1E5YA

Azurin from pseudomonas aeruginosa, reduced form, ph 5.5
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords AZURIN
publication title Rontgenkristallographische Strukturaufklarung Von Azurin Aus Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa
total genus 33
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1e5yA00
1A4BA 1NPJA 4BDVB 3WKPA 5TK2A 4HIPA 2DY2A 2QPEB 1E67A 4G7RB 3FQ2A 3ZX1A 1XB8A 4AKPA 1J9QA 1HFUA 5EHFA 1AZUA 2PPFA 1KDIA 1QNIA 3ERXA 3OM3B 4KO6A 5I28A 3PAUA 3SBRA 4DP8X 2GSMB 3T6WA 1JXDA 3NT0A 1KCBA 3ASOB 4WKXA 3NSDA 2Q5BA 2UXVA 2QDVA 1HAUA 4DP0X 2I7OA 1AG0A 5B3SB 2HLEB 3AY2A 1NPNA 1XB6A 3UACA 4BK5C 3GXUB 3S8GB 3OMNB 4KO5A 2EINB 1SF5A 3V9EA 1X9UA 3AG4B 4HCIA 2HX9A 3ABKB 2YQBA 1JZGA 1W6WA 1CC3A 1E5ZA 5B1KA 1AANA 5D4IA 1V55B 1WS8A 5I6PA 4A2DA 4AKQA 2IDUA 3QJRB 1KDJA 1W8EA 1J9RA 2P80A 3EHBB 1ILUA 1AOZA 4YVNA 5AKRA 1L9SA 2TSAA 1L9RA 1GY1A 1R1CA 3NJKA 2HRGA 3H4FA 2JKWA 2NRDA 3AG2B 2QPDB 2CBPA 1M57B 2BWDA 1KV7A 1NWOA 1F56A 2I7SA 3MBWB 2QDWA 2HZHA 3NJLA 3JTBA 1FWXA 4FA7B 4A68A 3IN0A 1GW0A 1ZIAA 4P5SA 1AQ8A 2DYRB 2PPAA 2VSKB 5B1AB 3BQVA 4NAJA 1JZIA 2CCWA 3FU7A 4QKTA 2E86A 3ASNB 3FU7B 2R7EA 1L9OA 2R7EB 4HZ1A 4EF3A 2MTAA 3FSAA 4AX3A 3QJQB 1BXAA 1XB3A 3KW7A 3NJNA 4ZK8A 4N8UA 1ID2A 3QJSB 4F2FA 2W8CA 2YAQA 1AACA 1KYAA 3TBBA 5B1JC 2EILB 1M56B 1OV8A 2FTAA 3N55A 4YSOA 2JXMA 2X88A 2B08A 4UAHA 4BWTA 3ZIYA 2AFNA 3QJVB 2Y1AA 1BEXA 3ZBMA 2OV0A 4GP5B 2XXGA 2ZOOA 2YAMA 2VMJA 2A3TA 3AW5A 4YSRA 2AZAA 4AKOA 1PCSA 2GI0A 2BW5A 2FWLB 2UXTA 2J57A 3WNJA 3X1BA 2GIMA 1ADWA 1JOIA 4YSPA 1KBVA 1PZBA 1PAZA 2FQFA 4M3HA 1GS7A 1ASOA 1B3IA 3S8FB 3FSWA 3IEAA 2HXAA 3FQ1A 3GDCA 1CUOA 1RKRA 4KO9A 4E9YA 3GYRA 4E9TA 2IH9A 3CZUB 2YAOA 3X1FA 1L9TA 1HAWA 1JZEA 1JZJA 2XX0A 1BQ5A 2YAFA 2HX8A 4G7SB 1GYCA 5D4HA 2VM4A 4RH4A 4G71B 4TXVB 3IBOA 1AS7A 3AG3B 2GBAA 1SF3A 4A67A 4DP9X 1A8ZA 2B3IA 4K9JA 1ET5A 2FT8A 3NJFA 1EZLA 2JFCA 3FQYA 3UAEA 3X1NA 3OMAB 3NSCA 4DPAX 4DP2X 4HCFA 5PAZA 4ENZA 2IWKA 2CJ3A 3PAVA 4YSQA 2XUWA 1KBWA 3PAZA 3S3DB 1SJMA 2YAPA 2XV3A 2HRHA 2UXFA 4X4KA 2H47C 1OCRB 2BZCA 1AS8A 3NJMA 2YAEA 1MDAA 2BP8B 3PPSA 1AZRA 1RZPA 2H3XC 2FNWA 3NJHA 4MFHA 2J5WA 1IC0A 3C75A 3H4HA 5AZUA 3UAAA 2BZ7A 1MG3C 2IDSA 9PCYA 2J56A 3FPXA 4A2GA 1X9RA 3OQRA 4NERA 4BXSV 1BYOA 5I5IA 3CVDA 2XV2A 3EH4B 1W6LA 5I6OA 3X2QB 5I6NA 7PCYA 4Q8BA 3IN2A 4F7KA 2IDFA 1URIA 2UXGA 3RYMA 2OJ1A 2DWSA 4DP5X 3UGEA 4E9XA 2YARA 4G70B 1YLBB 2FT6A 3CVCA 1GS8A 4DP1X 2WO3B 4GP8B 4E9WA 4YL4A 2UX7A 2BW4A 4F2EA 4KNTA 3BVDB 4E9QA 3HB3B 3T6XA 3WG7B 1TEGA 1IUZA 3H56A 1AZCA 2W88A 1PNDA 1WAEA 3ZDWA 3JT2A 1MZZA 1TU2A 2IH8A 1FA4A 1E30A 2WSDA 3V9CA 5E9NA 1OF0A 1WS7A 2BWIA 1BQRA 1WA2X 1NIDA 2AZUA 3ABGA 2VW7A 1AAJA 1CYWA 1AS6A 1ET7A 1JZFA 4PCYA 4KO7A 5ANHA 1OE1A 3NJGA 1PF3A 5IY5B 4AZUA 4W1TA 1A4AA 1ET8A 2Q9OA 3PLYA 3FU9A 2BP0A 2BHFA 3FT0A 2BP0B 3AZUA 1JVLA 5B7FA 2LLNA 3QPKA 3WKQA 6PAZA 2P80D 4E9VA 5A7EA 2VW4A 2XLLA 2IWEA 2XXFA 5I6KA 3G5WA 8PAZA 3IE9A 1OCOB 2J55A 1ASPA 3SBQA 1AG6A 1PMYA 2MRYA 1NWPA 1AR1B 1RZQA 2IDTA 3FS9A 3FYEB 1E5YA 3X1EA 2DWTA 1OOWA 2HX7A 3T9WA 7PAZA 4M4RB 3EH3B 2VSMB 1SDDB 1V10A 3NJJA 2DYSB 1DYZA 2AANA 1DZ0A 1J9SA 5I5JA 5B7MA 4YVUA 1SFHA 1XMEB 1ETJA 1A65A 1QLEB 3FYIB 1NZRA 3EF4A 5I26A 2ZXWB 1BXUA 4A66A 1PLCA 4JKNA 1A4CA 1V54B 1ZV2A 1AZBA 3TA4D 2N0MA 3QJUB 5F7AA 2XU9A 3FSVA 4L0PB 1M9WA 2QT6A 3FPYA 1WA1X 1JXGA 4DPCX 4KNUA 4W9ZA 3NP3A 1ILSA 1AZNA 1ZDSA 4FAAB 4BWWA 4KNSA 1ZDQA 3TU6A 5I6LA 1A3ZA 3KW8A 3L45A 3TASA 2CUAA 1BYPA 5TK4A 4A2HA 1J5DA 5PCYA 1ZPUA 2EIMB 2PP8A 4NB7A 2PP9A 2CAKA 2OCCB 1PZAA 2BP8A 1ZIBA 1TEFA 1NDTA 2CALA 2YXVA 5D4JA 2IDQA 1SHWA 4GYBA 5FC9A 4HAKA 1MZYA 5I5MA 2PLTA 4YSEA 2FQDA 1JXFA 1BQKA 2TSBA 3OMIB 1J9TA 1CURA 3U25A 4KOCA 4AI7A 2ZONA 2PP7A 3N2JA 1NIFA 4HHWA 1L9QA 2XX1A 1N70A 3CDZA 5I6MA 1JVOA 1L9PA 3CDZB 5B7EA 1QHQA 3UADA 1ASQA 2VN3A 1NINA 4GXFA 1OCCB 4A2EA 2PPEA 1N68A 1PY0A 3NSYA 4DPBX 2Y69B 1PLAA 1WA0X 4GP4B 4UF7C 1T5KA 4UANA 5LDUA 4JHVA 3DIVA 1PZCA 2DV6A 3PCYA 6PCYA 5B1JA 2FQGA 1PLBA 2FT7A 3X1GA 4PAZA 1I53A 1KGYE 3EH5B 2FQEA 1IKOP 1MG2C 4G72B 4E9SA 1EHKB 3NJIA 1FFTB 1NIEA 2XV0A 3S3CB 1J5CA 2GC7C 1OE2A 2PCFA 2XWZA 3T6ZA 2PCYA 3UABA 3ABLB 4BWUA 1NIBA 2XYBA 3ABMB 4YSDA 2GB2A 3HEIB 4HALA 4GY4A 3WNIA 2IWFA 1BXVA 1VLXA 4DP4X 3QQXA 2X87A 4KOBA 2YXWA 4YSCA 4YSUA 1RCYA 1IBZA 1E65A 1SNRA 2ZWNA 4N4YB 3WI9A 1NICA 4P5RA 3SQRA 3CVBA 4YSSA 2XVBA 3D12B 1CYXA 2WO2B 3S3BB 1GY2A 1UATA 2GHZA 3SBPA 4Q89A 3AG1B 3MX0B 2VM3A 1PNCA 2H5UA 1GR7A 1GSKA 4YSAA 3TBCA 1NTDA 2VW6A 1KCWA 2IAAC 4HHGA 4YSTA 3T71A 1JERA 1SDDA 4HCGA 3T6VA 2YAHA 4JHUA 1NIAA 2PPDA 3PXLA 1SFDA 4E9RA 4G7QB 4DP6X 4WTQA 1OE3A 3WIAA 1SHXA 1OCZB 5B1BB 3FSZA 2AVFA 4BXVA 3CG8A 2FJSA 1AIZA 1IBYA 4DP7X 2BO0A 2GC4C 3NSFA 1TKWA 4A2FA 1JZHA 2PPCA 3NYKA 2EIKB 3OD3A 4QLWA 5AFAA 1BAWA 1GS6X 4CSPA 2UX6A 3NP4A 2EIJB 3DTUB 3QJTB 4CSZA 2I85A 3DKHA 2RACA 5F7BA 4BDVA 3FU8A
chains in the Genus database with same CATH superfamily
1FRGL 2HTLD 3C2AH 3QRBA 3QWOA 4JY4B 3PXJA 5CP3A 2D4DA 4P07A 2QPEB 4W9GC 4NHCH 3RVUD 3D05A 2QVFB 2Z31C 4X7TA 4AQ1C 2HFEB 4U49A 2YRBA 4ILDA 3GSRA 2D31B 1AZUA 1KDIA 3A4EA 2LVCA 4FLSA 1OTTD 3SBRA 1FG9C 5CZKA 4XNZB 4DHLA 3NT0A 2XY2A 1DQIA 3H42L 4RFOL 2OMXA 4K07A 4KKQA 5CUSL 3DX7B 4ZAKC 1HAUA 1QRNB 5DJAA 4DP0X 1BGXL 3MODH 1GAFL 4JFSA 5LCVA 1S7UA 2EXYD 1WT5C 1YNTA 2CHWA 4HFUL 4RFEA 4YEFA 5EOTB 2GSGA 2X40A 5EIIA 1YNLL 2R29A 4EZKA 2GBUA 1HWHB 3QE5A 2NXZB 2WQSA 3QUKB 4MJ5A 3DRQA 1KDJA 1W8EA 1J9RA 4OLZH 2G75B 5MEOB 3Q2CA 3L3IA 2BX5A 2LAAA 4HJUA 1KGCD 1N4XL 4HH9A 3TONA 1WHPA 1MCPL 1DBAL 4LLWB 3DHUA 1E50A 2RCSH 4S0SD 5C0RL 2EUWA 4OZHE 4RDBA 3HG2A 2WZ5A 1H3UA 3QQNA 2KT6A 2XACC 5F7NC 5G4NA 3TN0D 4BFNA 5A6MA 2R0LH 4N3UA 2HFTA 4PGDB 3G6AA 1QW9A 3LHPH 1P1ZA 2OMZA 4K9EC 1CVSC 1JNLL 4LPXA 3ZUCA 3JTBA 2FX8H 4PV8B 3F3HA 3IJHA 4WWKD 2C3VB 1RJYA 1YN6B 4KQ4L 1JV5A 1JL8A 2PPAA 5E6SB 1X9QA 3MCLL 5AVRB 5B1AB 3GMQB 4F3FA 4YDVB 2NNAA 5C0DA 4F5CA 2R7EA 3FT3A 5I1JH 2G60L 1I1AD 4LEEA 2MQCA 3O9WB 2FD6L 3LN5A 1Y6NR 4OFKA 3WFBL 4MKMA 5DUPL 3UMNA 4E41E 4HV8A 2DQ6A 3ML9A 4N8UA 3SEPA 2ADFH 3WNPA 3V5HB 1FHGA 4XN1A 4AM0A 4PIRF 4LNVA 1EJOL 3IE4A 2BINA 4QO1B 1LJMA 4CVZA 2PCPB 3HVDA 2BS9A 3JWOL 2B08A 2R2EB 2W94A 3T2PA 4UQ9A 4X6BB 3BVTA 5ITBL 2QLVB 3EJQA 4WK4B 3QQ3A 5EZIL 4DUVA 4YDNA 2NY2B 2VXVL 1FH5L 1X5KA 4NXKA 3UROR 1BIHA 1KXQE 2D03L 4YSRA 2DMBA 2DQJL 3DBSA 3WEAA 1MDTA 1EEZA 2K78A 3S5ZA 1KEML 3VFMB 4M61B 3DROB 4NUPA 1NSNL 2OMNA 1Y6MR 5CZXD 2PTUA 2QSVA 4LQ1A 1M4KA 3GSVB 1FC1A 2AEOA 4QTHB 3K8MA 5GSRB 1C7SA 3MRQA 4ANUA 1UT9A 3NEXA 4KQ0A 4W6WB 1NEZA 3WGVB 5EIQA 4AYDC 4Z7UA 3V6FA 3ZK0A 5FPIA 3STLB 2DQUL 1QFUH 2GBAA 1CGSL 4H5SA 4ZO8A 3QDMB 4G9DA 3INUL 2V2XB 4FFYH 2BFVH 1E4HA 1PYWB 3RLSA 1B2YA 4J4PD 3TJHD 3UAEA 4FGMA 2OI9B 4HCFA 3ZSSA 2VZ3A 3HC4H 2DQGH 3MBEC 4JPQA 3UTSE 2AMGA 4NGHL 5CN3A 3RFRA 1AS8A 3HMWL 1YAIA 5CJOL 3LXCA 3REVB 2VL5A 3KS0H 4O2FB 2VDRB 2FNWA 5ICXB 5A3IC 4NM4L 5IIEA 4XPAL 3SYAA 1J1OL 2EQDA 1IKFL 2ENYA 2VAAA 1G9NC 1U8JA 4WQOA 5LBVA 3BGMA 1ZT7B 4G82A 4KDTA 1JF6A 3C5SB 4YLBA 1WG3A 3L4WA 1UM4L 4BEIA 3P3TA 4M7JH 2BP3A 1I7RA 1KGXA 1KY7A 2WXPA 4XBMA 4J5VA 3PNWB 4FQLL 4XPGH 5F1OB 1JHLH 5HD8C 3OR7A 3HZKB 1QVOB 3QBTB 1ZKAA 1WICA 3INOA 4ZJ9A 3QA3A 1NLDL 3V5DA 2Z92A 1OPGL 3KWXA 4PBVC 2WXRA 5D1QD 2KI6A 4MYWB 1NCHA 3F05A 3S4SG 5ETUA 1JGLL 2WOYA 4GSDL 4BQCA 1EFXA 2AF2A 1HXMB 3H7BA 5F21B 5A7BA 1S7RB 4QI3A 5AB2A 2L7UA 1IEBA 4CVWA 4OFPA 1PY9A 1UJTA 3AFLA 5I1LB 5L2KD 5EOQH 5F0PB 1OGSA 5DJCA 3DJRA 2R2BB 3MRHA 3P2TA 5FCUL 4JGNA 1K8DA 1QPKA 1BX2B 1DO5A 5BO1H 4ZX6A 1LO3H 5F3BA 5I18L 1VACB 2VZUA 1IIIA 2WGNB 5G4MA 1TYEB 1UWFA 1A4AA 1F6FB 3BEVA 3VXNA 4L1BA 4ZW8A 3B9AA 4LE8A 3FT0A 2DDQH 1UWXH 4XI5D 4MXVF 3S37L 2XJLA 1RZJH 3DPBB 3N5AA 6PAZA 3MV7B 3QZOA 1ONQA 4LVNB 3RNQB 2DICA 3S35X 3IE9A 5HBBA 1NCOA 4CNIA 3GM8A 4NEHB 4JQIH 4XMTA 1IAOA 1S7WB 2HFFB 1NGPL 4K5NA 1TFPA 4D0CA 1XF4B 2A4ZA 4XVSH 3MOQA 5HVFB 4PWKA 3RDTA 1RV6X 3S96A 2F53D 4Y4FA 2CGRL 4V2CB 2OS7A 2JJVA 2NZIA 1IM3B 2WWKO 4Q14A 4RMBA 3L08A 1V10A 3Q6GH 3QJHB 1JGDA 1RP8A 2EEXA 1KN2H 2EYRA 4HKZB 5AVYB 4BUGA 4UNTA 3RBGA 1XMEB 4G6AD 4XZ4A 4F8LA 1DR9A 1XGYH 3GI9L 4YHOH 4FKEA 3TBYA 3U9PH 3MGTB 5TE4H 3M07A 3EF4A 2ARJB 4M7LT 1CU4H 1C12A 4JFPB 4JKNA 4NHCL 4OKVA 4JANB 4GG6F 2HTLC 1RPKA 4FG4A 2CO1A 5GZOD 4AGOA 1OLLA 5E5RB 3RVUC 1QO3A 5G55A 4OY9A 4W9ZA 4MAUH 1F00I 2DM3A 1ZDQA 1OTTC 3R7QA 2VZTA 4NSKA 4Z7WE 4OAWA 5L4IA 2ZUYA 3ECWA 4RDQF 2G3MA 3QFJE 3RVVD 1EV2E 4XX1G 4A2HA 2OTPA 5KSAB 4WO4D 2OSLA 4JZJA 3DV6B 1K5WA 4Z7VF 4WFEE 1XF3B 1ZIBA 8CGTA 2YXVA 2EXYC 5EB9A 4GYBA 2DM7A 2B14A 3FTYA 4PTUB 1NLBL 2GBVA 1QLRA 3MJ6A 4ZTOH 1AD9B 2FQDA 3QQ4B 5FYKD 3VXME 2XC8A 5C8JA 1QQDB 4P46D 3AREA 4XCYA 3FU5A 1G7LB 4UQIM 4M7KH 4OLZL 3TO4D 3UPCA 3IDNA 3L81A 4DT2A 1E42A 4NZ8A 1SXZA 4FQQB 1JWUA 3BPOC 1JV2B 5F1IA 3K0WA 2WB1A 2RCSL 5D7KE 3IDXH 4HEPG 3IU3A 5KZCD 2VN4A 4QXTA 4HUXB 4DK3A 2P5ED 2WXFA 3CVHL 3H0TA 3HLAB 1OCCB 4FJYA 4HIIA 3IF1A 3TN0C 2WB7A 1CDIA 5KVEE 1T4KA 3LHPL 5B21A 3HRZC 1PLAA 2A6IB 2BM3A 5TF0A 1OGAD 3NFPB 2QFRA 4KVNH 2FX8L 4AGMA 4EI0A 3ARDD 1LO0H 2OJEB 6PCYA 1ZGLA 1Z6JT 4WWKC 5AW8B 1Z9MA 4X6CE 4Z7AA 2HG5A 3TIDA 4DAGH 4DW2H 2J2ZB 2IEPA 2VN6A 1ZHNA 2Z93B 3BIAX 2WBWB 2MQ3A 1XSOA 3EH5B 4JMNA 1XSKA 1ORSA 5I1JL 2FSEB 4XWGH 1CFNA 3BIKA 2NW2A 1D2OA 1E4KA 3CFKA 1I1AC 2HTKD 4HGKC 3UABA 4JG1H 3LPPA 1FVEB 5HI4D 5AL8A 4HALA 2PKDA 2ADFL 1U4FA 5GRZA 2Y5QA 4PJ6A 3K2MC 4NM8H 2CO7B 1WFOA 1ZOXA 5LB1A 1U8HA 3VXSE 1BOGA 1U58B 4YBLC 2UZPA 4N4YB 1M7IB 1KG0B 5FLUA 2VXSL 3M1BA 5IEKB 4B3VA 5HTSA 2DLIA 4UM8B 3ZE2B 2DYPB 2NNCA 3IYLW 3TV3H 3BWSA 1XH3A 3QUZA 5E6ID 1SVBA 2APWA 3BWAB 2HVJB 1P84K 4FZEH 3GIVB 3EOAA 4GT7A 3UZQB 1LE5A 1FNGB 2H3NB 1KB5H 1B4LA 1U92A 3OF6D 2P46B 2OMWA 2Z4QB 1KLGA 3F84A 2BY2A 1MI5B 1TQTA 1YYCA 1GOFA 4GSRA 1XF2A 1Q9OA 4KJQD 4N2IA 1E9PA 3ARTA 2I32A 1DLHB 2PABA 1GJIA 1NIAA 3MTRA 1YNTF 3QUMA 3OX8B 4UAOB 4OB5H 1I3GH 3ARRA 5CZXC 4YX2L 1T7VA 3UTZB 1EERB 5B1BB 2R1YB 3GLEA 1OL0A 3OKLA 1GGUA 3D1MC 1H8LA 5LUMA 2V5RA 3F12B 2FJSA 1E5CA 4PYHA 4AC2A 1SHMA 3RPIA 3SKMB 5CBEB 1R19A 5AOMA 2EDMA 3NSFA 1JZHA 4Y4KD 5ISZE 1QFUL 1AY1H 1T0OA 3BOVA 2YGNA 4QRTB 1TMCB 4Q4IA 5FO7A 2ZNXA 3VXRE 3GRWH 4FFYL 2BFVL 3IGKA 5ESQB 5AAMC 3NEOA 4LNRB 5KOVC 5EO1B 1NPJA 3IMTA 4FI6A 3HC4L 4J4PC 2DQGL 3KPLA 4JDVA 3TJHC 3CN1A 2IVFC 4RAHA 3JVFC 3UP6A 1HJBC 1NCAH 1SOSA 1T2QH 2F58H 1IB5A 4ZZKA 4L37B 4V1DA 1DCLA 5BZXA 3KM2A 1RJLB 2B59A 4P06A 2FH8A 3PAUA 1JPFB 1XVSA 4E68A 1TCRB 4HZAA 1RIUH 5D7JD 4ZOEA 3RWIA 3HE7A 4LDCA 1G84A 2Q5BA 1SQ2N 4IU2B 3VYNA 4BZ2H 1QRNE 4MZ3A 1GJWA 3WLBA 3KYMA 4OCXH 1NC4B 1AYRA 2X6BA 4JFDD 4YGAB 1XB6A 4M7JL 3D07A 3DXAA 4HUUA 3S8GB 4LPVA 5C0BB 4XPGL 3CDYA 1TDQA 1V3LA 1DUYA 2BVOA 3MCKB 2J6EL 4WI0B 5EDXA 4L4VA 1QSEA 2X89A 2DQDH 5I23A 5D1QC 3QFDA 5LBSH 5JPNA 3NCMA 1AOZA 1JMZA 1MLBB 4MXQD 4JFTA 1E8YA 2B4CH 3UBXB 2CHDA 4YK4B 1PL3A 2JB6A 4QT5A 4MJ4A 4JLRB 3N1QC 2BWDA 3UPRA 3UBXG 2EEAA 4ZNEE 1Z9SA 5EOQL 2J25A 5I1AB 1N8ZA 2V9TA 1JPEA 3A6OA 4OLXH 4PG2A 1FE8H 4QTIH 4UQCA 2QDWA 4PRPD 5F44A 3SD5A 1I8MA 1NGZB 3VXQA 1FGVH 3M1CA 3MAWA 1DJGA 5CXPA 5BO1L 3WHE1 1LO3L 3RTLA 2WMPA 3G5ZB 3SGJC 4LLQB 4X7CC 1AQ8A 4TV3A 3RWHB 1MJ7H 2VSKB 1R47A 3BQVA 2OMYA 4JQXA 1JZIA 2RGSA 2DDQL 2H32B 5CR8A 3RX9A 4WF7A 1RZJL 4MDIB 4Z7UF 4HZ1A 3D0LA 3D7PA 4WV1C 4XI5C 3C5JB 2XG5B 1ZJAA 3HNSH 5LO7A 1JGEA 4YBQD 4JQIL 5B4MD 5FM8A 5CBAB 1FJ1A 1A7BA 2IAND 3PJSB 5E8DH 1LMKA 4Y5YA 4XVSL 1NCIA 4MMZA 1M56B 5FGBA 3V4PH 1LHZA 1BFVH 5D8JH 2J3SA 3OG6B 2C3HA 1WZKA 3QUXA 4NKMA 1E27A 4R0LA 1XL4A 3CC5A 3Q6GL 1WC7A 1UB6B 1KN2L 5T8IA 1LQBC 3US1A 3HCVB 2ATKB 4PJCB 4Y16A 1XGYL 4YHOL 3U9PL 3K72B 4PMEA 3EH2A 5TE4L 5B8CB 3T1WA 1SYVA 3V0DA 4G6AC 1SLWA 2ZOOA 1CU4L 4GRLD 4DGUA 4ZXBA 4KTDH 5INCB 4FTVD 4NQED 3TF7C 3L4TA 2OSYA 2NDFA 3EADA 4ZFQA 3UGXA 5GZOC 4H1LB 4R5VA 5DVOA 2J1YA 5G2NA 4MAUL 3KYNB 3OR6A 3K7UA 2A1WH 2FL5B 3BDYH 8FABB 3FQ1A 1RKRA 4FNQA 4UWQB 1Q72H 4H1LG 1I4FA 1IKNA 3VXSD 4QIRA 1SJHA 4QGTA 4WO0A 3L4VA 2YEZA 3NGBC 2ZWZA 3SDCD 1PGRB 3RVVC 4I18A 3P4MA 1JDDA 3B56A 4MQ7A 2YD2A 5E1AA 4WO4C 3CLFH 4BH7A 2GTZA 3I85A 4K4KA 3QDME 3BZFB 1DVSA 4F8QA 4ZTOL 1XGRA 3DOIA 3KJ4B 4KXAA 5IMOA 3E6FB 5E5MA 3L7FA 5FHBH 3TBWA 5GSVB 3RGHA 3O4OC 1KTBA 4CN4A 5L7XL 4PW3A 4M7KL 4G11A 5DJDA 1WIPA 3BPLC 4KBPA 4KXCA 2YUWA 3O41B 5CCHE 1C7TA 3TO4C 2FJFA 4RZCA 5CZVH 3IDXL 2EDEA 1FZKB 3MJ7A 5SV4A 1LVEA 2CCLA 3QJFB 5K1JA 2ZG2A 2F8IA 3LXAA 3ZQ9A 5CKAA 1SOQA 2KLTA 5C07A 3RGVA 4NZRH 3V7MA 5FYJE 1EZUA 3UAJA 2BZ7A 4GUPB 3M86A 3LRGA 2IPKA 1SLVA 5BOPA 3Q8CA 4KVNL 3L2MA 1DQQA 3NDYE 5DEZA 3HG1B 1LO0L 4CDGC 3ZXAC 3ARDC 3ILPB 4JB9H 2VDQB 4DW2L 1FO0H 2B1HH 1AHKA 2BSRB 4DAGL 1S7VB 2WV3A 4L2YA 3FULA 5T1MA 4GAGH 2DWSA 4EOWH 2BSTA 2CGZA 4RISH 2H9GB 1OZTG 3MBWA 1XAKA 3S88H 2BSSB 3OWRA 3WAJA 2E7LA 2FWOB 2D0FA 5DEFB 2Q86B 4YL4A 5ADPH 4JG1L 5HHQA 2WLNA 2HTKC 1DVXA 4QHNA 5D2NA 5DVLA 3CFEA 3WEMA 4NM8L 5HI4C 2UUDH 2MCAA 2X7LB 1WAEA 3QARA 5D71H 1FA4A 1V7MH 3TM6A 5EF3A 1TU2B 3L16A 1SMOA 1UKSA 3BO8A 5C6TH 1P69B 1WZLA 5JW4N 3TV3L 4Y9FA 1JHKH 1ESOA 1ZLDA 4AIZB 1HHJA 3P54A 4FZEL 4A63A 5E6IC 3B7YA 3ZYJA 4BINA 1KB5L 2EDDA 1BREA 4W1TA 2Z34A 4HF5H 3BMWA 2F74A 3I2CH 1J10A 1YG9A 3BZEB 4JHAH 1PZ5A 4M5ZH 4HLEA 5HYIA 3PWUB 3QDJA 3QXAA 5HHNB 1XGQB 5DSCB 2HCZX 4XOAA 4OLEA 1G6RH 2I5YL 3MV7E 2O26U 3E6HA 1JTPA 4KJQC 4OB5L 5EU5A 3TCTA 1CICA 2VW4A 1I3GL 3R4DA 3POCA 1RK0A 2HKAA 5E1GA 4WVRA 3CD4A 1MIMH 1ZLUH 4U6VH 1U4EA 2DH3A 4ZFOA 4Z3TA 3O3DB 2IDTA 5ESVB 1AQMA 3LSOB 4LVOB 4M4RA 3Q43A 2G4GA 2W59A 3ASWA 4LRNH 1OLZA 4XB8A 3CX2A 3CMGA 1U8NB 3UCQA 1AY1L 3GMMB 2VDLB 2ODIA 4WSGA 4M29A 2ID5A 3P11H 4QRPA 2XQYG 3MRDB 4Y4KC 1ZLSH 4G8FA 5AAWC 3MJ9A 3RB5A 3WELA 3GRWL 2V9UA 4BA8A 2IBGA 4YHZL 5FFGA 4PJHA 2DWDA 5E8NB 3W0WB 5JW4R 1FNAA 4YGVA 1SDYA 5GS2D 1LO4L 4HSAC 1VFOA 2EYTA 3H2WA 3PQYA 3TIEB 1NCAL 1O6SB 1T2QL 3BVNA 2F58L 1D6EB 2Y0SA 4N9GB 3E3QC 4HCRA 4P4KA 1WGVA 3O81A 4BH8B 4F7CB 4XB7A 5ALBH 3FT4B 1P7QB 5KUMA 5D1ZI 5LNGA 4P2RD 3KWUA 4I9XA 4W6YB 1S9YA 1RIUL 4QYOB 4XXCC 4MDJA 4ZODA 5D1ZD 1ZS8B 4MBOA 5D7JC 3VGAC 1YUHA 2TRYA 1ULVA 1ND0B 5D93B 4EXPX 1JNNH 2ADGB 1HINH 3G6DL 4B9JA 2C1OB 2VWEE 3EJYD 4JFOA 3WMSA 3ZKQD 4PWJA 3NCCB 1EMTH 5EF1A 3UAFA 3V8OA 4WHTA 2WLYA 4NO5A 4IRZH 5AYTA 3DX2A 3ZRCC 1LYQA 1XCQB 1OALA 2F68X 3PPEA 3MFFB 4N0FB 4U2ZA 4CBPA 1UURA 5HY9B 1JXFA 2BY3A 2JQZA 3DVIA 1JN6A 3AAZB 3NRQA 2DQDL 3SOTA 3ZTJH 4IBVA 3W3BA 5I17B 2ZAHA 5LBSL 3T4AC 3OAYH 1MCCA 1IM9B 1NAMB 2WNXA 2B4CL 3BAXA 4PW4A 5H2BA 3SJVE 4AK2A 1R9FA 1MCOH 3CDZA 1JVOA 4B9PA 4MXQC 5I1IH 4JMXA 3D5OF 1PS3A 4LCYB 1MJUH 2Z7WA 1UXSA 4LLMA 1CXFA 1C8PA 2YPLD 1WBZB 3QDGD 1I9JH 2EEBA 2ZJSH 4OLXL 1FE8L 3D87B 4QTIL 4HIEA 1S7SB 2ARWA 4FCHA 4L3EE 4O2CA 1FGVL 1T0NB 4M03A 2I9TA 3D85D 5EU4B 1QA9A 3GSXB 4AVHA 2AEPH 3ZE1F 1XR9B 2ED8A 3QORA 4JDEA 4MMXC 1YJDC 1NMCC 1X5MA 2KC0A 1MJ7L 5FOJA 2GJJA 1NKRA 1MQ8A 3PU7A 5ABZA 3BGFB 4JO2H 5FGRA 3V5KA 3D6GA 4P9HC 3NZHH 2ZP0T 4BFOA 2GJ6B 1H5BB 4J6IA 4L1TA 3U2SA 2XWZA 2DIBA 1UD5A 2XRAH 4JRXB 4DGVH 3HNSL 2AJUH 4DEWA 5E6YA 2CO3A 4X6FB 5D9SB 3A0OA 2JKXA 2WWNA 3FH8A 4YBQC 5E8DL 2MMXA 3CU1A 3MUGA 2MCMA 4F1SA 5B4MC 5JHMA 3FFDB 2YXWA 4FKHA 4GKNB 1BFVL 4JPIB 2N7BA 5D8JL 1KWGA 3RTQA 3GUTB 4P5RA 1KWKA 2BNRA 5CJ8A 1HNYA 4U1IA 4X0KA 3ZE2E 2HKHH 4QUOA 1MH5A 4NBXB 1UATA 3IAQA 3RWCA 3HA0A 4KRNA 3N3EA 1D9KB 2NY7H 3KWWB 1CQYA 5GGVH 1N0LB 1JS4A 5KAQF 3US0A 1MI5E 4DN3H 2R0WH 1VFAA 1VGKB 4IIZA 2NSMA 1NGWA 3MJWA 3DSFH 4GRLC 5BPPA 4RGOH 3GLAA 4CU7A 3LNGA 2P5WB 1ICTA 4X8XA 4P2QD 5CGTA 1A02N 3F58H 2H45A 2WQ8A 4KMQA 2NTFB 1EEUA 1Q72L 3E7JA 3EJTA 3SCMA 5DVKA 3CG8A 1MELA 3FO2B 3MGAA 3SDCC 2RMNA 3HW7A 5AOZA 1M7DB 2VISA 3CLFL 3NYKA 3L3OB 3OKYA 3OD3A 3QQDA 5FKAA 3SDAD 4Z7IA 5AFAA 1MREL 2E6JA 3BP6B 2BVPA 4Y1AE 2I85A 5FHBL 1A4BA 2FGZA 3FQXB 3WKPA 3NH7H 1UGNA 4XC1H 4I4WA 2FEEI 3QWOB 3FT1A 5DK0B 4APQA 5IW6B 2AXFA 4Y2OA 4Y4HA 5GGVY 1FHNA 4X7TB 1ETZA 4RX4A 1KJ3H 1QASA 3CAFA 4U1SA 5E7BA 3VWKA 5CZVL 3GSRB 4M6NH 4HJ0D 4MB3A 4XR8C 1DJXA 1CXKA 3B9KD 1NBVH 5BOZG 1KSRA 2Y1VA 4NZRL 1QYGH 2ZUTA 1IC7L 3SODB 3WFHA 1RLWA 3FB5A 5DJAB 1CLZH 3ZHKA 3WN6A 3AY2A 4XBPA 3KWVA 4F9PA 4NX0A 1J8RA 4BFGA 1S7UB 5C0BE 4JB9L 3C6LA 4BM7A 2B1HL 1YNTB 4LP8A 1B9ZA 3B9DA 2GSGB 5CP7A 3ZVVA 1MOEA 2WKOA 1JDCA 2MOGA 4GAGL 4EOWL 2EYSA 5D4IA 2F1AA 1E8XA 4RISL 4TSBH 5IJDC 3S88L 3GLDA 1NC2B 3DRQB 2WXLA 3LD8C 2X3AA 5ADPL 5C0CA 4A7UA 2K6WA 4H26A 4TTDD 3VH8A 1L9SA 3L3IB 1EVUA 4FJZA 4HC1H 4X5PA 4JFYA 4HH9B 2E4TA 3S8WA 4PJDA 2EDYA 2Q87A 2NRDA 2XCMC 4HWZA 3O6FA 3VXUA 4UTAH 1NWOA 1V7ML 2X6MA 1U6AH 3QIBD 2ITEA 3AMLA 5BS0A 5C6TL 4JKLA 3TJPA 4Z1PA 3D51A 4AUUA 2Y25A 3G6AB 1CFQB 5MEPA 1JHKL 5IQMA 3NJLA 4YN3A 1P1ZB 2OMZB 5C70A 4A68A 3PDGA 1BMWA 3VMPA 4PG9A 2GT9A 3HC2A 3IJHB 1JZ8A 1Z5HA 4N2GA 4BE5A 1P6WA 1RJYB 4HF5L 3T08A 4N2AA 1MW2A 4FQXB 3ARBD 4F3FB 3NK4A 4KKRA 5C0DB 1WF5A 4PJ8B 2R7EB 1E0OB 1G6RL 3FT3B 1BLIA 2XBDA 3VXTA 4PRIE 2ZYIA 3QHFH 3LN5B 3D39A 3SJVD 4GXUM 2X1PA 4S1QH 5HYSB 1MIML 2VCOA 1DFXA 4H2CA 2VLMD 4HV8B 4U6VL 2B15A 4X8CA 5EZLB 5DHVH 2ZUXA 4AGNA 5B1JC 4OFDA 3V6OE 2K6YA 4LOUD 4AM0B 5HYSG 2JXMA 4CVZB 3DJTA 1BECA 1TPXB 3LH9A 4OBSA 1A7OH 1GVIA 4FXTA 4L3ED 3IFNH 2JTDA 1OD7A 3IBEA 4KWUA 1ZLSL 4FMFA 4GP5B 5JOFA 2R0KH 2Q20A 3GSNH 4FNSA 3QQ3B 2X2HA 2BSDA 5CD3A 1CFMA 5E0FA 1ZGLM 1C5CH 1J48A 2VMJA 3DMMA 3AVEA 5EBLA 4U2YA 3ZTEA 4A1RA 1TEYA 4JGUA 2WLZA 3WNJA 1IMHC 1E7VA 2NQCA 3BLPX 1MJJA 2J6WA 3K4AA 2A99A 5CM1A 1ASOA 1MRCL 2Y23A 4C56D 1A6ZA 3FSWA 2JJUA 4YHIA 1SUHA 2HXAA 2ZQKA 2WXJA 2EE0A 3Q48A 3DX6A 1GOGA 5A2KH 1VFUA 5DD6A 2YGOA 4JCMA 3OGCB 1CE1H 3SD2A 1TTAA 1ZTXE 5D1ZC 1JNNL 5DJ8A 1HINL 5DF0A 3MRMB 4G7SB 3FO0H 5HGGS 1NEZB 1M1SA 2K4WA 4Z7UB 3V6FB 1EMTL 2JI2A 3GKWH 3IBOA 1SMAA 3EJYC 1RD6A 2ENPA 3ARFA 4IRZL 4GKZA 5EZJA 4H5SB 4PWEA 1NEZG 5FK9A 4G9DB 4P59H 2X3BA 1F4HA 5LXGH 1BW8A 2FO8A 1DJIA 2FCBA 2X38A 3L9EA 3RDJA 5IHBA 1NCWH 3NAAH 4PJAB 2EDRA 4MAZA 1DL7L 4QRRA 4X4KA 1MCOL 5EBMB 4PUBH 5I1IL 1MJUL 1TTCA 5DHDA 3IJEA 1QABA 1WFNA 3U4EA 4BUHA 3SY0A 5IIEB 1PJ9A 2YMTA 3UGUA 1I9JL 3HRPA 4RFNC 3SGDH 1HDMB 3LTVA 1U8JB 1KYFA 1J0YA 3BGMB 3HZYA 3V6ZB 1CGYA 4GSQA 4PRAB 3HG1E 2ICWJ 4OCMC 2W5PA 1RZ7H 2PNDA 3M7FB 5KVFE 2AEPL 2EC9U 1U42A 5HHOD 3Q7JA 1I7RB 2XXMB 3VDAA 1LK2A 3K6DA 4OLVH 1HXKA 1GKEA 4Y1AD 1WJ3A 4ZRGA 3VFTB 4JO2L 3DA0A 2CBQA 1H3XA 3NZHL 4NKOA 4WJG3 3WIIH 2VRKA 3QA3B 2X9YA 3R18A 3HJ0A 3V5DB 2Z92B 1YEEH 2XRAL 4DGVL 3QEUA 1L7IH 2AJUL 3POHA 5ETUB 3BVDB 3HVNA 3QUHA 1T1YA 3WG7B 5IM7A 1EK3A 4WUUA 4ZQKA 3MXVH 1EFXB 1BG9A 1I85C 2F7RA 4XTRD 3L1OH 1JNHA 3MLYH 4PJHF 5CIPA 5ID0A 2FK9A 5ALCH 4GSUA 5L8JB 2X4OA 4C83B 4KU1A 5D1XD 1TYJA 2AQ3A 3ELQA 2HKHL 4AITA 1G1KA 5DJCB 3Q2NA 3MRHB 1AAJA 4TNVF 2GSIA 5LXVA 2PO6B 1K8DB 4KO7A 2AQ1A 3ZR5A 43CAB 4HD9A 3TYFA 3PV6A 4L9LC 4Z3GA 1T5WA 3TA3A 2Q3ZA 5DHMC 5GGVL 3MNZA 5BV7H 5A6IA 1HK6A 1ZA3A 5GGTA 2ED6A 2VKWA 2W65B 4LCCC 2R0WL 4DN3L 4HWEH 5K9QG 3WLWD 3PLYA 3BEVB 3DSFL 4HXBH 1FH2A 4KH9A 4RGOL 4IYKA 1JXKA 4CJ1A 3UYRH 3KLLA 4RESB 5A7EA 1MNNA 1SJEB 3G5WA 2IQAB 5J89A 4HIJA 1T2XA 1X6LA 1IAIH 1OCOB 2HFGH 4CNIB 1OAKH 2J55A 4OBRA 1X7TA 2LU3A 2F1EA 1IAOB 2APSA 4L8BA 3LY6A 5L2JB 4HJGA 2QSTA 4ZSOB 4X9IA 4D0CB 3S48A 4H7VA 1XCWA 2Z31A 3RDTB 3S96B 4OQTH 4AQ1A 4Y4FB 4G9FD 1VZIA 1QATA 3GMRA 3KM1A 3D18A 5F1NA 5E4OA 1JGDB 5B7MA 1SFHA 5E4EC 4E5XA 1X5YA 2G2RA 3KPRB 1B6DA 2BVQB 1NZRA 3SDAC 2V3EA 3TBYB 2OLDA 4ZAKA 2X1QA 3W0WE 3NH7L 4XC1L 1V54B 1JK8A 1C12B 5AB9A 2JCCF 4OKVB 1WT5A 2VGLM 1YEWA 1KJ3L 1VGEH 2NXYD 1RZGA 4L0PB 3FTXA 4PRID 3W38A 2BY0A 5EBWA 1IGCH 3FPYA 4M6NL 3VFUB 1DQMH 3GWJA 1BF5A 1NOLA 4FAAB 4XPBL 1TXKA 3IDYB 1U8MA 1NBVL 3WS3A 2E5EA 4ESKA 4HJ0C 2MPAH 4MLIA 4ZPVB 3V8CA 1EZVY 3KW8A 3OC8A 1P4BH 1CTMA 3P0GB 4NSKB 4U0RB 3B9KC 1F6AA 5LQBH 3A4FA 4AC4A 1T1WA 1CLZL 4EIBA 1L6PA 2FYYA 2PP8A 4MXVE 5DLMH 2AQQA 2DD8H 5F7WC 4JZJB 3FH5A 2XG4A 1G1OA 1D3CA 2CBMA 4Y19A 5F7LB 4PRBA 4I2XA 4ZMVA 1YEIH 3US9A 1LP9A 1QLRB 3L3JA 4X6DB 4A04A 4TSBL 5DT1H 1DO6A 1WSST 4JVUA 1JGUH 5C8JB 5F7HA 3K6SA 3VB8A 1YRKA 3HR5A 4LLVA 4XCYB 4HGMA 5MHSE 5JIIA 5IB4A 1KJ2H 3IDNB 5I8OH 4HC1L 2PYEA 1NIFA 1N18A 3HNTH 4HQQH 1TO5A 4LHUD 5C9JA 1TQCC 3AXLA 2G9KA 5F1IB 3BFQG 4TTDC 4PD4K 2EIBA 2H3KA 4PRHA 3ABZA 4QMEA 2JIXD 3IU3B 4LHJB 4MD4B 4ZI8A 2IQ9H 5DVMA 1QFWL 4XO5A 1DVQA 4LDLB 2F7IA 2VQTA 2H26A 3QIBC 2FX9H 4G42A 3FO9A 3EBAA 4HIIB 3BH8A 3HHSA 2IPTH 1T4KB 4UANA 4X4YB 2XBZA 3GMNA 5J9PA 5IQLA 2YD5A 4M3KB 5J11B 2XN1A 2YGVA 2HLAB 4HIQA 2FQGA 4KI5D 5E9DA 4F8OA 1ZGLB 1UJ3C 4U1JA 2HG5B 3FTVA 3HZVA 1INEL 1ZHNB 1OD9A 1L6XA 4G72B 3T2NH 3ARBC 3NJIA 1ORSB 4JREC 1HE7A 4OJCA 4U4BA 1CFNB 2GC7C 1D5IL 3BIKB 1JGIA 4L0YA 3JV4A 1OO2A 4R7NB 4JRXE 2NW2B 3QHFL 4LCUB 3CFKB 3GXPA 1KTDB 1BEYH 4OQ1A 4K2UH 4S1QL 4Z7VE 4GQRA 1KXTA 5IQ7H 4XH2A 2DM2A 5DK3A 4R7LA 1IC1A 3CHXA 4X5XB 1BOGB 1P4IH 2BIHA 4LOUC 4M6MH 1BAGA 5LN4A 5CILH 1A7OL 5E00A 3U0PA 1AVAA 4ODHH 3M1BB 3IAGC 3DX9A 3QEQA 3IFNL 2EEDA 2CK0H 2YWYA 1EJFA 2CM6A 1C08A 2GHZA 3ETBF 1AKPA 2R0KL 3FB6A 1BF2A 1XH3B 3QUZB 3GSNL 4R26L 1RH8A 1LE5B 1FQ9C 3EOAB 1PNCA 1CDUA 5FW6A 4JM0A 2YQ3A 4JRYE 1C5CL 1FVCA 2RQ8A 4A6YH 1CFTA 1U92B 3X12A 2OMWB 1KLGB 4L4TB 2CHNA 3SQBA 2LW3A 4CL7A 1Q9OB 2ZD0A 4J3OF 1E9PB 3LKQB 3RG1C 2CRZA 2DRUA 1CMOA 3K74B 1KBPA 1OB1A 5B39A 3UG4A 3GB7A 3WIAA 4I9WD 2WKOF 3KPSA 1SY6H 2VXQA 1EAQA 2JK5A 1FZJA 1MXGA 3G3LA 4TVPE 2AVFA 2WWOA 3IPEA 3MBEA 1CE1L 3CHOA 3OKLB 1DBBH 4PHXA 1H6FA 3BKYH 1VZGA 3SDYH 5I73C 3FO0L 2WLMA 3LVEA 4NN7B 1LLAA 3CCHB 3TC9A 4PQXA 2ICES 3GKWL 4G59C 5JR1H 3CFBA 2GIYA 4XCNA 3BN9D 4KK6D 2IDCA 1ETB1 1QFWI 3OZLA 1EXUA 4P59L 4P3CH 5FO7B 2RACA 2Q8AH 1DJZA 4ZS7H 5LXGL 4M62H 5KVEH 2B5IC 2DY2A 2Z8RA 2H2SD 4TN9A 3KPLB 2X2IA 3NAAL 3ZX1A 2HJKA 4KROD 3EFFA 1P6FA 2OZ4H 3TNNB 4PUBL 3BPCA 4V1DB 4FI8A 3N42B 5EFIA 2B59B 2YD1A 4FF9A 4YC2C 5F7FA 2OPCA 1T1ZA 4NO0A 3OQ3B 1YHPA 5ACZA 1MVYA 3RWIB 3HE7B 5IB1A 3VQ1C 3ATAA 1KFAH 1AG0A 2CR6A 3AY4C 3KYMB 2WKLA 2BHUA 5CFAA 1RZ7L 3THMH 5KJ7E 3WIHH 3GXNA 4XNQA 3DXAB 3UC2A 2HJFA 1E40A 4KO5A 4RMUA 3HG4A 1LO5A 3C5ZA 3ABKB 3N06B 4PLOB 4OLVL 4Q9CA 4EZMA 2E9IA 2BVOB 2VDNB 3WIIL 1QSEB 4AKQA 2AQPA 2F54A 1YEEL 4XMKL 5KBPA 3OJ2C 4QHMA 4HUVA 3GSOB 4ONOA 2N56A 2G9HA 4YVNA 5AKRA 2UZXA 5L4JA 3QFDB 1YMHA 1F4YH 3S3JA 5JPNB 1F5WA 4NJAH 3MXVL 4PJIA 1IV8A 1IE4A 2P8PB 1LEKB 1MIEL 2J4WH 3L1OL 4DKAA 3H4FA 3MLYL 3O4LD 2JB6B 3WIFB 2FWSA 4XTRC 3EJRA 5ALCL 2X5PA 2OL3A 2CKBA 4UU9A 1CLOH 2VDPB 1J5HA 3PUCA 1N8ZB 1TJMA 2HZHA 2L8AA 2DWYA 3WN5A 3FQTA 2P8MA 1V8HA 1I8MB 4Z5RA 1GKOA 1GW0A 1XH1A 5BV7L 1I9IH 2WMPB 2PXYD 3P4NA 1WLHA 3RRQA 1QOKA 4HWEL 4B9ZA 4UT9A 1K5NA 1T5XA 4QKTA 3FU7A 2BNQA 1T22A 2OMYB 4UNVA 4HXBL 4F5CE 3WLWC 4XT1C 3NUKA 5JPMC 1JPGA 3PWJA 3W9EA 2XWXA 3UYRL 1F58H 1J8SA 3DHPA 3D0LB 3QJQB 1FYTD 2XVLA 4FL4C 4BIKA 5FECA 2EDTA 5F96H 2VDOB 3T8XB 3D4YA 1IAIL 3QJSB 1HCZA 1OAKL 4LSUH 4MXWH 2VE6A 4R96A 3CQQA 1HOCA 1AQKL 3HI5H 3WO4B 5ID1A 3MCYA 5AVSB 4Y5YB 5DZJA 1OV8A 3BWUC 2VMCA 3N55A 1OAQH 1TZIA 2BVUA 3FCGA 4IDJH 3MLVH 1BVOA 1IILE 4FRWA 4Z0BH 3O2DA 3QUXB 4NKMB 1E27B 4R0LB 3T0XA 5F88A 3CC5B 1WC7B 5GJSL 4U1GC 4FADA 5CMAA 2H0PA 2OV0A 3DARA 1DQVA 3LQZB 4G80A 1J0IA 1H3VA 3PNRB 4ICWA 4I3RH 3SKOB 2WLJA 3RILA 4QJ4B 1SYVB 3SGDI 1NJ9A 1RIVH 2A3TA 2BS8A 2GI0A 1FZMA 1ZK9A 4MAYD 2B0SH 3U30B 3U48A 3WV0A 5IW3A 3D06A 1U95A 1KBGH 1J88A 1BDYA 1WFJA 1TTRA 1VGEL 3JWDC 5EEVA 3QR2A 2E6PA 4UYPA 5EUOF 1IGCL 3KZ8A 1YUKB 4H8WC 2NXYC 1DQML 5GHWH 1X44A 2YEQA 5C92A 3OR6B 3BRFA 3U9UB 5LQBL 1P4BL 3F83A 1CI3M 1JXJA 4DETA 5HVHC 3RWEA 4D9QE 3ZPDA 1I4FB 1SJHB 1V3JA 1JZEA 3V6OC 4XMPH 1B0RA 2YEZB 3MRRB 4Q7DA 1YEFH 1ZLWH 3IGAA 5DLML 3BZ5A 4P23D 5J6SA 3BSHA 4Z7UE 2DD8L 3STBA 4MQ7B 5SX5H 4HPYH 5E1AB 1AS7A 4BH7B 2GTZB 1R6VA 3A4DA 4K9JA 3WY1A 1W15A 2CIIA 1YEIL 3S36H 2VUOA 3JXAA 1XGRB 4JRYD 3CDCA 1W0WA 3HRZA 3L7FB 1JGUL 2CLRB 3I3BA 4M8QA 4TM9A 1ODAA 5E5MB 3TBWB 3QJZA 2FNBA 4LU5H 5DJDB 2GTQA 4V11A 4PJAE 4PJXB 1KJ2L 1BJ1J 2QVMA 5D72H 5I8OL 5F71A 1FFNA 3HNTL 1Z3GH 2XV3A 3ATEA 4HQQL 4WWKA 5FLVA 3ARQA 4JFHD 3OPUA 1CJYA 5ADOH 2FJFB 1BD2A 2CDGA 4RZCB 2ZTBA 5E24E 4R6UA 1DN0A 4PI2A 1RZPA 2IQ9L 4FQIH 3TYGH 5BO0D 1R0AH 4OKDA 4TVPD 3CZJA 4ZFGH 2FX9L 2CA4A 3GJFA 3DC0A 4MLSA 3RGVB 1I1AA 2IDSA 2IPTL 2YD9A 4QKXB 2IPKB 3CLWA 1DQQB 4ZD3H 1W72A 1IAII 5FHAH 4L23A 4DEPC 3IMBA 4N22A 2HMID 3LQAC 3FONA 4XMLH 2VC2B 4POYA 4PREA 4G8IA 5D70H 1WCBA 2ED9A 2YGQA 4KI5C 2YA1A 4AQZA 4ZFZA 3KLAA 3T2NL 2OA9A 3U36B 5DMKA 2BSTB 3MV01 3IDGA 4JBSA 2APVA 2WO3B 4O51A 5F0MB 3ZTCC 5LGJB 4M8UA 3AXIA 1BEYL 1W0VA 3Q2LA 1CXHA 3HB3B 4K2UL 4YXHH 5HHQB 4RRPG 5GS3A 3ZN6A 3EW3B 1K6QH 3CFEB 3QIUD 4TVUA 1P4IL 4M6ML 4GNKB 3VG0H 5CILL 4P5TB 5B38A 3Q2WA 1E5AA 4ODHL 4AQEA 3BO8B 5K9KA 4IBWA 4FLQA 2CK0L 5D96B 3GZOA 4WI6A 1ET7A 3CWGA 1ZVYA 3NQIA 1AKJB 5A2CA 1L0PA 1G7QA 1B9KA 4A6YL 2OMUB 2BP0A 1NUFA 2ICCA 2F74B 4ZTPH 1DVZA 2DKUA 5T5NF 3QDJB 3QXAB 5C3TA 3EGDA 3EYQD 4BQ6A 1F2XK 2YPKB 4N85A 3E6HB 3U7WH 2IWEA 5EU5B 3Q8BA 1OP5H 4GI6A 5AAMA 1Z9NA 1SY6L 1RK0B 1A4KA 1P9MC 2EDHA 2MKLC 2P26A 1UZGA 3T8MA 2CCVA 5LVEA 4J4PA 1MCKA 4ZSOE 4XPFH 2D8KA 4Y9GA 1DBBL 3VGFA 3BKYL 1HQ4B 4XNBA 3SDYL 5JDJA 4M4RB 2ZOWA 5EC1A 1ZEAH 5EC2A 2NQ3A 3KS0J 5JR1L 2CDFA 2VDRH 1S9WA 2QADD 3VXPA 3KPRE 1GYUA 2AMUA 4QRPB 3FYIB 4TNWF 3SHSA 4G8FB 3EOBA 4P3CL 1X7QA 2Q8AL 4ZS7L 1CXIA 1HILB 3BN9C 4KK6C 4GW4A 4M62L 4R97C 5FYJH 1NM9A 5FS5A 5KVEL 3L9YA 4PJHB 1BZ7A 2JKJA 4YGVB 3VMNA 1AQDA 2YOAA 3HUJA 1X4YA 2H2SC 1N0XH 2OZ4L 4GI8A 3BVNB 4P4KB 5E56A 2EH8H 4KROC 3BX7C 4N2DA 2B1AH 1JYWA 4DPCX 4MTMA 4XC3H 1KENH 1ZDSA 2O6FA 4TKWA 3TU6A 3MA9H 4HG4J 4BSVB 1S9YB 3CSFA 4MDJB 2K3TA 3WJLA 5D1QA 1MFNA 3DYOA 4ALAL 1KFAL 2PETA 5FYJU 1YUHB 1J5DA 2VM9A 4DO6A 1Y6KR 5FUOH 3THML 3WIHL 1IE5A 3KHQA 2OCCB 4PVMA 4JFOB 4DZBA 2CR3A 3KPMA 3V4VA 4AWJC 4PB0H 4WHTB 1QAWA 2XWBA 4NO5B 2JLPA 1G9MH 5TGBB 1A6AA 5DQJB 3U0WH 5L2KA 1E6OH 2WP3T 3Q13A 1JN6B 4OF5A 2AVGA 2CU9A 3BUQA 2B3RA 1F4YL 2N4IA 3LMJH 4D7PA 3CUPA 1V3KA 4NJAL 2HPTA 3OKOB 5H2BB 4C58B 2J4WL 1JPSH 3CDZB 2Q76A 5A43C 4A37A 5JA9A 3N44B 1BIIB 3LNEA 4QCIA 4FYRA 4XVOA 1UXSB 2F1BA 4LLMB 4WV1A 2PPEA 3EAKA 4DTGH 3NSYA 4YR6B 1C16A 3E8UH 4JCLA 3X14A 3BFOA 4MJID 2VXUH 4AE0A 4HIEB 4O2CB 4W9CC 3DIVA 2I9TB 1A3LH 1VSCA 5K69A 3PCYA 4YZFF 1I9IL 5IEHA 4JDEB 3QORB 4PGCA 4NOBA 3IGFA 4MDRA 5D7HA 5T3XH 3X1GA 4D8PB 2E76C 2WCSA 2BIIA 1GSMA 3FL7A 1BZEA 2FQEA 4LP5A 3II2A 4KMTH 5I0YA 3JZYA 1KTKE 2ADIA 3SPCA 2EXWD 1TJHH 2YD0A 4GH7B 4M4PA 5B3NA 1AXTH 3V5KB 1F58L 3VGDA 2WLLB 3CXHK 3MREA 5M95B 3NIFF 2Y3AA 4QHLB 3QG6A 5F96L 1Q0YH 1RVFH 1MCEA 4IKLA 4MXWL 4LSUL 5IMKB 3HI5L 4U0QB 5DMJB 3FQUA 3MUGB 1KIUA 5FWRA 1T1XA 3VRLF 4IDJL 1SOKA 3MLVL 1BLNA 4GUQA 4Z0BL 5IGXH 2WUCH 3CPLA 3MKGA 5EOCH 5GZOA 3CVBA 1MCDA 2BNRB 1A21A 2XVBA 1SEQH 4U1IB 4X0KB 2F6AA 4AEHH 1MH5B 5BCAA 4I3RL 3EF7A 5LAXA 4ETYA 1QRKA 1NTDA 3PHSA 3I6KB 1NA8A 3LOWA 3I9IA 4P5KB 2VW6A 4L4TE 1F11A 4JM2F 2HT2D 3H3BC 4RGNE 1KBGL 4HCGA 4KHTL 4WO4A 4MAYC 1EHAA 5DHXB 5IMOB 4HHAA 5GHWL 4PVBA 4MNQA 3HN5A 4RBPK 4X7SH 3ARPA 4X83A 3ZE1E 3UZVB 3ZKXC 4FABH 3FQRB 2MCPH 4OI9A 4AL8C 5C08A 1D5ZA 4P46A 1GOHA 3SCMB 1YPZA 3B6SA 4XMPL 2WQWA 3I6LE 1YEFL 2A9BA 4DP7X 2X4UA 2F08A 4U1MA 5IW1A 4A2FA 4HPYL 4APXA 4P23C 3L9RA 3DV4A 4B5ZA 4I13B 4AOFA 3QQDB 1QFOA 2Q7YA 5FKAB 3S36L 4B9CA 4UDTA 4AG4H 2P5EA 3W39B 4HS6A 2BVPB 2X4QA 2YHGA 3NFNB 3FU8A 4D9RD 1CCZA 3ZDYF 5JIMA 4LU5L 5JHLA 4I4WB 4N2BA 3FQ2A 5D72L 2EDQA 1Z3GL 2XN0A 4YDLB 3FN9A 3ARDA 2VYRE 4Y2OB 4Y4HB 1CBVH 1J11A 2BMKA 1KGJA 4V1DE 1CQKA 1ETZB 2VLRA 4U1SB 5ADOL 3WFCH 2QMJA 3I9AA 5A1AA 1FBIH 3TYGL 4FQIL 1R0AL 4BKLB 3AQZA 1JXDA 3IVKA 1X4ZA 2CHXA 3L2NA 2H7WA 1KYOK 4GUCA 1YEDB 3ECBA 3LS4H 3WUZA 4O9HH 4ZFGL 1Z1WA 1F8TH 1WPCA 3VWJA 2FZ3A 1BXXA 3WFHB 2LFGA 2FJHB 3FB5B 3VTTA 4ZD3L 5FHAL 3DXAE 2V5MA 1HI6B 3MV8D 4U1HA 3L3OC 4XMLL 1MHEB 1FN4A 1JPST 3C6LB 3V0IA 1X9UA 2IOMA 5D70L 2HX9A 2HMIC 1N9PA 3LX9A 1JZ4A 3SPVA 3GS7A 5CP7B 1E5ZA 1QSEE 4JO4H 4KDWA 1DCEA 5AB0A 5HYJD 4P2OD 2XNAA 1XQ4A 1ACCA 2IGFH 4AVKA 1CIDA 1W8OA 3TV8A 4YXHL 5E6IA 5C0CB 1OTUD 1CR9H 5DS2A 2F15A 5A2JH 4JFYB 4ELMB 1K6QL 4PJDB 3NK3A 5EEYA 1YEGH 2NY5C 1HWWA 4HWZB 3O6FB 3VXUB 4ODWA 2X0UA 5CGMA 4TNWK 3VG0L 3ZQXA 2ZCLL 3DLQR 5BS0B 1KJMB 4NRYA 2O61A 5MEPB 3C12A 1AGCB 4FA7B 3RIAK 2BVEA 4UOJA 3IDMA 1SVZA 1ZIAA 1INQB 5AZ2H 4MD0A 3RHWF 3VD3A 2GT9B 1TTBA 3ORJA 1NBQA 2NY0B 3IAPA 5K9OB 3B2MA 2R56H 4S0TD 3ES6A 4ZTPL 3WDIA 3ASNB 3OZKA 3P4LA 3ARED 4RAVB 5LBGA 2V7NA 1H8OA 5A40E 5CLWA 1G4MA 1S6NA 5IMLA 3HLKA 3U7WL 4FHBD 4Y4KA 2CLVA 3EYQC 3GNMH 4K71C 3VXTB 5AAWA 3D39B 4GFXA 1EJ8A 2MCG1 2KMWA 3CVHA 4XNDA 4TLTA 2BSED 3ULAB 1JWMA 4GAJH 1ZEAL 3HR6A 3IJYA 4JPVH 3UFIA 1I3VA 1YY8B 1Q94A 2VDRL 1N5YH 4NRZA 4XXCA 1AGFA 1VHPA 2QADC 5JOFB 5EH1A 5FYJL 5D7JA 3ZDXF 3FTUA 5DI8A 1PZ3A 3MLXL 4LEBA 5H8DA 3O2VH 5CD3B 3VFWA 5EBLB 4YNYA 3GEFA 4JFDA 1N0XL 4X9FA 4U1NA 5SWSD 5E03A 2EH8L 3BAJA 1ADQH 3J27A 4RSVA 4FQ2H 4ZMXA 4XC3L 1M2VB 1KENL 3IS1X 4LQFH 5CFHA 1BM3H 1J05A 4K7FB 3EYUH 3MGOA 4G7YH 4GW1A 2L04A 4JS7A 5DD6B 4OU3A 5T3ZE 3X1FA 1AGDA 3T4AA 1U8LA 5EMYA 1UENA 5IROA 2OX5B 5FUOL 3QIWA 3LKPA 4OFQA 4R7XA 3BZDA 5DJ8B 4BSJA 3IXTA 1T20A 3O8XB 1WK0A 4FFVD 4N1EA 1JCVA 1ZWIA 2NZ9D 1CI5A 4PB0L 2CLZA 3ARFB 1BP3B 1G9ML 2GTWA 5EZJB 5FK9B 1CIUA 4LVHC 1VFBA 5ECJE 3U0WL 1P0SE 2WW8A 3HC0B 1E6OL 3OMAB 2EDXA 4WU7A 3PG2A 2GPZA 2F5BH 3Q6FA 4ENZA 2X9ZA 1TJIH 5EUKB 1R5IB 4RGND 4PJXE 5IHLB 3NN8A 4PRPA 1MN4A 3LMJL 4POUB 1W9XA 4WFFD 2GBTA 4MMXA 5FYLD 4HK0A 4QRRB 1N2RB 1JPSL 5GS1C 1RK7A 4U31A 4JHBA 2BP8B 2H32H 5HGHA 2H3XC 4MFHA 3V7AG 1HH9A 2Y7MA 3IJEB 1IEHA 3CIAA 4Y7MA 3U4EB 2XWJA 3SY0B 4DTGL 3E8UL 2NMSA 5E8OA 2VXUL 4KH2A 4A2GA 3ZYZA 1M6UA 5IVXF 2UVEA 2IV9A 3HZYB 2YN3A 3BN3B 4P2AA 1A3LL 3OSVA 1UUSA 5I6NA 5DQ9A 5I1EH 1QG3A 1G0XA 2EZ0D 2O93L 5T3XL 4CC1A 4JQVC 1HC1A 4JGJA 4Z0XA 1URIA 3REWB 1LK2B 4KV5E 5AVZB 1NDGA 4E9XA 1AXTL 5DDHA 2E9JA 3UO1H 4NKOB 2EXWC 4BQBA 1YECL 4KHXH 1Q0YL 1RVFL 1UKTA 2NR6D 2XTJD 2FGWH 3VUAA 5IM7B 4WW1B 5D2NE 3H56A 4ZQKB 1IT9H 1AZCA 2W88A 2B8OT 4ICXA 3PABA 1JNHB 4LHQB 4OCLC 1NM4A 3HUJF 3P69A 5IGXL 2WUCL 1G1YA 5EOCL 4FTVA 3C09C 2X4OB 4H1LH 4NQEA 1SEQL 5J1AA 2WYHA 5DK2B 4AEHL 1CYWA 4M93B 4X4XB 5I5RA 3K81A 1BVKB 3T1FA 3ALWA 2FLMA 5AL0A 3TEUA 3CSYB 3TYFB 5GRWA 3MNZB 1ZTXH 1EZVX 2JI1A 3FOMA 2J6EA 4L4VD 3SDCA 2XETA 3QDJE 3D30A 4KTEH 2HT2C 4IJ3C 3ARZA 5DXWA 2A73A 4E9VA 2YZ8A 1HXYB 4X7SL 4F9LA 5HXMA 1E43A 3IMSA 1KJVA 1ZE3H 3GZPA 4TNFA 1NFDB 3TBTA 2NYYD 3ZLQC 2NY6D 4HIJB 4LSQH 4FABL 1ASPA 1MFCH 3JBG7 2MCPL 1ZT1B 4OW6A 4PWFA 1UKQA 3ZSTA 4ODXB 5F7DA 2CBOA 3GQFA 2Z31B 2DJUA 4PLNC 2ZYSA 4AQ1B 4AY0A 4ZW6A 4K3EH 2XKUA 4LF3A 2YIHA 3GMRB 3D18B 5F1NB 3PRZA 2AXJA 2EIDA 4QRPE 5KYYA 3FOLB 1OSZA 4AG4L 1MCRA 2BXYA 5IQ9A 2G2RB 4LESA 3V4LA 3A23A 3DO3A 4BZYA 4OH2A 2ZXWB 4ZAKB 4PJHE 5D7LB 4A66A 3BD5A 43C9A 3MRPB 4U6TA 2ZX8A 3PQYE 5KVFH 3KXFB 4X4ZA 1CBVL 1M9WA 4HKJA 1RZGB 1WDAA 4DGYH 1FBIL 1U41A 4WI4A 1FSKC 5EBWB 4LGPB 3TPUA 2ZX5A 4JQIA 4NN6C 4QRQA 4EO5A 4GAYA 3LS4L 4O9HL 4LSSH 3MRLA 4B7IA 7CGTA 1F8TL 1XSJA 3SDDD 3I84A 1F6AB 3K8LA 1FPTH 2VR6A 3CSTA 3IJ9A 4TRPL 3V4PB 1IFHH 3CBJB 1T1WB 3BUIA 4BCXA 2DKSA 2FYYB 4WFHD 4ZZFA 5DVPA 5BQDA 4Y16D 1HWGB 2XG4B 2UY7A 4Y19B 1RHHA 1MZYA 1K9TA 4P5MA 5E08L 1U0QA 5E94B 2BDNL 4I2XB 3DDGA 4JO4L 1LP9B 3L3JB 4X6EB 2TSBA 5C0FA 4ZXBD 1J9TA 4HJTA 1BPLB 4JO8A 3K6SB 1QBLH 2IGFL 2W1NA 4LLVB 5KSBB 1JD9A 4P2OC 3TJEH 3V0VA 5IB4B 1CR9L 4HHWA 4WI7A 2P42B 5C9JB 4NC1E 5KVDE 1S7XA 2K1MA 2WCGA 5KJ4A 1OTUC 3VNYA 3AXLB 5D7SH 5B7EA 2QQLL 4L18A 1TFHA 4GBXD 1WAAA 3B4NA 2R4SH 4GXFA 4H44C 3D3VD 1GRWA 3L4YA 4KJWD 4TUJA 4Q9QL 4B9YA 5T3ZD 1N68A 2H26B 4QYAA 5E8EB 4PU2A 4Z3FA 4G42B 1WA0X 2VZVA 3FO9B 3GJFK 4N6RA 2WQXA 4DEUA 2XZZA 1UZ8A 2A6JA 4QOKA 3Q8AA 5J9PB 1NBZA 5AZ2L 1WVZA 4F2MA 1V7NH 5JHDD 4OZGA 5B1JA 4BUQA 4G8GB 1EO5A 1UB5B 5DCCA 5EDSA 5E6RB 4EN3D 2R56L 3UJJH 3ZTDC 3BYYA 3HZVB 5T1KA 1TMQA 3KG5A 1I1RA 1A7RH 1VENA 2A7BA 3H9YA 4M6AA 2WLIB 4AE1A 2VDLH 1NIEA 4QHKJ 3AREC 3GNML 1FC2D 5DZNA 1K85A 3CN2A 3JV4B 5DC2A 5JIDA 4KRLB 3U83A 2FLRT 3NPZB 1K2DA 4ZUWB 4TL5A 4JR9H 5JORA 2LFEA 1KXTB 4XH2B 4IQHA 2EDFA 5D5MF 5C07D 2RALA 4UMSA 2BNRE 3UEZA 4NP9A 4UZGA 5AB1A 5E00B 5JYLA 3VACA 1EO7A 3DX9B 2ZPKH 1C08B 3LNFA 4G5ZH 2E9BA 4P2RA 5CLTA 1OEZW 3FB6B 1P53A 1NKGA 3I6GB 1X4XA 3HZ3A 3O2VL 5D1ZA 1FO0B 2LE9A 4LCIH 5CN1A 3KDMA 2WTRA 1X3DA 3OJDA 4K73A 3X12B 5C71A 1SDDA 2C9VA 3OBAA 3SQBB 4FULA 4JHUA 5CEZE 2R1WA 3F62A 1DLFH 2PPDA 4JFZH 4FQ2L 3KYOA 4K15A 4OUUB 4ECNA 1B90A 4LQFL 2CXGA 1QMUA 5HJ3A 4X80H 1LEGA 1H0DB 2EVFA 5B39B 3GB7B 1BM3L 2D73A 3KPSB 3G5YA 3EYUL 4HPOH 4G7YL 4LLUA 2JK5B 3WHXA 1FZJB 2VOTA 3CU7A 4O2EA 3LRLA 4RNRA 5IF0A 5JUEH 4H8UA 3MBEB 3P3YA 4MJHA 1NAMH 3V0WH 4ZO7A 4R84A 5B39G 2NY1D 4OCSH 4UILH 3PF2A 3UZEC 1MCSA 4LPYA 3TESA 1F13A 4FFVC 3CFBB 4XP9H 2ZP8A 4E0RB 4KMLB 1F3JA 5LGKA 4XCNB 2NZ9C 4WWPA 2BH0A 1SJVA 5GGQH 4BSWA 4TPRH 2XIBA 3VO0A 2YPLA 2DEXX 3GM0A 5EU6D 3QDGA 4GO8A 5ABAA 1E9OA 1TJIL 5BUGA 4HJ1A 2DQTH 2ADYA 1OB0A 3D69B 4OSUH 3V0AC 1UG9A 1CL7H 4RGNC 3U0TA 2HJKB 3FQWA 3L9BA 1CICD 3JYCA 2YUZA 3IMRA 4G3YH 3BPCB 5EFIB 2DQEH 1T1ZB 4FC3E 2Y7LA 4NO0B 2EAEA 4X5RA 3EH1A 4AQ8C 1D5XB 1J18A 5J0BA 3PS6A 3WNKA 4R2GD 4OF8A 1TTUA 1KULA 2PN5A 3NRPA 1T3FA 1I85A 3OKDA 2A5UA 5I1EL 3BUYA 4XNQB 2KDGA 3K4DA 4W9DC 2EH7H 3A4AA 1LO5B 2APTA 2EZ0C 2X10A 1RUPL 1WTGT 5GGRA 4A55A 3CH1B 1PX8A 3UO1L 4QRFA 3D0VA 3PQYD 1I7UA 2Y6SD 3IJ8A 4HUVB 2IAMA 5C0CE 4L9LA 4EKJA 1CO1A 2G9HB 5B3JE 1FFPA 2ADJA 1YMHB 2RH0A 4N2MA 2NR6C 2XTJC 3JTTA 4LCCA 4PJDE 4PJIB 1IT9L 3KH3A 2VQUA 5GZND 3BAYA 2OMVA 4OJFH 4PBWD 5DO2D 3W82A 1II4E 4UQEA 3VXUE 3PXHA 4XCEA 5HYQA 3QPQD 1JF5A 4Q74A 1EQWA 3AU1B 1UACH 5BS0E 2BVTA 2CKBB 4UU9B 3V0HA 2V5YA 2FO1A 4MB4A 1R24B 2WP3O 4NUJB 4P2QA 4YHLH 2P8MB 5C0ND 2ITDA 4Z5RB 4J2QA 4TVPH 3HAEA 1MUJB 1QI3A 5IFHH 2DYRB 4DKEH 1TZ8A 1A9EA 3HFFA 1NH6A 2OJZH 3VX0A 4D0DA 1ZTXL 3P4NB 4MSWA 3CHQA 1ZD6A 2CCWA 3FFCD 3SE6A 1T5XB 4PJGA 3UBXI 3FU7B 4K3DH 5JQHC 1T22B 4KTEL 4FN0A 1MKFA 2EIEA 2AV1B 2GAZA 3FSAA 1JPGB 3PWJB 3W9EB 1MHPH 4JPSA 5C0JA 1BBDH 3GBMH 3NJNA 2QHRH 4N28A 3D39E 1UEYA 3RX5A 3SDAA 5FECB 3MLUH 2IH1A 4LSQL 4OGZA 1REIA 4AW7A 1EBAA 1MFCL 1GZHA 2VE6B 2DBJA 2NYYC 2NY6C 5JLZA 4AT6A 5CP3H 1WWBX 3K6FA 2IPUK 4FNTA 2O1AA 3MOBH 5A2BA 4ANXA 1TZIB 2V37A 1Y0LB 4G6FD 4K3EL 1I75A 3JUYA 5IP4A 3CC1A 2JSFA 1PZSA 3RY6C 3QZWA 1MLCA 5F88B 4ZX5A 2I69A 4TQEH 5CMAB 4MA1C 3TPKA 3DUHA 3FXIC 4D3CH 1KB9K 4F37K 2WC7A 2YAMA 4LDOB 4F8TA 3D52A 1UXWA 2QSQA 3ESUF 1CDJA 3BUTA 4OGQC 2BCKA 5KVFL 5LCVH 3VE0A 2VDQL 2BSBA 1U95B 5CCKH 4CUCA 4DGYL 1GS7A 3MUJA 5DS8B 1PFOA 4Z3HA 4JUTA 5TE6H 3MC0A 1RUMH 4EEEA 4LSSL 1CUOA 2IH9A 2CDEA 1IGTA 1FPTL 3RWEB 3RTQD 1L9TA 1FIEA 1EAPA 4MMZC 1IFHL 3SDDC 2BXZA 4RAUB 1B0RB 3BPOB 3IGAB 3S36X 3OAZK 2VM4A 3BW9A 3FUJA 1MCQA 2APBA 4OVUA 4YDJA 2B9BA 4WDIA 3FT2B 1NBYA 4KVPA 4HFWA 2P9RA 4Y16C 4WW2C 2CIIB 5D7IA 3QIBA 5E5LA 3PIQA 4BE6A 3TN0B 5FUZH 3EXLA 3NIGB 3RQ3A 3HRZB 4M8QB 4JKKA 2IWKA 3OKMA 1BAFH 4J39A 1QBLL 4DQOH 3ZR6A 1KBWA 1G7MA 4ZXBC 3TJEL 4IOSD 4GMSH 1MCFA 2YAPA 3KYKH 1FFNB 4QRRE 1OCRB 4JPWH 4WWKB 1UJ3A 3LPWA 4OZFA 4CDHA 2YAEA 5D7SL 2OXGA 3RURA 1NFIA 2CDGB 1W91A 1DN0B 5IFAH 1L9NA 1OF2A 2R4SL 3BHBB 3H4HA 4GBXC 1O5DT 5CEYA 1QACA 2HYMA 1DEEB 3GJFB 1JJUA 3D4GA 4KJWC 5GRYA 1I1AB 3D09A 4GKOA 1WGOA 5IB5B 3K1DA 1THAA 3MZGB 4I18C 3X2QB 1AMXA 2VLJD 4N86A 5IVZB 2MWCA 3OLIA 4GRWF 2XT1B 3WY2A 3UJJL 3IN2A 2UXGA 3L4CA 4G8IB 4HIHB 3B7RL 4YBLB 2A77H 4ORZC 3RYMA 4EN3C 1A7RL 4DP5X 1O7DE 2WJ5A 3OAUL 2VDLL 4G70B 1K72A 2D9CA 1OAJA 2MQGA 5DMKB 3IDGB 2H41A 3N1PC 3V9FA 4O51B 1L0QA 3LXUX 4APQD 2ZOLA 2EECA 3V2AR 1HZLA 2RQEA 3VWKD 2ESVA 4WUUE 4JR9L 1R3LA 3AWFA 1SUJA 2JKSA 2WNGA 1A6UH 2DLGA 4LOFA 1KTCA 4NT6A 4Q9BA 2A74A 2RD0A 3E9UA 4MX7A 4YDZA 5CCJA 2ZPKL 4OLUH 4PCYA 3T3PF 4G5ZL 4C56A 5IQNA 2VRQA 5F1KC 5AW4B 4OV5B 3HBQA 3CX5K 4XNYH 3GDBA 2P8LB 1Q0EA 2BP0B 4HK3J 4ZMPA 4LAJH 5M94B 1DLFL 4JFZL 4LIQH 1IBBA 2XPGA 3EGDB 2HT4D 2E7LC 3VG9C 1MFVA 4KKPA 3KPTA 1J1PH 3WSQL 3E9TA 3ZL1A 3NZUA 1CFSA 5L9DH 4HPOL 1Z66A 1MFUA 1A4KB 1AG6A 4NFDA 5D2NC 1IBDA 3IRCA 5E2VH 5JUEL 4U6HA 1AIFB 2GUOA 4KFZC 5DRWB 4ABVA 5BUPA 3V0WL 5DRXA 2KDYA 5BJTB 1BQUA 3GTNA 4OCSL 4UILL 1WWWX 2V17H 3NJJA 5EC1B 3MV9D 2NY1C 1ODUA 1J9SA 5KS9A 4NQTA 3HBGA 2CDFB 3DUUB 3KE0A 1VESA 3Q06A 5GGQL 3LZRA 4TPRL 5IV2A 3EOBB 3P4OA 1X7QB 1A7QH 2NUPA 4GW4B 2QPUA 3QNFA 3AY4A 3KR3H 3MLPA 2DQTL 4OSUL 3L95A 4OZ4A 3G6JB 1RFDH 3WTSA 2N0MA 3M1OA 3KXFE 3QYCA 5DZ9A 1CL7L 1AQDB 3HUJB 4HOXA 3Q0HA 1G6RA 4GEIA 5C09D 2NLJB 1IBGL 3MRCA 1GGCH 4G3YL 5HHOA 3CFQA 1WA1X 4XAWH 3PDDA 4YHYC 2A9AA 1CICC 3EDJA 2DQEL 1XXDC 4LLDA 2WXHA 4RQQA 4XE5B 3S3PA 1IZJA 5AW0B 4HOZA 3FJTA 1VRSA 5DHVB 3S2AA 3QB7C 3G08A 5D1QB 1Q9LA 4FQJH 3QK0A 3IMUA 3LIUA 1E90A 1EGJH 3CFMA 4QRBA 2WZ6A 2Y7QB 4WKZB 4R2GC 1BWWA 5FC9A 1SHWA 4Y19E 4CADA 4DZBB 4F91B 2EH7L 5SWQA 2I07A 3KPMB 5AW7B 5H37A 3V4VB 2ZAGA 1BYNA 1K4DA 4I2XE 2XWBB 2UY6A 1LP9E 2EKSA 1A6AB 3DMMD 3WMPA 5FB8A 5D1XA 5L2KB 3BQUD 5KYUA 4LOVA 1XL6A 5KSBE 1KIQB 1FI8C 2F2HA 4WU5B 2FAUA 5SWZD 2J73A 2PYEE 2Y6SC 4QHPA 3CUPB 3UEQA 4URKA 3B5TA 4YAQB 4OJFL 4ABWA 3EO1A 1LM8V 4PRHE 1QHQA 2Q76B 5CJ5A 1VEPA 5GZNC 1IZKA 4U4IA 2Q8BH 1KIRA 5DO2C 3ULVD 5JPMA 4G8EA 4QCIB 1UACL 5JYMA 4WV1B 3AXHA 2P24A 3U7AA 3QPQC 5FO8A 3PDOA 3VGEA 4GKLA 1C16B 4X2UA 2ZSVA 1TQVA 4HWBA 3BLKA 5DD0L 4YHLL 3K2UH 3TLRA 2WQAA 4WTZA 5EO9A 3HI1B 4YHPB 2CRMA 2FE0A 2OJZL 5IEHB 5ABDE 5C0NC 1MCNA 4IRZA 2EABA 5DYOA 2X53A 2YEVB 4OZHB 2A6KA 3L3KA 1M05B 4K3DL 3WD5H 2F53B 1S8DB 1YMMD 2ADIB 1UQSA 3QO0A 4G9FA 5KN5A 1I8KA 3S3CB 3RA7H 1WBYA 1OE2A 5EN3A 1BBDL 3GBML 3WUWA 5DTFA 2PCYA 2QHRL 4GW5A 2ZSWA 4MA7H 3MLUL 2VIRA 4HUWA 1QR1A 4U1LA 4AYGA 4PJ7A 2WXNA 1BXVA 4JN2A 5TQ2L 4PJEA 2XZCL 3TZVA 4YSCA 4MQXD 5IKCA 3WU1A 2JWYA 3MOBL 1BFSA 4DCQB 1T1XB 4OJYA 1CL7I 1OM3H 5INDB 1NCUA 1T6WA 1BLNB 2M83A 1VFMA 2VXTH 3EHBD 4YSSA 1CLYH 1BZ8A 2IPUG 3B34A 2HJLA 3QEQE 1VPOH 4TQEL 4WUKH 5K1VA 2AQNA 2AJZB 1PEZA 5DR5H 5F1SA 3RZCA 4F1ZA 3FU3A 3GRGA 5LAXB 4D3CL 4YIQA 3S35L 3NGBB 2ZNWA 3MLZH 5C0IA 5LCVL 2YN5A 1H6UA 5K39B 3X3GH 3CX5J 3VI3A 5CCKL 1AO7D 4WO4B 3EYFB 3T0ED 1E2WA 3QWNA 4MWFA 4O02A 1OE3A 1KTLB 4MNHA 2BRRH 2VSCA 4WUUD 2H1XA 1SHXA 3KPSE 3BP5B 1RUML 4HS3A 4YZFE 1XGPA 3VRIB 3O4OB 3TNMA 4H2AA 3EOYG 4ACTA 5H94A 2GW5A 1FG2A 1D5ZB 5TDPA 5F6IC 1G9HA 1WTLA 3BPLB 4EMZA 2GK0A 1YPZB 2KUTA 5DJYA 2W60A 3RTQC 3VI4A 3TO4B 3ME0A 2X4UB 4U1MB 5ERWA 4LHUA 4MB1A 2GHWB 3LHAA 2LQRA 4APXB 1FL5A 2D3JA 4JVPA 5EU3A 2ZUQC 1GZPA 1SEBA 3L9RB 3DV4B 5KZCB 3QJTB 2Q7YB 1UVQA 3TA3D 5I1GH 4DGWC 2P5EB 5FUZL 4HS6B 4RCAA 5TK2A 2XQBH 5JO5A 2J1WA 4NWUH 1M3IA 3P40A 4G1MA 4GMSL 3EIFA 1OGAB 1UWXK 3KYKL 2P47B 4JPWL 3ARDB 5F7MC 4AENB 3ZL4L 5AYUH 2DMKA 5IFAL 3DGGA 4PJGF 5IHUL 1I9RH 4K94H 4WKXA 3IVKB 4ZUSB 2CO6A 3ECBB 3QVAA 5DWUH 1GGBH 2FZ3B 3P3UA 1NPNA 3TCLA 4F7MA 1B4JL 3UACA 1M6OA 5FR3A 1HIMH 4ONHA 3VGBA 4WENB 4U1HB 1FN4B 2A77L 2NTSP 2NW3A 1V55B 4AW4A 3PGDA 3TF4A 4M5TA 2E7BA 2XWDA 2Z7YA 4PGBA 1QWHA 5TH2A 1B0WA 2F54E 2VMEA 4ELDA 2UYLA 2XNAB 2YOCA 4FFZL 4IMLA 2TSAA 3EFDH 3PV7A 1SM3H 5SV3A 3GI8H 5E6IB 4APQC 1HZKA 4PJIE 3LH2L 4HDIA 2AW2A 3VWKC 4LSTL 1R75A 1A6UL 2HAZA 5JA8B 3Q05A 3WFEH 4ODWB 2R0ZH 3FUMA 3ZDYE 3F7QA 4NZTH 1TQBC 2O61B 4OLUL 1QPPA 3RPBA 5AVQB 2DQIL 3FMGH 4B9FA 2PMZA 1P9MA 2H8PA 1CGXA 1RU9L 3Q3GB 5AUMA 4MD0B 1FGNH 3OV6A 4CC4C 4XNYL 4OZIA 3RL2A 2BNQE 4KK8D 2HH0L 3ES6B 4DN4H 1JAEA 1L9OA 4PJBA 4LIQL 5IJVA 4JAMB 4N8VG 5JZ7D 2V7NB 2GK2A 1LNUA 5IMLB 1JF1A 2Y6TE 1J1PL 2QELA 2CLVB 2PYED 4Y4KB 3WKYA 2HT4C 4HC1A 3MRIA 4BRVA 4EIGB 5L9DL 3O0RH 5D7IF 4PRHD 5E2VL 4EPSA 1MY5A 4KFMA 2PR9A 2FTAA 1WEJH 1XAUA 4ZUUA 4FJ6A 5BRZD 3RI5F 3K71B 3QYNA 4F7PA 1KPRA 1JWMB 4ERSH 2V17L 3KDPB 2LU7A 5B1CA 3ZBMA 2OR7A 2PF6A 4I0PD 3EXJA 2XBTA 2IALA 3VA6A 5FO2A 4FG0A 3HE6D 2XTSA 1A7QL 3Q9QA 4FQXD 5E9DD 3VCLA 3FO1B 5D7JB 3KR3L 3VGAB 5DI8B 1TLKA 4NNPH 5AVUB 4YLCA 1RFDL 3VFWB 1L4IA 2HG0A 2UXTA 2B7DT 4YNYB 4JFDB 1PZBA 2Y22A 3QAQA 1PAZA 1GGCL 2TAAA 3IDJB 3U9WA 4K8RD 3EYVA 3FTGB 4Z9KB 2VDNH 2DQFA 3VSVA 1JD7A 1HSBA 3CZUB 3MGOB 3JWNE 4GW1B 4MB5A 2WLKA 3QUYD 4GFTB 1JZJA 1AGDB 4FQJL 1U8LB 4NCC1 3T4AB 2IADA 4Z7QF 1TQSA 1U3ZA 1EGJL 4HYTB 4LLAA 5CSZA 1FORH 3IXTB 3QEQD 1T20B 4TXVB 5GGSB 3X13B 5ACMA 3MUHL 3ZIMA 4LL9A 3RJOA 3EKCA 1VEOA 3LKNB 3QJXA 4B53A 2CLZB 1KLUA 2YD8A 4JFXA 1AR1D 3NIGE 3CV5A 1VFBB 4LDEB 2CJ3A 3Q6FB 1F0LA 3DMMC 4OFVA 1QSVA 2G2PA 1A9BB 3BQUC 5IJKA 1QEXA 2HRHA 3NN8B 4PRPB 2UXFA 4MMXB 5CINH 1KCLA 1NMCB 4HK0B 1SBBA 1PD6A 1BD2E 4EDXA 2PXYA 1T04B 3AABA 1P2CA 2C34A 2LGNA 4CMHC 4JFFD 5HGHB 1IC0A 1QKZH 3C75A 1AZVA 3ULVC 2XWJB 1S7QA 1HN1A 2J56A 2QZQA 3SDXA 3AM8C 35C8H 5E8OB 2VDOH 1BYOA 3FSOA 5J6HA 1FYTA 3K2UL 3LIZH 1MCLA 2ALWA 3KCWA 2LOEA 3N41B 1IU1A 1HHIA 2H1PH 4IBZA 4U05A 1D5BA 1ZGLP 1E7UA 2C9PA 1SYSA 2OTUA 2IANB 4LEOA 3S5LA 1IX2A 3VD1A