4FNLH

Crystal structure of broadly neutralizing antibody c05
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
239
structure length
233
Chain Sequence
b'EVQLQESGGGLVQPGESLRLSCVGSGSSFGESTLSYYAVSWVRQAPGKGLEWLSIINAGGGDIDYADSVEGRFTISRDNSKETLYLQMTNLRVEDTGVYYCAKHMSMQQVVSAGWERADLVGDAFDVWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody C05, Heavy Chain
molecule tags Immune system
source organism Homo sapiens
publication title Cross-neutralization of influenza A viruses mediated by a single antibody loop.
pubmed doi rcsb
total genus 45
structure length 233
sequence length 239
chains with identical sequence I
ec nomenclature
pdb deposition date 2012-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fnlH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fnlH01
3ULVH 1CFTB 2EYSA 1IGYB 5I18L 5D72H 2KZWA 3LZFH 4NNYB 1QACA 4YX2L 5DSCB 2OR7A 3TM6A 1IAKA 1FJ1A 2GK0A 1CLZH 4I77L 4LLAA 1FFNA 3RUGF 4AENA 5BV7H 4U1NA 5I1HH 4PJDB 2UY7A 4HG4J 3ZE2E 3AAZA 4U1KB 5ENWA 4JZJA 3HMWL 1XGRA 1K5NB 4U33A 4ZQKA 4UQ2A 3T0EB 3RU8L 2AEPL 1GZPB 3GMPA 5HHVH 3KLHC 2KQMA 5DA0B 2YWYA 4Q0XL 1TITA 1ZA6B 4OLWH 2Y6SD 3QEGL 1OOAA 5TFSH 2NY6C 2J8HA 1CGWA 4KJQC 4OLVL 5T3ZH 3BQUD 5EC1A 4BZ2L 4PGJA 1JGEA 4FTVD 2GSIB 1D5MB 3DGGB 1P7KA 1QBML 3SDCC 4M1GL 4HS3B 1OTSD 4ESKA 3MYJA 3QHTC 4MAUL 4EN3C 2YXMA 1QBLL 3GEWB 3OTTA 4QHUA 4G9FE 4F7MA 1YJDC 4ZFFA 4R96B 4ZUWB 3BQUB 4POZD 1XGQA 2P24A 4R8WL 1DN0A 4M02A 2HJFA 4ONHA 2QADD 1GAFL 1IZJA 2OI9C 1ED3A 1KIQB 1L7TH 2F54D 4PP1D 1WCBB 4OCRL 1AKJA 3LN5B 5E8OB 4Z7VA 5JMOC 4I3GA 2BRQA 3SDYL 3G9AB 1MJ8H 5TGBB 1MAJA 1GYAA 3UC0L 3U82B 5D4QA 1UACH 3WKNA 5B38G 5JUEH 1IKFL 2VLRD 1BWMA 2AXGA 4H88L 2KUTA 1F8TL 3O41B 5IB5B 1F3RB 1UB5B 2FJGB 4KRPB 1FN4B 3SGKC 2SEBA 5D7JC 1U36A 5E56A 4RRPA 5E2UL 4F3FA 4OGAD 3SN6N 1CLCA 4HIEA 4PP2A 2EDWA 3TBSA 4NZJA 4ZMAT 4U1JB 1FP5A 4JQXC 3UJIL 5I1GL 1KIRA 1EAPA 3TBWB 5DS8A 2EE3A 1P6AB 4C58B 1U8MA 4UILH 4PB0H 1NC2A 5CHNB 5IMOB 3AAZB 4TSBH 1A64A 4U1KA 4XBEL 5HGHA 5SWSD 4DUWA 5DMYA 3WS6C 3T3PF 4TULL 3T8XA 1JF1B 5T1LA 3C9NB 4P5TB 3EO9H 1UM4L 3U7YH 2XKNB 1JI2A 4QRRA 4O2CB 3JWDC 3MCG1 4G42A 5TDNA 1JMXA 2J4WL 4ZPTB 3RZCC 1N26A 4KROB 5E2TL 2VLKD 4M7KH 4KY1H 1XGUB 1LHZA 3VXMB 1FNGA 4OV5A 3QPQD 1K85A 5B8CB 3DRQB 1I1YA 5DJXA 5EBLA 5C0BE 1W72B 1LD9B 1NEZG 2Q76A 2EDDA 1AD9B 5KVFL 5IIEA 1ED3B 1JN6B 1LP9A 3MLSH 3UYRL 1KTDB 1L0YA 3MRMB 4DUVA 1XZ0A 5DFVC 4XVUD 2NPLX 4MNGB 1AY1L 1B0WA 3PGFH 4MVBC 1MHCB 3VDAA 4NC0B 3OKKB 4G9DA 4LQFH 2ERJC 1OP5H 4P23B 3OG6B 3UBXI 1MFBH 1IGIH 3RVWD 2VLLB 5FO8B 1CFNA 1UXSB 5HGDB 3D18A 1GH7A 2C4XA 2DAVA 3O9WB 2YRZA 3WS3A 1GRWA 3NBNA 5D7IE 2G2RB 3TBTA 1YMHA 3BPOB 1BQHG 4RFOH 3E2HC 1HHKA 1FYTA 3MLYL 2BRRH 3T65B 4JB9H 2E7BA 1S7UB 3Q6GL 1X5LA 1WC7B 5LQBL 5MENE 2NR6D 4QOKA 4CN6A 5BVPL 1Y18A 2P8PB 4FXGA 3DUUB 1KLGB 1OW0A 3O3BB 3N50A 1FQ9C 2J8UB 2F58L 1PVHA 4LCYB 3RWIB 4JQVA 2UY6A 2L7JA 4Z7VB 3VD4A 1ZT7A 3UPRA 4R0LB 4X5XA 4LLDA 3O8XC 3QXAA 3UAJC 3V5HB 3KPSE 4OSUH 1LILA 4E42A 3LEVH 5BS0B 5GZOD 4PJBE 2OZ4A 2FDBP 4XCFH 4UT7H 1SJHB 2CO6B 1G0XA 4G8EB 3ULUL 1T03H 2LU7A 2ZCKL 5SX5K 3M1BA 4Q6IB 3BIAX 3PGDA 4AT6B 1W72A 1W2KT 2VZOA 4KZDH 2WUCL 3VGBA 3S97C 2V7HA 2DQUL 2FHBA 4PJ8C 4PD4K 1I85C 3QRGH 1QRNE 4OZHB 5CIPH 4J6RH 1F42A 3DHJA 4TUKH 5TPWL 3LHPL 2X70B 4UI2A 5LBSL 2CQVA 4IRJB 4M5ZL 3KYNA 4J3OC 3D1MC 1PLGH 2OTUB 4P2QA 1TZIA 3TVMD 4YPJA 1AH1A 3R8QA 1XFPA 5BXFA 3TYFB 2IALA 3V5KB 5TF0A 3T2NL 3MUZ1 1E4XI 1JHTB 2XKSA 3DUSA 3OWEA 4ZXBD 1DLFL 5F7YC 3BW9A 3QWOA 2FD6H 2QHLA 3LZFL 4PLJC 5CSBA 5F1KC 3QT2A 1NSNH 5IB1B 4OCMC 2FBJH 5T1DL 3TT1H 1KJMA 4Z77B 4BQ8A 2HMIC 4PRHB 4ZXBA 5KSUB 4HUUA 2GJ6B 1KIRB 2XPGA 5E2TH 4N0YH 2NNAA 1NCUA 3PUCA 3L3IA 4LLQA 4WFFD 2D31A 3C5JA 1J88A 4KRNA 4NKMA 4JHAL 4AG4L 2JJSA 2EICA 4FA8A 3OR7A 1SY6L 2R0KL 2ZZUT 5I1AA 4GW5A 4XBEH 3X17A 5JMRA 2B5IC 2NY5H 4KAQL 1QFUH 5L8KB 2HT4D 3PNWB 1Z5LA 3WUWA 4GQ9H 2MSPA 2GCYA 1VCAA 2RFXB 1B2WL 4NYLB 3V6ZA 2H8PB 3MCLH 5FA4B 1QSFB 3U0PA 1HQRB 4TNVF 2BVEA 3GJEA 4KROC 2VMFA 4H8WH 5DR5H 1N0XL 4ODSH 5DRWA 2IFFH 1FZKB 2APXA 2QSCL 4L8SA 1TETL 4U1GB 5FM5O 4HF5H 1U95A 1VFAA 2WP3T 3G08A 1TJHL 3F58L 3MJ8B 4EEEA 2J5LC 4O2FA 3GSUB 4PBVC 4GAJL 4OF5A 4JFXA 4OZHF 1G7LB 2R29L 5KSAC 1C7SA 2AK1H 1XIWC 5JIIA 2R4RL 4QKXB 1DBMH 3GSRB 1RAMA 35C8H 1IAMA 1NC4B 2EDBA 5DD3L 1I1FB 3OAYK 4M6NL 4WFHD 3LN9A 3T65A 3SQBA 2R56L 5C0DA 2IG2L 2OI9B 4UV7H 3TNNA 5JLZA 1WZ1H 4YHMH 3L3OB 3RKPA 4U7MA 4OLZH 4RAVA 1OQOA 3O3DB 4LSTL 4XH2B 2MNUA 1BEYH 3SPVB 1GL4B 2VLRB 4ELMF 4X7CC 3O3EA 5AYQA 2DI7A 1CFNB 2XOTA 5GSRB 3RI5F 4DKFL 4NP4L 3Q5YA 4JFYA 1VEMA 3CPLA 4F8QA 2NY3B 3ARDB 2EXYC 1BFOA 1Y0LB 2FH8A 4EZMA 2QQNL 4KRLB 4QNPF 5DWUH 3L3HA 2RFXA 4PJCF 1M7DA 5C09A 4AL8L 1I8LA 4FFYH 4PR5A 4K7PL 1VFMA 3PGCB 5I9QC 1D5BA 3ARDD 5JW4M 1HSAA 4QHKJ 3MTRA 5F7DA 1RUML 1PSKH 3FHAA 3IGAA 5B4MD 3RL2B 4NO0B 5HDBE 4PLNC 2VDPL 3GK8L 3BZDA 4PB9H 4WTZA 1JI1A 5E7FA 5F3HA 3RX8A 2FJHA 3KLDA 1O7SA 3LAFA 4LOUC 4W6YB 1OB1A 3BMWA 3QZWA 2EDYA 1EMTH 2BZDA 4OFVA 3MJ8A 2H26A 4LLMA 4XP4L 2I07A 2I9LA 4D0CB 5ICZA 1U58A 3MRGA 3WN5A 4OF6A 4M43H 4U1NB 3GMMB 3O8XA 1RUQL 2Y36H 4FMKA 1RK1A 4NT6A 2IWGA 3V95A 3SO3C 4ORZC 3HN3A 5GGTA 1U8QB 1BM3H 2C26A 1TENA 1WFOA 2VUYA 3BW9B 2MOVA 3LKPA 1NAMA 4LDLB 4L1DA 3V6BR 1MCSA 2IC2A 2Z8SA 3BUTA 1HH6A 2P8LA 3TZVD 3I6LE 3QYCA 1GCFA 2G9HB 2D7TH 4H5SA 3JWOH 5FO9B 1BJMA 4TSBL 4W70A 4LLVB 3WLBB 4WW2A 4F57L 4WTWA 2G75A 2W07A 1JIBA 3NCJL 2HG5B 3L7FB 5JIKA 5IT2L 3KPRD 1N5YL 1G6RH 5HYJE 1ES0B 4PRHA 5F7WC 1LEGA 4NHCL 4YHIB 3MA7B 4GXUN 5C2UB 3MR9A 1U8LA 3G6JB 3NTCH 4OAWA 5DK3A 1MAML 1OSPL 2QHRH 3ALXA 3MLUL 3ZMRA 5F96H 4M61A 3CSPA 1CDYA 1MHHA 4Y19E 3BZ4A 4MMZC 4MQXD 4PRHD 3DGGA 1DVFC 4EDXB 3VGAC 1H0DA 2A77H 3GSNL 4LLMB 1D6VH 1EEYA 2D0GA 4XP5L 4X7DC 2JELH 4LASH 5T1KD 3RZCA 1RUPH 2Q86A 2WIMA 3FN0H 4NGHL 5KTEH 3D39D 4GO6B 2Z31D 5CP7B 5DMJB 2B2XH 1JPSL 1XCTA 1IBGH 1T04A 2X4PB 2GITB 5FKAB 2X4TA 4GMSH 5ANMA 4P9ML 2NY7L 1RZIB 4XI5C 2IMNA 1OCWL 4YE4L 5IK3B 1OD7A 3L95A 2EYRA 1JWSA 1TPXB 5D2LB 1N6QH 1F2XK 4AENB 3CVHB 3OKEA 3ARED 2Z92A 1H3PL 4X6EA 3DNKA 4IRJC 3P11L 4JPVL 1LO3H 2FLBT 4MJ6A 4NNYA 2XN9E 1BECA 4FMFA 1NCCL 3WFBL 2A0LD 1KJVA 1KFAH 4XH2A 2LFGA 4LSTH 4K7FB 4XP6H 2P48B 5L6YH 1F6AA 3WEXB 1WZ1L 4LNVA 4WENB 1INDH 4OFPA 2GT9A 1ZS8B 2QSQA 1CE6A 4XVJH 4MAYC 2MTPA 1CFTA 5BS0D 3IETB 5IMKB 2VWEC 3FKUS 1KOAA 1MIEL 1K2DA 3IJSB 1PKQB 4KU1A 3JXAA 4G6FD 5I8OH 5LJYH 2A6DA 3DWTA 3EDDA 4JY4B 3ELAT 4NO2B 4NKIL 5J1AA 4N0FA 1CK0H 5DVLA 4BELD 5F7NC 2AV1A 1CIDA 4PLKC 3C8KB 1MOEA 2EDHA 5JW4R 4KMTL 2AK4E 4YXHH 4X80H 4M61B 3BN9C 3RA7H 3IXTB 1KACB 5F8QC 1JGUH 2VLKA 1X4XA 4LMQI 3RPKA 1T66D 2XXCB 2LU4A 4LRNL 5JOPD 5C0AB 1G7JA 5D1QC 1JYWA 3WHXB 4K23H 1F3JA 4RBPH 1AR2A 4IRSD 4MJID 2P5ED 4FFWC 4JN1L 3B2VH 1FVEB 3CLEL 4PJAF 5GS1C 2SEBB 2G75B 2PF6A 4NKQB 3IXAA 3VWJD 1DQJB 3OJDB 1I3VA 4YHKL 3RWGB 2IBZY 4YZFE 1DQMH 5KW9H 4H1LG 2XKUA 4NQSB 3DECA 5LGKA 4U1MA 4O51A 1G7HB 1J1PH 3AU1A 4KKLD 4RMRA 3U46B 2HT3D 4O2EB 3I85A 1T20B 3KXFA 4G6AD 4ERSH 2OL3A 4OCWH 2V17H 1JBJA 2IAND 3BIKB 3T4YA 1F4YH 3FFDA 3LRSB 1NLDH 1VFBB 3WLWC 1M7XA 1R3LA 2DQHH 3LKPB 4D0DA 2EO1A 3BKJL 4Y7MA 1H0DB 4HEPG 4KK5D 4UQ3A 1UWXK 4TUJA 3V6FA 1T22B 1T6WA 4R0LA 4X5XB 3EO0A 4Y1AD 3O45A 4Q9RH 1UZ8B 1UFUA 1Z2KA 4HWEL 4AIXA 4NQDD 1GGIH 2O5YH 4JRYA 3BEWB 3I6GB 3P4NA 4HFUH 3GSWB 1A02N 3R06A 1TZIB 4F7TB 2NY3C 1QFPA 4FZEH 1TDQA 4OI8A 4BK5A 5GS0D 3EO1A 4PJ7F 1CLOL 2V7HB 1ND0B 3I50H 3RWEB 1BHGA 1IC1A 5EU3B 3U9UB 1A6TA 4R4FL 3KPNA 2P47B 3QUXC 4XP6L 3NIGF 1MRCH 1HCFX 2BVOB 3ZT5A 4YR6A 5CKAA 4PIRF 4H25B 1CICA 1XF5A 2X1PA 4ZO7A 4Z76B 2Z4QA 1KCVH 3GMLA 5ELIA 4L9DA 5GGSY 3CCHB 4X8JA 4PRDB 1CU4L 3QPXH 3X11A 3G5VB 2FLRT 3VFVB 2YBRA 1K4DA 3FJTA 5C08B 1MRCL 1I8KA 1OCWH 4UV7L 1NBYA 5B8CA 3LD8B 2X4RA 1RIUL 5CEYA 4Y2DA 3QUZC 1HE7A 3X3FH 3QULA 4U6YA 3ULUC 3DI3B 4N68A 2ZUUA 1TQBC 4HKZA 3NGBC 3L3IB 2OR9L 2NW3B 1FAKT 3H3PH 1VB9A 2YPLE 4JRXD 1IC5L 3WFHA 5D5MA 4FQ1L 1FNHA 3TBYB 2YD4A 4AEHL 3GJFA 3W39A 1EHXA 1QLEL 4U49A 5IFAH 3B3IB 5C0RH 2HT2D 2UYLB 3AY4A 4LIQE 1VEOA 4HIXH 3JWOC 1H15B 1JHTA 3RGVC 3TESA 4ODHL 4UDTB 3WIFB 1FV1B 2YN5A 3MLSL 3RTQB 3UYRH 1HKLH 5CBEB 1YDPA 2VRAA 1FO0H 3VH8B 3C6LC 1HQRA 5BVJA 3TBVA 5HDLA 1J0HA 2XY2A 1DTUA 3T4YB 4ZD3L 4KKAC 2Y9RT 1DQML 1DUZA 2W0FB 4MX7B 5IHZB 1XF3A 15C8H 3BGAA 4OD3L 1JFQH 3CFBA 2R0KH 3AROA 3IF1A 2OJEA 4KQ3H 4RBPK 3V8CA 4I4WA 1U3YA 3QH3A 3KLAB 2ESVD 1LVEA 3OR7B 5F7LB 5FAAA 3ARGD 3WN5C 4R26L 4PRHE 1B4RA 3MMEB 4HIJA 4GKZB 1AQKL 2ORBH 4MSWA 4ZYKA 5ISZA 1MCPL 2CLRB 3AUVA 4I3SH 5IJVB 3GMOA 4M7LL 1NMAL 2OSLB 5EFIA 1UQSB 3QIBD 4JN2A 5I1JH 4E0RB 1HXYA 4HPOH 1G7PA 5H35A 4ZDHB 4FZ8H 3IU3B 2PW2A 3VDBA 4LCWB 2NY5L 1T2QL 1U93B 2ZCLH 3S9DB 4NQCB 3QA3A 5B39A 3HZKA 4HV8B 1MVFA 2FX8H 3SGEI 5FK9B 5C92A 3LB6D 3GJFB 2IQ9L 4K71B 1BZ7B 3H42H 2HTKC 3ILQC 3TYFA 5HI5C 2IPKA 3PWVB 3AU1B 3G9VA 1S7VB 1RMFL 1OB1B 1Q1JL 3QZWB 2F8OA 2X4NA 3BFOA 3EHBC 2EE6A 3KLHD 3EOTL 5L8JB 2WWKO 1SMOA 1HQ4B 3DARA 3VE0A 4ETQB 2FATL 3UROR 2X41A 5CJOL 5HD8D 3RWCB 4C56A 5IM7B 1CU4H 3QPXL 4KDWA 5D2NB 4MX7A 5IHZA 4F7MB 1OY3B 3GM0A 4YK4C 4NM4L 4HSQA 1A21A 4LGRB 5D93B 1QSEA 4PRPD 1F13A 5D6CA 4NWUL 3EKCA 1KJ2B 4OQ1A 5HBBA 1R3KA 5CP3H 1CBVH 1NBVH 2YC1B 4MHHI 5F9OH 3AREB 2YD8A 2FL5A 1V7ML 1N2RB 2AI0H 1N5AB 4G5ZL 1ZVSB 3HS0B 3I2CL 2XWTA 4RAUA 2EECA 3O6KH 1RU9L 4M6ML 3WV0A 4XNYH 4HUWB 5CEYB 4RX4A 3VXUA 2AJSL 4PJAE 2WIIB 5IV2A 3HZKB 4HV8A 4G3YH 5I2IB 4FFZL 1A1NB 2IGFL 5ID0A 4BYHA 1KELL 5E4IA 32C2B 4NJAH 4KKBC 3SDDC 3SGDI 5EULV 3U0TA 4PPTA 4R4NC 1GGCL 4ONFH 3MSPA 3OPZL 5HYSG 1EIBA 1M7IB 4JO1L 3V8OA 2FEDC 4R3SA 5I71C 5ITFA 3T0EE 3H9HA 4Y4KA 2ZOLA 4Z7VF 1FORL 1T83C 2VAAA 3VCLB 3UTTB 2W0KA 5E6YA 4DN4L 3P4MA 4RWYH 1QSVA 1HHHA 5F21B 4S1RL 2HH0H 2WINB 4JFDE 4OV5B 5EU5A 1N6UA 4L5FL 1TJHH 1UM6L 1IGIL 1JCKA 1YYLL 1URLA 1BVLA 3RUGA 4PJCA 5DJ0A 2AJZB 5BMFH 4UIMB 4QLRA 5I1HL 4HPOL 1MREH 2FB4H 1FORH 2EEBA 4WFEE 5BJTA 2LVCA 1FO0L 3C60D 1YECL 4ODWB 1G7QA 4IDLA 1RHFA 4QOKB 4G9FB 1VKXB 1YPZF 5FYKD 3HB3C 4ODUA 1A7OH 1YEJH 3QISA 1ZSDB 2RR3A 2VXVH 3G5YA 3RJDA 2EE9A 2R2EB 4HJ0C 3TZVB 2NYYC 4CVZA 1INQA 4LVHC 3D25B 4V2CB 3WS3B 1FFPA 4BJLA 2J2ZA 2CO7B 1T5WA 3WNNA 5ACMA 3QQNA 5KW9L 3GMRA 2IALB 3O11A 3KWWA 2VXTH 2BSRA 2LABA 3H2WA 3BYYA 3NCMA 4L4VB 1FGNL 2DL9A 2R2BB 2EC8A 3CU1A 5D96B 2PW1B 1CD1B 1C1EL 3B2UC 3QQ9D 2KQNA 4KJPD 1T1XA 2C3VA 3C09B 3LVEA 1TJGL 2Y4SA 2Y07L 3DBXB 4JGUA 4LKXA 3QIWB 5D1ZC 5M7QA 3GRWH 1XAUA 1HWGB 1SBSL 2F9BT 2XZCL 1J87A 3VXQB 4HW6A 4LPYA 4OB5L 2HN7A 5I8CA 3WKMH 3V52L 4TPRH 1QPPA 3UBXG 1QG3A 4XPBL 3JV4A 4PG2A 2X4SA 5GZND 2A73B 3PXHA 2ZPKH 1X5GA 2E7MA 1KJVB 5JPMA 2AJXL 5F1IA 1JZ7A 1F3JB 1TTGA 3ULUH 3VFWA 3WDHA 5EC2A 4UT7L 4HQQL 5D7LD 3LQAH 5JDSA 3MOAL 5C0GA 2Q3ZA 3A0OA 4OM0L 4D0BA 3FQXB 2VLJB 4L4VD 1OWWA 4ZAKB 3ULUE 4EI5A 5IG7B 4LAQH 1NCAL 4HPYL 4ONGH 5HHXH 4P9HL 2GITA 3R0NA 3RGVB 4QHLB 1VADA 5FHBL 4GW1A 2ESVE 4PJCE 3BHBA 2FYYB 3MLZL 5DJ6A 1JWMA 4I18C 4G6KH 2VH5H 1WBXB 5EOTB 3UJTL 2C1PA 2LE9A 3WMSA 3RPIA 1PKQA 5C9KA 5FYKE 4LSPL 1VGKA 1I1RA 5E70A 1E27B 3C60B 2EEDA 3PWUB 4JFOA 2DB8A 3MJGX 2R0ZH 5DT1H 3QFJA 2Y06H 5D6DC 4AH2B 1T6VN 5E08H 1UZ8A 5AZ2L 2D0HA 4P3DA 2MWCA 5CZXD 3RHWK 5B3JF 5TH2B 5FGCE 5KVFH 5MHSE 3W9EB 4ELMA 3GKWH 3OL2A 5TE4L 2A6JB 1JPGA 4HT1L 3ULVL 2YA1A 4ISVA 4GRWB 25C8H 5EBWB 2APWA 2JJTA 3WL9B 2GAZA 2NY1D 4O51B 1R3HB 3SBWC 3HR5A 1K8IB 1A6WH 5FFLA 3S34L 3VCLA 1JGDA 4U7SA 4WO4C 4DVRL 1WTLA 3H0TA 4M7LH 2IH3A 5IBUG 4YIQB 4K8RC 5I1JL 5D7IF 3RNKA 2Q7YB 1C12B 4LU5H 5IOPB 5CLTA 2VXTL 2JF1A 5LCVH 3CDGA 4L9LC 3VXRA 4ZQKB 1FNAA 4DGYH 4RFNB 3WHXA 1MFCL 1HHGA 3SGKA 3O3AA 4I8DA 4M7LT 5ID1A 3ALWA 4NDMB 1NFKA 4JM4H 4JEGB 5DMKB 1WBXA 5EOTA 3LN4A 4MS8C 4WY7L 1FO0A 2P46B 3VI3F 1IRAY 2WLZA 4PV9B 5D7SL 1SBBA 2BOCA 2OJZL 3RDTC 5DJ0B 6FABH 1FRGH 3NVQA 3UZVB 1G7IB 3DI2B 5D93C 3LIZH 4O2EA 2X44D 1S5IH 1U41A 1BX2A 1DSFL 4JG1L 3ILPA 1XIWD 1PZ5B 1XGYH 1J1XH 3TN0B 4MJIA 2VR4A 4NUGH 1BLNA 2AJSH 4LSUH 1OAQL 2GK2A 4KZDL 1P9MA 2OK0L 3IDUA 4YO0A 3QNXB 2DBLH 4R96A 3SE4C 4HC1H 4I18A 1MHEB 2BFVH 4ZSOE 2WSKA 5GGTL 3RTQA 3BVNB 2VLME 4NP4H 4QY8B 1BBJA 4B7LA 1WAAF 5L2JB 2HJFB 4ONHB 2WWMC 4KK6C 1QBMH 5E5MA 3SBWA 3QNYA 4JFOB 5GS0L 1VGEL 3RHWF 1Q72L 4XHQA 4HS3A 4ZFGL 3OAZK 4PJXA 3TPUB 2ENSA 3VWKD 2EH8L 4KMLB 4NZUH 4AL8H 4PP1C 4V1DA 2HFFB 1JHLL 2X1WL 3C5ZB 2ARWA 5I75C 4C83B 3ZL4H 3BT2H 1A9BA 2NZ9D 5J12C 3DX8A 5EU6A 5F7DB 2MQCA 2PYEB 3BEVA 4LLYB 1NMCC 2CIIB 1IT9L 1RIHL 1IGTA 2AVGA 3Q5OA 4TNVK 4M8VA 4XAWH 5D1XC 1ZLWK 3VRJA 4I77H 4JQIH 5I6XB 4DAGH 4FOMA 1YUHB 2AJYH 2Y5EA 5BCAA 2BC4B 4CJ1A 3S4SA 5DRXB 5JOFB 3T0EC 3HNTH 2FH6A 1JF6A 2YD7A 1RHHB 1YY8A 3HKFA 3C08L 5ALCH 1UJ3A 5IOPA 3FONA 4L3EB 4QEGA 4F9LC 1FVDB 2F53E 4Z7UA 2CIKA 5DQJA 3RU8H 4PRAA 1A6AA 4HK3N 1Q9KA 3EOBA 3TZVC 2D7TL 4HKXA 4XX1G 4PRNA 4EI5C 1I1YB 3AS2A 3SDDA 3JWOL 3JWNC 3TO4D 4LLVA 2VOTA 4KGLA 4MXQC 5ICXB 3ARYA 5GRJL 2A83A 2LAGB 3QUKA 4XPAH 1A7QL 4NO3B 3SKJH 4X7EC 1FYTB 4ZG1A 3ZE1F 3CFCH 1FZJA 4EN3A 3OBAA 2W65A 1X6LA 2ZNWA 2VLLA 2FNBA 2AXHA 4DVRH 1MHHB 4FG6C 4XVUC 5CGTA 1XMWA 1PEZA 4BZ1L 3ULVE 3NIGE 4IRZH 5KZCD 3VXNA 2JJSC 2VXSH 3TT3L 2EDFA 4GW4A 3VW3L 3BGFB 4G6ML 2YUZA 4XAKD 4P9HC 1PG7W 2BNQE 3QO0B 3V6OA 3MBXL 2PTUA 1NFDA 2AJVL 1FH5H 1T0PB 4OZ4B 3C6SA 4R2GB 3ZO0A 4LPCA 5EPMB 1RJYB 3JV6A 4LSRH 3E6FB 3RL1A 4M7JL 3SGDH 2EDQA 3PHOB 3QH3B 4YPGA 4GRLD 3UTSE 1NGYA 3QBTB 5E8EB 3QWQB 3RWHB 2JB6B 3VFTA 4AT6A 1ZA3B 5LXGH 1BOGA 2CIKB 3OX8B 1HDMB 1P5VA 4QXGH 1HZHL 1Z9LA 2OR9H 4D9RD 3HC0A 1XR9B 4PJ9B 3RDTB 2GSGB 1T21A 4I3RH 1OHQA 1TVDA 4J7RA 4TSCL 3D0LA 2VLKB 2FIKA 1IGJA 2BNUB 5CD3B 1KELH 3BP4A 5F7EL 4H88H 1L6XA 1NBZB 3ULSB 1KTLB 1JUFA 5JW4N 4JVWA 5DHVB 2MMXA 3V5KA 4Y89A 4XXCA 5GIRA 3OGOE 4HXBL 5KZCB 3ILPB 3RWIA 5EIIA 1B88A 4LHQB 2VDOL 3ARXA 3QIUA 1N8ZA 4MAYD 1S7QA 1R3JB 3NCBB 5BXFB 3B6SB 3O6KL 4EJ1C 1HEZB 2X09A 3PE9A 4IOIA 1RUKL 1HIML 3IETA 4OZGB 1KEGL 4NO5A 2V2TB 2IANE 4Y19D 5T1LD 3IFLH 4NQDE 3W0WD 2EH8H 4NZUL 4V1DB 5GS0H 2J6EL 4Y1AE 3STZB 4ZFGH 4YAQA 4JZJB 4PYHA 4Y4KD 4XCCH 1OT1A 2W9EH 2DQEL 3F62A 4WV1A 5FUCC 1X7QA 1NUFA 3UPCA 1WFUA 1TCMA 2UZYB 1EO8H 4NC1C 3N06B 5KBNC 1NPUA 1CXEA 3BDBA 1IGFL 1FSKC 4E42B 4G9FA 4XGZA 1BVKB 3C6LA 3OKOB 1UCTA 3EJJX 3V6OE 4NKOA 3STLA 5C0BB 2R1YB 3VE0B 4ETQA 3VI4F 4OF8A 3MRIB 3O4OC 4O02L 2BJML 5D1XB 1IARB 1NEZB 4GH7B 2ADIA 2GJ6D 3U2SA 1EJOL 3MLVH 2E5EA 4ZODA 4JG1H 5HI4C 2E6PA 5BV7L 5CSZA 3GSXB 3OXSA 2X5PA 1AO7E 4WW1B 1VACA 4LLQB 1U3HB 4OFDA 3GHBL 5DMIH 1R3IL 2HT4C 2VKWA 3EW3B 4ZXBB 3TIDB 2VABB 3VXNB 4BZ1H 1GPOL 3VW3H 1DEDA 3RVXC 5D5MF 3VFSA 1CDJA 5IEHB 3WHE0 4PREA 3VXUD 3FFDB 3LRSA 5ANME 4O00A 4X7TA 1AIFB 4NN5C 3CFCL 3FQWB 3VWJB 3O0RH 1JPFB 1C5BH 3FQUA 1S7SB 2I9LB 1LEKB 2RGSA 1QSFA 3U0PB 5JXED 3O9WD 4LFHD 2O5ZL 2R0WL 1OVZA 3O81A 1AC6A 3V0VB 4IRSB 1NGWB 4K9EH 2Y6SC 4U6YB 2ED9A 1ZKAA 1DBAH 5KSAD 3WS6A 1U2CA 5BS0E 4YXHL 4XP1L 2ZSVA 1B0RB 4OZGF 4KZEL 2CDEA 2D9QB 4ZAKA 3MCKA 1JGUL 3QAZB 1FL6A 1H3VA 4FQQA 1IKNA 4UINL 3S98A 4F9PC 3TFKC 1MVUB 4CADA 5KVMC 3CFKA 3L3HB 1UEYA 4CMHC 2YPVH 1F6LL 3MLZH 1CLYL 3I3EA 3VFPA 5C0BA 1WGOA 4YHLL 3ECBA 2D9CA 4HS6B 2IH1A 2UZIL 3CDFA 1UCBL 4APQA 4PRDA 1PZUB 1LO5B 3ALPA 2YHGA 3EDKA 1BEYL 3TPKA 3CMOL 1VGKB 2KDGA 3J7HA 3STZA 2B5IB 1JNLH 4HKJA 2E7LA 2WMPA 1UVQA 2D7QA 4DGIH 1EBPA 4OZGA 3A67L 3OKLB 3SDXE 4JFDD 5I8EA 2OL3H 2NW3A 1J11A 5FHBH 4YHYC 1P4BL 3V0WL 1A9EB 3RJQB 3QI9C 1VADB 4JPWH 1AKJB 3LN5A 3UTPE 4OM0H 2J88L 1Q9LB 4U1GC 4OZIF 2XQBH 4GBXC 3ESUF 5E6IB 3MXWL 1IGJB 1A22B 5C0IB 4BH8B 5CD3A 1CGVA 4EI6A 4YHOL 2QSCH 5C0GB 3V5DA 1AP2A 3BDXA 5I30H 5C0FB 3IFLL 5KSAB 4P23A 3HFMH 3U4EA 1XIWB 5F1IB 2DMKA 2AGJH 4ZYKB 3SPVA 2AERT 1QA9B 4KVNL 3LPWA 4ZUSA 4S2SA 1X5XA 2G5BA 5D1QA 3CFKB 2I5YL 4XX1E 1JN6A 1LP9B 3ET9F 3CX5J 5KSBF 1CFVH 3TN0A 2HN7B 5J9PA 1KENH 2AQ3A 5GJSL 1T2QH 2J8UA 2NQCA 3VXRD 5F96L 1T1YA 3CUPA 2YK1L 1EDQA 3FQWA 4EKXA 3W9DB 5IB3B 1WSST 4HCRA 3CFJA 4JJ5A 2NTFB 5ABDE 1C1EH 2R1XB 3HNSL 1LK2B 3BESR 4AEIH 3MACH 1QFOA 3H6JA 1HZHH 4NKDA 2Y1VA 3VXMD 3T0WA 3NCJH 4IRZL 4Y5XB 4ZDHA 7CGTA 4IOSD 2YXFA 2AXJA 2JK5B 4FXLA 3U30C 1CT8B 1KJMB 4CMMB 1F4YL 2R0WH 1U58B 4NHCH 1MCOL 5J1AB 1S3KL 1G7PB 5E03A 5F7KC 4IMLB 4IMKC 1MCFA 3U6RB 5DHYB 2ADIB 1BBJB 4FQXD 5K59F 3KPMA 5DLML 2QJDA 1BPVA 4L3CB 4RGNE 2HTKD 1ZT1A 4GW5B 1JNHA 1K3IA 2CLVB 1SVCP 1I8IB 1GZQB 3QWRA 1CGYA 1J0YA 4JPKL 2AABL 4IRSA 1I7ZA 1E6OL 1T66C 2DJSA 3FO0L 4S0TD 4S2SB 1JNJA 3W5NA 2VDMH 1HI6B 4ZUUA 1CE1L 3TO2B 5DQ9B 3Q0HA 1ZHBA 4IRSC 1U3ZA 2VXQL 5DO2C 5F70A 4PJFF 5ACLA 2FEEL 5IM7A 1C08A 2OYPA 3IRZA 4MCYA 1MPAL 4PGBA 1VGEH 2I26N 4JREB 5CZVL 2JJWA 1BD2A 4XAWL 1CK0L 32C2A 5KS9A 3ULVD 3MYZA 3VRJB 2AV1B 2QL1A 2L4OA 2VLJE 4RISH 5F3BA 3KPRE 1NCNA 1N5AA 4U1SA 4KGJA 4W4OA 1SHMA 2BNQD 3QEHB 4OFYA 3ZSTA 4HC1L 3O6FB 4HUWA 1CD9B 3UTOA 5CEXB 3I2CH 4HBCH 3IDJA 3GMRB 4XCYB 3UX9B 3QNZA 4JLRA 4PLJD 3SGJA 3O2WL 1CE6B 3DETC 2ITDA 3RBGA 4HK3J 2GW5A 3MO1A 5FUCE 3VRIB 3HUJA 4HS8H 5CJQL 1MF2L 4WEMB 5IBLC 2DQIH 2DQJL 3KHOA 2VSDA 3QFDB 4KRPC 4DTGL 1DVFB 1EH9A 4HJJH 1TFHA 2BX5A 3FHQA 5K33A 1OAXL 2D7NA 4R2GD 1G7QB 1I4FB 1S9VB 1EVUA 3T77A 1U8OA 3BKYH 3I75A 1HINL 4U6XB 1FAIL 1MJ7L 3A6BL 4OLYH 3V5DB 4PGDB 4NNPH 5C70A 1HNGA 1E4JA 4QHNA 3ARFB 3L3OA 3SQOH 4YPGB 3BD4A 1I8IA 1FFOB 3BRGC 5C0DB 4Y4HC 2KL6A 3DXAA 3VWJC 4E41E 5HDQL 2OJZH 4UUJB 1A3QA 3MBXH 3HZMB 1CXLA 4M8QB 1E4KA 2GI7A 4Q9CA 4HD9A 5E99H 2JIXA 3F58H 3CZFB 4HWEH 4P2RD 4EBQL 5HPMB 4M7JH 4BQBA 1T22A 1LE5B 2YRPA 3ZLQC 5D7JD 4X6CF 2F53A 4Z7UE 2FX9H 3G5XA 4P2OB 3P9MB 1CQKA 1J1PL 4U0RB 5DGQA 1G1YA 1RZFL 5K9QG 4NQDB 3HC3L 3TH3T 5JPNA 1FFNB 1E28B 3ULUD 1JTOA 3ES6B 5JDSB 3TBYA 4G7YL 1NAKL 3HC0B 1NGZB 1CG9A 5I74B 1MFEL 3TO4B 4P48A 4BH7B 3MV11 4ZFOB 2A38A 4UZGA 4H0GA 4XVSH 1QFHA 1FIGH 2CKBL 3NZ8B 3QXTA 3CFJB 4JJ5B 5D7LB 5EWIH 2OL3B 2FJGA 3E3QE 3MOQA 4HX1A 5D7LE 1KPUB 3O6MH 2MKWA 3OMZA 3SKNA 5GGVY 2AEQL 4DEPC 2UVEA 3LKRB 4UTAH 4JKPL 3KNBA 4WI4A 1G9NL 5CUSH 3ZTJH 4PTTA 3ZE0F 5T5NF 3GSVB 4LKXB 3QCVL 1T2XA 3OJDA 5IESH 2D4DA 4X9FA 1DLFH 2BY3A 3LSOA 4GSDL 4YHYB 1WFNA 4U31A 4IS6A 4W81A 4GRWF 4Y5VC 4GMTH 5AZEL 1LDPL 3PJSA 4QT5A 3P40A 1KYOJ 4NC2B 1YJDL 1ZTXH 1MEXH 1T1ZB 2NZIA 4G3YL 4TYUA 3TWCL 3PWUA 3UP1A 1BIIB 1IT9H 1JGEB 3SKMB 3LQAL 4EIGB 5L2KD 5ISZD 2XA8H 4DKDC 3ARSA 1MJ8L 3Q48A 3SEPA 4C55A 3VFGL 3LKSB 4DQOL 4F7PB 2FYYA 4PJ5A 4P46D 4R97B 4DZBA 2QQLL 2YPKB 1KEGH 3F5WB 5EU7E 4DGVH 3HR5B 3QA3B 4UIKH 5B39B 4EVNB 3IKKA 4QWWD 2XWJB 3F6LA 3I9GL 1ADQH 5SV3A 2NR6C 2C9AA 5E94A 4FFYL 1RVFL 3S7GA 4RZCA 1YEKL 1RIVH 1U8HA 2DQDL 4L4JA 3I84A 5GSVB 1ULVA 3W2DH 4TNWK 3VXPB 2XYCA 4XNUH 2UUDH 4Z7NE 3LQZB 3SE3C 1INEL 4WWKC 3VD5A 2EKSA 4H1LH 4EDWL 2VE6A 5EUOA 3DSFL 3FTGB 5C0AD 3N1FC 4NZTH 2FR4A 3C2AH 2AJ3A 3U30B 5IWLC 5L9DL 3WJLA 4IOFC 5FCUL 3MBEA 4HIIB 4LPVA 5EOQH 1N8ZB 3WCYA 5C3LD 4HXAL 4HCRH 1PJ9A 3RP1A 8FABB 2F19L 1A3LH 5DJAB 4PJ8D 2GY5A 3TBTB 3UO1H 3MV8B 4UDTA 2VLMD 2VQUA 3V7AG 4Q6IC 1MFDH 1GGIL 1OP9A 4ZS6C 3ARFC 2LV4A 2PW2B 2P7TA 3QXWA 3JTTB 2NY5C 4X7TB 5TDPA 3D39B 2VABA 1P7HL 1MFCH 3OKKA 4G9DB 2ADGB 1SBSH 1PGRB 2VWEE 4WI5A 3ZKND 1A7OL 1J9CT 1YEJL 2HWZL 1EZVX 4CU8A 5HYQB 4I3SL 1OAUH 4K94H 3ZHKA 1BGXL 2EDNA 3SJVE 2PO6B 1OARH 1R3IH 1G9NH 3SKNB 4X5LA 4JPIB 4PJ5E 3IJSA 5I66A 4PTTB 1KXQE 5MEND 1CICD 4OLUL 4N5UA 3N1QC 2V5MA 1CR9L 5HI5D 3ARUA 3L5IA 3QO1B 5IJKA 5HHQB 2WBJD 2PETA 1UKTA 5A2KH 4Q6IA 5AG8A 2HTLC 3PQYE 1F6AB 5FXCH 1E4XH 4Z95L 3BPNB 2OZ4L 3NIDF 1ZLUK 1IL1B 2ICWA 1JJUA 4XC1H 3VXSE 3K74B 3KXFE 3O6FC 3NOIA 3C6LB 4JANB 1F8TH 5K9KB 3V7MA 2AK4D 4JFFE 2BNRA 4TN9A 4UNTA 4JE4B 5IK3A 5FB8B 4NN7B 3VJ6A 4HFWA 2W1NA 3KPRA 4DEPB 1YEEL 5HY9A 1U3JA 5C0AE 2BNRD 4RQQB 2IGFH 3FRPG 4QHKI 2B0SH 4LPUA 1FZJB 1ODAA 1W0WA 4RDQG 2Z8WC 2A6DB 2XZQH 1K8DB 3LEXB 4Y5VB 5SWZD 1TCRB 3GMQB 3V4PL 3VXUB 3ZDYF 1OAYL 2X1QA 4IRJA 1P9MC 5A16B 4HH9A 4GG6B 1I7TB 4MXVF 1LNUA 4JR9L 2V2WA 2X89A 5D70H 2W0LA 3WFEL 3RWFA 1E4WH 2DF3A 2E27H 2VAAB 1XCQB 1OAYH 1C5CL 3MUHL 1A0QH 5D1QD 4ZNEA 1NCWH 4G8EA 1ZLWH 4LNRA 5IMLA 5DFTA 3GMLB 1IE5A 3BSZH 4OZFA 5D1XD 4MDIA 4YBQC 3SDDD 1KSRA 4EI6B 2EZ0D 2W0PA 1BJ1H 5FV2A 5FYLD 5GSVA 4FFVC 4B41A 1P1ZA 4LSSH 5C0BD 4FXKA 3T0ED 1A0QL 2F5AL 2NY4B 1T0NA 1YEKH 2PCPB 4DZ8A 4YHNB 4S1SH 1CLZL 1GSMA 1R5VA 4LSUL 5J6HA 1A2YA 1RJZB 4KKLC 1DUYB 4XPGL 3FN0L 4QRSA 1AD0B 3MFFA 4Q6YA 4UQ2B 3T0EA 2B2XL 4EI5D 4GXUM 2UWEB 2HAZA 4JM2A 3WIIL 4POYA 1WEJH 2A2QT 4RFOL 4FNLL 1I9JH 5DUBA 3TO4C 4DK6A 5LQBH 5SX5H 5HY9B 3ARDC 4JFDA 3UZQA 4C59B 5EU7C 4XP1H 5D72L 2X4UA 1C08B 3OJMB 3GMNB 2FX7L 3TH2T 1U8KA 2F74A 1UGNA 3ISWA 1TJGH 5FGCB 3U7WH 4YHZL 2IBGA 1JWUA 2APTA 5DRWB 1QO3B 2VL5B 4HZLB 4MA1C 3BOVA 5DK2A 3ZTJG 3RDTA 2V17L 3QZWG 3DVNB 4XPFH 4P59L 2EKJA 4Z8FH 1MNUL 1CXKA 1OWRM 4D9RE 2FO1A 5HSFA 5INDA 1Z3GH 4TTDD 3GM8A 3MRPB 1GGTA 3BPLC 4HMDA 2PXYA 1FDLL 5H2BA 5T3XH 4JPKH 4K3HA 2ZOLB 1YEFH 2WK2A 5EZLB 2YUWA 1I75A 4L3AA 4JHWL 1HHHB 3BKML 2W60A 1OAKL 3O2VH 3SE4A 1VSCA 2X4QB 2VDPH 4GRLC 4R97C 1MFEH 3ZKMD 4D8PB 1DDHB 4IDJL 1TJIH 3O11B 5FYJL 4YXKH 5C7XH 2V5SA 2V9RA 1AR1C 2NW2A 1RZGB 3HG1B 4KMTH 4Z78A 2WANA 1J0IA 3QP3A 1ZANH 4LRNH 4RAVB 4RGNB 4I0KA 5IKCB 1EXUB 2VO5A 3N1GC 5DUBB 3TF7C 1AHWC 4PJEE 3S35L 3ZTNH 1GIGL 3CDGB 3K80A 4PJIE 3GK8H 2W9DL 4S11A 1JWMB 4QXWA 5GGVH 4NPYB 4N8PA 4C4KO 3TCLA 1QBBA 2VDLL 3FQTA 4NJAL 5KVEH 3L6FA 4ETYA 2E9JA 1RIVL 2DQDH 1D5XA 4HCRL 2EDRA 1KCKA 4KH2A 4P3CL 2R1YA 1A5FL 4QHNB 5IG7A 5D7KE 5I1EH 3B8YA 2X1OA 1N64L 4KDTA 1BFVL 4OZFB 2H32B 4MCZA 2C3HA 4N0UB 3X14A 3MA7A 1KIUA 4WUKH 3EOYG 3NA9H 5GSRA 3TIEB 3VGAB 3ME0A 5EO1A 1DBML 2Q8AH 5FKPB 1KXVC 1HINH 1I4FA 1RZ7H 43C9B 4DQOH 3ARDA 1IC5H 5F1OB 1K6QH 2R8SH 3QFDA 4LK4A 3R1GL 4OCNC 1AD9A 4UBDC 1S9YB 4LCIH 2E27L 1EHLL 3VG9B 4L3ED 3U0WL 2A0LC 3SCMC 2IPTL 1OGAD 2DQGH 1D5ZA 2V2WB 1WBZB 2XZCH 3O6FA 4OD2A 4BFGA 2N56A 1VEPA 2DWEB 3PP3H 2D0FA 3BUYA 2PO6C 2YD3A 5I1CL 5GRVL 5TE7L 2VDRH 3L3GA 3VXSD 2BNQA 5HYJA 4MB4A 3MRCA 2Q6WB 4BFIB 1ZT4A 3S6CA 5CD5C 2AJVH 4MQXC 1WICA 5F1SA 2A6KB 1MCDA 3X13A 5L88H 4Y16A 3G6JA 4OAWB 1FRGL 4M3JA 3LB6C 4PGEB 4N9GB 4HC1A 3H42L 4QHMB 1FVCA 5C8JB 3MRKA 3BGMA 4P4KC 1QZ1A 4BKLB 5LCVL 1BJ8A 3ECBB 5M95B 3BN9D 3FQRA 1X5JA 5DZNA 5FGRA 3GIVA 5LXGL 2NZ9C 4UT9H 4OZIB 4FRWA 4WVRA 4IIQA 2WP3O 3BX7C 1FCCA 5IB2A 3HE7D 3O9WC 3IXAB 4UV4L 3UBXB 1P4LB 1KB5L 5I1GH 4J1UB 1F4XL 1HH9A 1QA9A 5HGBB 2X4TB 5GRVK 1R5IA 4YGVA 4UILL 1IMHC 1JE6A 4FQJL 4MHHG 4Z8FL 1TQCB 4QRQA 2A9NL 2UZXB 5SWQB 2BHYA 2F5BL 4ZOEA 2QEJA 3SOBH 3LN4B 5JQ6H 1KJ2H 3DX7B 1CG9B 3NIDE 1U2HA 5C0FA 5K9JL 2B7DT 3MLRL 4CGTA 4M43L 1EMTL 2Z31A 1I8MB 5JPNB 2VDNH 5GGRB 2K3TA 4GAFB 4OGXH 4MXQD 3UDWA 3RRQA 4NJ9H 3U4AA 5F7UA 1OP3K 1KULA 2ATKB 4F58L 4EOWL 3G6DL 4G8FA 1QTYT 3V4UH 4JQIL 3VXTA 1DEEB 5E4EC 3DTXB 1LP9E 5J1TC 3N85L 1K2DB 3FZUC 1O0VA 5TQ0H 4O2FB 1CDIA 3KYNB 4WU7B 4JRWA 1NJ9B 4IM8A 3LRGA 4M5ZH 2MCPL 4F2MB 3HA0A 4GBXA 3WDIA 2YC1A 1A7NH 3E3QC 2NY1B 3LH2H 4FG6D 4NC1E 5GGUA 1FVDA 3CVIH 4JAMB 1G0DA 4D3CL 2FEDD 4ELKA 2VLKE 4LASL 4YR6B 2CXKA 2VC2L 4OM1L 4GBXD 4FQPA 3IJYA 3MRJA 4L1HA 4JFZH 1WAAE 5BZDB 3CCHA 4MCZB 5IWLA 3WNOA 2RAMA 3DMMC 3AM8A 1T7ZA 3HLAB 2VLRA 4S1DC 3SKUD 1RUAH 4EUPA 3FL7A 2AKRB 4P57A 4PJGE 3MRRA 1N6QL 1WTGT 4XMPH 4K2UL 4L29B 2CR6A 4HWBA 1NC2D 1BOYA 4MA1B 1QR1B 2ARJA 2YPKA 3MJ7B 1S8DA 3WJJC 2P5WA 4HUMB 2NXZC 3PG2A 2EIBA 1SJEB 2AK1L 1HILB 3KWWB 3GSUA 4OUOA 4G43B 3T8XB 3NPSB 3VI3E 2BOBA 3LEYH 4K8RL 4U1SB 5KG9B 3SKMA 1JNLL 2VLJA 4KJWD 2RHEA 5GRWA 1RK0B 1VFBA 2FX8L 1F11A 1D5IL 1IAKB 4U4BA 1FZMB 3RI5K 4NRXA 1SVZA 3ZKSD 4ODSL 4Z0BH 3CH1B 2IFFL 3LIZL 1IGMH 5IVXE 2F58H 1HI6A 4ZUUB 3W0WA 1IL1A 2HT2C 2ICWB 3NCEB 4LCUB 3QXDA 4KJPC 3CPLB 2EYSB 1MCOH 1G6RB 2PTTA 2AJUH 1BOGB 3OX8A 3SGEH 4O9HH 3U79A 1TIUA 3EFDL 4LSQL 1LD9A 3BJ91 4LVNB 1H3GA 3MJ9L 4JY6A 3C6LD 5DJZB 4QRPA 5IGXL 3UJIH 4G9FD 4WDIB 1QLFA 3E0GA 4PJEF 1AHWB 5I66B 4M00A 2R4SH 5I6XC 4IIQB 4KUCD 3I02A 1XGQB 1CF8H 1V05A 1IJ9A 4LIQL 4HDIB 2WBJB 1FYTD 4G42B 1T0MB 4P59H 4J8RB 4UV4H 2W38A 2QADC 1AGBA 2XXMB 3VWKA 4I0PD 4K3EH 3VFMB 2V6HA 5CINL 5DTFA 3GJFK 5EBGA 5FYJE 3GMMA 3PQYB 3VXRE 4O58H 3KR3H 5KVGL 1KUMA 5IFHH 2GJZB 4ENED 2V2TA 1MQ8A 1DLHA 3KPLB 2X89D 3WN5B 1A7RL 5DJAA 5KSBE 1I3UA 3EDJA 4Y4FA 3AS0A 4XTRD 2DQEH 5GGRY 4NCC1 1LK3L 4I4WB 5DT1L 2JCCB 4LVOB 1RIHH 1IGCH 2ZUQB 3BPCB 3IDIB 1RUMH 4Y8AA 1DR9A 3IU4L 2R0ZL 1I1AB 4NNPL 4JR9H 4Y4FD 3ILQD 3MRRB 3QCUH 4K3DH 5DYOA 2IAMA 5I76B 4MJIE 3GGWB 1WCBA 4S1QH 5E8OA 2PYED 3E8UH 1MQKH 1WWCA 1KTDA 2FSEB 4AK1A 1WQVT 1PG7L 5IW3A 4J3SA 1S78D 2EYRB 3RKDC 3M8OL 2H6PB 3HMWH 3LKRA 3X3GL 3CK0H 5GRZA 5DC4B 3RVUD 4R2GC 1A7NL 1CFBA 1MVUA 4YBLB 4CADB 5I30L 4YAQB 1MJUH 1XF4A 2V2XB 5KN5A 1U8KB 3MV9B 2ICES 1P7KB 1I8LC 1XGPA 1YEHL 2NY1C 1U6AH 3OKMB 3L95B 1MJJB 5FHAH 5E5RB 2R56H 4MB3A 4W4NA 3QUMH 2NY2B 2H32H 4ZFOA 4WNQB 4WO4D 4P2RA 2YEZA 5HHVL 4TVPH 1NGZA 1WC7A 1Y18B 2DDQL 2WQRA 4JZNB 4N8VG 1DE4B 4PTUB 4TOYL 1AXTL 3CXDH 4RGND 3UYPA 3DO7A 2GJZA 4JVUA 4PJIB 3MLYH 5L2KE 3PL6B 5ISZE 1Z9OA 1H9VA 2H3NB 4MAUH 3ABZA 3MNVB 4GAJH 4X8XA 5T1MA 5FB8A 3RVWC 5LVEA 2X6MA 3KPPA 2DICA 5DLMH 1DBAL 4CDHA 1F58L 5JQ6L 4NZRH 1P1ZB 2HLAB 1HYRC 1EERB 4PP2B 3NFPB 4AQ1B 5J0BA 3TA3D 4AEEA 1M6OA 1I1AD 5ILTL 1MHPH 2CK2A 1ZWIA 5BOPA 1T0MA 1KB5H 1Z5LB 2VDML 4LRIC 1QUNA 2AXFB 1DL7L 3NCYS 3VFPB 2JCCF 3HZYA 1JGLH 4A6YH 1I1AA 1KPUA 5EZLA 3SDAC 2B4CC 4RGMB 4WWID 3QIBA 3SDDB 3ZYOA 2ZJSL 4M4RA 4KKCD 1U8NA 4S10A 1GHFH 3EYFB 1XF1A 3MRPA 4Q9BA 1GGBH 3UTZB 4ZPTA 1NDMB 4W6WB 5IBTL 5EZIL 4DZBB 1HHIB 3FONB 3JWDL 1BZQK 2PYEE 3WHE1 1P4IH 4XXDA 4WIQA 3W0WB 3PWLA 3QRGL 1Q9WA 1X4ZA 3D3VA 1Z3GL 5DRXA 5C08E 2RBLA 3VU2A 4MAYA 3EO9L 1ZSDA 1KNOA 5IB1A 3P0YL 4MJ2A 4KXZH 1C16A 3TIDA 3FN3A 5B22A 5LWYH 4RGOH 1P84K 2CLZA 1BBDH 1FZOA 5IFAL 3JWDH 3RIAF 4ELME 3RIAK 1A1NA 4K3EL 5CWSA 5DF0A 5FUOL 3C5ZA 3T2NH 4MA8L 5CEZH 2QADB 3DOSA 1A9BB 4P2OD 5E8DL 1OM3L 3SHSA 4ZXBC 1HKLL 1KG0B 3HS0A 1QHPA 1ZK9A 1U8IA 1EHLH 4FFZH 5DZOA 4P46C 5F93C 3VXUE 2FR4B 4ZAKC 2VZVA 4TNWF 4S1RH 5F9WB 4TQEH 4UIKL 3B2UD 3QQ9C 3PGDB 4R4ND 1FJ1B 4Z7UB 2GTZA 1ONQB 4G7VL 4HBCL 1FGVH 5IQ9A 3SJVA 1O5DT 5TQ2L 4NN6C 2NXYB 2YSSA 4I5BB 1YC7A 3KYKL 3LQZA 3B9DA 4HXAH 3QUYB 2Q8AL 1DQQA 3IDMB 5D96C 3INUL 3IDXH 2VE6B 3OPZH 5K93A 2VTFA 3REWB 4HUUB 3WNMA 2K1MA 3H3BC 1J18A 4L8DA 5J8OA 5MHSD 3MRCB 4F15C 3NPSC 1CICB 1XF5B 4H25A 4Z76A 2FBOJ 3IJHA 4WHTA 1KCUH 3PWJA 4WWKD 3QUYD 4PJ8A 2HFGL 3PV6B 4DFIA 5C0IA 1H5BC 1T3FA 1FNEA 1NC4D 2UUDK 3D0VB 3VXSA 1QR4A 2P5WE 2ZKHL 4P9MH 2V9TA 2JE8A 1G7LA 3BEWA 2IADB 3I6GA 2DYPD 1KN2H 3VMOA 5IHBA 1CXIA 2CUIA 1V3JA 2IAMC 1NC4A 3BYTA 5FYLH 3ARVA 4PJHF 5GS1B 2UWEE 4RNRA 1WBZA 3D6GA 3QUML 1FZOB 1UB5A 1OTTD 4BQCA 4OZHA 4CVWA 5IKCA 5GJTH 5ENWB 5F8RC 5BO1L 1KNOB 5C0JA 3B5HA 1MUJA 4XVSL 3CMGA 4PBWD 2RJMA 4LPXA 1NUNB 1P7QB 3CMOH 5HVHB 5D7SH 4NUJA 1NBZA 2VZSA 3R4DA 1G9ML 3ULSA 6FABL 4M6NH 4JFFB 3BISA 3H9YA 5IFHL 4I48A 2VIRB 5IMMA 2E7LC 1IM9D 3HC3H 4MA7H 2X4SB 4NYLA 1U8NB 3V6ZB 1AE6H 1A6ZB 5HHNB 5AG9A 5JLZB 4QXGL 5ITBL 3HPJB 4JFFD 1M1SA 3MRIA 5FM5M 4CKVX 1P4IL 2AK4A 1PYWA 1WJ3A 3HUJF 2LTQC 1XF3B 3WUZA 5IB2B 1CZ8H 3MXVL 3M17B 1UH3A 1S7TA 4R90L 3RY6C 1NFIB 3V7AE 4PY8J 2B1AH 1AO7A 2ADJA 4PGEA 4XNXH 1R5WA 5F3BB 1KCLA 5EH1A 1X7QB 3GBNL 2QKIB 1OSZB 5EZJA 2VZTA 4Z7OF 1BFTA 2J8UF 1YMMD 2VN4A 4W6XB 2XI9A 3C8HA 4CJ0A 5JHDD 4N0CC 4NQTA 4PREB 4Y1AB 4JO4H 1QNZL 3H7BA 5K9KA 2C1PB 4HUVA 3PWNB 1N4XL 3WIHA 3RQ3A 3KPSA 5FA4A 5AAMA 4MQSB 1R3JA 1OGAE 4JY5L 4Y16D 5JNYB 5L2KB 1GGCH 3ORJA 4U1JA 5EOCJ 5KANG 5CIPB 2ZUVA 4TRPH 3HCVA 5CJQH 5KS9E 4KJYB 4L9LB 3B8SA 3FB5A 3QUMB 4LSPH 4PJHB 4KHXL 2QR0B 3UJTH 4U2YA 1JP5A 1FYHB 3HTLX 4NRYB 3U1SH 1FL3B 2APFA 2FWOB 4KVNH 1MLBA 4JO3H 4OLYL 5TDNB 3THML 1F45A 1MCEA 2A1WH 1C5CH 1H15A 1YPZE 5DEFA 4JFQA 4P3DB 1JYXA 2ZKHH 3CC5B 1J5OH 3S36X 3SQOL 5FHAL 1RUAL 5E8PB 3MGAA 4HJJL 2BOBB 5T3ZL 2J6EH 4AIOA 3DV4B 5ANMB 3DX6A 2F8XC 4YBQD 1I9IL 1IQDA 4FXGB 2BMKB 2OMBA 5CEXA 4LSSL 5FOJA 1JWSB 3CZFA 5ACZA 3PIQA 5DD1L 2APBA 2EIZA 1JRHL 4N0FB 3C5SA 3P9LB 5HDBF 1S7UA 1BX2B 5BRZB 5H94A 5E6ID 2IPKB 2VC2H 5C0CA 3JBG7 5IEKB 3LPFA 1R5VB 4Z7VE 4HKBB 4MDJA 3S37X 3GBMH 3QSKB 2MFNA 1RV6X 4QRSB 1S7RB 3V79C 1KJ2A 3TYGL 3GRWL 1J1XL 5F6IB 2BDNH 3NN8A 4NGHH 1YYML 5MP6H 5I1DA 1MWAA 1WWAX 1CF8L 2Q20A 1EK3A 4TSCH 4LHUG 4IBLT 4MB5A 1G6RL 1S7TB 4XWOD 1OQXA 3K46A 1ZLSL 2Z31C 3RVVD 1EO7A 4OTXH 3S37H 4QWWC 1MAMH 3FO0H 4XI5D 2OMNA 5E1AA 4MD4B 2IQAA 5FYJU 5CCKL 4LKCA 4HWZB 4XXCC 4XRCA 1QSED 3GBNH 3O3BA 1XCTB 3L3KB 3QCTH 4JM2F 1DBKH 3NA4A 4H8WC 5CGMA 4ZO6A 2Z93A 3QDMD 3KJ4B 2Y5TA 1QVOA 4NQDA 4JHWH 5MERB 2W9DH 4JKLA 4Y1AA 5DD0H 5E9DD 2GJ6A 3ZDXE 2XT1B 3NAAH 5F7FA 4I2XE 2VISB 1T1ZA 1DL7H 3DVFA 1I85A 4P46B 1RK0A 3NACL 4V2BA 3NH7H 1LO2H 1MH5B 1ZE3C 1CT8A 1Q0XL 5E9DA 3EJYC 5HHOE 4YDIH 1X6NA 2BNQB 3ZHLA 4NM8H 3W9DA 4MLSA 4EUPH 4EXPX 5IB3A 2NXYC 2P5WB 3QEQB 3HI1A 2IH1B 4NO2A 1EJ6A 4LIQH 3IFPB 2VJXA 5FDWA 4PTUA 1UYWH 1CGUA 3OXRA 2VDKL 3P4OB 4RFEB 2Q8BL 3RTQD 2XQBL 5JORB 2L0DA 2FX7H 4WTXA 4NQUA 1KCRH 2V2XA 2XTJB 5KN5B 5JOPE 2WINA 4KPHL 3TV3L 1ZT1B 3U7WL 5HHMB 5DC9B 4X7FC 1CGTA 3UTTE 2D03L 5C09E 2E9BA 4DN4H 3FQRB 5MENA 3IKCA 1H8NA 4ZD3H 5EUOB 5MEOB 4PRAB 3WXWL 5EORH 1PEWA 3F6IA 4OLXH 5I1DB 1CL7H 2Y7QB 1IC4L 3DSFH 4U05A 5I1LB 5CILL 3C08H 4DAGL 4XPGH 1MRFH 3VGFA 1UKSA 1FNLA 4HIHA 1U9KA 2AQ1A 5I1KL 4YDVB 1CFQB 4OUUB 4BZ2H 1KXTB 1D5IH 4DVBB 1MJUL 3MV8A 4RMWA 3SCMA 3MRQB 3ROOB 4L9LA 3BAEL 1CTOA 1AI1L 2HT3C 4RIRA 4WEUD 4MYWB 4R6UA 1S7RA 4LCCC 3OKDB 4D2NA 5BVPH 3H8NA 3E8UL 4PJBB 5L7XL 4PJ9C 3UZEA 3SCMD 1IQDB 12E8L 2QBWA 3NZHL 3WNLA 1J8HE 1WT5C 1H8SA 3GI8H 2IPUK 3L3JA 4OLEA 3PP3K 3EUUA 4ZNCD 4GW1B 1BQUA 3WUWG 4E5XB 1KCUL 1FL5B 5DEFB 1UM5L 3S88L 1EAJA 3BH9A 4TUOB 1UB6B 1RZ8B 1X9QA 3FTGA 3D0LB 3QHFH 4NO0D 4MCYB 4M1DL 4OCLC 1B0GA 4NO3A 3ARBD 3C2SA 5CJ5A 4RMVA 4G6MH 1U8HB 2ZG1A 5GGTH 2NY3D 3VFWB 1UZ6F 4PJDE 4PJHE 3QIWD 4L3CA 3RX7A 4XZUB 4KI1A 3K3QA 4PJAA 5I1EL 2VSCA 3WO4C 4K3GA 4FQXB 4DKEH 4FQ2L 3SDCB 2AW2A 3JV0A 5EPMA 2A9MH 3SDXF 4EIZC 3KG5A 5IW6A 2AEWA 1JZ8A 1RULL 1GZPA 2P42B 3EYUH 1OAZL 3QO0A 2CDFA 5EUOF 3H7LA 3GSOA 5CBEA 3HI1B 1FFRA 3HRZA 5DO2D 2A9NH 5CKGA 3MJ9A 3G5ZA 4WO4A 4XPHL 2CMRL 2EZ0C 3RY4A 3VG0L 5IW1A 3LOWA 1JF1A 3QCTL 1SJVA 4RIRB 3FO9B 2PXYC 2GEEA 1ZEAH 4WFHE 1N4XH 1DBBH 3TVMA 3QAZC 5LWYL 3O4OB 1ETZB 1NL0L 2KKQA 4JM2D 5IHLB 1OW0C 4WGWB 5DVMA 2ZUTA 2X40A 5AUMA 5C7XL 4K23L 4G6FB 4OIIH 5IQ7L 3FMGL 3V4VH 1KN4H 1YN6B 5AZ2H 1Z0MA 1P2CB 3OJVC 5EZIH 1R6VA 3U2SB 3G6AA 4C56D 1YECH 4JFPB 2YD5A 4X80L 3FRPA 1UC6A 5F97E 3FOLB 4X0KB 4LBEB 2FD6L 4NCC2 3AY4C 1NGYB 2OJEB 3WL9A 4QTHB 5C2BL 1WUNT 2YBRB 1TVHB 1TVBA 3KPOA 5IVXF 4P5TC 3OXRB 3KHQA 4ISVB 5GXBB 4LCCA 1NGQH 5DUPL 3HI5H 2AQ2A 2J3SA 3B2VL 1S9VA 2QV2A 3QFJB 1UWXH 3TNMB 4K55A 5BZDA 5DRNA 2XRAH 4D9QD 4PJFE 1HK6A 4YQXH 1NMBL 2FHFA 4JDVA 5TH2A 2NY6B 3T4AA 4N8CL 4BUGA 4ELKB 3FB6B 5FYLE 4PJEB 4R4BB 5B8CC 1W72H 1OP3H 2BVPB 2X1XR 3ARGC 5JHLH 3BSZL 1FYTE 4JFEB 2JJUA 2QSVA 1OAXH 3SDXB 43CAB 3HZMA 4LLUA 4TPRL 4R4FH 4PJXB 3TPUA 1W0WB 3QIBC 3TEUA 3OKYA 4M7ZB 3OKDA 4OLZL 4JFED 4PJAB 4M6OL 1OTUC 2HVJA 1HHKB 4HS6A 3LKQB 1U92B 4GKSA 3M1BB 1RMFH 1HXYB 4HFUL 4M9OA 3V2AR 4F58H 1FG2A 2NX5D 5DUML 4XP5H 3QG6A 2CRYA 3V4UL 2ESVB 4DKFH 4FQQB 3SE8H 2WBJA 4YHLH 1V3KA 4G8GE 3SJVD 3KNBB 4JO2L 1EEZA 4TVPD 5A2JH 1YUHA 4Y5XC 1II4E 4N0UA 3EHBD 2NX5B 3NFNB 5IR1B 2GKIA 5J7CC 3FT4A 1YNTB 4YDKH 1JGVL 1WZLA 3MLRH 4QTHA 4CBPA 4DCQA 1OPGH 3TFKD 1K9TA 5F9JB 4PRPE 4LSVH 2XNAA 4TTDC 5FUOH 3T1FA 3DVNA 4OCYL 1N3NB 4LVEA 4UINH 4C83A 1A7RH 2G60L 1S5HA 4PFEA 2OQJB 1YN6A 2E9IA 1ETZA 3BE1L 1NL0H 3U7YL 3S36H 4J3VA 1F97A 4UBDD 1KLFA 1MI5D 1UXWA 2EDKA 4KHXH 3T4AB 5DK0B 3O4LD 3ZKMC 3RAJH 2EYTA 3LRHA 3DV4A 5CINH 3MREB 1R5WB 3HPLA 3D5OF 4YEEA 1EGJH 4YHPA 4BK4A 2C5DC 1OAZH 2DM4A 1C5DA 3LQMA 4JY5H 2YWZA 1KJ3H 5HYJB 4D8PA 4XNMA 4FQIL 4TULH 3U9PH 5F9DC 3H9SA 4BFEA 1MY5A 1I3GH 4HLZH 4WNQA 3PHQB 1Z0NA 4PV8A 2BXYA 3UTTA 2ERJB 1Q9KB 3EYVB 3MUY1 4MD5B 4PJXF 5I17A 2I5YH 1X5YA 3OR6B 5EU5B 3SE9H 4KTYA 3N9GL 3LS4L 1KENL 2G5BB 3BI9X 2I9TB 4KJYA 5C86A 1ROWA 1A6AB 5KVDH 5HYQA 4Y4FC 2RB8A 2VB5A 3IDNB 3HE7A 3H9HB 4Y4KB 2OP4H 1ZHNB 3KPPB 3EOAA 2J8OA 5BZWB 3BO8A 5TDPB 3SDAA 2BY2A 4XNZB 1OF2B 4K9EC 3BN3B 3MV8E 5INCB 2DQGL 5EZOH 2ARJQ 4FQCL 5E6IA 1CGSL 2GHWB 1LK2A 3NN8B 4IOFD 2J7LA 3L6FB 4MJ5B 5ID0B 4MQ7B 3R1GH 5L0QC 5T5FL 2XNAB 4G8IA 2EC9U 4JKMA 1U91B 3IDGA 3T3MF 1A6UH 4M1GH 1IC7L 2APVA 4FTVB 5ICXA 1UZ6E 5C08D 5JXAL 4U6HA 5C0EB 2H45A 1U95B 3EGSB 3TA3A 2Z8VC 3FQXA 4RGNC 1Z6JT 3WO4B 3O4LE 3ZKNC 2BNRB 1EEZB 3GB7B 5TFSL 4NBZB 3GJEB 1NDMA 5HDOA 1CLYH 5CD5D 4JFQB 5F1NA 3U48A 5I19H 4QXUH 1MCNA 2WW8A 3S35H 3E6HB 3ZTNL 4JVPA 2GTZB 2HVKA 1HDMA 2CDGB 5D7KD 5EU3A 4JDTL 1MPAH 2KZ1B 5CJOH 1IEAA 1Q94B 4Z18A 3QO1A 1P4LA 1KCSH 3O6LH 1K8DA 4Y5VA 4YZFF 3F7YA 3QHZL 3OV6A 1NQBA 2W0FA 4OZFG 4F7EB 3JV6B 4QCIA 2IG2H 1KIPB 5HHMD 2EDLA 5GISH 1SYSA 2OXHA 4PUBL 5GHWH 4B0MM 4XMKL 3QDJD 4ORGB 5GGRA 5GIRB 3WNKA 3T1WA 3MREA 4FQLH 3DMMD 2H2SD 2VDNL 1HXMB 1Y6KR 1JTPA 1YEDA 5F89A 5JA8B 2P5WD 4P2YA 1FO0B 4Z7NF 3VJ6B 2DN7A 5LGJA 3MC0A 1I3GL 3G5XB 4KVCH 4P2OA 5DGRA 3DMMA 1JL8A 1UQSA 5HI3C 5DQDH 1CGXA 2UWEA 4J1UA 3MRFA 4WW2B 3QQ3A 3TGXA 1EGJL 3L9RB 4P5KA 2HYMA 3C2AL 1X3DA 4UU9A 2CLVA 5EBWA 1YYLH 1DBBL 1BQLL 5H2BB 3S5LA 1HSAB 4P2OC 4UOJA 5FDWB 1V3LA 3FZUD 3HLAA 2MHAA 3OKOA 3KPQB 1BREA 3VWJA 1SY6H 1A6ZA 5HHNA 1J1OL 2NLJB 5IMLB 3IJYB 4POUB 3TBVB 4PV9A 1Q8MA 3MQIA 4K7PX 1E4KC 2DQTL 1MUJB 4Y5YB 5EA0H 3RWCA 4C56B 2DKMA 3DURB 1RD6A 4CW1A 3RWJA 3TYGH 4HUKB 2IMMA 4X6EB 1XF2B 4NUJB 4RCAA 2HRLA 4S1SL 4OGZA 1FL5A 3HUJB 4JDZA 4X4MA 3RPIB 5BO1H 3BJLA 4JFDB 1G1CA 1MCRA 3N0PB 4XP9H 3CNKA 4LDEB 5I1CH 2EXWC 2NY0C 5L7XH 2NTSP 5IW6B 3GHEL 1KIPA 3MUGB 3RNKB 3MRBB 1MI5E 1NEZA 4M3KB 5FYKH 5K59E 3IGAB 3QDJE 4H0HB 1PYWB 2P45B 4MQ7A 1GC1H 3HE6A 3SGJC 4XVJL 3HPJA 3O9WA 1WV7T 2L7UA 2AAVA 1UVQB 4HIHB 2PKDA 3PJSB 4QT5B 4KQ4L 5EO1B 5JHLL 4JFFA 2LVEA 1XZ0B 1B6UA 3UYOD 5L2JA 3K1DA 1PDKA 2QR0A 3P11H 2C1OB 3GSVA 3DRTA 5FCSH 4Q9QH 2VAJA 2W60B 3BMVA 4LLWA 5CMAB 5FECB 2PYEA 1ITCA 4OJFH 1ZTXL 3QXAB 3V52H 4H1LA 2JIXD 3CVHA 4APQD 3HNVH 1EO5A 4NN5B 2H32A 1FIEA 4R7DA 4ZO8A 3NZ8A 1GOHA 2MCPH 1F4WH 2ZSVB 3KYKH 1YPZA 2YN3A 4OCSH 1J05A 2DQCL 3HC4H 3PQYD 3C8DA 4BH7A 4U1LA 5EU4B 3FAXA 4HWBH 5HYSA 1OT2A 4JDZB 1P2CA 3C5JB 2WWMD 5HYEA 1AR1D 3B9EA 4YGAB 1DLHB 3UCRA 2X9WA 1CFQA 5EZJB 1HSBB 3I6KB 2NNAB 3S3PA 1MRDL 2GUOB 4PJDA 3ZT6A 4YFLF 1ACYL 1M05A 5IB4B 2YZ8A 3MR9B 4AG4H 1ACZA 1DFBL 3DVGA 4MA3A 1VKXA 4YIQA 4P0DA 3L1OL 5D2LE 4D0DB 4GFTB 4MXVE 3H9SE 2YUXA 4ZS6D 4OF7A 5IQ7H 3S5LB 1BM3L 4PJCB 2NXZB 5JOEA 4QCIB 3FO2B 4RA3A 2JB6A 3VFTB 5J11B 3QUMA 1VHPA 1GPOH 4KVCL 1RJLA 5DYOB 1J8HD 1D3CA 4XTRC 4PRNB 1JZ4A 4DOHE 1LO0L 1MJ7H 2OLDA 4LU5L 4NKIH 5CJBA 3VGHA 1G7JB 3K2UH 4PRBA 5D1QB 3A6CH 2J4WH 4Q7DA 1FVCB 5ALCL 4KY1L 5C8JA 4A2MA 5T3XE 4GS7C 3FCTA 2O61B 2N7AA 3V4VL 2ESVA 4LHUB 1QSFE 4PBXA 5A2LH 3BH8B 2W65B 4X7SL 3T04D 1QKZH 3KJ6H 1ZVHA 1DCLA 3O3DA 3S8WA 4CVUA 2AGJL 4B7IA 1AXTH 3CXDL 4HHAA 5JW3H 5FO7A 3QFJE 4NM4H 3BQUC 5IMKA 4OZIE 1A3LL 1WCQA 4GKOA 5C07A 4A6YA 3ARZA 3DX9B 4UIMA 3IYLW 4WHYH 2RQ8A 3LEVL 1T89A 4P4KA 3UJJH 5E9DE 3ARBB 1RIUH 4DKEL 1UT9A 3JUZA 2IF7A 3L5WA 5DVOA 1D5BB 1CLOH 4WUUB 2WUCH 5KTEL 3G5VA 4R8WH 3IS0X 1BVKA 4P4KD 2DDQH 3VFGH 1RU9H 2ZCHL 2Z35B 4M6MH 4Z7WE 2GSGA 2H2PD 2QQLH 2B4CH 3G6JF 3V0AC 1ERNA 5DQ9A 1LE9A 3TNMA 1D5MA 4DGIL 3GGWA 4HXBH 1QYGL 2KBGA 1NCBH 1IM3B 1VPOH 4U1HB 1QQDB 1D6EB 2VDOH 3LKOB 4LLYA 1DVFA 1WVZA 3WIFA 1MAKA 3OB0K 5MEQB 3QDMA 5E00A 4ZTOL 3W11D 1IGTB 4F2MA 1I1AC 1OD9A 1OAQH 2BHZA 5AZEH 4E41A 3DIFB 3DSNA 4PJIA 2HTLD 3PP4H 2ED8A 3GSQB 4X6CA 2P49B 1KLGA 4N8VA 1T7WA 3IU4H 4XBPA 5D9SA 5BV7C 4BKLA 4O2CA 4XWGL 1TJIL 1HH6B 2P8LB 3MJ7A 4XB8A 2XFXB 5C1MB 3QUZD 2M2DA 3K8LA 2XZQL 4P2RB 4MNQD 3PWVA 4JHBA 2HRPL 3FAWA 3ROOA 1U8QA 5DMGD 1OGAA 3BPLB 4M4PA 4WW2C 1Q9WB 1ZANL 3D3VB 5CWSB 2AP2A 1ORSA 3RUGE 3FB7A 5C2BH 1NGXB 3LS4H 1A1OA 2JJTC 1QSFD 2Y23A 2DQTH 5FA3A 3HE6C 4KPHH 1DBJL 1MFAH 5ADOL 4NZDA 2OR8A 3AMKA 5HPOA 4UQ3B 1W0VB 4PJBF 5CAYB 1G9EA 1D9KC 3UTTD 1UA6H 4GRLB 4NQEA 3O4LB 3ARRA 2J8UE 3HE7B 4HWUA 1ES0A 2CUMA 5DJ8A 2IAMD 1ZA3A 2HP4A 3W0WE 1DQDL 2IEPA 3MCLL 4OCWL 2GIYA 4JGMA 3PL6C 2NXYD 5INDB 5KAQG 3AB0B 3MMEA 3QEQD 2WWKT 3OR6A 4OI9A 1T80A 4KTEH 3TV3H 4HMEA 3D85A 3MACL 1DQLL 4X4YB 3L5HA 2R9HC 1S7VA 1AJ7H 4U1HA 3RTQC 4YHKH 5TE7H 3EYOB 3IF1B 1RI8A 1A7QH 2K7QA 5DQDL 4Z7QF 3VH8A 4M93C 2C3WA 3SKJL 1KC5L 5EO9B 3W9EA 4ELMB 4JHAH 1UWGH 1A14H 3MX0A 3NABH 5ID1B 1L0QA 4MD0A 3E1F1 4NRXB 3VFOA 1EJOH 4S1DD 1S3KH 3S35X 3PWPE 4NNXA 3IFNL 4ODVH 4F37K 3BP7B 3VFSB 5I2IA 3G6JE 2BHUA 2F53B 3HG1E 3DYMA 1YQVH 5BOZG 4NIKB 1JVKA 2P5EB 1REIA 2XIDA 3PXJA 3QUXB 5TE6L 1QP1A 2ICWJ 5CP7A 1HILA 2F5AH 3P77A 4JG0H 4PG9A 3PV7A 2IH3B 2J6EA 4UT6H 4N8VB 4XBPB 4GS7B 1QR1A 1S5HB 1ZGLM 4P3WA 2ZUSA 2ZG2A 5J6HB 3VRLE 5J56B 3OB0H 4FTVA 4OFIA 4XCNB 1FFOA 1M71B 4OSUL 4P23D 1T7YA 2DTML 2DS4A 2E9WA 2GT9B 1S9WB 3BXNA 1NCDH 3WFDH 3SY0B 1OF2A 1BD2E 3PF2A 2WNGA 3T3PE 1V7NL 2QQNH 3QIUC 5I16A 3MV9D 3EDFA 1S7XB 2V5TA 4IS6B 3BO8B 1A4JB 5BS0A 1KGCE 1NCDL 1XEDA 5FYKL 3BH9B 3QR2A 4Z5RA 1ZOXA 4RISL 3SJVB 4MXWL 4X4YA 5IQ9B 5J6GB 1J12A 2D2OA 1OP5K 2GFBA 2C3XA 5JXAH 2DWDB 3ARBC 4U0RC 4OLVH 4UTBL 1Q9LA 4P99A 5BRZE 4L8SC 4P2QE 5FGBA 3KVQA 1BF2A 3C8KA 1RUKH 3W82A 1B4JL 3BPCA 3IDIA 5DJYA 4DN3L 2HJKA 2HLFC 1YMMB 1WZMA 5JHDB 4NFDA 1QD0A 4GUPA 5HJ3B 4G7VH 2X7LA 5I15H 3LH2L 2BERA 4JKPH 3A6CL 5TQ2H 1TTUA 5HGDA 5CGYC 2JCCE 3A67H 4M5YH 3KR3L 5KVGH 3RWJB 3QDJB 3O2DH 4P3CH 4TRPL 3H7BB 5C0CD 1IAOA 1CCZA 3PWPD 1JTTA 3QJFA 3HG1A 1HN1A 2NY2D 2HFTA 1TETH 2PXYD 1KCRL 4X6DE 2X9YA 3IAGC 3RFZC 3JV4B 2YUVA 2QLVB 2CD0A 5EO9A 1DQLH 1KV3A 1WF5A 4KKBD 3K81A 4D9LH 2UZIH 2ORBL 1AJ7L 2IAMB 4I0PB 3VA6A 5I76A 4R26H 3QWRD 3QI9D 4NWTH 4NSKB 4YDIL 2I60L 3VRLF 2AJ3B 4Y16C 4X9HA 1ACYH 4YWGL 3RWDA 2PO6A 1NEUA 3T2QA 1YNLL 1LEKA 5E2WH 1P7QD 1D9KB 4LEOB 3DBXA 5D2LF 4UU9B 4RMQA 5HVHC 3GHBH 3OKNB 3HE7C 5ITFB 4F8TA 5F1NB 3RKDD 1FVEA 4QRPD 3MA9L 4FABH 4PG9B 3LEYL 5E2WL 4F33B 4O02H 1FG2B 25C8L 3ZKXB 3CD4A 2IANA 4FQ2H 1SYVB 2VDQH 3MLPA 5EC1B 3LDBB 4QYOB 4M48L 4UAOB 3TJEH 3PABA 4GUPB 2J12B 2W9LA 4RMSA 2HKHH 4MNQE 5J13B 3K4ZA 5EU6D 1BZ9A 4EBQH 3ROLB 4WWKB 4JFEA 1JZ5A 2HJKB 1TQCC 3DROB 8CGTA 5HXMA 4YUEH 3P73B 1O7VA 1D5ZB 5L9DH 5HYFA 1PSKL 2YPLD 1F58H 4JRXE 4NZRL 5EIIB 2D3VA 4PY7A 5MP6L 2DIJA 4PB9L 1UG9A 1NDGB 1XGPB 4H26A 4MXWH 1QFWI 2EXYD 5I9QB 4CW1B 1BFOB 1Y0LA 5C0CE 1OGTA 3KYOB 3EJYD 4B5EA 1LQSR 3VH8G 5K9OA 1OTUD 5DWUL 5E95B 3QG6B 3X3FL 1WBYB 3SY0A 1MCWW 3WFDL 4QOKE 4GAGL 1A5FH 4ZFFB 4J2XA 3QDAA 2P43B 3STBA 1JV5B 1GZQA 1NKRA 4HQQH 3I9GH 5KSVB 1A7PH 2E3VA 5D5MB 5KSBA 4YDJB 3C6SB 4HWNA 4JQXA 1VA9A 3UMTA 1IFHL 3FRUA 3PHQA 3QIUB 4KI5E 3FFCA 4F37F 1R24B 1GXEA 4X5WB 4LP4A 2BFVL 4WJ5A 4F7TA 3G6DH 5D7JA 2XA8L 2C4FT 4I3RL 4PJDF 5ACZB 2YPLB 5GGVL 2JB5L 2A6IA 3MLTA 1LO2L 1XR8A 2JJVA 4Y19B 5LG1A 4N8CH 1NBYB 4MAYB 3PWJB 4LCWA 5E8NA 3RGHA 4ODUB 2ENYA 3SE9L 2QHRL 5EDXA 3B9KD 3MV7D 3N1PC 4MA8H 4CVZB 4GOSA 2VDKH 2AV7A 3MOBH 4KHTH 4M93B 2XWBB 1JYVA 4KJWC 3EOAB 2WZPD 4JFEE 2DL2A 4KTEL 2PYFA 3QJHB 4Y2OA 1KJ3L 1VESA 5JORA 1D9KA 1JGDB 3NACH 4JZOA 4LEOA 3OXSB 4YJZL 3DPBA 2VN7A 4NHUB 4NQVB 5HVGB 1U8PA 4KAQH 3DRQA 3P0YH 4JCMA 3ARBA 3QIWA 3H9SB 4D9LL 4OD1L 1NGWA 1KEMH 2BY1A 3FO2A 2ILLA 4GKNA 1AXIB 1BZ7A 3AC0A 3MROB 3ES6A 15C8L 4OD3H 4HZLA 1UA6L 4BUHA 3S3JA 3ARPA 5BMFL 3F7QA 3TO4A 4QYOA 5EOQL 2H9GA 5JO5A 4P5TA 4NRZA 4OBRA 2DKSA 3QIWC 1YNLH 5D1ZB 2CGRH 5C0NC 1VERA 3VFUB 2VZ3A 4GG8A 5IB4A 1RY7B 5H37H 3EGSA 3EYSH 2MKLC 2H41A 2N7BA 1GJIA 1KPRA 2DQFB 3WE6B 1P6FA 2FECL 4JN2B 4WO4B 2BSTA 2FJHB 1HXMA 4Q2ZB 3VD3A 1X5IA 2WUBL 2X4QA 4AEIL 4X5WA 2H26B 5IVZB 4JY4A 5T3ZE 1UENA 4JY6B 4NQSA 2Q87A 2BDNL 4P2CG 1OTTC 3OKLA 4F7EA 2HVKB 4YHML 4BQ6A 5DI8A 4HAFA 4OCRH 3RDTD 4PJ9D 2Z91B 2NMSA 1Q94A 2A74A 4PRID 1T3FB 4WHCA 5HVFB 1L4IA 2XWBA 4E41B 1LP9F 1KYOK 1TZHB 4PGDA 4K8RH 4ALAL 5I73B 1CTNA 4WEBL 1KTKE 3MLWH 3LSOB 3W81A 5C0AA 3MRJB 3GBLA 2ZCHH 1E6JL 4GRLA 4WUUA 2CIIA 4PS4H 4BH8A 2YA0A 3IDYC 3DV6A 2AI0L 1A7PL 1IGYA 2Y7QA 3TIEA 1D5XB 3MBED 4Y4HA 3UTSD 5F7EH 3UJJL 3S88H 1NGXA 3AGVA 1AGFA 1QBAA 5C07B 5KOVC 3MOAH 4HG4K 2E7CA 2O26U 2VQ1A 2WIIA 2XICA 3PDOB 3HCVB 1XR8B 1OM3H 4QRPE 1FNSL 4AMKL 1FCGA 1QOKA 4PJXE 4PG2C 1A4KB 1EXUA 3Q1SL 5ALBH 3M45A 3GO1H 2FL5B 4I0PC 5DVKA 2DQFA 3CIQA 4JO4L 3ZKQD 4XHJC 5DJCB 1K5NA 1V7MH 3MNZA 3AMLA 5T3XD 2OK0H 4X4ME 1EBAA 1BIIA 1PQZA 5EU6E 3DX6B 1FFPB 4K7FA 2Q1EA 5DVNA 1QQDA 1XH3A 2H6PA 3EYOA 4HUNB 4W4OC 5FKPA 5J4MA 5CEZL 1UWGL 3ETBF 4H8WL 4JM2C 5DR5L 2DLEA 2O5YL 5GGSB 1U0QA 5K9QI 1AC0A 1DQTA 2OTWA 4P4RB 1KEML 4HF5L 1JPST 1XGTB 1N59B 3ZKXC 3BDYL 4RZCB 4URTB 4WDIA 1Y6MR 1TVHA 3LDBC 3WUWB 1ADQA 4LKCB 4UAOC 1MCPH 4BFBD 4F7CA 3QQ3B 4KK8C 5E99L 4ZUTA 3EOBB 5J13C 1A14L 3HAEA 2DLFH 4HULB 3O45B 4L8BA 4RMUA 2MPAH 1PBYA 1IAIH 3C87A 1QSEE 5GJTL 3J8F7 4HH8A 5T1KB 3PWLB 3UC0H 2JK5A 3FOMB 1FDLH 2ZOKA 3D39A 7FABL 2N4IA 4FNLH 5F88A 3MRDB 1FZKA 1EA9C 4X9IA 2H3NA 4NN6B 5DJCA 4YGVB 1HOCA 2YK1H 5H94B 1DANU 2R1XA 4U1MB 1YMMA 5EG6C 4WU5B 5CZKA 3LV3A 4R7DB 1CVRA 1HHJB 2AXGB 1IFHH 4O4YH 4LARH 4F15B 5IB5A 2UVFA 3CUPB 4NO0A 1YN7A 2ATPB 1NFDE 1FE8H 4O5LH 5GS2D 4NKOB 3STLB 5FECA 4U6TA 3H9SD 1MJJA 1CDGA