1E5YA

Azurin from pseudomonas aeruginosa, reduced form, ph 5.5
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Rontgenkristallographische Strukturaufklarung Von Azurin Aus Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 33
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1e5yA00
1ILSA 2YAOA 1SHXA 2XXGA 3X1GA 3N2JA 1AZUA 3PXLA 5F7BA 4E9SA 1SNRA 1NPJA 1PZCA 1URIA 4M4RB 7PAZA 4HZ1A 1AS8A 3NSFA 4E9RA 3T6ZA 3EH3B 1AG6A 2ZXWB 2FQEA 5TK2A 3SBPA 1KBVA 2EILB 2MTAA 3QJSB 4DP5X 1JERA 1I53A 3FYEB 4CSPA 2BP8B 1NINA 4HIPA 5B1BB 3IN0A 5B3SB 1JOIA 3MX0B 4DP1X 5I6NA 2W8CA 2BW4A 2YAQA 5AFAA 4YSEA 2OJ1A 1NIDA 1WA2X 4FAAB 1E5YA 2HX7A 3QJVB 2DWTA 1WAEA 3QJRB 2ZOOA 3UABA 1ETJA 3FPYA 3S8GB 3UADA 2HLEB 1J5CA 4EF3A 2DYSB 3IBOA 3S8FB 4YSAA 3NJIA 3ZIYA 4DPAX 2WSDA 2ZWNA 1M56B 3PPSA 2IWFA 1ET5A 3FSWA 5AKRA 3TBCA 1OCRB 4GP5B 4W1TA 4G7SB 3UAEA 3X1NA 2J5WA 1OCOB 1NTDA 3TBBA 4DP9X 2PP7A 4E9YA 2HX8A 3IE9A 2N0MA 2JFCA 3U25A 2UXVA 2BZCA 1SF3A 4KO9A 2AVFA 4AKQA 5B1AB 3OD3A 4AZUA 6PCYA 1V54B 3EH4B 4JHVA 3X2QB 4KNTA 1KCWA 1ET7A 3FU7B 1GYCA 3GYRA 2VW6A 1MG2C 4UAHA 3FQYA 1NIEA 1T5KA 1KGYE 3T9WA 1XMEB 3X1FA 3T71A 1DZ0A 1SFDA 3H56A 4YVNA 1E65A 1SDDB 1AAJA 2IH9A 1KV7A 1BAWA 7PCYA 2UXFA 3JT2A 4M3HA 2QPDB 1OCZB 5B7FA 4KOBA 1BYOA 1GS7A 2W88A 2YXVA 3KW8A 1ZV2A 2GHZA 4BXSV 1GS6X 3FT0A 2IDTA 3DTUB 5I26A 1OE1A 3NSCA 3PAUA 1JZGA 2OCCB 4YSUA 3QJUB 4GYBA 2QDWA 1E5ZA 1TKWA 2I85A 4QLWA 3ERXA 4NB7A 2IDFA 1PLCA 3SBQA 2FQGA 3SQRA 3AG3B 4E9WA 1PF3A 3CZUB 1RKRA 3S3CB 1AR1B 1AZCA 3UAAA 1A4CA 1KBWA 1OV8A 3UACA 1HAWA 1NDTA 3SBRA 4HCIA 2JKWA 2P80A 5B1JC 5TK4A 3FQ2A 2BZ7A 2OV0A 2B3IA 2DWSA 3HEIB 3WI9A 2HXAA 4ZK8A 4YSCA 2PPEA 3T6WA 1PLAA 1CYXA 3ABGA 2VSKB 5I5JA 2XXFA 1BEXA 3CVCA 4G71B 3WKPA 3C75A 1L9SA 1PCSA 3HB3B 4YSOA 2FWLB 2AZUA 2GBAA 1GY2A 1FA4A 1M57B 2A3TA 4P5SA 3WG7B 4KOCA 4G70B 1IBZA 2BP0B 4HCFA 1OE2A 2Q9OA 3QPKA 4A2GA 2DY2A 2PP8A 4F2EA 2Q5BA 5B1KA 3T6XA 2IH8A 3GXUB 2R7EA 1L9QA 2H3XC 5I6PA 1GW0A 1NIAA 2X88A 1PAZA 2CAKA 5LDUA 5FC9A 1EZLA 1WA0X 4BWWA 1AZBA 5PCYA 1MZYA 2PLTA 1CUOA 1JVLA 2EIJB 4E9XA 3NP3A 2GC7C 2B08A 5I6LA 1HAUA 4Q89A 3NT0A 1KYAA 4CSZA 5B1JA 2FT6A 1SF5A 1V55B 2AANA 4DP4X 1BXAA 1BQRA 3FS9A 4KNUA 4HHGA 4Q8BA 1SJMA 4BDVA 1AANA 1IUZA 3DIVA 3FPXA 3OMAB 4HALA 1N70A 1JZFA 2J57A 3N55A 2YXWA 4G72B 3WKQA 9PCYA 1KCBA 1X9RA 4AKPA 1W6WA 2BO0A 3PLYA 3WNIA 3EHBB 2VSMB 1FWXA 3FSZA 4NAJA 2IAAC 1ASOA 1JZHA 1FFTB 1PMYA 2YAEA 8PAZA 4P5RA 2EINB 1GY1A 3NJHA 1BQKA 1ZDSA 3CDZA 2R7EB 1BXUA 2VN3A 3ASNB 4RH4A 3JTBA 2I7OA 2BWDA 2ZONA 4BWUA 1L9OA 3X1BA 1V10A 3MBWB 4DPBX 4KNSA 1JXGA 4W9ZA 1NICA 4G7RB 1E67A 3CVDA 2GI0A 2BWIA 1J9SA 2PPAA 2YAMA 2EIMB 4WTQA 4YSRA 2XX0A 1NZRA 2HRGA 2RACA 1PZAA 2FQFA 2IDUA 3WNJA 4YSQA 3FYIB 1F56A 2VW7A 1L9PA 1EHKB 1OE3A 1XB6A 3CG8A 1PNDA 2UXTA 3NJFA 3WIAA 1NIFA 4AKOA 2FT7A 1A8ZA 3X1EA 4AI7A 1RZPA 1RZQA 1AIZA 5AZUA 2VW4A 4YSDA 1JZJA 2DV6A 3TU6A 4DP6X 1A3ZA 3OMNB 2GB2A 3QQXA 2XYBA 3PAZA 1A4BA 2BW5A 4A68A 2HZHA 1SFHA 2I7SA 4G7QB 2Y69B 4YSTA 2XV0A 3AG2B 4HAKA 3NSYA 1GR7A 3QJQB 1W6LA 1ZIAA 1DYZA 3H4HA 2WO3B 1ZPUA 3S3BB 1IKOP 3NYKA 1TEFA 1ZDQA 2CCWA 4DPCX 3FQ1A 5D4JA 1AACA 1HFUA 2PPDA 3NJNA 1E30A 2GIMA 1KDIA 2PCFA 2EIKB 3ZX1A 4DP7X 2AFNA 3RYMA 3KW7A 4A2HA 4F7KA 3V9EA 1WS7A 3ZDWA 1ASQA 1W8EA 2MRYA 1X9UA 1B3IA 2J56A 3AG1B 1ILUA 2FTAA 1J9QA 3IN2A 1QHQA 4HHWA 4HCGA 3ZBMA 2HRHA 3OMIB 5I6KA 1RCYA 1AOZA 2CALA 1ET8A 6PAZA 4PAZA 4BK5C 2XV3A 2H47C 1OCCB 2IDSA 1XB8A 1TU2A 5B7MA 3NSDA 4YSPA 1PNCA 4GY4A 4N4YB 1CYWA 3ABLB 3GDCA 2UX6A 2VMJA 1NWOA 4MFHA 5I6OA 4FA7B 4NERA 3AY2A 5I6MA 4DP8X 1SHWA 3TA4D 2XX1A 4KO7A 2VM4A 1PY0A 3OQRA 4UANA 2XU9A 4BWTA 2X87A 5D4IA 1OOWA 4ENZA 2UXGA 2Y1AA 3BQVA 1AZRA 3ASOB 3FU7A 1BYPA 4E9TA 2TSBA 1NPNA 2QPEB 1BQ5A 2NRDA 2UX7A 2YQBA 3IEAA 1UATA 4QKTA 1OF0A 3FSAA 5PAZA 5I5IA 3CVBA 3G5WA 4E9QA 2FQDA 2CJ3A 1BXVA 4WKXA 1ID2A 2PPCA 2DYRB 2TSAA 4X4KA 1SDDA 4F2FA 3BVDB 4PCYA 3UGEA 4YSSA 1AG0A 2FJSA 1CC3A 1MZZA 4YVUA 3S3DB 2YAHA 5EHFA 2IWKA 3EF4A 1XB3A 3PCYA 3NJGA 4A67A 4E9VA 5A7EA 5I28A 3AZUA 1M9WA 1QLEB 1WA1X 4A2EA 4UF7C 2GSMB 3TASA 2XV2A 2GC4C 4DP2X 1JZEA 4BDVB 3FU9A 3NJLA 1L9RA 3V9CA 1CURA 1KDJA 2VM3A 4A66A 2CUAA 3EH5B 1NIBA 4GP8B 3DKHA 3H4FA 2IWEA 3FU8A 2P80D 2YAFA 1A4AA 2WO2B 3NJKA 1AS6A 1YLBB 1J9RA 3CDZB 1WS8A 4KO5A 2XVBA 1QNIA 1N68A 1J5DA 1R1CA 1NWPA 4YL4A 2HX9A 2YARA 3NP4A 1AS7A 1ZIBA 1J9TA 2QDVA 2FNWA 3FSVA 1IC0A 1JXDA 2E86A 4K9JA 4JHUA 3L45A 2PPFA 4JKNA 4GXFA 1L9TA 2LLNA 4L0PB 4BXVA 1VLXA 2QT6A 3AW5A 3QJTB 2AZAA 4KO6A 4TXVB 2PP9A 5IY5B 3OM3B 3PAVA 1MDAA 2XUWA 2XWZA 1PLBA 2YAPA 1GSKA 2BP0A 1MG3C 3T6VA 2CBPA 1AZNA 2IDQA 1ASPA 3NJMA 2PCYA 2BP8A 4DP0X 4A2FA 5I5MA 1PZBA 2FT8A 3NJJA 1IBYA 1ADWA 1TEGA 2H5UA 3ABMB 5E9NA 2JXMA 3D12B 1AQ8A 2BHFA 5B7EA 1JZIA 4N8UA 1A65A 5D4HA 4A2DA 4GP4B 3ABKB 5ANHA 1GS8A 3AG4B 5F7AA 1JVOA 1JXFA 2XLLA 4AX3A 2J55A
chains in the Genus database with same CATH superfamily
2A9AA 5INCB 1YEWA 1FPTL 5F1OB 2BP5M 3ARBC 4JFZL 4AQEA 2Q76B 4OLYH 2ENQA 1JZDC 2MKLC 2V7HA 2PCXA 3QO1B 4R4FH 3NSFA 2ZWZA 1IGIL 4O02L 1WWAX 1GIGH 2WZ0A 3BKYH 3QDHA 3TV3H 3BPCB 1JGLH 4PRAA 1HKLL 1QR1A 2LTQC 4UWQB 5TK2A 1IILE 1IO4C 2ZXDA 4J3OD 3BSHA 2NDGA 4HS8H 1EEYA 5CHNB 5D1XE 5B1BB 3HHSB 2DPKA 5KYWB 2W8CA 2BW4A 4AH2B 3IVKA 1P4LA 4EPSA 5HYQA 2GIYA 1NFKA 3H54A 1RHFA 3F7PC 4KHXL 4U1SA 3CHXA 4EF3A 3AU1A 1IGMH 3KCWA 1DUZA 5I1AB 2EDTA 3BW9B 4POZC 3RX9A 4I0PD 4BZ1L 1ET5A 2K7QA 4NI3A 4ZX5A 3P9LA 1ZWIA 4Z7UA 4OVUA 4YNYB 1KN4L 4KTYA 5JHMA 1NTDA 1VENA 4LSUH 3QSKB 4MJIA 4X6CF 2C3VB 2JV6A 1NC2A 4N9OB 2Y5QA 4H0HB 3VU1A 4RVBA 1IGJB 1TQTA 3D2UA 3R4DA 3OKMA 2I25N 4H0IA 3O3EA 4Y9CA 4RGOH 5EUOF 1I1FB 1DQTA 2CR3A 1UVQA 4QRBA 1ET7A 3ILDA 1MI5E 2G5BA 2YPLD 1PG7H 4J3OF 1QR4A 4JG0L 5I1LA 1ZOXA 1I7RB 4N6RB 3SGEI 2VERN 4RESB 3SKNA 3VJ6B 4WHCA 2BIIA 1BAWA 3BKMH 2UXFA 2IQAB 4XNUH 5D7JC 1AO7E 5DQ9A 4L8CB 4P48A 3DO4A 5HDLA 3ZE0E 2FX9L 2A6JB 4BKLB 1R0AH 1IEAA 2GFBA 4XPAL 4AXWB 5FUZH 1JF5A 5JW4Q 2B16A 2CDGA 4QTFA 1UOWA 3M1CA 2HFEB 3N42F 1NKRA 3RY5A 3DTDA 4PRBA 2Z31A 1YMHB 3RTQC 3ZE1B 3FFDB 3SDAD 3UZEC 3V4UL 1CZ8H 4N0RA 3RWFA 3EJSA 1A0QL 1FYTE 2IQ9H 3DJRA 1ZTXH 3OR7B 4Y9EA 5IB2A 5GHWL 1OOAA 1HWWA 5HVHB 3QUKB 1Q8MA 5G5DA 4HC1L 4HD9A 3P4MA 4R84A 1WZ1L 2Y36H 1GZQB 2Z6FA 3K0YA 5F9OH 3Q8BA 5KJ4A 2JE8A 2CKBH 2N7AA 2Z1KA 4MTMA 4N0YH 4ECNA 5IMLB 5CU5A 4G6AC 3ZJAA 1AJ7H 3C2SA 1MW0A 4L5FL 1DQLL 3IDGB 4PHZA 4H5SB 1WVZA 3O8XB 2BZ7A 2EUVA 1MUJA 1HEZB 4KJQD 5FHBH 1E2WA 3OSKA 3UP1A 5F72S 3VXUD 2HKHH 3KR3L 2H2SD 5EN2B 2WNXA 4PB0H 3L5JA 2O61B 5LUMA 3IU4L 5AWNL 3V4LA 1BJMA 3CVHB 2K9UA 1OB1B 1FZMB 2NYYC 2D7QA 4R3SB 3B6SB 3ZYJA 1DO6A 3P4NB 3Q5OA 3QXDB 4F5CE 3IFNL 4PJDB 1E4XH 4LCCB 5D1XA 5AZEL 3ABGA 3NDZE 2VISB 4FG0A 5IF0A 2KZ1B 3BHBA 1J12A 2GJJA 1A1NA 5L88L 5IB5B 1OM3L 3VU2A 1FL3B 2FWLB 3K6SA 5ERWB 3SE8L 1I7UA 3ECUA 2D31B 4LSDA 1LK3H 5IQOA 4Y5VC 5IJVB 4XWOC 1O5PA 3LPGA 5SWZD 2V5SA 2WTPA 4TNWK 1PQZA 3K6DA 4XHQA 4ZUVB 4Z8FH 2Q5BA 4OFIA 3BCDA 4PM1A 2X6MA 4JO5A 1AKPA 1RPUA 4X6BA 3S5LA 5K9KA 3FRUA 4HS3A 4ACPA 2L7EA 3MV7A 5ALCH 3CSFA 4EUPG 5FW7A 1LO5B 3L81A 4K94C 4GUQA 1FL6A 2CU9A 4WTZG 3QQ9C 3WAJA 4MDIB 4GG6F 1PDKB 2W60A 3PWVA 2X41A 4YXHH 3AU0A 1OPOA 3NP3A 4WHYG 4YFEA 5DZNA 4K7PL 5DJAA 1UT9A 1M2OA 4XMWA 1OAQH 2OXHB 1FNSL 2EYSA 5IIEA 1G6RA 2EH7L 4CC4C 3WTWA 1AR1D 2VDOL 2F53D 2VITB 3OMAB 4HALA 3SPHA 3BGFB 1MI5A 2Z92B 2XZAL 3HAEH 3MRDA 1MCWW 4X80H 1QHOA 3OBAA 4B41A 3PLYA 3K46A 4LKCB 4ONHB 4NRXA 4AUUA 1BQKA 2R7EB 4P2RD 2VLLB 4I3SL 3S3JA 2H8PA 1NBQA 3SE9H 1F3DJ 4KDWA 4Q9BA 3BO8A 1I31A 1PZ2A 43C9B 4N8VG 3R1GL 3BEWA 4NBYB 2FX8L 1IM3D 3GK8H 5ILTH 3WELA 5HHNA 2X6VA 1NL0H 4NPJA 3MJ7B 4FA6A 2QFRA 1U2YA 5SWSE 2R4RL 2NY3C 1WFMA 4I87A 5JW3H 1NZRA 3V8OA 1DL7L 3IKCB 3CH1A 1FYTA 1XCTA 2C4FU 1BYNA 2I07B 1JPGB 2VKWA 3UXFA 2R69A 4K9EC 3PV6B 4G1MB 5A2JH 1B4LA 1DUYB 1ZAGA 2YMTA 5F8RC 1MPAH 4JVWA 3U2JA 2W0PA 3KPPB 1SLWA 2VR3A 1OCWH 1J8HB 5AVQB 3BEVA 2COQA 4U6TA 2OXGA 3O0LA 5AZUA 3HE6A 3ZHLA 5HI5C 4ZO8A 4KK9D 3O2DA 2A4EA 4O4YL 3VGGA 5CJBA 4H0GA 1T4KA 1A4BA 4OFVA 5JHDD 1D5XB 1H5BC 3AWGA 4MS8D 5AAMA 4FFWC 3SYAA 5KS9B 3U30C 3TF4A 3RILA 1P7BA 4F5CA 4EI5A 1Y6NR 4GAGL 4HP5A 2HFFA 1G1YA 4BRJA 1F90L 1SVBA 1TJIH 5J6HB 1TEYA 4UQEA 1IAMA 3H4HA 1YMME 5T5FH 3UDWC 5KVDL 1AD0B 1IM9D 5AVRB 4G3YL 8FABB 4OF8A 3DX7B 4LVNB 5FO8B 3MA9L 3HZKA 5FK9A 1R3LA 2X12A 3QCUH 3G6DH 2PCFA 4RQQB 1KT2A 2X3BA 5KSVA 2F68X 2EUZA 2XWDA 3RWDA 1UJ3C 1ASQA 4ELMF 3IAQA 4U1JA 4DZBB 3QG6B 4PJBE 3UBXG 1BP3B 4PD4J 1FSKB 2XTSA 2ATAA 3MV01 2YGNA 1CXLA 1XF3B 3EDKA 2OA9A 2P8PA 3CZFA 1WFJA 3ES6A 1MCWM 4LHUA 4UU9B 1WTGT 5FECA 3TESA 1TVHA 4DZ8B 8CGTA 5FFLA 4BFKA 4OCXH 1J8KA 3OG4B 4FADA 4G9FA 2X4QA 3VRJA 5C0GB 2X28A 2J6EL 1RUAL 2BIMA 1IEBB 4PJFA 3ZDYB 5C2BL 5IESH 1O5DT 2BNRD 1I8IA 4F57H 4LVHB 5IG7B 3EADA 5I15L 5DD1H 1HXMA 2X5PA 1Q72H 5GSVB 2JKTM 5ADPL 3HC3H 2ZZUT 3RUGE 1CLYL 3V0AC 2YD4A 3VFUB 3Q8CA 4WI2A 3L4XA 1LGVA 4S10A 2VL5B 1B9KA 2XX1A 2VDRB 1NCGA 4FYTA 2IFGA 4XHJC 4LQFH 4OCRL 2BOCB 4H1LG 1NAMH 4NZRH 5E8DH 2P48B 5J3HC 3ZE2B 2VM4A 1BQHA 3KXFE 3KM2A 4PCTA 3TN0B 2IH1A 5FWQA 2XU9A 2MCG1 1M7IA 4PS4L 3ZVVA 5IJCC 5EEVA 5F70A 3BQVA 2AK4D 5SWSA 1ZK9A 1IFHH 1ZANL 3BP4B 3DC0A 4P23D 1MFAL 3GSNH 4XZ4A 1D5IL 3VE0B 3V52H 2CBQA 4DGYL 3L2LA 4QLRA 2KZKA 4LSTL 1CK0L 2ADGB 2B4CH 4TUJA 5AKTA 3E38A 4XVJH 2WXLA 2D4DA 3S98A 4OV5A 2QVIA 1SDDA 2W65B 4JGMA 4NUJB 1MFEL 3WIFB 3TVMD 5ICYA 3FT2A 3RNQB 5MP6H 1S7TB 1WD9A 2CHWA 2OJEA 5LBSH 3LKOA 1MRCH 1XGUA 4GSDL 4LAQL 4H2CA 3K8MA 4XO3A 4Q9RL 5JLZB 3KMDA 2C3GA 4B50A 3QUXC 3F8UB 3LKPB 5KVFH 1EHLH 4R5VA 4M7JL 1KLUA 4YHNB 4XVUD 5I66A 3O3BB 1NC4B 1JHTA 4MAUL 3U48A 4XCEA 4JFYB 4J12A 4PWHA 3FU9A 4PJ5B 5IVNA 5DDHB 2DAVA 4CGUB 4O02B 3DX9A 5HGAA 1BZOA 4JFHD 1QFHA 2FYVA 3QUML 2DEXX 3UTZA 3H4FA 2WMPB 4OSUL 5GIRA 4OZIF 3HG3A 4I77L 3H9YA 2B14A 2CIIB 3E8UH 4ABVA 5E2VH 3DYOA 3TJEL 5IMMA 5L7XH 2PN5A 4R7XA 1AS6A 4Z7VF 4E9LA 1RMFL 5D5MB 4ATTA 3O2WL 3JV6A 4C47A 3B3IA 2EICA 3L3HA 4KDVA 4QRSB 5BS0E 3S36X 3GSOA 4XBMA 3HI6H 1AS7A 1AGBB 3S35X 5H35A 1E50A 4LL4A 1WWWX 3V10A 2AJYL 4K9JA 1J0ZA 3DVNB 2J8UE 3Q6FA 4X42A 4KKCD 3SDCD 1O6VA 1ETB1 5JPNB 2H3KA 3KEHA 5L2KD 2EYTA 5FCUH 1UG9A 1QMUA 1R3JB 4PJ7F 5INDA 3QORC 4JO4H 3QIBB 3UEZA 1RLBA 4L37B 3ZUNC 4IKJA 2VN5A 2NQCA 5FM5O 4H88L 2CJSA 2E7HA 2FWSA 1PLGL 4HUUA 5DGQA 3RGVB 4PWKA 1LXMA 1JPSL 2KC0A 3H2WA 4XBPA 2DIAA 5L6YL 4Y16A 3G5ZA 3P40A 4WWNA 4U31A 1JF6A 1YDPA 2GHWB 1QSFB 1TEGA 3WNOA 2EVJA 4PTTA 3EO0A 5KYUB 1YNTB 3RUGA 2B0SH 4R8WH 2JJUA 2QSCH 3PP4H 3MV8A 1QSZA 1IBBA 2B77A 4EI6B 2WLLA 4QMEA 3RL1A 3GBEA 2DQCH 4G7VL 2UV3A 3M1OA 4ISVA 1N5YH 2YK1H 5F21B 3KL5A 2YEZB 1DN0B 1Q0XH 3KXFA 2IF7A 1HI6B 3LS5L 3Q0HA 4R4NC 3OAYK 4HKZA 1AKJB 1FDLL 2OR7A 2XTJE 3KDPB 3ZDZE 1BG1A 1ZVSA 2MWCA 4C59B 2FR4A 2JKSA 3FQRB 4GRWB 1BA9A 3SCMB 2EDDA 1HKFA 1JK9A 4OF0A 3S88L 4L29B 2XDHA 1IAIM 2ZF9A 3UPCA 1D6EA 1ZGLA 4N2HA 1W72A 5GGQL 1KIRA 3LOWA 1AMYA 1R5WA 3C8KB 3UC2A 4XVTH 5IOPA 4CSPA 1F3JA 1CI3M 4K3JH 4LLMB 4KU1A 4R96A 2NZ1A 3U2SB 3VYNA 3O3UN 4CDGC 1YEIL 3IK2A 2JJTC 4NO0A 3AXLB 2CDFB 1V3MA 2MNUA 2R2BB 1MHHA 3NIGE 5EZIH 5DFTA 3DV6B 4QRPE 1Q9KB 2WQXA 5IQ7L 3RE0A 4BYHA 1YAIA 2FJGB 3VH8A 1U8IA 2DLHA 2IANB 4ZODA 2VLJD 3RWGB 1A7QL 5MENB 4RCAA 4M6MH 4YHPB 5EU3A 1NDGB 4TQIA 1X5FA 3JVFC 1WIOA 2APFA 1QKZL 1FLRH 4TNGA 2Q10A 3T77B 1BZ7A 3MLSH 2DMKA 4GUPA 1EZSA 3QHFL 3NCBB 3OWEA 4RMVA 4TLKA 4F7EB 2R2CA 1RIVL 3KLAA 4JO1L 1G43A 4EDXB 1DQJA 5FW8A 1ESOA 4AC4A 4X6FA 1OIOA 3KYMA 4UDTB 4AZ8B 3MRNB 1MJ8H 1QWNA 2JMRA 2FVNA 5DEGA 3IGFA 4X4MA 4UT9A 2ZP8A 5K9JH 2EEBA 3PHQB 2GBUA 1WBXA 3BPOB 3O45B 1LE5B 4OKVB 4MQ7A 2J8UA 1I3GL 1WCQA 2NNAA 1AGEA 3KVQA 3MJGX 4FL4B 2F54B 3CFMA 4JG1L 1G7QA 4M1DH 3AB0B 4WDIB 4IRSD 4ZMQA 4HZAA 2DLEA 4TN9A 2Q6WB 4JM2C 4A7VA 2DW5A 4JFXB 5BJTA 1BF5A 1ONQB 3E0GA 2DQ6A 4QHLA 3U6XA 4MJ6A 4XNZB 1H3PL 3LXBA 1TSHA 4FKHA 3QARA 5KVMC 3JT2A 2C3XA 2J20A 2N56A 1CGSL 4LRIA 3FT4A 4GFXA 3ULUD 2W88A 1GS7A 2EDXA 2XIIA 4GIPD 3SQOL 1A6AB 3RVUC 1HH6B 2QQNH 5GS1A 4LPVA 5F7MC 4KK5C 1NFIA 2IOOA 2CK0H 4ZAKA 3ECBB 3V6FA 2IPTL 3TX4A 4B0MM 5CEXB 4JQIH 5I26A 2WCGA 1KACB 1P5UC 4LB8A 5IMKA 2E7LA 3MACH 3MLXH 3KPOA 2VDOB 5E51A 1RPKA 2C9QA 2O6FA 3SO5A 2B1AL 1FCCA 3CZUB 4FLOA 4FKEA 2NT0A 4K73A 4GKNB 1XXFC 1HYSC 2D0GA 4UINL 3MI6A 4NOBA 5ABDE 2G0LA 4AV5A 3UEQA 4MCZA 1N8OE 2DD8L 1NCCH 5D7SH 4JS7A 4M1CD 3V5DA 1KGIA 4AL8C 1CFSA 4N2FA 3QI9C 1MHEB 2OV0A 4PCSA 2OSWA 3CMOH 4NKDB 3J07A 5C8JB 4KKRA 1LL1A 4L8BB 4NHUB 4H8WC 2OMWB 2R4SL 4QGYA 1E4KA 4ADGA 4GRLA 4HCRA 3MV9E 1HILB 4OF3A 1GAFH 1P7QB 4FXGB 3PWPE 4WV1A 5EF0A 12E8H 1UA6H 2QQLL 3D39B 3F7RA 5AZ2L 3KWXA 2KL6A 1T80A 4WI8A 3S35L 1D5MB 3NCWA 4DKFH 3ULUF 1TO5A 2VLRA 3U83A 5AW3B 5E24E 4KX9A 4GW4A 2WQVA 4P5SA 2LFEA 4TNFA 1F41A 4NZUH 3KLSA 3Q3GB 1DQMH 1R17A 4L1LA 3WN5C 1IBZA 5DMIL 5KVGE 5CZVH 4W9HC 4ZW8A 4ZDHB 4KTEH 5LBGA 4XXDA 1A3RH 1COBA 3BWAB 2Y7OA 3BYTA 5DR5H 4Z7OF 3O6FA 3EYUL 3E2HB 1WD8A 4TLSA 2JKJA 4O58L 5M95B 1SM3H 2C9PA 3NJXA 5EWIL 2K6YA 1GC1C 1BD2E 1QSVA 5EU6E 4IOFC 4HGWB 1GYUA 2WWKO 5JQIB 3TV8A 2ICWB 2X70A 4JMXA 3VYOA 4OKDA 2BNQE 1J1PH 3DHMA 4CVZB 3FS9A 4D7BA 4DCQA 1CFNB 2W38A 5C7XH 3FH7A 1UWXK 3WEBA 3ZTNL 2YXWA 2ESVD 3NZUA 3M17A 2Z91A 1E3XA 2PCPB 4HHAB 4IGBB 5BZDA 1JZHA 4DERA 4I4WA 1QP1A 4XMLL 4GXVH 4V1DD 5TQ0H 1GZPB 1M3JA 4FLQA 3VW3H 2C4FT 4RH4A 4I3RL 1XD1A 4LMQE 5FF6B 3ZMEA 1U3YA 1F6FB 2AI0L 5TE7H 5ITBL 4QOKB 2R9HC 3GGWB 5GGVY 3OKLB 4HS6A 5GRJL 3STLB 4ZNEE 5HYSB 2K45A 4PLJD 3B1UA 3V0IA 1U8OB 3VB8A 5EIIA 2MTPA 3KDMB 2GI0A 1N7ML 3RKDC 2OW7A 2XX0A 3Q2WA 2JIXD 1U8JA 2NY6D 3FO2B 4ZMPA 5A7BA 1JS4A 1KB5H 3A4AA 1A7PL 2IDUA 3N1QC 3IDXH 2NY4D 5JW5B 5J6GA 1Q0YL 3KWWB 2WNWA 4UM8A 2YKLL 2UXTA 3VTAA 2H0JA 3CPLA 3RDTB 2XZQH 4NZFA 3S36H 4AI7A 1JZ7A 4YDLB 3JVGA 3P4OA 5AVSB 5E8EA 5CN3A 5IJKC 3ARBB 4HT1H 1INDL 3BUPA 2CRIA 3QDGA 5FUCC 2R0LH 3FCBA 3UGUA 3VXRE 5DJ6A 2I7SA 2CLRA 4OFYA 2LTQB 1WFIA 3PWPA 1CS6A 1I7ZB 4F27A 4L4TA 5T3XH 1MFCH 2X2YA 5HI4C 2NUTB 2EZ0D 1MNUH 5KYXA 3HR5A 1LDSA 3T1FB 3CXFA 4D7PA 4HZLB 4MWFA 4YDIH 1BCIA 4HF5H 3ZIMA 2NLJB 2YD6A 4LDEB 5DHYA 1JGVH 3P54A 3ARDC 4LCIH 1O75A 3B37A 3FF8A 3N42B 4B9YA 3PQYB 2L3BA 1RIHL 4GW1A 2HKFL 1JF1B 3ZDWA 3CNKA 2VN4A 1PFOA 3Q43A 1PZSA 4YO0B 2ITFA 3IN2A 2ICWI 2H32B 4HHWA 2YZ1A 1J8RA 5D72H 3TWCH 1EANA 3MX0A 4PGEB 4PGBA 1D9KC 5DHVH 2GUOB 1M2VB 3NCYP 4FQLH 3FFCD 3ML8A 3CTTA 5EU6A 3W0WE 2K3TA 4PV8A 1O7VA 1F58H 2OJZH 2CRYA 2WVVB 2DIEA 2QJDA 4P99A 2ZKYA 2CSPA 2V5TA 3BI9X 4X9BA 2AQTA 2APBA 3VI4E 4WJKB 2EECA 4APXB 3UX9B 5CZXD 1HHKB 3M1BA 5C0IA 4C4KO 3I2CL 1NM9A 4N2EA 3FFOA 4OM1H 4L4JA 3ZL4L 1W0WB 3HNSL 4OBSA 4DK3A 2K4AA 1RHHB 1OHZA 4D3CH 1D7CA 1EXGA 5F9WC 3QZPA 1TQCC 1AGCA 3U1SL 4UDUA 3AJ7A 4KI5E 3CXDL 4OLEA 4KTDL 4BK8A 4MHHI 4ZNEA 1NANH 5D7JB 3P02A 4FTVE 4BWTA 1CGVA 1VPOL 3GM0A 3MNZA 5TJWK 4LK4A 5EZOH 1HDMB 1JTOA 2J5LC 3QR2A 4XXCA 1YCSA 2ZTBA 1BQUA 4MRCA 1O7DC 4KC3B 3HS0A 1L0YA 2F1AA 3DXAE 2AAAA 3ECVA 3RTQB 1OB0A 1MY5A 4F8QA 4HUNB 1DLFH 4UYPA 2CR0A 4OJCA 3I6LE 4D8PB 4DN3H 4GG6B 2PYED 3BVNB 2IH3A 3LYRA 4FLSA 4XPHL 1T83C 4Y5YC 3TA3D 3L3OB 3QFJE 5D1ZC 4FTDA 4KGLA 2VR8A 5FYKU 5EPMA 4PI2A 2A77H 3U7YH 2HLFD 4EXPX 4Z7WB 4IJ3C 1QLRA 4YWGL 2PW2B 3EF4A 2BJML 4JPIA 2WXMA 4MXWH 4JRYE 3ZT5A 3K6OA 3OXRA 1HCZA 5AALA 5HXMA 1MVUA 2FX7L 3MBXH 1OTSC 4PVBA 1F2QA 4DP2X 4QJ5B 1HJBC 3VXRA 5ESAA 1G7LA 3KVPA 4JJOA 2ICCA 3BDYH 5A40E 1FNEB 3BDXA 1U41A 4R26H 3QULA 4YGVA 5FCSH 2JB5L 3A4FA 4ZW7A 1DBBL 1DP0A 1G7PB 2YD3A 5DI8A 3HI1B 3REWB 3ZMRA 4HEME 5IFHL 3Q6GL 1CG9A 2EEFA 3OF6A 1LWJA 1EDQA 4TUOA 3ZYIA 1ADQA 1CDHA 2UZYB 3K2IA 3PXHA 1OAKH 1JUFB 2QVKA 3ZGHA 2EH8H 3DK0A 3ARRA 5IM7A 4ICXA 5EA0H 4ONOA 3S97C 1UOKA 1Z5YD 1Z1WA 1MCQA 1J5DA 3GXTA 1XMWA 3C8HA 3AS2A 1ZXKA 5CLTA 5CCKH 3CC1A 4Y5VB 1DJHA 4YX2L 4Z78A 4NXSA 4JPQA 1TZGL 1T2XA 3DRTB 4F15C 4UQBA 4L0PB 1J05A 2WIIA 2OZ4A 3L48A 1KIUA 2QT6A 4ZXBB 5BV7H 4PS7A 5CJOH 1KGWA 3LNIA 4PRID 2VR7A 1W0VA 4AUYA 4ODBD 4ZUSB 2ZUYA 5EU4A 4W93A 1FO0H 1NJ9B 1S5IL 3DI3B 1PZ5A 4ZS6C 2PTUA 4GAFB 3W0WA 4D0DA 1RVFL 4L9LC 3MO1B 3C60A 4HJ0C 2YAPA 1MVYA 1OD9A 1E9OB 4P4KC 3FUMA 2KDYA 4RDQG 2FUTA 2W92A 1RZJL 3VD7A 2AEIT 4YDMA 2GTZB 3NJMA 3VI3F 2PABA 1PZBA 1FVDA 3WEXB 1QFWL 2XQBL 2GAZB 4GXUM 5ETUB 2GJPA 2YRBA 3MGTA 2OYPA 5I1CL 1CF8H 2BVQA 2XVGA 5CGMA 1P4BL 3IU3B 1C16A 3CU1A 2Z7UA 3AADB 5AEAA 1IX2A 2VZ3A 4GP4B 5DUPL 2OPCA 4EN3D 2YSTA 4P59L 2QFPA 3U0TB 5TGBB 5JPMC 5D7LE 1R9FA 2VDMH 3IDJB 2H2PC 3UYPA 4ELKA 1KG0B 2JELL 1QLEL 3X1GA 1AZUA 1A7RL 2ZKHH 4FJ6A 1LMIA 1SNRA 3DX8B 3EUDA 4QJ3B 4P3CH 1AC0A 2XKNA 4RAVA 5GS2D 1L4IA 4Z7NB 4Z7AA 1RERA 2EE6A 5D6DC 4ELMB 3OKYA 2NY3B 3DXAA 4L4VB 1E8XA 3R0NA 2JI2A 2O6EA 1UGKA 2VLKE 3FQTA 3QJSB 2LV4A 4U49A 1PKQB 4DEUA 1L6ZA 3WUZA 3SO3B 4IU3A 4KXCA 2VIRA 4TF4A 5LKNA 3L9RA 2UVEA 4G8EB 1GW6A 1GHFH 2CRZA 3IN0A 4NQEB 4WKZA 3QFJA 1PZUB 1FG2B 1ORSB 4NQCE 1KPUB 3F01A 1NFDF 1XH3B 3HC0A 1MCJA 3FT9A 1J1OH 1TOXA 5FYJD 4MNHA 1SQMA 3EGDB 3D9AH 4UYQA 4TOYH 5JHBA 3II2A 4JRYA 3UABA 1A2YA 3JV4B 4UTBL 3RG1C 4Y0GA 1BJ8A 3CD4A 3D3VE 1L0PA 1T6VN 5CUSH 3FSOA 4G5ZH 4MAYD 7CGTA 1M56B 3JTTA 4G8GB 4U3SB 1UUSA 1RQ5A 5IHZA 4QRUA 4TVUA 3KLDA 2OBGA 1QNZH 4RMUA 3QQ3B 5C07D 3VCLA 2BHUA 4G6MH 1MFUA 3X1NA 1MELA 1M42A 2JQZA 2X2HA 1Z32X 1GC1L 4W81A 3SYOA 2F5BH 1RUML 2R2HB 4XP4L 5DMJB 3SE4C 3TTSA 4LOVA 4DP9X 3WTVA 3KCPB 1XR9A 1F8TH 3TT3L 5IGXL 3P0GB 4JREB 4X83A 4JX0A 4RZCB 3ZKMC 2BZCA 1SF3A 4ZTPL 1IT9H 4ZTOL 1YEHH 4GBXA 6PCYA 3H9SE 5C0CD 2WXQA 1USZA 3EYOA 3SQBA 5D2NE 1OANA 4JFED 2WBXA 4FMFA 3FU7B 4HPYL 3TGXA 1QBLH 3VDCA 1CR9L 2VW6A 3WE1A 1R5VB 3FQYA 1NDMA 3ARED 1I8UA 3V5HB 2HVJA 4J5VA 3VUAA 3B4NA 5E2TL 2RA1A 2OKMA 2EE0A 3C5ZC 3MUZ1 3QUYC 1DSFL 1U93B 2KQNA 2G60H 3FN0L 5FA4B 1DVQA 2W94A 2DBLH 1OCZB 4JFDB 2WLJA 4LBAA 5DA4A 3V5KA 3D09A 3GPSA 2EEDA 2P26A 3QEQE 3I02A 2BVPB 3KW8A 5J1AA 1ZV2A 4JJ5A 1LMKA 3NMEA 3GLDA 1ZVHA 1YUHB 1W8NA 4FQCH 1PEWA 4LSVH 4P46C 3AUVA 3DETC 3MXWH 2G2PA 4PS3A 4X9GA 3EOAB 3FBQA 4QLWA 3O6LL 5KOMC 2ZXAA 3MTXA 4O5LH 1ZGLM 3WNNA 2F0CA 1XSOA 1KYFA 3ILQC 3LIZL 1EFXB 4JPKL 2YUWA 3L1OL 3O11A 3EOTL 1K2DA 4FQ2L 1A4CA 1FE8L 1OV8A 2AKRA 3IXTB 1IIIA 5KG9A 2NR6C 4JPVH 4LNRA 3OZLA 1MJUL 3ZZSA 2Y07H 1I4FB 4TM9A 3V6OE 1RL1A 4CMMB 4F9LC 2EUWA 1MAKA 1E7VA 4EQ3A 3U9UB 5HYSG 2VLKA 1RULL 5D1QC 4ZTEA 5TDOB 2FWOA 1HHHB 4ZK8A 3TWYA 3HS8A 3T0BA 1ZKAA 3RWEA 3SPIA 3R0MA 2X3CA 1FVEA 3SODB 4GSUA 4NQCA 5DYFA 3OKEB 2AEQH 4OT1H 2NW3A 3RGHA 2DQFA 3HTLX 2OYLA 5F3BA 2DJUA 3C9NB 2EE2A 4H20H 3GJFK 3BH9A 4M5TA 5A6LA 3AS0A 3OKDA 4HCFA 3GJFA 3SGKA 2I5YL 3D3VA 3LY6A 1WP6A 2YLHA 3QUXB 4N1EA 1BFTA 2PP8A 3SYQA 3T3PF 1J7VR 1SLXA 1TVBB 1L9QA 4KWUA 2EE9A 3POCA 1OGSA 4HJTA 3NBNA 4TUKL 1NIAA 3NEEA 5CMAB 4OQTA 1PAZA 1HHIB 4PJ8A 1IAOB 4J3OG 3BZ4A 3GUTA 5EBLA 4Q56A 4LLUA 5DJ2A 1F11A 1BF2A 3K6FA 5CS7A 5JW4N 2BVUA 1HAUA 3I6GA 2AQ1A 2ED9A 1DEEA 4OLXL 4UT6A 4OLYL 2X53A 1JZFA 3FB6A 1BMWA 1E4HA 4PJHB 2CK2A 4KHTL 1KCBA 1X9RA 2FIKB 3MOBH 2FO1A 5E2JA 1DSYA 4JKPL 1XCXA 2QQKL 3WNIA 4ZO6A 3Q8FA 2GK0B 3WIHL 5GZND 1YA5A 3L5XL 4XGZA 3QORB 1YY8B 3D52A 3BAXA 2NNXA 2X89D 3JTBA 4FN0A 3QEQA 4F7PA 2VC2L 2AXGA 3MYJB 1H8LA 3RWCB 1JXGA 1KCUH 3V2AR 2IIJA 1I3UA 3IMRA 4MVBC 5B22A 2VSDA 1LEKB 5DC0A 3S48A 2P5WD 3VACA 4FERA 3LQMA 2PPAA 2EIMB 3HB3D 2JSFA 5T5NF 1G0YR 5HGBB 4ZNCD 1CDUA 1FFPB 3UBGA 5L8LB 3OKNB 3NFNA 1NCJA 2OLDA 4LEBA 4Y9FA 3I9GH 1GJUA 1KJMB 1N0XH 4XE5B 3TP4A 4DF9A 1XSKA 3WIAA 3VMPA 3LZRA 3QH3A 4EMZA 4LLVA 4O9HL 3QJHB 2WD0A 35C8L 1VACA 3MRLA 4FULA 3V6OA 2VDKL 3PFQA 5I18H 1M6UA 4JDEB 2VXSH 3TU6A 3VXME 3IJSA 4NKOA 2I32A 2BM3A 2XYBA 1Z9PA 3PAZA 5E5LA 4U2YA 4PGCA 3ZE1E 4YDNA 3QWOA 2AXJA 4J2QA 4KROC 3HG1D 5EZJA 3UTTB 5A2AA 1KGUA 4XO9A 1BWMA 3I9AA 4OCSH 2CQVA 3VFMB 3RU8L 2ENSA 1TTGA 3B2MA 3CQPA 1B2WH 5INCA 3Q9PA 5K1VA 3BRDA 2Q76A 5D4JA 3UJTH 2FJHA 3VWJC 3WJLA 4FFYH 1J0IA 2DL9A 4RBPH 1KDIA 3QO0B 1FBIH 5A6IA 5MEQB 4MSWB 1NBCA 3PU7A 5KBLA 4DP7X 1F4XH 3BPCA 2BRRL 1UUNA 2O6PA 5C09E 1S9YB 5E6ZA 1QAWA 3D7PA 1LEGB 4PJDE 2BSCA 4OJFH 5CHNA 2A9MH 2FBRA 4YE4L 5E4OA 3HHSA 3IFOB 1JV5B 1CZ8L 3QZMA 4AH2A 1MW3A 5SX5K 3E6HB 5CIPB 3KGTA 1PX8A 4MRBA 4F8OA 3FF7A 4ZZFA 3B7SA 2Y36L 2XWRA 4QAMB 3LMJL 3RNKB 2V8LA 1ACXA 4HIIB 5IBTH 2BSRB 3H85A 5FV2A 1QI5A 5I1AA 1AZZC 2ZSVB 2UX6A 1QEWB 3T0EC 4MJID 5DS2A 3NCYS 4G7YL 2GT9B 4E2OA 3UYOD 1NC2D 2CNZA 1GGBL 1MH5B 2KERA 2HKHL 5L9DL 3EGSB 3GZQA 2C3VA 3FQWB 4H8HA 5AW5B 2HAZA 3D2UD 3DGDA 3HKZA 1R5IB 1MIML 1QTSA 2H6PB 3EXJA 3FMGL 1IGJA 4ZZKA 1YNKL 4UQ2B 5AENA 1NMBH 1R4XA 2UXGA 4YIQB 5JA9A 2R0WH 2QVMA 4S0SD 4BEIA 5E8OB 4WWOA 1I1FA 1A3LH 4HOXA 4PJCF 2ALWA 2R0KH 3AMKA 5EOQH 1I7RA 4N6RA 3VJ6A 2C9SA 5AW1B 5KBMA 4Z8FL 1NEZG 1SY6H 2PPCA 2BFVH 5DZAA 2A1WH 4M5YH 2DM7A 1FC2D 2IQAA 4HWBA 4AEIH 3EFFB 4XTRD 2WZPA 3P0YL 4L8CA 3EGXB 5EEUA 4RGND 2WQUA 2Z31D 2EC9U 2A6JA 1UCBH 4YLBA 4BKLA 4AXWA 2JKXA 1Z0MA 3QQDA 4DQOL 5BMFL 5LCVL 3NJGA 1Y1DA 2HFEA 4JPWL 4Z7UF 4E9VA 1RY7B 1GYVA 3N1GC 1YMHA 3BP5B 5D96C 1QLEB 2M83A 4S0TD 1ZGLP 1CU4L 2XV2A 3FO0L 2B59B 2YBRB 1LO2L 4E36A 3OR7A 1HXYB 1RZIB 4KZEH 3QUKA 1Z9NA 3F3HA 3ATEA 4GAJH 4HSQA 3HZYB 3GI9H 2DLTA 1GZQA 3FU8A 4LSSH 5DGRA 2WCSA 4XNYL 3PHOB 5IMLA 1J8HE 4DN4H 3BJ91 2BDNH 3IDGA 4H5SA 4JE0A 3T0AA 2QSTA 2DQHH 1R1CA 3W5MA 1NWPA 2QV4A 3C08L 1HEZA 3RTLA 4AIXA 3BIKA 1ZIBA 4R90H 1Q38A 5EN2A 5D1XD 3WN5B 1NL0L 1A3QA 2O61A 4P3DB 4XNXH 3CVHA 1N12A 1FZMA 1OB1A 1UWEH 4R3SA 3HC4H 3B6SA 3P4NA 3QXDA 2WVUA 3BYYA 4PJDA 5H4YA 5IV2B 4LCCA 4G11A 1UD3A 2VISA 4NN7B 1DVUA 3P2BA 3ZKNC 3U2IA 1XAKA 3AAZB 4AYSA 1G0XA 5IB5A 1C08B 3EJZD 3K8KA 1FL3A 3DV4B 3DWTA 5ERWA 1TQVA 2GY5A 4Q58C 4F8NA 1N0LB 2D31A 5KANG 3TO4C 5IJVA 1B4TA 4YHZH 5GS2H 1RJCA 4U4IA 3AFLA 4IKKA 3SGDI 3MV7D 1LWRA 1M71A 3ASWA 1OCWL 4H25B 1TYJA 4XBEL 5D7IF 4DVBB 2H5UA 1KEGL 2XWBB 3DUSB 1LO5A 4HWEH 1XVSA 4NAQA 4MDIA 3W81A 1CGUA 5I1KH 1PDKA 3MLPA 4KQ3L 4P2OC 1R34A 3ABKB 4H7VA 5EO9B 4BJLA 3TM6A 1E4WL 4XODA 1JVOA 1FIGL 5EOCJ 4L48A 3B2PA 1L7IL 1NGWB 5IUCA 3N2JA 1MI5D 1X5YA 2WCPA 4RSYA 5CZRA 2OXHA 3O81A 4LPUA 3S2CA 1MFVA 3ISWA 4WUUB 2NY0B 3ZDYE 3EJUA 3RQ3A 2VITA 5CNHA 4HZ1A 5HDWA 4Q6YA 4ODSH 2OFQA 4HGMA 4WWID 2VRKA 3RZCA 2GW5A 3EH3B 2R29H 3V8CA 4LKCA 3WO3B 5FLUA 4FQJL 4ONHA 3X3FL 2FCBA 2D7PA 2HTLC 3CFCL 4EAEA 4ZRGA 2VLLA 3HA0A 5LNEA 4P05A 3UJIL 3WFHB 43C9A 4MNGB 3RIKA 4YXKL 2CBOA 3E80A 2ZP0T 4IEFB 4YSEA 1NIDA 2UZXA 3EYSL 5DUMH 1I3RB 1U0QA 3MJ7A 3W9EB 5HDBB 5CEYB 1FYTD 1I7TB 2A6IB 3R7QA 3KBFA 3KLKA 1OAUH 2C3HA 4GNKB 1H15A 5CR8A 3IKCA 3ZIYA 4YSAA 1IAIL 5A2IH 3EFDH 3AITA 3CDGB 1K3ZA 1JPGA 3ISRA 4F57L 1TMQA 4QYAA 3GNML 1IGCL 4OU3A 1WISA 4URKA 5T3ZE 3PJSB 4AYBA 3PV6A 4G1MA 3D34A 1KZYA 4X8JB 1L9NA 1DUYA 1JTTA 3GHBL 4GP5B 3B9VA 5AOZA 3HE6D 4PRHB 3V0HA 3O6KH 2WSKA 2WHVA 1KCLA 3KPPA 4KXDA 2PP7A 5DO8A 1J8HA 3NFSH 1SYSB 3L3DB 5I1GH 3UAJA 1XQ4A 5FB8B 3A67L 3TBSB 1NAML 4LLDA 4PSPA 4WEBH 3TEZA 2YLKA 1T0NB 1ZSDA 2QPUA 4EI5D 5DYOB 1XF4B 1G84A 1D5XA 3UBFA 3ARDB 3STZB 3L2MA 3V55A 5KS9A 5JO5B 1NAKH 2VLME 4UT7L 1OSPH 2RFXB 5K1JA 1UWGL 2ZOTA 4HUKB 5J6HA 3VQ2C 4HIHB 1OZTG 4PJIB 1D7BA 1AD0A 2ZT9C 4IBUA 4RAHA 8FABA 3D69B 3DX7A 1D9KB 4M7LT 5FO8A 1TTAA 3D33A 2OMUB 1VZIA 2R1YB 4UTAA 4B9IA 1DZBA 4RQQA 4K5OA 3NCEB 5E1QA 2CPCA 3T2NL 3WS3B 1TTRA 3MKGA 5ABZA 3NIDB 4GLRH 3VFNB 5J06A 1JV2B 3FT0A 3BE1L 1X5ZA 4JN1H 3QG6A 4YK4C 4DZBA 5KVFL 4LOUD 3MV11 4N2BA 1VFMA 2ZX5A 4M5ZL 4E0RA 2YA0A 2B3RA 4LHUD 4KKLC 3VFPB 2BS8A 1WUNT 2AJXH 1XF3A 1A9VA 5JHAA 4G9FD 1SJHB 3Q2LA 2XC8A 4UU9A 1T22B 2JKNA 4DZ8A 3MRMB 1WZMA 3E1F1 4TNVK 5F9WB 3UZQB 2M2DA 1TQCB 1MAMH 3CU7A 2VDPL 1ECYA 2ZCLL 5C0GA 5IKCB 4FG2A 4GAYB 4BQ9A 3CQFA 1IEBA 3B7UX 5CSZB 3ZKSD 1MCNA 1ZXQA 3QCTL 5IG7A 2WBJC 3HMWH 3CLWA 2HFGH 1YQVH 1QSFE 5GSVA 2J5LB 5DFVC 3VFUA 2UWEB 2Y7SA 2Q87A 3U4BL 4ODVL 2VL5A 3S7GA 3T4AB 2IGTA 2VMDA 4N0UB 1EEZB 1I1YB 4XRCB 1S4IA 4MMXC 2APXA 2EE3A 5SWSD 3DNKA 4ZO7A 1I8LC 4Y5YB 1TKWB 3TF7C 1KXVC 4JANB 1GY2A 2DEYX 4FCAA 1M57B 1F13A 2ZAGA 4GRWE 3BP4A 5I1EH 5ID0B 4IJ3B 3CAFA 3VE0A 3VI3B 4A55A 3Q7JA 2ADGA 5JZ7D 2OSXA 1FG9C 5HGHB 2BZDA 2DTML 4RETB 3GMMB 3SPVB 2ORBL 4P23C 5BVJB 3PS6A 2W65A 4WGVB 4FQIH 4APQC 3D06A 2X88A 4NUJA 3WIFA 3MNDA 1UD4A 4PJFF 1S7TA 2HLAB 3PP4L 4FEIA 4FP8L 2I24N 1ZK5A 5FC9A 1V7NH 2PWGA 2FO8A 1AZBA 2WUBH 3MRJB 1SUJA 4N25A 2FEDC 5TE6H 1JVLA 5JLZA 4PG9B 2GC7C 4Y19B 3LKPA 3FXIC 1Q0XL 1ZLEA 3GXIA 4YHNA 3O3BA 1NC4A 1UJTA 1RU9H 3FRPA 5DT1H 2IANE 1UZ6F 1BZ8A 5MENE 4PJ5A 1SJMA 2BFGA 4L5FE 5DDHA 3FPXA 1IUZA 1SZNA 1S7RB 5L0QC 1U92B 2ZF8A 4MJ4A 1ZJAA 4JGUA 2NYKA 2WMPA 4F15B 2D7MA 5BVPL 4EOWL 5GRUL 3TNNB 2PXYA 5DLML 2EINB 3QQ4B 1OTUC 3ZO0A 1KEMH 5D5MA 4OIBA 4QRSA 1C5CL 2VAAB 4Z7QF 4L9LB 1ZD6A 1H3UA 1AGBA 1F3DH 2V17H 4Z0BH 4P4KB 1DQQB 3F65A 3QC5X 3DVNA 5F96L 3PNWB 4O2EB 5JPNA 2F54E 4MNQB 1SJEB 6FABL 1ZMYA 3KPNB 3RI5K 3QDJB 2Y3NA 1R3JA 2ZD0A 2KLSA 4F7MA 2CKBB 3MUJA 2PWFA 1T89A 4I2XB 3WGUB 3QIBA 1PD1A 3ARFC 4L37A 4M6ML 4KKCC 3SDCC 4O2CB 4AJWA 1FLRL 5AVYB 1WF5A 1EHKB 2QZQA 4Y16D 3RGVA 2WLMA 1CDJA 3MRPA 1BLNB 2JJSA 1MFDH 1HHJB 1YYLH 2WK2A 1A8ZA 5LBVA 4POYA 3PIQB 2QHRL 3OR6B 2R15A 5I23A 4JZOB 2Y06L 3MV8D 5CGBA 5CJQL 1QSFA 2AF2A 5KYUA 1YNTA 5FKAB 3VA6A 1VGKA 2VDQL 3RVTD 3MMEB 4KVPA 1R3IL 3KXFD 5D1ZI 4W9CC 4EI6A 4G7QB 2A4CA 5G2NA 4C57C 4FNPA 1BVKB 3FCSB 5B21A 5EORL 1GR7A 4XI5C 2YEZA 1DN0A 1T7YA 2G9HB 3VD2A 1HI6A 3FU0A 1B0GA 3GBDA 3ZZLA 2CCWA 5BV7C 3H42L 3FQRA 4RFOL 2PF6A 2XPGB 1HFUA 2P46B 3F05A 5CXPA 3SCMA 1TO4A 3VGFA 4KMTL 2B1HL 2DLGA 3UC0L 4L29A 2GJRA 2AFNA 1OGAE 2E74C 1LE9B 2QQNL 4JFOB 5IHUH 1JCVA 3A6OA 4IDJH 3C8KA 5JXEC 2DOCA 4OTXH 1U91A 4NO0D 4LLMA 2VM9A 4OUUB 3MCLL 3U2SA 1XTMA 4J4PD 4OGXL 1BVOA 3ZBMA 1QOKA 4XP6L 3OMIB 3F64A 4F9PC 1NM4A 3AXLA 2CDFA 2AJVH 2OR8A 4HC1A 2R2BA 3NGBB 4ZD3H 4HOMA 1TG8A 1EO8H 3HAEB 4BH8B 3DV6A 1EZVX 1Q9KA 1UD6A 1UXLA 4NOFA 4EO5A 4XOCA 2FJGA 2IANA 5C6TH 3T8MA 3RWGA 5MENA 3NSDA 3HOGA 1NDGA 3P2DA 1AI1H 3T77A 5D7SL 1B4JL 1J86A 2YEVB 5C0NC 3GI8L 4ELDA 2N1TE 5IFAH 1TJHH 4OLWH 2F5AH 4B9JA 1CL7L 2X9YA 3GBMH 3K1DA 2F9BT 4NM8H 3KLHC 2AJSL 5FW6A 3DI2B 4R5XA 3ROOB 3VMNA 4EDXA 5LGJB 5LXGH 4FNSA 4UDTA 1LDPH 4AZ8A 3MRNA 3HLAB 1H9DA 2GPZA 2EKSB 4J39A 4RMSA 12E8L 2AS5M 2AJUL 1UYWH 3L1GA 4YDKL 3PHQA 1BQLH 4UNIA 2WYHA 4R9HA 2H7WA 3BESR 3O45A 5KVDE 3KNBB 1LE5A 1GOFA 4OKVA 3L5HA 5LNDA 2MPAL 3P11H 5DWUL 4ETYA 3TIEB 4KRPD 2F54A 2EC9T 3OAZK 3US0A 4E9TA 1G9MH 1QVOB 6TAAA 4WDIA 1LYQA 2YQBA 5I5IA 1UATA 5IB3B 3F6LA 4DK6A 2EDKA 4L1BA 2FQDA 3HNVH 1ONQA 1ID2A 4P46B 5GISH 4GT7A 2DYRB 3C5SB 1E4XI 1L0XA 3EJCA 3FOMB 2ENPA 4H13C 4X4ZA 4HMEA 2ICEB 5SV4A 4KJYB 4W9FC 4R0LB 4ZAKD 1CF1A 5E2UH 3L9EA 4CVUA 2VMCA 2FJSA 2J8OA 3GKWH 2B39A 1HH6A 4HH9B 4QOKE 5CILH 4MDRA 1SM3L 3ECBA 1C7SA 2CO7B 4P0DA 4A67A 3LS4H 2P9RA 5CEXA 5I28A 3IPFA 5EO1B 5B38G 3H6AA 1WA1X 5FYKL 2RHEA 2E46A 2FBJH 2CWRA 3O2DL 4A7GA 2PR9A 1UWFA 1NGYB 4XCNB 2CGRH 2DQEH 4ODUB 1FNHA 5IBUB 2XTJD 3H3PL 3MJ9L 4JRXA 4QRFA 4A7SA 3T4YB 5D55A 4NXKA 4X6CE 3NN8B 4UV4L 4GKNA 4XOEA 2OTWB 1ZT1B 5DD0L 2I60L 1BEYH 1MCKA 2X05A 2NXYD 1QNIA 3GSUA 3SDYH 3EO9H 2LHAA 3O4LB 2Z3FA 4MA1C 1MHEA 5EUOE 4DNLA 4GRLD 1P1ZB 4NKDA 4U1HB 1ZHBB 5C8JA 4PVNA 4L8BA 4NHUA 5EBWB 2OMWA 4NX0A 4M1CC 3VO0A 1HILA 3IF1B 1P7QA 4FXGA 5JMOC 2VLRD 5LO7A 3DK2A 3D39A 5IJDC 4NRYB 5C6WH 1D5MA 4UIMB 1HWHB 2ZP9A 3WHXB 5MEOB 2UYLB 4KY1H 3Q3GA 4B7IA 3C2AH 1MEXH 2J1XA 1HIMH 3UG5A 1H8OA 3ARWA 3PQYE 3EYVB 4XAKE 3PGFL 1KTBA 4ZDHA 3MLVL 1NAMB 4ERSL 4KKAD 3OJDA 3O6FD 3NABL 5LQBL 3EJYC 4M5SA 3BWAA 2Q3XA 3A6CH 1YNLL 1A14L 3MCYA 1CT8B 2R0LL 5I5RA 2Z8RA 3PGCB 1K4DB 1XGYL 3MGAA 4FYSA 2Q3AA 1NBVL 4NGHH 1N3NB 2WKLA 3GRBA 1G7IB 2X4OB 3GSNB 4HKJB 4ODHL 4GI8A 2O93L 1U36A 1JXFA 3TCXA 5T3XL 2F58H 4QXGH 4HGWA 2J88H 1YY9D 2OX5B 2NXZD 3RYMA 3C87A 3WSQH 2C26A 2WOBA 4WO4B 2ICWA 4JL1A 2V2XB 3HZ3A 1MNUL 1N19A 4HEPG 2IPKB 5T33L 1CFNA 2R69H 2Z1PA 2WY3B 4G5AA 1JGVL 2B1OA 4LCIL 3SZ6A 4F80A 4XWGH 2PCPA 1AR2A 2VUOA 1E28B 3NIGF 4HHAA 4IGBA 1N59B 3HJ0A 3AABA 5F7NC 1GZPA 5D4QA 1X5XA 2VABB 2WGNB 5FYLL 5HHOA 1D6VH 5FF6A 4C4BA 4OR1A 5I6NA 5LGHH 3GGWA 3OKLA 4L8DA 3LH9A 3STLA 5HYSA 1VDGA 4XB3A 2V2TB 1U8OA 4NENA 3QZLA 1WAEA 3QJRB 5HHQB 5FGBA 1A1OB 4BHUI 3LPWA 2IBGA 5ECGA 3RVXD 3FO2A 3GLZA 4PLJC 3B9DA 7FABH 4G1EB 4KROB 3KWWA 1A7OH 1OCRB 1U8QB 2CO1A 3PXJA 4GG6E 2D8KA 4AENB 3UO8B 3UAEA 4XT1C 3SE3A 3RDTA 1FGNH 1JFQH 2J1YA 1LO3H 3C6EA 3QDGD 1KBGH 2HX8A 4YFLI 3SJVB 4IRZL 3U25A 2ZUVA 3K6NA 4A6YL 4RA3A 3ARBA 5DZ9A 2UXVA 2WN2A 2W9EL 3VWJB 4OFYD 1J5OL 2DRUA 3PWPD 3G6AB 4L4TD 4HSCX 2WLNA 3FUFA 4PJCB 1T66D 3WU1A 4HK0B 5EZOL 4MBRA 2OCJA 4LKXB 1I7ZA 3FO9B 5E03A 3WMSA 4N5UA 3GYRA 2FLBT 2NUTA 3B7RL 1JGUH 4UB0L 2VCOA 3T9WA 3X3GH 2LU7A 3H56A 5K9QG 2F1BA 2BSDA 4X7FC 4HLZG 3IMTA 3EO1B 2NLJA 4X4XB 3TOPA 5SWZE 2E7MA 2E6QA 2X4PB 1M4KA 2X2IA 3A5VA 3IS0X 2I26N 3ETBJ 1CE6B 2WSPA 4BFIB 1VB9A 1UA7A 3IB4A 4ZOBA 3U7YL 1JF1A 1SVZA 2C9XA 4NJAL 4DAGL 1HE8A 3MRHB 3NAAL 2WOYA 5ELIA 2NT1A 3H9HB 1C1EL 4YO0A 5E0QA 3T0EB 1X6NA 2M26A 2DTSA 5CP7B 5EU6D 1RZ7L 4PGEA 1SXZA 3KPMB 2GUOA 1M2VA 3IGAB 3B2UC 4S1QL 3SBQA 4QHUB 4E9WA 1S3RA 1E7UA 1GTNA 4KZDL 4KK6C 4M7LL 4NCC2 2WVVA 4PJEA 5JNYB 1N64H 1BBJA 3NSJA 1SEQL 4APXA 1H3XA 1HHKA 1LLAA 4Y4FC 1W0WA 1NH6A 2DWSA 1HYRC 3D6GA 1RHHA 3QJFB 1L0QA 1WAAA 5CZXC 4C56B 2JKRM 5AYUH 4XO8A 1D3CA 1Y18B 3QRGL 3ZHFA 1SMOA 3IFLH 5BV7L 1J0HA 3D05A 3OHMB 2DI8A 1CFVL 4R2GC 3CVCA 5F0MB 5D7JA 4I85A 1S78D 3ULVF 3ULSB 4OM0H 3V6ZB 1BGXH 2B15A 2XA8L 3IM1A 3UOAB 1BAFH 1HDMA 5IB2B 5E6YA 5IVXB 3OXSB 3SSGA 2E7DA 5I9QC 3F2LA 4Z7NE 2BXYA 1OE2A 5D7IB 2WXGA 4S1DD 1JFHA 3DBSA 4ELME 4LZKA 4L4VE 1DQIA 3EH2A 1ZEAL 3RTQA 3UZEA 1U33A 3K72B 3VGAC 1PKQE 4KBPA 4D8PA 4GG6A 3BVNA 3ESPA 3L54A 1WHPA 2QKIC 2VDQB 1G6VK 3GXFA 3L3OA 4PY8J 1PKOA 3LDBC 1WA0X 5JOEA 4LAJH 4Z7WA 2E27H 4KJPD 2PW2A 1TLKA 1SVCP 1IZJA 3V7MA 3JWOC 4XCYB 3VXRD 1MJ7H 5JQ6L 1S7VB 3B9KC 1NCAH 3TA3C 2FGZA 2VDML 1KYAA 1GZHC 2P43B 5JHDE 3SY0B 5J6SA 3IKKA 5DJXA 4EEEA 1V55B 2ZKHL 4UT9L 1BQRA 4I1RA 3OF6D 4LBEB 1FNEA 3O3DB 4G8GE 1IQWL 1G7PA 3REWA 3HI1A 4DO5A 1OO2A 2LVCA 3VGEA 3WFZA 1E6JH 1ZPLA 2UZYA 1JMZA 4U6VL 1HJCA 1JUFA 3GZKA 3L4YA 2DLFH 4IM8A 1WWBX 5TE4L 1ZDSA 4B7LA 4N8CH 5BUPA 2ZONA 2W9LA 4BWUA 1ANUA 4Y5VA 5I74C 3TO4B 2FWUA 1RFDH 3KAAA 4Y9BA 4CU6A 3DRTA 2BWIA 3CHOA 1RSYA 3KJ6L 4KNQA 1DSWA 1XSIA 3W0WD 1CTMA 1G1OA 3N5AA 3VFGL 5CUSL 3C60D 3OAYH 3SPJA 4G5ZL 4I8DA 1FZOB 1A7NL 1NJ9A 3BSGA 5EU7E 3BKCH 1DBKH 3MO1A 1HU8A 1QNZL 4KXZI 4P2OB 2XN9B 2ED7A 4G6ML 4JFDE 4K2UH 3TEXA 1E9OA 1QYGH 1FH5H 1OL0A 2WLIB 1D5ZB 2X0WA 1W72H 2ZCKL 3NDYE 5IFJB 3LZFH 2BNRE 1P2CB 2GTZA 1A1MA 1G7JB 2BC4B 1USQA 3WEXA 1MY7A 3OHXC 2GAZA 4JPSA 4CC4A 5LWYH 4DP6X 1XCQB 3OMNB 5F88B 3OLDA 3GFUA 1IT9L 5CCJA 4OD1H 3IU3A 2GCYB 5F6HI 4KI5D 4YHML 3MRKB 2CM5A 2Q20A 5J1TC 4OZIE 4YSTA 5D70L 3QZWB 4FTVD 1INEL 5EBGA 2CO3A 3U0TA 5TGBA 3QJQB 3EZJB 3IDJA 1BM3L 3KGRA 4HCRL 4IU2B 4P2QB 4Z7VE 1KG0A 3MLUL 2P49B 1IKOP 3RRQA 5D93C 3VRLF 4EN3C 3DX8A 3VQLA 4NUGL 2Z65C 5H94B 3DXAD 4ACTA 5BW7C 2NY1C 3QC6X 1FRGH 1O9ZA 2DBLL 1MCHA 2P5EB 1UFGA 2R0ZL 2YD7A 3VFSA 2XJLA 3I6LD 4U1IB 1YYMH 2Z7ZA 4ELMA 4L4VA 4IKLA 3QFJD 4U7KA 3ZDXF 1PKQA 1X9UA 1JZ4A 4GH7B 1VGEL 1HHGB 1S9XB 4HYTB 4G8EA 3N40P 4NQEA 4XNQB 3HC2A 1FG2A 4JRYD 1ORSA 3RIAF 1EMTL 1KPUA 3WGVB 5B4MC 4ZQKB 5IBUG 3QZNA 1RI8A 1XH3A 4RRPG 4FXTA 5EEZA 2ATPB 1HINL 4MA7L 3JV4A 1SJVA 5FM8A 2XKUA 3Q1SL 4GY4A 4LXFA 2CDEB 3BAKA 4XX1G 1EZUA 3QUGA 4KI5F 3GDCA 4LCUB 4G8GA 4U3SA 5EN3A 1LILA 1RK0B 4N2KA 4GI9A 4JG5A 4N2CA 4YZWA 1M7DA 4B97A 1DDHB 3QQ3A 3KPRB 4W9JC 5ACLA 1KELH 3ARGC 1BDYA 5JUEH 2EDYA 4NO2B 1NGZB 4HUCA 3W2DH 2R2HA 5T5NG 3KCPA 4GB9A 4AK1A 4ANVA 3BT0A 1TITA 2HUEA 5DQDH 4ZPVB 3RWDB 3UDWA 2N01B 1KC5L 2A74C 1R33A 4RZCA 4OGYH 3BWSA 1PSKL 5DHMC 4B3EA 5LB1A 4ETQB 5IEHB 4B5EA 2Z8SA 4AEHH 3CLEH 2EACA 5L2KE 2AHIA 3NK4A 3FU7A 4OJYA 5CWSB 5CD5C 1XL4A 4PJHE 5CCHE 1NPNA 4OLZH 4WFHD 2XN2A 5PAZA 1R5VA 2HA1A 3BUYB 5GZOA 4K23L 4YK4B 3V5HA 2UY7B 1EGJA 3A4EA 1FH2A 1FP5A 4PJFB 3HI5L 4YHKH 1U93A 3JWNH 4YHOL 5FA4A 3S2AA 2L7QA 3ZR6A 4B9CA 4JFDA 4DUXA 1SXAA 1HZHL 1TETL 1HQ4B 4GMTH 2HH0H 1BJ1J 1NOAA 2BVPA 4XZUB 5DLLA 5E99L 5K1NA 3Q05A 5IP4A 5C08B 3B8YA 4NQTA 1YUHA 4N1HB 1DHKA 4ZMLA 3BZ5A 2H1LM 1YJDL 5GRZA 2WBJB 2V6HA 2YWZA 3EOAA 1SXCA 3G5VB 5JOFB 4LP5A 3CSTA 1VFBA 4N2GA 1EFXA 4A66A 2A5UA 2Y4SA 4CU7A 1H8NA 3MOBL 3UYRH 3VXSB 3DKHA 4N2OA 1GGCL 3WUWB 2OK0H 2G4EA 3IXTA 5K9OB 1HX0A 4TULH 1BAGA 2UZIL 3VVWA 4HUVB 1LM8V 4Z1PA 1QSEB 2VLKD 5J8OA 2AEPL 1UH4A 4CMMA 4YL4A 3W11C 2K3HA 1MW2A 1OEZW 4X7SL 3U9UA 5DHVB 3HJEA 5CLYA 5TDOA 4KUZH 3ZTDC 1HHHA 2OJEB 4NQCD 2HRLA 4OZFH 3HE7B 1XGUB 4MZ2A 2BY0A 3T3MB 3UTTE 4AWJC 3BOVA 4IIQC 3ULVL 1XAUA 1OSEA 1VLXA 4KPHL 4OLUL 4P23B 2WXOA 4BE5A 3OKEA 3BUDA 4APQB 2WGXA 1ZLSL 5JXAH 1DBAH 5CU9A 2O5ZH 1UXWB 4BA0A 4K07A 4QTHB 4OQ1A 1IKFH 3C9NA 3D3VD 5GGRA 3AT0A 3ATDA 4FCHA 4I1NB 4N5ED 4WVRA 1UWXH 3GWJA 1B0IA 2VLJE 3T6VA 3VTTA 2GTQA 3QUXA 3WDIA 2NNRA 3W39B 2Q7NA 1TVBA 4AJ0A 1K4CB 4PJ8D 4A6YB 1J18A 3K4ZA 4IJTA 1F6LL 1WWCA 5CMAA 3D85D 3B3IB 1HHIA 4MCYB 5F93C 5L0QB 1IAOA 4NKMA 3HMXA 3NQIA 4Q4EA 1HL4A 3PWNB 5HJDA 5IK3B 5DMGD 1CXIA 5DJDB 3US9A 1DVFC 4JUSA 3FQUB 1K72A 5HHPB 1BVNT 4V33A 1S9VB 3QWRA 5E5MB 4JBSA 5K69A 3UJTL 1DEDA 2V0AA 4FFYL 7PAZA 1ES0A 5DVOA 2JTDA 1XZ0B 4PJHA 1KENH 2Y7QB 4HIEB 2FIKA 3OB8A 3QA3B 4HFUH 4JY5H 3THMH 2GK0A 4TL5A 2Y7LA 3QORA 1YY8A 3QEQD 4AVIA 1HSBB 3ARFB 4M61B 1FVCB 4XP5H 1YDPB 5ICZB 1U2CA 2A9ML 3RDJA 2HYMA 3MYJA 1WH0A 3RWCA 4JQXA 3MA7B 1PY9A 3QJOA 4MGXA 5F7KC 1LEKA 1D7FA 1U8HB 1FAIL 4LASL 1QFUH 2PO6B 4HAFA 2HLEB 1E6OL 2EADA 5HGBA 2GSGB 1PVHA 2QGEA 1FFPA 3OKNA 1NGQL 3I50H 4NHCH 4XN7A 1KJMA 3UIZA 1DDTA 3PP3K 5KVGH 4RNRA 2VYRE 2JB6B 4KV5F 2YD1A 3E6FB 5DS8B 5GGSB 3IGUA 3JWOL 2KZWA 4DGVH 4K7FB 1T1XB 1EJ8A 3DPBA 3L1EA 5I30H 3FL7A 5HD8D 3QJHA 5I76B 5L2JB 1JGIA 1ZGLB 1M1SA 1ZCRA 2VUKA 2N3JA 5FA3B 5BV7B 4JDEA 3Q2CA 4UIKH 5IOPB 2XN0A 5KTEL 1NPUA 2VXTL 3RY4A 2X2UA 2F1EA 4LARL 4P3WA 2DLIA 3QXWA 5DEZA 5B1AB 3W9DB 5FUOL 3OD3A 5EEWA 1EH9A 3QG7H 3UTTA 1A3LL 3FN3A 2BS9A 3PHAA 5AW8B 1KYUA 3L4TA 3VFMA 1G9EA 4AW4A 5KZCB 5EOQL 3MLRH 1TT6A 4WU7B 2BRQA 4UOJA 5C9JB 4FZ8H 1SJXA 3X1FA 1EWHA 3B8SA 3NRQA 2A1WL 2YOAA 4M5YL 2YRLA 2JJTA 3OV6A 4FS0A 5GRXG 1E5UI 2C5DC 2CJUH 4LSQL 1H0DB 1UH2A 3QO0A 4GUPB 4KOBA 1KLFB 1NANI 4MSWA 4N9GB 4NWTH 4XO4A 5T1KB 3S37L 5MEQA 1NLDH 5B8CC 4HA1A 3IMWA 1S9YA 4DVRL 1GS6X 4ZW6A 1JNJA 4XAWH 1LEGA 2VDMB 4QRAA 1XGPB 1F1GA 15C8H 4FZEL 2CJTA 4P9HH 4O00A 4FFZH 3IFOA 1JPEA 1JV5A 1UACL 3E6HA 5CIPA 1MREL 3GLEA 1NCWH 1S7XB 1MCDA 4IK7A 4GAJL 5IBLD 2VJXA 1TLMA 2FIRT 1RKRA 1CBJA 3UJJH 1BQSA 3RNKA 4LSSL 4HIIA 4AMKH 4LU5H 2DJSA 1P4IH 3FAXA 2NY2B 1W16A 1QFOA 4XC3H 1DCLA 2ESVE 2ZSVA 3MUGB 2IBBA 2IEPA 1QEWA 4MDJB 5ALBL 4FE9A 3VG0L 4E41B 1XF2B 2K4WA 1G94A 2GT9A 2YZ8A 1MH5A 2HXAA 3EGSA 4IOSA 1U6AL 3TBVB 1N6QL 3QDMB 3L3KB 5GS1B 1NFIB 4HFWB 3U36B 3FQWA 3V6FB 2IAMC 3IDIB 2DQIH 2H6PA 1UXSB 4UQ2A 4NO5A 3EG9B 1MF2H 4YIQA 4WUUE 5F1IA 5E8OA 5KUMA 2D03H 4ZFGL 3J2PA 3QXAB 3UMTA 1ADQH 4YHZL 2DQJL 3F58H 2JCCB 5GS0D 4GKZB 1A7BA 4F8PA 4WWKB 4F2EA 2WZPD 2H3XC 4D0CA 4WW1B 4A04A 3ZPDA 3CSPA 3V5DB 1RJLA 1DFBL 2O5YH 4LCWB 5D6CB 1NCBL 5SWQB 1N67A 3EGXA 1QG3A 4I89A 4MNGE 3WKML 5I1KL 3GO1L 4NZJA 1O6SB 3QZWG 1CUOA 5TDNB 1JTPA 1WGOA 1MFBH 1Z3GL 2OZ4H 4M62H 3ZKQD 1CGTA 5I6LA 3FUJA 5AL0A 1IC4L 3BP5A 3O0RL 3KPQB 4WHDA 4RGNC 2Q8AL 4ZW5A 5KVEL 4AVHA 5C0BB 2YO3A 4MB4A 2B59A 2X3AA 1WBYB 2YBRA 3OPZL 4MA1B 1YC8A 1XV8A 3A24A 5L8JB 1OARL 1HXYA 1RZIA 4AK2A 3IDNB 2J57A 4I3GA 1XHHA 3HZYA 3FOLB 4YJZL 4UBDC 3LQAL 4K7PY 3DJSA 3K5RA 2YWYA 2YEQA 1FWXA 2X42A 2ZOLB 2IAAC 3PHOA 1G9MC 3O8XD 1REIA 4RMBA 3MLWL 3B5HA 1ZA6B 3SB3A 3BFWA 2WNGA 1BSIA 2BWDA 4P5MB 1ZLVK 3CHRA 2LR4A 4D9QE 1AZVA 3WN5A 1OK8A 1M7XA 2ZCHH 5DUML 2GJZB 3BDBA 1GGIH 4ANKA 4DGIL 1J9SA 4UTBA 5IV2A 5JYMA 3RB5A 3LZLA 2HVKB 3FQXB 1OAUL 4M4PA 4DUVA 2DB8A 2YJLA 2W07B 3AAZA 2YPKA 3FFCE 1JWMB 2ZPKH 3GMOB 4JM4H 1C08A 4PJIE 3KM1A 5DO2D 5CINH 4AE1A 3DV4A 3U0PB 1JNLH 1N0LA 3FW6A 3ZE1F 3NJFA 4UOQA 2IJ0C 3KLQA 3M17B 4XO5A 3CSBA 1CBVL 1JZ6A 3P0VL 3NIDE 4I4WB 4M7KH 3BMVA 4JNXA 4EVNB 4QXVA 4W6WB 4A37A 3GD1C 4DVBA 4WEBL 1SXNA 3TJPA 2XWBA 3DUSA 1TIUA 4ORZC 2WZ5A 1IGYB 1UA3A 3CK0H 4CSTA 5EO9A 1NCTA 2UVFA 3UIYA 4PBXA 3B5GA 4HXBL 4X5QA 2UUDH 4RFEA 2CZNA 1XIWB 2A9BA 1DYZA 1NGWA 2WPGA 3PDOB 1G1KA 5F97E 3UTSB 4WUUA 1YN7B 3FQ1A 5F7EL 3K81A 4PJDF 3GBNH 4OI8A 1NBYB 4V1DB 3IDYC 5J6GB 2J4WH 4NZTH 4DTGH 3A3YB 4JHAL 5EV7A 3CPLB 1XF1A 1DTUA 2FLRT 1O7DE 4N0UE 3ZSSA 2CHXA 3JWDH 4EUPH 1QHQA 3WFHA 2DKUA 4MD0B 2Q8BL 1KJ2A 4OIIH 4MNGA 5I8KL 1TCRB 4IEFA 1A9EB 3CFKB 3LIZA 3UH8A 3N9GL 4U1MB 1I3RA 3DX1A 4PIRF 3W9EA 4J2XA 1ORQB 4W70A 5CEYA 1I7TA 2A6IA 3D18A 4WHYH 3GS0A 5IJKA 3VI3E 3RPKA 5ESVB 2YD5A 3LVTA 3NK3A 3CDGA 3BPNB 1JHLH 4OCMC 1RUQH 4QI3A 4OD2B 1F6AB 1F4WH 4X8JA 1J8HD 5FDWB 4FA7B 1CJYA 5LNGA 1MXGA 4PG2C 4PRHA 3V0DA 1B90A 3TA4D 5D71H 4N86A 2JQAA 3B9EA 3L3DA 3ZSTA 4DFHA 5FB8A 2J73A 2MQ3A 3TBSA 3IJYA 5EFIB 2ITDB 3TC9A 3WFBH 4FC3E 1T0NA 1PY0A 1SMDA 4NPYB 4Y19E 4BQ6A 5DYOA 2O5XH 1XF4A 3DOSB 3O9WB 2X87A 3ARDA 1GH7A 2V3EA 3LHPH 3STZA 4ABWA 5JIDA 4YMPA 2G5RA 4YLQT 5JO5A 3ASOB 1RIUH 1BYPA 4BCZA 2TSBA 2RFXA 4PRIE 3MBEC 2JJVA 4M02A 3NCMA 4HIHA 1KSRA 3T8VA 2OQJB 2DEWX 2IGLA 2Z0BA 3CVIL 4GRMB 4PJIA 2WC7A 3INOA 3JV0A 3D69A 1D9KA 2E7CA 1J87A 4LLYA 4R7LA 5FIEA 1UQSB 2OMUA 1NFDE 2R1YA 2R51A 3X11B 1K5NB 1EAQA 3FTYA 1MRFH 2ZUQC 1SMAA 2ZXBA 1KCRH 3FHAA 5DZVA 4U33A 1S3KH 1I9RH 3WS3A 2WUBL 4Y8AA 1GYAA 5TE6L 3OVUB 1JV2A 5E08L 1M1XB 3L4CA 4OJAA 5ICUA 5IEKB 3UROR 1U8PB 2LAAA 3QDJE 4N28A 5MI0B 3PF2A 4MA8L 2A6DB 3VFPA 4Y4FB 2JH2A 3DGCR 2DDQL 3EUUA 1KDJA 3KEDA 3T08A 1SJHA 1U8CA 3MNZB 2NYZA 4EZLA 1T22A 3EH5B 4LOUC 4MCMA 3MRMA 3UZQA 2A0LC 2W81C 4K3EL 1KWGA 2YAFA 5CO1A 2WO2B 3MGOB 2K7PA 2G3XA 5KS9F 4JRWA 4UZUA 4YE0A 5IKCA 2MCPL 3AM8C 4GAYA 2DQDH 2ED6A 4R2GB 4S1RH 2KMWA 1FYHB 5CSZA 1B0RB 1WS8A 2Y7MA 4OQTH 4WCYL 4QEGA 5D7EA 4JDVB 1THCA 5BZWB 2VKXA 2IXQB 2NY7L 2HX9A 4HPOH 2YPVH 2AABH 2CKNA 3FZUD 2UWEA 5I9QB 2Y3AA 3B2VL 5KJ7E 4JO3L 5L4MA 5DEFB 3TN0D 1T2QH 4N0UA 1EEZA 1I1YA 1WT5C 4FNTA 4XRCA 3D48R 4XN9A 3VRIB 4X2UA 3BZFB 2ITEA 2P4AB 3TT1H 4JDTL 4Y5YA 1T83A 2QKIB 2PP9A 4UT6H 2FATH 2V3DA 2WWOA 5D1ZA 2DM4A 1IGFH 3MRQB 4JANA 5KJRH 3LDBB 3K2UL 4YXLL 4P9ML 5ID0A 1OKEA 4XPTH 3VI3A 1MG3C 1KF9B 2B2XH 1EAJA 3B9KB 3DSFH 2IDQA 2D0FA 3HPLB 4S1SH 3TA3B 3WXVL 1CLOH 2NMSA 1QABA 2PCYA 1CE1H 5HGHA 4PUBH 3GMMA 3SPVA 3CFJB 3AY4C 3TYFB 3TYGL 3UTOA 1FORL 2FT8A 5J56B 5BVJA 4G8IB 3ALXA 4I48B 3MCKB 1IFRA 1IMHC 1CFTB 1AQ8A 1CFMA 1FLTX 4PB9L 4KVCH 4TNVF 5B7EA 2HLAA 1A65A 5GGTH 1P69B 3QHZL 3MRJA 1NC4D 3LZQA 1KJVB 4H1LH 2MSPA 4N26A 5HYFA 3GT6A 2DQTH 3JQOB 4PG9A 4WW2C 4PJ5D 4Y19A 3HUJB 4YQXH 4AX3A 2VLMD 4WWPA 3VH8G 3RVWD 3ARVA 5EOCH 5LXVA 3RZWA 1ZRUA 1KCSL 4JFEE 5I74B 4XN8A 3ZE2F 2C7FA 4L9DA 1S7RA 3P1VA 3W3BA 1U92A 2YXMA 3HZMA 5AW0B 3BAYA 5EZPA 4B9FA 1QBML 3TNNA 2MTAA 3HNTH 1RAMA 3QQ4A 3NTCH 1J0YA 1AHMA 3RWIB 4C83B 4ZMNA 2JVUA 3RBGA 1H9VA 2GY7B 2VAAA 1E9PB 3UG4A 4L9LA 3QIUB 2YAQA 2J2ZB 1KFGA 4P4KA 1DQQA 4V11A 1MWAH 5I8OH 3QIBD 3PNWA 4ZD3L 3S3SA 2NCEA 4O2EA 2AV7B 1EO8L 3T3PE 3GTNA 4MNQA 1IKNC 1M05B 1SJEA 3KPNA 3QDJA 1U3ZA 3OHXB 2CKBA 4I2XA 3SOBH 2R56H 3RGVD 2P8MA 4M1GL 2W80C 1QHPA 4O2CA 4OD3L 1W0YT 2DQUH 1LHZA 1AI1L 3AQYA 32C2B 1Z9MA 2RIKA 2C34A 3C09C 3COOA 1BLNA 2F5AL 5H37G 1I9IH 1HHJA 3QEUB 1QSFD 5ACMA 1EHAA 3MN8A 3MRCB 5J5EA 1IC5H 2BMKB 2RAMA 3OR6A 3BSZL 3KVDD 4I0KA 1HH9A 1HEJC 5D93B 1XH0A 1WK0A 4YDJA 1IQDB 4ZUWB 4IYKA 1KCKA 2WQRA 3MNVB 5FKAA 2NY1B 4Y2DC 1BQLL 3DSNB 3BAEH 3MMEA 3KPSB 3ZYOA 4WFEE 5D5MF 4LEOB 5D6DA 5SX5H 1BVKA 1AKJD 2C3WA 3FCSA 1OTTD 4BFBD 1G9ML 2FD6L 2V8MA 5LLIC 1UM6L 1TNNA 2G9HA 4QRRB 4KKBD 3SCMD 3T71A 2CO6B 1SFDA 1E65A 5IVZA 1AXTH 4YL9A 2O4EA 1EERB 3PL6B 2XPGA 4XX1E 5A43C 2OP4H 3AUWB 5JDJA 5C0RL 5I73C 2IBZY 4K55A 5CJXC 3JSSA 2IFFL 2QADC 1LE9A 3QXVA 5IW1B 5JTWA 3DJ9A 3GRWL 3VQ1C 5CILL 5LCVA 2Z0UA 4KAQL 1NMAH 3NSCA 4OUUA 2ZUUA 5AW6B 1AQHA 1E5ZA 5IQ9B 3WIIH 4ZG1A 4PJAB 4BFNA 3ERXA 3ARGB 5K93A 4HBCL 4ILDA 1W9XA 3WFEL 4PRPB 4GBXB 1PLCA 2EVHA 2IAND 3TEWA 4JR9H 3SE4A 3V0FA 5MEND 3HAEA 4BH8A 2YUXA 4BSWA 4J4PC 3UTPD 1ETA1 3N91A 1ZT7B 4GQ9L 2BVEA 3ZQWA 4UQ9A 1UEMA 2A74B 5I71B 1GGTA 4RMQA 5IW6B 1AP2B 2M8XA 3SBRA 1N10A 2WXNA 5GS0H 2EIZB 1K8DB 5MEPB 2Z35B 3H7BB 3J7HA 3VQMA 4Q9CA 1LP9F 3S5ZA 5JYLA 1M9SA 3ROOA 5J1AB 4L1SA 5LGJA 2C7UB 3LTVA 5JW4R 3N1MC 5CGYD 1MCIA 3CHPA 3HLAA 5GJSH 5T1LB 2EKSA 2VSKB 3VD9A 4BKSC 1EIBA 4ODWB 4DETA 2F54D 4W4OC 3GMNB 1EHNA 1KTDB 1EDYA 3KNBA 4YSOA 1VJSA 1PBYA 3NEXA 4MZRA 3TIEA 4Q2ZB 5HPMB 2ZX7A 1QVOA 3WY1A 2BP0B 4NN6C 2XKSA 4MKTA 5IB3A 1HIML 3RA7H 2OL3H 4P46A 1CIUA 4KRPC 3C5SA 3ARPA 2OMXB 3NCJL 3FOMA 3HFML 1T2JA 2M1KA 3FUKA 4FXLA 4KJYA 4MAZA 3CUPB 4R0LA 2RQ8A 2OMVB 2VXQL 2CAKA 1R6VA 3CVHH 4OGZA 4HH9A