4FNLH

Crystal structure of broadly neutralizing antibody c05
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
239
structure length
233
Chain Sequence
EVQLQESGGGLVQPGESLRLSCVGSGSSFGESTLSYYAVSWVRQAPGKGLEWLSIINAGGGDIDYADSVEGRFTISRDNSKETLYLQMTNLRVEDTGVYYCAKHMSMQQVVSAGWERADLVGDAFDVWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody C05, Heavy Chain
publication title Cross-neutralization of influenza A viruses mediated by a single antibody loop.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 233
sequence length 239
chains with identical sequence I
ec nomenclature
pdb deposition date 2012-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fnlH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fnlH01
3CFKA 1XGPB 4PJBF 5JNYA 3RAJH 5D1QD 4Y5VB 1XGQB 4OZFB 5IQ7H 4DUWA 5C0AD 3VXOB 2J5LC 1S9KC 4IEFB 2EKSB 2VLJB 3C8HA 1UEYA 4Y2DC 5CJBA 5DYOA 3S3JA 1RZJL 1MFDH 3CJJA 2ZUUA 4MX7B 5F88B 1J1XL 2VXVH 5DFVC 4UOW1 3V4VH 1WWWX 3P0VL 2D3VA 3QG6B 4RSVA 5EBWB 2MJWA 5LGKA 3NFSH 1RJYA 3A6OA 2HRPH 5D71H 5GIRB 1EAPB 2D7MA 3OKDB 2FHFA 1QLRB 3RWCB 4KVNL 3LPGA 2AK4B 1FNFA 2OQJB 4D8PA 4ZNEA 1I1RA 5DC9B 3RVVD 2K9UA 5JOFB 1WLHA 1FH5H 4CDHA 4HKXA 1KB9J 4I48A 5ID0A 2XA3A 1N64L 1B3JA 3BDYH 3MXVL 1YMME 4QRSB 2WBWB 3MNVB 5I1CL 4K23L 4WNQB 4O00A 2VDRL 1IAKB 3TNMA 3CVHH 5T3XH 3HTLX 1JGUL 4WFFE 4APQB 3SPVA 1M4KA 4BUHA 2ADJA 1QBLH 1F4YH 3BYTA 1DQML 1KCSH 5IHUH 2DM3A 4ZOCA 2Q7YA 2IPKA 1IMHC 1EBPA 1LGVA 2F54D 4MXWH 2B4CL 1LP9E 4IJ3B 1OP3H 4U1SB 5J06A 5I71B 4HLZH 2GK0B 1LEKA 3STZA 1R24B 3TV3H 4KUCF 2EXYC 5EU6E 2RFXA 1YEDA 2YBRA 4ZFZA 1UG9A 3QRGL 1OQOA 1G6VK 5DRXA 3WD5H 5EFIA 4HEPG 4J6RH 5C0BE 4ZUUA 4AYFA 3S36H 3ARDC 3UPAA 3KYNB 4G7VH 4S1RL 4WI4A 3S5LG 1RUML 2BRRL 3NABL 4XH2B 5F9OL 5LWYH 1A7OL 3O2WL 4LHUB 4U1JA 3UZVB 4LLDA 4IS6A 1EEZA 2FBJH 1CE6B 4M02A 1TLKA 2EH8H 1UQSB 4M7ZC 5ICYB 4OZHB 1KPVB 2EYSA 4GRWF 5LXGL 3HNVL 5TQ2L 1RVFH 4A6YA 3EYQD 1MNUH 1UM4L 4YO0B 1MRFL 1VGEL 5EULV 1U8MB 2IBGA 4NP4H 1LO3H 3DO3A 3D0LA 3LS5L 5J6GB 2QV2A 4PRDB 1XGTA 3UPCA 4LEXH 3R1GL 3WN5B 4I18A 3OSKA 3U7YL 2HH0L 3HI1B 3MXWH 5SWZD 4ZD3H 4O58H 1KUMA 1XF4A 1MHCB 2BRQA 2BNRA 2JJWA 3GKWH 4LCUB 4MA1C 4Q58C 4QF1B 4U6XB 4WO4D 1XCQB 5DA4A 4NQDD 4F7MB 4FXLA 4U7KA 1DANU 3U9PL 1RJCA 1G6RL 4I2XE 1QPXA 4CADA 3TFKD 1QBML 4EEEA 1Q9KA 3BD4A 3ZKMC 3BAEL 4HH9B 3W9EA 3CFIC 3MCG1 4ENEC 3IAQA 5BXFA 2D4FA 2X7LA 3ZDYE 2OR8A 2OTUA 1TTFA 1NBYA 4KUCD 5DJ2A 2CSPA 4UUJA 3IGAA 3DMMB 5HPMA 2J8UF 4G43B 4PGJA 4U05A 1DL7L 4HAGA 4DGVL 2CD0A 3BD3A 4FNLH 5FYKE 2C3HA 4RMSA 3MV9D 3W2DL 3A0OA 1FFOA 1BFSA 2CJUH 2GSIB 1Q1JL 4HF5H 1N59B 3QO1A 1GVIA 4JRYB 4WWKC 3OAUL 2QHRL 3PHSA 2Q6WA 5DJYA 1MJ7L 4MJ4A 2QR0A 3H9SE 4F7CA 1MF2H 2XKSA 3G6JA 4NQCD 4ZUSB 5T1LD 1ACYH 3ROLA 1T1XB 4ZAKD 5GGSB 2YPLD 2PYEE 3GSRB 1QSFA 3DTXB 4JO2H 1SBBA 1TQCB 4MJ5B 3R0MA 3VXMA 1XGYL 1HCFX 5E4EC 1WQVT 4WU7B 3VXRD 5CZKA 4R90H 5T3ZE 4PJEF 1QACA 5KVFL 3PWVB 4NM8H 2ZCHH 1VENA 1UA6H 1IEAB 5FUZL 4NQEB 5DGQA 3KWWB 4G8GD 5L88H 4DQOL 2WANA 5JUEH 3EYOA 3S98A 3K0WA 5INDA 3O8XB 4L4TB 3TA3D 3QUZD 2HJKB 3E8UH 4L8SA 1AFVL 3L7EB 1EHLH 3GSUA 5JHDA 3OR6B 3MOAL 1C12B 1HHJB 1UVQA 4BQ8A 5FB8B 4WV1A 3B6SA 3TFKC 2Q8BH 3PHQB 5DUMH 5J11C 1CICD 4PRAB 3IDMB 1I8MB 5I1KH 2VLRA 3MCLL 3LRSA 4NNXA 2EC9U 4ZDHB 3RWFA 1DE4B 3WDHA 1QKZH 5BS0E 2P8LA 1H8SA 4U0RB 3ZDXE 1OQXA 4U4BA 3TO4D 2ZOLA 3GO1L 4PJ9A 1ZVYA 4RGMC 1W0WA 4PGEA 3SO3B 1OCWL 4PRBB 2DI7A 1Y18A 1C16A 3RWEB 5J9PA 3INUL 5JW4Q 1C7SA 4ODUB 4ZS7L 5KZCB 2C1OB 4DN3H 3WXWL 4MA7H 1F2QA 5IW1B 5EWIL 4XNQA 5D7KE 4PS4H 1OAQH 5KSAA 4G80A 3W9DA 3NA9H 4LQFH 1P7KB 2BC4A 3BKJL 5TE4L 2DQUL 1MEXL 4FQLL 1I3GL 3O3UN 4JHAL 4XPTL 4GQ9H 1XGUA 1ORQB 4ZAKC 4YHPA 2H32B 2FR4A 5FCUL 2UY6A 5HI4C 1MAML 4LCCC 3UROR 3BKMH 1AGFA 3RWIB 3SCMA 1BZ7B 4YR6B 4CVUA 1BQHG 5IWLC 4U1MB 1NLDH 1R3LA 3DVGB 5IK3B 4IMKC 3PQYB 4YDIL 4ALAH 4AEEA 3VE0B 4RGOL 3IXAA 4M6AA 1RURL 5T1KB 4A2LA 5J6HA 4OZGA 3X11A 3UMTA 4W4OA 5LG1A 3C60A 4V1DA 3U0TA 2QKIB 3OKNB 4MMZC 3BSZL 3RDTD 4IRJA 1JWUB 2FSEA 1FCCA 5F72S 4KI5C 1NL0H 4C54A 5E1HB 5D1QB 2X2YA 2XZQL 3TYGL 5F3BB 1YYLL 4P2RE 4P4RA 5C0AB 1U2HA 4AT6A 5EU4A 3ARFD 5KJRH 1E4XI 3B5TA 4PJDE 2QHLA 5L7XH 2A83B 5K9KA 4TQEL 4HD9A 3HPJB 1V3JA 4JY5L 3SJVE 3HS0B 2MKLC 2ADGA 3V7AE 2A74B 3I75A 4IDJH 3A6CH 4R4FH 4OLZH 2X1XR 4DEPC 1I8IB 3O45A 4HWBL 1WF5A 5TDPB 1WSST 3OKMB 2YN5A 2H1PL 2EXWD 3CK0L 3S5LB 1JRHL 2M26A 3BP7A 2VKXA 4XMLL 4YHZL 2AXFB 4HK3N 3TPKA 3TYFA 1J88A 3WUZA 5ICZB 3GEWB 3JBG7 3L3GA 2VN7A 5GRJL 1J86A 1HE7A 1ETZA 3PV7A 4G3YL 4PLKD 3HG1E 2VH5H 3I2CH 5AWNL 5AZ2H 3LN4B 5FDWB 4WI3A 5LCVH 4P5TC 5GS2H 2R4RH 5GSRA 4MA1B 2VDNH 4QT5A 5FYLL 3VFWB 5C0FB 3G04A 4LGPB 4PR5A 4OV6F 4ZTOH 1N26A 5CD3B 1GZPB 2FJHB 4NZUL 4X9FA 5F9WB 2VDKL 1CLZH 3T08A 1DDHB 1CFQB 3SDDD 3TN0D 1JFQH 2BNUA 1Q72H 4QRRB 2F54B 2QQNL 1NAMB 2B2XH 3QR2A 4L3EE 1B0RB 3LHPL 1G1CA 1OW0C 3QNZA 3VFRA 1A2YA 3HZVA 1KXTB 4XPFL 5DZNA 4ZUWA 5MI0B 1YMHB 4PP2B 3NTCL 1AGBB 3BZEA 4PJBB 3S37X 5D93B 4ZUTB 5H8DA 3T4YA 4CJ0A 4XBGA 1NCDH 1FZMA 5ANMB 3KDMB 1AHWA 4ONFL 4X7SL 3KR3L 5IB3A 4M4PA 2AJZB 3H9YA 3QEQE 1YQVL 4UT9H 1HZHH 3KPQB 3J8F7 3NZ8A 4K8RC 4NHCL 4Z0XA 1V3KA 4N9GB 4FQQB 4ZOBA 4LBEA 4LEOA 2V7NA 4WHCA 3P30H 1MAKA 2UZIH 5EDXA 3PWPA 2Q3ZA 1FYTD 4DAGL 1E6JL 1JN6B 1U92A 3IS0X 1C1EL 1J05B 3RZCA 2P8MA 4M7LH 2WQRA 1FO0H 5I1AB 2FIKA 43CAA 4OIIH 3ARBA 2HN7B 3FRPG 1GJIA 3HNTL 4JN2A 2O5YH 3DGGA 5E4EB 1UACL 4TVPH 4CGTA 2W0FB 4ZQKB 3FFCE 1KNOB 5E2VH 4UIKL 3QUYA 1B2WH 5HYFA 2E27H 1U58B 4IRSA 1LP9F 3R0NA 4HC1L 4PGCB 1D5XA 4WENB 5DRZB 1F4XH 1EO5A 3SQOL 4EN3C 3EJYC 4MD4A 3OKKA 5BZDA 4LPXA 3M45A 4LSQH 3TBTA 3T65A 5FO7A 5H94B 3LMJL 2YC1B 2EH7L 5JOEA 5JPNB 4NKDA 3U4EB 5E1AA 3BIKB 4NQDB 1I9EA 2D0GA 1MRDL 5I1LB 4ODVH 4X6BB 3UXFA 4PUBH 2FZ3B 3DV6A 3MLYH 3QISA 3O11A 4FQIH 2GI7A 3QQ4B 3MRFB 1CG9A 1MCRA 4P46D 1NGWB 4EZMA 3LKNB 5HGDB 5D70L 2VTFA 2BY3A 4RAHA 5I8KH 1JTTA 4DGYL 3HUJF 4RGMB 2B0SL 1I7RB 3RPIB 1LEGB 3EOAB 4MQSB 5ESVA 2YEZA 3BOVA 32C2B 3HZKB 2VDOH 5I0ZA 4C83B 3IAGC 1OGTB 3FO2A 4LNVA 2X4UA 2A1WL 6FABH 4OFYA 4KTEL 3FO1B 3MV9B 3BZFB 3WS6A 5D1XC 2GY5A 5JXAL 3PJSB 4D3CL 12E8H 4KROD 1YNLL 1N2RA 5D96C 2EE9A 3H9HB 2ESVA 2I9LB 3EHBC 4GRWB 4CW1B 4PTUA 1P4LA 1CD9B 4PRPA 3CMGA 1QSEA 2DN7A 4OCWH 5DHYB 4NQCB 3D1MC 3DHJA 1QLFB 5T1LB 4LHQB 1LDSA 4ZAKB 3FO9A 4R8WH 3B8SA 2YPLB 4AIOA 1AIFB 2CDEA 4LCCB 5C0RH 2JK5B 3VXRB 5EC1A 4RNRB 1VCAA 2WUBL 5GZND 2XFXA 3ZYZA 1HDMA 5D6CA 3GSOA 5EU6D 4DCQA 3QDHA 1K85A 1CFTB 1KLFA 4G8GB 3TNNB 4XHJC 5JPMA 1B0GB 4I8DA 1S9VB 1E0OB 5HYQA 2FO1A 5DT1L 4DZ8B 4XVTL 1JHTB 4ODBD 3TA3B 4E5XB 3MRQB 3QUZB 2H9GB 3UC0H 2DJUA 4MNGB 1MFEH 1A3LL 5HDOA 1BQHB 1BOGA 2PETA 4OCYL 4E41E 3ABZA 3WFCH 3EJZC 4JO1L 5FYJH 4XXCC 5KAQF 2ARJB 1INQA 4PY7B 4Z7UE 3K8MA 1KTLA 3L3KA 3ZE2E 4E9LA 5HGAA 1SJHB 3LRGA 1BJ1H 2GTZA 3B2VL 4XC1L 1U41A 2CDGA 5E9DE 3AMLA 2X70A 3ZHKA 3DUHA 3LVEA 1MPAL 5DJXA 4L1DA 5FUOH 1B6UA 1JTOA 3ULVF 4D0BA 1QBAA 1RZ7H 3AU1B 1CBVH 1T0MA 2FO4A 4GAGH 1EIBA 1BAFH 3RVTD 3GGWB 5EPMB 3DYPA 3ARYA 3F7YB 3TWCH 2VZSA 4OCRH 3DX7B 2E3VA 5F9AC 2Z91A 1QQDB 1QA9B 3L3IB 1TTGA 4PJCE 2A6IA 3MV8A 3VA6A 1DEEB 4TSCL 3O41B 3AROA 3V5DB 4PJEB 5I1HH 1PSKH 1EAPA 4X4XA 1T03L 5I17B 2CO7B 1QPPA 1YY8A 2FX9L 4EI5A 1A6ZB 1J8HA 3KJ4C 4N0FA 3RWCA 2OQJA 2ZUXA 5C8JB 5F7EL 5GZNC 4JB9H 4G8EB 5IEHB 1VPOL 3ZDXF 5FYKD 2WBKA 1CS6A 3V2AR 2XN9D 1FC1A 4NHUA 3MNVA 1NANI 4GJTB 1G84A 3DRTA 3LS4L 4JVWA 4WNQA 1IAKA 2HKHH 1EGJL 3CMOL 3B5HA 4BZ1L 4OZ4A 4WU5A 1NAML 1HWGB 2IAMA 3MV7A 4ONGL 3PDOB 4GG6E 3H9SD 3I6KA 4GXVL 3GI9L 4JG1L 3DURA 1MLCB 4U1SA 1CFSA 4OD1L 5EUOE 5IHZB 1K3IA 2HWZH 1F02I 4XNYL 2VO5A 2KPNA 3CH1A 3ULVD 3PXHA 2PYED 1Z5LA 3U36B 5ELIA 4P49A 1YEHL 4L29B 2Q8AH 1AH1A 1VKXB 5SWQB 1BZ9A 2YPVH 1HKLH 4P2OA 2FYYA 5T3ZD 1D9KA 1KFAH 1G9NC 1FP5A 2FECI 1U8JA 2NZ9D 3KAAA 2UYLB 4JFED 4EN3B 5CGMA 5KS9E 2PNDA 2XQYG 4Q6IC 4G6AD 2GFBB 4U1KA 4D0CB 3KJ6L 1J87A 1NANH 5I8CA 3F7VA 4J4PD 1E28B 2ZUVA 3TJHD 1FNGB 5ICYA 4OZHA 3D2UD 3L7FB 2X4QA 4JKMA 1RZKL 3V0VA 4CN1A 5LGJB 1WZ1L 5I8EA 4YO0A 5KOVC 3EW3B 1MFBL 3NAAH 4C55A 4LVNC 1PKOA 3TN0B 2FATL 3O81A 4PJDF 5BS0D 1U8MA 2GJ6E 4JQVA 5GHWL 4J3XA 4MNHA 4WRLA 3QUMH 4XAKE 4BYHA 4KK8C 3TLRA 5BJTB 3HE7D 3TBYB 2GAZA 3DUUB 1PZUB 2G5RA 3BEVB 1KJ2H 2IFFL 3RVWC 3SE8L 1TJIL 4LFHD 4OUOA 5D1XB 2ICEA 1MCQA 3WHXB 2C7UA 2Y4SA 4JFOB 5D7KD 2AXGA 4QHKI 5D96B 3HE6A 4PJGB 3U0PB 4L4JA 3T1WA 3G5ZA 1BJ1J 3ILQD 3V6ZB 5CCKH 2N7AA 3JUYA 1FYTB 5L2KE 2G9HA 5CLTA 3DV4A 1DFBH 1JYWA 1ITCA 3N1MC 2Q76A 3CZFB 2OZ4A 3WL9A 1DBKL 2VLLB 3DIFA 2FD6H 1H8NA 5ADPH 3G6DH 4H0HB 5DD3L 3VGGA 4WDIB 1J9CT 3PL6D 4EJ1C 2V9TA 4Q6YA 3QEUA 5DZLA 2CRZA 2CQVA 3MZGB 3QJFB 4WHTA 1NUGA 4Y4FD 3G5XB 2ADIA 5EU7E 5KW9L 1Z3GL 4DUVA 1B88A 4WW2C 4F15C 1HILA 3GBNH 1MQKH 4JZNA 4M5ZH 5CEZL 4DTGH 4MHHG 5BV7C 5TE6L 1HSBB 3MJ8A 9CGTA 4HIJB 4M9OA 1BVKB 2HT4D 3JV6B 1S7SB 4AY0A 5BMFL 4P2RD 3MPCA 4Y19E 1KIUA 3PHOB 4ZUSA 2YA1A 1N7ML 3CPLB 4YGVB 4JZJB 3D3VD 1JK8B 2A73A 2YOCA 4I0PD 5FHAL 4RISL 5FGCE 5TDOB 5C09E 4P46B 4NBYB 1F3RB 2OK0L 3P9LA 5F7MC 2LAGB 5HVGB 2QQKH 5DGRA 5SWSE 3CFCL 3QDAA 2WLYA 4WFEE 3V5KB 4PYGA 5FDYA 5MEOA 2W65A 5IG7A 3HE7C 5CINL 2E7HA 4OV5B 1A0QL 4NO5B 2D03H 4L3CA 1SEBA 4QRTB 5IQ9B 2HT2D 4XVUC 3LPWA 4WCYL 1S7WA 2Z31D 3LDBC 3B9KC 5CHNB 3CLEL 4AG4H 1EVUA 1KEGL 2KZWA 4PJAA 5C0GB 5K33A 3OPZL 2PYFA 4M62L 5KSUB 3L5HA 3HG1D 4N0UE 2LU7A 3VFGH 3QI9C 5I1DB 2E8ZA 4KROB 2NTFB 1INDL 1YMMB 1IL1B 2Q20A 3S96A 4J23A 3UAJD 4WI5A 2JB6B 3TBSB 1P9MA 1AJ7L 4K7FA 5DQJB 3D0VA 4HWNA 2YUWA 4BSWA 2EE6A 5GZOD 1LP9B 2B7DT 2DL2A 4IOFD 2DLGA 3PL6C 4OLYL 1E4KA 2VWEE 3OGCB 3S36X 3RWEA 4Y4FC 2C9AA 1CF8H 4PB9H 4YHOL 5E08H 3FN3A 3STLA 4GMSL 5EU6B 4ZNCD 3V7AG 2W0KA 3MLTA 3MV01 4HIHA 1FE8L 2HJLA 4JKPL 1T1YA 1VFBB 2WUCH 3EFDH 3OXRA 2C4FT 4QXGH 5IW6A 3MR9B 4B0MM 2GIYA 4XB8A 3EGSB 5ILTL 3FOLA 3QEQD 3V52L 1OP5K 4JM2A 3E2HB 5TFSH 5B8CC 4MZ3A 3N06B 1ORQA 3LQAH 4UIMB 3FQUB 4CMMB 3L3DA 3RWIA 2ORBH 5GS1B 4LSVL 1N6QH 4BH8B 3WSQL 1IKNC 3DX9B 4X4ZA 3W5NA 3DVGA 3N1PC 2BSSB 4XPHH 3QIWD 2KQNA 2UUDK 4I3RL 5D72L 4JAMB 2QKIA 5DK2A 2OSLA 3E6FA 1TZHA 3K8KA 4A6YH 1LEIA 1I7UA 4IIQA 1JWUA 3H42L 5IMKA 3KYMA 4Z7VE 3VXTA 3IDXL 4X7DC 3DX8B 2AJUL 3KXFA 4Y0GA 5JZ7D 1FLRL 2Z4QA 4WJ5A 4L8BB 1R5VB 2D4DA 4KJWC 4XMPL 2BX5A 4EDWH 5T3XD 3W0WE 1UWXK 5AG9A 2EDHA 4CNIA 5CMAA 4M48L 2ARJQ 4I2XB 2X9XA 4X6EA 4GMTL 4G5ZH 1IVLA 1T5WB 1UADC 2W0LA 3LKSB 3GSNB 3X14B 5J12C 2QSTA 5ALBL 4IOIB 3MLVH 2X4TB 4JPIA 1O5DT 4TUJB 3OR7B 5GZOC 1A7PH 3ARGA 3U1SL 1F5WA 4Z7UF 4OFIA 1UM6H 2EDNA 2AP2A 3FRUB 3RUGF 5JIIA 4LCWE 1G7LB 4XPBL 4QHKJ 1WFUA 4LSRH 3LN4A 3Q1SL 2EYTB 4XNXH 1TETL 3O6MH 3LPFA 2DICA 1BEYL 5CWSA 1SM3H 4PV8B 3RY5A 3U46A 5FYJE 1QFPA 3ECBB 2HFEB 5I1JL 4PB0H 1C08B 2XA8H 4O2EA 2X4PA 5BQ7B 1R5IA 3H9SB 1UZ6E 2NY4D 5E00B 5A16B 3RI5F 2J12B 3OZ9H 4P23C 4X80L 1H15A 2F19L 3L1OL 1X7QB 4MCZB 1SEQH 4OUUB 2PYEB 3T0AA 2EEAA 4XBEL 4PJHF 1K6QL 3JWOH 2B1HL 5D2LA 3GI8H 1BFOB 3BPCB 1AE6H 4WW2B 3HI5H 5DUPL 4HZLA 4F3FB 3T4AB 2CUMA 2BNQE 1U8QB 4JFEB 2QQLH 4H8WL 2E8YA 4F7PB 5BV7B 4ODWB 4KK9D 2HLFD 2PTTB 4XWOD 3P9MB 5DZOA 5HDQH 1ZLSH 5EA0H 1CYGA 3V5HB 1QP1A 5J3HC 4WTZA 3D25A 4NRXB 1HXMB 1RZFL 3RWDB 5KBNC 3REWB 4E41D 3D2UB 1K5NB 3MRGB 1JWMA 4ESKA 5IM7A 4K94H 4NDMA 3JTSB 4GW4B 3UTPE 2C3VB 1MJJB 4ZQKA 1CR9L 2H41A 3DJ9A 5BS0B 2IANA 2V7HA 1UKSA 1OB1B 5DQ9B 3P4MB 3F6IA 4LAJH 2MWCA 5E9DD 5TPWH 4HT1H 2Z93A 5C9JB 5KSBE 2IFGA 3WHE0 3WNMA 1RJZB 4UQ3A 5EUOF 1VEOA 4BJLA 3EO9L 1R3IH 3HE7B 4JREC 5DRNB 3DXAE 4LMQI 5K59E 3DROA 5H94A 5SWZA 3OTTA 4HV8A 3LDBB 3B9KB 5J0BA 1FZKA 4XMKL 2Y72A 4KJPC 2VZUA 2DQGL 4WO4A 4JFDE 2WBJD 3ET9F 3SE4C 3O6KH 5DMGC 3VFNA 3LIZH 1KBGH 5CD5D 4H88H 3HKFA 2UWEE 4LGSB 2KZ1B 1B4JH 2DJ4A 3QQ4A 5KS9F 4Q9RH 1TZIB 3QPXH 4QHMB 5HD8C 4YIQB 2XTJE 1OAYH 1JHKH 3EOBB 4GKNA 1ERNA 1RHHB 3HPLB 4KKLC 4BH7A 4LLUB 1DUZA 1I7RA 4UDUA 3QNXA 1JUFB 3RPIA 3QYCA 1NGYB 3EOAA 3NPZB 5E03A 5ACMA 3PL6B 1RQ5A 5K9OB 4U6HA 4KU1A 4M93B 1D6VL 4Y4FB 2OBGA 2VABB 4NGHL 1W0VB 1Z9MA 1LE5B 1BFVH 4Z7OF 3ZDZF 3H9HA 3U7WL 1SYVA 1QRNE 4HWEH 1IGFL 1QLEL 2HLFC 4P9HH 2A9NL 1PKQA 4N8VA 4YWGH 4OLVH 3T2QA 3TZVC 1KB9K 4P2RB 4YHNA 1AGEA 1GXEA 1QZ1A 5FXCH 1CLOL 3MJ6A 4OCSL 5B8CB 3LD8C 4PJDB 4W4NA 3D3VB 1NCBH 4I0PB 4RRPA 3U4BL 2IBZX 3FT3A 3MCKA 1T7YA 3OJDB 3VXRA 2NY6C 3D39D 4XAWH 2OM5A 2EDLA 4Y5XA 1HYSD 5DWUL 2XPGA 3T0WA 1O7VA 1YN6B 1YJDH 1NFIB 4KXZI 3T3ME 1VHPA 3DSFL 1I3UA 3UZQA 1J1OL 1RUQH 4EQ2A 4LSUH 3FB6B 3MRQA 4EXKA 5IFHL 2EDXA 3ES6A 4AQOA 2AEQH 4MB3A 3RKDD 3CNKA 3P4OA 5DMIL 3HG1B 1KCRH 2NR6D 3P0YH 1CICA 5F9JB 1F13A 2D31B 4NO0D 3WIHH 2F15A 1XAUA 2J8UA 2WQ8A 4KVCH 1LK2B 4J8RA 5ADOL 1UT9A 2ZUWA 1T1WA 1L6XA 4JFYB 4FOMA 1I85A 1HSAA 3TO4A 5I2IB 4P4KD 4AENA 2VLKE 5J12B 1HXYA 1OAUH 4L3EB 1UZ8A 3QDME 5C7XH 3NOIA 1ROWA 4JG0L 1UXWB 4XAKD 5HY9B 1QD0A 2QADD 4JM4H 4OF5A 5M95B 4PD4K 2P5EA 1A3QA 4JHWL 3R4DA 1KENH 1XZ0B 4CKVX 1N3NA 3KPLB 2HMID 4KXZH 1BJ8A 4Y5YB 4BQ6A 2V2XA 3F7YA 4NN6C 1IGCL 2VQ1B 4HH8A 1C5DA 4LSPL 3DX7A 3NCCB 3GSNL 1XIWA 4JE4B 4R7DA 1PX3A 2HKFH 4ZS6D 3MLUL 5CUSL 2CKBA 3QEQB 2JE8A 4RQQB 4O02L 4MQXD 4MVBC 5ISZD 3RA7L 2R2HA 5DEZA 4Z8FL 2YD8A 2FX7H 4NNYB 3S6CA 2C4XA 1FVDA 3CUPB 3BP5A 3DYMA 4NQSA 4P23B 4LSTH 4NOBA 3LY6A 4JPVL 3GMRB 1KPRA 2A6DA 5EZLB 2H3NA 2FEDD 1MVUB 1KELH 1QNZL 5FYKL 3PWNB 5IESL 3QIWB 4U1GB 1DVFD 4WW1A 4PPTA 4F7TA 3K4AA 3FQXB 3FFCB 5GGVL 3RDTA 5F9DC 3VH8G 5TF1H 2EIEA 4HK0B 3P73A 2LE9A 4FQCL 3QO0A 1NDGA 4Q9QH 3IU3A 2VDML 4NKIL 1T89A 3TO2A 5ENWA 5GS2D 2VOTA 1VEMA 2R8SL 2R0WH 4KRMB 4ZNEE 4NKMA 3MOBH 3ARFA 3CVHB 4FN0A 3T2OA 1KCUL 5C6TH 1MLCA 3WHE1 5L8KB 4OD2B 4Y19D 3ULVL 1OARH 3GBMH 5IHZA 1A7NL 4JDVA 4U1LA 3GHBH 3A67H 2WWKT 3CX5J 1CXFA 4XI5C 1LILA 5IT2H 2VITA 5T3ZL 1PG7H 4GKSA 2I07B 1VKXA 1AD9B 3T1FA 4ZO8A 2EDQA 4OLEA 5GRYA 4OLWH 3WUWG 3LEVL 3L5IA 1U8OA 4LLYB 5BV7L 3HZMA 2EZ0D 4C56A 5DK0A 1JGVH 5DTFB 2IADA 3FKUS 2NY0D 3PWLB 1KT2B 4NFCA 3UDWA 4H26B 2GTWB 1JNLH 5J1AB 3AY4C 3QIBC 1JPSH 3UBXA 5GPRA 1WBXB 3S4SG 2P24B 5E6ID 3BHBA 3FFDB 4XRCB 4PFEA 3B5GA 2XNAA 4FMFA 2XXMB 2VMFA 4RMRA 3MODL 3MGAA 2DKMA 1A6TB 2WWMD 5ETUA 3SDDA 3T3PE 3TN0A 4Z7WA 5CZVL 2NY4B 3GMLB 5C3LD 3IDYC 1BHGA 5CBEB 2HLAA 2IBZY 4XP9H 1ZGLB 4XP1H 2J8HA 4YXLH 3QAZC 1IGMH 3F7RA 3UO1L 2GT9B 4TVPD 3PIQA 3PGCB 1Q0XL 2YXFA 4HPOL 1JV5B 1ZAGA 1DVFC 1N0XH 4PJ7F 4LOUD 3CIQA 5EO9B 1WBYA 1NCAH 2P5WE 3BEVA 1KCLA 4MCYA 3AS3A 5EU7C 4XNMA 1OF2B 1X5IA 4G42B 2PR4L 2AABL 2YK1L 4R26H 3WJLC 2X1PA 2FEEI 1XF3B 3SDCD 4JZOA 2E9WA 5J4MA 2F53A 1JI2A 1NEZA 4MDIB 3X3FL 5B22A 4M6OL 5JDSB 2Y06H 3ORJA 1HHIB 4NZTH 4TSBH 3LEYL 1GH7A 4UTBH 5HHQA 3TZVB 5EOQH 1H3XA 2BNRE 1YUHA 3VWJA 1P4IL 5GJTL 5C6WH 1NC4D 3MRDB 4M7KL 3SQBA 5AG8A 3LD8B 4E41B 3CZFA 1NFDA 1OTUD 5EO0A 4XVSL 4EIZC 1OAXL 1ED3A 4Z7UB 1FNSH 1KTDB 5EOTB 4PREB 4IOSD 1TQBB 4D2NA 1NGXA 4NIKB 4Y89A 4N0YH 3CC5B 3ILPB 1SQ2N 5CS7A 2NY6B 5C0JB 1UZ6F 5E9DB 4POUB 5KANI 3ZYIA 5GGRA 1QTYT 3C6SA 3GSXB 2ZPKL 4ODTL 2Z92B 4BFEA 3KPOB 4JFXB 2NY0C 2VDPL 1HSBA 2OL3A 4OM1H 2AJXL 4JPKH 4PJ5D 3BMVA 2B5IC 1U8KA 2Z8VC 3UJIL 3DI3B 4JGMA 1EJOL 4U33A 2A38A 2IF7A 2WBJB 4UV4H 3MRHA 4ERSL 2IGFL 5I1IH 1PEZA 4QRUA 3W0WD 4QRPA 3FOMB 1AP2B 3U6RB 4HUWB 4X6DA 3M1BB 2P43B 1BX2B 3TGXA 3NCYP 4RWHA 2VR4A 3C6LA 1UJ3A 3AXLA 4PJHB 5EBLA 1ZT4B 2VC2H 3FONA 4MSWA 1DQTA 4JFZH 5IVZA 3O3EB 1LO5A 1A3RL 3OAZK 5J57B 4TN9A 5E99L 3DO7B 4LCYA 1QFWL 1ZSDB 4POZC 4JFFD 2P8PB 1UEMA 4QXTB 4LSSL 2E7BA 5DJ6A 1RMFH 1ZHBA 2VWEC 1DQLL 5D2NB 4I5BA 1NQBA 4LCWD 2XWJB 2IG2L 4QWWD 4NRYA 4QNPF 1T80A 4NN6B 3ZTNH 1OM3H 3IYLW 3RI5K 4MXQD 5KSBF 1I8KB 4Z18A 1SBSH 4EXPX 3OF6A 2WNGA 5K59F 2R1WB 5KG9B 1MCEA 3FQRA 4MJ6B 5FYJD 4BUGA 5C70A 2C1PA 5FV1L 4F9PC 4M1DH 2YD9A 1MFCH 1KYOK 2NY3C 2PW1A 3BEWB 3ZHLA 3UTQB 4GG6B 5EG6C 2L7JA 5JMOC 4HS8L 4BZ2H 1A7RL 1MI5D 1TVHA 3N9GH 2I26N 1X5ZA 5EUOB 3QXAB 2VLRE 5DD5H 2PW2B 4HW6A 1UKTA 4Q0XH 3BUTA 2AVGA 3K2UH 3RAJL 2BJMH 4XZUA 2FB4H 3FN9A 4BSVB 4UT6H 4HJGA 1HCVA 1ZLVK 4XCEB 5DJCA 1AI1H 1YDPA 4NQVB 1MFDL 2BNQD 3HC3H 5EIIA 1WC7B 5KS9B 1JZ8A 1AO7D 2VXVL 3SGJC 3V4VL 3LAFA 4KAQH 5FKPB 3RWHB 2GKIA 4UBDD 2CMRH 5E8EB 4CL7A 5JXEC 4NSKB 3NFSL 3U2SA 3BMWA 4CMMA 3RWJA 4NO0B 3HUJA 3EYVA 4LARH 2HRPL 5D71L 4XX1E 3BUYB 4ODHH 5F1IB 1BREA 1V7MH 3VH8B 4NUGH 4P4KB 1G7MB 1CDYA 4HWZB 1FH5L 4PRHA 1YA5A 2EDJA 3LEXA 4H25B 4K3EH 1WVZA 4Z9KB 1C5CH 3HCVA 3BDYL 4X99B 1W8OA 1C5BH 1CDCA 2FH6A 4HIIA 3RX5A 2QADB 3HMXA 5HVHB 1FFNA 4LMQE 4LKXB 2SEBA 4MA3A 4KQ4H 3CVHL 3O9WD 4KQ3H 5T3XL 1MIEH 3DXAD 2GCYA 4R0LB 1I9JH 4GKZB 4OZGE 1QBLL 1XH3B 1KCSL 4V1DE 5IHUL 4JFDD 1T21A 3VFVB 1MCPH 1KB5A 4MXWL 2BOBB 3QDJA 4DZBB 3I3EA 3MRNB 3WUWB 4F58H 4OI7A 4IOIA 3TV3L 2XTJD 4WFHE 4OFDA 4AH2A 3W82A 2WINA 1MVFA 3WFZA 5L2KB 5DJZB 3WD5L 4J6RL 1GZQB 3QAZB 1MY5A 4MA8L 1LO0H 5E5RB 3S36L 1DVFB 4G7VL 5IEKB 5LWYL 4XCNB 1I1YA 4JHBA 3S4SB 4L4VD 5ESQB 4LPUA 2OZ4H 4G8FA 2BSRA 2FBJL 2XN9A 2NY2C 5A3IC 4DFIA 2EH8L 3MUGA 4J12A 3PNWB 3FB8B 3Q5TA 3REVA 5DEFB 5GRXG 2ZOKB 4LNRB 3WS3A 1QRND 1MNUL 4KRNA 3WFBH 3VXQA 1AC0A 4Q74A 5E00A 1NKRA 2GSGA 1FZJA 3JVGA 1JWSA 1S3KH 4Y19B 4UI2A 2G5BB 4X5LA 4NP4L 4ZFOA 4XWGH 1LO3L 4Q2ZB 1X7QA 1U93A 1YEIH 1RK1B 5FOJA 3DVNA 4LEXL 5FGCB 5HHXH 5C09B 1WWCA 3MXWL 3MA9H 2YD7A 1U95B 4ZD3L 3RTQC 1P4BH 4O58L 3BPCA 4RA0C 2A6JB 3GKWL 1DQQA 4ODXA 2W91A 3W11C 1D5MB 4HMCA 2NY0B 2O61B 4FP8H 5DUBA 4FQHB 3MGTA 4OGAD 1HHKA 3I85A 1KF9B 3EFFB 2Y5TB 2DLEA 4FFYH 1AD0B 2F5BH 5I30H 4ISVB 4FTVA 3PE9A 4NJ9H 2FJGB 4N0UB 3RWDA 1ACZA 1F45A 5C2UB 3CXHJ 1LNUA 3MRGA 3TCLA 5GS0C 1QR1A 3BW9B 3MRJA 5EO1A 3TIDB 1UENA 1L0XA 3FZUD 3JTSA 1VGKB 3X3GL 3C5ZD 2BHZA 1GC1H 2LV4A 3HZYB 4HKBB 1FO0B 2XTJC 3HB3D 4YXHH 4FNLL 3BXNA 4RMWA 1S9YB 1FL5A 3LSOA 3PWPE 5E6ZA 3SKUD 4F7EB 5J1SC 3ZO0A 1VSCA 5IGXH 5DVKA 2NLJA 2CJUL 2FHBA 4HGWB 2APBA 4HF5L 5DRNA 1NAKH 1F6LL 1RULH 1G7IA 3T2PA 5D7SH 5JOPE 1MF2L 1YEEH 3AM8C 5DA0B 4Y7MA 3SDCB 5I15H 5C0CA 2IPUK 2CO6B 4LIQH 2P44B 1ACYL 4KK6D 3VCLB 4Z5RB 2B39A 3UTZB 3QXDB 2CLVB 4JO2L 2NPLX 1OY3B 5D7IE 2R2BA 3MBEC 4E0RB 2VXTH 1ZK9A 4H5SB 1T0NA 2VR9A 5HHPA 3IT8D 3DOSA 5KN5B 3P40A 3T0VA 5K9JH 1UA6L 5DJDA 5E2UL 3IFNH 3BKYH 5L88L 3DARA 3IVKB 5JUEL 5K9OA 1TDQA 1WCBB 1RY7B 3G5VA 2EO1A 1XF2B 3AAZB 1W0VA 3E8UL 4N5EC 3WLBB 2Z35A 1EHLL 4AM0A 1LD9A 2Q8BL 5DUML 2VQTA 5HYIA 3TJEH 1NEUA 1XF5A 3KPMB 3QFDB 3SBWC 2CDFB 3M17A 4OGAC 3QG7H 5I1KL 1A4JB 3DRQB 4YDVA 4RBPK 1T7ZA 1EFXB 5F1KC 5CFHA 4O2FB 1S8DB 1QKZL 1OGAD 1ONQB 3EO1A 4NN5B 2A9MH 1S7XA 4JFQB 1T4KA 3D3VA 4R4ND 3W0WB 4I0PA 2AJ3A 2ESVE 3F6LA 2DAVA 3LKPB 3WEXA 1UB6B 3N1GC 4PRPE 4G8IB 1Q9OA 3IJYB 5D9SA 3KPNA 3I50H 5CKGA 4DN3L 4MA7L 4PJIE 2BVPA 5SX5K 4PS4L 4M8QA 1R3KB 1OAQL 4JFFB 1U8LA 1ZVHA 1A6AA 3GDBA 3NA9L 4LQFL 5E2TH 5IB4A 4K7PH 2Z31A 2EKJA 3RNQA 4KK5C 3VMPA 1P7QB 4CMHC 4M3KB 3QHTC 4HLJA 3PWUB 4LCWB 5J8OA 1JZ3A 4GQ9L 5IOPB 3H0TA 4IHOB 4HG4J 1QVOA 1CVSC 4MDJB 5JIHA 4KK6C 2ILLA 3BD5A 2K7PA 5LKNA 3BKML 2GJZB 1NLDL 3ULSA 3U48A 4ALAL 1OWWA 2FL5B 5JA8B 4J3OC 5FO9B 1S7TB 2A0LD 1M6OA 3QBTB 4JFPB 2FRGP 2KH2B 4V2BA 4YUEH 3L5WB 4X7CC 3QDGA 1NL0L 3CDGB 4YHIA 4ETQB 2KQMA 3HR5B 1IGIH 3G6JF 5KJRL 1G9MH 3LV3B 1SHMA 1ZLUK 2VN4A 5L7XL 1FBIH 1OLLA 3DX6A 1L9NA 5HGBB 2C3XA 5EUKB 4FQPA 3JWDC 1KLGB 2BNQB 1F4HA 1H3PH 1E4JA 2QJDA 2H26A 1CK0H 4IDJL 5JO5B 3A6CL 4CAGA 1IKFH 2RJMA 4FZEH 1S7QA 5HYSB 4OLZL 4ZO9A 4QXWA 4GXUM 4MWFB 4MMXC 1OSZB 4LLQB 1MCNA 1YEGH 5EZIH 1XCTA 2ZWLT 4ONHA 4NNPH 4BELD 1HH6B 4ELKA 3F5WB 2RIKA 2QEJA 3QIWA 4YFDB 4OF6A 3P9WB 1LK3H 4YFLF 2GW5A 4S1QH 1MWAA 3WFHA 5A1AA 4KKBC 4GRLA 3CSGA 4QEGA 3I2CL 2VH5L 5AZ2L 3BGMA 3FQXA 2Z8RA 5LCVL 5DSCB 2DYPA 2HG5B 2R4RL 3RGVC 4HK0A 2R9HC 2VDNL 5KSBB 2RCSH 4YHMH 1J8HE 4ZTOL 5IJKC 2X4OA 5CIPH 3O9WB 3BYYA 4LASH 3DXAB 2NY5H 4MQTB 4NPYB 3OB0K 1CLZL 1G7PA 1FHGA 5BZWB 4EQ3A 2AV7A 1N4XH 1OL0A 1DUYA 3CVHA 5DJ0A 4LP5A 4ZUVB 2AJVH 1JFQL 3KYOA 4JFDB 1Q72L 2VZOA 1CT8A 2B2XL 1BQUA 1BZQK 4Y2DA 3B83A 1FNLA 1IM9A 4XCFH 1PG7W 5I66A 1NJ9B 3GMNA 4NZJA 2YZ8A 4PG9B 4RIRB 1ZS8B 1KLUB 3MV7E 5EZJB 3BQUC 4LGRB 2A0LC 1IM3B 2XTJB 4S1DD 1NCDL 1RZIB 2FGWH 4HCRH 5IKCB 2C5DC 2VZTA 3BGAA 2BHUA 4UDTB 4M1CD 2ZCKH 4KDTC 3MJ7B 4HUMB 5DRWA 3T0DA 1F6AB 1QSFD 3NPSC 3F7QA 4KMTH 3VXMD 2XG5A 1HZHL 4UT9L 4L4VB 3VGAB 1ZWIA 3TF7C 5IJVA 4NT6B 1S9WB 3P30L 2UZIL 3NFNB 1WBZA 4LPWA 1WBXA 3RWGA 2NY1D 1AC6A 3CFJB 4XP4H 4XRCA 4M7LL 1FO0L 5DD6A 1QRNB 4OIIL 4I18C 1P2CB 2R56H 3R8BB 1QUNA 3MBEB 2O5YL 3CFDA 4OZGF 5E2VL 4X7TB 1D6EB 1ZGLA 1B2WL 5JHDD 1U8HB 2E27L 4OZHE 4GW5B 5BOZG 2BP3A 2LFGA 2GT9A 5TQ0H 1F4XL 1EHNA 2DQTH 3CH8A 3BP6A 3QUMB 2VLRD 4LSQL 3RQ3A 4LVHC 1N5YH 1F3JA 1LO4H 4OSUH 4XXDB 2H2SD 1ODAA 1VFAB 5B21A 1IAII 5DC0A 5K9QI 4OLUH 5DR5H 1MREH 5HPOA 4ODVL 4PJ9D 4PUBL 4OT1L 1KJ2B 3MLYL 5CGYC 1TJGH 5JDSA 4PGZA 4FQIL 2AERT 3ARDA 3FQWB 3OHXB 3NIGE 4K3HA 1X5LA 1JPFA 3MACH 3VXSD 2JB5H 4KY1H 1KN4H 2XY1A 2V2TA 3MNWB 5I8KL 1FN4B 2YPKB 3EYFB 1HHHB 2BMKA 1LE9A 3C5ZB 3RUGA 5DMYA 2VDOL 4KMLB 5IIEA 4KKAD 6FABL 1JGEB 2OJEB 2VLKB 3BIAX 3CFEB 3JWOC 3MUZ1 2Z92A 12E8L 2VYRE 5DI8B 3TBVB 1BJMA 3QA3A 3VXNB 3QDMB 1A22B 3L3OB 1NC2D 4PJ8C 3F12B 3BJLA 3SCMD 4GRMB 1RFDH 5E0QA 1IAIH 1NFKA 5I9QC 4ZPVB 4XCCH 4QTHB 4FRWA 1S5IH 5EIQA 2CRMA 4OCWL 1A64A 2ICWA 1G9EA 2WBJA 4BFBD 2DWEB 3V6BR 4YHKH 5DJAB 4NUJA 3C60D 4HXAH 3HFMH 4P0DA 1U8IA 4R8WL 4IRJD 4JRYE 4IRZH 4F9LC 2V5YA 3CFKB 1U42A 5JNYB 3KPRA 3EIFA 1T20A 5C0RL 3MLZH 4PJHA 4K94C 3L95A 3QIUD 4L8SC 3O3EA 3DETC 4WV1C 3GIVA 3WNPA 2O26U 4O4YH 3VGBA 2CKBH 5DYOB 4BKLA 2W1NA 3KYAA 3L3JA 2KDGA 3QQ9D 5D2NA 1WIPA 2XWJA 3GIZH 3UC0L 4XX1G 5DLMH 1MFEL 4YK4C 5BO1H 5HDLA 4GW1A 5F8QC 1HN1A 3WFCL 5J13C 5FYJL 2E9IA 5JHLH 3OXSA 4PRNB 3QCVH 4WWKA 2V9RA 4MJ6A 5KVEH 4PJAE 4X4MA 5EBGA 4KRPD 5D1ZC 4L1HA 4XHQA 3RU8H 1IEBA 1PG7X 4HKXB 1MJ8H 4GUPA 4I48B 1I3VA 5KSAC 3UBXI 5ID0B 1X5HA 3W81A 1T04A 5FUOL 4WFGE 2ZSVA 1DP0A 4XT1C 3D39A 1CBVL 4GAGL 1CE1H 3G6AA 1BAFL 3SPVB 2ADJB 1CFNB 4BSVA 1X3DA 5IB5A 4LPVA 3MRPA 2DQDH 2Q7YB 4X9BA 2IPKB 3TWCL 3HAEG 4OCRL 1RD6A 5F1SA 1CFVL 1FAIH 4HKZA 4YBLB 1KPUB 4LIQE 4GG8A 2EC8A 4HSQA 1A6UH 3BPOC 3C9NA 5SX4I 3H2WA 3STZB 3VI4E 5I19H 1HOCA 3DGCR 1OVZA 4HUUA 2RFXB 1YEDB 2YBRB 3QCTH 4MD0B 4ZFZB 5DRXB 5I1HL 1IGYA 1PSKL 1RPQA 1U8PB 5EFIB 2N1KA 5DD0H 4ZUUB 1TFHA 4YC2C 1WWBX 5CP3A 2Y9RT 5GQBA 5L8LB 4HEME 1AR1D 2R1XA 3MSPA 4N8PA 4JB9L 4U1JB 3B8YA 1OOAA 1QHOA 3C5JA 4LLDB 1EEZB 3PWPD 4K9EH 5FM8A 4X99A 5LQBH 3RZCD 1GGBH 2EYSB 1A7QH 4NFBA 3O4OB 2HKHL 4Y16C 1JF1A 1NSNH 4A6YB 3RHWK 1NBZA 1T2XA 4C4KO 1G7QA 5JOPD 2ZUTA 1IC4H 3VFVA 5GS0L 2R2EA 3QUYD 3C87A 1FPTH 5HXMA 5EN2A 5AD0B 5I73C 5SX4H 4P3DA 2HWZL 4P9ML 1XGTB 3KXFE 5ISZA 3GMMA 1I1AD 2K1MA 5HVWA 1F90H 5LGHH 5KTEH 1PX4A 4XCYA 1XF4B 2YPVL 1HKLL 2BNRB 2F74A 4OF8A 1AQDA 5DJZA 3FT2A 4MS8D 1GZQA 4CADB 2OJZH 1KFAL 4LAQH 1Q9KB 3MRCA 3W9EB 3CX2A 1IJ9A 5IWLA 1AR2A 4IMKA 5BXFB 2X7LB 3BP4A 3IFOA 2OTUB 1NBYB 1BIIA 5DJ2B 3GM0A 5IP4A 2WAHA 4UUJB 1B9ZA 5HPMB 2ZOKA 2B4CC 1RZJH 1F00I 3FTGA 2G60H 2YD1A 2G75A 3CAFA 3NAAL 2GUOB 4QY8A 4X5WA 2RGSA 3MV11 5T1DH 2OL3H 1AHWC 1FL3A 1FFOB 1KIQA 3QUML 3T0ED 4X8JA 1JPGA 3QO1B 1AGCA 2Q6WB 5DJYB 3WNOA 3TEUA 4F7CB 4PRPD 1U95A 5GSVA 1HI6A 1QSED 4UTAH 3G6JB 1PAMA 4GO6B 2NQCA 1KJ2L 2FECL 3ZYOA 1FGVL 2IQAA 4YFEA 3HC4H 3QEHA 2YUXA 5IFAH 3ARBC 1HQ4A 1QSFB 2CLRA 2WIMA 3LZFH 3D9AL 3VXMB 4KMQA 5I9QB 5JW5A 4ELMF 3RBGA 5CCKL 1CGSH 2QL1A 2AJSH 3LN5A 4OD3L 3CXDH 1EV2E 5E6IA 3BO8B 2NY1B 4IRSC 3JXAA 3T2NH 4P5TA 2L4OA 1DFBL 3WFEH 1I9RH 3OX8A 3BW9A 2P7TA 2BVQA 4HFWA 1ITBB 3EYOB 3K1KC 2FD6L 3ARVA 5ADPL 3G6DL 5INDB 4M7JH 5D8JH 3VXPB 2ZNXA 1S9YA 4EDXA 4A2MA 3SOBH 3TPUA 3GSUB 5JHDB 4FXGA 1H3WM 4WI7A 1UVQB 3QWQB 3GBNL 4WV1B 4K3DH 1MQKL 3RL2A 4M5ZL 4ZXBA 1PZ5A 3WLWD 2VLRB 5E5MA 3LRSB 4NNXB 3RWFB 4Z95H 3B2UD 1RUMH 1OLZA 2AEWA 2IANE 2P8LB 2N7BA 2UZYB 2UUDH 3ZE0E 2O93L 1MCHA 4PJ9B 1F58H 1W0WB 4PGEB 4AZ8A 4WIQA 5SV3A 3PUCA 2COQA 1F11A 3OJMB 4MLIA 5SWZE 1Y18B 4RWYH 1A9BA 1C16B 4XBPA 4G6MH 5J9PB 4D0DA 3AS2A 2KUTA 3VXSB 1NC4A 2QQKL 3WS6C 1II4E 2XACC 4XNQB 3QPQC 5KSAB 2NXZC 3W9DB 1A1NA 3BPNC 2BC4B 1UWXH 3LS5H 3VD3A 2D03L 4ODSL 1P6AB 5EBMA 4AG4L 3SKOA 3MV8D 5F7KC 1XGUB 3I02A 3VFGL 1GPOH 3JWDL 1LO2H 2FR4B 5FUCE 3A6BH 3QFDA 2P4AB 1NC2B 2CDFA 1AGFB 4PJ5A 3SCMB 4RGNE 4P5KA 2FNBA 4EI5D 3MBXH 1J8HD 1ZANH 1R3LB 4N8CH 4O2FA 1S8DA 1UYWH 3HRPA 3IXAB 2OXGA 5F93C 5J6HB 4OZGB 3HMXH 3C60B 2I60H 4V1DB 3U0TB 4IRJB 1IQWH 3D18A 1UWEH 3JV5A 4ZOAA 1TVBA 4ZODA 3EUUA 2FSEB 4I77H 4QOKA 3ARWA 3G9AB 4XNUH 1PKQE 4PJ7A 3BN9C 3TIEA 3QIUB 4P4RB 1KB5H 3IJYA 1FQ9C 2IAMD 3BX7C 3NIGF 3MV7D 4LPTA 5EU4B 4AT6B 2ERJB 1CF8L 1ZA6B 4PB9L 5E08L 4OFKA 1R3KA 5D7JD 4OZFG 1FAKT 5K9KB 4H0GA 2AW2A 3CX5K 4MQ7A 2WUCL 3EFDL 5BRZA 3DVIA 4QXGL 2BY0A 3B2UC 2ADGB 3VXRE 3I75B 3EDJA 1NCUA 3PWUA 4Q97A 1NUNB 3F7PC 5TFSL 3O45B 3SGEI 3LQAL 1SJVA 4L3AA 3CGTA 4GS7C 4P2OD 1EBAA 5C0ND 4ZSOA 2ORBL 4JGUA 1N6QL 1D9KD 5DMKA 4NYLA 4Y5VC 1WGOA 4XPHL 5DVOA 3L3GB 1R6VA 4KRPB 3K7UA 1HINH 5MEQA 2HTKC 5DO2C 3ZKNC 5GSRB 2DKSA 1MI5A 4YXKH 4QT5B 4A6YL 3G04B 5CSBA 3OJ2C 4PR5B 2J8UE 5LBSH 1QRKA 1C8PA 1B90A 3L3HA 2WM0A 1JNNL 2YUVA 3VRIA 3CDCA 2DQJH 5E95B 2J6EA 5IBTH 5E5UB 3LV3A 3QFJD 3OMZA 4I3SH 2BNUB 4EDWL 5C92A 1BWMA 3MRBA 1PY9A 3QNZB 4EI5C 1A2YB 3HZVB 4ZUWB 1ZXQA 1AO7A 2P5EE 3BZEB 3CSBA 4G5ZL 3SGEH 2R69H 3ARPA 5HYSA 3T4YB 4JY6A 3CLFH 1FZMB 2VIRA 3MLVL 4B7LA 1OSZA 3O6FD 3FMGH 4LLQA 1A7PL 1AHWB 4GBXD 3MTRA 4JQIH 5IB3B 4XXCA 3HE6D 4YJZL 1UM6L 1BVZA 1J12A 1TJHH 4U0QB 2IAMC 3IJSB 4Z0XB 3NZ8B 4PJAF 5IW3A 4LSRL 4LBEB 2DWDA 4LEOB 2V7NB 5CILH 5HHNA 4XNXL 4LF3A 1X5XA 3PWPB 5F6HI 4M1GH 4NWTH 1VFUA 1U92B 4D9QD 3O6ML 4B5EA 3RVUD 3RZCB 5I71C 2P8MB 2FIKB 3MLXH 43CAB 3O9WA 1EXUA 3ARBB 4NPYA 4PB0L 3K81A 4JN2B 1JZ7A 2XA8L 3DGGB 1VESA 5AAWA 3QUYB 3OZ9L 4L8DA 3VFMA 3MFGB 4XGZA 4L5FH 3ULUH 3ZYJA 4IRSB 2YRPA 4OTXH 1D5XB 3JWNC 3EDDA 1SEQL 2BY1A 3NN8A 3OKKB 4MD4B 3TBTB 5BZDB 2RBLA 1TCRA 1JRHI 1IM3A 3JWOL 4NKDB 1D7FA 5CJQH 3GI8L 4DJMA 5E1AB 1AE6L 3HI5L 1FG2B 2A77H 5HI3C 3DV6B 5HGHB 3K1DA 2ZUYA 3MFFA 3R8QA 2MPAH 1CG9B 4L4VA 4JJHA 4IM8A 1ZLSL 5HDQL 3QXWA 4JM2F 5EA0L 5C07A 4YAQB 4Z76A 1G0YR 4C56E 3RY6C 4ZFFA 2Y23A 4FQXD 3NGBC 4K94L 5ESVB 2YEZB 2D7TH 1L7IH 2I24N 3FO2B 4XTRD 4LCIH 2X4UB 4W6WB 4P2QA 1GGYA 1J0KA 4Y4HD 3KPSA 2XZZA 5JQ6H 5TPWL 3T0EB 1NLBL 1N2RB 2Y7QB 4XP5H 2NXZB 4YBHA 1R3IL 4XMLH 2VB5A 1SMAA 5TH2B 4PTUB 4K7PX 4MAUH 1P4LB 4PRPB 4Z7WE 1QSEB 3PV6A 4G3YH 4XXDA 2VISB 5IR1A 1VFMA 3DPBA 1E4WH 1YYMH 3PABB 4MJIA 4C58B 1H3TA 2X4SA 4RMTA 3DMMC 3O6KL 3QULB 3RVUC 1WZKA 3LIZL 1KBGL 4H88L 2CDEB 1B4JL 2IPTH 4EKXA 4FFVD 3GM8A 4Q9RL 3FQWA 3QPXL 1GGCH 2HJFA 4AMKH 2M1KA 1OAYL 3OJVC 4Q6IA 2NW3A 3RVXD 1A47A 2XFXB 1HDMB 1JHKL 3MNWA 5D6CB 4YBQD 5T1MA 2F53E 3GSOB 4DCQB 3BN3B 5JPMB 4BQCA 5HYQB 5GGSY 1MCBA 4HS6A 3AC0A 3D48R 5T5FH 2DM7A 5CEYA 4JVPA 4JM2D 2NNAA 1BOGB 1BFVL 1N0LA 1NFDE 4U1IA 2DOCA 1INQB 2MFNA 4TRPH 4ZFGH 1TQCC 3LKOA 4KHXH 4HWEL 4FFWD 1KTLB 4P9HL 2X89A 3L3KB 4YWGL 4OLVL 3RIFF 2GTZB 1ZLWK 2ZUQC 2CDGB 3AB0C 4K71B 2IALA 2X09A 2PXYA 2X70B 4IBLT 3QWOA 2HFTA 5DJXB 4OAWA 1GIGH 1NCBL 1T7VA 5DVLA 5FYJU 4D0BB 3STBA 4KKCC 3O8XC 5ACLA 2XKUA 1T0MB 2FO4B 3F58H 3N1QC 4XAWL 3KXFD 1S78C 4TOYH 5D2LF 2X05A 2JJSA 1RJLA 5HI5D 5EU5A 4OKVA 3P4NA 4X6DE 4QHNA 2P47B 4YEFA 2Z91B 2NYYC 4TTGA 4Z77A 2HVKA 1RUQL 4LSUL 1TIUA 5B39A 4U0RC 1CD1A 5CP7A 3Q5OA 2A6IB 4I0CC 3MV8B 2AEQL 5FKAA 1P9MC 3BJ91 2IMNA 2YKLH 5I1GH 3SO3C 1KCRL 1DBAH 3O2VH 1QFOA 1JJUA 1OTTC 4X4XB 1MWAH 3ARGD 2EDFA 5A2KH 3WIHL 2MQCA 1YY8B 4PRNA 4EI5B 1E4KC 4N0FB 1J8HB 4KVCL 1OGAA 1DBMH 4YBQC 1FNEA 3VFSB 3ZE0F 1OAUL 4NHUB 2FBOJ 3MJ9A 4DGYH 5C7XL 1TNMA 3DRTB 4H1LA 4NKOB 4JM4L 5DDHA 3NCYS 5F6HJ 4HMEA 3EJJX 1KENL 1TXKA 4OZ4B 4WU5B 2IAMB 4X0KA 3BGFB 3MV7B 1ZT7A 2CIIA 1CFNA 4RAVB 3I6KB 5D7JB 4D9LH 4G6KH 1F4WH 4O2CA 3DURB 2QSCH 4YPJA 2AXJA 4RCAA 1CFSB 1YNLH 5DXWA 2X1OA 1R3JA 1KPUA 4HGKC 2HKFL 3NFPA 3CH1B 1Z5LB 4PLNC 2EECA 3F62A 1EEYB 3VDCA 1BZ9B 4JLRA 2FX7L 4MD0A 4P2OB 1MHPH 4OCLC 2FYYB 3VFTA 4LSTL 4IIQC 1U8PA 3QI9A 3SDXF 1T22A 1D9KB 2X9YA 5D1QC 1U8JB 2O5XH 1KELL 1BMGA 1NUDA 4JO4H 1T6VN 1RAMA 4U1KB 15C8H 3WO4C 5DURB 3AS1A 4JPWH 3MRMA 5I8CB 1TVDA 3CXHK 1EO8H 5JIKA 3F7VB 3HUJE 5TF1L 4PV9A 4OZIA 1B6DA 3MROA 2X4QB 4OI8A 4Q9QL 1RZ8A 1Q9WA 2FHCA 3V0VB 1CLYH 2EIZA 3GRWA 5I8EB 2R0WL 5ACZB 2DI8A 4AEFA 1YNTA 3MOBL 4PD4J 3KG5A 5EB9A 3KHOA 2DI9A 5LJYH 2IAND 4MNHB 5AD0A 5C6TL 1OARL 3ARGC 3GBML 4Y8DC 3GHBL 2J4WH 3A67L 3NGBB 3ESVF 1K8IA 4CU7A 3RVVC 2GAZB 4LDEB 3ZHDA 2XKNB 4YNYB 5IT2L 1PG7L 2ICWI 2X44D 4XC1H 2R0KH 4OLWL 4GBXB 2ICEB 3QDJE 2C7UB 2AXGB 1JGVL 2JJUA 3HE6B 2OYPA 5F9WC 1I4FA 3WO3B 2VLME 4RZCB 4TPRH 4FG6D 3SJVA 3G5ZB 1MCOH 1JNLL 4JRWA 4TNWF 1IQDB 1N5AB 4IMLA 1GGIH 1T6WA 1JPSL 1U3HD 5I1EH 1L6ZA 2G9HB 3FQTB 3DV4B 4GOSA 1G9MC 3OAZH 5MI0C 2Q76B 5E24E 3WL9B 3DIFB 2JIXA 4CN4A 1IZJA 1M7IA 5D93C 4M61A 5A40E 4GKOA 4RGND 2PO6A 3QEUB 2WWKO 4M8VA 2EEBA 4WHTB 2GUOA 2ADIB 1CLCA 1ADQA 2XN9E 1HILB 5I18H 3FT4A 4OI9A 4XP1L 4JZNB 4YXLL 4LKCA 1IGML 3ARTA 2R23A 3MA7A 3MJ8B 4KWUA 1CTNA 1N0XL 5LAXA 3U9UB 5ITFA 3FN0H 3BPLB 1QFUH 4R26L 3SN6N 1XT5A 3ULVE 2A73B 3EYQC 5FK9B 2Y06L 1KG0A 4NZTL 1BOYA 4TSBL 1RZKC 4LPYA 1U0QA 4UTBL 3P9LB 5FM5M 2IH1B 2ZUQB 4PG2C 5BCAA 3AB0B 3BO8A 1R0AH 1OD7A 4GAJH 5MEOB 2W65B 4FQXB 4OB5H 4JFEE 5IG7B 4UAOB 2PKDA 4L3CB 1SEBB 1ZLVH 1FNSL 4N90D 1F6FB 1S7WB 3VXPA 1KJ3H 5ICXB 4KFZC 4G7YH 3H3PH 4N0YL 4PJAB 4HG4K 4WO4C 4OCNC 2B1AH 2PYFB 2BOCA 3U30B 2XZAH 1U6AH 3SE9H 4RFNC 8FABB 3ZL4H 1WT5A 1I8LA 1UJTA 1J10A 1V7NH 4OM1L 4JPKL 3S96B 1EZVX 1UH2A 1JPTH 2FEEL 4HIXH 2ZKHH 1BQLH 5EU3A 4K7FB 3CVIH 5I1IL 2D7OA 3D0VB 5T33H 3P0GB 4R9HA 3GB7A 5FUCC 4BSWB 3TH3T 1MHHA 1JYNA 4YQXH 4YZFF 1JMXA 35C8H 4N5UA 1HNGA 3AS0A 3ULUE 3WDIA 1HQRB 4YDKL 3D5OF 2P5ED 1UC6A 3HC0A 1MFBH 2OR9H 3VXSA 4RRPG 2VC2L 2EE3A 2J8OA 1RUAH 4KTYA 4JFZL 2YHGA 3EZJB 5C0CE 3STLB 3L9RA 3MLTB 4HIHB 4LRNH 2E9JA 2HJLB 1T1YB 2WP3T 1JL8A 3OXRB 1XIWD 1RK0A 3LKQA 5I8OH 5IW6B 2YRLA 1EA9C 1RMFL 4ORZC 4P3CH 2LAAA 4EIGB 3FOLB 5GRVK 1IGTA 1URLA 1BD2D 4JM2B 1CXLA 2IFFH 1TJIH 5F1NA 3ZTNL 5CP3H 3L3DB 1OM3L 3TH4T 3P77A 1NC2A 5IV2A 2E7LA 5IHLB 1OHQA 5E8OA 1QSVA 4KUZH 4Y5XC 1WISA 3QH3B 4Z7WF 3OKEA 1MFCL 2BSTA 2VL4A 2PTVA 4J1UA 5I76A 1HHGA 5DK2B 2OSLB 3E6FB 1TZHB 1LEIB 1I7UB 4BZ2L 4IIQB 4MNQA 1KCVH 1OTSD 3N9GL 3D69A 3V4UH 5F96H 5IMKB 3KYMB 3IFPA 3VXTB 5DD5L 3JZ7A 5EH1A 3TA3C 3QUZC 3QIUA 4Q0XL 2E9BA 3KXFB 3K2UL 3C5SB 5DC4B 2Z4QB 3WO4B 4WJ5B 1ZA6A 2BJML 5KW9H 2FB4L 1CWVA 3D3VE 5HHVH 1CICC 1MRCH 1MLBA 4QKXB 2HRLA 4UT6L 3LB6D 4CNIB 3QUKA 5CMAB 1X5AA 5CEZH 4X6EB 1J0ZA 1AI1L 1A02N 2BVEA 3HC3L 1Q9LA 5ALCH 1RIVH 1I85C 3TO4C 4G9FD 4KAQL 1MJUH 2CMRL 3ARUA 1EAJA 4JPIB 2EEDA 3NZHH 3L5XH 3QNYB 2WIIA 1NFDF 1TITA 1X6LA 2WMPA 3ARGB 4LARL 3WNKA 2YSSA 3CDFA 3EDKA 4C56D 2ICWJ 4ODHL 1V7ML 3VG9B 3DBXA 1X4ZA 5GRUH 3HRZA 4I4WB 3VFOA 2HAZA 1KYOJ 1QFHA 5D6DA 4KGLA 1C5CL 3IJHA 1C5BL 3SDYH 1E4XH 4HKJA 5CWSB 4Q9CA 3U46B 4D94A 1QG3A 4KQ4L 4KQ3L 1P7HL 1MIEL 4FHBD 1ZVSA 4O2EB 1I9JL 2X4PB 1R5IB 2IH3A 3DNKA 4HMDA 1HIMH 1H15B 1MCPL 4PJFA 4W68A 3ARXA 4NC2B 2V9QA 3T04D 4X6DF 4F58L 1PD6A 5D2LB 3RDTC 4X83A 1SY6A 4HZLB 1OTSC 2F53D 1NCCH 4R3SA 4MGXA 1LO0L 3IJSA 3ARFC 1Q94A 2Z8WC 4PJCA 2OZ4L 3D25B 3VWJD 3LB6C 3RIFK 3WIHA 3MRRA 3SKJH 4U6TA 3FO0H 5ERWB 1JNHA 1JWMB 5IM7B 4U49A 4NDMB 3UBXG 4QHUA 3WFBL 4JKWA 4X9HA 5CIPB 2E5EA 2IANB 2V7HB 1IZKA 1MCSA 2EXWC 3KYKH 1S3KL 5EC2A 3O4LD 3C8DA 2Z93B 4LHJB 4XWGL 4UQ3B 5FAAA 3QHFH 4ZMAT 5IBLD 2DQFA 2OTWA 1YEIL 4PGDA 4UINH 1BF8A 3DROB 4PLKC 2W9EH 1I1AA 5SWZB 5HHXL 2VKWA 4HV8B 1YN7A 5HGGS 3V6FA 1FZKB 4RBPH 3MA9L 1ZHLB 3BT2H 4P2YA 5T3XE 7FABH 4WO4B 1CQKA 1FG2A 5JW4M 3U83A 5K93A 3WE6A 3VFNB 3WNLA 4RFNB 3UTTA 4U7MA 5HGHA 1X5YA 1T83A 4QRPD 5TGBA 3P4LA 4K9EC 3H42H 1IBGH 1K2DA 4K8RH 4FP8L 5BOPA 2F58H 3SDDC 3TN0C 1D5BA 1NEZG 3C6LD 2BZDA 4YAQA 1INEL 4FFYL 1U2CA 3IKCB 2F5BL 3IETA 5I30L 4GKNB 4LLWA 4NJ9L 4BH7B 2VZVA 5T5NF 5MENA 4OIBA 3ARQA 1DUZB 2HFFA 4UDUB 3QNXB 5SX5H 2DS4A 1K3ZA 3SO5A 3UTOA 4LVOB 2DB8A 4RGNB 3IDGA 1Z9OA 2DQHL 4U6HB 4S10A 5E8DH 1FNAA 1GC1L 3ME0A 4EVNA 4GQPH 4NM4H 4DOHE 5F3HA 2ITDA 1WWAX 2VQUA 2YS4A 5J1TC 5GGUB 5E8NA 4DW2H 5IGXL 3T0EA 4YDLC 2Y7QA 4XPGH 1L9MA 1SYVB 1PJ9A 1U3JA 2P42B 5TH2A 1RULL 2GHWB 3OF6D 1F3DH 4HIEA 1PKQB 4N8VB 4H8WC 1F97A 5D7SL 4YHNB 4XPBH 3K3QA 2VISA 4X6CF 1AGEB 1YEEL 3VWJC 3PABA 4WTXA 1VADA 1IC7H 1KEMH 4X8XA 3QULA 5I15L 4LIQL 2GJ6A 1WTGT 1DCLA 3I6GA 3GMPB 4G9DA 3L6FA 2XICA 5LVEA 5C86A 3FT3B 3MCKB 5CJOH 5C1MB 5FHBH 1EHAA 2VXTL 3SEPA 4Y5XB 2H6PA 1WITA 2XPGB 5JQHC 3AY4A 1Y6MR 3QIBA 1YPZA 3MMEA 1K9TA 2MHAA 4EI6A 2F19H 5TF0A 5K9JL 1ZLUH 3IFNL 3BKYL 4BK5A 1NGZA 1TMCB 5IFJA 1G0DA 3ES6B 3P4OB 3JV0A 3M07A 3Q6GH 4JZJC 1ZT1A 1CICB 1ZV5A 1IGJB 5CSZA 4FA8A 1S5HA 3TJEL 2R4SH 2J8UB 4P46C 5F89B 3QG7L 3RUGE 5DS8A 4J8RB 1T1WB 4NQXA 3B43A 1HSAB 3TO4B 5A2IH 4AENB 4OLXH 2A9ML 3GZKA 1HXYB 3KNBA 4PRHD 3EOYG 1UZ8B 1MFNA 2J6EH 1YC8A 3O2DA 1S9XA 2P5EB 1N3NB 4RMVA 5HVFB 5MERA 1VA9A 4PJXF 3IU4H 1R3HA 2V2XB 1N6VA 3OB0H 3I50L 4KROC 1DSFH 1CIDA 3KHQA 3RNKA 3SY0A 4TNWK 2DDQL 1C5DB 1DQJA 1J1PH 1XIWB 4R7DB 3QDJD 5E2TL 4C4KT 4K7PL 3VG0H 3KPRE 1FFPA 2D2OA 2HP4A 2CKBB 4PJHE 4Z7NE 2VLMD 1CI5A 4BK4A 4ELMA 2R2HB 1X5FA 4NRZA 1FVDB 2R1YA 3BP5B 4NQSB 4O51A 4EOWH 4U6VH 3HNSH 1J8KA 1KPRB 2FLRT 4AIZA 2A6DB 2X4RA 5ESAA 2H3NB 5D2NE 3ISWA 1KCKA 4P5MA 5T5NG 3V4PH 3DSNA 2JTDA 4WW1B 4FQ1H 5FGSA 2F8OA 3CZJA 4F7TB 2DM4A 4Y4KA 3VFSA 3RDTB 2BSED 2MNUA 3GJFK 3P73B 4YUEL 4NKOA 4DKEH 3QO0B 1NDGB 3IU3B 1W72A 4JO3H 3TO2B 3ULUF 5ENWB 1I3RA 3S37H 4X4ME 4NKMB 3E2HC 3ARFB 3GNMH 2IWGA 1IGIL 4RAVA 3RZWA 1G9ML 2BK8A 5D7JA 1FJ1A 5GS1C 1FBIL 3RFZC 4JDVB 4U1LB 1DQDH 1MCKA 3D39E 1OT1A 4N68A 1H3PL 4U7SA 5E7BA 1CK0L 5GGTA 4AIXA 3H7BA 1IKFL 3V95A 2VITB 4FZEL 4GKSB 1EEYA 3T1FB 1I7TA 2E6PA 4LDOB 1MCJA 1U8OB 3HZMB 1J5OH 4C56B 1S7UA 1YEGL 5EZIL 5DK0B 5IROA 3BI9X 4MYWB 4NNPL 2IADB 1LVEA 3U4BH 2H2PD 3SDAD 3IB4A 3PGDA 1F3DJ 5HJ3A 3RVTC 1LK3L 4S1QL 5DWUH 4KZDH 1QOKA 1KC5H 4FTVD 3UBXB 4KPHH 2FDBP 3BHBB 3CU1A 5EOCH 2RCSL 4YHML 3LQMA 2NW2A 1A6VH 1K4DA 2XNAB 5ACZA 4LASL 3ELAT 1M7DA 2NY5L 4OF3A 5KAQG 4M43H 3QFJA 5ETUB 2Q87A 3SDDB 3VDAA 4Z7WB 4JRXA 2GEEA 3SE3A 1N4XL 1AGDA 43C9A 2HLAB 2AJVL 3AVEA 4Z7OE 3ZDZE 4L9DA 2CGRH 1NGPH 1UH3A 5FECA 5D5MA 1REIA 3PIQB 2P1YA 4XCFL 4UV7H 4CRPA 5FFLA 5GGVY 3ULUD 2XKNA 4YNYA 4RFOH 1WBYB 4PP1D 3BVNB 3BE1H 4MCYB 4XNMB 3O6FA 5TE7H 2FGWL 3AREA 4HCRL 1RUKH 4GBXA 5JXEA 4JZOB 1FL6B 5FCSH 3VMOA 5C0CD 2F53B 2EDBA 1G9NH 2GQHA 2QBWA 1NEZB 4YDLB 3MO1A 4RZCA 4TNVF 5ISZE 2IJ0C 4KMTL 1MUJA 1HK6A 1IQDA 1N5AA 5HHQB 4WEUD 4APQD 3JVGC 3B3IA 1YUHB 3VWJB 3FQTA 1KXVC 3C09B 2DLFH 5EORH 1NFDB 1TTUA 4XP4L 3ULVC 3U0WH 5EO0B 1ED3B 4OGXH 3MLUH 1Y6KR 2R56L 1NGXB 5JW4R 1V8HA 4X7EC 3R06A 5F7DA 4J3WA 2H8PA 4NO3A 2CK0H 5F7UA 1SJEA 3O4LB 5GGRB 5JR1H 3C6SB 2NZ9C 1MHEA 4M7LT 5TQ0L 2VUOA 4UNUA 4WEBH 4G6AC 1VFOA 2DQTL 2OL3B 3U9UA 1U8KB 1N5YL 3IF1A 1LO4L 4J4PC 4OSUL 2VE6A 1YNKH 3MRHB 3TJHC 3KVQA 5GGVH 4OLUL 5DR5L 1MREL 3MC0A 3T77A 1CDIA 4QRUB 4QRPB 2MCG1 4LFHG 5FK9A 4X6DB 2HTLD 1TJGL 1FNHA 1Z9SA 4YX2H 4XP6H 3C6LB 1UJ3B 3AXLB 1GGUA 5EBLB 3FONB 3MACL 2IH1A 4MSWB 5IVZB 2JB5L 4KY1L 1KN4L 1LO5B 4Y88A 3UP1A 4LCYB 3SKMA 4MXVF 4FQXA 1JI1A 1EUUA 3HA0A 2VL5A 5DJ6B 1ZHBB 5ICXA 3CCHA 1Z6JT 1UWGH 1Y0LA 3VA2C 4I5BB 3MREB 4Y4HA 2DIAA 4JR9H 4UOW0 4NRYB 4KJQD 1AY1H 5JIPA 5C0DA 4PBXA 4HUXA 8FABA 5IMOA 3NCFB 4JEGB 4U6YB 3ILQC 3QZWB 4DVBB 1T66D 1RFDL 1F4AA 4RA3A 1IAIL 5JORA 4XCCL 3FQRB 1S5IL 2C1PB 3MJ9H 2PW1B 4F37K 2AGJH 3MYJA 4H1LH 4YHKL 3RTQA 4TVPE 3EYSH 4DKFH 3HFML 3QUXA 1TVHB 4HBQA 4IRZL 1HQRA 4M93C 3QDGD 4U1HA 3MLZL 4N1HB 3SKNA 1XR9A 4URTB 4XZUB 1NGQH 3NACH 3BESR 3BKCH 4GH7B 4LQ1A 4HJGB 4O4YL 5EOCJ 2CKBL 5DJCB 1EVTC 1YDPB 2HT4C 3V8OA 3VRLF 1CIUA 5EIIB 1D5ZB 2JKXA 3GIZL 5DLML 5CSGA 5BVJA 3U2SB 4F33A 5BO1L 3RWJB 4I0PC 3HUJB 3EYVB 1G7HA 5L2JB 5FGBC 3RJQB 5JHLL 5DJ8A 3UCRA 1P1ZB 1NDMA 4S1SH 3QCVL 3QH3A 3WXVH 5KVEL 1YQ2A 1DEDA 3X17A 5MHSE 4HHAA 2GK2A 2HT3D 4GRLD 3RU8L 4PRHB 3LEXB 4P59H 5J89A 1MJ8L 2CUHA 3SGKA 2DYPD 3GRWH 4QHLA 3HCVB 1IAOA 4YGAB 4PJ5E 2HT2C 3MLSH 4HIIB 2Z31C 25C8H 1FFNB 4DGIH 2SEBB 4MA3B 3LOWA 4HUVA 4HJJH 3GSWA 2MQ0A 1CE1L 2GCYB 3C5SA 1CDHA 4NQUA 1GSMA 1ZKAA 3MNZA 5IB1A 2VXSH 2DQDL 5HBBA 1T21B 2EDEA 1OSPH 1KB5B 4YE4H 2VXUH 3QDJB 4Y2DD 3UAJC 4QOKE 1FAIL 5C9KA 1IM9D 4PJ7E 4LPCA 1X4YA 2AJXH 1A6UL 3WCYA 5I19L 1A4KA 4UMGA 1EJOH 4WUUA 5DFVD 1ES0A 4JFFE 4OQTA 3QCTL 4AH2B 4FQ2H 3QNYA 2WINB 1HYRC 4IOFC 3QQ3A 3MLWH 1R5WB 5BRZE 3IDNA 4JDZB 5DD0L 1D3CA 4EUPA 2R0ZH 4I4WA 4WHDA 4Y5YC 2V17H 3FQNA 1I1YB 1JGDA 2AJYH 2EIDA 1A9EA 2E7CA 1EFQA 4G8FB 7CGTA 2BSRB 2XN9B 3TBWA 1Q0YH 4K9EL 4ORGA 3MUGB 4R6UA 4ZSOE 4OCMC 5LQBL 4WI9A 2ZSWA 3REVB 4DVRH 1GGBL 3QXTA 3GSVA 1A7QL 3WS3B 3UEZA 1ADQH 4J3SA 2ZJSH 4LDLB 1NSNL 3C8KA 4YFLI 3VXQB 1AKJA 2C4FU 2H45A 3S88H 4WUKH 2GSGB 1FZJB 1X4XA 1JWSB 1IC4L 1MI5E 2NY7H 5CBAA 1FPTL 4BQ9A 4NBXB 4Z7QF 4ZFOB 1U93B 3QIWC 4U1GC 5CZXD 3DVNB 1WEJH 1DN2A 4FABH 2HT3C 4GRLC 4Z7NF 1F90L 4J2XA 5LGHL 5KTEL 1DQQB 4ODXB 2J88H 5H35A 2PCPA 1CD0A 2EXYD 5FA4A 3VRJA 3VD5A 4HLZG 3K80A 2OJZL 3VW3L 1AO7E 3NIFF 4JN1H 4LAQL 2ZG1A 5JZ7C 5DUBB 1P5VA 3MGTB 2F8VA 1HHKB 3BZ4A 3ARDD 1S7VB 1IC5H 4BFGA 3X13A 4F2MA 4FTVB 4RFEA 5F21B 1LNUB 2W07A 5ERWA 2JCCA 3OKLA 3TCLB 1QR1B 3MRJB 2AV1A 3GFUA 3J7HA 5EO1B 4NZRH 2G60L 2R0LH 4CJ1A 5C0EA 1ND0A 3BXNB 5CIPA 4QNPE 2G2RA 1FL5B 3LSOB 2LABA 1KJMA 5T1DL 2OL3L 2NLJB 2FX8H 4XVJH 2V2WA 1MSPA 3PP3H 1G7IB 1BFTA 2FJFA 3HLAA 5KSVA 3G08A 2BDNH 1ZHLA 3TT1H 2XWTA 4YDJA 4UTAL 1NMAH 1DANT 1J7VR 2Y6SD 3WIFB 4HX1A 4K2UH 1PYWA 5C0CB 1FGNH 1A1MA 3PP4H 2X4NA 1FSKB 3HC4L 4L9LA 4OM0H 5CKAA 5MEPA 5IFAL 4HCRA 4W6XB 4AQ1B 5I16A 5IBUG 3IDUA 3LZFL 2R2BB 1SVZA 2NY4C 3KPRD 2BVUA 3GMOA 2XQBH 3ZKMD 4OGYH 1ZTXH 3UTSA 4YPGA 3IKCA 1MFAH 1T0NB 1U3HA 1CGSL 4ENED 2AJSL 1WAAF 1P53A 5HHPB 3WBDA 3CXDL 4QRRD 3T2NL 3VD9A 3SDXA 5H2BA 4XPAH 1RZGA 4QYOB 5DJDB 1I9RL 3RGVA 3ROOB 3WFEL 5CZXC 1TPXB 2MKWA 1W8NA 5IJKA 4M5YH 4L4VE 2EDKA 4M7JL 4D9RE 1CXIA 5D8JL 2XXCB 3G5VB 5C07E 1IEHA 3ZE1F 3GJEA 3WJJA 3GUTA 5GGUA 3SOBL 3AUVA 2Z35B 4AK1A 4AM0B 1LD9B 2F5AH 4K3DL 1A21A 1D5IH 1XF5B 3E6HA 4UU9A 4KK9C 3M17B 4WEMB 4XWOC 4MA8H 4YDVB 1HKFA 4WWKD 5A2FA 4Z95L 4WWID 4P2QE 1ZHNA 3BQUA 4LP4A 3EO1B 3KPSE 1S7XB 1T4KB 1LDPH 5JLZB 1F58L 3GMPA 3G5YA 3LQZA 3VWKA 2AJ3B 4X6FA 5HHMD 1TQBC 3WEXB 3VDBA 4KDTA 4P57A 4RWYL 1I7ZA 1Q9OB 4G6ML 2ITCA 5D9SB 4MJIE 1MIMH 3KPNB 2P5WA 3T8XA 1BLNA 4JANA 2BVPB 3D85A 4M8QB 1AXTH 1U8LB 1A6AB 1YEKH 5IB4B 1FV1B 2Z31B 1IAIM 5CGTA 3RNQB 1JE6A 3C08H 3GMQA 3MGOA 4XC3H 4LLVA 2WBJC 2AEPH 2Y6SC 4NWUH 4S0TD 3HMWH 3H0TB 4X5XA 2I27N 5CD5C 1E6OH 1QVOB 1GPOL 1IGJA 5HTSA 1LO2L 3VI3E 4UNVA 3A6BL 4Y1AA 4DK6A 2EC9T 5F89A 4R2GD 3IFLH 1FZOA 3MBXL 1ZANL 3ULSB 4KI5F 2DIBA 4N8CL 1UYWL 3HMXL 2DBLH 4OF7A 1M6OB 4Z0BH 2I60L 2ATKA 2XRAH 1G7JA 1IQWL 4LSDA 2MCPH 3IRZA 1UWEL 4BZYA 2Q1EA 4I77L 5D2NC 3QDGB 3UYRH 4XNUL 4YHIB 3X3GH 5CAYB 3IXTA 2NX5A 1KB5L 2J7LA 3GJFA 4TNVK 5C3TA 3DX6B 1MAJA 1GHFH 1JTPA 3O3DA 3S97C 3M8OH 1UXSA 2W60A 2GITA 1KJVA 1HH9B 2H26B 5ID1B 3MRIA 1BD2A 1SY6H 3VXUA 1S7QB 5CEZD 2HA1A 3HR6A 5E8PA 3WIIH 4HAFA 1T3FA 4IDLA 3CSYA 5KVDH 3FAWA 1XCTB 4ONHB 3U7AA 3EYUH 1T5XA 5L9DH 1HYSC 5HI4D 3U79A 4ELKB 4YHLH 4PJ8A 2XWBA 4KRLB 2BERA 2X1WL 3WFHB 2AI0H 1MWAB 1HINL 4GRLB 4AJ0A 2D9QB 3BGMB 4Z6AT 5DQDH 2DYPB 2X9WA 4UILH 5FF6A 1EH9A 1DBJH 4ZPTA 3I6LD 4HS3A 4YXKL 5E2UH 5LBSL 1DN0A 2X4OB 4AL8H 4F9LA 3RKDC 1OGAE 1TNNA 2DQJL 1DTUA 1G7PB 1UCBH 4KI5D 3VJ6A 4K3JH 5IBTL 4ZFOL 2AV7B 2NR6C 2VUYA 1DUYB 5DJ0B 3P3YA 4I3SL 3KYOB 2J5LB 1CT8B 4ZG1A 3NH7H 3H6JA 2CUIA 4FFZH 4Y2DB 4R2GC 1CGXA 2FLBT 1IM9B 5I66B 3GMNB 3WKMH 1JBJA 2R69L 4G9FA 4P4KC 1AQKH 2ADFH 3CLFL 4O9HH 4NO2A 4TUKH 3FMGL 1DLHA 2QADC 4KI1A 5HVHC 4JQIL 5DRWB 1WFNA 1BVLA 2HMIC 4R0LC 1TJHL 2I9TA 3VGFA 1ZWIB 4KZEL 5IJVB 4DOHB 4KJYA 5D1ZA 2CPCA 5CILL 1KGCD 3TVMD 2WZPD 1WBZB 2E7MA 2APTA 4M1GL 1X44A 4NWTL 3RWGB 5B3JF 4ZS6C 4P5TD 1L0QA 3E1F1 1CL7I 3MLXL 5EIVA 5DD6B 4HFUH 4MQXC 3N85H 5L6YH 4ACPA 1T7WA 3C2AH 3CFDB 1UM5H 3ZLQC 3OKOA 4WI2A 5FOBA 4H20H 4OZIE 3MRLA 4L5FL 3ULUL 3UPRA 4QXUH 2FEDC 2ED7A 4OTXL 4R7NA 1ZA3A 3Q3GA 1VERA 4ZXBD 4NBZB 4P48A 5AYQA 3BP6B 5HHOA 4HWUA 3X12A 3BVNA 5D4QA 4TUOA 2JJTC 1F3JB 5F1OB 1U8NA 4AEHH 1FRGH 3BWAA 3NCBB 4JJ5A 3VFPA 4HBCL 4B53A 5FA3A 5CJQL 1FL6A 5IBUB 1ZLWH 4WGWB 2A77L 4DN4H 1EMTH 1M05A 3EDFA 5HYJA 1PW3A 2MPAL 3ARDB 3HAEA 5L8JB 5BVPH 4WGVB 1JPFB 4MAYA 3N50A 1CL7H 4K8RD 2V2TB 2DQIH 4M03A 4R96A 2IPUG 1NPUA 1WFOA 2L7UA 4LRIC 4M7ZB 4KV5F 4PJGF 2BMKB 1LE9B 3CFBA 3U4AA 3RUGB 4ZYKA 3WFDH 2CRIA 2D7TL 1L7IL 4Y16A 1IT9H 5IIEB 4LCIL 1YEFH 4TSAH 5MHSD 3O4LA 2EZ0C 3O3AA 2A6KA 5JQ6L 4PTTB 3QA3B 1PQZA 4XP5L 5IMLA 4M9PA 1U91A 1JYVA 1FVCA 4MAUL 4EN3D 1SYSA 3EJYD 5IMMA 2ICWB 1QO3A 1EUTA 1E4WL 1YYML 2AXHA 5E6IC 3DVFA 3O2DH 4NUJB 2JJVA 2Z8SA 4ZTPH 1U8IB 5B38A 2DTMH 4HQQH 3ZKXC 2BXYA 3IRPX 2WWMC 2IPTL 4QOKD 3KPRB 1T20B 2QTEA 3G6JE 1GGCL 3JV4A 1K8DA 3L95B 4AMKL 3ZTJH 1DBBH 2CIKA 1H5BA 1FIGH 4HDIA 4LVEA 4WI8A 3GIVB 2DQEH 2Y07H 1QR4A 1XR8A 4HPYL 1J0YA 4ZXBC 4B7IA 1M71A 4FXKA 4BKLB 1QSFE 4PRID 1DLFH 4LOUC 3L3JB 3VXME 2LVEA 3NVQA 4X98A 5BRZD 1KIRA 4E42A 3OB8A 3MREA 2AS5M 1OPGH <