1MCOH

Three-dimensional structure of a human immunoglobulin with a hinge deletion
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
428
structure length
428
Chain Sequence
PLVLQESGPGLVKPSEALSLTCTVSGDSINTILYYWSWIRQPPGKGLEWIGYIYYSGSTYGNPSLKSRVTISVNTSKNQFYSKLSSVTAADTAVYYCARVPLVVNPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPQVKFNWYVDGVQVHNAKTKPREQQYNSTYRVVSVLTVLHQNWLDGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1 MCG INTACT ANTIBODY (LIGHT CHAIN)
publication title Three-dimensional structure of a human immunoglobulin with a hinge deletion.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 49
structure length 428
sequence length 428
ec nomenclature
pdb deposition date 1993-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcoH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcoH04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcoH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcoH03
4PGCA 3E1F1 4JFHE 4X7SL 3DURA 2PO6C 3SQOH 4N8VA 3LEVH 1G9ML 5INDA 4AL8H 4I3GA 2E5EA 2V2WA 4Y1AD 3UTPD 2YSSA 2HWZL 4KK5C 1B0RA 1Y6NR 4L9LB 4AMKH 5C07A 5CUSH 3PP4H 4KVCH 4X7FC 1A6AB 3QIWB 3IF1A 3TNNA 3C5ZA 3LKQA 3T4AA 3P0VL 1YEFH 4L5FL 4GXUN 2QR0A 4O5LH 3N1GC 4PJ7B 3NZHH 1N5YH 1F58H 2CIIB 4U0RC 5I74B 1GZQB 2VOTA 4MD4A 2I60H 1QYGH 4GXVH 5EBWA 1ZLUH 3T3PE 1HQRA 2HJFB 3TVMB 2HT3D 1L0XA 5JW4R 4MHHI 3S36X 1TNMA 1J86A 4LPWA 3BO8B 4NHUA 4EDWH 3BVNB 4JQVA 4KK9C 2NPLX 5HXMA 4HW6A 2AJ3A 4PG9A 1UB5B 1LO2H 3JVGC 1LILA 4JY6A 4EQ3A 2ESVE 4YHZH 1U8KA 4U1MB 3WNMA 1U8PB 4N8CL 3C6SA 2YXMA 2DRUA 4UBDC 1YECH 1LEGB 4ZNEE 3HB3C 2X7LA 2R1XA 3FT2B 2MJWA 4V2BA 1QRKA 4QHKI 3IDIB 1OAKL 4TYUA 3ZL4H 3MV7B 1TJGL 3V4PH 1T1WB 5D5MA 2G60L 4F7MA 4ZG1A 4NBXB 4OSUL 1C1EH 5IR1A 4ZMAT 1QEWB 3VA2C 1HZHH 1PSKH 1IGIL 4UTBH 2QSCL 3AREA 2VLRD 1H8SA 4AG4L 2IH1A 4YWGL 4IDJH 2WAHA 5F7FA 3DHMA 2YD6A 2YBRA 2P5WA 2XRAH 5ID0B 1R5VA 4TN9A 1Q94A 3DSFL 1I1CA 4MJ2A 4XPGH 2G5BB 1S7UB 3CC5A 4LPUA 4NOBA 3DVGB 2JK5B 4NKMA 5E2VH 4NNYB 2VDKL 5F3BB 2DQCH 4FHBD 1U8HA 4IS6B 4MAUH 4FQXC 5ITFB 3SDDB 2CXGA 2FLBT 4NWTL 1GH7A 4QRUB 1U3HB 1YJDH 1ZVSA 4JFXB 3MYZA 3R06A 5KSUA 4GLRI 1BQHA 2BRRL 4F3FB 4L8BB 3RL1B 1QP1A 4GS7B 1NC4B 3BZ4A 5DK0A 1DDHB 2O5XL 1FZOA 1HI6A 2VC2L 5F9JA 4F2MB 5I8KH 3GUTB 1UJTA 4H20L 1AFVL 5E94B 4IM8A 5GGTH 4CVXB 4KTDH 1QSFD 3GK8H 3TN0C 4EKXA 4XAWH 4GAGL 1A6TB 2GTWB 3CSYB 1BFTA 3BX7C 2WQRA 3BPOB 1RZ7L 1ZWIB 4OCSL 4QRTA 3GMNB 4C56B 2F54E 5LBSL 1E4WH 1ETZB 1XF4B 2EC9T 5JHDB 3OKOA 1ZGLA 1OAQL 3X17A 4KKCD 3QUKB 43CAB 2P5ED 5I30H 1NEUA 1C8PA 1ZSDB 1U2CA 1RUAH 2YPKA 1I9IL 4K3HA 4ODTL 2H41A 3BE1L 1SVZA 4PJBA 3VXMD 1NDMA 2QQKL 1X5FA 4OGYL 4OIIL 3T3ME 4OCRL 5JW4N 3B9KD 4AJ0A 3CFJB 2NXZB 4P2QE 4R9HA 1RY7B 3HE6A 5F7WC 5FYKE 2C1PB 4FZEL 2CR6A 2H32A 4DWHA 2HLAA 4PJCA 4E42A 3C5SB 3OBAA 4G8GE 5K59E 2ARJQ 1A4KA 3GMQA 3T09A 5J8OA 4HEME 5CJQL 3VXPB 4XP1H 1EGJL 3U4BL 1FP5A 5IVXA 1CGXA 4PJ9A 4ZTOH 1MHHA 4X6CB 3QI9C 3RWCB 3E6HA 5BO1L 2J4WH 3UPAA 1BF8A 1KEMH 4X5WA 2NYYC 3RU8H 1YEIL 5M7QA 5FIEA 3RJDA 4FQ1L 2ICWB 4R0LC 3BEVB 4CVUA 2B2XL 1OSPL 1WZ1H 3PWUA 2X4SA 4S1RH 3H0TB 4JR9L 4WFGD 4YHPB 2VDRH 5DHXB 3PWLA 3L3HB 4L8DB 4HPYH 3IYLW 3G6DH 5KS9B 5I1KL 3CDCA 1VDGA 1Z0MA 4ODSL 1FVDB 3MUGB 2P1YA 1FYHB 4PGBA 4NNPH 1ONQA 3MACH 3AM8A 2WBWB 3UO1L 4Y88A 1S7TB 2Z35B 5DQ9A 4JRXA 5IJKA 3EOTH 2IAMC 2R2CA 4PJ8D 2Y6SD 4UOW0 3WKML 1ZMYA 2X4PB 3EFDH 2IPKA 5DFVC 3KLAB 4XBPB 1EPFA 4ZUTA 2RGSA 4Z8FL 1KJMB 1IJ9A 1UQSB 1FNSH 4MA8L 2AEQH 4Z7WA 2M2DA 5A43C 4NHCL 1QA9A 1W72B 4PREB 2FGWH 4GO6B 1RZKH 4X6DB 1P4BL 5DEZA 2FATL 1AIFB 5HGDB 2DD8H 5EC2B 4OCMC 1KSRA 3G5XB 5FYJE 3MRQA 1RMFH 4JREB 2JJSC 2XZZA 3UZQA 3I50H 4C4KT 5I17A 3BISA 5J11B 4WHYH 5EU6A 4N0CC 3RI5K 1MELA 1AGDA 3EBAA 2GT9B 3IRZA 3U36A 3T3MF 3O11A 3R0NA 4MSWA 3DMMB 5C8JA 4LBEA 4DGIH 4IRJB 3MSPA 4NYLA 3RWFA 2F15A 4JFPB 1MCNA 1F97A 3DUSA 1U3YA 1LNUB 1K5NA 3NIFE 3QFDA 5DUPH 5K59F 4POZC 1MWAB 2W0FB 5FA3B 1B6DA 5KVFL 4PTUA 2R69H 4P9HH 5LCVL 3UTTB 4N0FB 2NY0D 1MI5D 3ZTJH 3QIBA 1UA6L 4Q74A 4I3RL 4EI5B 1CDBA 1I8KA 2DIBA 5J9PB 3DETC 1EFQA 3OX8B 2XV6B 3QEGH 4WTWA 4HIEA 5BXFB 1S5IL 1TLKA 2PXYB 4CU8A 1UVQB 3LEXB 1IGFH 2XQYG 4U6HA 1DQTA 3ZKNC 1DE4A 2NY1B 4QRRD 4LEXL 1EUTA 1DN0A 1KPUB 4XTRD 2R1WA 5LVEA 1SY6L 3C5JA 2VZSA 3VFUA 5I8EA 4BZ1L 1FFNB 4DGVH 4PRID 4OUOA 5L9DH 2AJSL 1IC7L 4I5BB 4G9DB 4MDIA 2BNRE 2D9QB 2JJWA 2FIKB 4XPBH 5D7KE 4PJDE 5D1XA 4TUKL 2V9RA 3RTQC 1DVFD 1JYXA 1MFNA 3P9LA 5E1AB 4CADA 2KZWA 2ZUVA 2VXSH 3CDFA 4J7RA 4Y1AB 2GIYA 1ADQH 2OTPA 2QQLL 4LHUD 5TGBA 1CR9H 2R9HC 1E4KC 3OAYH 1DBMH 3V4VL 3I9GL 3CCHB 1CDUA 4XRCB 5L88H 4PG2A 2BK8A 1X9QA 4X7SH 4ZPTA 1PW3A 3L95B 5HI3C 1G9MH 1WCBA 2MCG1 4Z7QF 2HWZH 3GMOA 3S4SB 4QTIH 1WZLA 2H1PL 5CAYB 3CFKB 2Z4QB 4U1NB 5B8CC 2E3VA 3P0VH 3QEQD 1YMHB 2NTSP 4UDUA 2HVKA 3CX5K 4G8IB 2G5RA 2HFFA 5E0QA 3QDJE 5JW4Q 2FR4B 3QH3A 4ZUSB 4LSDA 4X80L 3DUHA 3D0VB 2D7MA 3VXTB 2F53D 1HSBA 5LAXB 3NIFF 4J4PC 4KK5D 1JPTH 3QIUA 5TF1L 4BSWB 4FABL 1J05A 6FABL 1SYSB 3IETA 1CFSB 3LQAC 4QY8A 3WXWL 4QHLA 4N8CH 5C92A 1HWHB 3GEWB 3BUYB 4N0YL 1UXWB 5BRZD 3MRGA 3VRJB 3V5KA 1WBXB 1WC7A 2LFGA 1BECA 1QRNB 2VDLL 2VLRB 2X9YA 2K7PA 3MNZA 1OAKH 5FECA 1TJGH 4KK9D 3UMTA 3MBXH 2G60H 5C3LD 1G7JA 5FUCC 4OSUH 4YDLB 5DRXA 4J6RH 4WW2B 5ACMA 2I9LA 4MMXC 1NMCB 4GRWH 1IBGL 2QSCH 4TUJA 1GVIA 3SJVB 3BDXA 4AG4H 4DFHA 3V9FA 5B39B 3QDGE 3JV6A 4GBXA 3MRPA 5D7LA 5E03A 4YWGH 2XNAB 1PY9A 1CICA 1BZ7A 1TVBB 4UBDD 3BP5B 3PIQA 3HB3D 3DSFH 2M26A 5GRZA 3RZCC 3UXFA 1ZEAL 4AEHH 4GAJL 4PJDF 1SEBA 3B9VA 4K23L 4RFNC 3IJYB 5F9AC 1QFWI 4OKVA 4MJ5B 4WUKL 5TPWH 3UC0L 2A0LC 4JPWL 2CIKB 4H8WC 1XCQA 3H42L 4LQ1A 1X4XA 3CD4A 1B9ZA 4IRZL 4XCNB 4P2OA 1CT8B 2DIJA 4JFDE 5I15L 4NWTH 5DJAB 1QLRA 3BEWA 3FQNA 4NQED 2GK2A 1RJLB 3HZYA 4GUPA 1QSFB 4J3VA 5BJTB 5MENA 1P2CB 3RWJB 3UTSD 5BZWA 3P11L 4M1CC 3DWTA 4XNQB 2FLRT 2O5XH 1S8DA 4U1LB 1ZA3B 1N8ZB 1A1OA 4PJ5E 5CWSA 3RVTD 1AFVH 1X4ZA 3MCKA 3W5NA 3O3AA 4L3EB 2FZ3B 1AGBB 4BH8A 5JOPE 3IDMA 1TCMA 4GAGH 4U1JB 1Y18A 5FO9B 4QXUL 3IB4A 2O26U 1CCZA 1K4DB 2PCPA 1YPZA 4PY8J 2P5EB 1RZ7H 4OCSH 3VGEA 5L7XL 4NQXB 5LBSH 3SPVA 3RWEB 5KTEL 3WS6A 3T1FA 3CVHL 3RUGE 4R26L 5E9DA 5AYUL 3HI1A 4QXWA 5HDOA 1OAQH 1QOKA 5DJYB 5EIIA 5FOJA 2GJ6A 3PL6C 4QT5A 3HUJB 4B5EA 4IIQC 3HRPA 4P3WA 3RL2B 1I9IH 5ILTL 2YMXL 4ODTH 2RFXB 3SKMB 2CK2A 4YDIL 3BE1H 3IKCA 4P5TC 3DOSA 2CLZA 3JUYA 1ZAGA 4OIIH 4IOFC 3U6RA 5E6IA 5CP3A 4OZFA 3F58H 4FZEH 1KPVA 3QNYA 4L29B 1JTPA 5ANMA 4OCXL 4S10A 2AS5M 4OM1L 4P0DA 4XP4L 5KSVB 5IM7B 1P6FA 1HXMA 1EGJH 3U4BH 4U05A 1MAKA 1Q9LB 3F7VB 2GAZB 4Z78B 4KI1A 1R3HA 2Z31C 3MO1B 5BO1H 4AT6B 3FOLA 5GGRA 3ARQA 3PQYD 1JF1B 1RUKL 4PJFA 4RAVB 5F7UA 2MHAB 3K3QA 3H9HB 2HRPL 4FQ1H 4TNVK 3U4EA 3SBWA 3S5LB 3KJ6L 5D6CB 2B2XH 1MREH 2RR3A 3OKLA 5I1IL 1I1YB 2IWGA 4JR9H 4KKBC 3V7MA 5GRWA 3AS0A 4WWKA 4PJ8B 2BY3A 4ORZC 1YDPA 3GMPB 3RKDC 3MRMA 2FX7L 2HLFD 5I1KH 2I27N 4ODSH 3LN5A 4PJXA 4Q9QH 2BVQA 3QA3A 2F58H 4NN6C 3UO1H 2FEEI 2R0LL 2HTLC 2Y1VA 1KTLA 2ARWA 4MA7L 5IESH 5GGUB 3WKMH 4HX1A 4I77L 3I75A 5EN2B 1DL7L 1AJ7L 2OL3B 1XR9A 3BGFB 3RIFK 1I3GL 1T0MA 3EUUA 2NW2A 3BZDA 4M48L 4MA8H 4TSBL 3AXLA 3S36L 4UOW1 4O51A 1PQZA 5DMKB 5A2JH 1IM3A 4JPIB 4EZMA 1EBPA 1MLCB 3KJ4B 4LLUB 2EIZB 2FATH 4PGDB 5ESAB 2LE9A 5FHBL 3U0WL 3NPSC 5DJ8A 4D8PA 3MRIB 2Y25A 4WEMB 4KI5C 4HJGB 3L3GA 3L5HA 5EO0B 5TDPB 2XG4A 2BVOB 5C0GA 2WIIA 3KLDA 5J1SC 3WNNA 3T0VA 2VABA 2DQFB 4OGAC 5GHWH 1TQCB 1KJ3L 4GJTB 3SDCD 5L2KA 3VGBA 3QAZB 3OF6D 5DHVA 2EDYA 2NY0B 1MI5B 5LG1A 2JTDA 4M7JH 1JHTA 1UYWH 4YO0A 5IW1A 1RIUL 3KLHC 5IBLC 1DR9A 2HN7A 1KB5A 4S2SA 4LVNB 3UJJL 3IJSB 3BI9X 3CFBA 5KVFH 3HMXL 5LCVH 5E56A 4APQA 3GSNL 4XH2A 4X6EA 1R3KA 1UA6H 3VGAC 1Z5LA 3VRIB 4I3RH 3OR6A 2AJVH 4FS0A 3FAXA 3BIAX 4PY7A 1C5BL 1FYTE 2OSLA 3L5WA 4F7CA 2BXZA 2VLKE 5GSVB 4J8RB 3E2HB 1S5IH 1V7ML 4X4XB 2AEPL 2X4TB 4EUPB 2DDQL 2LU7A 2B5IB 1RFDL 1YN6B 2UV3A 4PRIB 1NDGB 5FM5M 2MNUA 4YPGA 3QQ4B 2QSTA 5E8OA 5ID1A 1E4JA 2V5RA 2C9AA 3CDYA 5IMOB 2R8SH 3MRDA 1SY6H 2E9WA 1A4JB 1DVFB 2FHBA 2ITDA 4EOWL 4Y19E 2JF1A 5TQ0L 2AJSH 1DN2A 1IC7H 5L2JA 3QUXB 3DETD 5GS0C 1H3UA 1FO0A 3MUY1 3C08L 1A47A 4LHUB 3CSGA 1Q9KA 3K8LA 3I3DA 2DWDB 4PTTB 5C0FB 5E7BA 3SE4A 2Y9RT 3Q3GB 5DJCB 1BVKA 5EUOA 5EUKB 4HBQA 5KVGL 4G8EB 4PRNB 2YKLL 1MHPL 2V2XB 5ICXB 2EDLA 2QQLH 3WO3B 3HZMA 3V4VH 4L9LA 1GGUA 1SJHB 3I9GH 4OLUL 3VXRD 2CDFA 4ONHA 1X6NA 4G6JL 3DXAD 4Y4FD 3QIWA 1QBBA 3QEQB 1GL4B 4QRQB 3AB0B 4ODHL 2IQAB 4OT1L 1WT5C 2CIIA 3VI3E 4W81A 1WBYB 3WL9B 3HNSL 2HJFA 2H1PH 3TVMA 2F53B 2AKRB 2P42B 3BVNA 3K2MC 3UBXA 4KK6D 2B0SH 1A6WL 3SGEI 5DSCA 2R9HD 3MLTB 3FHAA 2IANE 4DKDC 3S3PA 2I24N 2M8XA 4X80H 2E7LA 4C54A 3VFMB 4FA8A 3PF2A 1JNLL 1U8PA 1BX2A 3HI5L 1A02N 2UVFA 1CFVL 5TF1H 1LEGA 4FABH 3FQXA 4HG4J 6FABH 3FT2A 1A3QA 2E6JA 2R0WL 3IDIA 3WXWH 3QCUL 4I48A 5D7IB 1T1WA 4OUUB 4WI8A 4N0YH 5IG7A 2D03L 3FMGL 1QEWA 5CJ8A 1LE5B 2VDLH 2DBLL 1YMMD 3AROA 3FJTA 1Z9OA 1A6VL 1D6VL 1JZ7A 2GEEA 3CUPB 4E9LA 5ID0A 4FTVA 3K80A 1T2JA 5F1NA 4N0UA 2G5BA 1S7UA 2D0GA 1IBGH 3DVGA 3OXRA 3ZMRA 4K3EL 4MZ3A 3HE7A 1HDMB 4NNYA 4DTGH 4ELKB 5F3BA 1RZJL 4JM2D 2NNAB 2DICA 5BS0D 1ZEAH 4IS6A 2OP4L 5ITFA 3WIHL 3O2DL 5I1AB 4KJQC 4UV7L 4GAJH 3SDDA 2PYFB 2X1XR 2W65A 1VA9A 5AEAA 3WD5L 4NQEB 5CEZE 3VDBA 5JO5B 3H42H 1D3CA 4IRZH 3UTSB 4PP2B 4EN3A 4F3FA 1J8KA 3Q5YA 3RL1A 2BVUA 4BQ9A 1NC4A 1VGKA 3IJHB 5CBAA 1DDHA 1MFBL 1MNUH 2VISB 3TT3L 3FO1A 3NOIA 4NKDB 3RZCD 4CVXA 4PJAB 2Z92B 3GJFK 4P49A 5IUSA 1P9MC 3N9GL 3O0RL 4FXGB 3VI3F 4MNQE 5JIIA 1A6TA 5E00B 3CSYA 2D7QA 2D9CA 4OLWL 3EO0B 2A0LD 2NLJB 1PKOA 1ZWIA 2SEBA 4OF0A 3HR5A 2FO1A 1J7VR 2WINA 3NBNA 1IQDB 3DECA 1RK1A 5DMJB 1ORQB 2HT2C 4BFEA 5E4EC 1JGUL 1CD9B 5ISZA 1JZ4A 5L7XH 5HHQB 4JKPL 3IU4L 5EORL 5KTEH 3P4OB 3TN0B 4TSAL 4CBPA 2ZNWA 3CVHH 4FQCL 3QXUA 3MJ8B 4KWUA 5AYUH 1F6AB 4NSKB 1MCWM 3FN9A 2OJEA 1XGUA 2VXVL 1MQ8A 3NGBC 2NY5C 2X05A 1BFVL 3CFJA 2YWZA 1PG7X 3OAUL 5ILTH 3ROOB 3QXTA 2YMXH 4LSVL 2C1PA 4OZGB 4YDIH 4YR6B 4P23C 4JFFE 2R39A 4X5LA 3T8XB 3NFNA 4X7TB 2WP3T 5C9JA 3WJJC 3VXPA 2IMMA 4JHBA 4OF7A 1UKQA 4WTZA 2O93L 1CL7L 3WUZA 3QWRA 4LCUB 4X6CA 2G75B 4U3XA 2ZUYA 4OCXH 1J1XL 2XKNB 1SMAA 2A83A 3PQYB 4XP4H 1LP9B 4NC0B 3TH2T 4JDVB 4QOKD 3D25A 3HLAB 1DANT 2VAAB 4QGTA 4JZJB 1F3DH 4JFHD 2IADB 4P2RE 1NFKA 3VFVA 3H0TA 5HYFA 1MCSA 1RUKH 4IOFD 4U1IA 3L3HA 2HRPH 3KJ6H 2IBZX 3QI9B 1FSKC 3S9DB 3DI3B 1C5DA 3TCLA 5I1IH 3GSRB 3HPJA 1S7TA 3IDXL 5E99H 4POYA 4R0LB 4HMEA 2VN4A 5FKPB 2FX7H 1AXTL 1BREA 2X4UA 4LF3A 3P4MA 5CEXB 4LQFH 4OGZA 4DKFL 3FQUB 1KB9K 4I13B 3MRHB 3KLAA 2R0LH 3G9AB 3WEXB 2EDKA 1CVRA 3G5ZB 3PHSA 1UQSA 2ESVD 3QT2A 4KU1A 3C60A 2XY1A 2BSRB 4NKQB 1W72A 4KKBD 4X6DA 3HG1D 1DL7H 1AJ7H 2PW1A 4RGNC 1I3GH 1AIFA 3WMSA 5HGDA 1HWGB 3Q1SL 4M48H 4QHMB 1J12A 4MS8D 1VEOA 5GS2D 4TSBH 5A40E 5DT1H 3S36H 3TWCL 3EGSB 1CIUA 2C3GA 1FL6B 3VFPB 1UJ3C 4JO3L 5FHBH 3U0WH 2ZUXA 4QTHB 5M94B 2GT9A 1IGML 2BNQE 3BPCB 2AJXH 3MZGB 3DMMA 5H37H 4MCYB 5FAAA 4IRJA 5HY9B 3V4UL 3EIFA 1A5FL 1KJ3H 5DYOB 2AXGA 3UJIL 1YNTB 3KPLB 3PHOA 2CRZA 5KZCD 1F4YL 3UTTA 1DQQB 1RIUH 5DUMH 1LWRA 4E41E 5MI0B 1T5WB 5FFLA 4RMQA 3VJ6B 4EI5A 2GYSA 4KMTH 3HMXH 5J9PA 5K9KB 5BXFA 2J8UE 1S9WA 3KYAA 3T2PA 4Z7NE 3VWKC 2EO9A 1UVQA 3LEXA 3T4YA 4F58H 5HYSA 1DEDA 2ATKA 1C5BH 4HS6B 4M03A 2OXGA 4Y4KD 3GFUA 1KPUA 1IZKA 4GG6E 1V7MH 5EZLB 4KRLB 1RFDH 4GKSB 1FFNA 1LO0L 2J8OA 1AD9A 1ZHKB 4YFLF 1CXKA 5J1AB 4G9DA 4WU7B 4KVNL 1H5BC 5CD3B 2RIKA 3PDGA 2FIKA 4KMLB 1IRAY 3KYKL 4XMLL 4EOWH 2F54D 3OKDA 4YHKL 2NW3B 1KLGA 3MBED 4D94A 3TBYA 2JB5H 4Y1AA 4HK0B 3SKUD 1JGLL 4JFZL 3VXRB 3RWIA 1BOYA 4X4YA 4JPKL 3AS2A 4Y4FB 4KGJA 4HQQL 4XRCA 4NQDE 5T3XD 5IIEB 2QADC 2YKLH 1MHPH 3MV11 2ZCLL 1ZA6B 5FA4B 3L95A 4PLNC 2JCCA 1KT2B 1WUNT 5KSAA 4M5ZL 5AWNL 4N90E 3GSQB 4OLUH 2H8PB 3FKUS 1NFDE 1N3NB 4P2QD 3KPPA 5FYKD 2Z4QA 3WJLC 4ZOAA 5J6HB 1I8LA 4ODHH 3W39B 4G8GD 1MCOL 4OT1H 2AXFA 3ULVL 1EAJA 1EV2E 1VADB 1UT9A 3SQBA 1CZ8L 3HNSH 4JG0L 1FC1A 2MQ0A 3LPGA 3L3OB 4HWBA 3D0VA 3BGMB 1I9RH 4Y5YC 1G7IB 4IHOA 2ORBL 1RU9L 1A6WH 4MLIA 5DK2B 4OI8A 3OKKB 3EYFB 5CMAB 5DVMA 4BSWA 1F13A 5DJXB 5B8CB 5BVJB 1SYSA 3STZB 4A2MA 5J0BA 4H5SB 1T7YA 1CGSL 1JYNA 1JNLH 1PY4A 1XCTB 3HI5H 4OLVL 3TF7C 3WN5C 5D70L 4C57C 1CFVH 3BUYA 2FSEB 2HJLB 2I26N 1UXWA 4R7NA 5ENWB 3VRJA 1YMMB 2J8UF 1WBXA 2AGJL 1YJDC 4Z7NF 2R0WH 2A6IA 2X6MA 3QCUH 4Q6IC 2JLLA 4JZNB 3UROR 4JG1L 1FVCB 3UP1A 3FMGH 2DBLH 2R2BB 4GG6F 2Y4SA 1C7TA 1MHEA 4X98A 1LO4L 1A6VH 4FQLL 3IKKA 2AJZB 1FAIL 1JN6B 3BPLC 1D6VH 1OTTC 4JM2B 4G9FE 5BS0B 4KK8C 3E8UL 1XFPA 5FV1L 2GJJA 4OBSA 4AZ8A 3CZFB 1XGTA 1WTGT 5DQJA 4WU5A 3L3DB 2DOCA 4MX7A 4U1SB 3VFNB 5E8PA 1XGPA 1RZJH 2YD2A 3EAKA 2BX5A 2OP4H 3WIHH 3O2DH 2IALB 4UV7H 5FYJD 3F7QA 5DJAA 4L8SC 5C70A 4ZUUB 1RJLA 1QBLL 4NQCD 3RZCB 2PR4L 3MV8E 3IU3A 2P7TA 5BJTA 2EYRA 1G6RB 3U7AA 3KPNB 4RFNB 3V6FB 1UCTA 1U42A 3H3BC 4CMHB 3UAJC 1NFDF 5AZ2L 4U1LA 3W9DA 1W2KT 3TT3H 2HJKA 4NT6A 5SWSE 1Q0XL 4LFHD 2ADIA 5I8CB 3N9GH 1AGBA 1F42A 1PG7W 4Y5XC 3TH3T 4U1JA 1NCWL 1WEJL 3LB6C 3S98A 5DRWA 4G6KL 5EPMB 4UT7H 2P5EA 4H88L 3DHJA 3SY0A 3FB5B 1CDGA 1BFSA 3B9EA 5FGSA 3VXMA 4PS4L 1GOHA 3HZKB 1E0OB 4HGWB 3ZT5A 1JGUH 1LO3L 2YUXA 3B9KA 4JKPH 2FWOB 2APBA 3IU4H 1UFUA 4PV8B 5EORH 5ABDE 1YY9D 4TSAH 2BDNL 4FQCH 1S7QB 5JIHA 5I9QB 3SGJA 5IT2L 4R4ND 5E4IA 2HA1A 5EU3B 4Y7MA 1YYML 1YY8B 2VXVH 2HKHH 1BFVH 1HN1A 1JNNH 1EEZA 3F62A 3OAUH 1JUFB 4KHXL 5TE6L 4LSVH 2YOCA 4L29A 5BV7H 1F4WH 2HT2D 4UOJA 2BNRD 4YEEA 5HHNB 4QOKB 4IIQB 5IM7A 5D7KD 3OG4B 1NAMB 1Q9LA 3F7VA 2GAZA 1CL7H 2E7MA 4P5TB 2W1NA 1B4JL 1J1XH 1FN4B 4AT6A 2F5BH 4YX2L 1JF1A 5F7KC 1A1NA 3CXHJ 1TJIL 4N1EA 4LEOA 4IDLA 2ENSA 3RIAF 5JDJA 3H9HA 3KNBA 3QULA 1EFXD 3MQIA 1RZKC 3S5LA 1BGXL 5D6CA 3V6OA 4P23D 4LSUL 4FNLL 1HOCA 1I1YA 2VMFA 3CU1A 1ITCA 1MFAL 1CD1A 1UADC 1U93B 4PJ8A 5E5UB 4HV8B 3GMPA 5JHLL 3UDWC 2AVGA 5KOMC 2Z31B 1PX3A 2OS7A 3CSBA 3DRTB 3LQZB 1H3PH 4XVSL 3TT1L 1SEQL 5ACZB 3SE3C 5IW3A 2ESVB 3QDJD 1PLGH 1AXTH 3PDOB 4AENA 5GGUA 3TBWB 1J0YA 4HH9A 4DKFH 4K7FB 4ZSOE 4IRSC 4RQQB 2ADGA 2FO4B 3MRFB 4FQJL 4P9HC 5CJXC 1KG0B 3NFSL 4ZFFA 4QHNA 5DMKA 2A2QT 1MLCA 1IKNA 3SKOA 4NRZB 1WZMA 2A6KA 3EOBB 2CO6B 3Q1SH 1PBYA 3K74B 4N1CA 3MRIA 4UILH 5DJ0A 4YBLC 3OTTA 5EO0A 5IVZA 2BVOA 2XWJB 2WK2A 5DVNA 3TZVC 3PG2A 2DQFA 5AD0A 4JO3H 1HILB 4G7VH 3EHBD 1IGMH 3VG9C 4GMTH 3QUZC 5KZCB 4QEGA 5F8QC 3RWGB 4Y0GA 3KG5A 1MI5A 3ME0A 2ZJSL 3QDGD 4WDIA 1BD2E 2GJZB 2H3NB 3Q6GL 3V0WL 3V4UH 5LGHL 2X40A 3NPSB 1A5FH 4UAOC 4LKCB 3IDGA 3UJIH 4DKEL 4J23A 1OWRM 1S3KL 3FRUB 5IGXL 4BUGA 5DGRA 3T77A 3T0EE 1B90A 5I6XC 1XH3A 3CFEB 5J06A 4JFDD 4QRRA 4WUUA 4S0SD 2WWKT 4WGWB 3VW3L 5GSVA 2GFBB 2UZIL 2H32H 2C4FT 3NTCL 4X4XA 5HJ3B 4EUPA 3PGDA 5INCA 1MCRA 1QHPA 5GPRA 1G9MC 1I3RB 4PR5B 4WI5A 4PY8I 3EFFB 3QZWG 12E8H 4UI2A 3VGAB 4PJ5D 1DVFA 5FGCE 2F54B 4BQ8A 1UM5H 4JEGB 5F7LB 2E7CA 5JOPD 1K4CB 3MBEB 1F3DJ 4N5UA 5C0AA 2DWDA 2EC9U 2GQHA 3KYKH 4XMLH 5F7DA 3AAZB 4YHKH 1MIML 5F1IB 1I4FB 1KXTB 4KZEL 3TM6A 1UG9A 2APVA 5FK9B 1JGLH 3A6CL 2AEIT 4JFZH 4NGHH 4LCYB 4UU9A 4JPKH 4P2QB 2NXYD 5SX5H 4PYGA 4HQQH 1T7ZA 5IEHB 1DZBA 3OJ2C 2ZCLH 5DRZA 4G8GB 5IROA 5AWNH 3JWDL 1AE6L 3U9UB 1BLNB 2HVJB 4MAYC 1QFOA 4RCAA 1MPAL 4KV5E 2AKRA 4NZUL 1OB1B 4EIZC 3RNKA 3MRKA 4YBHA 2BSSB 1MCOH 4BELD 3ULVH 4JFOA 1CE6B 3WFBL 3MLSL 2DQGL 1CZ8H 4JG0H 1XR8A 4HLJA 2QADD 2VXTL 1TZIB 4U1KB 4K7PX 2ORBH 1RU9H 5FGBC 4XC1L 5E2WL 1OF2B 5BRZA 3PE9A 5T1DL 5EU4B 2EIBA 3QR2A 4RBPH 3ARFC 3BDBA 3PWJB 1YQVH 4G6MH 5D7IA 1CGSH 4GKNB 4OUUA 2DTSA 4OLVH 4HHAA 3DTXB 5D70H 4BJLA 4RAHA 3S6CA 4U33A 5B21A 1KB5L 3RVUC 3HC0A 3DV4B 2AGJH 4NKOB 3BJ91 4NZRL 4GT7A 3C8KB 1BJ1H 3QRGL 4QXTB 4ORGA 3DX9B 1WISA 1MCPH 4JG1H 2R2EB 4DZ8A 5HHXL 3RY4A 3CUPA 3NCEB 2FJFB 2UY7A 3HC4L 4PJ7F 2MQ3A 4ZUWA 1GAFH 1A9EB 4YHNA 2Q7NA 2VXQL 1LO4H 4FQLH 1FAIH 2DB8A 3KS0H 3RBSA 4I4WB 5GGSB 2IFFL 4ELKA 2NNAA 5DRNB 1KCKA 3KWWA 3ZE1E 3NCYS 2F8VA 4ZTPL 1T21A 5F96L 5I1AA 2X9WA 1VPOL 4RIRB 3CVIL 1EH9A 5IV2B 4KROD 4WFFE 1NGWB 1GZPA 4NQEA 1DBJH 3U1SH 5JIPA 1WAAA 3NVQA 1AKJB 3UTSA 1S9XA 2BCKA 5DD0H 4WO4C 4LASH 5I1DB 3IJHA 4Z95L 4EIGB 3BP6A 1FO0L 5FM8A 2VISA 1OTTD 4Q9RL 4FFWC 1QBLH 3NCJL 1W8NA 4PJAA 2Z92A 4LPVA 1N5AA 2HAZA 4UB0L 4YDJA 5JOFA 1ZV5A 4U49A 3B2VL 3BHBB 3GI9L 5E00A 5AZ2H 1G0XA 5FO7B 4QGYA 4KV5F 4MLSA 3TPUA 1U8JA 4JN1H 4TTGA 1L7TL 3S96A 2AK4E 2HP4A 2AV7A 2ZZUT 3S4SG 2P24B 5HDQL 4OZIE 4LL9A 1I7TA 4LDEB 3MRBB 3WE6B 1VHPA 1IQDA 1NCWH 1WEJH 3W9EB 1NCTA 3JV0A 4G6KH 4WI4A 4FRWA 5EBGA 3VRLF 2QKIB 1EJOH 2DKMA 4YAQB 4JDZB 3QNZA 3P4OA 1HHGB 1EMTL 5EOQL 1FYTD 1UWXK 4PS4H 3VFSB 3UAJD 5C09E 1CWVA 2VLKD 3HAEB 2LAGB 5DQDL 1RUPL 3AVEA 5IB4B 3SKJH 1F3JA 3X12B 4MHHG 2DS4A 3VWJC 2BDNH 5IMKA 1UZ8B 1FBIL 1MCLA 5AAWA 5IK3A 5IT2H 3GBNL 2XZAL 2BNRB 4P4RB 2BHZA 4LSPH 4X7TA 4PJDB 4ALAH 2DI9A 3P0YL 4PV9B 2ZOLB 3ARTA 5K9JL 3X13A 2H45A 5DURD 4Y19D 1U8LB 2HRLA 3N1QC 3D85D 3QFJE 2G75A 4MXVE 3GJFA 1ORSA 1MRCL 1L9NA 2DJUA 3MV9E 2XKNA 3PQYA 4Y5VA 3ZDZF 3NGBB 2P8LA 1LP9A 4K3JH 1EFXB 3KPMB 1OQXA 5HVHB 3I02B 3HLAA 1I7UB 4P23B 4JZJA 2APTA 5D7SL 1S7SA 4R97B 1B4JH 1HEZA 4JKKA 1ZT1B 2WLYA 3EYSL 4XB8A 5B39G 1S9KC 3KPSE 1ZLWK 2HMID 3AFLA 3G5VA 1H8OA 1TJIH 2J8HA 3VFTA 5DD5L 1CTOA 3TJHC 2NTFA 4XPTL 2BY2A 4LVHC 3GRWA 3ARSA 1U8OB 2J3SA 1D9KC 2X9XA 3GSRA 4FNLH 4JZOB 5CILL 1MFAH 5EWIL 1VFBA 2FECI 3QDJB 1KELL 4O2FB 1GPOL 3FQUA 4GSDL 2EEAA 5IEKB 3FN0L 4MCZB 3MRHA 4WV1B 3WEXA 4XVSH 3TT1H 1SEQH 2IAND 2DAVA 5FF6A 1LO5B 3G5ZA 1KJ2L 2EEBA 3UX9B 1XT5A 1X5JA 3MGTB 4HZAA 3I3BA 4QO1A 3RRQA 2KKQA 5IMMA 4U6XB 4OZIF 3GKWH 4UDTB 5IB3A 4FQJH 3EO1B 3ARDC 4QHMA 1CDCA 1I1AC 3NFSH 4JAMA 1A1MB 1QPXA 1H9VA 4XBGA 4MJ4A 3HC3L 5IHUL 1FL6A 2OI9B 4O9HL 3VFPA 3RGHA 3NN8A 3SDCA 4QTHA 1D5MB 1RV6X 5T1LA 4JN2A 3FT4B 1F3RB 2YPVH 4TRPL 3QDGB 3VI4F 4MCYA 4C55A 3LY6A 5D93C 3CMOL 4X9IA 2EZ0D 1TTGA 4YHIA 4L3AA 4RA3A 3D18B 1AHWA 5H35A 5C0RL 5HSFA 1AQKL 2W92A 1E27A 4ZAKD 3KPLA 4UIMB 1OLZA 1S9YB 5ADOL 1AP2A 2ZJSH 4C58B 4JB9L 3Q6GH 1UJ3B 1N6VA 3V0WH 4NFBA 5LGHH 1X7QB 4MXVF 1F11B 2EH7H 4DKEH 4KFZC 5DDHB 3VJ6A 5IGXH 1EA9C 5CEZD 2KBGA 4ZS7L 5D1ZC 1I8IA 1VACB 2NZIA 2M1KA 1OHQA 5CP3H 2PNDA 3FO0L 3QUZD 3TBVB 1X5XA 4HS6A 4OZFH 1N2RB 3O3UN 3VW3H 4U6YB 2UZIH 4P5KA 5DMGC 3QUMB 4PJ5B 4AH2B 3NTCH 3BP7B 5EZLA 4OD1H 1RZFL 4BSVB 3DYPA 4GKSA 1LDPH 3PNWB 1ZHKA 2WUBH 4OIAA 3ESVF 4MNQD 3GSWB 1FGVH 1INQB 2UYLB 1YN7B 4BH7B 4LSTL 5CD3A 3VWKB 1CDJA 2PYEE 1I9JL 1J1OL 5H94A 2DI7A 3RUGB 2CKBA 2MPAL 3V5HA 3QNXB 2R23A 5GSRB 3MRCB 4WCYH 3FT3B 4NCC2 5KG9B 1G6VK 3QJFA 3JTTB 2XY2A 3VMNA 3VXRA 1P5UA 1ZXQA 2NXYB 3DXAA 4Y4FA 1TPXC 5D8JL 2R0ZL 4HUWB 4K9EH 1H5BB 1U91B 1ZA6A 3X3FL 2P5WE 4KZEH 3VD3A 4S1SL 35C8L 4H1LB 3NCFB 1L0YA 3A6CH 5J6GA 3U0TB 2AI0H 4NJAH 3GSQA 5EBLB 1VFAB 3CLFL 5I2IA 4XNZB 1QRNE 1KIUA 4Y4HC 4HIXL 4JFFD 3VXUE 1F02I 5ITBL 5ERWB 5MERA 2AXHA 3JWDH 3NABH 1DBAL 3ARGC 1AE6H 2QADB 1JPFB 3GM0A 5D2NC 3H7BB 1MPAH 4H26A 3L3OA 3BGMA 2A9ML 4M6OL 2X5PA 5GXBB 5TDNB 3V5DB 3OKKA 3EYFA 4X5XB 4TSCL 5CMAA 2DQGH 3WFBH 3RHWF 5DJXA 2CLVB 1NUDA 2VH5L 3STZA 4P2RD 1EUUA 4XC1H 4JDTH 1SJXA 5D9SA 2NR6C 4E0RB 1AD0B 2HJLA 2A6JA 5T1DH 3RY5A 5ENWA 3ARVA 3G6AA 4Y5YB 3WDIA 4HXAL 1GOGA 5DHVH 2ZUWA 3L3IA 5FEBA 3S7GA 2VERN 4Z7UE 3OL2A 1FVCA 1U8NB 3D48R 5DEFA 4ETQB 1KB5H 5DS8B 2R2BA 2VL5A 4DFIA 3VDCA 3OB0K 4PBVC 15C8L 1R3JB 3WN5B 4JM2A 5BOPA 1CLYL 2E7BA 5HHXH 5BS0A 2KQNA 1WWBX 4XWOD 2BMKB 4EUPG 4PJBE 4GKZA 1NAKH 3CZFA 4Q6IB 4M93C 3VXNB 1QKZL 1LEKA 2QHLA 1U8IA 2DQEL 1JJUA 2XWBB 2A38A 3VFNA 2IFFH 2CDGB 3SGKC 1WLHA 5IB1B 4ZTPH 1JPGB 5F96H 2EDWA 1KJVB 3CVIH 4BZYA 3BPLB 5HGGS 2A1WL 3WNPA 3ULUH 3B6SB 2H9GB 3KR3L 3O3DB 4HXBL 4NRYB 4U31A 4ZUUA 4LHUG 3MLZL 2X4RA 2XN9E 1JV5B 3T0EC 1GYAA 2ZUSA 3QWQB 1G6RA 1KCRL 3SE9L 2BNQD 2ZSWB 4FP8L 1KCUL 3V6FA 4Z95H 4JRYE 2P8MA 4Q9RH 2V5TA 3EDDA 4BFIB 2O5ZL 4JQXC 4XGZA 1NUFA 4BK5A 5I8CA 3B2VH 1RIHL 4ZFOA 3GI9H 4L8SB 1TDQA 2YN5A 2VN7A 1H3VA 4WFEE 1HHJA 1CQYA 1NKRA 5EPMA 3OAZH 2NY2D 3BSZL 1L7TH 1VENA 3O6KL 2IQ9L 4X4ME 1FYTB 2QL1A 5EC1B 5HDQH 2X4NB 3FB5A 3UYRL 4E41D 2F8XC 3IDJB 5MEOB 5BW7C 2VLKB 2BVPB 3VCLB 5HHOA 1FDLL 2DI8A 2X1QA 1TTFA 5LWYL 1AXSB 5E2TL 3GSUB 3VFWA 5C1MB 5IQ7H 5D4QA 1EMTH 5EOQH 4Y5XB 3WS3A 4HWBL 1ZGLP 1IL1B 5DQDH 3QQNA 2C3VA 5EU3A 1RUPH 1HSAA 1YY8A 5CSBA 3WIFA 4Z7WE 3DBXA 4PJHE 2BP3A 5DURB 4OFYD 4Y19B 1TENA 3D85B 1JUFA 2P43B 4UQ3A 4Z7UF 1EEUA 3ULVE 1FBIH 2EDNA 3GBNH 3O4LD 2XZAH 2EIEA 5T3ZH 5D7JD 4X83A 5HHNA 2XFXB 1H8NA 2QEJA 1NAMA 1BJ8A 5A2KH 3O2WH 1EXUB 4RRPA 4P46C 2B1AL 1MRCH 5IFHL 5EU6E 4CU7A 5GZNC 1D5BB 2B4CL 1IZJA 3R0MA 2V7HA 2PTTB 3CXDL 1RAMA 4PRHE 3RY6C 1NBQA 5D7SH 4NQDD 4MQTB 2VNCA 3P30L 3EYSH 3BKCL 1BJ1J 1OW0A 4Y2DD 5DD5H 4N90D 4RGMC 2ZPKL 4XPTH 1OARH 3P4LA 4HV8A 2XWTB 5ADPL 3MJ9A 3IXAB 1NBYB 5B4MC 4HWNA 5CBEB 1S7XB 1WV7T 3KS0J 5CILH 1FIGL 5EWIH 3DRTA 2ZUTA 3P2TA 2IANB 3LQZA 4J3SA 5L8KB 3QXVA 1KELH 3PDOA 3C6LC 1GPOH 1F90L 3HG1A 4GSDH 4RQQA 2Y5EA 3KHOA 3FQRB 3S88L 4M6ML 1V3LA 5DMIL 4ZNEA 4KRPD 5MP6H 3ILPA 3LZFL 3QRFM 1KG0A 3OB8A 3TYFB 1D9KD 4UT6L 2FHFA 1J8HB 3WIIL 1OAYL 2NX5E 1XF5A 1P84K 4NO3B 4HF5H 3EOBA 5MEPB 1MCDA 2NY3C 3RGVA 1WTLA 2DMCA 4XZUA 1KXVC 4M3JA 4OLEA 2V9QA 5I1JL 5FO8B 1J5OL 2CXKA 2NY4C 3C09C 4QRPA 1VFOA 2XWJA 2ZNXA 3HC3H 3JV4A 3I6KB 5IHUH 4O9HH 1CU4L 1HILA 4WTXA 2OMNA 1F45A 4ZAKB 4PJHF 3RWGA 3WDJA 2V7NB 3MLWL 1MH5A 3CMOH 4PLJD 4G9FD 4D3CH 1IC4L 4U0QB 3NCCB 5C0RH 2Y7QB 4BM7A 1AQKH 3OZ9L 3FRUA 4YBLB 1U6AH 3RVVD 5ADOH 1K8IA 4JB9H 3G04B 1AQDA 5EOCL 2YPLA 1JTTA 2OX5A 2Q76B 3MA9H 5FYLD 3FN3A 3E3QC 3QUZB 5TDOB 1VB9A 4ACPA 2ZOKA 1S78D 4Y4KA 4G80A 5CEYB 4KKAC 2GFBA 3U4AA 3VG0H 4P9ML 4HK3N 3BJLA 2V2TB 4NQTA 3B3IB 4UAOB 1KCVL 3FTGB 3MV8D 1OP5H 1WBZA 1I7RB 4M43H 1G7HB 1Y0LB 3FO0H 3K1DA 4MNQB 4YGAB 2VQTA 5B3JE 2GK0B 3TA3D 4PR5A 3EFFA 1P4IL 3AMLA 4GW4B 1NMBH 4XVUC 5SWSD 2F54A 1RZFH 4HFWB 5EOTB 2Q7YA 1CD0A 3MBEA 4Z77B 4UNVA 4LSTH 2UZXB 4OF6A 2WNGA 3O41B 1E4XH 3FOMA 5D1ZD 1I9JH 1J1OH 3GO1H 3IVKB 5IHBA 1MJJB 4LCCC 2MPAH 3SO3B 3BQUA 3QDHA 5F1IA 1LEIB 3ARBC 3D69A 1I4FA 5DA4A 5JLZB 4W4OC 5FK9A 4LCYA 1EHLL 2D31B 1FFQA 4PRPD 5CINH 2WWMC 4BUHA 1MVUB 4L3CB 1DQML 3UZEA 2R0ZH 5IOPA 1GGCL 5IEHA 1J0ZA 4JFFB 2OTWB 4W70A 3X3FH 3STLB 35C8H 1FPTL 1CLOH 2P48B 5DF0A 4WHTB 1XMWA 1V05A 3CLFH 3U9UA 2QQNL 2ILLA 4HIXH 3O6FC 1R3LA 1LQSR 3O9WD 4I3SL 4KJWD 1W72H 4FG6C 5ITBH 3MREA 3EDEA 5C2BL 1CE6A 1DBAH 3BYTA 4OCLC 3MRLA 2FL5A 2IBGA 1FFRA 3FO9B 1MY5A 4P2RB 1PGRB 4ZQKB 2A9MH 3IXTB 1OY3B 4M6OH 3TO4C 1NSNL 1A0QL 1CG9B 4OLYH 2R2HB 2E9BA 4TSCH 1T2QL 3X11B 4L4TE 5EU4A 5TF0A 1P1ZB 4NZTL 2VH5H 3RKPA 1RZJC 1IAIM 1NGXB 3GJEB 3ES6B 3C9NA 4HS3B 4DW2H 4JQIH 3LD8C 4GMSL 4NKOA 1YPZE 3FB6B 1MWAH 1MCHA 3GBML 5KW9L 4Z76A 5B3JF 4B7IA 2R2EA 1TZGL 4XC3L 3PWNB 1QLEL 2OMBA 5JPNB 5EBMB 1A9EA 1A2YA 3MGAA 2GJ6E 15C8H 3V7AE 2WM0A 1CLYH 4TUOB 5DRNA 4YIQB 3WLWD 1SJEB 1PAMA 4POUB 4RIRA 5HGBA 3MLXL 2X2YA 4U1HB 2DQEH 3HS0B 4ZXBD 1NGWA 2DLFL 2LU4A 4NQCA 2EKSB 4A6YA 4J3XA 1I8MB 4HLZH 1RK0B 3C5ZC 3Q48A 2BNQB 4LLVA 3IFNL 3VFRA 5A2LH 2JJUA 4KXZH 4H25B 2A1WH 5I1DA 3KR3H 3KYOB 5EFIB 1UKSA 2H2SC 1IFHL 5DC9B 1R5IB 4HEPG 4HXBH 5F9OL 3EYQC 3MJ6A 3MLZH 1OL0A 1XGYL 2XTJC 4YDKL 1U3ZA 2Z91B 1KCRH 2DL2A 4JQVC 3SE9H 4I0PA 4FP8H 5GGVY 1KCUH 3U30C 5HI5D 5CD5D 3BHBA 5FDYA 1HHIA 4NDMB 2NY2B 5GISL 3TV3L 1BD2D 4BQCA 4E41B 2O5ZH 5BV7C 1FNGA 4YJZL 3MRBA 3WE6A 1RIHH 2CDEB 1KN4L 2ZG3A 4XXDA 2DM7A 5DO2D 3RVXC 3W9EA 2J8UB 1WCQA 4WHDA 3NCMA 1F4HA 2EXWD 3BSZH 3O6KH 2IQ9H 1X5LA 5CSZB 3UYRH 1HHGA 1FDLH 2BC4B 1FNFA 1MCIA 3I6LD 1KGCE 3L6FB 1KIPB 2DLGA 2Y07L 3ECBB 5C0CE 1QYGL 3BKMH 5E2TH 5LWYH 4NKIL 2FD6L 1RURL 3AREC 5LGJA 1AC0A 1DCLA 4LAQL 2VDPL 5LQBL 3SKNA 3PGCA 3NZ8B 4MXWL 1JWSA 3PXJA 1KPRA 4HWBH 3S8WA 5D7JB 4HUUB 5H2BB 4AIZA 5MHSE 4P4RA 1K8DA 4OGXH 4HPOL 1X5ZA 3HPLB 4PJDA 1MAML 3H8NA 4XX1G 3BN9D 3BD4A 2EDBA 1IC5L 2IF7A 4I2XE 43C9B 4YHZL 5DMYA 3HCVA 3ZE0E 3QO0A 4XMKL 3U9PH 1C12B 1YECL 4PGEB 4KJYB 3LKNA 3QJHA 3RVWC 1EFXA 1PKQE 2XKUA 3VWJB 1A64A 4NQDB 4HIHB 2HFEB 3ZL4L 2B1AH 4K94L 5IFHH 2N7AA 2B4CH 2DM4A 4OAWA 2DQDH 5HYJA 1NFDB 5AUMB 1ACYH 5FUZH 1HZHL 1LD9B 3CXDH 1R0AL 3P30H 3I84A 3PJSB 32C2A 1F6FB 1TZHB 3BKCH 4YBQD 3PWVB 1KIRB 5KN5B 2DLHA 4JZOA 4MNGE 2H26B 3UTZB 2XRAL 4OCYL 4CJ1A 2W91A 2ZPKH 1RHHB 3WDHA 4NQSB 4X7CC 4P46D 4YC2C 2MCPL 2CUHA 1F4XL 1FIGH 5IEKA 4WV1A 4KRPB 4K3DH 4OZGF 5ALBL 1T03H 1BEYL 4LVHB 2QTEA 5D1QD 1N0LA 3PHQB 2JB6A 2DJSA 1D9KB 1QFWL 2ZWLT 3MGTA 4LMQE 4F33B 3D5OF 4ZYKA 5GGVL 3VXQB 4U6XA 4UDTA 1TMCB 3S88H 2QHRH 4M6MH 5DMIH 2FDBP 3EO1A 2ZP0T 3U2SB 4MXQD 3LZFH 3DO3A 1D5ZA 2VB5A 3V8OA 5GIRB 4UT6H 1RUQL 1FNHA 3DROB 1JPSL 3T0BA 3WIIH 1OAYH 4JFQA 3DRQA 3HE6C 1JVKA 3OMZA 1FL3B 5GGTL 3WYRA 1D5MA 3AY4A 2EYSB 2XG5A 3MOQA 3S37X 5HPMB 5I1JH 4K7PH 1J5OH 4G9FB 1EZVY 1C16A 3U0PB 4PJ9C 4LLWB 1E4WL 3WNKA 3FZUD 3D18A 4LARH 2JIXB 1E28B 4Q2ZB 3CPLB 4UIMA 3QG6B 1S9YA 2YXFA 1JF5A 1UJ3A 2DMKA 1EAPA 1IC4H 1RUAL 4JFDA 2NY3D 5ALCL 3NIGE 3OZ9H 4NRXA 4XT1C 4WFFD 4I9WE 5KANI 4TQEL 3MV8B 2GTZA 4OD3L 1QLFB 1VACA 3EYOB 1A8JH 1II4E 1UWEL 3H6JA 3TA3B 3AM8C 4RAUB 3P3YA 4PGZA 5IJKC 3QP3A 3ILQD 4OZHA 5I1EL 3O8XD 4P9MH 1B0WA 2YEZA 4EDXB 3QUMA 4PJ5A 5IW6B 4AH2A 5SWSB 3PV6A 2IG2L 3DGGB 1G7QB 2ITCB 4OF3A 3VD9A 3PNWA 4GQ9L 4ZTOL 3QPXL 2C4XA 3GSWA 1FFOB 1INQA 2UYLA 4LOUC 1YN7A 5I75C 4BH7A 5D1ZB 4JLRB 1NJ9A 2RQ8A 3MNVB 2RBLA 4UT9H 3ULVC 2BOBB 3GRWL 1UENA 1AC6A 5GSRA 3KDMB 3MRCA 3FT3A 3T0AA 4CAGA 4WEUD 3F6LA 5DI8B 5HGAB 5KG9A 2VR4A 1OTUD 2Z8RA 4NBZB 5C6TL 2Q1EA 5F93C 1TJHH 3GHBL 5GS1A 1CIDA 2OM5A 3VGFA 4HUWA 4G43A 4NNPL 3WFHB 1DFBL 5IWLA 1U91A 5C09D 1DJSA 4F9PA 4FTVE 4XX1E 4NIKB 4N0UE 2CRYA 1EHLH 1F6LL 4BSJA 1IILE 4CJ0A 1O0VA 1VCAA 5EBLA 1VFAA 1O5DT 1DQMH 4K3GA 1GGCH 5IQ9B 4RWYL 5IF0A 3QO1B 2FEEL 4M6NL 1FAKT 2FBJL 1FPTH 1TPXB 2VO5A 4J3UA 1FNSL 3MMEB 3H7BA 3ALWA 4XMPL 9CGTA 3ARBD 2DLIA 3FFCA 4I3SH 3GNML 3QIBC 3MV9D 3GSXA 4NPYB 5TDNA 5C2BH 4IBLT 3GI8L 1QNZL 2CLVA 1G7PB 3KLSA 3OXSB 4PD4K 3BIKB 1NSNH 2DLEA 3I50L 4TPRL 1A0QH 3NIGF 3FFDA 3KPSD 3P73A 2Q6WB 4O2CA 1A7RH 3BW9A 1BQSA 4E0RA 1AD0A 1T2QH 5KOVC 5C2UB 2EDHA 1R24B 3ARXA 4NZTH 5HDBE 3WXVL 4K55A 1SMOA 1H0DA 2A77L 1FZJA 1U8NA 5DUPL 4DCQB 4ETQA 4HULB 1JI2A 5ISZE 4MNHA 4ZSOB 2R69L 3K0WA 3TO4D 3GBMH 3INUH 5D1XC 5KW9H 1R3JA 3WN5A 1YEKL 5FKAA 5IJVA 3GB7A 1TZGH 3EYUL 5I76A 4XC3H 4I18A 4Q7DA 5JMRA 4Q6IA 4WY7L 4FFYL 3VXNA 4ZXBB 3M1BB 2J5LC 1YEGL 4YE4L 2EXYD 3O3EB 3JTSA 4PG2C 4XPHL 4M7KL 5EO9B 4EUPH 2ZUQC 1KJVA 3H7LA 5GRJL 3GIVB 3MLXH 3N1MC 4DOHE 2FX9L 4B53A 5C0JB 3P4NB 2DLFH 1R5WB 3W2DL 3WFZA 1U8QB 3O3DA 4U7MA 5I0ZA 2Z93A 1OTSD 2VIRA 5JXAL 1JV5A 3X14A 3QHZL 4M93B 1W8OA 4IMKA 3IFNH 2ZSWA 3GGWA 2BY0A 2CKBL 2NY1D 2HH0L 2D3VA 5IMLB 3PWPE 5IBTL 1BD2B 1IFHH 5F9OH 2JJVA 3SHSA 1WICA 3AU1B 4HC1A 3GIZL 2GUOB 1XGYH 3LKRA 4YDKH 4HFUL 4HKBA 3REWB 4R90L 3MRNA 4YHYB 2VXSL 3QIUC 4P4KD 3CVHB 4P3DA 1T4KB 1KYOJ 3TV3H 5DUBB 1CR9L 1NBZB 1XGQB 3F7YA 1DBML 4HT1H 4MD5B 4RX4D 3T0EB 5GZOD 2P44B 1FYTA 5EC1A 2X4NA 2J2ZA 1KN4H 2VLKA 2BVPA 3DUUA 3O3BB 2R56L 4ZUVB 4PGJA 2H2SD 3EYQD 4GW1B 1Y6MR 4QTIL 1NEZB 3G5YB 2RAMA 1CL7I 1CXHA 5KAQG 1RZ8B 1IL1A 5ICYB 5HDBF 2Y07H 5FGCB 5BCAA 5GRUL 3PABB 5DHYB 1JIBA 4NKIH 1L4IA 1RURH 2FD6H 4LAQH 4G7YH 2VDPH 3LKOB 4D0BB 3D85A 5LQBH 3KPOB 4GBXC 4MXWH 1EEQA 5C08A 1CICC 2NY7H 1VSCA 3RVXD 1JI1A 3ZHKA 1ERNA 3EOAB 2DKSA 4HIIB 4HPOH 2NQCA 1JPTL 2PYED 1MAMH 2MOVA 1XZ0A 1IC5H 2WW8A 3FONB 4LVOC 3MUJA 2FEDD 5SWZE 1D5BA 4XMKH 1YEJL 4P2OC 1IEBB 4GRLD 2DM3A 2PTTA 2P8PB 1IGYA 3MBXL 1BZQK 1NGYA 4K94H 1LHZA 2P5WD 1Z9LA 4NZJA 2AAVA 5JW5A 3V6ZA 4J6RL 3T2QA 4P46B 4HGKC 1QRND 1R0AH 4FQHB 3FB7B 4KUZL 1T0NB 3VXUD 3W11C 2IANA 5D1QB 1OSZA 4OCYH 3D2UD 2D7OA 1EJ6A 1U92A 4AEHL 5ICZB 1QBAA 3OKMA 3NH7L 4AM0B 1G7LB 2MCPH 4LCWE 3BKYL 3SJVD 4YPJA 1AGCB 5TPWL 2VYRE 1F4XH 2L0DA 4WJ5B 3WS6C 5ALBH 3TGXA 2WV3A 1BEYH 1FJ1A 4LFHG 1MEXL 4KI5E 5F3HA 4FFZL 1G6RL 1QFWH 1ZHNA 3TLRA 3TYFA 5GGVH 3FB8B 1WFUA 2ZSVB 4HKZA 3I2CL 1CGTA 3TESA 1T1XB 4NOFA 4U3CA 3BESR 4Z0XB 1OP5K 1OLLA 2DMBA 2EDQA 1UKTA 3NFPA 3RNQB 1RUQH 1JPSH 4ZFOL 1CDYA 4TVPL 1RIVL 4RZCA 5HTSA 5CJXA 2ERJB 3OJDB 1D5IL 5DJ2B 4ZAKA 3TFKC 1DP0A 3T3PF 4G8FB 2RB8A 3B2UC 2R1YA 4ZS6D 5HYQA 3HAEG 1BIIA 3BP4B 1IAKB 1JGEB 4MWFB 3RWDB 2NY3B 1FCGA 1MCEA 1EHAA 3GSNB 3TIEB 4L3ED 1MVFA 2JCCE 2Y7QA 4V1DE 3M07A 3GMRA 2NY4B 3MJ7A 2W9DL 4XCEA 5IB2B 2Q76A 1ROWA 3SBWC 1KOAA 5E2UL 5I8OH 4ZOCA 5ALCH 1I7ZB 1OGAE 5CEYA 2VDQL 3O8XB 3QPQC 3CZJA 3WNOA 4WWKC 1T89C 5A16B 4TQEH 2V2TA 4OD3H 1OD9A 1I7RA 5I1CL 1ZT4B 1UWEH 2XN9D 4AEFA 1G7HA 4OB5L 2ADJA 1Y0LA 3F58L 4KQ3L 5SWQB 1I1FA 2EDEA 3U79A 5J3HD 4JRYD 4ODWA 5I1EH 1MFCL 3GJFH 4F7TA 2VZOA 2AK4B 2IG2H 1HYSC 4YQXL 1C08B 4JANA 4OZIB 3CFDB 3WFDL 2DLTA 2CKNA 4GQ9H 4D9QE 3QPXH 3IFPA 3JWDC 1J10A 1T1ZB 3CU7A 4RMUA 2CQVA 3KXFE 3O41A 4HKJA 4WFED 2EO1A 1QO3B 1QUNA 1J0KA 3IVKA 4R4BA 3VXOA 3UTOA 5C09B 3GRWH 3QZWB 3MJ9L 1LEIA 1MREL 3CDGB 4RA0C 4IEFB 2OR9L 4KI5F 5TH2B 2YD4A 1DEEB 1IAMA 1PZ5B 4MJIA 5C6TH 3GHBH 5C6PB 4L3CA 5DJDA 4GQPH 4Q9CA 1A21A 4MVBC 3SDAD 4Q9QL 1IM9D 1OPGH 1CD8A 1DFBH 3N1PC 4GXUM 2F58L 2OTWA 4LOUD 3CX5J 3STLA 5I18L 1PYWB 3FO2B 1UXSA 5IESL 5E1HB 4LCCB 1B2WH 3ARBB 3QFJB 4X9GA 4RWYH 3MV9B 2YUVA 1N64L 4M6NH 2FBJH 1AGEB 2FJGA 4MGXA 4WVRA 1T3FB 4XNMB 4XCYA 3GSVB 4GG8B 3P40A 4R7DA 2AABH 4XMPH 4Z7VE 3FO9A 4P2RA 4APQC 2VLLB 4HGMA 3GNMH 1NH6A 3MJGX 3SDYL 3KPSB 5EU6D 2HG5A 5T5NG 5F89A 1ZE3C 4ZPVB 2VZ3A 4N1HB 4R96A 4S1DD 1AR1C 2R2HA 2G2RA 1YEDB 2V5SA 3GI8H 4X6BB 3SE8L 4BKLA 1QNZH 3O6FB 5E5RB 5F72S 4TTDD 4PRHD 7FABL 3LHPL 1K3ZA 2ATPA 5CCKL 1NGXA 3ZKSD 4G5ZL 3GJEA 4TPRH 4YXLH 1EO8H 5GHWL 5JXED 4LK4A 3L3JA 3ULUC 2X1PA 4ONFL 3W0WA 3RHWK 3MRJB 4HS3A 2DN7A 3TO4B 2YA2A 3O81A 4EBQL 3FB6A 3WXVH 4ZO8A 4OV5A 1UWGH 5JDSA 3QIBD 4QYOB 2A77H 4M7JL 1UYWL 3AS3A 4M8VA 3VXME 1RJZB 5DFWH 5EBMA 1A9BB 4MD0B 1YEKH 3SE4C 5EOCJ 3VFGL 3CJJA 5LGKA 3EYUH 1WQVT 4NCC1 4JY4B 3H3KA 2AJVL 3LD8B 4YIQA 3OG6B 5T33L 1ND0A 1SJEA 4WY7H 3QG7L 4FFYH 1T0PB 5DEGA 3RDTA 4U1HA 1P7KB 5KAQF 1YEGH 4HS8H 4L9LC 4GRMB 1X5KA 4YE4H 2EKSA 2NX5D 3SCMA 3SDXE 3IRPX 3QIWC 4XPHH 1I8MA 4M7KH 1FL5B 1RZGB 4YEFA 5GRJH 1B0GB 3IS0X 4KQ4H 4QF1B 2FX9H 5D1XD 5I74C 1UM4L 1XIWD 2R8SL 4LRIA 5FYKU 3W2DH 3KYOA 5EFIA 3LN4B 1XGRA 3V95A 3QEHA 3DGCR 3DURB 5JXAH 2Z91A 3QHZH 4KDWA 2PN5A 4PPTA 1KACB 2V2WB 5T3XL 2YSSB 2CKBH 4P4KB 2HH0H 5C07B 3B9DA 1GGTA 3MOAH 5IBTH 4NDMA 5IHLB 1IGJA 4RFEB 3TNNB 4H1LG 3GIZH 3LKQB 4PFEA 3T4AB 2E7LC 2HTKD 2QR0B 2BVEA 4HFUH 4P5MA 4R90H 5FYKL 4OKDA 5HDLA 3QUXD 4MD4B 3S37L 2J8UA 2W60B 4NJ9L 1LK3L 4YK4C 3DLQR 2XTJB 3EZJB 4Z7VF 2CH8A 3NIDE 3DIFB 1H3XA 2YD5A 1FH5L 4PG9B 1JRHI 3OKNB 5E70A 4PLKC 3RZWA 2R56H 5D72L 2BC4A 4JY6B 4GG6A 5I71B 2WBKA 5JW4M 1KIPA 2HFGL 4OFYA 3MCLL 4MQSB 1U8KB 3T65B 3K4AA 3NPZB 3C6SB 3NZ8A 5C0BA 2EECA 3O4LA 4H0HB 5D7JA 4HUUA 3QIUD 2B0SL 2PYEB 2R1XB 1J1PL 1ZHBB 3ZKXB 4EVNB 5FHAL 5GRUH 3MYJA 5F6IC 4C4KO 5DR5L 2PO6D 3HE7C 5IR1B 3ZE2E 3TH4T 3MXWL 3JWNC 1Z6JT 4GRLB 4F7EB 5F7MC 2OJZL 3SDDC 5I1LA 5F44A 3UZVB 2HFEA 1S9VB 2J1KA 1RPQA 2P5WB 1R5VB 1RUML 5FYJU 1YEJH 4Y2DA 5L0QC 1MRDL 1CK0L 1FQ9C 4EN3C 4PP1C 4YLQT 5ESQA 1NLBL 1YNLL 1OWWA 1S7VB 4GBXD 5C0EB 3LQAH 1LE9A 4NO0D 1WFOA 3SDXF 1B6UA 1CICD 1IAII 5DJ6A 3VXUB 4KKLC 3I85A 3PWVA 1KIRA 4HD9A 2B7DT 3D2UB 2H26A 4HCRA 3QUYA 1PEZA 1IMHC 1RHHA 4PRDB 1FZMB 3H9YA 1NGPL 4NQSA 1ZVSB 3MLUL 3VGHA 2C1OA 3PP3K 3BPOC 4KUZH 4XPAL 1CTNA 1BQHB 4RGNE 4P2OD 4WFHE 4DTGL 4WUUE 4A6YL 3T08A 4KGLA 1FZOB 3NH7H 1Z9SA 1J0HA 3PHQA 3S35X 3BKYH 4Z6AT 1NGZA 5HGHA 5EO1A 3VXQA 1MRFH 1FHGA 1MEXH 4L4TD 4YC2B 3U2SA 4FFZH 1G6RH 4QRTB 3NIDF 5D2LE 3X3GH 5GIRA 1MNUL 4Z7UB 2B1HH 4CW1A 4H8WH 3I2CH 1VERA 5DJZA 2CO7B 3OKOB 1NUNB 3RPKA 5C0AE 2EYSA 1QR4A 4L1DA 4L4JA 5HPMA 4JO2L 4F57H 3WUWB 4HUVB 1MFEH 3GMMB 5CS7A 2OCFD 2YPKB 4TVPH 1QPPA 1RIVH 2EICA 4FQXD 4Y89A 4PJBB 1NDMB 1D5IH 1DLFH 4Q2ZA 2JJTA 2GJ6D 3HE6B 3ET9F 1G7MB 4JY5L 4W6YB 4NUGH 1KNOA 2X89A 2O5YL 5ACLA 2YHGA 2H32B 3ZE2F 2CUMA 4E42B 3GMQB 3MUZ1 5D6DA 1NPUA 3MCG1 2W9DH 4LAJH 2W9LA 1CDIA 4OFDA 1M6OA 4KKNA 5FOBA 4PJ9B 1MHHB 2XN9B 3EYOA 5E2UH 1M7XA 2Q86A 4P59H 3E6HB 3TN0D 3TA3A 4JRYB 2VDQH 4CN4A 3DNKA 2BOCB 2J88L 5KVEL 4NQVA 3PWUB 5I1CH 2ITCA 5F8RC 2XXMB 4XPFL 4OB5H 4KQ3H 2QSVA 3DVIA 1NAMH 3PWLB 3QB7C 4OZ4B 1FFOA 1BQUA 3LV3A 5BRZE 1MFCH 4XHQA 4PGBB 5T5NF 4YQXH 3FQTB 2PW2A 3C60C 4NN7B 1JWMA 2ZG1A 3WFDH 3T1WA 5DQ9B 4JRXB 2AXJA 3WSQL 4D0CB 4PRPA 3QHTC 4QRSB 5CIPA 1CGYA 5CLTA 4CGTA 5K33A 3SDAB 1IM9B 4JREC 1HYRC 3MJ9H 2VZTA 5J11C 1UB6B 2OR9H 4XNXL 3B8YA 1KGCD 1P7QA 5E99L 4Z7WB 4PJHB 1BF2A 3QHFL 4ENEC 5C0CD 5D2LF 1HYSD 5DZNA 3T0DA 3O9WA 4LQFL 1A6UL 3QI9D 1KLFA 4WHYG 1TNNA 1D5XA 1FE8H 5MHSD 5I18H 1BJMA 1P5VA 2A6DA 4RMRA 4X9FA 3F12B 4FN0A 2NYYD 3N50A 1XAUA 2RHEA 3MMEA 2ZCHH 3LKSA 5GS2H 3G9VA 5DD1L 5EU6B 1N64H 2LVCA 4FXKA 1AGDB 2LABA 5CSGA 2B20A 4NPYA 3U36B 4IOSD 1OP9A 4EI5C 4MSWB 1A7QL 4HBCL 4LBEB 4PRHB 4MVBD 3KPQB 5FB8A 3RWFB 3ZTJG 1G7PA 5DT1L 5FGRA 3OXSA 3SDYH 1K5NB 3QFDB 3HR6A 3RUGF 2IAMD 5CKGA 4QWWC 3SE8H 1SQ2N 1EVUA 1R24A 1JMXA 1T80A 7FABH 3LHPH 2AJXL 3B43A 5F9WC 3QIBB 1AO7E 5CCKH 5EA0L 2GSIA 5DFVD 4UUJA 4G5ZH 4LMQI 5FDWA 1I8KB 1JZ3A 3MXVL 1JHLL 4ONFH 4DCQA 5ETUA 4KDTA 3ROLB 2ED8A 4HJJH 4EBQH 5F6HI 4ZSOA 4U6HB 3K1KC 4R3SA 2X4OA 3LPFA 4E5XB 5DUML 1DE4B 1ZVHA 1DN0B 5HHVL 2H2PC 4ELME 2R1WB 5IHZA 5HHPA 4KMTL 5J4MA 3KYMA 3C5JB 3VFUB 5I8EB 4ZXBA 4JGUA 2YWYA 5C0DB 2DQJH 3IDYC 2NX5B 2D4FA 1J0IA 4LLMA 3VFGH 4Z5RA 1AY1L 1FLRL 2VSCA 4N0CD 4F58L 4M4PA 1S7RB 5T33H 4WHCA 4IOIB 3LDBC 3QG7H 5D1XB 2VITB 1MJUL 4JCMA 1XIWB 4HDIA 1R3IL 5KSAC 3KPRE 5C0JA 1R5WA 3CIQA 4QHUA 2HT3C 1U8QA 2D7TL 2UZYB 1CS6A 4CADB 1LVEA 4POZD 2PUQT 2CD0A 4XI5C 1I8LC 2J5LB 1INDH 4ESKA 4Z7OE 1UM4H 5IMLA 1BD2A 1QTYT 1JK8A 3RPIA 1ZLSL 3AU1A 4ZPTB 8FABB 4JKMA 5T3XH 1TFHA 4DUWA 3REWA 3GMOB 1JYVA 4LLQB 3UBXI 2JB5L 2NMSA 4FQQA 3LKPB 4NC1C 4M9OA 1NBZA 4HMCA 3WKNA 5F21B 3VD4A 2CSPA 2EE6A 3ZKND 4OCNC 4DN3L 4Q0XL 5FYKH 3P77B 1J0JA 3S37H 3O3BA 4ZUVA 3U7YL 4NJ9H 1NCUA 1LK3H 1NC2D 4I9WD 4ZD3L 3U46B 1NEZA 1FH5H 1A6AA 3VMPA 2B4CC 1HHKB 3QIUB 3SGDH 4PJ7A 5D72H 5B22A 4YDLC 5ICYA 1GZQA 3IETB 2HFGH 3L7FB 3MCLH 3RTQD 3PABA 5DHYA 4QY8B 5K9OB 3LKOA 4QHLB 4D0BA 2PO6B 3KPOA 1I9RL 3P9MB 4X7EC 3BO8A 4XVJL 3H9ZA 3NCYP 3MRGB 4JVUA 1UB5A 3V5KB 1J1PH 1X44A 4HIIA 5FHAH 4CMMB 4P2CG 1FV1B 1G7JB 5DR5H 4PJIE 4PLKD 4M5YL 5F9DC 5HI3D 4U0RB 4U1MA 3MXWH 4ELMF 3H9SE 3ULSB 4TUJB 1IEBA 2OJZH 3OJMB 4EQ2A 3ZDXE 4GBXB 3MRPB 1TETL 4NO0B 3BRFA 5C0IB 1CICB 1MCWW 4LRNH 3MV7A 3PIQB 1RUMH 1Q9OB 1J8HE 2Q3ZA 4FTVD 2AK1H 4BZ2L 5DC4B 1MRDH 1CK0H 1SYVB 1L7IL 4LVOB 1NLBH 1YNLH 3B5TA 1KB9J 2K7QA 1XCQB 3HE7D 4FQHA 3FB7A 4P2OB 1OAUL 4J4PD 1H3WM 5E08H 5D1QA 4Z7OF 2FYYB 3BEWB 3FQNB 1NGPH 4AM0A 4HAFA 3MLUH 4KKCC 3HZYB 5GJSL 4XPAH 2JK5A 1KTDB 5MENB 3VXSE 1KIQB 3JSSA 3QCTL 5BZWB 3WHE0 4A6YH 4L4TB 3TJEL 5D71H 3MLPA 3CFIC 4WI3A 5IVOA 1J9CT 1GJIA 4LLDB 4QRUA 3B9KC 1U3HA 3O3AB 1X6LA 4BH8B 4JFXA 3IDMB 4KRMB 2GCYB 1OP3K 5DD3L 3F6IA 2PCPB 4L8BA 4MZ2A 1YPZB 4Z0XA 5JNYB 3RNQA 4F2MA 3GUTA 1Q0YH 2MMXA 3J8F7 4FQXB 5E94A 4LCIL 1N6UA 4M1GL 5E9DB 1YEEH 2BXYA 3D39E 4HUXB 5DJ2A 4JO2H 2GTWA 2GJ6B 1VESA 4F8QA 4UT7L 1X5IA 3GBLA 3GMNA 5F88B 4C56A 1YZZA 3BP4A 3PUCA 3GSNA 2CLZB 3TIEA 2VZUA 1ETZA 1XF4A 5IBUB 5GGQL 5JHDA 5IB2A 4BFGA 3BKJL 2N1KA 4OZFB 3BYYA 3QUKA 4JY5H 4PJIF 43CAA 2O5YH 1GCFA 3V6OC 1ZSDA 2XTLA 2IC2A 4M1CD 4R6UA 2IPTH 3IFOB 3O8XA 3ZDYE 3ZDXF 5HI4C 4PJ8C 4NO2B 4M62L 3MV01 2HKHL 1QSEE 3BWAB 1JNNL 1R3HB 1ZT4A 3QWRD 4FZ8L 1YC8A 1QHOA 2HYMA 1CXEA 3LN9A 5BV7L 1F4WL 3C5SA 2OZ4A 5CJ5A 3PWPD 5E8DH 2J88H 5KVEH 4LSRL 2GKIA 3HZVB 4XPFH 1FVEB 4OCWL 1KEGL 1X5HA 4BQBA 3RWCA 3EO9L 1YDPB 2F5BL 1LMKA 3MRMB 3PL6D 3LN5B 3REVB 1QO3A 1O7VA 2BVQB 3QA3B 3RJQB 2ICWA 3BEVA 5CJOL 4GAYB 2MWCA 5C09A 4P5TD 3QZWA 3KJ4C 1IKNC 1A7OH 1KTLB 3K81A 4LPYA 3WSQH 4YHPA 5TH2A 5C0CB 4FQ2L 1UWXH 4L8DA 1PZ5A 4HX1B 4PUBH 2XZQL 1CFBA 5KS9A 1GRWA 1FVDA 1DBBL 3MUGA 3QCVL 3FRPG 2BERA 2NW2B 4XNXH 4GRWE 3OQ3B 4WI7A 2Z35A 2CR3A 1H3PL 3QHFH 2EDJA 1QFHA 5AAMA 3C60D 3QAZC 1PLGL 3RWHB 4O51B 4I2XB 5DTFB 3D0LB 2FIRT 2NY0C 1A6UH 3B5HA 3L5JA 1BP3B 1J18A 2Z31D 2R15A 4KTEL 3QXAB 2MKWA 2X4PA 2XKSA 4XBPA 4D8PB 1V3JA 4N5EC 1AGEA 5LJYH 3LVEA 1KC5L 1NCBL 1PKQB 1T3FA 1KJMA 3L3GB 5EZOL 4XNMA 1DTUA 3GSVA 2WIIB 1V8HA 4GG8A 3LRGA 1N7ML 2VABB 4PREA 5FXCH 5DD1H 4ODUB 2IAMB 3KPSA 5SWZD 4G3YH 4B50A 3RKDD 1E6OH 4J3WA 4X6BA 1YEDA 1A7QH 4HBCH 5EC2A 1NFIB 4UILL 3G5XA 1ZLWH 1BWMA 3V0VB 2IJ0C 3E2HC 3TPKA 2XXCB 1KB5B 3VH8G 4MNGB 4S2SB 4O58L 2HTLD 3CFBB 5K9QG 5A1AA 3QDAA 4G7VL 4GMTL 4TVPE 4DVRL 4XH2B 3TO4A 4X6EB 1R3KB 3C87A 4Z18A 1Z5LB 5EA0H 1DVFC 4QYOA 3K4ZA 4PY7B 2OSLB 5CEZL 4JFPA 4F7CB 1ZLVK 2Y06H 1LNUA 3MXVH 1JHLH 1XF1A 4KXZI 1MWAA 1RJZA 2W0FA 5HHOE 5FA3A 5I66B 4LCWD 3H3PL 4M1DL 2AW2A 4N0FA 2OR8A 2AERT 1JMZA 4W6WB 3TP4A 5KSBE 2F74B 5DVLA 5LXGL 4KTYA 2OTUB 5E8OB 2Y72A 3MFFB 4JY4A 3VU2A 5ID1B 3Q5TA 5HHVH 4KI5D 1LK2B 3MRDB 2WP3O 3WNLA 3OX8A 1P7KA 5J12C 4J3TA 1OD7A 3K4DA 4OGAD 4F8TA 5L2JB 1AY1H 2PXYA 3QUMH 1FLRH 1FO0B 1CVSC 5BZDB 1NCCL 5IROC 2IBBA 3CFCH 1A3LL 1MJUH 3EDJA 1IVLA 3AS1A 4O2EB 1R3IH 4QF1A 5ESVB 2E7HA 4EI6B 1BVKB 12E8L 3KLHD 2D7TH 3LN4A 5IBLD 1K2DB 4XXCA 1UM5L 4GRWF 2YS4A 2H2PD 4I5BA 3HZMB 3L7EB 4P4KA 2EDFA 2CDFB 2HKFL 4ONHB 1XF2B 2D7PA 3HRZB 3JUZA 4RX4A 4RFEA 1ZLSH 3NACL 4XP5L 1IEAB 1EVTC 5E1AA 4V1DD 5KVDL 5KSAD 1NC2B 2B39A 2W60A 4O4YL 4NGHL 4H1LH 2LU3A 3CCHA 5F1KC 3DIFA 3UBXB 4JO4H 4RMWA 1DQLL 1PZUB 3OKNA 4DN3H 4XI5D 4Q0XH 5TJWK 4F15C 2KL6A 3K2UH 5DSCB 1OGAD 3LMJH 3U7YH 3BAEH 3RTQB 4ZD3H 3B5GA 4UIKL 3S4SA 3T65A 1UGNA 4K94C 5EULV 4PIRF 3HG1E 1J88A 1BX2B 3CFKA 4U1NA 5GS0D 3LEYL 4YK4B 3FQXB 3L9RB 4HZLB 4PJGE 1YMHA 2PYEA 1ZHBA 4EVNA 3MA7B 4G8IA 2FR4A 1Y6KR 4I48B 4ZUSA 1DQDL 4BK4A 4N9OB 3LS4H 3VXTA 5EDXA 4D9QD 4XVJH 5JQ6L 5LAXA 5IG7B 2W9EH 4M7ZC 3DJ9A 3KXFD 4GRLA 3E0GA 4F7EA 5CGYC 4ETYA 2X70B 5KSBF 4RFOH 1CFSA 1S9VA 4QRPE 3LH2H 1YQVL 2Q8AL 4G6ML 4M5YH 4FTVB 1UH3A 5F1NB 3KYNB 3CK0H 4N0UB 5D96C 2FX8H 3OXRB 1KBGH 2AJYL 5F6IB 4AQ1B 1QRNA 2VLRA 1TETH 3HE7B 1S7VA 5C0EA 2MQCA 4XAKE 2AQ3A 3RVTC 3VXUA 2AV1B 1MCPL 4BZ2H 4FQPA 4JE4B 3D2UA 1CFNB 1L7IH 2W65B 4TNWF 4WW2A 2BHUA 1T66C 1GAFL 3UTQB 4PRDA 1FZMA 1BBJB 2VQ1B 2YPLE 3SJVA 3C2AL 5DGQA 1KJ2B 4TVSa 2UUDK 5B39A 4CKVX 1OAUH 5L0QB 2XNAA 4EN3B 1TVBA 2UWEE 3BP5A 4YH6A 1VGKB 25C8L 3KVQA 5CBAB 2IMNA 1U2HA 5EZIL 3VA6A 3FO1B 4UNTA 4KUCF 3IJYA 5GJSH 4MJ5A 4U1GC 4S1QH 1DBJL 1C7SA 2CIKA 3U1SL 3MODL 1WK0A 4ODVL 3QCTH 4XCNA 3TJEH 1CT8A 2BVTA 2DBJA 3V0AC 5DD0L 4LASL 1OAZL 2SEBB 5K93A 3HR5B 4Z7UA 2WINB 3A67L 1QSVA 3O6ML 1QSFA 4HC1H 1RK1B 5DD3H 1P2CA 3WHE1 1AKJD 2WBJC 3RWJA 5ISZB 4J3OC 3GMLB 4XNQA 3MR9B 3WUWA 1ZA3A 4HUVA 3DX8B 1N8ZA 3GMMA 2XT1B 1KYOK 5A3IC 1CGVA 5T3XE 4JN1L 4LCIH 4M1GH 2V6HA 3OB0H 1F00I 4L3EA 4PJGF 4KJQD 2FZ3A 1NEZG 2OJEB 1XGUB 4Y5VC 5FO9A 2VR5A 1K4DA 4L4VE 4LNRB 1G7MA 3MOBL 1EJOL 4JZJC 4NQXA 3RWEA 3NFNB 4HWUA 3K7UA 4UINH 2VDOH 5C9JB 4DOHB 2BRQA 5GGQH 3FCTB 4Q6YA 2ADFL 1FGNL 2CJUL 3BKJH 5DJYA 2HLFC 3SKJL 3HUJA 4DGYH 2XN9A 3RL2A 2A83B 2RFXA 3SKMA 5I1GL 4NWUL 4JRYA 3C8HA 3PWPB 3D25B 1FLTX 3N85L 5HVGB 3L5XH 3NAAH 2ENYA 4LSPL 4ALAL 4M62H 2BOCA 2HFTA 3VE0B 3VFVB 1VFMA 4FZ8H 4LU5H 4RDQG 1A7PL 5J7CC 4U1IB 4OZ4A 1WFTA 5DVOA 5KSVA 3PL6B 5SX4H 2ZG2A 4K3JL 4LSRH 1ZANH 4PJEE 4X4MA 1C5DB 3FQTA 3TCLB 2X4QB 4OCWH 3HPJB 1KEGH 2D2OA 2UWEF 2I25N 4Z78A 1EIBA 3EO9H 3MO1A 5HI4D 4K2UL 4RAVA 4D0CA 2X4UB 2MHAA 3P4MB 4LF3B 4QRSA 4HCRL 3TBTB 5CJOH 3SDAA 1IM9A 5CGTA 4NZDA 5L6YH 1NBVL 2X41A 5GGRY 1UB6A 5BVPL 4FQ2H 3SDCC 3C60B 4PJHA 2XZQH 5D2NE 4ZNCD 1CLCA 1DBBH 2PW1B 3QCVH 1AXIB 4EXKA 2R4RL 1SVCP 3F12A 3JWOH 1AHWC 4Z7QE 1K85A 3VGGA 5E8EB 5KBNC 5H37G 4NN5C 1A22B 4NQCE 3I6GB 4KTEH 5EN2A 5SWZB 1WIUA 3GKWL 2OL3A 3DARA 1KC5H 3ALPA 1NCBH 5EZOH 3BRDA 5MI0C 2RCSL 3G6JE 4PRHA 1N7MH 3KPQA 4NN6B 3NMEA 2V9TA 5GQBA 3ZHLA 5F7NC 2AXGB 4JPIA 4LLUA 5JXEA 2EIZA 4PGDA 5ESAA 3PHOB 3AUVA 4XCFL 3ZYZA 5JR1L 1JWUB 1VEMA 1TCRB 2R29H 2YPVL 4HJGA 4PB9L 5TDPA 2Y5TB 4O58H 2D0FA 4N5ED 3ARZA 3V6BR 1D6EB 2DTML 5DWUL 2WSKA 5FYLL 4K8RL 3ROLA 4DVRH 1S9WB 4LCWB 4NO5B 1K6QH 1Q9WB 3T4YB 2FCBA 5HYSB 1TIUA 1GIGL 2ATKB 4M02A 4ODBD 4RGND 4WFHD 4E5XA 5CEZH 1WGOA 4WUUD 2EH7L 5F9WB 2LTQC 3EW3B 3IJSA 5GRVK 1NUGA 4PJEF 3H3PH 4M1DH 5KANG 2FGZA 5C0DA 1AD9B 2NX5A 3UJTL 4Y4FC 5LXGH 2F5AH 3VRIA 3TBSB 1S7RA 1FCCA 3EZ8A 4IOIA 2VITA 1XIWA 4J8RA 1VKXB 3OKDB 2JKXA 3D3VE 2X4TA 4OD1L 1YN6A 4PRIA 3FL7A 1KLGB 3TBYB 1NDGA 2IBZY 3PGFL 1LDPL 1NCCH 2WUBL 4KK6C 1ITBB 5C0AD 5FM4A 4DAGL 1A3LH 3QQ4A 1FGVL 3RWIB 4YFEA 2IFGA 3IDYB 4X4YB 2YC1B 2A9NL 4ZOBA 3S35H 5IMOA 1A4JA 1ES0B 1CN4A 2ARJB 1Q8MA 1U9KA 1I85A 8FABA 3LDBB 4M00A 2JCCB 4V1DB 1KF9B 3QUXA 5KSAB 1MCQA 1X3DA 4LLQA 1K9TA 4WCYL 3BXNB 5HYJE 2HKFH 4LHUA 4M61B 3LKPA 4MB3A 4TULL 4PTTA 3R1GL 5C0FA 3IAGC 3VWKD 1YA5A 3KPPB 3NACH 3Q3GA 4G42B 4L5FH 5DJCA 4XP5H 5EUKA 3O4OC 1D7FA 4K9EL 4G8EA 4PRNA 2AXFB 1OGAB 5KVDH 3P77A 1HXYB 3K8MA 3G6JF 2V2XA 5ICXA 4O4YH 2XQBL 5B38B 2AI0L 4NJAL 1SJHA 1KFAL 2YR3A 3U46A 4IHOB 4I0KA 3QSKB 1DQLH 3JV5A 4HUMB 1HHKA 3QEQA 4QRQA 1JP5A 1YNKL 2IQAA 3NABL 4UIKH 3L7FA 1N26A 1WBYA 4AIOA 3WL9A 5K9OA 1W0YT 2XYCA 2F53A 2PO6A 5EH1A 1TITA 1INEL 3P9MA 3LEYH 4JM2C 1GGBL 4R7NB 3KXFB 1U95B 3MLTA 4CMMA 1FV1A 2A6IB 3ARYA 1DQDH 3AC0A 1DLHB 1PG7L 5JQ6H 5TQ2L 3VFMA 4JDTL 4M6AA 1IGIH 3ULSA 5E2JA 1MHEB 4X98B 4G6FD 4M7LT 1YEHL 4AQOA 3NA4A 4NO0A 5C0IA 2Q8AH 5J89A 1M71B 1Q9OA