4FNLH

Crystal structure of broadly neutralizing antibody c05
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
239
structure length
233
Chain Sequence
EVQLQESGGGLVQPGESLRLSCVGSGSSFGESTLSYYAVSWVRQAPGKGLEWLSIINAGGGDIDYADSVEGRFTISRDNSKETLYLQMTNLRVEDTGVYYCAKHMSMQQVVSAGWERADLVGDAFDVWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody C05, Heavy Chain
publication title Cross-neutralization of influenza A viruses mediated by a single antibody loop.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 233
sequence length 239
chains with identical sequence I
ec nomenclature
pdb deposition date 2012-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fnlH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fnlH01
1A3LH 4WFFD 5D1ZC 4M00A 3CVHL 3MV8A 1KT2A 3VD9A 3TFKC 3LHPL 4ZUVB 3W0WE 1W2KT 2HFGL 1FSKC 3KJ6H 2R0KH 3FFDA 3FO9B 3WN5B 2AKRA 2FZ3B 5F71A 5GZOC 2VN4A 4IRJD 4JY5H 3LKRB 5L2KE 3RPIB 1EH9A 5L0QB 1GL4B 5EIQA 1FVDA 2DQUL 3G6JA 1IEHA 1PG7X 5CP7B 4NQSA 1D6VH 3S96A 2DLFH 1L4IA 1NUDA 1KN2L 5F7DB 1LK3L 3ALPA 3EYVB 4UILH 1FBIH 3KYKL 1HEZB 5TE7H 3QUYB 4ODHL 3KPQA 3O4LA 4BUGA 4WTZA 1UB5A 1CWVA 1OARH 3S36H 1FDLL 3WE6A 1CICB 1R3JA 2Y36H 4ZTPL 4BFEA 3ARDD 3PP4H 3V9FA 4AJ0A 4A6YA 4ODXB 1D9KB 3GSUA 4GAFB 3QNYB 4WCYH 1WBXA 3FQNB 1A1OA 4R0LC 4FFYH 4ZAKA 5FDYA 2AQ2A 5CEXA 2XTJE 2X05A 3SY0B 4Z7WF 4Q2ZB 5IBLD 4TVPD 2VKXA 5DEFA 2VZOA 1OAKL 1OGAE 4I2XE 4IJ3B 4JZNB 1U42A 3SGKC 5JLZA 1U8OA 3CLFH 2V9TA 1ADQA 5EUOB 3C6LB 3RVVC 2FCBA 2JJTA 1KIQB 5EBMB 2FJFB 2F53A 2G9HB 4L3ED 5F70A 3D0VA 4Y5YA 4E41A 5A43C 5BQ7A 4GBXC 1UH4A 4YHNA 1CZ8L 4N5ED 1FNGA 4OAWA 1J18A 4PRPB 2FB4L 1XH3A 4YHZH 3T2NL 3OBAA 1TTUA 3U4AA 3VD7A 1AXIB 3IFLH 3FMGL 4WW1B 4Y8DC 4PJXB 3OAZK 1T1ZB 3BYTA 1FV1A 5FIEA 1OPGH 3BZ4B 3LB6D 4N0UA 3O3AB 3O6LL 5L6YH 2C3GA 4IRJA 1YEHH 1IGFH 4DN3L 4Z7UA 5IVOA 5F8QC 4N1CA 4XBPA 1BVKB 5CAYB 5CCKL 1KLGA 3BJ91 1OTTD 3GRWH 2FATH 4D9QE 3HI6L 1X7QA 1FFOB 3LV3A 3SPVB 3VFGL 3S5LG 5I1IL 4MJID 3VXMB 3MRHA 2DRUA 5CKGA 4M3JA 3LKQA 4OT1H 1U8NA 3SDDC 1FE8L 1U9KA 2KUTA 2XZAH 4AENB 4BQ6A 5GGVL 5FO7B 3VG9C 4S1DD 2P42B 1AGEA 3QJFA 4WW2C 5A16B 1FGVL 2XPGB 3MBXH 4LEXH 2B7DT 4P49A 3T0DA 1IBGH 3KPNB 5IMLB 4PGCA 4NNXB 3HRZA 3ARDA 5GSVB 4OZIE 3PUCA 4HZAA 1P2CB 3GSOB 4G80B 3GFUA 3FONA 3NA9L 4XWGL 4AEIH 3L3KA 2V5SA 2Y23A 5BJTA 3MLZL 3P30L 4GS7B 5IROA 3U9UA 4XX1G 1JHTB 5FUOL 5D72H 5EC2B 2ADIA 2YC1A 3QQNA 5E5RB 1QRNB 5EA0H 5D2LB 1LO0H 5DRXA 1REIA 1HKFA 4H1LB 1H8SA 4ELKA 2J6EA 1HINH 3CDYA 5C09B 4ZFGL 3DRTA 4L3EA 4CNIB 2DQGL 3H9HB 2FX8H 5I1GL 2ITCA 2Q7NA 2HG5B 4NM8H 2A0LC 5ICZA 3EIFA 3D69A 4LASL 1MJUH 3ARFB 5J11B 1MIML 4Y4FC 4ORGB 4YHLL 1IAKB 1GXEA 3OKKB 2VITA 4AT6B 1A7QH 4RFOL 4I9WE 4YXKH 1DVFD 4PJ7E 3C9NB 2XKSA 2YXFA 2DAVA 2VDOL 3PV7A 1LE5B 1WCQA 3NGBC 5IUSA 3F7YA 4N8CH 3TYFB 2MFNA 2XFXA 2X70B 1NMCC 1BAFL 5IJKC 1R5WB 3TIEB 4L4VB 1RURH 5EPMB 4P23D 1N4XH 3ZYIA 3JWDH 4MYWB 2IQ9H 5EZJA 4TQEH 2P5EB 2PTTA 3RY4A 5FGBA 3WUZA 5MP6H 4O2FB 4MJIA 3VWJD 2R4SH 5H37G 2E27L 4WNQB 2Q1EA 2WLYA 1HHIB 5KSAC 1GAFH 1T5XA 3FRPG 5F72S 1CE6A 4RWYL 5KVMC 3PDDA 3PL6A 3CSGA 5L8LB 1ZLVK 3QUML 1AIFB 3N9GL 3MODH 1FFPB 4OV5B 4KZEH 1KJMB 1RHFA 2AAVA 2MWCA 2R0LH 1SBSH 4M93C 1QFWH 4U6XA 5CBEA 3TBYB 3ZYJA 1GGBL 3QZWG 5DHVA 4X8XA 1TTGA 5IHZB 3PWJB 3CSYB 2J7LA 4NC0B 1IC7H 5E8EB 1SQ2N 4RA3A 4G8IB 1RIVH 2HJKA 1OY3B 4I3SL 3D9AL 3CFBB 4EN3B 3RKDC 4P57B 2NY4D 5DUMH 1YMMD 4XHJD 5JXAL 5KZCD 5GGSY 5L9DL 3L3GA 4M7ZC 3D87B 4PGDB 3MNWB 2A83B 4XTRC 4UOW0 3TPKA 1DVFA 4FQ2L 4FNLH 2O5YL 4RZCA 4Y1AA 1ZLSL 1BLNB 2ICCA 4MDJA 3CDGB 2F8OA 2OCFD 1SYSB 3HFMH 5DA4A 2Q8BL 2H6PB 3ZTNH 2GY5A 5HGBA 2IFFH 4NBXB 4NSKA 4X8JB 3B2VL 1EGJA 3P40A 2IADB 3S35L 5GS2H 3I6GA 3LPFA 3QA3A 1Z3GH 3KYAA 2GSIA 4O9HH 1FNEA 3P4MB 4K3DH 4LSVL 2V2XA 8FABB 5I19L 1LO3H 1WWWX 2FL5A 5CMAB 4I5BB 4NCDA 2AV7B 4KQ3L 4UIKH 3U1SL 4KHTH 2W9DH 3CFKB 3AAZA 4NKMB 12E8L 1BFSA 3QAZB 1U0QA 3ARWA 5D7LE 1J1PH 4BKLA 3V6FB 2X42A 4FS0A 2NY1D 4JRXD 3GKZA 1FFNA 5E9DE 3IDJB 1IM9D 1JWSA 3MOAL 4CKVX 4RMUA 1EHNA 4HIXH 2R69L 3PGDB 3GJFA 1AI1H 3GRWA 1NCUA 4FXKB 3VD3A 4GAGL 2NNAB 43C9B 4KV5E 3MLVL 2J4WH 2XN9E 1ZT4B 4U0QB 4MJ4A 2IEPA 5AUMA 1QR1B 4F37F 3ARBD 1T1WA 3CFJA 3JWOL 1NBZB 1URLA 1N8ZA 3WKMH 2D03H 4ZO9A 3RWFA 4MNGA 1T5WA 4XPTH 1H5BC 1NKRA 3JUYA 4KJQD 2FEEI 3OKMA 4PG2C 3QIWB 5C8JA 4PJDE 4QTHB 4NO2B 5IFAL 2A6KB 1ZSDA 1G7PA 5GISL 5GPRA 4NNYA 4JPKL 4G8GD 5K59E 5M7QA 4KZDH 1WF5A 3FN0L 3G5ZB 4Z77B 4HIIB 4XXCA 3IJSA 5ALCL 1SJHB 3H9SB 5CEYB 4RAHA 4NOBA 2AJYL 4XPFH 4KI5C 3MMEB 3RDTD 1EAPA 4NHCH 3STLA 2VDKH 2C4FT 4YFLF 3DMMC 3QFJD 1GZQA 3HAEA 4NIKB 4XT1C 4ODSH 4KRPB 3X12B 4PRBB 5FUZH 3QIUD 4QCIA 5M95B 4JFED 4G6KL 4WUKH 4OI8A 5IR1A 3PGCA 1F90H 2NXYB 1IC4H 1KPVB 3B9KB 5D1XC 5C0AD 1A5FL 4OLZL 2VDRL 2LVEA 1E4XI 1CIDA 4PP2A 1G7IA 4JDTL 2R23B 3ZKNC 2DQJH 1Q1JL 5KVDH 3VJ6B 5AZEL 2PCPB 3V95A 5JOFA 2HWZL 5IEHA 1A9EA 5D7IE 4OZFG 3RIFK 4PGEB 1PSKL 3M1BA 3LS4L 1JZ2A 5EU3A 1AC0A 5GS2D 1J1OH 3RIFF 4MCZA 4BZYA 1T21B 3ARGB 4LSRH 4JRYE 2YKLL 1I9JL 4HPOH 3EJYC 1CR9L 1AR1C 4CDHA 4PYGA 4M6OH 5EBLB 1A6ZB 2QTEA 3N1FC 4KK6D 2QHRH 4RBPK 4TVSa 1F4WL 3TA3A 3X14B 5GS3A 3TIDB 4HWZA 5DR5H 4NDMB 3VGHA 2D2OA 3V79C 2O93L 3WMSA 2Z91B 4MDIB 4PTUA 3SDXA 1UM5L 1X4XA 3FB8A 2AS5M 1EMTL 4F7MA 5GXBB 1MHPL 5B39A 4X9FA 3RBSA 4C56D 5GGUA 3QCUH 4JJ5B 3DVFA 3VCLB 3VI4E 4GW4A 1Q94A 4G5ZH 4PLOB 5GS0L 4BZ2L 3RDTA 3C87A 3JTSB 4G6FB 2NY2C 3CVIL 3OKLB 4ONOA 3FT3B 1OP3K 4KJWD 3GHEH 2LVCA 4QHNA 1K85A 2OR8A 2CPCA 4DGVL 1I1YA 5IMOA 4E0RA 3JV5A 1H8NA 4OJFH 4JFHD 4FRWA 1MHCB 3QIUA 3QISA 5E94B 4XPAL 2FECL 4JFEA 4XVUD 5T3ZH 2VDPH 2CO7B 2PXYA 3GMRB 3WHE0 1SJEA 5C0AA 3REVA 1YEGH 3MCG1 2BHZA 3B83A 4YFEA 2E6JA 3RA7L 1RZGA 2BSRB 4P46A 3S88L 1S9XB 4D9LL 3LEXA 3MRQA 5IVZB 5C3LD 3PNWA 4FQXD 4PRDB 4KMLB 4HWBL 2BX5A 3L7FB 3PDGA 2GW5A 1V7ML 2VZUA 1F6AB 4NBZB 1WCBB 4NQDE 4LVNB 2P46B 1UXWA 4WV1B 1TJHH 1MCBA 1KJ2B 4D0DB 5AD0A 4YAQB 1U93B 1CXIA 1I7ZB 4OLYH 4KVNL 3FL7A 2M26A 2ZUTA 5GIRB 3L3OA 1IKFH 1HHGB 1HQ4A 3TNNA 3VFOA 4MQSB 1JZ8A 2Y06L 4WFGD 3S4SB 1IFHH 1JK8B 4D3CL 3SGJA 4M8VA 1AQDB 1G9MC 2HKHH 1AKJB 4UV4L 4HXAH 2BVQB 2ZPKL 3MACH 1KB5H 2AXJA 1T2QL 5DJZA 2DBLH 4YE4L 4UNUA 3MXWH 2Z31B 1FIGH 1F45A 2K7PA 5ILTH 1FZOB 4Z8FH 3C60C 1U8QA 3OSKA 3H0TA 2VAJA 4NFBA 3WLBA 5I30H 1GGUA 4P5MA 1HN1A 2EZ0D 3JZ7A 3HC0A 5GGRY 4XB7A 4LLQB 3JBG7 3LCYA 4W70A 1SYVB 1IM3A 3M45A 3RWCA 3DIFB 1IAIH 3ZKXC 1YYMH 5CILL 2VQ1B 1V8HA 2M2DA 4PRHB 5EN2B 1P4BH 2NQCA 3DXAD 1KCUL 5IMKA 3KWWA 4NZUL 1TJGH 4I18A 3A67L 4WWKA 1HZHL 1UEYA 2BNUA 4XAWL 1NMAL 4QHMB 3UYRH 2BXYA 4M5YL 2HLFD 4XP1H 2X4NB 1BWMA 2R4RH 3RVXD 3EO1A 5BMFH 3Q5OA 2XQBL 4OM1L 3KNBB 4GKZA 1KIPB 5BZWA 2ENYA 3O3BA 3AM8A 5B4MC 1N3NB 5JIHA 3GUTB 2QQKH 3BYYA 3WNLA 2FHCA 4FQLH 4L4TB 1I8MA 4KKBC 5MEOA 4FN0A 4J4PD 3O9WA 2EXYC 5EOQL 4POYA 3DETD 5T3ZD 1VFOA 1W0VA 1LEIA 2UY7A 1TZHA 4NN5C 2VKWA 5D7JC 2WV3A 1I3UA 4H20L 2ARWA 2EO9A 4XWOD 4JG1L 3ZKQD 5KSVB 1S7RA 1F3DJ 4N0CD 5CSGA 5HYJD 1IEBA 4LKXB 2VAAB 4LARH 1OTSD 2CIIB 3B6SA 3QUZA 1RJLB 1J8KA 2B5IC 4HIJA 4MCYB 4MNHB 3BQUB 3BUYB 4WHYG 4QXTA 2X41A 3MRBA 2HKFH 4XMLH 4PV9A 2MPAL 3P0VL 5FO9B 2NZ9D 5I1EH 2BY2A 4LIQH 2YD6A 5JTWA 2Y6SD 4ZUTA 1RULL 4ISVA 1O5DT 1U91A 3WDJA 4QWWD 3VFTB 1MQKL 1T0MB 4GUPB 2DYPD 4LSPL 5C0BD 1OLZA 4MS8C 3FFCB 4E9LA 4WU5B 3DXAA 3IDYC 1XGYH 3ARED 5I1JL 5AZ2H 3K4DA 5TE6L 5DA0B 2OK0H 3O0RH 2E5EA 3PXHA 3QUXB 5C0CB 2XWBA 4N1HB 2ZNXA 1XGPB 2QQQA 4Z7VF 4HS8H 5CP3H 4RFNB 5FA3A 5KVGH 3OX8B 3K0WA 4RAUB 4WTZG 3HNTL 2IPKA 2F5AH 4I4WB 1XCTA 2V9QA 2X09A 1Y0LB 1U8MA 4K3GA 4LPWA 5L2JA 1MCDA 4Q58C 1YEIH 1RVFH 2XA3A 3BP6A 3D0LB 4J4PA 1QFWM 3GKWL 3P73B 3I75A 2WWMC 2LABA 1KN4H 4J6RL 1CIUA 2KDGA 2VXVL 1A6UL 5BV7H 2A73B 3MLPA 1JL8A 1OAUL 3TVMB 4TSAH 3WXVL 4OQTH 1QFUL 2V7NB 2PW2B 5HYJA 3GI8H 2X40A 3GMNB 1W0WA 3FAXA 5HHVL 3WS3A 4RA0C 1ZVYA 1DTUA 1WC7A 2FJGA 1ZHNB 3IKCA 5FYKL 3HG1D 4U3XA 3WS6A 4JQXA 1ZLVH 3QJHA 3PWVA 4ZSOB 3NFSL 3HUJF 3VMOA 4DUWA 4JZOA 2EECA 2NW3B 4HHAB 4PRAA 5SWZD 1JHKL 3HNVL 4Z7QE 2F15A 1RUQL 2EDDA 3IU3A 1NBYB 2VDML 4B7IA 2WBWB 3K81A 2DYPA 1CCZA 1NGXA 5C0BA 3QXWA 3CZFB 3CD4A 4AG4H 2VUYA 2AVGA 2QBWA 5EO9B 3AREA 1U2CA 5HHMB 3JXAA 3DX9B 5F1IB 3O2VH 1JGEB 1I9RL 1KB5A 3CAFA 5ID0A 1ZTXL 4BSWB 4KDWA 4Z78B 4IMLA 1DBBH 3VMNA 1CFVL 5JDJA 1V7NH 3HR6A 1T7YA 4P3DA 5JW3H 4KXZH 1MCRA 3DBXB 1XR8B 4KKCC 4OGXH 1WK0A 3WFCL 3LRGA 3MRNB 5A2IH 3BWAA 3DV4B 4U1JA 3IF1A 1I9EA 4JAMB 4Z9KB 5I1AA 3E2HC 3DECA 5TE4L 5J89A 3E6FB 3EDDA 1DQDL 5HJ3A 2P47B 1BVZA 5FOBA 2Q3ZA 4G6JH 3ULSA 4FFWC 3X3GH 2VZSA 1HHHA 4L8DA 5DJ6A 5C07D 3U30B 5I76A 4Q9CA 5SV4A 1MFDL 2RHEA 3DYPA 4RIRB 3OPZH 4X4XA 3P9LA 3RJQB 3HG1A 4HCRL 1U8JA 5IVXE 1BVLA 1PX3A 3BSZH 1ZANL 3DO3A 3W39A 1X5XA 5DJ2B 4JRXE 5TDPB 4MJ5B 4MA8H 4G6MH 1MIEL 4R97C 1U8LA 4XBEH 2R0WL 4KU1A 3PJSB 5E8NB 3L6FA 3V5HA 5I75B 1E4WL 2ATPB 3OKDA 4NQXA 4Y4KD 3MJ8A 3H8NA 1EVTC 2BSTB 1CLOH 4R4ND 3PIQA 3R0NA 1EXUA 3IVKA 4PJHE 3UAJD 2CR3A 5GRUL 3MV11 5CEZL 3OJDB 2VLJB 1RJYB 3H3PL 4OCMC 4DKAA 2BC4B 2YUZA 2GAZA 3QNZB 3HZKB 3KLAA 3DX7A 1IL1A 4P5TD 5LKNA 1NAML 2DQEL 4G8GE 3RVUD 1MJ8L 3MYJA 4P59H 1Q9WB 1CFQB 4WUUB 4RGNC 1OTUC 1KCSH 3UPRB 2RFXA 5D2NA 5EZIH 3FQTB 4M1CC 4ZXBD 2UVEA 3EDFA 3PWNA 1FO0B 1VFAB 2WZPD 2I5YL 2QSCL 3NAAH 3ZL4L 2MJWA 1W72A 1PFCA 3IU4L 4PY8I 2W65A 1Y6NR 1U58A 4PJCE 1N7ML 4HPYL 5J6HA 1U3ZA 1YNTA 4ZS6D 3RNKB 1C12A 3DTXB 1EHXA 2EH8H 3GNML 4OIAA 3VXUE 2G5RA 1ZHBB 3VWKB 4OFYA 5D6CB 5IFJB 5GRXG 4PP1D 5I74C 5C07A 1FVEA 1WLHA 1UKQA 3SJVB 4JREB 3HE7D 5CD5C 3CFCH 5CSBA 2YMXL 3VXOB 1QNZH 4LHQB 4OFKA 5HI5C 2PR4L 4I3GA 1A6AA 5CP3A 5MENE 4LVHC 1MRCL 3S6CA 3D39B 2JK5A 3IS0X 1MCPH 1MOEA 3WIFA 1OAZH 3MV7D 4JZJA 6FABH 1AXSB 4PY7B 5E6ZA 2YZ8A 1YQVL 5EG6C 3HUJB 2FGZA 1N0LA 3WJJA 3WHXA 2FSEB 1KJ2L 1S7QA 5JA8B 4DVRL 4PRNA 3TO2B 3KJ4C 3LS5H 3BRGC 1S7WA 1H3TA 4RMVA 3ZMRA 4XPGH 4I0PB 3QNXB 2EDNA 4HAGA 1R3LB 3F7VB 1NFDE 3HB3D 4HS3A 4K8RL 5H2BB 3SDCD 5E24E 2ZCKH 3BKML 2V9RA 2YPKB 1LE9A 3A0OA 4HMDA 2LQRA 4N8VB 3FO1A 4B50A 5J1SC 4V1DB 2DKUA 3BWUC 1FP5A 4P5TA 4U1GB 2Q8AH 3MRJA 1T66C 4KDTC 4XNMB 1KACB 1UJ3C 1TQCB 1Q0YL 1NMBL 4ZYKA 5KOMC 3RKPA 2ZUVA 3FO2B 4J3TA 5EOCL 4GMSL 4C56E 2P4AB 2N4IA 4PRID 3RWJB 1J87A 3ES6A 4LRNH 5F6HI 4JDVA 4ZXBA 1WV7T 5DD3H 5AAWA 5BVPL 2EIEA 3PGFH 4TUJB 3TBVB 1GZPA 5CJOL 4Z95H 1CFSA 2H45A 5E2JA 4FQQB 1XF1A 1PQZA 4N0YH 4XZUA 3STZB 3IRPX 1FZMA 4JFHE 4YDJB 3MNZB 2CLRA 4CVZA 2ICEB 1H15B 4J3OC 3HE6D 2ED7A 4NNPH 3DVNA 3S37H 5J56B 1A02N 1PAMA 3H3BC 1B3JA 3E8UL 1Y6KR 3GO1H 4J8RB 4U1KB 5I9QB 1QFHA 4QRTA 3O11B 1AGCA 3RL1A 5INDA 2ARJB 3MLSL 3MR9A 4EVNB 1M7DB 4KDVA 2F54E 4LF3A 3AXLA 3MV7A 4WGWB 5IFHH 2ZJSL 2Z93B 4NWUL 3RY6C 5DWUL 1QOKA 2BOCB 5C6PB 1HIML 4P5KA 5D5MF 3JSSA 3B9VA 4G9DA 4M3KB 2FGWL 2IALB 3CVHH 3GSQB 3SDCA 4M1GH 5CGYD 2EC9T 1WSST 2AJVL 5F96L 3LHPH 4QNPE 2HFGH 5CIPH 1HXYA 5HYSG 2XN9A 4MD5A 3VXPA 2PYEB 1D5MA 3FB5B 5CGTA 5D1QC 3MJ7B 1XF3A 4F3FB 1CDGA 4O4YH 5C0EB 4K71B 2DQUH 2HVJB 1CFTA 4DK6A 3R1GL 1QFPA 3E1F1 4PJXE 5IQ9B 4PRIA 4PJDA 4W4OC 2MCPL 1KN2H 1VKXA 1LK3H 1U92A 2EKSA 4P3CL 3VFWA 2H41A 4LBEA 1FNLA 4KROC 3JV6B 4ODHH 2FEDC 4OCYL 1F3DH 2GCYA 3EHBC 4U1SA 3L5WA 1FDLH 5LGHL 3RGVB 4N0FA 4ZTPH 1I4FB 1ZA3A 4Z76A 3NPSB 4PIRF 2RQ8A 1CGYA 3VXME 3GSNH 4X6FA 3HE6A 3CMGA 3ALXA 4AEHL 5I1DB 3WNOA 5LGKA 4K9EH 3OMZA 5IVNA 5DJ0A 3RRQA 1J11A 2Q86B 3D6GA 4NFCA 5FA4A 2CK0H 4KHXL 4I48A 1T1YA 4OLWL 3WFHB 1BBJA 5J1AA 4CGTA 3OXRA 5HHOB 3VW3L 1XCQB 5IB2A 2DMCA 1ZEAL 4R4BA 1FG9C 1CZ8H 3GMMB 2HVKB 2GHWB 3BUTA 4P4KC 1NBVL 1A14L 2WUBH 2AQ3A 3MA7B 2FB4H 3O3DB 2C5DC 3IDMB 4MAUH 1U95A 1EZVY 4L8CB 3FMGH 2JCCB 5C09E 2Y5TA 3NH7L 5T3ZE 3S3PA 3L3DB 4WW2F 4FQCL 3KXFE 3EDKA 5DVKA 4NP4L 4UU9A 1U3HC 2KZWA 1HWGB 1JTPA 1A8JH 4ZG1A 3AFLA 4HUXA 3UO1L 3MOBL 4DN3H 1U41A 3MXVL 4LK4A 2NY6D 2BCKB 3SCMB 3BE1L 4HULB 1WBZB 4Z0XA 1CGSL 4UI2A 5CCKH 4OSUL 1I3GL 5I2IA 1F4YL 4LCYA 3AY4C 4NRZB 4BH8A 3VFGH 5I1IH 4BK4A 1MRDH 2WLZA 1JMXA 1XF4A 3R06B 1FE8H 1HSAA 2PO6D 5GGVH 4TNVF 2FLRT 4XCEA 3RAJL 3WUWB 1NCCL 1FGVH 2QQNL 1CDBA 4L4VE 4POZC 2ENSA 5MEPA 1U6AL 2GUOB 4Y5YC 3MX0A 3OR7A 3FQRA 3P0YL 3BPNB 2P5EE 4EI5A 3NA9H 4YPGA 4XWGH 3RZWA 1UH2A 5IW6A 4N8PA 3VMPA 3FT4A 2J12B 5DRZB 3MLZH 2VXQH 3MOQA 4MHHG 1MHEA 5D1ZB 5KAQG 4L3AA 4R8WL 4J7RA 3RHWK 4G43B 1FSKB 4MX7A 1WT5A 3JWNC 4ZFGH 2E3VA 2DQGH 4OV6F 3SE9L 5HHPA 1QD0A 3EO9L 4XXDA 3NCMA 4XNZC 2AI0H 2IANA 3EFDL 4JY6A 3F6LA 1HKLL 1MIMH 3RFZC 3QQ3B 3QDJB 5I18H 1LEGB 4U6YA 4QHLA 5F9JB 2VDOH 5GGRA 5F7YC 2ESVB 4X5WB 5SX4H 3QCTL 2AERT 3M07A 4X6BA 2GJ6B 2VN7A 5F97E 3W5MA 4L5FH 1WVZA 4XVTL 4LNRB 3FCTA 1MFCL 4IOIB 5DFWH 4Q9RL 1RV6X 5F6IC 3AU1B 2OXGA 1BAFH 4HWEL 3BD5A 3CXDL 2PF6A 3ARDC 1VADB 3SDAC 4JCMA 1FH5L 2WIIB 3MREA 1LILA 2GFBA 4X4YB 1R0AH 1QFWI 2G75B 4R0LB 3PQYB 3B8YA 1LHZA 2ZWLT 3BP5A 5IROC 1ACZA 4PJIA 4QOKA 4JFZH 4JR9L 2E27H 3TCLA 3L95B 4H88L 4KGJA 1PYWB 4O02L 2PO6A 5TPWL 3NCEB 1YQ2A 4GG6F 1P4LA 3EOTL 1AY1L 4Q6YA 4RWYH 2H26A 2QR0A 3TBSB 1GCFA 3QUMH 1NGYA 3CVHA 3N9GH 5F89A 4DZ8A 1G7HA 5K9KB 4GBXB 3SO5A 3UTQB 4LLMA 5HYEA 4N5EC 4GH7B 2BHUA 5KW9L 4WDIB 3O45A 4CN6A 3NIGE 3HI1A 3UJTL 1QLEL 1RY7B 3GB7A 5JDSB 2OL3L 1GGBH 4UDUB 3P9WB 4LP5A 4Q9QH 2R0ZH 4OIIL 1KPRA 1S3KL 2XY2A 3ARTA 5HHNB 4X9IA 4RX4D 3LB6C 4X9BA 1HH9A 2HJFB 3OZ9H 2VIRA 3LN5A 4AEEA 3QIBA 5SWSB 3TCXA 3UTSB 1CTOA 1M05A 3D9AH 5T33L 4LIQE 5JXAH 1OTTC 5L9DH 2OQJA 1BFOB 4HF5H 4MHHI 4FQ2H 2O5YH 2APXA 5BOZG 1NCBL 4LGPB 5DURD 1ZLSH 4U1MB 3SDDB 4BK5A 2DD8L 1MQ8A 4KJPC 3EW3B 2C1OA 4HGMA 2YHGA 2YUWA 4M6AA 4S1DC 2YPLB 1C7SA 4WFEE 3QG7L 4Y89A 2Q8BH 1INQB 1LDSA 2I9TA 4LCWB 3KYMA 1FLTX 1KG0B 2VWEE 1QQDB 3B2VH 1S7SA 4HKXA 3S35H 4JN2A 2H32B 5I19H 4PJFF 2GI7A 3OKNB 4GW5B 4YNYA 2H2PD 4ONHA 4KQ3H 5ALBH 3QDGE 4X6CB 3U1SH 4HMCA 1N64L 3QWQB 5DTFB 4FQHB 1T6WA 4ZPVA 3HLAB 12E8H 5ICXB 1I7TA 3ZT5A 1Z5LB 4HV8B 1GYAA 5D7KE 2EDKA 2WQ8A 5B3NA 3VE0A 4Y4FB 3T3PE 4IM8A 5DVOA 4MA3A 5KOVC 2ZCHL 3MOAH 3ZTJH 3GSWB 4YK4C 1DVFC 2R69H 2UYLA 1F42A 1IAOA 4GAGH 1U8KB 2ZOKB 4RX4A 4UDTB 2PTUA 1QSFB 3NGBB 5TQ0L 1WJ3A 4YDIH 4NGHL 3T1WA 4KI5F 2G5BA 4NYLA 1L0YA 3UX9B 2AEQH 3BD4A 3JWOH 1G9NL 4K7PL 1V3KA 5DDHB 2XNAB 3QXUA 1J8HB 3GJEB 4WI8A 5DI8A 4P23C 3NBNA 1MREL 3L3HA 1Z6JT 1BIIA 4Y19D 5DYOA 5I8EA 5EBGA 2D7NA 3DGCR 1TCRB 4YC2C 4TSCL 3OKOB 3VWJC 5IFAH 1ETZB 4WI4A 4ZUSB 1G6RL 3FT2A 3S8WA 5GISH 3P77A 3C6SB 4JPKH 4NKQB 4KRMB 3FN0H 5KSAB 3MUZ1 1X6LA 1DUZB 4CU6A 5ALCH 1PKQE 2AJYH 2CGRL 4UQ2A 5DSCA 3U48A 3NA4A 5E99H 3ZZ1A 1OSPL 1FL6A 3OGCA 3OTTA 2YUVA 4D2NA 2LAGB 4WEUD 4M93B 4C4KT 2E7LA 2GSGB 4PB9L 3T8XA 3MO1B 2EE9A 4D9RD 1DQQB 2L4OA 2OSLA 4OF7A 3DURB 3QYCA 3HPLA 2P5WD 4G6KH 3KLSA 4GG6B 1PD6A 2DI8A 5ADPL 1A5FH 4OLZH 2ILLA 5I1KL 2VOTA 2VDRH 1LD9B 1IGJA 2YD2A 1JGDA 3T65B 3X11B 2HN7A 4G9FB 4LHUD 4MXVE 5I1CH 2APVA 4JDTH 1EEYB 2OZ4L 3EOAB 2NY4C 5AZEH 5C08D 2EKJA 4LQ1A 3VFNA 4M7ZB 5IHLB 1J0KA 3QQ4B 2MQ3A 5HHQB 1GOFA 4IIQC 3V5KB 5I8KL 4PJAA 3LS4H 4HJGA 3HMXA 1V5JA 3ZE2F 4WY7L 5JHDD 4Z0BL 1QHPA 2W0FB 1KXTB 1G9EA 4XCNB 1AD9A 1UWGL 4ONGH 1OT2A 1I9JH 3U36A 1AP2A 3RZCD 1S9VB 5IB1A 2A9NL 1CR9H 1RPQA 2Y1VA 3HHRB 1NGZB 4LFHD 43CAB 3G9VA 3IDNA 1F4WH 5HGAB 2Q6WA 3W5NA 2W0KA 1T7VA 2BNQB 5JIPA 3C09C 1QSED 3MRGA 4WENB 4YQXL 1LK2B 2D0FA 2XZZA 4M7KL 4BA8A 3MQIA 1KTLB 1ZHKA 4ZFZA 2HT2D 2C3VA 1MHPH 4H5SB 1T4KB 4LMQE 4OZ4B 4M03A 5GS0H 1VFBB 4BZ2H 4LLUA 1NAKL 3WNPA 2IBBA 3CVIH 4AQ1B 1K4CB 1PBYA 1E4JA 2OBGA 3P9MB 1T22A 5EU6A 2XRAH 3AS3A 3UPCA 3T0AA 4XCFL 4ZUUA 3RNQB 2NY1C 4DGVH 1F8TH 5CBAA 2V5YA 3MRDB 3C5ZC 5DFTA 5FYJL 3THML 4JQIH 1VPOL 4XPAH 3JWDC 3UC0L 2P5WA 3BPOC 5IVXA 3EO0A 1QVOB 3IJYB 1NGPL 4YHML 4PGBB 3H42L 3ARBC 1F58L 3UBXB 4LHUA 4WU7A 3RA7H 3BEWA 4DKFL 3S88H 4D9LH 2GT9B 3STBA 1U8IB 4QRRD 1TCMA 4HWBH 4Y0GA 1NUFA 1H5BB 4KJQC 5FF6A 2MQCA 3U0PA 2ZG1A 3P2TA 4PRHE 4Y5VB 2ZUSA 2HLAA 2UY6A 3CPLB 1KUMA 2I07B 5F3HB 5JHDA 3D3VB 4H0IA 2UZYB 1P4IL 3GI9H 3MLYL 2NX5B 1NJ9B 3RZCA 4KVNH 3RDTC 4HEME 2PKDA 3VFUA 1BD2B 1YA5A 2HMID 4NFDA 5B22A 5EOCJ 15C8L 2EDLA 3EFFA 3CUPA 4APQD 2Y06H 4F7EB 3MLTB 2IQAA 3DMMB 1YPZB 3FOLA 1UACL 4D3CH 1A0QL 1FAKT 5B38B 4HG4K 1B0RA 1YN6B 5ERWB 4UV4H 3MRLB 4LGRB 3NIDF 3VXRB 2ZPKH 3QIUC 3PWUA 1BHGA 4P4RB 3VH8G 1T2QH 5K9OB 4YE4H 4IEFB 3N1GC 2X1QA 5DJCA 2GITA 1YC8A 2NZIA 4KUZH 2GIYA 4PGZA 4MGXA 3B2UD 4XMPL 3BGMB 3KPMB 3UDWC 2ZOLA 4ZFFB 2V5MA 1EO8H 5HDQL 3T1FB 1HQRB 2Q87A 3ARVA 4P2QB 3PG2A 1OB1B 1P7QD 3JV4A 5ANME 5C86A 1KCUH 1CICD 4NZUH 4FFZL 3A67H 1HZHH 1QEWA 2DJUA 4P2RD 3QWOA 4XAWH 1NMAH 1M6OA 4M5YH 3GSRA 5ECJE 2EEDA 1JUFA 3LZFL 3DVGB 4QRRA 4OLVL 4KK6C 4OM1H 5GS0D 8CGTA 5CD3B 3FFCE 3SGJC 3LQZB 2A6IA 4X6DA 3RY5A 2I26N 1MF2H 5FK9A 5FKPB 3IFPB 1MCWW 1CLCA 3O3EA 5I71B 1EIBA 3HZYB 5C0IB 5C0CE 3UZQA 4ELMF 4ZDHB 1A7RL 4KJWC 1CG9B 4IOSD 4H20H 1AR2A 4JG1H 1QO3A 4XPBL 3QO1A 4HD9A 4XVUC 1KJVB 3FO9A 2FZ3A 3OG4B 4YBLC 2LU3A 3MGOB 3LKRA 4I18C 3RPIA 1R5IA 4YUEL 2QL1A 1OP5K 2MPAH 3P0VH 2W0LA 4EEEA 5FM5M 1KC5L 5GJTL 4FQXC 1BWWA 4HZLB 3P4OB 1TETL 3BAEL 3EYVA 3QBTB 2CXKA 2A6JB 1LP9B 3ESUF 3KYNB 1HEZA 1F02I 3MZGB 3QUYA 4LSPH 4LRIC 4MQTB 2VISB 4ZSOE 1CICA 1QLFA 2VRAA 2O61A 5TE6H 4IRSB 4ODXA 4P2RA 1ZT7B 3QNYA 3FQNA 1FYTB 3P4NA 3SY0A 1EUUA 4Q2ZA 3BHBA 1D5XB 1HSBB 4Q0XL 5F88A 4JZNA 1QRND 5EUOA 4R3SB 4JDZB 1JV5B 3N85L 1KIQA 5EBMA 1J0JA 5E8DH 1A6TB 3EYUL 3S5LB 2XWTB 1KIRB 3C2AL 1VHPA 5I8CB 3C60B 3GKWH 3ARFD 3MRMA 4PRPA 4UZGA 4J6RH 2EZ0C 2VLKE 1EDQA 1A6UH 1ZT1B 4GKNB 1OAUH 4WW1A 1BOGB 1YY8B 4PJXA 4EQ2A 1T1ZA 3ARUA 4PJBF 3PP3K 3BZ4A 4HWBA 3ZKXB 3O3AA 5FYKH 2P8PB 3RVWD 3QWRD 1T20A 4RAVB 4OD2B 1RZ7L 1NCDH 2FR4A 3RUGB 5DHXB 3NFSH 4ODUA 3IETB 1BVKA 2HLFC 3BZDA 1XGQB 2ZUQC 2D31A 4YO0B 1VERA 3SKJL 1JHKH 5HD8C 5I0DA 4Y4HC 1AFVH 3GBML 2VDMH 1OAQL 4AENA 2QSTA 1S7TB 5FO7A 2DQIL 1CL7I 1GVIA 5A16A 2XPGA 4F7PB 3HC3L 3KPNA 4OD1L 5HYQA 5IMLA 4NNXA 4KAQL 5GSVA 2VLME 5C0ND 5E4EC 1P2CA 3GSOA 4G80A 4J4PC 1I9RH 4MMZC 3RL2A 1DQML 1ZTXH 3DETC 4BQ9A 2HFFB 4EBQL 1JHTA 4NN5B 5D7JB 4P2OD 5EC2A 5F7KC 4GXVH 4XWOC 1QRNA 5D2LA 1CFVH 2VDQL 4NQEB 1T03H 3MV9B 4N0CC 4NQCD 5E2VL 5MERB 4H1LA 1CVRA 1OTSC 2H1PL 5C09A 2BNRB 2ARJQ 4CNIA 2VLJE 4UNTA 3WFCH 3WDIA 4OGYH 3MFFB 4GOSA 5ICYB 2HG5A 1BX2B 4PJEA 1JZ3A 2F19L 1OSZA 3ARFA 4RCAA 1AGFB 5TE4H 4M4RA 3BISA 1IAKA 1DQDH 4AT6A 4Z7VE 5F7HA 1YUHA 5AWNH 2Y6SC 1A6PA 1A9BB 4QWWC 1MAML 2EDWA 4AM0B 1LE5A 1XIWD 4OZGB 3QEQB 4FXGB 4DGYL 1MFDH 2F58L 1ONQB 5E08L 3OKYA 2J8UF 4HCRH 4XC3L 1G7QB 1WUNT 3IDYB 5D70L 3AREC 3QWRA 4LMQI 1R5WA 3TIEA 1KEML 3DV6B 4TN9A 3QZWB 1UGNA 1UYWL 4OKDA 5EPMA 1H3GA 4NC1C 5JQHC 1EGJL 1MIEH 1I8LC 2P5EA 2R0WH 3SJVE 3T09A 3W0WB 5EO0B 1P69B 3GK8L 4O2FA 3L5XL 2R1XB 1E4WH 2EDEA 5D6DA 3VI3F 2CO6B 5JXED 1DDHB 1TVDA 2YSSB 1AIFA 3DLQR 4JG0L 1L9MA 4OV5A 2M1KA 5GRUH 1KJMA 3HUJE 1HE7A 1Q9OB 5CEZH 2DQDL 3H3PH 1BJ1J 2VQTA 4F33B 4YFLI 5FYKD 1T83A 3TBYA 2XQYK 1MNUL 3DVIA 1NAMH 3DROB 5EZOL 3JVGA 3C5JA 1MJ8H 1MUJA 1QBLL 1S7UB 3CMOL 3PWJA 3CSYA 3DRQA 3QRGL 2I5YH 2QSCH 4MXWL 3ZL4H 3QULB 1WAAF 4G8IA 1C5CH 1TIUA 2C1PB 1FVCB 4V1DE 2D4FA 1RIUL 1OGAB 4I2XB 5GGTL 3CFBA 4EN3A 4P57A 1N7MH 1QBAA 2YEZA 4HPYH 2V5TA 2GEEA 4MJ2A 4PGDA 3MNWA 2VDNL 2A83A 3GNMH 2K7QA 2B20A 3RVTD 1RK0B 4LDOB 2ORBL 1BLNA 3DNKA 3CDGA 1UXSA 1SYSA 3SE4A 1CGUA 4S1QL 1CFNA 3UYPA 4KGLA 4OFIA 4JPIB 5KS9F 1DE4B 2H6PA 4HFUL 2E7HA 3UXFA 4KQ4L 3MRRA 3R8QA 5DO2C 4X8JA 3SDYL 2UUDK 1BQHG 2IADA 4JANB 3P4MA 1KJ2H 8FABA 4DVRH 1TVBB 1H3VA 1Q72L 4I5BA 4G8EB 1JNHB 2AV7A 3K8MA 4YHIB 3SGEH 3AB0C 2HTKD 3O4OC 5HBBA 5D2NC 5JXEA 1NC4D 4K8RH 1XGTB 2NXYD 3B9KD 1FN4B 3CFKA 4N1EA 4NKMA 4J2XA 1DCLA 3E2HB 5IKCB 3IDJA 1Q0YH 1NMBH 1RZJL 1JNNH 1DBJL 5EOCH 4YX2L 1BOYA 1NSNL 4QTIL 4U7SA 4CU8A 4HXBL 4FXKA 1JIBA 2NNAA 2VWEC 4BQ8A 1ZT4A 3CK0H 5F1SA 2PYEE 5BVPH 3PDOB 1QR1A 4JVWA 1F4HA 1VCAA 5CJOH 1CE1L 2AJ3B 5DXWA 2BJML 5IK3B 1NBZA 1E0OB 4Y2DB 4GRWF 4R97B 3WJJC 4QTHA 4NO2A 2A6KA 3MGAA 5CEZD 1I9IL 1ODAA 4Y4KC 5JORB 1PJ9A 5C71A 3ULVF 4R4NC 4DTGL 4DQOL 3E8UH 4QKXB 4Z77A 4HIIA 5BV7C 5K9JL 3H9SA 5CEYA 2FIRT 1LO5B 4HT1L 3MMEA 4CMMA 4LLYB 4PJ9D 5I66B 1XGRA 4OZFB 4ZPTB 3MLSH 1PVHA 2VL4A 4MNQE 1ZVSB 4PJ7B 4K7FB 1WTGT 4XNQB 3BT2L 2ZJSH 3DYMA 4HK3N 4NWUH 5D93C 4YXHL 1D3CA 5DWUH 5ESQB 1HIMH 3X12A 5C0GB 3RVUC 2VYRE 3OB0K 1A2YB 4PRBA 3O8XD 4RGNB 4GAYA 2COQA 1DEEA 5KN5B 2FGWH 5MHSD 4ZXBC 1MFBL 2AJVH 3B9KA 1SEBB 4JGUA 2CDFB 1B6UA 4OZHA 5F96H 4ZNCD 1BECA 4XPHL 3ARRA 3MLXL 5JIIA 1V3LA 1JE6A 5CSZB 2R23A 2ERJB 4FZEL 5GGSB 4HCRA 3VJ6A 2PCPA 4ZS6C 1ZXQA 3BZFB 3WFDL 4GKSB 1T80A 3ZSTA 2JCCE 4PP1C 4LSDA 5I74B 2JIXB 3HE7C 5BRZE 2MCPH 4YBQD 4P3CH 2CDGB 1UA6L 3T0ED 5ENWB 3QDME 4BUHA 5LWYH 4LVHB 5F9AC 3G08B 5CZVL 1FC1A 5LGHH 3DI2B 4K8RD 5EBLA 1A6ZA 3ROLB 4QRQB 3TIDA 3G6JF 4NDMA 3FOMB 1AKJD 2CMRH 2Z91A 3KJ4B 1NCWL 4U05A 4AEHH 1FAIL 2ZSWA 1NAMA 2Y07L 3HB3C 1MCCA 3ZDXE 4JJ5A 3SDCC 3VCLA 4KHXH 4H26B 3JTSA 1AJ7L 4KTYA 4TRPL 4OLWH 1HILB 3V7AE 1IC5L 3VW3H 1EEQA 3FT3A 5DJDB 1TQBC 3N50A 3MGTB 2ED9A 3S34L 5C0RL 2MSPA 2CIKB 1NBVH 1A14H 2FX9L 2X4OA 1UJ3B 2DIJA 1MHCA 5C0DB 3BP7B 5IBUG 2DLHA 1G7LB 3GMRA 4EOWH 1EHLH 3NH7H 3O3UN 3DX8A 2JB5L 4NP4H 2EIBA 2BSRA 1S9XA 5IVZA 4FG6D 3UO1H 3MOBH 3MXVH 4PRDA 1F2XK 1AXTL 3BE1H 3IYLW 5D5ME 2FWOB 1CGSH 2QKIA 3LKSB 4OBRA 1F6AA 1OT1A 1F4YH 1WCBA 3HE6C 2VLRD 5D7LB 4WV1A 5AYQA 5HHXL 1KJ2A 4D0DA 1CD9B 1VGKB 3BH8B 1U93A 2QV2A 4X4ZA 1I7ZA 4LHUG 3RAJH 3BIKB 1NCCH 1HNFA 2QQNH 5E9DB 5GIRA 4AYFA 4X83A 1XR9B 1U6AH 4LPYA 4YDLC 1F13A 1QPPA 1MH5B 4HUVA 3P0YH 1OP5H 3UCRA 5I16B 3PQYE 4P2CG 3S4SA 2DQFB 4Z7UF 1JK8A 4I77L 2D7MA 4JE4B 1AQDA 4H0HB 1AKJA 4EUPH 2K9UA 5E8OA 2X9YA 3FQWB 4KK8D 3DUSA 3TN0D 5L8JB 2C7UB 2XWJB 4XP5L 4K3EH 2Z31A 5CGYC 2VH5H 1FZOA 4NO0B 4NCC1 5DVLA 3BQUD 4KVCL 2I27N 4QF1A 4IDJL 3SE9H 1K8DB 2DLGA 3C5SA 3CC5B 5D1QB 4LCIH 4LLQA 4RISH 3EFDH 5DQDL 1PY9A 1HKLH 2P7TA 4OCWL 3CSBA 4JFXB 3DIFA 1G1CA 4LKCB 4JFFD 1VGEL 2VUOA 1TZIB 3ZTJG 3AROA 1UB6B 3LKPB 1BGXL 4G6AC 5EN2A 4D8PB 1ZAGA 3TWCL 3QCTH 3VFSB 4WTWA 3BX7C 4KROB 4XVTH 3L7EB 1MFCH 4Q9RH 4E5XB 5DK0B 3Q6FB 2X4NA 1EJOH 2C3WA 4HWEH 3CXDH 2PTVA 1DBAL 1P84K 5HYIA 3KNBA 1FL3B 1M71B 1H3UA 1FH5H 1KIPA 1J7VR 2FEEL 4CDGC 4F9LC 3MBED 1MCHA 4JB9H 3HI5L 1SJXA 3FN9A 3SQBA 1JJUA 4JR9H 4H88H 1RUMH 1P5UA 1N3NA 4O02H 3PP3H 4L4TA 3D2UD 3EOTH 4B7LA 3ISWA 2JTDA 5HI4D 1BBDL 5EORH 5D7IB 1JP5A 5IQ7L 1M7IB 4WIQA 2GJZB 3DSFL 3TVMD 4N5UA 4P4KB 4PFEA 4JRYB 2HJLB 3TJHD 3G6JB 1R6VA 2VAAA 3AS1A 2CIIA 2OL3H 3TN0A 1RJLA 5ACZA 3D48R 1UEMA 4MCYA 4OIIH 2CQVA 3BQUA 3BUYA 3D18A 5JHLL 4OLXL 1S7VB 3KPQB 1EBPA 1U3HB 4XP9H 1E4XL 4OCXL 4OTXL 4S1RL 4HKJB 1UB5B 1JPGB 2NY6C 5T33H 4A6YB 3GSUB 3VFTA 1T0MA 4GUPA 4TTGA 1BJ1H 5LG1A 4O2EB 1HXMB 1T0NB 4UBDD 4WU5A 3WO4C 5DLMH 1NCBH 3D85B 2PO6C 2BMKB 1DUYB 4FTVD 3QG7H 5E1AB 3BZEB 1X5AA 3D5OF 1EPFA 3O6FD 2X4UB 3D0VB 1D6EA 5F7EL 3R8BB 1XGPA 4YHNB 4XNUL 4OAWB 3OX8A 4PB0L 3MBEA 1DBKH 5DZNA 4RAUA 1ES0B 1MPAL 4UMGA 3IFOB 1YEKL 4I4WA 1Y0LA 3QHTC 4M62L 4TTDD 3CCHB 3D2UA 3GMLA 3TO4D 3D0LA 1NEUA 1NEZG 3LAFA 1N64H 3P73A 1JN6B 3BEVB 4BZ1L 4KMQA 5TQ2H 3V7AG 2ATKB 4NQDB 3F5WB 5EUKB 1JTTA 2A73A 3K2UH 4XNZB 4LDLB 1B0GB 3TVMA 2V7NA 3JTTB 4XBPB 1GPOH 1I3RB 1YN7B 2R8SL 3GMNA 5T5FL 1M4KA 2ZCHH 4QHKI 4Y16D 1ZKAA 1ZHNA 2CKBB 2MCG1 2F8XC 4GG6E 3MUY1 4ZSOA 1L6XA 3V6OA 5TQ0H 2QADB 3B5TA 4NGHH 4K9EC 5F6IB 1LNUB 2NW3A 4HHAA 3KLDA 1G9NH 1RUAL 5FEBA 3HRZB 2EDJA 5ELIA 3SDAB 3FONB 3TC9A 4WFHD 2WMPA 3ESVF 3CZFA 4FQPA 3KPLB 2KZ1B 4TSCH 5EO9A 2AJXL 3GJFK 4GQPH 3WXWL 1JFQL 3E6HB 1G6RH 2ADIB 3T0BA 2MMXA 4KJYB 4FTVA 4HWUA 5F1IA 5KSBA 1JGEA 5DUBB 5TJWK 5KJRH 4ELKB 4PJ5D 4BSWA 1OSPH 1W8OA 2W59A 3LPWA 1OW0A 4Z78A 4XNYL 1I7UB 5ICZB 4OF8A 2OTUB 4FXLA 2B4CL 3DBXA 2XZQL 3MRNA 3DV4A 1TNNA 3I50L 3TO4A 3BPLC 5IIEB 2R56L 4JAMA 4IOFD 5IG7B 5ADPH 3E6FA 1T89A 5I1KH 2WK2A 4I13B 3ZDYE 1RMFL 2CXGA 2UUDH 5DMKB 5J6GB 3VWKD 1ORSA 4JVPA 3O81A 4PJFE 4OF6A 4Y16A 2PTTB 2GK2A 5BOPA 4KMTL 4MJIB 1MCIA 4LU5H 5I8KH 1AD0B 3EYOB 3QI9C 4ZUWA 2O5XL 5BVJB 3V4PL 4WY7H 4JFYB 2Q3AA 3TJEL 4ERSL 4MJ5A 1H3WM 1UWGH 3VGAB 3KLHC 1X5YA 2B1HL 5L8KB 2A9NH 3PJSA 4YEFA 5IOPB 5E8NA 5DC4B 3WIIL 3QH3A 4HIEB 2ATPA 1RIHL 1AC6A 1JGLL 4I0PD 4U6XB 5FHAL 4YQXH 4M7KH 4JFDD 4UUJB 2H2PC 1I7RA 2B1AL 1G84A 4PS4L 3OJDA 4KI5E 2VLJA 1DBML 1RJYA 2BC4A 3QNZA 3EYFB 3HZKA 5C0JA 4GRWH 3S36X 1NAKH 4KKLD 4EDWL 3RWDA 1YJDL 1OAYH 3VXSD 1A6VL 1Q9WA 2KL6A 1CFQA 4WUUA 4QRUB 4U3CA 1MI5E 1NANI 4XCFH 3ULVH 3FQTA 3UPRA 3VXRE 1KYOJ 3L3GB 5MEQB 1FO0A 1IRAY 1VFAA 4F57L 5FYJH 1X5JA 4YK4B 1AO7D 3THMH 3SDXF 1DVFB 5TDOB 3L1OH 1VPOH 3DHMA 3UC0H 5DUPL 3AMKA 4BQCA 2EYTB 5DGQA 4XAKD 1NGPH 5IB4B 4BM7A 3RNKA 2OX5A 3DTXA 1DLHA 4PTTA 1F58H 4LSTL 5GS1B 4NKDB 1ZHBA 3VWKA 5J12C 1A64A 4YHKL 4DKFH 5IWLA 5D6CA 4LSQL 5IFJA 5HGBB 2NCMA 1C8PA 4LCUB 4P23B 3RWHB 1N5YL 3PHQB 1D5ZA 4PJGA 1JRHH 3VXOA 1F2QA 4N68A 4YC2B 3VWJB 3MUGB 3WEXA 3VU2A 3D39A 1P4IH 3ABZA 1J10A 3MLYH 3UYOD 1AXSA 4PY7A 1MCSA 5TH2A 5CS7A 3V5DB 2I60L 4MD0A 2FSEA 5D8JL 5IHUH 5DS8B 5JPMA 2DQTL 1ZMYA 4L9LC 4I0PA 4P0DA 3QNXA 1A0QH 1R3LA 3F7VA 5H2BA 2G2RB 5DMGD 4LAQL 3EKCA 4LLDB 2YPKA 3WLWD 2BOBB 1CGWA 4N8VA 4ZOCA 4TOYL 2NR6D 1Z0NA 4V1DA 1R3KB 2MHAB 3KPSD 5AUMB 4XNMA 5F7LB 3N1QC 4XMPH 2DN7A 1FPTH 3FO2A 1OLLA 2R29L 1MJJB 1YMMB 4ZNEA 5HVHB 4F58L 5KZCB 3RWJA 3MLUL 4PLNC 5HDQH 5DJYB 1E27B 1INDL 1HCVA 2NXZD 3TBVA 5F44A 1OM3L 3TP4A 3GHBH 4IIQB 1EA9C 3TZVB 4X98B 1GGIL 3GSVB 2L0DA 4FQQA 1EFXB 3RGVD 2CRYA 2X1XR 3V4UL 3STZA 4FFZH 3LEYL 4TNWK 4YDJA 4CW1B 3MNZA 3B5HA 3RZCC 1L7IL 1MCNA 2ICEA 1H15A 2LE9A 3NZ8B 2JF1A 5HYSB 3FZUD 4GJTB 1GZQB 4U1KA 1MLCB 3O11A 1S9YB 4OD3L 4PBVC 5A1AA 1PY4A 2ARJA 3DSNA 4EVNA 2HT2C 1FNFA 5EDXA 3ULVD 4QCIB 1M7DA 5HHOD 1FIEA 1YEJH 1ZGLM 3S3SA 5FYJD 2Z93A 5J9PB 4RMTA 2BOCA 1RHHB 3MFGB 4ODBD 2C26A 3DJ9A 1G7IB 3SBWA 3IXTB 4IMKA 4LCCB 4NZTL 2IALA 2NY1B 3BW9A 3MRKB 4JRXB 1CDYA 3GSQA 3JWOC 3ZHDA 2YD3A 1IM9B 1MHHB 3C5ZB 4XPBH 1I1AD 2OZ4A 2EC8A 3CH1B 1F5WA 1RZIB 3N1MC 4UINL 5EU3B 5IEKB 2OP4L 1QLRB 1WWAX 3BPOB 3FB5A 4JQVA 2EDRA 1BZ9B 4AH2B 3MJ7A 1ZLUK 2DIBA 3CX5K 4P9HL 2XYCA 2EE2A 2K3TA 4YUEH 2GKIA 4GAJL 4F3FA 3ARBB 5C0EA 2HVJA 1KC5H 1ZWIB 4MAYD 1FCCA 5IQ9A 4UT9L 3SE8L 1KENL 2AK4E 3HCVB 1TETH 3BN3B 2X4TB 3BAEH 1RZ8B 3C8HA 3NIDE 1UZ6E 2PUQT 3NFPB 4HWZB 2FO4A 4JJHA 5KG9B 3GM8A 3JV6A 1IQDB 1CDIA 3BFOA 1OF2A 1ORQB 5BS0D 3M8OL 4G8GB 2X6MA 3RUGE 3RGVA 3MV8D 5ITBL 1I4FA 4G3YL 5DRNB 2Z4QA 5TGBA 4JFFE 2JJVA 3BKYH 1FQ9C 3U79A 2HMIC 2BZDA 3GGWB 4Y5XB 4TVPH 1RI8A 5FCUL 4GMTH 2NLJA 4APQC 5I1DA 3QFJB 3MLRL 1I1YB 4PJCB 4L8SC 1CK0L 1Y18B 3LMJL 3N85H 2Q7YB 3UTTD 2J6EH 3WFHA 5HHOA 3BMWA 4JFEB 1XCQA 3EYUH 2FIKB 2JLLA 2HRPL 1Q9KB 5DQJB 5C0AB 3GMMA 2HVKA 5CJBA 1UM4L 2QSVA 3MA7A 3B3IB 2E8ZA 3B2UC 2YD1A 3O3DA 1RZGB 3F7QA 3QDJD 4HGWB 4LPVA 4NQEE 5ESVA 5MENB 3PWPE 3MRQB 1BZQK 4X7EC 4L8CA 1GC1L 2JCCA 2BNRE 1TLKA 4MWFB 4QT5B 5B3JF 1I1AA 1DL7L 4ZAKD 3L3DA 3SGDI 2XKNB 5H94B 2GJ6D 3LRSB 1YNKL 2HFEB 1NCAL 1CICC 2XG5A 4ELME 1RZ7H 3SCMA 2EIDA 3U6RB 2CKBL 1NFDB 2F53D 3ZYOA 1KGCE 2ZKHH 3SKJH 4NRZA 4MA1C 4E41D 5K9QI 3QEQE 5GS0C 4UQ3A 1I85A 4M6NL 3GBMH 3LQAL 3R06A 1OAQH 4U4BA 3Q5YA 1NLDL 2DQIH 3IT8D 4BSVB 1EK3A 4OCSH 4QHUB 3WUWA 5HGHB 5BS0A 3OWEA 3AMLA 4OD1H 3KPOA 4GQ9L 5JR1H 2YOCA 4C56B 2Z35B 1K3ZA 3QPQD 2DJ4A 1HHJB 4ODVL 4ZO8A 5DRZA 5HSFA 4P5MB 2ZG2A 4ORZC 1RU9L 5D1ZA 1MCQA 5DHVH 1L9NA 1IM3B 1GGCH 4G43A 3UTTA 4WI9A 2H1PH 2BY3A 4DWHA 3UBXI 4YBLB 4DN4L 3L3JB 4U1LB 3UTSD 3BIAX 2F19H 4I18B 2BNUB 3WJLC 1U2HA 3QQ3A 3VA6A 3QDJA 4EZMA 2APFA 1KEGL 1C08B 1UCBL 3EO1B 3UROR 3G5VA 4FQXB 1LEGA 3BP4B 1HI6B 4NHUB 4PR5B 2F54B 4CRPA 5F9JA 2D0HA 2ESVA 4NPYB 4X5WA 1KNOB 2GJ6A 5BZWB 4GW1B 2W92A 4DGYH 4JFQB 3O3BB 2F58H 3V0VA 5E08H 2YPLD 2AK1L 3AU1A 4XC3H 1RK1A 4TULL 1KEMH 3F65A 1VADA 4LCWD 5E6ID 1PZUB 1UYWH 1RZKL 2FX7L 5E70A 1KLUB 5GSRB 1EGJH 2G75A 4R0LA 1DQJA 1TXKA 3GK8H 1G1YA 4HBCL 1GGYA 3SGKA 4KK5D 3L3IA 4PJBE 3BPCB 4IS6B 4ZOAA 3TBSA 1MCWM 4JG0H 4RWHA 1J05B 3B6SB 2VE6B 5K9KA 5E2WH 4GBXA 3UTQA 1EZVX 4WFHE 4JM4H 2J8HA 5AG8A 4WDIA 4QXTB 4XVSL 3T04D 3TNMA 1RUKH 1MNUH 3QCVL 4MD4A 5JDSA 1JYNA 4Q6IB 4UDUA 3NCBB 5KSUB 1QBLH 4ISVB 4M61A 3CMOH 3GJFH 3VFRB 5TE7L 4OI7A 5HHNA 4PJ5E 1QSFD 2HJFA 4LLVA 2DMBA 3SO3C 2RR3A 1QA9B 3MRPB 1FJ1B 2B8OT 3RVWC 1OARL 5SWSA 1RIUH 2XA8L 4IDLA 3UTSA 2Y36L 4Q97A 5GGTH 1J8HD 5F9OL 3PL6D 3H6JA 4WCYL 3WD5H 2Z8WC 4WWID 2VDNH 1BFOA 1DEDA 4W68A 4Y4HB 3V8OA 2ORBH 4U1MA 4NT6B 2IBGA 5KSAD 4S1QH 2YPLA 1O0VA 2HT4D 5EWIH 2IPKB 3ELAT 3O2WH 1INQA 4OF5A 4HFUH 5TF1H 3A6BL 3K80A 4XNXH 4LCWA 4DVBA 5E6IA 5C0NC 4KQ4H 4F8QA 5E4EB 3KPRE 3SDYH 1QQDA 3BESR 1MSPA 1XF5B 2X4QB 3WIHA 3HAEH 1NCTA 2IWGA 4U6VL 3TH3T 2H32A 3KXFB 2IJ0C 5T3XL 3JVGC 4P2OC 2MQ0A 1Q72H 3OKNA 3TGXA 4GW5A 1JYXA 1YC7A 4X6CA 1HNGA 2J8UE 3S7GA 5HYJB 5DTFA 4FQHA 1CQKA 1WC7B 3KDMB 4CMHC 1AE6L 4LLWA 3HLAA 5ICXA 4Y1AD 2IPTL 4JFPB 2EO1A 4G9FD 2ICWA 1FLRL 1Z5LA 1QSVA 4HV8A 5A2LH 4JFDE 2E6QA 2P48B 3EOBB 4RGNE 1RZJH 5TFSL 1DBJH 4YLQT 4YX2H 3VI3E 4QTIH 1XIWC 3HMXL 2XZAL 1P5VA 1U8KA 2ZOKA 3MNVB 1NGXB 5C0BB 1QSFA 2PYFB 4LNVA 1MLBB 4YGVB 3MBXL 1R3IL 1CE1H 2BJMH 2XNAA 1YNLH 1J8HA 3GJEA 3ARYA 4DAGH 3T77A 5E00B 4JRWA 3MRFB 4FABL 1TCRA 2BNQD 5FYLE 1ETZA 2X1WL 4IMLB 1Z9OA 4J3WA 5EA0L 3C6SA 5L88H 4DTGH 5KSAA 5LGJA 4DQOH 5LQBL 4Z7WB 1DUZA 1WAAE 5K9JH 1HINL 3RWGA 2FX8L 5HI3D 1WFUA 3O6ML 3QAZC 1A1MB 4NM8L 1HH6B 1IGYB 3W82A 4QYOB 5SWQB 3RI5K 1TPXB 4ZQKB 2GSGA 4J3VA 5I1HL 1SY6A 3MO1A 4JM2D 4EUPG 1DQQA 3GIVB 2D9CA 3DURA 4MMXC 2J88L 3CGTA 4YPJA 5E2TL 1I8KB 1MFBH 2ID5A 5KS9E 3VXNB 4N8CL 4XPHH 1JZ4A 4TUKL 3MLXH 1LD9A 4HFWA 4F80A 3HG1B 3T65A 3X11A 3VDAA 1BVLB 3W39B 4G9FA 3QFDA 2VNCA 3MCLH 1EEYA 4FZEH 4JO2L 4RRPA 5GRYA 3WFDH 3CFEA 3DGGB 4I3RL 5F7MC 1U8LB 2X7LB 4LLAA 5SWZB 2ZNWA 3Q48A 3RVTC 2X5PA 5HHQA 3L6FB 3V5KA 3V5HB 3E3QE 4ZS7L 3BGFC 1MWAL 3D3VD 3KPSE 1UA6H 2W0FA 5T1MB 3LEVL 3PIQB 2YA1A 4XCNA 2NTFB 4P9ML 2NY7H 1S9VA 3BDYL 2OI9C 1BD2D 2BDNL 5F21B 4K3JL 1SBSL 43CAA 3V4VL 1A3RL 1LEKA 1QFWL 4HDIB 2BNQA 1LK2A 3QO0B 3WV0A 1NCWH 4PJDF 2HTKC 2DI9A 3AB0B 1FAIH 5AEAA 2RFXB 2Y07H 4H5SA 4QXWA 1T4KA 2AEWA 3B9KC 4OZ4A 1T0PB 1VFBA 3RPKA 3X13A 5DMIH 4TRPH 1IC5H 4GRWE 1U3JA 5JO5B 1H9VA 3S34H 5C0RH 3QPXL 4ZD3L 5IMMB 3MRDA 4JM2A 5GGTA 3ULVE 3GMPB 3ZLQC 3NIFF 5GJSL 4P2QD 3ET9F 3QHZL 4U33A 3TA3D 4QRPD 1BZ7B 1J5OL 2IMNA 4NJAH 4NQUA 4PGBA 1A6AB 4RGMC 4L29B 2JB5H 1JF1B 1Y6MR 2VDLL 2VXSL 2GT9A 4N9GB 1U8IA 3IFNL 3VH8B 2N1KA 1H5BA 3QDGB 1AXTH 3J7HA 4PG2A 3ORJA 4Y5VA 4K3DL 1LO3L 3CPLA 2I07A 5TDNB 2W60B 4Y4KB 5F3HA 3D3VA 3K7UA 2DF3A 4UIKL 4XP4L 5BV7B 1XT5A 2NX5A 2W9DL 1A47A 1DN2A 1WISA 1KTDB 1YECL 1BD2A 4PJ9C 2VXUL 1LE9B 1ZLUH 1A7NH 1J1PL 2PXYD 3WNKA 5DJXB 4F7EA 3MLTA 3DMMA 1YPZA 4I77H 4U1IB 5E56A 5B38A 4EDXB 1YN6A 4P46D 3TV3L 3O8XC 4R26H 5K9OA 1AI1L 4XP5H 2Y7QA 2CJUL 2BVYA 1LWRA 4U6HB 3VI4F 4IDJH 2H2SD 2WAHA 1K8IB 3BGMA 3KPMA 3G6JE 1T7ZA 5HVWA 1FZMB 4ZFFA 4S0TD 5DQDH 4OCWH 3T1FA 1HQRA 1PKQB 2CLRB 4YXLH 2HRLA 4P2QA 1PG7L 1S78D 1OB1A 4LPUA 3ZYZA 4PPTA 1NCNA 3DVNB 4U6TA 4LVNC 3HE7B 4L9DA 4QRPA 3T2QA 1BGXH 1MVFA 4G7VL 4WV1C 4YBQC 1J9CT 3T0EC 3O4LE 2BP3A 1SMOA 2IH1B 4IRSD 4J3UA 1GH7A 4HMEA 2XOTA 4B53A 1FYTD 3HZVB 1ZLWK 3DVGA 4I1NB 4K8RC 4LF3B 5IESH 1DBAH 3MV7B 4F8TA 1PGRB 5CD3A 3LQZA 5F3BB 1NDMA 4P5KB 2BXZA 5F7NC 5FKPA 2JELL 3IFPA 3FRUB 3IXAB 4G9DB 5EULV 1KSRA 2E9JA 2F53E 3RBGA 3HZYA 5C0IA 1ITCA 2B0SL 2OYPA 3UJIL 4ZDHA 4CN4A 5IQ7H 1D5MB 3H9ZA 1CG9A 3DSFH 4WWKD 4IHOB 2XZCL 1PZ5B 5LXGH 4WFFE 4WI3A 1CLZH 4L1DA 3UEZA 4PJIF 3JV0A 3IB4A 4HUUB 1KJVA 4NUJB 4KTDL 2X1OA 3MGOA 3VFWB 5IB3B 2AP2A 4N0UE 4OGAD 5JW5A 5JHLH 2DDQH 4HPOL 1B88A 5DEGB 1E4XH 3EUUA 4OCXH 4OTXH 4S1RH 4JO1L 4Z7UE 3VXTB 1F3JB 4M6OL 4HZLA 4XI5D 5FGRA 3P4OA 4GSDH 1RUPL 1YDPA 2A6JA 1LP9A 3O9WD 1FNHA 4MJ6B 5DR5L 3HE6B 4YEEA 2VISA 1JGVL 1A4KB 5HGGS 3FB6A 4WJ5B 5B4MD 3A6CL 5JMRA 1WIPA 4OQ1A 4IRSA 3VG0L 1ZT7A 1N59A 4HIHB 1P9MC 4XP6L 1JWUA 1T1YB 1FYTA 3KS0H 1VDGA 2B2XL 1V05A 3QUZD 1D5XA 2VL5B 1HSBA 3FQXB 5I73C 1P6AB 4U0RC 4WGVB 5F7EH 2CUMA 4HX1B 4A2MA 4TVPE 1J0IA 5ISZD 4PB0H 4MXQD 3MJGX 3MV9D 4JDZA 1JV5A 2ZUWA 3SKMB 5DJ8B 1VENA 3O6KH 5EC1B 1Z9MA 2FJHB 4KK8C 4PY8J 3TN0C 5T3ZL 2V2TB 2VDPL 1A6TA 3KR3L 3S5LA 2XWTA 4L3EE 3RTQB 2Y5TB 3QEHB 3DYOA 4RQQB 5I8CA 3BQUC 2R1YB 3N0PB 2VZ3A 1IILE 5FO8B 1GIGL 2OTPA 4GKNA 4AIZA 2CLZB 2Z0BA 5D4QA 1BOGA 1YY8A 4Y8AA 2R8SH 5T5FH 5F9DC 1MJ7L 3IDIB 5I8OL 2P8PA 5ID1B 5CZXD 3FO0L 4RAVA 4OD2A 3N06B 1FFQA 3S97C 4HC1L 3RUGA 3IETA 1K4DA 3OAZH 5J7CC 1XGQA 2A1WL 4YO0A 2L7JA 3W0WD 3ZE1F 5FDWB 3NN8B 1RUAH 2J1KA 5JW4N 1IKNA 4CN1A 3VFVB 4JY4A 3NABL 4MJIE 4YPGB 2HKHL 2VB5A 1S7TA 2ADFH 4WHTB 3MBEC 5IW6B 5L2KD 5D71H 3UZEA 2ICES 3DUUB 2HP4A 4AZ8A 3WXWH 1JFQH 4ESKA 4HXAL 2H9GB 2XY1A 4NBYB 3IRZA 1IAMA 4Z8FL 1LO4L 5HI4C 4GT7A 5I30L 1VA9A 4RNRB 5D7JA 4X99B 4XNYH 4XHQA 5ANMB 1G0YR 3TVMC 3ULUL 5IV2B 4HQQH 5ISZA 4JY6B 2A6DB 2B4CH 4ZFOB 3MV9A 5MERA 1A7PL 1HYSD 3S37X 5FFLA 2UWEA 3H7BA 2XZQH 2XTJD 3MFFA 1NQBA 5ICYA 1W72H 1AHWB 3I50H 2XT1B 5FAAA 2ITDB 2R56H 1E4KA 4X6BB 4G7YL 1AGFA 1GSMA 3WBDA 3ZO0A 5ACLA 5HGDA 4YDVA 1RMFH 1CD0A 1OQOA 5F7FA 2NY6B 1CD1B 1PG7W 1A9BA 5IGXL 5C6TL 1OWRM 4AM0A 1KTRL 1UFUA 4OZGA 3QEQA 4FXGA 4HJ0D 3CU7A 5JNYA 3I3BA 1ONQA 4UBDC 3Q0HA 3SKUD 4XGZB 1G7QA 3WO4B 2E8YA 4OF0A 5E5MB 2LU7A 2O5XH 3V4PH 5FCSH 2PO6B 3TJEH 3QZWA 4FQLL 4ERSH 4G8FB 3TBWB 2B1HH 1NGYB 3W0WA 3CVHB 3O6FC 5EO0A 3ZKSD 2BVTA 4DZ8B 3WIIH 2EYSB 2AV1B 4WO4D 4LLMB 5CIPB 1RIHH 5EH1A 4CAGA 3M17B 1JGLH 2IG2L 4Z7QF 5L2KA 3T0WA 4HGKC 1DDHA 3I2CL 5JIKA 2FBOJ 2YSSA 1QRKA 5K93A 4PJAF 2JKXA 4TTDC 5DD5L 1E6JL 4BSJA 4PS4H 3PABB 3TO4C 1Q9OA 1DBMH 1KPRB 4B5EA 4F33A 3DARA 2AXFB 2HKFL 5TF0A 1KXQE 3UTZB 3DROA 1YJDH 1A6VH 3C8KB 2E7BA 3U0TB 1M05B 1S7UA 5B21A 3T4YA 1JRHI 3ZDZF 3U30C 1BQHB 5DK2A 1FZJB 4Y16C 3KG5A 2DLIA 3VA2C 3QULA 2C1PA 3V6ZB 1FVCA 1XGYL 3GSNB 1OGAA 4I2XA 5DUPH 1WGOA 1SM3L 5CINL 4Y2DD 4YR6A 2NW2B 5H35B 1YMME 4LSTH 2VLLB 1Q9LB 4YHKH 1P6FA 1RK0A 3K1DA 1IGCH 1N5YH 4HKXB 3BRDA 4NZJA 1ZHLB 1CYGA 4JN2B 1GOGA 3MCKB 4JPIA 4POUB 4OM0L 2F5AL 2VLKB 5DZOA 4HS6A 1DE4A 4YNYB 3CSPA 4LGSB 4ZOBA 5IVXF 1YEIL 1QSZA 1CU4L 2OR9L 4JCLA 2YN5A 4BFIB 2I60H 2DKMA 1TVBA 4WO4A 2N7AA 4AL8L 1PEZA 1HCFX 2DQTH 4G8EA 4RDQF 1JNHA 4TSAL 4YHIA 35C8L 1KULA 3MSPA 1XGTA 1KBGL 4OFYD 1FN4A 3G6AB 4LAQH 1YEEH 3PHOB 3HA0A 2L7UA 2UYLB 5LBSL 4UAOB 3BPLB 4FQIL 4IOFC 4KK9D 3ZT6A 4TOYH 1A21A 2ZUYA 4X5XB 5IKCA 4D0CB 3VWKC 5IWLC 2EH7L 1YEDB 2W38A 3ARZA 2R29H 1UCTA 5DI8B 2JIXD 4OZIA 4F58H 4M7JH 1BIIB 5CD5D 3MLUH 5I8EB 5IP4A 1INDH 5CZKA 2R2BB 1RFDL 5IK3A 1GGIH 2BSSB 5DURB 3QI9B 1C5BH 3RX8A 5J8OA 3V4UH 4Y2DA 3LEYH 2DI7A 2YD4A 1DR9A 4NWTL 1H0DB 4ONFL 3HRPA 3FB7B 5E1HB 5EU5B 3G5YB 2DQCL 5JORA 3TPUA 1TVHB 1DBBL 3QXTA 1EVUA 1SEQH 1OHQA 1JPST 3TT1L 5JW3L 1CL7L 3P0GB 4LOUD 1H3PL 4OD3H 2DL9A 3T8XB 4R4FH 1LO5A 2DWEA 1E6OL 2UZXB 4LLYA 4Z7VB 5I66A 4ZPTA 4OZFA 1ZVSA 4PJ7A 3LPGA 4XNQA 3VXQA 1EEZB 4TSBL 4B0MM 2V7HB 1LDPL 5ESQA 4KKLC 4PJ8B 1IGJB 3QFJE 2EDQA 4K94H 5C0GA 2P45B 1TQCC 2YRLA 3ME0A 1A2YA 3ILQD 1YMHB 3X3GL 5IF0B 2AJUL 5KN5A 3N1PC 4MSWB 5I15H 1G9NC 5DQ9A 2CDFA 3QQ9D 4K23L 1EHAA 4JFEE 4X6DF 5IW1B 3IDXL 3DHJA 5IT2L 5C0AE 3SE3C 4PJAB 2KBGA 4UINH 4EXPX 2OP4H 5CSZA 3Q6GL 1F4AA 3TBTB 2YR3A 5GGSA 4P9HH 4PYHA 5B8CB 2FO1A 3BZFA 4MA8L 5T1DL 4G6ML 4GAJH 1AP2B 4GKSA 5J12B 1G7JB 4UT9H 2JIXA 3RU8H 3SE8H 1KENH 3QUMB 4W6WB 2EYRB 4Y19B 2CDGA 5ENWA 4KFZC 2Y4SA 4MQ7A 1N5AB 3G08A 4H8WL 1ZHKB 5E9DD 4ZFZB 3M8OH 4EI6A 1PKOA 4QO1A 3I9GH 3ROLA 5C2BL 5IBUB 4QRQA 1X5IA 1C16B 2NY0D 1BPVA 2XN9D 5FCUH 5FM8A 4L9LB 3SQOH 1FORL 1DN0A 3K4ZA 1KCVL 2F9BT 4V2CB 1BQLH 1UWXK 3WNMA 2WW8A 3FTGB 4LQFL 3CXHK 5DMGC 2WWKT 1CK0H 4YFDB 4RBPH 5DD0L 3LMJH 1BM3H 4M43L 3SHSA 3WLWC 1HILA 2P5WB 2X4RB 2LTQC 2NR6C 2IGFL 3QDAA 2HRPH 3E3QC 5DJDA 3KYOB 1T1XB 3EO0B 3MGTA 4KKNA 4L4JA 4OCLC 2VZ1A 1WITA 2CIKA 3LKOB 1UM4H 4KDTA 1UJ3A 4K71C 1QACA 4LHUB 4WU7B 1RJZB 2HAZA 3BEWB 1R5VB 3VDBA 4M7LT 3U0WL 4O00A 3BP7A 5C08B 3S35X 1GC1H 2GQHA 1OP3H 2K1MA 5EUOF 1QNZL 3U0PB 5HPMB 2NXZC 2BK8A 4LEOB 1U8HB 1YNKH 5I1LA 5CHNB 2WM0A 1CXLA 5BXFB 5JHDB 1NCAH 1CXEA 3H7LA 1OAZL 3NPSC 1J86A 4FHBD 5E2UH 3S9DB 3RZCB 2FWOA 1A22B 4ALAL 3OHXB 2DLTA 2IAMB 4GRLD 1KIUA 1YZZA 5D7LA 2DB8A 2P43B 2IQAB 4DOHB 3LQAH 4PJXF 1VGKA 3BH8A 1QSEB 2HTLD 1Q38A 4JGMA 4QXUL 1WBYB 5E9DA 1X3DA 3ULVC 3HN3A 4GQ9H 3TYGL 2D7QA 1MH5A 4E42B 5I16A 2DQFA 4PV8B 3RY6A 5CJXC 5DJCB 4WFGE 2DWDB 1N6VA 4P4KD 5JW4M 3GSXB 2DLEA 3HAEG 4JRYD 3I84A 3D25B 3I02B 4UOW1 2XWJA 1RU9H 3LN4B 1IAIM 4JKMA 4NO0A 1I1AC 1FNAA 1GRWA 5JW4Q 2P8LA 3HNSL 1CLYL 2VXTL 3OKEB 3S98A 1K8DA 2VC2L 4ZFOL 4DN4H 5CJQL 3KYKH 1AQKL 5D1QA 4N0YL 1QEWB 1C5DB 1KELL 5F8RC 2H3NB 5C2UB 5C70A 5GHWL 2AEPL 1VFUA 4JFXA 1OOAA 4LKCA 4MAYC 1KEGH 1UCBH 1TZIA 4QRRB 1MCLA 3LKPA 4MNQB 4W4OA 5D2LF 4EI5D 3ECBB 4MVBD 4W81A 3D85D 3SKOB 3L7EA 3DXAE 4DFHA 1OAKH 4X6DB 5E8PB 1R3HB 4E5XA 2E9IA 5FK9B 3Q6FA 4POZD 4TULH 4PJEF 1VEMA 5FGCB 3O3EB 1FL3A 1M71A 2YK1L 1CVSC 4GRLA 5A2FA 4APQB 3F12B 4HBCH 5B3JE 1KTKE 2IAND 1X4YA 4A2LA 4JO3L 1Z9SA 4L8SB 1QO3B 4M1GL 1F4XL 3T2NH 3QO1B 5B39G 5D7IA 5DMJB 4LSUL 4NQDD 1M7IA 2GJZA 2IH3B 5BRZB 3WSQL 2ADJB 1R5IB 2F74B 3BO8B 3OL2A 4P4KA 4XVSH 2X9XA 3O6LH 3QDMB 4O4YL 3NCYP 4JRYA 5ACMA 2HJLA 1DQLL 1D7FA 3QCVH 3TEUA 4O58L 4H25A 1DQTA 5HYJE 2A77L 5HDOA 3F58L 4ZAKC 3HI6H 1FGNL 1S7VA 4GRMB 1P7QB 2QADD 4QOKD 4X7SL 3DUHA 1U3HA 1ACYL 2WBJD 4DZBB 4HKJA 2XA8H 1JPGA 1QLFB 2O61B 5F9OH 4P2RB 4X0KB 5DF0A 5FYKU 3SDAD 4KY1L 2JJTC 6CGTA 1BREA 2CLVB 1NEZB 3GSNL 3P4NB 2YD7A 3AY4A 1B6DA 1QBBA 3BHBB 4MA1B 4O2EA 3FJTA 1HXMA 1T0NA 4X5LA 5F88B 1GHFL 3ULUF 5C0BE 4K9EL 1DJSA 3D85A 3V0WL 1Q0XL 2BMKA 1DUYA 3P30H 1F00I 2CK0L 2FRGP 5FUOH 2BVPB 1JVKA 4PREB 5E1AA 3BZEA 4CADB 5FUCC 2X4UA 4NC1E 3A6BH 1DLFL 4GKOA 3D1MC 1OQXA 3QPQC 3RHWF 4M9PA 5CLTA 2WUBL 5I1GH 4BJLA 4FQJL 3HS0A 3MRMB 3QIBD 4U6VH 4IRJC 4NKIL 1ES0A 3FAWA 3IFOA 1FCGA 5T3XH 4Z7OF 4LASH 4MAUL 4PLJD 4Z7WE 4NRYB 4YHLH 2CR6A 3CCHA 2ADGB 2UZIL 4JKWA 4RFOH 5D5MB 1JN6A 3BEVA 1EO7A 4RFEB 2WNGA 2I9LB 1AE6H 2ATKA 4NQDA 3F5WA 5EUKA 1M1SA 2IPTH 3VGDA 1S7XA 1B0GA 1FLRH 1T20B 2FR4B 4ODUB 3JTTA 4S2SB 1I3RA 3WDHA 1YN7A 5DRWA 5LAXB 2D31B 3G5XB 4ODTL 5TFSH 2NY5L 3NIGF 2CKBA 1BEYL 1MRDL 3ILPB 3HMXH 3UJJL 5IBLC 2WIMA 3HG1E 4KJPD 3NTCL 3C08L 1R3IH 1LNUA 2WBJA 3QT2A 4FA8A 4EKXA 1ED3B 5HYQB 1PDKA 5CWSB 4JHAL 1CDHA 5E6IC 4HKZA 3SDAA 4F2MA 5SWZE 1XMWA 4HJJL 1N2RB 5GZND 3RL2B 5F1NB 4X80L 4FABH 3KPLA 5AYUL 3E6HA 3HZMB 2VXQL 3NMEA 3ARPA 2DQHL 4KK5C 4PLKD 3GM0A 4KJYA 5DVMA 5LQBH 5DUBA 4OKVB 3WHE1 2OJZL 4YH6A 2RCSL 2FDBP 2APWA 3O6MH 3L5IA 5A3ID 3IKKA 2AI0L 4PJEB 1I7UA 3MRIB 2ZSVB 1OSZB 2OTUA 4JFOA 2VABB 2HYMA 5I1HH 4FOMA 5I18L 1WEJL 2E6PA 1EERB 1FO0L 4OGZA 1YUHB 4I3SH 2OM5A 5D2NE 1UQSA 4GLRH 2I25N 1NUGA 1JNJA 1HDMB 5E95B 2J88H 2VERN 5IIEA 5E2TH 5FGBC 4LDEB 25C8L 4L1HA 4Y2OA 4L5FL 5IG7A 1BFTA 3SO3B 3VD4A 4TUKH 4DFIA 5ESAA 3WL9B 4HKBB 2WQRA 5DMKA 5J6GA 1S9WA 3VG9B 3FQUB 2GK0B 5EU7C 5F1OB 4WW2B 3PL6C 4JO2H 4PUBL 1R0AL 4I3RH 4ZO6A 5C07E 4U1NB 4G42B 3T3PF 4JFZL 2Q76B 1DANT 3SEPA 1AD0A 3EYOA 4ZS7H 5BVJA 1JPTL 1MWAH 4JFYA 2P1YA 4LSVH 2UV3A 3LEVH 3QEGL 2HT4C 4OZHF 5T3XD 3NCJL 4P9MH 1KPUB 3BDYH 5IOPA 4KWUA 2BDNH 4MB3A 4X7TB 4YIQB 4HIEA 4K3JH 3V4VH 1A3RH 3HTLX 4U2ZA 4ZOEA 3MTRA 4YHPB 4P2OB 3C5JB 4UUJA 3VRIA 1MUJB 2Y9RT 1T7WA 4RMRA 5H8DA 4Q9QL 4NQCB 2R0ZL 3K4AA 3DRQB 1A6WL 3EYFA 2IBZY 3OZ9L 4CMHB 1J1XL 3MLVH 3OAUL 4QRUA 1T04B 1X44A 1FL5A 1P1ZB 4OLUL 4C54A 2YEZB 3QPXH 4ZD3H 1NMCB 5MEQA 1DP0A 1WZKA 4HF5L 5GJSH 5TDOA 2BRQA 3QHZH 3TZVD 1XIWB 1MVUA 3MPCA 1J5OH 2EYTA 1UXSB 1EFXD 1D5BB 1CFNB 5IB4A 5ETUB 1XFPA 4L8BB 4UV7L 5GS1A 4NKDA 5C9JA 2VDLH 2VXSH 1Z2KA 3MRRB 3I6KB 4LCUA 4P23A 3RWHA 3IFNH 3PHQA 4MXVF 3EDEA 3VWJA 3MUGA 4PG9B 5DVNA 2AEIT 4PBXA 5JA9A 5EU6D 3ARQA 2R2EB 3LSOB 5GRVL 5ALBL 4XP4H 1MELA 3MRCA 1UJTA 1XGUB 3V5DA 1YECH 2XIDA 5HI3C 2VXUH 3MV7E 3G04A 4KKAD 1GOHA 5DS8A 3SN6N 3MROB 2G2RA 3P4LA 1ROWA 4KH2A 4XMKL 3C5ZD 4JM2C 3P11L 3TV3H 4LLDA 3PV6B 1WZ1L 1Q1JH 4XHJC 3HPJB 1NKOA 4XCYB 4DW2L 2HWZH 2BOBA 2CJUH 1ZE3C 4F37K 1S5IL 4YDIL 1PSKH 1R3KA 2MHAA 4X7FC 1DSFL 2AEQL 3QXVA 1X5KA 4R7NB 1MJJA 4XXCC 1YMMA 2YKLH 2G60L 2VSCA 1QPXA 5DJYA 4PRIE 1E27A 1BF2A 5CKAA 3QUKB 4Y5VC 5K33A 1JMZA 1PG7H 1UWXH 4IIQA 5FV1L 3TZVA 2NY3D 3O2DL 4X98A 4O5LL 3GSVA 4G7VH 1MCJA 3BGFB 1A7OL 1EFXA 1UM5H 4CW1A 4TUOB 5E99L 2OI9B 4CMMB 1EMTH 1YYLL 1XGRB 3KAAA 3NZ8A 5HYSA 1QYGL 3FHQA 2CDEB 3NIFE 4F15C 1MLCA 1S9YA 5EU4B 1XZ0A 3ETBF 2JELH 4LPCA 5HXMA 1AH1A 3VXUD 4GAYB 3CFDB 1DEEB 1NC4B 3GMQB 5DD6B 1RZJC 3GBNL 1UVQA 2B0SH 4PJFB 2J2ZA 4OZHB 5J9PA 2QLVB 3TESA 4R2GD 3NZHL 2NTSP 1RHHA 4DKEL 5JPNB 3LKNB 1QHOA 4K07A 3UJIH 5I1CL 5MEND 3LIZL 2JJSA 3IXTA 2A74B 4LCCA 2XZCH 4S11A 4JHZA 3MRKA 4JRXA 1OGTA 4HK0B 1IM9A 1MCEA 1MHHA 3C5ZA 3CH1A 2P8MB 4S0SD 1RZIA 4JPWL 3TA3C 5IEKA 1QLRA 4KTDH 1JZ5A 5T1KB 4NC2B 1BZ9A 1HYRC 3B4NA 4AH2A 1V7MH 3PF2A 4ONGL 4YZFF 3ARBA 4RGMB 1MWAA 1X9QA 3BRFA 3KGRA 2OJEB 4DEPC 1ZWIA 3ROOB 4JO1H 3LY6A 2X4SB 4PJHA 4W6XB 3HCVA 2X4TA 3DO7B 1RUPH 1RZ8A 4L3CB 3LDBC 1I8IB 4JEGB 3NFPA 5IW3A 5KG9A 4HK3J 1IQDA 5JW4R 3GEWB 1ORQA 4XBGB 7FABL 2EDYA 1JGVH 4G8GA 1K2DB 3A6CH 2ZSWB 1NAMB 4WVRA 1IAII 5DRNA 1MI5B 3VG0H 5I71C 4J1UA 1BJ8A 2AJZB 3NVQA 4XP6H 4PJ9B 3PWLB 3BKCL 3GGWA 1KXVC