1E5YA

Azurin from pseudomonas aeruginosa, reduced form, ph 5.5
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Rontgenkristallographische Strukturaufklarung Von Azurin Aus Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 33
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1e5yA00
1OF0A 4E9XA 1JZEA 2BWDA 3CDZB 2PPDA 3QJRB 3QJVB 4YSOA 3FYEB 2YAHA 2VSKB 3EH3B 2AANA 1CUOA 1ET7A 1MDAA 4KOCA 5I5IA 2LLNA 1AQ8A 1L9SA 2XXGA 1IBYA 2PPCA 1VLXA 1WAEA 2GBAA 1AACA 2PPEA 2HZHA 4W9ZA 2IDSA 3ABLB 1ET8A 3PCYA 2ZONA 3AG3B 3OMAB 1WA1X 1JZIA 1J9QA 1IUZA 3FYIB 3KW7A 2GSMB 4EF3A 1WS8A 2YAPA 3IN2A 1A4BA 2BZCA 2WO3B 3OM3B 3S8FB 4F2EA 3X1GA 2J57A 3T6VA 3IEAA 1QNIA 2PCYA 2XXFA 2FT7A 1L9QA 3CVCA 4E9RA 1W8EA 2CUAA 3OMNB 4AZUA 3NYKA 4HCGA 5EHFA 3PPSA 3SQRA 1J5CA 3N2JA 4PCYA 1TEFA 5F7BA 2CJ3A 1A65A 1N68A 3HEIB 2YAOA 1KYAA 1V10A 2HX8A 2P80A 1KCBA 3QJTB 1ILUA 2YAEA 4N8UA 5B7FA 1OOWA 3S8GB 3ZDWA 1BQRA 2CAKA 3ASNB 3SBRA 4DP8X 2H5UA 3S3BB 4DPAX 3TBCA 3NJMA 3IBOA 1B3IA 1ET5A 1ZIBA 2IH8A 3OQRA 1ZIAA 3DKHA 1SF5A 3QJQB 2EIKB 2J5WA 1ID2A 3PAZA 4E9QA 2EIMB 5I5MA 1W6WA 2XV0A 5B3SB 4HHGA 1RKRA 4CSZA 8PAZA 2QPDB 4YSAA 5I26A 3DIVA 2HLEB 1E5ZA 3T71A 2QDVA 1NPJA 1JXFA 1NIAA 2BP0B 1FWXA 1BXAA 3AG4B 4YVUA 1XB6A 2CALA 4BWTA 2DWTA 4BWUA 6PCYA 5I28A 5F7AA 1SJMA 2BZ7A 3ABKB 3FU8A 2MRYA 2VW4A 2NRDA 2I7OA 2QT6A 2IH9A 2R7EA 1V54B 2ZWNA 2OJ1A 3GYRA 1OCOB 4M4RB 1A3ZA 1E67A 4DPCX 1NZRA 5D4IA 1SHWA 2VN3A 2FT8A 5IY5B 3FQYA 3EH5B 3NJFA 4A68A 4KO5A 4GP8B 3MBWB 1WA2X 2EILB 3TBBA 1ZV2A 1PCSA 3ERXA 2JXMA 3ZX1A 1OE2A 1JZJA 3NP3A 1SNRA 1JXDA 4BXVA 3UACA 1IBZA 3U25A 2XVBA 2IWFA 3FSVA 4A2FA 3CG8A 1AZUA 1PZCA 6PAZA 2A3TA 3ASOB 1JVOA 4L0PB 1PF3A 2IDTA 1IC0A 5I6KA 1XMEB 1ETJA 3OMIB 2TSAA 1AZBA 2I7SA 2W88A 3IN0A 4GY4A 4KOBA 2X87A 1J9TA 2FQEA 3H4HA 3FQ1A 1PNCA 3TU6A 4E9WA 1HFUA 1W6LA 1I53A 1AOZA 2Y69B 2DWSA 4PAZA 1KCWA 4DP9X 5PCYA 3EF4A 4G72B 1NIFA 1OCZB 2IWEA 1JOIA 2BHFA 1PLBA 4M3HA 3RYMA 1DYZA 3JTBA 3TA4D 3UAAA 3BQVA 5AZUA 1SHXA 2VW6A 3WKPA 1AS7A 1AR1B 4WTQA 4DP0X 5I6MA 7PAZA 2VM3A 4G7RB 1J9SA 3FPYA 4FA7B 5AKRA 1L9OA 2DY2A 2YXWA 2HXAA 1TU2A 1EHKB 4DP2X 1MG2C 1JZHA 1KDIA 4GP4B 3CVBA 2VW7A 1BYPA 3ZIYA 1XB8A 4X4KA 1NWPA 3AG1B 3T6XA 3WNJA 3X1EA 5B7EA 3SBPA 1L9PA 3X1FA 1AS8A 3NJHA 1E30A 2AZAA 2YAMA 2FQGA 2DYSB 3FSAA 1BYOA 5D4HA 3FQ2A 4G70B 1PMYA 2GIMA 4AI7A 5B1BB 2BP8B 3X2QB 4AKPA 4GYBA 3QJSB 4Q8BA 4GXFA 2GI0A 2YARA 3WI9A 4NERA 2PP9A 2IWKA 1JZGA 4HALA 1NTDA 1HAUA 3NSFA 3AW5A 1GR7A 1SFHA 2B3IA 4UF7C 4P5SA 5I6LA 4AX3A 2XLLA 1JERA 1OCRB 4BK5C 2BP8A 5TK2A 1BEXA 3UAEA 4GP5B 5B1AB 2PP7A 4A67A 2UXFA 2R7EB 1GYCA 4YSRA 5PAZA 1KBWA 1V55B 3BVDB 1SF3A 3NJKA 1RZPA 1SFDA 4F7KA 4TXVB 3WNIA 1CURA 1NWOA 1TKWA 2YAFA 1A4AA 4UANA 1M9WA 4A2DA 3NJGA 4JKNA 1AIZA 4KO7A 1BQ5A 1OCCB 4W1TA 4YSEA 1KGYE 2FT6A 2RACA 3NT0A 2ZXWB 1FA4A 1E65A 1AZRA 2XX0A 1BXVA 2XX1A 4BWWA 1GY2A 1GY1A 2GHZA 4FAAB 1GW0A 2BW4A 2HRHA 3EH4B 4QLWA 4YSQA 3FU7A 3WKQA 1CYWA 4YSCA 4KNTA 3ABMB 1F56A 2OV0A 2BW5A 4G71B 2DYRB 4A2GA 2UXGA 4HCFA 1NDTA 1RZQA 3AG2B 4DP5X 3NJJA 2PLTA 3ABGA 4YSPA 4DP1X 4BDVB 4Q89A 1AANA 1TEGA 3PAVA 3NSYA 2OCCB 4E9VA 5B1KA 1IKOP 2MTAA 1BQKA 3N55A 4E9YA 5I6PA 2VSMB 4JHUA 1QHQA 4DPBX 2VM4A 2Q5BA 3PAUA 1QLEB 1KV7A 4KO6A 1HAWA 4HAKA 1AZNA 2E86A 4BDVA 3X1BA 1URIA 3G5WA 2FJSA 3CVDA 4KNSA 2Y1AA 2FNWA 2TSBA 3NJLA 2XU9A 3S3DB 4K9JA 4AKOA 3GXUB 4E9TA 2UX7A 2I85A 2UX6A 2UXTA 3NP4A 1MZZA 3EHBB 4CSPA 2GB2A 4RH4A 1ASQA 1PLAA 2FTAA 1CYXA 3FSWA 2W8CA 3H4FA 5B1JC 1OE1A 4YL4A 2P80D 1GS6X 2X88A 2YXVA 3QPKA 1YLBB 2VMJA 3T6WA 1PNDA 1AG0A 3UABA 1ZDSA 4N4YB 1AS6A 2EIJB 5I6OA 3HB3B 3FSZA 1E5YA 1WA0X 1ZDQA 2UXVA 3PLYA 3CDZA 1X9UA 2JFCA 3KW8A 3DTUB 1NIDA 4G7SB 3GDCA 4DP6X 2WO2B 3L45A 2XWZA 2PP8A 3D12B 1ASPA 4E9SA 1PY0A 4KNUA 5I5JA 1OE3A 4MFHA 5B1JA 4HIPA 1WS7A 3WIAA 1CC3A 1M57B 2XV3A 2ZOOA 3H56A 4BXSV 4HCIA 3V9EA 2WSDA 2YQBA 4ZK8A 2FWLB 3SBQA 1N70A 1NICA 2XUWA 4KO9A 2N0MA 3ZBMA 1JVLA 1KDJA 1SDDB 1L9TA 1BAWA 4DP7X 1DZ0A 2CBPA 4DP4X 1MZYA 3T9WA 5AFAA 1AZCA 3UADA 3NSDA 3T6ZA 2AZUA 5A7EA 1ZPUA 1NINA 1A8ZA 1SDDA 1R1CA 1JZFA 1KBVA 3QQXA 4ENZA 1XB3A 4QKTA 1ADWA 4WKXA 1PZAA 4NAJA 2J55A 1M56B 3FU7B 5I6NA 1X9RA 3IE9A 4UAHA 4YSDA 1A4CA 1EZLA 1J9RA 3X1NA 1J5DA 1NIEA 2PPAA 2PPFA 3JT2A 1FFTB 2JKWA 5TK4A 3WG7B 2H3XC 5D4JA 1PLCA 2BWIA 2CCWA 2QDWA 2YAQA 3V9CA 2IDUA 5LDUA 3CZUB 4YSUA 2HX7A 2GC4C 3UGEA 1PAZA 2GC7C 2QPEB 3FU9A 2BP0A 1AAJA 2H47C 2J56A 2Q9OA 4NB7A 2AVFA 5FC9A 2FQFA 4P5RA 1UATA 3FS9A 2IDQA 2XV2A 4A2EA 1RCYA 5ANHA 1GS8A 3FPXA 4JHVA 1GSKA 3MX0B 4A66A 1OV8A 2EINB 3NSCA 3S3CB 3OD3A 3AZUA 1ASOA 1L9RA 2AFNA 3C75A 2B08A 5E9NA 2IAAC 2XYBA 3FT0A 4YSTA 7PCYA 1NIBA 1GS7A 9PCYA 1AG6A 1T5KA 1PZBA 2DV6A 2FQDA 2PCFA 4A2HA 5B7MA 3QJUB 1BXUA 2HRGA 1ILSA 2BO0A 1NPNA 1JXGA 3PXLA 3NJNA 3NJIA 4YSSA 4G7QB 3AY2A 3TASA 4AKQA 4YVNA 4F2FA 2HX9A 1MG3C 4HZ1A 2IDFA 4HHWA
chains in the Genus database with same CATH superfamily
4AW7A 5FAAA 4PJBF 3WLBB 1ZD6A 5JXAL 1AGEB 4TUJB 4WW1B 1BVKA 3QWQB 3BCDA 1MJJB 4PJCE 1CXHA 3AGWA 4Z7WB 2HTKD 2X1OA 1CUOA 1N0XH 1DUZA 3DGGA 4WWNA 3EF7A 1KGWA 4P07A 5I73B 2LLNA 1HHHA 2X89D 1URZA 3TPKA 3QDMD 2BS9A 4Z3TA 4ZD3H 4M7ZC 4YX2L 3RZCA 5C08E 3J7HA 2QADD 3RWFB 3T2OA 5BVJB 1PQZA 5GIRB 4N0CD 4X9HA 1KIQB 4MYPA 4GRWH 4F3FB 2L3BA 2J7LA 3NTCL 1A7OH 1MY7A 2YAPA 2G9HA 4HT1H 4Y5XA 1VZHA 2BZCA 3C2SA 3F12A 4XX1G 3WIFA 1T2QH 4D9LH 4F5CE 3K5SA 4P3WA 1ZV9A 2PCYA 3DUUB 2YMXH 5L2KE 4PJ9A 3OMNB 1HOCB 5JUEH 3OJ2C 3FUHA 2VR3A 3VJ6A 4WI0A 1YEHH 2W9EH 4HS6A 1XF5B 3QIBA 4OBRA 4JFFE 5F7BA 1G7QB 4P46B 1J0HA 1WWBX 3HMWL 1E27B 3PQYB 3ZKSD 4I0CC 1I3UA 4LQFH 2D7QA 2ZWLT 3ARYA 3MTRA 5DHDA 2E0PA 5E8DH 2EUXA 1G84A 1X5MA 1V3LA 3QYNA 2CAKA 1UZGA 5FDWA 5AD0A 3BIKA 4LLVB 3AT0A 4EUPB 2I60L 3VW3L 1B3IA 4G1EB 4LOFA 4QHKI 4KTDH 1KN2H 4B9JA 4DO6A 3HNTL 3QJQB 3O6LL 3EYSL 3FZUC 1I8IB 3GTVA 3G6AB 4RMWA 1EDYA 1L6XA 1OZTG 4ORGA 3FT2B 1FBIH 4G59C 1LE9A 2R0ZH 1K3ZA 8PAZA 3TOPA 2H8PB 2GJ6B 5C0IA 2CCVA 1T7ZA 4GAGH 5AKVA 1JYWA 2XY1A 1UWXK 1QQDA 1DBML 2L4OA 1JHLL 2IV9A 2W1NA 3O2WH 3OTTA 2BP0B 4XPHH 3WHE0 5I5IA 1TEYA 3QCVH 4L8BB 3FHQA 2NR6D 3FH5A 5D7JA 4TPRH 3KJ4C 2EH8H 3DXAE 3TYFA 3ZL4H 1XGRB 1DL7L 1EO7A 3C5SA 3OG4B 2H32B 2Q7YA 4G8EB 4WW2F 5E1GA 5IV2B 3CFDA 2FYYB 5BOJA 5ISZA 4M4RB 4WQOA 2AJVL 4DN3L 1FFOA 3PHQA 4L3CA 3OZLA 4KMTH 4M7JH 4D94A 1FYHB 1FPTH 3GO1L 3PNWB 5DJ2A 2XTLA 1UM6L 3IB4A 1FVEA 4M5SA 1A1MB 1MUJA 3KXFB 1DO5A 4PBDA 4GKSA 5HHQB 1OLZA 3PWJB 3X12A 5KSBF 3DIFB 2MWCA 4KO5A 1WO2A 2LU7A 1IAII 3LZQA 1U8CB 3IMUA 1H3VA 3ERXA 1MHPH 3WE6A 1EZUA 4OH2A 1G0XA 3K6DA 3VFRB 2GSIA 3F7LA 4O51B 2NSMA 3OAYK 1HHKA 1HI6A 4DEUA 1CS6A 2V2XA 3LN4A 4NWUL 3ASWA 1RV6X 4TNEA 2VLRD 3CBRA 1WBXA 3MV7B 3D5OF 3WN5A 2XTJE 4PG9A 4XMPL 3RY5A 3REWB 1ROCA 1HHIA 1RZ7H 1QX1A 3NEXA 1WBYA 1TTRA 1W72L 2I7SA 4M29A 5I2IB 1Q4NX 1WFNA 2ZSVB 4HUUB 3RGVD 1FQ9C 4JAMB 1S9YA 3IKCB 4G2AA 5I1CH 1FLRH 1M7IB 1UJ3B 3ZUNC 3IJEB 2FJGA 2EC9T 3BN9D 3KMDA 4XC3H 3A4DA 2IBZX 4ABQA 5HTSA 4JY4A 4QOKB 1Z3GH 4RNRB 3LJ3A 3PJNA 5F9WC 1WICA 4UV7H 1Z9LA 3SGJA 2FJHB 2E7MA 2X7LA 2B77A 5DYOA 3PIQA 2ILLA 3T04D 1MN4A 3VI4F 2K70A 1AI1L 1QI5A 2DD8L 5AAMC 4ZMZA 4PJGA 5KUMA 4IU3A 3AB0C 1A3RH 3MRBB 3UJIH 2MEJB 3EDJA 5IESL 4NO0A 4QRQB 5DMKB 3ZTJH 1XO8A 2OI9B 1I9IL 5E00B 2QGEA 5IJBC 5I8KL 4ONFL 1YEIH 1J1PH 1Q9OA 4LHUB 5E1HB 1BQUA 3FF7A 1UB6B 2P5PA 2YFNA 3BRDA 3QDGA 5LCVH 5BVPH 1CU4L 1AS8A 5T1JA 1FZKA 4G3YL 3GSVA 2FR4A 2ATAA 2FDBP 1OAZL 2L0DA 2CR6A 1VFUA 2R4RL 3FQ2A 4P9ML 5F1NB 2YMTA 3QZLA 4UUJB 3OAUL 3UZEC 5FUZL 1LLAA 1YMHA 3V0WL 1BA9A 5BV7C 4JBSA 1HAUA 4XP6H 1K8IB 3D0VA 3KPOB 3EGXA 4FP8L 4P5MA 4Y2OB 5FO8A 3NRPA 1U93B 1RHFA 4N20A 3D25A 5E2TL 3REVB 2G5RA 4XPTL 3K0YA 4QXVA 5B1AB 2VQTA 3BSZL 4Y5VA 1X4XA 3GNML 5EUOE 4XMLH 3GPSA 3VI3A 1AH1A 1Q1PA 4MLSA 3BHBA 5T5FL 4HFWA 4FC3E 5CJOH 4IOFD 4X0KA 2JB5L 3QIWB 4WI5A 4OB5L 4HK3J 1UWXH 1IE5A 5KN5A 4POZC 2VXQL 1I1CA 2FHFA 4YHOL 1QSFD 4BK5A 3LNEA 2B1OA 3AADB 3WFBH 4KK9D 2D4FA 4YQXL 1T0NB 5I1JH 5IKCA 1GW0A 4QLWA 4M93C 2YKLH 2BVUA 2Y7QA 3UYOD 3S35X 3PWPD 1KCSH 4FYSA 1YEFL 4G8GA 4NN7B 4LSQH 2H45A 3VXSA 5F6IC 5IIEB 4E0RA 2UXGA 3ISRA 3OKDA 3LXAA 4Y19E 2NLJA 4KZDL 4H0LC 2X53A 5CHNA 1YAIA 2C7UB 2OMTA 1K4CB 1INQA 3VFOA 3PAVA 4YBQC 1TQWA 4JRLA 2VNCA 4OSUH 2MTAA 1E0OB 2WBJD 4YWGH 3FQWB 3SYCA 3P9LA 4L1TA 2Y5TA 4L4VE 2BLFA 2QL1A 5BOZG 2DLFH 4WUUA 4PI0A 3FCTB 1UTDA 1YNTF 2IAMA 4HAKA 4RMRA 3HN8A 2YRBA 3FTGA 3U82B 4PY8I 5MI0B 5ICZA 1IQWH 2KERA 3ZDZB 5AZEH 2QJDA 1CLZL 3CDGA 3SDAB 2UXTA 3V7MA 4I48B 1GPOL 1ASQA 3ML9A 4LKCB 3RVVC 4BE5A 2NPLX 4HLEA 1CYXA 2FBJL 2P80D 2O61B 4ABWA 4U3CA 1MDTA 3QPKA 3FO9A 2YWYA 1PGRB 1AR2A 1IM3D 3P30H 2EH7H 4RWYL 2O72A 1IGTB 1NMAH 4F7EA 3ORJA 1FLTX 3P9WB 3C5XA 2IADA 1A4KB 3ILQD 2UXVA 4XVUD 5DJXA 3V0FA 4OKDA 4WTZA 2DQEL 2DJ4A 3B7TA 4AM0Q 4JDTH 5EF3A 3QUMB 3VXUB 5H37A 4E9SA 4XNMA 5GZND 3WS3A 4G6JL 4OZIB 4DW2H 1NCDL 4HIPA 1BQSA 1HVXA 1KLUB 1T2XA 5EIIG 1WT5A 3CH8A 1MWAB 3BEVA 4WSGA 4X6EA 5CGBA 1F41A 1A6TB 3VFPB 2NX5E 4YOKA 3GEWB 3OB0K 5HVHB 1QSEA 2BNRE 1PW3A 4FF9A 1NCTA 5BV7L 3S2CA 1UD2A 2Z31D 4RQQB 5E6IC 5J0BA 2N0MA 3QUYA 1C08A 5IFAH 1SDDB 3U1SH 4HJGA 4GSDH 1GZHA 4G5ZH 3RWHB 2Q7NA 4L9DA 5CD5C 5IJVA 15C8H 3T9WA 3MUY1 4D8PA 1E8WA 2UWEB 3SDDC 3G6JE 2F15A 3MRQA 4TRPL 1E6JL 2XBZA 5EIIA 4YDKH 3OPZH 4DO5A 4IOIB 1RUQH 3S37X 2YUZA 2VR7A 1RIVH 3OKOA 4XMKL 4YAQA 2K6WA 4E41D 3CZFB 3T0ED 4YSDA 2LU4A 5T8IA 4ZOEA 1SM3H 1YEEL 2VLJB 4NI3A 2HUHA 1D5MA 1TF4A 5E1AB 1HQ4A 3ECWA 2MCPH 1LDPH 4QF1B 1S7SB 5DI8B 3L7EB 4M8QA 4ODHL 1VFAA 3ABZA 2I5YH 1EAJA 3EJTA 5F72S 3FOLB 4DZBB 5BRPA 4Y8DC 5ENWB 2B5IB 3PHAA 1MF2L 4IBUA 1R3HB 1WE5A 5B22A 4N25A 3FRPA 4RFEB 2E9JA 3F5WB 1OD7A 4PJEA 4ZPTB 1U36A 1ES0A 3A6BL 1NCCL 2VOTA 3L95A 1BLNA 3N0AA 2DQUH 1JZ6A 2CO6B 1JPGA 3ZK0A 1MKFA 4X7FC 4KKZA 1FV1A 1XMWA 4M56A 4YDIH 1HHJB 2X0VA 2CUMA 2Q6WA 3S3CB 2F9BT 3Q9PA 2RAMA 5DSCB 4ZX5A 4MD4B 4Z77B 4OQTL 1F3RB 5AZ2H 1S9WB 1NIBA 1GS7A 1I1YA 2WJ5A 2Y07H 1YZZA 1KGCD 5D2NA 5F9OH 3ZT6A 1OGAD 1BXUA 4HVBA 5DO2C 2C9VA 5K9KA 2BO0A 1GMEA 1KC5L 3BPNC 3HPJA 2ZT9C 4NC1E 1W0YT 4PJDF 3C6LB 1MW2A 2OK0L 1FG2B 2CGRL 3WFCH 1HHHB 3CBKB 3EADA 4XMZA 3WLWD 2ZKWA 2PW2A 1SLWA 1UZ6E 1EJ6A 5D1XA 3RBSA 1PQZB 3I02A 4CADB 4GT7A 4OF0A 2G9HB 2PWHA 1N26A 1UKSA 3F12B 3B83A 3UDWA 2H4EA 2MKLC 5JXEA 4CDHA 4BSWB 2GBAA 1ZVNA 1DQLL 2R1WA 1X5LA 1KJ2L 1RQ5A 2VDLB 4YDJA 1ZHKA 1XL4A 4P3CH 1IJ9A 2VDKH 3DGDA 4HS6B 2AK4B 2DKMA 3QEQD 5IK3B 2C1PB 3QYCA 1WEJH 4U1LB 5HJGA 3ECUA 3T6VA 3E8UL 1HH6B 1U3HA 4ZAKC 2A6KA 3M1BA 4JO4H 2EEXA 4MNGB 1WJ3A 4LAQH 1XV8A 4R4NC 3MDJA 4RMUA 3UPAA 1XDTT 3QEUA 5EHFA 4NN6B 5D93C 3BIKB 1TEFA 3BYTA 5EU4A 5F6HI 4BH8B 5MHSD 4HUVB 3APMA 3WUWA 2J8UA 1MCRA 2VDMB 2CNZA 5C0NC 5D6DA 3MNDA 1AO7E 2VB5A 2PABA 3HAEA 3TJHC 3ULSB 2FSDA 1CTOA 2F54B 4LVNB 3IGUA 2XPGA 4TTDD 1OOWA 1TZGH 1BQRA 3ASNB 3LHAA 3B2DC 1IKFH 3JQOB 3QHFH 4HIJA 3H3PH 4PJ5A 3KLQA 4PTUA 1MEXH 3GBNH 2E7BA 2J4WL 1S2EA 2PWGA 4J23A 4X6DA 5IM7A 2AQSA 4UOJA 4FNQA 5T1DH 1ET5A 4MBOA 1ZIBA 5T1LA 1TZHA 1NBCA 1ODAA 3VNZA 3RHWK 2WXNA 5D6CA 3CJJA 2Y24A 3U0PA 4IK7A 4LPXA 2V5RA 3HC0A 4U31A 5T5NG 2VLMD 4ZX3A 5IWLA 5FHAH 4X0NA 4XE5B 2XV0A 4BQ6A 4XAKE 4OCYH 1YCSA 3GTNA 1HNYA 3BFWA 3PWLA 3WJLC 1PG7X 2CO3A 4FYQA 4XHJC 3B9EA 3NSXA 5DVPA 5EO0A 4OIAA 4NZ8A 1CK0H 4APXB 2UY6B 4P2OA 4RGMC 1ADQA 3S96A 1HESA 4GMTH 2Q7YB 4AQEA 3FC8A 3QUKA 1KJ3H 4P5KA 5E94A 5E2VH 1NIAA 4H2CA 5EIQA 3SKOA 6PCYA 3WTVA 2ESVE 3C60B 1P1ZA 3HHSA 1B0IA 5JMOC 4TS6A 4YXKH 1J5HA 2NRDA 1CXEA 1EK3A 1QRNE 3DVIA 5DJAA 3FTWA 3BDYH 3BWUC 5F7YC 3BGMB 3EJZC 4TV3A 5ITFA 2I69A 5HI5C 2D31A 4N2GA 1IGFH 5KVDH 4AM0B 1H3PH 5DZLA 3NN8A 4JDVB 4G83A 4BFRA 4RIRA 3WE6B 2QKIC 4EUPH 1OD9A 5JIMA 4RBPK 3SEPA 5IB3A 4KKAD 1HIML 3EOAB 1QWHA 5E2WH 5KVGL 1BZ7A 2Z0BA 4J5VA 1FVCA 4JB9L 1Q90A 1Z9SB 4PG9B 3S5LB 3GM0A 2P8PB 1HHIB 2DQGH 4XMWA 8FABB 3JV5A 3EHBD 2JIXB 2YEQA 4I3RL 3LKQA 4OZGE 4AGLA 5AVSB 3NK3A 1HTYA 2X9ZA 2ZXCA 4NRYB 1N2RB 4PJXF 3ESUF 3MRJA 1PF3A 1IEAA 1LEGA 1N64L 3V0IA 4BINA 3WYRA 1TTCA 2FHBA 2FJGB 1XMEB 5DT1H 3O0LA 3CDFA 1JFQH 2TSAA 2X4PA 3MLRL 3UTTA 4NQCA 4Q2ZB 1DJXA 1B2WL 1EFXB 3IRPX 4HLJA 1PFOA 1PNCA 2A4ZA 5AW3B 3ZMRA 1I53A 4NQEB 5FW6A 4PAZA 2EXYD 1KCWA 1QHOA 4UDTA 4LIQE 5DYOB 5FXCH 2WZAA 4XNQA 2VDPB 4M1GH 2ZXDA 5DQ9A 2HKHL 5GGUB 5IEKA 5DWPA 4IU3B 1NCUA 1UGKA 2Z35A 5FA4B 2Y06L 4B3EA 3TBWB 1EFQA 4IRJA 4AK2A 1RFDH 4XGZB 4YHKH 1AR1B 2FK9A 1SJEB 4F1SA 1LD9A 1XIWA 2Y2TA 4L18A 1I3RA 4UM8A 3BP5B 1SLXA 1S7UA 4KUCF 3S98A 4P2RE 1I4FA 4OKVB 5E2UL 2NXYD 3FRUB 3QDGB 2GK2A 3GSVB 2FR4B 3PF2A 4ZS7H 3R4RA 3T3MF 5BRZB 3IVKA 1YG9A 5E9DB 4N28A 3L9EA 2R1YA 4DKEH 4QMEA 1TVDA 2V9RA 3T2QA 1A6AA 4JLRA 3QI9A 4F2MA 4IGBB 4N87A 1YMHB 3X1EA 3I3DA 4R7LA 2QKSA 4HJUA 4N2LA 2MNUA 3NJHA 3NCBB 5EZLB 1OO2A 1BYOA 3U4BH 1CICD 3EGXB 4NQSA 4ZBJA 5CEXA 1H6UA 2YOCA 3WY4A 4Y4KD 2ZOUA 1TZIA 1ZHLB 2IAND 4ZW5A 1DBJL 2Y4SA 3NJVA 3JSSA 2Q8BH 1ND0A 1P5UB 4X99B 3RB5A 1NGQH 2X1XR 5C0AA 4MCMA 2ATPB 1FL5B 4Y5VB 4LSVL 2F7OA 2QQKL 3PXHA 2ZP9A 5DTFA 1CE6A 1PZSA 3B3IB 1MQKL 2FX7L 2XVGA 3AW5A 3IJHA 2JCCA 3L4XA 3BLKA 3BHBB 3T09A 4KKCD 4EZLA 4X0KB 1NBVH 3Q8AA 4F58L 5TK2A 2DQDH 3IGKA 2OZ4L 4R7VA 2CM6A 3V6OC 3CVIH 3DMMD 2IGLA 4DK5A 2R7EB 1A7RL 4FYRA 1LE5B 1JVKA 1RHHA 4NNYA 4BZ2A 5GS0D 1JPSL 5HPMA 1NWOA 5HHNA 4UANA 5HHPA 3CC1A 4A2DA 1EXUB 3K2KA 3NJGA 4KUZH 4HGWB 4YUEL 1G1OA 1TQSA 2XY2A 3ARXA 2FT6A 2KDGA 5KBMA 4G8GB 1IGYA 4UNTA 5D7IA 4Z7OE 3SOBH 4NRXA 4E0RB 2HAZA 4HBQA 3ARFA 2VAJA 3E6FA 3SBWA 4LSSH 4WSJA 1F3DJ 2BW4A 3CD4A 4H8HA 4N2NA 5CHNB 5JW3H 2OMTB 3CX5K 4HKXA 5E0FA 1FYTD 3KS0H 3ZZQA 5EULV 2D03L 4XXDA 3NH7H 4RBPH 4OLXH 3FUEA 5DFTA 1BVLA 3S3PA 2FO1A 2DYRB 4YHMH 4YH6A 2VITA 3U4KA 1GXEA 3KBEA 3QXDB 4JVPA 3BP7A 3DTDA 1R3LA 4HKZB 1RD6A 3DUSA 1ZA3A 1HILB 3FN0H 2VABA 5GGQH 1GMIA 4WUKH 1MQ8A 3L3KA 1HZKA 1PZ5A 1QFWM 5HHVH 3TEZA 4F92B 3EO9L 1S4IA 1FO0B 2YZ8A 3RDJA 3CDGB 4LCYB 1DQDL 1JGEA 4P9HH 1FIEA 1BXXA 4LHQB 3FULA 5EORH 1SEQH 2Y0SA 1ML0A 3BGFC 3KGSA 3L3OB 1Z0MA 2YMOA 2GJZB 3S3DB 5DFVC 3GXUB 1OAKH 3QFJD 4MQ7A 4NN5B 4PJBA 4AE1A 2WWMD 4UOQA 5CU5A 5C6PB 1NCWL 4FTVD 4KJYA 1F58L 3GQFA 1ORQA 2WQWA 2JKRM 4U49A 2IPTH 4KJPC 4F7EB 1PLAA 4HHAA 4P23C 5EO1B 2YUVA 4J4PD 3MOAH 3Q44A 5ISZE 5F1SA 2PWFA 3T0DA 3S8WA 4XNMB 4N4YB 2QV2A 4JPWL 1EHNA 5I6OA 3LH2H 3HB3B 3FSZA 1RURH 1HWGB 1ZDQA 3BEVB 3MHZA 3GSNH 3UBGA 4X6EB 3G08B 3KW8A 3O6KH 3OKNA 3QA3B 5FGRA 3GDCA 5HDLA 4IBVA 4XX5A 4JFED 3IMTA 3H8NA 4UQ2A 3NJXA 1QSEB 1MCWW 3TNNA 5DGQA 4YR6A 5DXWA 3T3PE 4RGOL 5AKSA 2XKNB 1YA5A 2P4AB 3FT3A 4CJ1A 4UT6A 1C08B 2H0FA 1F86A 1P0SE 2MOGA 3N1GC 1Q1JL 2WNKA 2PKDA 4UOW1 1Z9OA 2R29L 4FXKA 2E5EA 4OD3H 5LBGA 3VWJA 1E9OA 2NUTA 3VRLE 1V7MH 2IPKA 5T3ZD 4Q9RL 1H3UA 1NICA 1WUNT 1X5IA 3MRQB 4MJ6A 5F7EL 5EIIB 1XL6A 1PTZA 1CZ8L 3B2XA 3BGAA 5EOQH 1IGMH 1X5ZA 1L9TA 4X7CC 4LCWE 1BAWA 1M7DA 5C0FB 1FNSL 2K1MA 1T4KA 5IMKB 3IXTA 3BZ4B 4PD4K 4GEJA 4KXAA 4NSKA 1A2YA 1BV8A 4Q0XH 3U46B 1CR9H 4I5BA 4LK4A 1NLDH 4ODSH 2EECA 1XFPA 1R1CA 4MXWH 2DLGA 4KPHH 4PJFF 1YJDC 1HQ4B 2VXVH 1OF2B 3FNKA 5I0DA 4OGAD 4DGYH 3RVWD 4M8QB 3FFDA 5EBLA 4AENB 4D0CA 1FZJB 3O11A 3QUMH 4BUGA 1Z32X 5BJTA 1P5VB 1U8NA 2BNUA 3IDMA 2CQVA 2EYRB 4PJGE 4XC1L 1N59B 5FCUH 3O4LB 4UINL 5JHLH 1OXYA 1MWAH 5LUMA 3QXAA 2DI8A 1LMKA 4UT9A 1DSFH 1FNGA 2KZKA 5C09D 1U8LB 4G9FA 5I1AA 2VWEC 3K74B 4JFZL 1LWHA 4LESA 2Z9TA 1JRHL 3WG7B 4P4KA 2R56L 3RIAK 2UV3A 2PTUA 5E6SB 4BQ9A 4X42A 4ZX6A 5FYJD 3T3ME 1FV1B 1FGVL 3BX7C 3KPSB 1UURA 2Q6WB 2NYYC 3PNRB 4CSSA 2J8OA 2ZKHH 1DJWA 4FKKA 4HP5A 3BWUF 1S9XA 3EJSA 3QFDA 4IKNA 5LG6A 3RKDC 3GUTB 2CHZA 4Y5YC 3BVNB 4H0IA 3EDEA 4R90L 5D2NB 2BXZA 4XOBA 3ZLQC 4G6AC 4K8RD 1A1OA 4Z78B 1MY5A 1CGUA 3PWVA 2APSA 4GRMB 4K5OA 4PJAA 3SE4A 3SIKA 2YWZA 4UILL 3RA7L 1ACZA 4JM2B 5EBWA 2HT3C 4XODA 4DVRH 2PW2B 1OTSC 1LXMA 2OJEB 3QJUB 1IC4H 5CZXD 4XR8C 1Y18A 3UTZA 4KU1A 3B9KA 4E5XG 4JFPA 2Z64C 1NPNA 5DJDA 1DBBH 2WNGA 3Q8CA 2QBWA 2HN7B 5LAPA 4GAYA 4WEMB 5HYQB 4YSSA 2X4QA 4DUWA 3BUQA 2MSPA 4IBTA 1NUFA 4GQ9H 5GSVA 2HX9A 5JPMC 2X2YA 1CD0A 1EZSA 5BO1L 2AXFB 1S7XA 3D9AH 1FVDA 1MFEL 2QR0A 3SO3B 5I9QC 2C7FA 5DVLA 3GBMH 3QJVB 4LGPB 5IT2H 2ENSA 4Y16D 5D9SA 2K0RA 5KS9A 3MV8B 2HJFA 3IDGB 2DYPA 4ZMXA 1AQ8A 2ETWA 1F6FB 4OF6A 3M1BB 3S5YA 3FCSB 2K7QA 5IFJB 4Q9BA 3OMAB 2AQ2A 3VXSE 1A6WL 1KGJA 1KXHA 2BOBA 2GSMB 4YNYA 3IN2A 4U6HB 1SEBA 1VZGA 3IEAA 4NGHL 1EZVY 1CFTA 3NDYE 4NPKA 1MHHA 4CJ0A 2X4UB 5L9DL 3VXQB 3CDCA 1MFCL 4QAMB 2NNXA 3C5ZA 5F7WC 4OCRL 1WG3A 4HJ0D 4HIJB 2EC8A 4O58H 3NQIA 2GTQA 4LASL 2C9UA 4HA1A 4WUUE 1N68A 4PRPA 2YN3A 1F4WL 4M6NL 5KYYB 4F8TA 3ZHNA 3HE7A 3GSWB 4HH8A 3TL5A 4ADIA 2BY1A 4AQZA 1JF5A 2BOCB 5F96L 4AJWA 3HC0B 1FL6A 4NM8L 2NY2D 4Z5RA 3FUIA 3WJJA 5JZ7D 5LBSL 2WC7A 2BSSA 3BH9B 5B8CC 3AQXA 2QHRH 3QORD 1UVQB 4KTGA 4H0HB 4M9PA 4LNVA 3H9HA 3PFQA 1YJDL 3Q2WA 5F89A 1AZVA 4FFVC 4GEIA 3RRQA 4CVUA 1TSRA 3WELA 2X5PA 3F58H 4PJCB 3S3JA 4DKDC 1D5BA 2CRIA 4JFDB 3FQNA 1W6WA 1Q9KA 5C08D 4JFHE 2AXGB 3GIVA 4P5KB 1A7NL 4CSZA 1SMAA 1WWCA 4H4NA 4ZFQA 4D9RE 1T22B 4ODTL 3HHSB 4HUKB 3WEXA 5C0CD 2MPAH 3GJEA 2PCPA 3EXLA 1HHGA 1QA9A 5L2KD 2P42B 1UT2A 2OXHA 1JXFA 3VSQA 3F7YB 4R96B 1NAML 1OTTC 4BWTA 1DN2A 3CFIC 4XP4L 3CN1A 5E4IA 4M5ZH 2NZIA 5DD1L 3HBQA 1XD1A 1NLBL 5KBDA 1H19A 1X9LA 4RFOH 2Q8AH 3FB8B 5CP3A 1AQMA 1N67A 2XN9A 2VAAB 5GRZA 1DDHA 5HDQL 2Y22A 4M8RA 3R0NA 4DOHB 3CFEA 1CLYL 4XNZC 4ZUTA 5BS0B 5FYKD 3P0VL 3NZSA 4AQ8A 1A21A 3ZE0F 2VXUH 5ECJE 1JI2A 3TA3B 3QDJD 1AHWC 4FFYA 1JZJA 1P9MA 4O2CA 3WIHA 2H2PC 5I1GH 1PLGL 2X4PB 4OCNC 2WUCL 4NQCB 3WFZA 4ZS6C 3WFEL 3NPZB 4DCQB 4TOYH 2O5NA 2A3TA 2BFGA 3BKMH 3CCHA 3SQOH 1YNTA 5D7EA 4W9JC 5BW7A 2EIZB 1NH6A 3UAJA 2B8OT 3R8BB 5C0RH 1GSMA 2DIBA 2HLFD 1T03L 1SY6A 1J88A 1MCPH 2WVVB 4GG6F 1TSHA 3O6FB 3QAZC 1B9KA 1TVHA 2Y69B 3MLWL 4HJJH 4JO3H 2DTSA 3LNDA 2C9AA 4GT0A 4IRJB 1MFMA 4LOUD 1XIWB 3U1QA 4LRNH 4MCNA 1N8ZA 2E9IA 2E9BA 2DLIA 4POUB 2WTRA 2FO4B 3ISYA 4Y4FC 5ICYA 1OWRM 2Q20A 3RTQD 1FFRA 3QJOA 4YFDB 1ULVA 4JCLA 1PD1A 1AKJD 1R0AL 4EQ2A 4PJEE 4XP5H 3B43A 5CSZA 1W72A 2E46A 4IRZL 3QQ4A 4N9OB 4W9CC 3LSOA 1ZSHA 4H25A 1MI5D 4JPVH 4R8WH 4UM9A 5LXGL 5E8OB 5C07E 5SWSD 3SKMA 1M1SA 5HYEA 4DP2X 2ALAA 4UB0H 4GLRI 3LD8C 4JO5A 3QPQC 1AP2B 5HY9A 2WIMA 1SGKA 3C8DA 3VE0B 2VW7A 2X4TB 5DMGC 1ZJAA 1SPDA 2CRMA 2XTJD 1ND0B 5C0DB 2XZAH 1KG0B 4QTIL 3KPMA 1XB8A 2CJSA 4KRPC 4HIEA 4QD2E 3DOSA 3BZEA 3G5YA 3MXVH 5DTFB 3V6FA 2A9AA 3CK0H 3IJHB 3S7GA 5JORA 3MBED 4JG0L 3VXPA 2DMKA 4AI7A 3BWSA 4GIAA 2C26A 5B1BB 3UGXA 4DFIA 5AENA 3FB6B 2K4WA 3KR3H 3GSRA 5EU5A 5FFGA 3TO4A 3V9FA 4WWKB 5D1XE 5GGSY 4IW4C 4A7UA 4F24A 2NNAA 4U6VL 3ROOB 2JKJA 3IFLH 2C4XA 4LFHG 4XNXL 2CKNA 3RBGA 3WIIL 1E4JA 4NNYB 3TC9A 2IFGA 2CPCA 3L1OL 3D8MA 4NCC1 3TIDB 3TT1H 3U83A 4GSXA 1G6RL 1Z9NA 5HHNB 1BM3H 1A9BA 2NY3B 4KK6D 3DRQA 4HS8L 3QJFB 2JELL 4ZQTA 2YHGA 4ZNCD 1KELH 2MQ3A 2PR9A 4UIMA 4HH9B 3ZDYF 4NHCL 5LWYL 2BSBA 5BZDA 1M9WA 5KVEL 2NW3A 1OIOA 2NY0C 1U3YA 7FABH 4JHAH 2CRYA 4RFNB 1YEGL 3GMQA 5A2CA 2QEJA 2YD6A 4QXTB 2EKSB 2J8UE 1AZRA 5CCHE 4O2EB 4AEIH 3BP7B 4HPYL 5DD5H 1N0XL 2R9HC 4HSAC 2DTML 3ME0A 3RX5A 3H9SE 1TQVA 4PRIA 2UZIH 2VABB 3FU7A 1I1AC 2V2TA 3POHA 1F4HA 4U1IA 2KQNA 5LB1A 4ZD3L 1X5XA 3C8HA 3ABMB 3EG9A 5IBLD 4N9GB 4X9GA 4X6DE 1A7OL 1D7DA 4HT1L 4I0PB 5D7HA 3AG2B 3CNKA 4K2UH 1QR1A 3SE3A 1GJWA 2A83B 2DDQH 2N7AA 1R5WA 1T2QL 1EVTC 1CXLA 2UZXB 2VXQA 3IRZA 4MCZA 3IFOA 4PH8A 2WLIB 4F37K 4L0YA 4N6RB 4PV9B 1FAIL 1ZVHA 5B1KA 2YMXL 1OPGH 1WGOA 2V17H 1H5BA 4PLKC 3SYPA 4HBCH 3VD4A 4PJBB 5JUEL 2DQHH 2VM4A 2OMXA 2Q5BA 3PAUA 3HR5B 1CFNA 4RX4A 4HC1H 4Y1AA 1YN6B 1ORQB 5B4MC 3RGHA 3D05A 1S7RA 5GHWH 3ZQWA 2FJSA 2WXKA 4LEXH 4MA3A 4LQFL 5LKNA 3CSYB 2X2UA 4NQVB 1PD0A 1TLKA 2FCBA 2P28B 5D7KD 2EXSA 4J8RA 2XA3A 1EMTH 2B20A 2Z93B 4YHYC 3QARA 3WN6A 4JJ5A 2VR4A 1P4LA 3AC0A 4W9FC 4N2IA 3PG2A 4IU2A 4FCAA 4O02A 5J56B 4KTDL 1KN2L 3EKCA 2BK8A 3IDYC 3NCYS 2PYFB 3GK8L 1CGSH 3K6NA 3CFJA 3G5VB 4UQ2B 1CFMA 1UACH 3QFGA 1FBIL 1UOWA 5T33L 3EIFA 5HVGB 4N85A 3FT3B 3ARDC 1BMZA 2DH3A 2WP3T 5DZNA 5IB2A 3RFZA 1X9UA 3L54A 4RAUA 4M1DH 4X6FA 3UCRA 3V4PH 4GUOA 1FO0H 4XPHL 3KLSA 1WZ1L 4L4VD 3B9AA 5TE7H 4CN6A 2CO2A 3EYOA 3N41F 2O93L 4TPRL 3ZL4L 2I9LB 3LB6D 4FNTA 3G04A 1RZKH 1OP3K 1CFVL 1HXMA 1RAMA 1ANUA 4NUQA 1T4KB 1HNFA 3IXTB 1I9RH 5HJ3A 2G4GA 3RDTC 3O6MH 3AT9A 2ZIDA 3CZKA 3EAKA 2GK0A 2CLVA 1AVAA 1DQMH 2H26A 2RH0A 2VDRH 4KMTL 1K5WA 1I8LC 4GIPD 1FPTL 5DDHB 3UROR 5L8KB 5KSAC 1NGYA 1B4TA 2ZQKA 1BD2B 1UA3A 3D3VA 4HGKC 5DF0A 5EBLB 2P5WA 4E42B 1U8NB 2OSLA 1MHPL 2E7HA 2HFEB 2A9CA 1UHVA 1RZ8B 2ED7A 4QXGH 4TVPL 1KBVA 3UZEA 1FNGB 4Q56A 5CM1A 1D3CA 1BQLH 1PZAA 2XWBA 4QHKJ 4JDZA 1IC5H 3ZR5A 1JWSA 4WW2B 4ZUVB 2GJPA 1NC2D 4M5YH 5E8EB 4F9PA 5FUCC 3GDBA 1A7QL 3VX0A 2AJSL 3FUKA 1C7SA 3QZMA 4EOWH 4XBMA 3MGOA 2WTOA 4QRPA 3KXFD 2R59A 3HI1A 1TR7A 1MW1A 5ICXA 5BZWB 2OBGA 1OAQH 4V2CB 5LGHH 1WQVT 1JNNL 2OR7A 4DK6A 2R4SH 1FLRL 2CJTA 3GLAA 4F2ME 2H3XC 5KSBB 3QFDB 2DIJA 4U0QB 1SXZA 2C5DC 3MLZH 4LEBA 4XC3L 2BWIA 4PP1D 3P3UA 4JE4B 1MNUL 2CCWA 1X9QA 5A7BA 1Z3GL 5LDUA 4ODBD 2NZ1A 3PWVB 4PS4H 2X4NA 2GC7C 5ELIA 1GW6A 3FU9A 2VR5A 3RVXD 4CN1A 4D0BA 2R2BA 3SE9H 3TBVA 4ZMAT 5EBWB 1ZVSB 2NDGA 5C0AE 4N2AA 5DK2B 3CMOL 3SE6A 4FQJL 5I8CB 1M71B 4PFEA 4YMPA 4OBSA 1NMCB 2JCCE 5AOZA 3WHXB 3TWYA 3HG1E 4GQQA 5GS1C 2P5EA 3LQZA 2V9QA 4XNYL 3IU4L 4AQAA 4IRSD 4CC4A 1S7XB 1XR9A 2PYEA 1YEIL 4PJXA 4N1HB 1J1PL 3BAIA 4QYOB 5AKTA 2PW1A 4WK4B 3I9PA 5IVXA 2WLNA 2YD5A 4X4ZA 3K0WA 5LCVL 3BKCH 3SGKA 2HMID 1KCVL 2A74A 2OQJA 2HJFB 4NUPA 3U4EA 3MYJB 4FHKA 1T3FA 2W65A 2YPVA 2YGVA 1WHOA 2DQIL 3F7RA 5I16B 5MENA 3H42L 4MA7H 2BWDA 2DJSA 2GVYA 4IMKA 2RFXB 3BLPX 3LRHA 4FERA 1HX0A 3VI4B 4Q52A 4MMZA 4E5XB 4PGEB 2ORBH 2Y5EA 4FRWA 4GJTB 3EH3B 4GI6A 5D7IE 4XP6L 3CN3A 5IMOA 1MDAA 1SEBB 4MS8D 2LGNA 4DP8X 3V5HA 3IE4A 1HZHL 2R0LH 3T0XA 2RB8A 3TX4A 1RIHH 2PPEA 2VE6A 4OLUH 4WHCA 3UTPE 3VGEA 4ZMWA 2IC2A 3V52L 5IJKA 3HUJF 2F18A 3W5NA 2IQ9L 3PUCA 5E4EC 4IEFA 3OPUA 5CJOL 5E8NA 3K6SA 3D2UA 4K8RH 3FFCA 2DQFB 3TN0A 5DVMA 1D6VH 1FL6B 2A9NH 3QR2A 4HXAH 5FO9A 5AB2A 3N44F 4AL8C 1FHGA 4NC0B 3C09C 3ZTCC 2P1YA 1GA2A 1AY1H 2BSSB 4P5TD 1IU1A 3H9HB 2EICA 3RUGA 2BVQA 2CMRH 4JQVA 1DVFD 1DQVA 2FJUB 5ICUA 4TLSA 1M1XA 2EDLA 3RVTC 4Q6KA 1H15A 4FADA 1KCSL 1NEZG 1U92A 2ZYSA 4LSQL 4YZFF 4NT6A 4KZEH 3MRMA 1RPUA 1YMME 1IAIM 3BC9A 2AMGA 3PL6C 2L04A 3WEXB 2EO9A 3QIWD 2P24A 1ZT1B 4Z0XA 4J3OD 3VTAA 5J3HC 1QA9B 2EIMB 4PS8A 3GKWH 2F08A 4M43L 1C12A 3BQUB 4OSUL 4YWGL 2WAHA 1ZEAL 2X2JA 4L2YA 3U0WH 2BVTA 4NUGH 5TFSL 1BEYH 3LVTA 4IIZA 4AYID 2VO5A 3ALWA 1RERA 2VH5L 1CL7I 2HH0H 3C87A 3Q1SH 3TVMD 1JCKA 4RZKA 3IF1A 2PETA 4PJ7E 5A16B 2AQQA 2ICCA 2JJWA 3MKGA 3U2IA 3O45A 4I1RA 3QIUA 1SJMA 5JOPE 4WEBH 4X6BA 2I7OA 1LQSR 5FHBH 4N5UA 3T0VA 2O5XH 1LHZA 1V54B 3KGRA 2VN7A 4IJTA 1B0RB 1LO0H 2RD0A 4OJEH 4BKTC 2XN1A 1NC4B 2XA8L 2R69H 1A22B 43CAA 1WDAA 3VXNA 4JPSA 4JJOA 3P30L 1HOEA 2WM0A 3F83A 2VLKB 4NENA 3WXWH 3QEGH 3O3AA 5HHME 2VZSA 4DNLA 1XZ0A 1R24A 5GZOA 5IJDC 3CCHB 1YNTB 3H2PA 3TBBA 2HJKB 4PRNB 4NYLA 4XAKD 1T2JA 3KNBA 1TJXA 4YO0A 3IJ7A 3UBXA 3VX1A 2F74B 5CZVH 3X3FH 4K5LA 1VPOL 3KWWA 4DQAA 3FSVA 2CZNA 2G60H 2C3GA 4Z7VE 1J87A 3X14B 1QLFA 2FWSA 5BNXD 5JR1H 4TYUA 1MCCA 1RZJH 2D7TL 1N8ZB 2JI2A 3SO5A 4RDBA 2G9KA 2WTRB 2C9XA 3DHPA 4JFTA 1TJIH 2F0CA 4WI6A 1QRND 5HD8D 1GGCH 4G9FE 5FECB 2ESVB 3U1SL 4MDJB 4R3SB 5EC1A 4L8DA 4HOZA 1R9FA 1KB9J 4GSDL 1FE8H 1L0XA 3C9NA 3KBFA 1HINH 3G9VA 3N85H 4G5ZL 1W72B 3MVSA 3QQ4B 3W82A 3A23A 4PY8J 4UDUA 2V37A 15C8L 4U1JA 3SY0A 4ZMQA 3PU7A 4C56D 1IQDB 1ZTMA 3BRGC 5L8LB 3TA4D 3SKMB 3US9A 4M7ZB 4I13B 1B0GB 1NCAL 4QCIB 4IM8A 3ROLB 5CMAA 2OLDA 1RIVL 1AS7A 1V3JA 1G43A 4U3SA 5I6MA 1COBA 2A6JA 3MJ9H 2HTKC 3TFBA 4FL4C 1BX2B 4KKLD 7TAAA 1JXKA 3FB7A 3WDJA 1GGTA 4AL8L 1C7TA 3KPMB 4MAUH 2Z4TA 5IEHB 5DQJB 4KHTH 5J12C 2V8LA 4JQIA 1DJGA 3E3QE 1KV3A 1EHKB 5DHEA 1F90H 3V6FB 4PJAE 2QADC 3TIEB 5CWSA 4N0CC 3VXPB 4Y7MA 4I4WB 2EUZA 3RPIA 4PY7A 1KXQE 3JZ7A 5KVEE 5K9QG 2CDFA 3ATBA 5EBMA 5I66A 3DV6B 4BRVA 5GGVY 3SBPA 3D18A 2ZYIA 4OD2B 4WNQB 5JIIA 1D9KD 4EKXA 2Z34A 3HZMB 4NQXA 3IDJA 1MCKA 2VRAA 4KVCH 5D4HA 4ZZFA 5CLTA 2F53A 4XB8A 4B41A 4D3CH 4X8GA 4HPHA 1G7IB 4BFIB 1WZKA 4GXFA 4R5VA 4PW3A 3DRQB 2YARA 3K91A 4WO4D 4JFXB 4KKPA 4XBGA 2AXHA 4WGKA 2CO1A 3PJSA 5KS9E 4BZYA 4UIMB 4YDIL 1WFMA 3FH7A 4TQ8A 1Q9WA 2N1KA 2E56A 2BP8A 3VFWB 3L8QA 35C8H 1VFBA 2NYZA 3EYVA 4L3AA 4QRUB 4OFVA 2NW3B 5KOVC 5FR3A 2PP7A 5AZ2L 2W91A 3A6CH 4YSRA 3OR7B 2KUTA 2Y07L 2XHNA 3TXAA 4AYFA 3INUL 3LQMA 4P2RD 2UUDK 4ZSOA 4A7QA 3GEFA 4FQXA 3HI6H 1W8OA 3BP6A 2Z7UA 3WFCL 4PRIB 3QH3B 5CUSH 4U1IB 3KJ4B 5AW9B 4XN4A 3BP4B 1TZOA 2JQZA 1KTDB 4UTCA 5IGXH 2XX0A 4Y8AA 2OZ4A 3SJVB 1X7QA 2C1OB 3II2A 2F8IA 2OP4H 4WCYH 2NR6C 3D6GA 2XZCH 4ONGH 1F56A 4QY8B 4YPGA 5TTRA 2D73A 3W57A 2NY4D 1GYVA 4GLRH 3AMKA 5HYJA 4JFUA 4FN0A 1BG9A 2ENQA 4P3CL 1UH3A 4A39A 3QG6A 2EEAA 2K9UA 3GRBA 1JHKH 3NJJA 2FB4H 1WEJL 4P57A 1CBJA 4PJDB 2OCCB 4HK3N 4JO4L 1EEZA 4Y9FA 4DGIL 3WTYA 4P8QA 3RZCD 3Q43A 4LAQL 2KYIA 3W5MA 4HWZB 2DBLH 2K7PA 4JVWA 5DD0L 1A6ZB 5IUSA 1F11A 2R2EA 4I88A 4JJ5B 5CEYA 3WAKA 3ZW3A 4DTGL 2B59A 1KIRB 2FEEI 1CDIA 4PRHB 5EMYA 4F15C 2NY7L 1G7LA 4IU2B 1QSFA 1WC7A 2XWXA 4PJ9D 2FNWA 4FLSA 2ZUYA 5KSVA 1U9KA 2HT4D 4P2QA 3B9VA 3P3YA 1IKFL 5FF6A 3BJ91 3H3PL 1MEXL 3GBNL 3QIBD 2Y6SC 3VACA 2P8MB 4XO3A 4LL1A 5T1DL 3OXRB 5F97E 5LN8A 2YD3A 4WFEE 2XZQH 3DX8B 3WKMH 3SPIA 5IB2B 2JB6A 2XN9E 3LIZH 3N1MC 1E7VA 1Q0YH 4PWHA 5FHAL 3T6WA 2ADJA 5F9WB 3KLHD 3AU1A 3RGVC 3ULUH 3KPQA 5IB4B 2WAQA 3O3BA 1A9EA 5G5DA 5TH2B 4P3DB 3EYOB 1E5YA 3QZWG 1AZZC 1KJMB 2CPUA 1CI3M 3BN9C 4LZKA 2AAVA 3LRSA 1CK0L 1NIDA 3HG3A 4GMTL 5ERWB 4IBZA 5CILH 1XQ4A 2BNQA 5DS8B 2WO2B 3K4AA 4MKTA 3AB0B 1KJ3L 4LLQA 3BUBA 4NRZA 4Y2DC 4MFHA 5LGYA 3P77B 3TGXA 4R97C 1IKNC 4AVHA 1JXJA 4C83B 1EEQA 4YXKL 2XG4B 3X11B 2WOYA 3H56A 1KYOK 1JBJA 5AVTB 2EE0A 1H3PL 2WXMA 5J6HB 2P5WB 1G7HB 2EEBA 4PJIA 3WTSA 3RU8H 1QLRB 5D7JD 3DUHA 4ZXBA 5H2BB 1JK9A 5F6HJ 1LDSA 1T66D 4DP7X 2AXJA 5E2WL 5BV7B 2EDFA 5CFHA 2WD0A 1UZ8A 2YA2A 4LCUA 3VUAA 4WHYG 1IM3A 3V7AG 5ISZD 3MJ8A 3C60D 4RZCB 4OCSH 3KWTA 3MCKB 3FUDA 2HFFA 3FSOA 1P69B 2H6PA 3VWKA 2XFXA 3MGOB 3RP1A 1EJ8A 2A6DA 3VFMA 2OMBA 3TBSA 2WXRA 4X4ME 5HYSA 2GY5A 4OM0L 2NZ9D 5DU7A 4PTTA 4UAHA 5DT1L 2A38A 1A4CA 3NRQA 2UUDH 3HE6A 3FQTB 4JZJA 5DA0B 3P4LA 4RRPG 1A1NB 4ZFOA 1WWAX 1NIEA 4P9HC 2HG5A 1IFRA 3RWDA 3ES6A 4K9EH 3ZIMA 5I8OH 2X2IA 3MA9L 1LL1A 2OPCA 5JO5B 1YEKH 3LVEA 4IOFC 2XWDA 3P0YH 2IALA 4M93B 2YAQA 3BO8B 2WJ7A 3CDYA 5DD6B 1PAZA 4C4KT 2C4FT 1ZE3H 4BEIA 5F6IB 4KK9C 3M17B 1RFDL 4YHKL 2DOCA 1SZNA 4BFFA 4WJG3 5J6GA 3PHOA 4PJXB 1JDAA 4LCWB 3K8KA 2WXFA 3X13A 2PW1B 3D34A 3T8VA 1EFXD 4A2EA 4N22A 4RRPA 1H8SA 2EE6A 1OV8A 3MV11 2X0WA 3VG9C 1JV2A 2PXYA 2X05A 1K5NA 1ASOA 2AFNA 2A74B 4ZS7L 3T0EA 1T3FB 2W65B 2FIKA 4DKEL 4UTBA 5FEBA 5MENB 1CN4A 1AG6A 1KFAH 3ULVE 2AW2A 2IH1A 1O6SA 2Y36L 1S7TB 4FFZA 3IPEA 4YFLF 5DUBA 4G8IA 3QP3A 2XIIA 4AITA 4MX7A 3B7YA 3EH2A 4WFFD 3L3GA 1RSFA 3TASA 2WBJC 4NO0D 5IMOB 1IAIL 3H7BB 5LO7A 1FGNH 2CJUL 1JF1A 3O41B 2AJUH 4NZRL 2XQYA 3P4OB 2Q8BL 2FX9L 2VE6B 1JAEA 3ILPA 3LXUX 5IOPB 3OZKA 2YJQA 2VSKB 4NJAH 4NPYA 4FXGA 4CDGC 4U1HB 3QDGD 2X4OA 3QT2A 4DUVA 5C0GB 4BFEA 1J05A 3UXFA 2PR4H 5J13C 2WKOF 4YC2C 4DVBB 3N9GH 2J6EA 2ZCHH 4PSPA 5E8NB 2XXGA 1P84K 5CP7B 2EXWD 3D2UB 2BX5A 4OGQC 1NBVL 3FONA 3T3MB 1YVLA 3NAAH 2DQDL 3K7UA 5D7LB 4AMXA 3CVIL 3TJEH 4H7VA 3KW7A 2VM9A 2WBKA 4KTEH 2JI3A 1C5BL 4FFTA 2G3NA 1YEDA 5FUCE 3WMSA 3D06A 4TVSa 3DX3A 3VFTA 3NA9H 2QMJA 5H35A 2V3EA 4ACTA 3HKFA 1L0PA 4Z3IA 3RUGB 4U1KA 1KJ2B 2ADFH 3KVDD 1XGZA 1UGNA 5AL8A 3TEWA 4WU5A 2BIPA 1J5CA 1LNUA 3D07A 1JMZA 1H15B 3ILQC 5G4OA 4XVUC 2JKXA 3A47A 4Y1AE 5DK0A 2FRGP 3MRMB 5E1IA 4PHZA 5FA3B 4Z3JA 5B39A 1YUKB 5GZNC 5F7HA 4K5NA 3LKPB 2LV4A 2YPLB 4N8UA 5JW3L 5CSGA 3D39B 5KYXB 5E6IB 1NGZB 2IH3A 1B4RA 3NH7L 4A2LA 3O9WA 5ALCH 4OLXL 2IVFC 4YDLC 2HVJA 2OW7A 3W38A 3ZZ1A 5JXAH 5I1KL 3SD2A 3KLAB 3A4FA 4AXWB 1F8TH 3FN0L 3SDDB 4E9QA 2Z31C 3IF1B 3I50H 4MZRA 3CBJB 1NEZB 1S3RA 1QMUA 4G8GD 4JRYB 5HHVL 5I8EB 3CUPB 3F65A 3TNMA 7CGTA 2DN7A 3QIUB 3GLEA 2OL3A 4WZ9A 4P9HL 4YX2H 4X6BB 1EAPA 4TSCH 2Q86B 2EDNA 2XKUA 5EORL 1EGJA 1SEQL 2IGFL 3ZT7A 3FUJA 2QDVA 1GZQA 3NTCH 3SODB 2WLMA 5CD3B 5A2AA 3RL2A 3L4ZA 3MRNA 3AG4B 1GTFA 1BFOA 1AJ7L 1FI8C 2VERA 3VXNB 4A6YA 4WUUD 3JWDC 2LU3A 1ZAGA 3JTTA 3B7SA 1A5FH 2IAMD 4U7SA 1XZ0B 3JV6A 3NFNB 2OJ1A 1SXBA 4NZFA 3WNOA 3F3HA 4NKMB 3GSXA 2WYZA 4H20L 4F80A 3KNBB 5AVRB 1ZGLM 3IBEA 3PGCA 3VSVA 4YO0B 5IY5B 1DO6A 3TTSA 1BHGA 3LH2L 1WSST 1CFSA 2CR3A 2VISB 1RURL 1PS3A 4NO3B 3DROA 4PW9A 3KWWB 2VZ3A 5F3HB 3GSNL 3MACH 1YSOA 3MBWB 1KT2A 3P9MA 4C4BA 1QLFB 2W0PA 3VW3H 3KPRA 1Z3RA 4JFHD 1T5WA 3GSOA 3IU3B 2X6AA 4FLHA 4PEEA 5E0QA 4FQ2L 3FCGA 3HNTH 4G9DB 2EDJA 2JK5B 1A4JA 1R75A 3K8LA 2G2NA 3CZNA 3KM1A 3D85A 2BS71 2RQ8A 4OFYA 5JHDB 1ED3A 5EC1B 1IGJA 1MCFA 1IC0A 2OSXA 4HEMA 1KJVA 3BPNB 2VC2H 3FXIC 2OX5A 4G7YH 4OD3L 4UDUB 2W88A 4HCRA 3V5KA 2GUOB 3MRHA 1J9TA 3DK2A 3FQ1A 4HUWA 3ATAA 4KWUA 5EOQL 5C0JA 1JHLH 1W8NA 3CSPA 3S4SA 5CMAB 1RJYB 5PCYA 3HLAB 4X6CF 3BI9X 4P2CG 1MCOL 1QSED 4OGZA 2OYLA 1DL7H 3DPDA 5HGHB 4JK0D 3FB7B 1H6TA 1CR9L 3STLA 1GOGA 4ZO8A 1GGBL 1DYZA 4BBWA 2DM7A 1TLMA 3QUYD 1I1RA 3TCTA 4LCCA 2AV1B 2VW6A 3SYAA 1K8DB 5CU9A 2BVOA 3BZ5A 1WITA 2YXMA 3QJHA 4R83A 2VXVL 5C0BA 3K1KC 2Z4QB 4DGYL 4UTAL 4K3DH 4Z6AT 3GO1H 5F0LB 1EEYB 1J9SA 1UM6H 5C6TH 3ZZLA 3PV6B 4ZAKB 1J18A 2ED6A 5JHLL 1MG2C 4GW1A 4PBVC 2OKMA 4L48A 2P5EE 2EYSA 3SZ6A 3UERA 4HF5L 1KPUA 2DRUA 1KY7A 2VIRB 2VUYA 3PGDA 1TETL 3T4AC 5D93B 2PYEE 3ZYZA 2M2DA 3IETB 1HJCA 4NWUH 5ESVA 5IVXE 5DEGB 3J07A 2NOYA 3PRZA 4J1UA 4DWHA 4ZFFA 1LO3H 3BH8A 5KYWA 4IRZA 4M8UA 2A73B 4XMPH 3WDHA 3KCWA 5DGRA 5DYFA 5EF0A 4N3TA 1Q9WB 2BP8B 4PJ8C 2DMHA 2C34A 4NNPL 2ZKHL 4PJFB 5IQMA 1C8PA 4M61A 1AHKA 3MCLH 3B7RL 3CFTA 1JZGA 2D8KA 5E6UB 1I8KB 2H1LM 1VIWA 4TTDC 2B3IA 3EOTH 4MKMA 1O9VA 1JERA 3GHEL 3EFOA 1NDGA 5CAYB 5KW9H 5B8CA 5JOEA 2WXHA 4GP5B 4OF5A 4RMVA 4X98A 2V9TA 3HMXA 5E5MA 2Z8RA 3OF6A 4RGMB 1IC4L 3V10A 3JWDL 4OLZL 4XWOD 2X41A 1ECYA 1UWEH 1DBBL 1TO4A 4TM9A 4C47A 5HI4D 4P06A 3NSJA 5AOIA 3VCLB 4PGZA 3RIFF 4GQ9L 5C07B 4K5PA 2Y1ZA 4A7GF 2R51A 4JRFA 4W1TA 3D9AL 4F7MA 4AJVA 5IESH 3KPTA 2LT9A 1LJMA 4YPGB 5DJCB 4J3UA 4KGLA 2GITB 5HYJB 5IT2L 1BZDA 1G6RA 1I9IH 1KIUA 4UBDD 5I8KH 1GY2A 3M1CA 3C6EA 4O5LH 3QG6B 2VZTA 2D2OA 2QKIB 4JM2D 3WKQA 3ZTNL 4U1NA 1ZHBB 5JW4R 1WIUA 1EEZB 1C5DA 1CU4H 1XF3A 2ENPA 4OLVL 1OAZH 5D1XD 2ADIB 1CVSC 1SYVA 1DQJB 5E4OA 4ENEC 3L5XL 4GQZA 4L9LC 4MAYC 3OAUH 1MJ7L 2B59B 4G43B 4OLYL 4YDZA 4HOXA 5JXED 3BOVA 4PWGA 1ZANL 5IHHA 4KKAC 3WFHB 3K71B 5KSVB 2FNBA 4FP8H 3W11D 4Q6IA 4OM1L 4O58L 5E2TH 4NBZB 1AD0A 1KTJA 4GOSA 3AU0A 3GNMH 3V4VL 3K6FA 4LLMA 4X7SL 3T4YA 3DX2A 3VMOA 4K9JA 3GZKA 3MX0A 1A0QH 2JNZA 2JB5H 3MRKA 4OB5H 3HLKA 3KPQB 3ZY7A 4CSPA 4GKZB 5DZOA 5G5DB 3Q1EA 1TQUA 1W0WB 4KDTC 1QUNB 2AK1H 5B1JC 2WXIA 3F58L 3K5RA 4KDWA 4YQXH 4HD9A 1U8IB 3JWOC 4KVNH 1W9XA 1HCYA 4LLQB 2Y1VA 4PJ5D 2EXYC 4NRZB 1HK6A 1QVOA 1JF6A 1A3QA 4LRIA 1I9EA 2ICEA 3C6SB 5FX3A 1O5PA 3HUJA 3K81A 4AH2B 2MPAL 4EEEA 3CIQA 1TVBB 2GTZB 1JGDA 4JN2A 4MMXC 5EV7A 4X4XB 4JPQA 1OL0A 4KZDH 4MTMA 2E7CA 1U8HA 1WS7A 4ABUA 3WIAA 1ONQA 3QZWB 3L6FB 3QO0B 2X4RA 4P2OD 2XV3A 1I1FB 2ZOOA 3L4UA 3UBHA 4RFOL 4JFDD 3QUZA 1S9VB 1UZ8B 2NXYC 5EIVA 1RZFL 1S5HB 5K9JH 4XO5A 1Y6KR 3DI3B 4Z7VA 5CF3A 1R19A 4UQIM 1SN5A 3MUHL 2HFFB 2EIEA 3BIBX 3HRPA 3MOBL 4KROD 1L3WA 2H6PB 5FO7A 5IR1A 1QPKA 4UZSA 5D1ZA 1CLZH 2CBQA 5D96C 2W60B 3S36X 1LP9A 2Q10A 3U4AA 1H3GA 2VXUL 1KNOA 2OMNA 4ZQKA 2PTTA 5GRJL 4JRXB 1CT8A 1CICC 2KLRA 1WD9A 1KLGB 4X8JA 2FBJH 4Y4KC 2DMBA 3N91A 4KQ3H 4TOYL 5KJ7E 3DK0A 4JFEA 3DNKA 4X6CE 1IBBA 3BKML 4JO1H 3RWDB 4LVHB 4RWYH 3A67H 1T7YA 3GZPA 4MB3A 3WO4C 3KYKH 1E42A 4KKCC 5HPOA 2APTA 2WVTA 5E5UB 1NOFA 3E9TA 2VLRE 4HK0B 5IREA 2ADGA 3DPBA 1PZ3A 2DQEH 3DMMC 4XCCL 5F1IB 4GBXC 4HJJL 3VXRA 4GW5B 5GGTH 3KDPB 3M8OL 4K71C 3NIGF 5GS0C 1ZWIA 3ZE0B 4I7ZC 3SSGA 3MO1A 2ODIA 5CINL 3UTTD 4NQCD 3GXIA 5EOTA 3RPKA 5DD3H 3MV01 2F53E 4WNJA 1KSRA 1K5NB 5BV7H 2MNWA 5JIHA 1TMCB 5D2LF 5MEOA 1IAKB 2WUBH 3W81A 4JKPH 4J27A 4YDNA 1KBKA 1O6SB 5IVNA 5TGBA 2ODHA 3NPSC 4JPVL 4OU3A 4R8WL 4G8IB 4TQPA 5DUBB 4ELMA 3UZQA 3AQZA 4JGUA 5AAPA 2WLJA 2XNAB 3BIAX 3L2LA 4U4BA 4GG6B 4FD0A 4IRJD 1WFOA 3E38A 2GFBA 4H44C 1JF1B 2M8XA 2ZUQC 1E6JH 4TRPH 7PCYA 1XIWD 5BZXA 1OW0A 2ZKXA 2ZG2A 3ILPB 4PGJA 2XZAL 3ARTA 3QO1A 2XJLA 4MNQB 3TT3H 3NJNA 2X4OB 3MXVL 3PAYA 2VUKA 1FSKC 4XMKH 4LPCA 1OSZA 4LL4A 5SWZB 1D2PA 5F0JB 2WQXA 2AEOA 3IJSA 1IZJA 3JWOL 4NHUA 3FONB 3VD0A 1YEEH 1MW3A 4X5QA 3MNVB 4P23B 2HTLC 3T77B 2BSEA 2QZ5A 1X5FA 3IFLL 1FNFA 4QEGA 5H35B 2FH6A 4H8UA 1ZS2A 3IWVA 2NT0A 3TT1L 2IDSA 1BM3L 1ET8A 1MF2H 4J3SA 1WA1X 4K3EH 4IMLA 4BCYA 5C0AD 1K3IA 2EO7A 1KN4L 3CZJA 4BGDA 3APFA 4NOBA 2WO3B 3MUJA 5AVZB 4RETB 1NCCH 4NKQB 1AGDA 1T5XB 2XWJB 1UT9A 1MFNA 5SWQA 3EJQA 4ECNA 4D9QD 4N8VA 1BZ9A 2YRZA 2WPGA 3QQ3A 1WPCA 4PWKA 5FS5A 3P2BA 3LMJH 2HVKA 7FABL 1SLVA 3SDXF 2H3NA 4Y4HA 4PWEA 3OKKB 2KPNA 4AIEA 4X5WA 4OQTH 3HNSL 4Y7OC 3HJ0A 4XO4A 4L3EA 5DD5L 1QSFE 4PLOB 3CLFH 1SOQA 2NY3D 2UZIL 2DLTA 3ZE1F 1KTBA 5ESQB 3S8GB 3U9PL 3ZU8A 4P2QE 5LGJA 3L9RB 4CNIB 5F3BA 2OK0H 3LKSB 3B4NA 5DHVB 3LZFL 5IHLB 1HQRA 3ARFD 2JJUA 4XRCB 1NKOA 2PO6A 3PWPE 4K2UL 1JK8B 2DDQL 4TUOA 4HU8A 3ZDYB 1FC2D 1I8LA 2P48B 2G2RA 2V17L 1JP5A 3RL2B 2G30A 3MMEA 5BUGA 2D7MA 4DEPC 2WP3O 1ZKAA 5DURD 4YSAA 4DHLA 1YECL 3RI5F 4HC1L 1IBHA 4LDEB 1H9DA 1DQLH 4UQAA 3P4MA 3JTTB 3KYOA 1DANT 2ZUTA 3RWEB 4A37A 4AVJA 4EI6A 1Z7JA 2KL6A 2BNQE 5GHWL 1NPJA 4APQC 2FGZA 2P26A 4LEXL 5GS0L 4OUUB 1CDJA 3GSXB 5ID1B 3E8UH 3FB5A 4FKEA 5T1KA 3OHXA 3FU8A 4OGAC 3RVWC 4N2EA 4XBEL 3VH8G 1I8MB 2GBTA 3OGCA 2E27H 5GXBB 3VGBA 2Z91A 5JW5A 4LEOA 1NAMB 3RWIB 3GYRA 3UIZA 4BA0A 4M62H 3RX8A 1Y6MR 1CGSL 3KPRB 1XTLA 4QTHA 2OA9A 4XNAA 5HHOA 4PJIE 4PP2A 3SDCA 1UACL 2JLLA 4XN1A 3VD5A 2CK2A 2E4TA 1FCGA 2AF2A 4Y5YB 2X70B 4HKBA 2DQJL 4PB0L 2WKGA 2CH8A 1PYWA 3BWAA 5AEAA 3EYQD 5FW8A 4M1DL 1OE2A 5C0CA 3V4PL 2HP4A 1W0VB 2WIIA 5DWUH 3V5KB 3ARWA 2J1XA 1TT6A 5A2FA 3D4GA 2OYPA 4I18A 3ZKQD 4ZFZA 2W81C 4K8RC 1CDYA 1UXWA 1MXDA 4ZTPL 2WYHA 4ODWA 1BZ8A 2CU9A 3G5XA 1I9RL 1J0IA 1G7JB 5KAQF 3LEXA 4LPTA 5JOPD 5JPMB 4OW6A 4OT1H 1DQML 1NSNL 2VDRL 4PG2C 1TTAA 3TU6A 2DWSA 3IDNA 5I9QB 3AAZB 3I9IA 3QJZA 5I76A 4R0LA 3MROA 2C3HA 3QR0A 4ABVA 4ONHA 4JKLA 1MJUH 5JDJA 1JOIA 5ESAA 4MCYB 4K7FA 1ZLSL 2GTWB 3UG5A 4HXBH 3Q13A 2QQNL 2GUYA 5AZUA 3SCMA 3WKPA 4Q74A 3EUDA 3N41B 3J8F7 1C9SA 4Q58C 4PRDB 4AUYA 4FS0A 1KPUB 4EIGB 4DP0X 4Y16C 5I0VA 2AABH 2FGWH 1IC5L 1P6WA 4S2SA 5EFIB 4AC2A 2DICA 9CGTA 2EADA 1UASA 5CJQL 3VXOA 1DFBL 1MHCA 3TS8A 4GMSH 5GGVL 3P1VA 4OR1A 3BPCA 3BH8B 3P3RA 4D0DB 4PGBB 5D2LE 4E41E 3T0EE 2EC9U 4QKXB 4XOAA 4JZNB 5LN4A 4I89A 1OAQL 5A43C 3DYMA 3DVNB 4I3RH 1RUML 1QFWI 5TE6H 3AG1B 5IQ9B 2HKFH 2CKBA 3LN9A 3LKRA 2LQRA 4XZ4A 4AIZA 1N64H 1F2QA 2V5TA 1JV5A 2KDYA 1HE7A 1EXGA 4FXTA 1YAZA 2GAZA 1AXSA 1P7QB 4G9FD 4ZO6A 5T3ZL 4PS4L 4HJ0C 1MHEA 3MNZA 1NDGB 2FJFB 2EVHA 4AKPA 2NUPB 5HSFA 5B8CB 1FFNB 1B2WH 4P4KD 4NERA 4PIBA 3WI9A 2IWKA 1KUMA 4H88H 3A3YB 1NTDA 3EJYD 4HALA 4N2CA 3HC4L 2D9QB 5FYKU 3K3QA 1R3JA 1D5IH 2E6PA 4KXZI 2NY2C 3IKKA 1BEXA 4QHUB 1L5GB 5JZ7C 1I9JL 3JTSA 3QORC 1U8QA 4U3HA 2RBLA 3H2QA 3NIFF 5EU3A 3SN6N 1E4WL 2Y06H 5BXFB 3OJDB 5JDSB 3ZMNA 4HG4J 1SFDA 3EGSB 2BSTB 1E4XI 5INCA 1G6RB 1TKWA 2YAFA 5FO2A 4EI5A 4R26L 4DQOH 2ENYA 4NQDA 4QT5A 1KOAA 5AW4B 2COVD 3W9EA 4ODUA 4MJJA 3ZSTA 4U1NB 4F8NA 4MA7L 1ZLDA 5DEFA 5BQ7A 3LPGA 4RAVA 4B9IA 1RZJC 3MRLB 4HEPA 3B9KD 1U58A 4FEMA 4MA8H 1SYVB 1PG7W 2ORBL 4PCKA 3MV9A 4OZHF 3VXTA 2BVPB 2ZXGA 2QVIA 1C1EH 1AQDA 4ORZC 1XCTB 1XZWA 5FYJL 4BD4A 5D8JH 5DJ0B 4XNZB 2R0LL 4L5FL 3L5WA 2QGCA 2XVKA 4OLUL 2DH2A 1C8QA 2V5MA 3MRFA 2BW5A 1VADA 2Y7MA 3K80A 2OULB 4CBPA 4KH2A 4L0ZA 3SPVA 4YBHA 4MB4A 1BZQK 4M3KB 2BS8A 4YK4C 1LEIA 1BWWA 1M05A 4GXVH 4L4JA 4W93A 2DYPD 3ESPA 4BUQA 3WHE1 5CIPH 1AHWB 3V0VA 3ZE1E 4LSVH 2QQKH 4K8RL 4K0OA 1M4KA 2ZOKB 4EXPX 1OY3B 2XV6B 5K9OB 4V11A 1MQKH 2FX7H 4EKJA 3S48A 1X7SA 2OW6A 2YD9A 1D6VL 1HDMA 5D1QA 1RK1A 2A9NL 3HS0C 4MMYB 3OC5A 4HXAL 4F7PA 3PWNA 4FABH 3N1QC 3GMNB 4KK5C 4F58H 4XZUA 1GVIA 5D5MF 4R2GC 1HAWA 4QRAA 4LDCA 2YR3A 2VLLB 2YRPA 3ZQ9A 2K9FB 4KNSA 3KPLB 3A24A 4AKOA 4E9TA 1FC1A 5MHSE 2ATKB 1QEWB 3EBGA 1H8OA 3JYBA 4PW4A 3C5ZD 3QAZB 3RL1B 5J9PA 3L48A 2IMMA 1MZZA 1P7KB 1ZXQA 3PABA 4ELKA 3EH1A 4PRPD 3HUJB 2PWDA 4ZOBA 3MA7B 4MB5A 3TFKD 5IF0B 3HE7D 2HLFC 3H4FA 1OE1A 2J43A 1HL9A 2DWEA 2AQRA 2X88A 5GSRB 5JLZB 5MERA 3D08A 2Y2YA 4FG4A 3U0WL 2XDHA 4QIRA 1SRDA 3DJTA 3WLBA 1ONQB 5CJXA 2D03H 4LOUC 5K59F 3T6QC 5IB5B 1IO4C 4TUJA 4WW1A 3PLYA 1NL0H 1UD3A 2HH0L 3Q1SL 4LOEA 5D7SL 4PRBB 2ERJC 1MJJA 4PV1C 3RTQC 4Z7WA 2D9CA 1L9NA 1ASPA 4TLKA 2WNXA 2P8LA 4E2OA 1EJOH 3LD8B 2YQGA 2E76C 4U2ZA 4HAFA 4TNWF 4LBEB 1RUPL 5F9JA 1T6VN 1Y0LA 1JGUH 1PCXA 2DKSA 3GLZA 3RWFA 4OD1L 2VJ8A 4Z95L 3ZUCA 4P2YA 1D2OA 4YHZL 5BVJA 5IR1B 4KRPB 5GIRA 4GFTB 1KIQA 4DGWC 4F3FA 1LO0L 1NKGA 1U0QA 2WSDA 2XVLA 4HEME 2PTTB 5F7MC 3RY6C 2R69L 5JIPA 4X8JB 3SKJH 3BRFA 5EEXA 4KFZC 2XTJC 1DSYA 3WXWL 3QEGL 1HOCA 3VMPA 4AUUA 3T1FB 1NCWH 2NT1A 2XN9D 1F58H 3EDDA 5CN3A 4F27A 1PL3A 4P46A 1AZCA 3HAEH 3MBEC 5AOJA 4NDMB 4PVMA 1E27A 3PQYA 4FFWC 1A25A 3O2DL 5INDB 3GGWB 5CZVL 5ETUB 1NFIB 4A1RA 1IM9A 2QPUA 5A2LH 5JPNC 2WYIA 5C0BE 4LLVA 5BMFH 2G60L 3MLTA 1RP9A 4EUPA 4L8SC 5JR1L 4G1EA 1RZJL 4LCVA 1YNLH 4FQLL 4QHPA 5DS2A 2IWGA 3FTXA 4LP8A 2VXTH 1I8IA 4KK6C 2NY0B 3G6AA 5EOTB 4QJ4B 1WAAF 1P2CB 3O3EA 4ERSL 2PPAA 2R83A 1BJ1H 3FT2A 5J8OA 3K2MC 1FFTB 2QSCL 2H8PA 2GJ6A 1FE8L 1HINL 3N85L 3UAJD 2BIQA 1DP0A 1N6QH 4BE6A 4W81A 1Q1JH 1I1AB 1YUHB 1SQMA 2V5SA 4L37B 1BIHA 3UGEA 4HPOL 4WKZB 4NQTA 3R06B 3MI6A 3HVDA 4OFIA 4HWBA 4OJCA 2BP0A 3KBPA 4Q9RH 2BOLA 3RKPA 2GFBB 2OMWB 4L8BA 5F7EH 4M8VA 2RR3A 1U21A 2K8MA 3MJ9L 4OVVA 1XGRA 5E5LA 1WGVA 3BZFA 1MVYA 3RWJB 4MYWB 4G8EA 4QXUL 1FNSH 1GAFH 3OLIA 1HEHC 5IV2A 5EUKB 3GWJA 2FYYA 3FDWA 4HU2A 1F90L 5G2NA 5IBLC 2CDEB 2YEZB 2WZ0A 1OSZB 4M4RA 2IAAC 2OTWB 4X50A 2P47B 3UEQA 2RALA 4NHUB 1O0VA 2XT1B 2PCFA 3PNWA 4KHXH 1A1MA 3KXFA 4UM9D 5HHQA 3PWJA 4JMXA 2CR0A 5TDPB 3DIFA 3BT2L 1U8CA 1VCAA 1MAML 4KVCL 2QGDA 1G7MA 3HG2A 4HWNA 1KBPA 1OF0A 4X4YB 4E9XA 3BD4A 4O51A 4YHYB 4UINH 4WHDA 1VEMA 2FZ3B 1SQ2N 1OT1A 4YSOA 3MRRB 1HNGA 3HR6A 3MV7A 2G3MA 3CZEA 1ET7A 3FTYA 4QXWA 3IDYB 2IANE 1GJIA 4R7NB 5DEJA 3BISA 1H6FA 1JRHH 2ZUXA 4PBXA 3REWA 4B7IA 2R56H 3CU1A 1J1OH 1LILA 1SJXA 4JUTA 2MQ0A 5MEQB 3O0RH 1BZ9B 3ABLB 2J6WA 3CSBA 3RLSA 3TO4D 1FGVH 5FKPB 3ESNA 5I2IA 3GFUA 1XH3B 3ARDB 4HUUA 4OZHE 2H3NB 4JAMA 3OM3B 5F44A 1M7IA 4Q7DA 5DJ8B 4FJYA 4X5WB 3V0HA 3I3BA 2OSWA 1QNIA 3TTYA 3HI6L 4B53A 3MZGB 2FT7A 4JCMA 4R90H 1DQQB 1FNEB 4QOKA 4RNRA 1PD6A 5CUSL 2MHAB 3SQRA 3ULVD 2QELA 5FFLA 2FJHA 1KZYA 1CLCA 1DEEB 1W80A 2FHCA 3Q5YA 4UILH 1HQRB 3TEYA 1T6BX 1M3JA 4LARL 4Y2DA 2Y23A 3RDTB 1KCBA 3C08L 1X5JA 2JE8A 2WLLB 2OP4L 4WCYL 3RB7A 3CFBB 4GRWE 3MRBA 4K9EC 5AAWC 5CBAB 3LHPL 1OHQA 2G2RB 4ONGL 3TONA 5DHYA 1ITCA 3HZKB 4QRQA 5DMKA 5KSAB 2J1WA 5BO1H 4I3GA 1FYTE 3NRFA 5FM4A 4WDIB 3ZJAA 4AMKH 1XT5A 4LHUA 2FB4L 3KYOB 4PRID 3HPLB 4Q14A 2X09A 4TULL 1UB6A 4EI6B 1LYQA 3WY1A 1QFOA 1T83C 2DBLL 2VYRE 1BZOA 1S3KL 3CXHK 5F1NA 5KYUB 4I85A 5T1KB 3HW7A 1NGPH 4UV4H 4XCYB 1BDYA 4H8VA 5HJDA 4DETA 4UUJA 3DJ9A 3SYQA 2HJLB 4A2MA 1BQHG 1A6WH 4FQIL 2Z91B 4I77H 4XAWH 5JW5B 1MLBB 2F7IA 1K8IA 1NCHA 2C9SA 3GM8A 4B0MM 4BWUA 2LTQC 3KPOA 3MJGX 3NIDB 4J7RA 4A7GA 4Y2OA 3FT1A 4L4TB 4LPVA 4NGHH 1U93A 5K59E 1O7DE 2WY3B 4RX4D 3REVA 4Y1AD 3BSGA 2LFEA 4IS6A 1J0ZA 3MTXA 3VD1A 2XZQL 4BZ2H 1IV8A 3C8KA 3WKML 4KVPA 4XTRC 4MD0B 4AE0A 3LIZL 4FTVE 4G5AA 1E67A 4TSAL 1XCXA 3U1PA 1B6DA 4M6NH 1YPZA 2P49B 4YGAB 5DHVH 4DZ8B 1EQWA 2XG5A 3CFQA 3VH8B 5C0EB 5E8PB 4DJMA 1IC7H 1I85A 2OMUB 3L1EA 4LPYA 3NJFA 4NM8H 4ETYA 1P1VA 1RZIB 4I18B 4PP1C 1LP9E 5LBSH 3WS6C 1GTNA 1UXWB 1T0NA 5KANI 3OLDA 1YJDH 1I7TB 3CU7A 2FWOB 1F1GA 4J3BA 3RVXC 1IAOB 4OTXH 3PV7A 4EN3C 5E6RB 4CU8A 2XVBA 4L2LA 3GJFB 5L4FA 3HG4A 1AGFB 1SMOA 1KB5L 4JFEE 2O5YL 3IDNB 3V0GA 2NMSA 4PMFA 4HX1B 3VRJA 5IIEA 4ODTH 1C5CH 2AMUA 4R0LB 3AM8C 3U9UB 5FLVA 4QRTA 2FD6L 3H9YA 4CW1B 4KOBA 3MKKA 1K4CA 5I75B 1MH5A 1UEMA 3VGFA 5L2JB 5E7BA 4IRSC 5AG9A 4WV1C 1G0YR 2KPWA 3MN8A 4UT7L 2IQAA 3GZOA 3SCMB 4ZRGA 4MNHB 1HZLA 1NAMH 1F4YH 3VXRE 1UJTA 5DD1H 3UTSB 3U48A 4AQ1C 3FK3A 5KOMC 3RYMA 4H26B 4WI8A 3WY3A 3VXOB 3FAWA 4RGNB 3HI5H 3VG0L 5ALBL 3ARSA 2MFNA 5HDQH 3QW9A 3MRCB 1AGCB 4EN2A 4ACPA 3SDAA 3D3VD 1G9NH 2QQLH 4I48A 1J9CT 2P5WD 5E4EB 3QCTH 4MS8C 4LKCA 3P0VH 1TQCC 3KYAA 3L3DB 5KN5B 3RGBA 4HUCA 1IGIH 5TDNB 2O61A 4AZ8B 1ZK5A 2GAZB 1NAKL 4F7TB 5C8JA 4I8DA 3C09B 4K9EL 4OCXL 1EHLH 2WUCH 5I8OL 1F0LA 3WNJA 1A4KA 2WWKO 1YEKL 4L1BA 3K2IA 2QPFA 3X1FA 1QG3A