3NRFA

Crystal structure of an apag protein (pa1934) from pseudomonas aeruginosa pao1 at 1.50 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
DAVMVFARQGDKGSVSVGDKHFRTQAFKVRLVNAAKSEISLKNSCLVAQSAAGQSFRLDTVDEELTADTLKPGASVEGDAIFASEDDAVYGASLVRLSDRCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords ApaG protein
publication title Crystal structure of an ApaG protein (PA1934) from PSEUDOMONAS AERUGINOSA at 1.50 A resolution
rcsb
source organism Pseudomonas aeruginosa
total genus 19
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3nrfA00
3SB3A 3NRFA
chains in the Genus database with same CATH superfamily
1CXEA 4JW3A 4W6WB 1EBAA 1AY1H 2D8KA 1KJVA 2E59A 3STBA 1C1EH 3B9EA 1W0VB 3KPPA 1ACZA 4HIEB 3WNKA 2Y7QA 2FHBA 2IGFL 4RGMC 1JV2B 3HOGA 3Q6FA 4JN1L 5DFVC 3RURA 4F80A 4YSEA 1UXWB 3UP6A 4WHTB 2GTZA 3QFDA 5CEZH 5F97E 5E94A 4BZ2L 1J5CA 3VXSB 1AXIB 3AU0A 3IMRA 3X11A 4M9OA 3SKOA 2VZUA 2W9EH 4Y0GA 1E8ZA 5I6OA 2DLHA 3MJ6A 1B0GB 3VB9A 2CA4A 1I1CA 3HG3A 4K8RD 1JF5A 2BNRD 2GHZA 3ILQD 4XP9H 1GOGA 2VXUL 5JW4Q 3NFPA 3RJQB 4PJFA 1NJ9A 2W80C 3L9BA 5B7FA 2EE3A 5HGGS 3QUMB 3KJ4C 2NR6A 1CFMA 1TCRA 1QTYT 4G6KH 1LO2L 2QSCH 2ZPKL 4N6RB 2V33A 2IPUG 3LXUX 4I85A 3K4AA 1UVQA 1C5CL 2Z1KA 4XMLH 3NRFA 1G1KA 4Z95L 2VM4A 5GSRA 4JUSA 3AGWA 1TQBC 1DFBL 3CV5A 5I1LB 5D5MF 4OZHA 3GYRA 3ZGIA 1HIML 3L5HA 1GSMA 1G1OA 3MRNA 4PG2C 3ZKSD 2QGCA 4W9CC 4NHCH 2E6PA 4WW2A 1T0NB 3ZKXC 1BBDL 2XVLA 3CLFH 2IADA 2LABA 2AAAA 4W6XB 4U0RC 4YH6A 5BZDB 3FUFA 5D7JC 4BIKA 1MFEH 1QLFB 3FHQA 4JDZA 3RGVB 2VLKA 3SKMA 1T03L 1REIA 4U6HA 4JE4B 2G9HB 3FW6A 4AH2A 3QCUL 3INOA 5AVYB 3F2LA 2DMGA 3JVGC 3QJZA 1BXAA 1DBKL 1SJMA 1T5XB 3KLHC 3WY2A 2F19L 3QAQA 1ROCA 1J9TA 3PXJA 4XBEH 5EO0A 5KYWB 4F7TA 4GBXD 1MJ8H 5IP4A 3HAEH 4YFLF 1T83C 1M7UA 1FC2D 2I32A 4GW5B 4NKIL 5DLMH 5I18H 3A4DA 5DHVA 5A3IC 4L9DA 2ZNXA 3LQAL 3QS3A 4IRZA 4HFUH 3UGEA 1QRNB 5G5DA 5JHAA 4EVNB 3SDCB 2DYPA 3FSVA 2EADA 1BIIB 3C09B 4N0RA 4ILDA 2WIIA 5E4EB 1V3LA 2EXSA 5ICYA 5D2LA 5KJRL 1UJTA 1H6UA 4L3ED 4I0KA 5CWSA 3FUNA 1MHHB 3FRUA 2Q86B 1SJHB 2HLEB 1ZIAA 2ZUTA 1XMWA 1UGNA 4JMXA 1F42A 2NY5C 2WVUA 4LCWE 4XNZB 4HKXA 4KZCA 5DQJA 5C71A 4OIFA 1HZHL 5E9DD 5I1DB 1AQ8A 2D9CA 2J88H 2X41A 2AXGB 2ZQKA 4LSPL 5SWSB 1AXTH 2H1LM 2Y7OA 1XIWC 3LH2H 3K6OA 4FJZA 4PJGF 5D70L 4YGVA 1MJUL 5F72S 2CHXA 2Z8WC 3FCSA 4WW1A 1UD5A 5JPNB 1RZJL 2EINB 4X5WB 5HHMD 3TBSB 2B1AL 4AYID 4G9DB 5BS0B 3V6OE 4F7EA 3LIZA 4LVHB 5KSAB 2BZ7A 4AIZA 1AANA 1E4KA 4LVNB 4M7ZB 2MQCA 4LVOB 1JK8A 1BEXA 3DX6A 3FMGL 1I8LC 1NGXB 3HC0B 4QXUH 3VXNB 3RDTD 1OD9A 3K4DA 2A9MH 1KLFA 3RY4A 3TT1L 2OMXB 4E42A 2JQMA 1FIGL 1F90L 5JXED 5F93C 2AEOA 5FYLH 4M93B 4D0DA 2RIKA 1UA3A 2ZF8A 2ZOUA 1CU4H 3GSUA 4UQIM 2A77H 5IJKC 4X83A 3UBHA 4RLDA 3GHPA 1OGSA 1E3XA 2IOOA 1A6AA 4BA8A 2QQNH 4I7ZC 1QASA 3BZ4B 5KANI 1MI5B 5SWZE 1Z1WA 5IMLB 2A74B 1WWCA 4JZJA 3O0RL 3BWAA 1LEKB 2BVYA 5MEQB 4R8WL 4LLAA 3T1WA 2P7TA 2VNCA 3NGBC 3QZBA 5D93C 2KUTA 5ID1A 1TLMA 2AZAA 3KPRD 4EI0A 4ZTEA 5LWYH 4PRPA 1TZGH 5SV3A 4Z3GA 2QQKH 3PGFL 2ZWZA 3HLKA 3MLRH 4EN3B 1NFDB 3QEUB 4Y4FD 1BYPA 1M7DB 1SFHA 4G43B 4AEIH 1M6OB 4G70B 5JA8B 3W9DB 2ID5A 4HPYH 4GSXA 1HHHB 2WQ8A 4XPGL 4XN7A 3KHQA 1MKFA 2XWZA 1IGJA 2EIZA 4HAKA 5EN3A 1JGUH 4G7YH 4ODSL 3X1GA 1D7DA 1MFUA 3W0WA 1WISA 5KSBB 3BSGA 5CGTA 3RNKA 1R3IL 4OAWA 2IAND 3CFBB 5E5MB 3ZK0A 4YK4B 4ORGA 1NCOA 4KAQL 1AG0A 3QUYA 1S7QA 2BVPA 4AYEC 4YWGL 5EFIB 1FRGL 3ZUCA 3FTSA 5DF0A 4Q97A 2J8OA 1MWAH 3T3ME 4KKAD 3NJLA 4KO9A 1U58A 1AGDB 1ZE3H 5AAMA 4ALAC 1CLZH 4J8RB 5KYUB 2F1EA 1TPXB 4A6YA 2EUXA 1A5FL 4IBYA 3Q44A 1MCEA 2W0LA 4KKCC 2BMKA 2R2CA 4L3FA 5D7LB 2R83A 3UYPA 1P4BH 1E4XI 2FT7A 4OD3H 4DVBA 3IMUA 4TUKH 3PAVA 4XCEA 5C9JB 3BKJL 2XZZA 4WV1B 4Z7VB 3HNSH 1I3VA 3NIGE 4P57A 4ISVA 3OZ9H 4NZTL 4WO4C 5E2UL 3MXWH 1E9QA 4R7DB 4KPHH 4RNRB 4K94C 2A3TA 3DIFA 2ED9A 2H8PA 5GGSA 2VITA 3F58H 3ZQXA 4OJDH 4A2DA 4LSUH 5AVUB 3MV8A 1A4JB 3KPOA 1KJ2A 1OLLA 5CZXD 5F7YC 4BZ1L 5EBLA 1VPOH 4WFFE 2ZUQC 5CHNA 4UOZA 3QNZA 1VF5C 2LVEA 1PQZA 2XSKA 3NJXA 4WGKA 1HWGB 4G8GE 1QZNA 1F3RB 2X4UA 1OGTA 3OKEA 4FL4C 1A6TB 2OSLA 2ZWYA 5EUOF 2X4OB 1PAZA 2OLDA 3AQDA 3CFKA 3MQIA 1QKZH 1KFAL 1BW8A 3AREB 3KWWB 5F0JB 1NOAA 3DO7A 5JIDA 2FK9A 4QJ5B 4PB9L 3GI9L 1INQA 2DL2A 5AYUL 3TESA 1TJHL 3JTBA 1WAAE 3NEOA 4JRWA 5SV4A 1XR9B 3BHBB 2YD0A 4EQ2A 1PEWA 4R7XA 3SGDH 1AVAA 5EEUA 4WNSA 1JGEA 4UAOB 2FQDA 3OQ3B 1UD8A 5DC4B 1YEKH 3RTQA 4OCYH 4QTIL 1J0ZA 1O5DT 3WN5A 4JQVA 3VJ6B 3FS9A 3GJEA 1SLUA 4NQCE 1EO8H 2K45A 5FIEA 2G30A 4IRJC 4YDVA 3WFEL 2OMUB 5C0BA 4PJCE 4L9LC 1HILB 1CQYA 1UKTA 1CL7L 2ZT9C 1WPCA 1B2WL 3PDOB 1HYSC 4DPAX 4PTUB 3O6FB 4XPTL 4GNKB 3IT8D 4LOVA 5J1AA 5CD3A 2NX5B 4RMTA 3IDJB 4QNPE 2W60B 3U0WH 4LF3B 5EZPA 4X4YA 1UYWH 4MRCA 2Y7SA 3STZB 2CRZA 1EJ8A 2F08A 3AXLA 2ESVD 2MTPA 4TLUA 4Y5XC 2UWEF 3CVHB 4RGNC 5C08D 5D5MA 5FO9B 2AK4A 5F3HB 4Z77A 3TCLB 3BMVA 3A23A 4IIQA 1JI2A 3MRPA 5HDBF 3VACA 2OZ4H 4YHNA 3VXUA 4KVCL 1U8NB 3EO9L 3MJWA 3RPKA 2R0KL 1MQKL 2G5UA 3QUHA 4YSQA 1GCFA 1Q9LA 3HC3H 4JK0D 4LQFH 3MRCA 3FC8A 1QUNA 5ISZB 2Y36L 1PJWA 4IKIA 5L2KD 4FTVE 2JI1A 3HJEA 2IGFH 3MBWA 1TTBA 2FGWL 4DO6A 4AKPA 4TRPH 1S5IL 1Q72L 3O8XD 1OHZA 3G5ZA 3H42H 4S0HA 4JFFB 3U46A 4HG4J 1O7VA 4YHKH 2DAVA 3DX9B 2NNXA 4FKEA 4BZ2H 4LSRH 3FB8A 4ZOCA 3RWEB 3UBGA 2AABL 1RJZA 4OZ4A 1IKOP 2FZ3A 3K6DA 2C4FT 3D4YA 3VNZA 3L3HB 3PABA 1MOEA 1HQ4B 3QQXA 3MFFA 1Z32X 2XFXA 4IKLA 5ANHA 5ICZA 4IBUA 5H8DA 1I9RL 5AZEH 3GDBA 4PJ9A 3SOBL 3ROOA 4CKQA 1WLHA 4MWFA 5ESQA 1JGDA 2F74B 4YSAA 3QQ3B 3T1FA 4RDQF 1PKQA 1LO2H 3UZVB 2ZSVA 3PGCA 4JHUA 4DFHA 1NCAH 1ZHLB 3TYFB 1D7CA 4HHWA 1MW3A 4KXAA 3MJ9A 3FQWA 1DVFA 4G7QB 3ZW3A 3BI9X 1KEGH 1DYZA 3TBBA 4I3RL 3E8VA 3DV4A 3QWNA 1QEWA 3QO0A 4P4RA 1DBMH 2WQUA 4PWJA 2W88A 3L4XA 5J8OA 1E2VA 1FQ9C 3G5XA 3WKNA 5I28A 3EBHA 4LXFA 4IM8A 2P8LA 3GRBA 5JPMC 5KVEE 4FQLH 1KPVA 5C8JA 2VDNL 4PJGA 1DVTA 2OMZA 3MRGA 5HHXL 4AT6A 2QVMA 4P06A 5CCKH 2HFGH 35C8L 4K23H 1SF5A 4NBZB 5ACZA 4PRHA 1T03H 1J5OL 3R1GH 4GRLD 3NIFF 3QCUH 2J5LC 1IJNA 2MQGA 5IEHA 2X5PA 3KLQA 3WXVH 4H8WC 5L9DL 3UBXG 4LLDA 3RP1A 2YBGA 4I13B 4YE4L 2AJXL 2CUMA 2X89A 3QIBB 4NKIH 1FNGB 1U92B 2LFEA 3VO0A 4AKQA 4JO5A 4PJEE 3VXPA 1WFTA 3J07A 3BKYL 3KPSE 3N85H 4K3EH 1QSZA 3IMTA 3ETBJ 1NL0L 1PX8A 3V0EA 1DQQA 1HINH 1QBLL 3R4RA 2J1WA 4ZZFA 4WY7H 2A6KA 4ZAKA 1GVIA 2J21A 2ZX7A 4GUQA 1RPQA 3K72A 3S0PA 1K3ZA 1HYRC 3U83A 1G9NC 5GS0L 2JIXD 2D73A 4EAEA 4KFMA 4YDKL 2DQUH 1S9VB 3DXAB 2CDFB 3ABMB 5FA4B 3ETSA 1TJMA 4ZMNA 5I66A 3PG2A 1G7LB 2OS7A 3LSOA 4R96B 4JY4B 4IBTA 4LHUD 1FN4A 2IAMA 4KKPA 4AJWA 2QEJA 3F64A 4A2FA 1OAQL 2IJ0C 4U7MA 1K6QH 5E8DL 2VDRH 1RZKH 1XF5B 4RDQG 4JDEB 3H9SB 4JFYB 4ZOAA 5T1LD 1RZJH 3QQNA 3RWGA 3QHZH 4MLIA 3WSQH 3BP6A 1GA2A 2BCKA 1DR9A 5DJCA 1UM5L 2ITEA 4BDVB 1AHWC 1OOWA 1SXSA 4E9LA 4PRIA 4HEME 5AL0A 2IWKA 5J13B 1BZOA 4UTBA 3KXFB 3BPNC 3BWZA 3LOWA 4CRPA 2VZ3A 5BNXD 1UH3A 3PWPA 5GGTA 3D3VE 5JIHA 1OP9A 1F90H 5BV7L 1I31A 2D2CC 1F4AA 2P8MB 3SJVB 4NBXB 1Z66A 1MLCA 2IXQB 4AGPA 2ODIA 2F54E 3HUJF 4UMSA 1U4EA 1T7WA 2H32B 4AKOA 2GHWB 4Y9EA 1R5VB 2CDEA 4ZRGA 4ZW3A 5LDUA 5IOKA 3HVDA 4YFDB 5K9KB 4L0YA 3GXMA 5C2BH 5GRVK 3RZWA 3ZPDA 1QSFA 1J8HE 2H0JA 3LKPA 1BQHB 1ODAA 5TD4A 2UVEA 1H8NA 1R3KA 1WS7A 1KXQE 3OXSB 4UT6L 2QZ5A 4YSPA 4RESB 5EO9A 1ZANH 1A4KA 2UY7A 4J27A 3WKYA 1ED3A 4ELMF 3SBWA 3O3AA 3N1FC 3RA7L 4WF7A 2DQFB 1QVOA 1U93B 5J1SC 3V4VB 1W8OA 4M6OH 2LTQB 2DBJA 3KBEA 3BZDA 3RKPA 3KDMA 4PJXB 1QW9A 2VLJA 3ZLQC 1KIUA 5J0BA 4Y9BA 4AGOA 4X6DB 4N2BA 2UXTA 4K3JL 2D2OA 2V5RA 1MHPL 4JN2B 4Q0XH 1L7TH 2ITCA 5H37H 3FB7B 3N43B 4HIHB 4YC2B 3KVDD 2FEDD 4IMLB 4E5XG 3W0WE 2XV2A 1JF1A 4OUOA 4LCYB 4P9HL 1X7SA 4OCSL 5LDSA 4N1CA 5D7SL 2QFRA 3BAXA 2BVTA 3LNFA 2L04A 4ZXBD 2DWDA 4NUJB 3LZOA 2HJKA 1CL7I 1R3IH 1MN4A 2W07B 1CDBA 3CN0A 5EUOA 5C6TH 3HE6B 3HHRB 4I0PA 4KAQH 5EH1A 1X5LA 1X6LA 3B9KD 3DK2A 3D39E 1RUPL 2IFFH 1FRGH 3FXIC 4OF3A 3DYOA 3QIWB 1D5RA 3VWKA 4F91B 3IDMA 5CP7A 1ACCA 3VXRA 5L2JB 5IWLA 3C2SA 1WE5A 3H1ZA 2X4SA 1DN0B 4I1PA 4XP1H 2WBJC 4AW4A 1QX1A 3PUUA 4WHCA 3I6KA 3AC0A 1SQ2N 4HVBA 4X7TA 4BH7A 4ODHH 3SO5A 1U21A 3FTUA 3ZKND 4QHKJ 4G8IB 4L4VE 2RJMA 2FX9L 2E7MA 1UD3A 2CJUH 1P4IH 2QQLL 1WRFA 3FCTA 4ZTOL 1N8OE 1E0OB 1Z5YD 1IBGL 5DHYB 5E2UH 3SE6A 1WZMA 1NPNA 3PV7A 2KZKA 5F1OB 5BZWB 4EJ1C 4FG6D 5ETUA 3FO2A 5IB1A 4R83A 5DJDB 1ZT7B 4I48A 1YMHA 4ONOA 2HX7A 3RJDA 2E3VA 4PREB 3SKNA 4AIEA 5L4MA 5AVRB 4G83A 1S7SB 1T1YA 2UWEA 2VN6A 4J3UA 4E41B 5FECB 4HSCX 3P11H 4C59B 4HOMA 4L0PB 2L7JA 1MCLA 3MV7B 1S7XB 4HJGA 2CO7B 2CNZA 1YNLL 5C70A 1RFDL 4KC3B 3KCPA 3UBXA 2FEEL 2EYRB 4Z7OF 3ASWA 5I1EL 4L3CA 1KCUL 2Z8SA 3SQOL 2XTJE 3FYIB 5D2NB 4MZ3A 1P69B 4LP5A 3B2DC 3EYUL 1Q9OB 2IH1A 4OLXL 5AYUH 3GI9H 3T08A 1U3YA 2R56H 4HC1L 1SY6A 2B0SH 3GLEA 3NT0A 4K8RH 1OALA 4PGEA 2G9KA 1QRKA 4XCFH 3CIAA 2DJMA 4IW4C 5F7EH 4JREC 3LB6D 1JI1A 1CFVH 2VLRE 3KJ6L 2EH8L 4QRSB 1ZVYA 4QTIH 2CD0A 5D1QD 1NC4A 1R3HB 5MP6L 1NWOA 1E7UA 3D2UA 5D7IE 4BQ9A 1IM9B 4XO9A 4RGMB 4UTCA 4MVBD 5AOIA 1T7YA 1SEBB 5FM5M 4Y1AE 1G7JB 2JKIS 2EYSA 1WCQA 4LLWA 2YMXL 3QVAA 1JTOA 3Q8CA 3QXDA 2NCMA 3MGOB 3T4YA 4DZBB 1XSIA 3GHEL 4XPTH 3JT0A 3AFLA 1GYWA 4PWIA 3HR6A 2P24B 1N9PA 2V2XA 1AZCA 4IHOB 1P5VA 4M6AA 1RK1A 3CTTA 3QA3A 4CGTA 3K71B 1ZSDA 3RL2B 2OXGB 3ARFA 5K59E 4XO4A 3RX7A 5AWNH 2EDLA 4PRPD 2ZKHL 4P5MA 1S9XB 4Y7MA 5E8EB 4FQXC 3T8MA 5HD8D 1OSPL 4NZUL 1DUZB 2V9QA 4RGNE 3OZKA 3QDJB 2QHLA 4TNFA 4AVJA 5BO1L 5INDA 3EYOB 2TAAA 1J0IA 4KVCH 4QYOA 2YD4A 1AS8A 1QR1A 4FXKA 2YO3A 5J06A 3ZHNA 2NY4D 3L4VA 1E2WA 2A0LD 1NAML 2WJ5A 1MXDA 5J3HD 1P7BA 4K3HA 2K9FB 4PGBB 2ZZUT 4FQIL 2Y36H 3UZEC 1PYWA 5IMMA 3DMMC 2PXYA 2G3MA 1S5IH 3AY4C 1Q72H 3DI3B 3MR9A 3RUGE 3L9RB 1UXMA 1MFDH 5DHEA 3SEPA 4K5MA 3IDUA 3LRHA 3OF6D 1II4E 3O2VL 4M4PA 5D7JB 3QQDB 3Q5YA 4HYTB 4L8DB 3SE3C 1RZFL 2IH9A 4MMXA 1R3JA 1H3PH 4CU8A 4XX5A 2AABH 2VWEE 2ZP0T 2ZCLH 2PO6C 4MD4B 5I9QC 1VACB 4H2AA 5C0GA 1WBYB 3MRQB 1CICA 5KUMA 2IMMA 4AZ8B 1BZDA 1I1YA 1I1AB 2YKLH 3OWEA 3SOBH 3V8CA 5HDQL 1ZHKA 4RFNB 3M8OH 4XVOA 4DP9X 3CUPA 3EUUA 3EO0A 4Q6IA 1BVNT 4AGQA 4GMSL 1TKWA 4DHLA 3DROB 1Q38A 2DIEA 4MASA 5HVGB 3ZVVA 2ATKB 1GOFA 1MIMH 1WCBB 2WLIA 4I3RH 4J3OF 1N5YH 4E5XA 2ADGA 2KDGA 3FU3A 4YBQD 2NY3C 2Q8BL 2RA1A 4KK9C 1MVYA 1JHTB 1CGYA 1EMTL 2MMXA 2YZ8A 2AC0A 2D7TH 7CGTA 1I8KB 2YXMA 3MV8D 1RIUH 2NR6C 3BE1L 5IMKB 1KIRB 5HHXH 1CBVL 3V0FA 1XCTB 4M4RB 4A7UA 5D4HA 4DPRA 3OKMA 3CSYA 3KPRE 3UROR 5F3BB 3VFWA 5E4OA 2CCWA 1T66C 5H94B 1IARB 4P05A 2YC1B 3VFNA 3P9LB 4JJ5B 4G6JH 4HJJH 4RMWA 2XFGB 5HXMA 1LO5B 3MAWA 1OW0A 4XX1G 1G6RH 3LEVL 2JKXA 3FT2B 1FAIH 3WUWG 5L9DH 1SEQL 3T5WA 2F8IA 4W9ZA 1CZ8H 1U2HA 2X7LB 3BPCB 4LGSB 4BXVA 4KQ0A 3O2WL 1VLXA 5CLXA 3HEIB 3ETTA 1IGMH 3GKWH 3T2NH 1YUHB 4MJIA 4XPHH 3E7JA 1VA9A 2FQFA 3JBG7 1GS8A 2UZYB 3BKYH 2IBZY 3FO0L 3LH9A 3MO1B 1NL0H 1L7IL 3T0DA 4M1GL 5I0YA 3HUJA 4I9WE 5H4YA 3WJMB 3OAUL 1QBLH 5ITFA 2V9RA 4ABVA 3POCA 5TDNB 4YAQA 1KPRA 3O4LA 4H0HB 1V3JA 3GWJA 1F5WA 4JFTA 5EU3A 4AENA 1ZXQA 3Q0HA 5IR1B 2I07B 3PDGA 3EDDA 4UANA 4XNAA 4LU5H 4U1IB 2N59A 2O5NA 4DERA 4BXSV 5C0BD 1ID2A 4BFEA 1SYSB 5D7HA 3VW3H 1JWMB 4ELMA 1CE6B 2A9BA 4WFED 5BXFB 3FB6A 4PP2B 5KS9F 2C9RA 5HY9A 1OAQH 1KUMA 4JVPA 3BUQA 1MW2A 3QFJE 1IKFL 1MCHA 2VDOB 1S5HB 2D0HA 1NAKH 2DWXA 3ES6A 2KI6A 4YHIA 3ULUH 3DYMA 1TFPA 3BGMB 1H3XA 1PGRB 2AK1L 3PJLA 5DMYA 4YHZH 3NGBB 4IGBA 1CGXA 2HLFC 4Y4KC 5EZIL 4ZW6A 3SDXF 1RZ7H 5FM5O 3L95A 3VXUD 3U9UA 3QEHB 4DPBX 3GF8A 3TA3D 5CEXA 3FU9A 1GYCA 1R3LB 1EXUB 1N2RA 1YMMB 1NCBL 1A64A 2WUCH 2BP8B 3T6XA 5LHDA 2DTSA 2V9UA 1SDDA 1KXTA 3LS5L 3SDYH 3W37A 4NRXB 3QNFA 3WEMA 2DM4A 2WQVA 3D52A 3OXRA 1JWUA 2P5PA 1L9RA 2JKTM 1NUDA 2NT1A 4PJDE 4NM4L 3BC9A 3LX9A 3H85A 3QC5X 3H2PA 5CCGE 3K8KA 5EPMA 1IGTB 1E9PA 3SDAA 4P59H 2JB6A 4OCWH 3OJDA 2CIKA 4BJLA 1UOWA 4Q6YA 2J8UE 3QULA 1BLNA 1J9RA 1SDYA 1YEEH 2FEEI 2QV4A 4DO4A 3RDJA 1C5BL 4J8QA 4CVXB 2A83B 2AERT 4NO2B 4IBQA 4FEMA 3ZYOA 4PCYA 1CK0L 3EYFB 2VB5A 1AQHA 2YRBA 4RIRB 4X98B 4LASL 4X0NA 5IVXF 2WXMA 4X7DC 4OZIF 1IAIL 4ZPVA 3MA7B 4ESKA 1S6NA 4NQED 1J9SA 1KCSL 4U3SA 5DQ9A 4CN4A 3NK4A 3NSDA 4XNXH 3MZTA 4BRVA 4MDRA 4K3JH 4F5CA 4U4IA 1MHPH 1TZHA 1JBJA 3E80A 3LIZL 1WIOA 1XSKA 5M94B 1TJXA 4PWKA 4J4PC 5B39G 1RUAL 1VCBC 3F5WA 1ID5I 5EHFA 2HMID 3OG6B 5D6CA 5IB4B 2P5ED 5IJBC 5AW9B 4OCSH 4OR1A 4ANWA 4X9IA 5D7SH 5ANMA 4WWKA 4RMBA 4WO4B 2WBWB 1HESA 2XN9E 4FQ1L 5GPRA 3OHMB 5DZOA 1BV8A 3VXSD 1RIHL 4LVEA 5JHDD 4UMGA 1NBQA 4FFVC 5C97A 1PY9A 2Q6WB 5E51A 3VD4A 1KG0A 2EUZA 2QTVA 3IE4A 2ZUQB 3L3OC 2CK0L 5DO2D 5HHPB 4GSDL 1E43A 1U95A 2R39A 4IK7A 5F8RC 3BVUA 2X89D 1MCFA 3HB3D 4K9JA 4PH8A 4X8JB 1F86A 2IALA 3A21A 5I26A 4JAMB 4AYMC 4NNXB 1OTSD 5DD1H 4FAAB 1FFNB 2CXKA 5DS8A 3UO1L 3EHBC 3GIVA 1FVDA 3CX5K 3QFGA 4PRAB 4R26L 2EDRA 3GSNH 3HC2A 2JH2A 3K5RA 4OFDA 4XB3A 5DJ6B 2FX9H 4PSRA 3UTTA 1FBIL 1FFOA 2NNAB 1UB5A 5IHZB 4ZTOH 3U48A 1NCUA 4M5ZL 1W15A 2XWRA 2R0LH 5C07A 3VXTB 1QLRA 5IJVA 3MCKB 3UTPE 1XGTB 3ZBMA 1FO0B 2DM7A 5C09E 5ES4B 1HHJB 2JELL 1WITA 4ENED 3O41A 3LZPA 5GGUB 4PV1C 3CPUA 1XX9C 4L9LB 1LP9F 3QQ9D 1EFXD 3MJ8B 5C3IA 4QHMB 1M53A 2FYYA 1RFDH 4WEMB 4KZDH 3FN0H 1S9WB 1O0VA 4BH8A 2YSTA 3KD4A 1IGIH 1BIHA 2FIRT 2X1OA 3BUPA 3SIKA 4B6ZA 4GT0A 4Y5XB 2I5YL 3SQOH 3FONA 1QATA 3FSZA 1ZE3C 5FAAA 3VFUA 2PMZA 1DQJA 3A24A 1SOQA 3SDCD 2WYZA 2CO1A 4Z0XA 2BSED 5JO5B 1N59A 1P6FA 3SY0A 4WNQB 1D5BA 3MYJA 3VE0B 1DVSA 1E28B 1N64L 2VXSL 3LIUA 2CKBA 5IMOA 1WT5C 5IF0A 2YAOA 3TBVA 3S5ZA 4A6YL 4CSZA 2BIPA 5KW9L 1IC0A 4KNTA 5C0AD 5T1MA 5K1JA 2VC2H 4X4ME 2E27L 3MJGX 4JG5A 1KSRA 1NCDL 3JTTA 2EDEA 1UT1A 4XC1L 5JW4M 1QSFD 2PP7A 2J20A 3GTVA 2H1PL 4QRPE 1DQKA 2OSXA 2X10A 5D55A 1HSAA 3CSFA 4PS4H 5HYJB 3PHSA 1UCBL 4GS7C 5DUPL 4N0UE 2ED8A 5F1KC 4O02B 4ZMVA 1L0XA 1WEJL 4X7SH 1E9OA 3BSZA 3QXVA 1ZXKA 3TIDB 2FBRA 2BNQA 4X50A 3T8XA 3SYQA 1KJ2L 3MREA 2DF3A 5C0CE 3E6FB 2ZKHH 1AD0B 1K8IA 1HWHB 3SODB 3RWHB 1NEPA 4JQIA 5GJTL 1UXSB 1X3DA 3D69B 4FLSA 5HI4D 3V0AC 2AEQH 3BUIA 4XC3L 3QNYA 1CE1L 3FTYA 1E6OH 1AOHA 3ILPB 5KZCB 2OMVA 2Z93B 3BAJA 3LZFH 2PWEA 2BZDA 3WELA 2QJDA 3ABGA 4NS0A 4HISA 1H3WM 1EZLA 1U8KA 3COOA 4N0FA 3Q8EA 1ACYH 3X12A 3BT2L 3PWLA 1BD2B 4MA8L 3WNNA 4EOWL 3TEWA 5EWIL 5JPMB 1R9FA 1ZV2A 2JI3A 4NO0B 4UU9B 4L1BA 2YD2A 3PL6C 4ZUWA 1D9KB 5LBGA 1MI5D 1L9SA 4WI8A 3TCXA 3HI5L 4MZIA 3RPIB 2MOGA 1KB5H 3TNMB 4AVKA 1I9EA 3CDGB 4R7NB 1RY7B 4QKTA 1KB9J 4FKHA 2H26A 3B43A 1ECYA 1MXGA 1WC7A 3HG1B 4RWYH 2VKXA 5LAPA 4G5ZH 3DOSA 4U1NB 2MKWA 3CBRA 5I6MA 2EXYC 1X5IA 2P48B 3SPIA 4H5SB 1EDYA 3QUZD 4ZK8A 5DJ2B 1C5DB 5HDQH 3RNQA 2WQAA 1I7TB 4K2UH 3V4PA 2GG1A 2NLJA 4X6FB 2KMWA 3X14B 1GS6X 4GQZA 1H3VA 1PLBA 5HYQB 1JK9A 3D0VA 5MEPA 3OAWA 4J2QA 1GSKA 4EN3D 4M6MH 4AEEA 4G6FB 4YBLC 2ZSWB 1ZLWK 4BD4A 3GXNA 3NZ8B 3FFCB 3X1NA 5IHUL 3ZDXE 2CALA 4HQQL 5KS9A 4IDLA 4MFHA 3CFCL 2Z7UA 3N06B 4A7VA 3NAAH 2BXZA 4QRUB 1KC5L 4UB0L 1FVCA 1Q9KA 4PJFE 4Z18A 4XNUH 1INDH 3BE1H 2Q7YB 3T0EB 4U49A 4W9IC 3RVVD 3S88H 1KNOA 1GMIA 2B9AA 3IWUA 5K9JL 4H1LB 2CIIA 1BEYL 3IXAB 2HA1A 3DGGA 2XWEA 3DUUA 4YHYB 3VFOA 1ML0A 4GRWF 4LQ1A 3T09A 1AQDB 2EIDA 2LFGA 2HZHA 4OCXH 3SDXA 2VZSA 3RVWD 4OZFB 4WUKL 2I24N 4A2HA 3AAZB 1HXYB 3NFSL 1SEQH 5D6DA 1P7HL 2H4EA 1BXUA 1IX2A 3HR5A 4MAYD 1N6VA 1N8ZA 4POUB 3HZYB 1IAII 1KTCA 1VGEL 5JIMA 1UB6B 3MBXL 3IYLW 1EVUA 3HRZB 3QXAA 3JWNG 4NQXB 2W0KA 1AHWB 4D0CA 2VLKE 5L4JA 1H15B 3FQ2A 2HT3D 3OAUH 1RZIB 1U8LA 2FX7L 3SYPA 3DX7A 2MOQA 3NCWA 3NBNA 1U8IA 5K33A 1I85A 4PV9A 3MYZA 4ONHA 4Q7DA 1UA6L 2QADC 1HXMA 5EC2A 2A4CA 3CQQA 2NXZB 3Q01A 4WEEA 2NTFB 4S10A 1QA9B 3GC3A 4BFIB 4XWGH 1FF5A 1E40A 3EJCA 5FYJD 3DHUA 3L17A 3MJ9L 2H9GA 4UZUA 1MZZA 3DWTA 3ZR5A 2NZ9D 4NRZB 1AZUA 3DOHA 4LSDA 5HI3D 5IVXA 3Q2VA 4OZIA 1RJLA 2IH3A 1EEYB 3BUYB 3HS9A 4P5TA 4Q58C 2VDMH 1IKFH 2WO3B 4WKZA 5D1XA 3UMNA 1M2OA 5D2LE 3N55A 4BHUA 3ARFD 4WHDA 1KTDA 4XNYL 4ZO7A 3TBTB 4NO5B 3GI8H 3MJ7B 2VE6B 1UD4A 2GBVA 1VIWA 3EDKA 1BZ9A 3E9UA 1AMXA 5DJ0B 5ESVA 3PS6A 3MNMA 1ZMYA 1PDKB 3NACH 5A2FA 1UM6L 2EEXA 4QT5A 4HSAC 4OD2B 1BX2A 3TIEB 1JV5A 3NIDF 1E3FA 1XAKA 1B4JH 2XA8H 2YGNA 4NJAL 5CSZA 4MCZB 3WKPA 1KXVA 5KVGH 1QBBA 1IGCL 3H2WA 4KH9A 4M48H 4W81A 1T2XA 2P5WA 3DJ9A 4NYLA 2P8PB 5F7BA 3FTXA 1TZ8A 1ZRUA 2VDLH 4AYSA 4OGQC 2AEIT 2XBZA 2XTLA 1N26A 4QTHB 4U1HA 4F3FB 4OM0H 4W93A 1IM3A 3VDAA 1N70A 2EO9A 1A3LH 3BLPX 5AVXB 4J6RH 1AZVA 5T1DL 2DMKA 4GUPA 1AR1D 3WTTA 1MCRA 3IXTA 2DQ6A 4LEOB 4NENA 1SUJA 3LKQB 4AK2A 2CA3A 4KWUA 2GCYB 2JCCB 1KWGA 3IDYB 4L8SA 4TVSa 1CK0H 2BS8A 2CO3A 2XQBH 2WGXA 1RZKC 4HALA 4V1DB 4A38A 3TF4A 3B7SA 4Z23A 4AMWA 1S7UB 2OMNA 4LASH 3FQ1A 4NCC2 2NY7L 4PLJC 4X9BA 4PY7B 3SDDA 4CADB 2CHDA 2DWSA 1BWWA 4QXTA 3WE6B 3Q8AA 1QBMH 2CM5A 3DJTA 4GB9A 2IVFC 2YA1A 1FL3B 3GSQB 4UIMB 4ZBJA 3RAJL 4CNIB 2BRRL 5DZAA 5K9QI 3PNWA 4LRNH 4TUJB 4YZFE 3FAXA 3GSVA 1RUAH 2UZIL 1ET8A 1A6ZB 4H25A 5DHDA 5H4ZA 1LP9A 4FQ2L 5IW6A 3S5YA 3UBFA 2R2EA 4UM9A 4UTBL 4Y19A 4OFYA 3LEXB 1DUYA 2XZCL 4FQ1H 3QORC 2CLZB 3FTGB 1IGYA 4N2OA 2QPEB 4PRPE 1L9TA 4PMFA 5IESL 5GGTL 5C0DA 1UURA 5TDPA 4HX1A 5GS2D 2ENSA 3FFDB 2WN3A 4DETA 1J1OL 2APVA 1O7DE 1NCHA 4LKCB 4C56E 2WP3O 1QSEA 2X4NA 2QKIA 1B3JA 4JFXA 1NEZB 2CK0H 3KH3A 4IIZA 4GSDH 4N5EC 3C9NB 3L5IA 5KN5A 1MEXL 4Q9RL 4JGMA 1X5XA 1GPOL 3QZWG 2TRHA 1EAPB 1A1NB 4EF3A 5FO2A 3R4DA 1IBFA 3L5JA 5CM1A 3SE4A 4I0PC 1PFCA 3NJIA 2H47C 4R4ND 3CHOA 1KYUA 3CJJA 3VUAA 3LKOB 4JG0L 1FBIH 1CDIA 1FNEB 1U3JA 4U1LB 1LGVA 2R69H 4L0ZA 3QYMA 1XGQA 3F7RA 1ZGLP 1VFUA 2D7QA 5ENWA 3C6LA 1SJEB 3OX8A 4YSCA 1BF8A 2EKSA 4D9LH 3LKNA 1V27A 4LPVA 3ZT5A 4H2CA 4JREB 1JCVA 1KJ3H 2LQRA 4HH9B 3WIHA 3NPSC 4WUUB 2A1WH 3BVNA 4D94A 3F3HA 5MENB 2CCLA 1D2PA 1SQMA 4PW9A 1NDGB 1CXFA 1CR9L 3KWUA 4NLHA 4W9DC 3TO4D 1YEJL 1CI3M 2XG5A 4XZUB 4QXGH 4ZFZB 3VI3B 1OTUD 1Y0LA 1QFWH 2ZJSL 5DD3H 4IBWA 2FBOJ 1U8CB 3BJLA 2GBAA 4ZDHA 2AKRA 2GJZB 4P4KB 4H88L 3Q2LA 4XVUC 4C4KT 4IGBD 3E8UL 1P4LB 1T22B 3QDAA 1KCLA 3QXUA 4JLRA 3RY6C 1QUPA 2ADIA 2FR4B 4MJ5A 4OCNC 2DJ4A 5F7DB 1N10A 1CT8B 1PS3A 2J7LA 4FQXB 4APQC 4M62L 1SHSA 3A6CH 3BT0A 4AQEA 5CUSL 4Z3JA 2I26N 3S34L 3WD5H 1I7UA 4HEPG 1N64H 2DB8A 4C4KO 1XT5A 2FO1A 1K8DB 1Y7VA 4PLKD 4PSPA 2VL5A 5J89A 2J4WH 1KYOK 4KRMB 4R2GB 1L6ZA 1LNUA 1NC2B 4NP4H 3AS0A 5KW9H 3INUL 3D4GA 3EFDH 3VWJA 4JZOB 4YIQB 4OD1L 3O9WB 4NHUB 4XNDA 3D33A 1EBPA 3N5AA 3O6MH 5E6UB 2WYTA 5J12C 1NCDH 4QHKI 3FOMA 1YYCA 1VFAA 2H1PH 2I60H 4P46A 3EYQD 3WEAA 2F53D 1F3JA 1RURL 3OGCA 4AMXA 4DVRL 2DQEL 1OCWL 3BPOB 3LKSB 3O6LH 3GNML 1KPUB 1G5GA 5BW7C 1AKPA 2PO6B 2JK5A 4YFLI 1RK0A 5I0XA 2IQ9L 2R1WA 3VFSA 4R0LC 3PAYA 5KSVB 2IDTA 3FUKA 4BWUA 3B7YA 3GBEA 2HYMA 1BZ7B 4KXZH 4XC3H 1ZA6A 2BERA 3P2BA 4R5XA 2GTWA 2V2WB 2YAFA 4KXBA 5AZ2L 3TM6A 3P3TA 3GJFH 4OFPA 2WLYA 2CGYA 3SJVD 4K8RC 4ZX6A 3RWCB 2X6VA 2NY3B 1C7TA 3ILQC 4M7JL 1CXKA 4CC4C 2HPOA 5CJXA 4X4XB 5EWIH 1AO7E 1DE4A 3QWRA 5D5ME 1MAJA 3TO2B 2AK4E 1JXKA 1DN2A 3LRSA 5MERA 1PZ2A 3C5ZA 1SY6L 5FB8B 2WXHA 1A3RL 4KTGA 3HS0A 1E6JL 4RQQB 4O51B 4BELD 2N7SA 1LQSR 2X6UA 3X2QB 3IGAA 2WD0A 5GISH 4ZMPA 1E5AA 1I8MA 1SXBA 4TL5A 4BINA 2EE9A 3IJYA 1P0SE 4LLMB 4PJ5A 2OW6A 1E90A 1EZUA 3K1DA 2WLJA 4K07A 3SPHA 3MUJA 1FNAA 1BG1A 2WZ5A 3ZIYA 5DK2A 4B96A 3AG2B 1EZVY 3C5JB 4P2QB 4ZSOE 2OL3A 1IBYA 4JQXA 2F18A 2B4CH 3GS0A 4AM0A 4X6CE 4DAGH 4YHPA 3KYAA 3RWFA 1C08B 4XVTL 4MSWA 5GGVL 4QRTB 5JW5A 4XCCL 4OIAA 1F13A 4A66A 5C07D 3KPNB 5B8CA 2MNWA 4IU2B 2OSWA 4NQDD 1XGZA 3QDGA 3ULVE 2VCOA 4Q52A 1T3FA 3QIUB 3SD2A 5D7KD 3B6SB 5F89A 1R4XA 5CR8A 1Q4NX 1V8HA 3KYOB 1BEYH 3LPWA 1NFDF 1S9YA 3GXPA 3IWVA 2R8SL 4QRFA 5ICXA 5BOJA 2WSKA 4UQ3B 4WUKH 3ML8A 4Z76B 1MREL 5I0DA 1VKXB 5B1BB 4L4TA 4MB3A 4ATTA 4AX3A 2YHGA 2AGJH 3AQXA 5KSBF 3H8NA 3QZWA 1ZCRA 5DUJA 4RGOH 4NNYB 5D1ZA 4PJGE 4ZYKB 4YVUA 3DIVA 1X5FA 2YD3A 1GHFH 2DV6A 3RWJA 3B7UX 2DWTA 4H44C 1JN6B 2YPLE 5I8EA 5TE7L 3T6QC 5IM7A 1U3HB 4PRHE 2XLLA 3HAEB 2BX5A 4DGIL 5IFJA 5KYYA 3WTUA 4GAGL 5I71B 1I1FA 1TQTA 3P73B 5EU6B 1NBZA 5JIPA 1NM4A 3P4MB 3PP4L 5D4QA 4JM2D 1WAPA 1U8HB 3EJJX 3UMTA 1PLGH 2WK2A 3FK3A 4Y16D 5I5RA 5FV1L 2QVIA 1RZQA 2B16A 5LCVA 2X3AA 5K1VA 3PFQA 3ZOAA 3LDBC 3KGUA 1RAMA 2YSSB 2BSSB 3ZL4L 3DO4A 2VAAA 4MYWB 3TZVA 4E41D 3ZDYB 3H7BB 2ROYA 3EOAA 4TNGA 2PR9A 1VEOA 1WF5A 1FYHB 3FT0A 4Z7VF 2IV9A 4NN7C 5E5UB 5BRZA 5I8KH 5DZVA 4OIIH 2F7PA 2FO4A 2PYED 2X2UA 1UKQA 2CBPA 5JXEC 1N5AA 5HDWA 5CZVL 2FD6L 3GIZL 3J27A 5AOKA 4ES8A 3NCMA 2QGBA 5C86A 3Q43A 1ORQA 2DWEA 1ORSB 3CSBA 1FYTA 3BD5A 5JZ7C 1N0XL 1G9HA 5DI8B 5FYKU 4DP2X 5IQ7L 4BEIA 4PUBL 2PP9A 3ARBB 2FQEA 1BFVL 1KMGA 4NJAH 1FC1A 3NCJL 1H8LA 1BYOA 5IFHL 5LGKA 2WVTA 4IU3A 1IGCH 4OLVL 3WY3A 2DMBA 4J28A 3QUMH 5LAXB 4E9XA 2QSTA 5E2VL 1IC7H 3CFIC 1SYVB 2X42A 3OKLB 1LK2B 4PD4J 5CIPB 4PRIE 5J7CC 2VN7A 3CK0L 4YO0B 3B9VA 5T1DH 1X5KA 1A14H 4WHTA 3S35X 1AYRA 3MI6A 1NBCA 2EDYA 5B38B 3Q3GB 3PWPE 5CGYD 4HUNB 3M1OA 3L3DB 2RCSL 4OV6F 4YN3A 4H8VA 1WIUA 3S8WA 1MFAH 5I1KH 3FNKA 1J05B 1OE2A 1GGBL 2GIYA 3L3OB 1BBJA 1EAJA 5HHNB 1AQMA 1XB3A 3DETD 2WB7A 4PP1C 3SGJA 5FR3A 4F57H 3ULUC 4TXVB 1S3KL 4GO6B 4MB1A 2HLAB 4GSUA 5KVDE 1ZTXE 1DJHA 4JR9L 1YY9D 1WO2A 2ZUYA 2R0WH 4OY9A 3TN0D 3DSFL 4JFDB 5TDOA 4N6RA 3GRWA 2ITFA 5IIEB 1H5BC 3DGDA 2UZIH 3C87A 3LKRB 3O3DA 4JKKA 4XI5C 3I75A 4UNUA 3P0YH 4XMPL 4LCCC 5B1CA 1NLDL 3T0WA 4K7PL 4FQ2H 4JEGB 4OI9A 1PL3A 3TC9A 3FU7A 1OARH 4KKAC 3SHSA 1FJ1A 1YEWA 1W0WB 2R9HD 3VMNA 2HRLA 1LTXA 2Q10A 1TEFA 4AQAA 1HE8A 4XPFH 2VLJE 1TYRA 4GG8B 4GIPD 3EGDB 3RGHA 1U42A 4R7LA 5BZDA 2HFFA 4LEBA 4KKQA 4YJZL 1J1OH 4S1RH 1RHHA 1UT9A 1ZGLA 5DXWA 3Q2CA 4Q9BA 2G9HA 3O6KH 2GSIB 3C2AL 3X1FA 1VERA 2A6IB 3IJEB 4JL1A 4EXKA 1NMBL 1BFOB 3OB0H 4AQ8A 3FZUD 8FABB 2Y06H 5DSCB 5F0MB 4XB8A 4X6EA 1GPOH 5KYWA 3SD5A 1NGQL 3RX5A 2NZIA 4N2AA 1GH7A 4I18B 1R5IA 3UBXI 2Y6SD 4W4OC 4FFYL 5EOCJ 1M1XA 3VH8B 3GRGA 2ZOWA 4G8EA 1O6TA 3MXVH 3D09A 2PWHA 4WVRA 5FKPB 3P9MB 4AYBA 3WJJA 3PV6B 4PJ8A 2YK1H 4V2BA 3VXRE 4DK3A 1VEMA 4P3WA 3EZJB 1AE6L 4Y88A 4ZJ9A 4FYTA 3GXFA 4DO5A 1MHHA 5LNEA 2BCMA 2XWJB 3KVPA 2Q86A 1SJHA 1CD8A 3EFFB 4JNXA 4FZ8H 1SUHA 1KACB 3P4LA 1HH9B 1UZ6F 2HP4A 1CR9H 3K5SA 3JZ7A 1YEJH 5ALCH 4U1KA 5JQIB 1ILUA 4DGYH 5AOJA 5I1DA 5KYNA 3LZQA 5I24A 4GH7B 4U6VL 5I1AA 2XXMB 1XGYL 2AXGA 5SWSA 1UWEH 2XOTA 1BVKB 4JCMA 2J2ZB 4LO9A 4H88H 2PW1B 2M2DA 5I75B 4MJ2A 5JPNA 3H54A 4X5WA 3TBSA 2A6DA 5KSAA 4G9DA 3WDHA 5BS0A 2FB4L 2XZAH 2HT4D 1BJMA 5EBMB 4FLQA 2W65B 3TV3H 1NGXA 3HFFA 2X9XA 5CUSH 3S34H 3VXNA 4NI6A 3HFML 4H0IA 5GZOA 4TUOB 2WQRA 4ZT1A 3S98A 3BPLC 4M43H 2J57A 4WWPA 2WINB 1AC6A 2GJ6A 1ASPA 3BGFC 3QUXC 4FFZA 3INUH 5SWQB 4KNQA 2ICWA 1NOLA 1Z9OA 4ELDA 1IM3D 1RERA 3VAEA 1SBBA 1K4CA 1LD9A 3UG5A 4QI3A 3FRPG 4LL9A 3TWCL 4AJVA 2G75B 4ZW7A 3PL6B 2E7HA 2Z4TA 4MMZC 1RIVL 5CSGA 1RURH 5I1JL 4DVRH 1RI8A 2DQEH 3BZ4A 2QZQA 4N3TA 2D7OA 3F65A 1K4DB 5IMLA 4AQOA 5TPWL 3Q2WA 1LEKA 5MEQA 2CXGA 2ADJB 3S3SA 3CSGA 1KBVA 1IRAY 3D0AA 3PJSB 2WCGA 4N5UA 1ANUA 1TR7A 5K93A 4APXB 1ITBB 2HCZX 1J1PH 3HBQA 3MV9D 4G6AD 3WFBL 4HIPA 3EJYD 1L5GB 4ZFOA 4MCYA 2B08A 5D9SB 1OTTD 1IKNC 4P2OB 4TPRH 2MHAB 1UC6A 2BP5M 2D0FA 4ODXB 2EIJB 4YBLB 1B90A 1NFDA 3QEUA 1M7DA 3ECUA 4YPGB 4G43A 4ELKA 1M6OA 2XKUA 3W9DA 1ZDSA 4HETA 4OFYD 2YWZA 4BSWB 3FO9A 3M88A 2RACA 1OM3H 3THML 4JO8A 3OC8A 1CYXA 4FHKA 1G9ML 3EFOB 5I8CB 3E3QE 1PX3A 2CKBL 3RI5K 5KSBA 4KJYB 4IOSA 1SHWA 4YX2L 1JRHH 3DSNB 4PBWD 5E2WL 1AHKA 3RFZA 3WIIL 5EFIA 4OLWL 3GD1C 4EUPB 2E75C 2R29A 3RZCA 2RD0A 3NIFE 1S7TB 1OLZA 1TZIB 1AGDA 4TV3A 5FYJH 2HN7B 3U9PL 1A6PA 3I74A 1XHHA 3CHXA 3V52H 1ZTMA 4OF0A 5C0JB 4P2RD 4TUUA 1SM3H 5D7LA 3BSZL 3TT3L 3AG4B 4XCCH 4GRLC 3ARPA 4UTAL 4YUEH 1EVTC 1RPUA 5E00A 4XO3A 1AZZC 1DQDL 4RCAA 2OJZH 3UO8B 5BMFL 2YPVA 4HOWA 4JQIL 4PJXF 1JYVA 4Z7VA 4FTVB 2RALA 1H6TA 4R7DA 4X2UA 4RETB 1IAKB 3B7RL 2AQ3A 4WI0B 4DNLA 1A4JA 4BKLB 3N43F 4AE1A 2D03H 4GKNB 1GGCL 4JRYD 4M8UA 3NIGF 4QXWA 4ACTA 3HE7C 4HCRA 2H0PA 3VD1A 2WZAA 4TNVK 2FQGA 5F9OH 3ELQA 4FDWA 4F2FA 3Q05A 2V5TA 3LNHA 4HKJB 3BZFB 3ME0B 3UABA 1A6TA 4KOCA 5FM4A 4TVPD 4PS7A 1RUKL 2X4OA 3WOVA 2FWLB 3AREA 1PZ5B 5DZ9A 3T4AC 1Q0YH 2R0ZL 3KWWA 1V05A 4KY1H 4R5TA 5E1HB 4GAGH 1BXXA 1WA2X 3ATEA 4CU7A 1LO4L 4OW6A 1WSST 1BZQK 4BCZA 3BHBA 3CVHH 4JRXD 5TE6L 3VWJD 2IOMA 2AQSA 2XA3A 2O6DA 2APXA 4DF9A 1EAOA 2IPKA 4Y4HC 5IK3B 3R06A 2YEZA 2AXFB 2YD1A 3UGXA 3QEQA 4MJIE 1J0YA 2VISA 3OD3A 4P46D 4WK2B 2DQCH 1QABA 4O2EB 5DS1A 3VJ6A 2NW2B 3CZKA 1E42A 4MYPA 3RVUD 2H3NA 5BRQA 2VDKL 3HUJE 1T2JA 4HLZG 3V0DA 4I88A 4KKRA 3O4LE 4BUGA 1AI1L 3DX4A 4FNLL 4Y1SA 3I6GA 3PDOA 3ZKQD 4PTUA 4KMTL 1CXLA 1O9VA 1WBZA 2X40A 2GSGB 5E70A 1TF4A 3IDJA 1QHPA 2HFTA 2Z31B 4XH2B 2HRPL 1N0LB 2VDRB 2OA9A 4PJCF 4FC3E 2BFGA 2D31B 1D5IL 4OF5A 5HHVL 5L88L 2ITDB 4N85A 4M7LT 3V95A 4YSUA 3ESOA 3QPXL 5GS2H 1KLGB 3KPSB 4ELME 2EDKA 5FO9A 5HP5A 2QGDA 3CZGA 3N0PB 1BFSA 5E6IA 5IQ9A 1QWNA 5IFHH 2O5ZH 2VMEA 2XQ0A 5JXAL 1P84K 3U1SH 3W2DH 3TVMD 1NTDA 1U8NA 1LDSA 1KLUA 5DYOB 3NCJH 2ZUSA 3QGVA 1FGNL 1KTLB 3IS0X 3QJXA 2O72A 3QUKB 3I85A 3QR1A 5PAZA 4O9HL 3CFUA 1BJ1J 2NYYD 2UY6A 3B2VL 2IO5A 4NGHL 4J3SA 5ISZA 2DS4A 3IDIB 1A7RH 5T5FH 2NY2D 3EDJA 1AOZA 3CK0H 3FRPA 1VGKB 3L6FB 4TSCL 5EA0H 5JTWA 4JFFA 1ET7A 1DSFL 2VQ4A 2HTKD 3U4AA 3DX9A 3FCGA 1M05A 3CXHK 3KBFA 1P53A 4HWNA 3HG5A 1D5ZB 4W9EC 5EZLB 3D9AL 3NQKA 4CVZA 4PJAB 3FQXA 4QXVA 5FV2A 5GS1C 3UX9B 3FQYA 1YJDL 2FEDC 2I69A 3L3HA 1GKEA 3TH3T 4NIKB 4XBMA 1CGWA 4NUMA 1S3KH 5T3XE 4ZXBC 3ULUE 4LHQB 4BE5A 3B3IA 3OPUA 5AQ0A 2F74A 3PAUA 4K5OA 2DBLH 4LKXA 3QQ3A 4O2CB 2XVGA 4JR9H 3UZVA 3G6JB 3ARTA 1ZHLA 3DSFH 2CCVA 1IQDB 2JWYA 1GCYA 4FFWD 2ICWJ 3B9KC 4PGCA 3N42F 3EGXA 3TYFA 4FRWA 3UP1A 2HRHA 5FGBA 3ZE1E 4M1DH 3IJHB 4KK6D 2GAZB 15C8H 1C8PA 3ZMNA 4PYGA 2AV1B 3L16A 1ASQA 1YNKH 1GIGL 2CLVA 2WWKO 3NRQA 2DLFL 3ARYA 1MCJA 3FQNA 2H6OA 2KPNA 4OJFH 1PG7L 5HPOA 4PY8J 5L6YL 1JYNA 3GMPB 3ZKNC 2GUOB 2V17H 3UTZB 1T1WB 2QDWA 4LPCA 1FGVL 3ATAA 4L4TD 4LNRB 2F5BL 2BOLA 3PQYB 4Q74A 1JYWA 4WFGE 5FUOH 3I02A 3VNYA 1T21B 5KYXB 2OR8A 2P1YA 4XWOD 3V6OA 4G8FA 5ANME 1MRDH 5E5LA 3K8MA 3DVGB 2MJWA 4UQEA 4Y5VA 3QIBA 3GUTA 3F84A 1FNGA 2MCAA 1U92A 3IDNB 3GPSA 2OTWB 1EGJA 2WB1A 2WLNA 4JFPB 3CQFA 3RHWF 4FFYH 2DMHA 4APQB 5C6WH 4ETQB 3S96B 2EVJA 2F0CA 1ULVA 5ADPH 2FE0A 2R51A 3JSSA 3DOIA 4CMMB 3I2CL 3UTSB 2ARJA 2QPDB 3CG8A 1CG9B 3OJMB 1I7RB 3TX4A 4DGUA 4J1UB 4GXUM 5E08L 1AE6H 1HWWA 2FJFB 2J6EA 3BDYL 4ZMWA 4PRDB 2OW7A 4XXWA 3DXAA 3CHSA 2F7QA 3SKJH 5FA4A 2Q3XA 4YL9A 5J12B 2KERA 4HUKB 4S0TD 1OGAB 1G7LA 1TU2A 5EOQL 5BRZD 3N91A 4N8VG 4JY4A 3UTTE 4MA3B 5SWZA 1NMCC 3P2DA 4U6VH 4HUVB 2ICEC 1XGYH 3ZE2B 2EDWA 2QMJA 2VSCA 1S7VA 1GY2A 2H32H 1XF5A 3Q6GH 3LB6C 4RDBA 3JT2A 3QHTC 4JDEA 4JFYA 1J88A 5C0FB 1BM3H 3KEHA 4G59C 3GBDA 5D1QC 4AV5A 4BDVA 1BP3B 4GYBA 1FHNA 2FSEB 4CVWA 4N2NA 1MAMH 1HL9A 1FZMB 3KPLB 2MCMA 5FOBB 1F6AB 3KXFA 5AAWC 2UZXB 5C92A 1B6UA 2WCPA 1AG6A 4L29B 3SPVB 4E9VA 5JMRA 5JORB 3V4VH 3TFKD 1T1ZB 4WK4B 2NXZD 4KXDA 4ODBD 1NFAA 3UJTL 5DRXB 2P8MA 4KROD 2YAMA 4IJ3B 3UIZA 2BNRB 5DUBB 4FQPA 1EEZB 1KEML 3S35H 2PPAA 1FCGA 2DEWX 4JHAL 3T77A 1RH8A 3J8F7 4L8BA 2OPCA 5T1KA 4LIQH 2Z4QB 3WLBB 4R90L 5CJOL 3TWCH 3MODL 5I5JA 3AWGA 3VXMD 3POHA 1S9KC 3C60A 1ERNA 1LK3L 5FUCE 5AW3B 4YEFA 5I1JH 4LMQI 2B1HL 4N2GA 4X6BA 3OKNB 4ZNCD 1BAFL 2X4PA 1MVUB 2NY4C 3WIHL 4N8CL 2A0LC 2APTA 2VLLB 1KTKE 3CN2A 5IKCB 1JDDA 3OXSA 4G6MH 2ZOLB 4OKDA 3ZDZB 3EJSA 1CF8L 3TJHD 4W9HC 2FJSA 3G6AA 3P4NA 4JPWH 2DQFA 4GFTB 3VI4B 3VFGL 5TF1L 4BCYA 2XTJB 4GRMB 1OAXH 5CKGA 1J5DA 2CR3A 3WFBH 4PJXA 4XBGA 4QHUB 3N3EA 5EU5A 1DBBL 3CMOL 1MSPA 5F96L 4JN2A 3S4SB 1EV2E 2DM2A 2L8AA 4HIHA 3UG4A 2VLRB 4IMLA 2BNQE 2PPEA 3QCTL 2BZCA 3K91A 5ACLA 1AJ7L 4KI5D 1JPGB 4LCYA 4F9LA 8CGTA 1GC1L 3FUEA 3MNWB 3ET9F 3K6IA 1G9MH 4GBXB 5A43C 1FLRH 4NC2B 3RBSA 2G3ZA 2R15A 4BFBD 3MNZB 4BUHA 3A47A 1I8IB 4AGLA 3UC2A 2NOYA 1MJ7L 1MPAL 3FQUB 3MLSH 4UV4L 4YX2H 1A9EB 4LESA 2NUPA 4ZUVB 3QI9A 3K7UA 3OHXC 1CN4A 4YBQC 2O93L 2KKQA 3GFUA 3KW7A 5L2JA 4YDIH 5HYSB 1T80A 1NBYA 1WFJA 4MDJA 4LMQE 1DN0A 4L3EB 3F7KA 3HBGA 2YPKB 1EZSA 2NNRA 3D1MC 5AVSB 4JPSA 2L0DA 5CILH 3RQ3A 1V7ML 4XXCC 3Q7JA 2OXHA 2R59A 2ZG1A 2F7IA 5EZOH 4W68A 3O45B 3D5OF 3E1F1 3MLVH 1OD7A 5E9DB 3GZOA 5EBGA 3HJ0A 3V0VB 1QWHA 4UTAH 1I8UA 1R1CA 3HMWH 4HBQA 5E0FA 4YZWA 3ZGHA 3V55A 3FSWA 3UPRB 5BMFH 4FA7B 3PHQB 5B1JA 1XCXA 2EIBA 3EOTL 5HHMB 4B5EA 3MBEB 4WNJA 4RSVA 5BZWA 3TLRA 2PF6A 2VZOA 1KTJA 2AXHA 5DJDA 1ZT7A 3MRMB 2VDNB 4PJCA 5EOCL 2D0GA 4PREA 2SEBB 4DOHB 1S7SA 4Y2DD 3RDTB 2X87A 3W38A 5FECA 4AOFA 4R5VA 3K4ZA 5DD6B 1T89A 3TBWB 3MV7A 5KS9E 2CO7A 1OCOB 2EYRA 4F7CA 1J86A 4KDTC 1GGYA 4HIQA 3WNOA 1RUKH 4HK3J 4NXKA 4IDJL 3MROA 1HL5A 4ZFFB 4BHUI 5D2NA 1WIPA 4P5SA 1GW0A 4RFOL 4Z7AA 1LO4H 1T7XA 1S78C 2B4CC 3US1A 4LAJH 1D7FA 4MHHG 5FFOA 2V7HB 2GJ6D 3PREA 4C8XA 4HGWA 3TURA 5TE6H 1T5WA 3FBKA 2VERA 2OL3L 1MZYA 5A40E 2YZ1A 4LAQH 4TQEL 4X7EC 2QVTA 4I9XA 4MB5A 4XE5B 2CRIA 4XBPA 4WEBL 3DX8B 2K9UA 2X1QA 4YXKL 1IM9A 4HUXB 4NZJA 3BSHA 3KPRB 1Z5LB 2VDKH 4OGYH 3TA3C 1I4FB 1G7JA 3K2UL 2WVVB 1TEYA 2BWQA 2FJGB 2B59B 2FLBT 5DDHB 3MGOA 3F12B 4P4KD 1UWXH 2NDGA 5I15H 4KMTH 4LCVA 3EZ8A 4FLOA 1L0YA 4Y4FB 3MLTA 1KCBA 3KYMB 4U33A 4IHOA 3K71A 1DVXA 2O5YH 1D5IH 1FHGA 5L88H 3RL2A 2OXGA 5A6LA 1A7QH 1MH5B 1DJGA 3IB4A 1S9XA 1HJBC 4JFQA 4G42B 2CNYA 1JXDA 4LLYB 4NJ9H 3QDJA 4P5KB 3HMXH 4Z7WB 5JOFB 3I6LD 2AJVH 4ERSH 1CTNA 2IANB 3EYOA 4OZIE 1UEYA 2FIKA 3E2HB 4R2GD 1YLBB 4MZRA 5D1XE 5FW7A 4LP8A 4Q8BA 1MHCB 1A4CA 4O9HH 4U1MB 1H5BB 4LSQL 4QRRE 2V8LA 3B2VH 2N4IA 3LD8B 4UT9A 4PGBA 5F88B 1H9VA 1MFCH 1VZHA 3IMVA 4PG2A 2VMCA 2TSAA 1N19A 4W9LC 2ZWNA 4AITA 3ARUA 1RJYA 1KIQA 4IOSD 1A3QA 1T2QH 3BQVA 3MGTA 2XPYA 1S8DB 3X3GL 3U6RB 4X5LA 6PAZA 4FXGC 1DSFH 1ZD6A 3QO1A 5D7JA 4ZQKA 4DUVA 4XRCA 4L8DA 4NKQB 4BRJA 4BE6A 3D9AH 3FSAA 4C83A 3RZCD 1YJDH 2D3LA 3RUGF 4MD4A 4KRPD 2P5WE 5FF6B 2HMIC 1HN1A 1WUNT 2Z91B 3HZ3A 1UJ3B 3NZHH 1WBYA 3JVGA 1ONQB 3II2A 3MRQA 4MA7L 4PN6A 5G4NA 2I9TA 5FHAL 5J6HA 1IGFL 3LTVA 4BUQA 1IVLA 2X44D 3IRPX 4MJ6A 5KBDA 3JYCA 4U6YA 3W1ZA 1PZUB 4GEJA 3KM1A 2JJSC 2XG4B 3BRGC 2IGTA 4JPVL 3EIFA 3DROA 4LLUB 4LSVH 3GDCA 1EHXA 3ENEA 4LT7A 3JV6B 5EF3A 3EGSB 2R4SL 1P2CB 5DO2C 3QG6B 1U33A 2GK2A 1OSEA 3DTXB 4WFHE 3ZSSA 5LBSH 1JHTA 1GGUA 3HB3C 5TFSL 2BSCA 4WTWA 2IAAC 3AM8C 3UYOD 1IEBB 1I8KA 5KVGE 2E8YA 4DN4L 1OTSC 3MRHB 5IMKA 1KIRA 4GMTL 1PSKH 1XCTA 4XPAL 3QSKB 1D6VL 3QQ4B 5IJCC 2YUZA 2I7SA 3N50A 4ONFL 4KV5E 4AVIA 1RKRA 3WGVB 2YC1A 4JJ5A 1KJMB 4YBHA 4JGJA 4ZPTB 4DKEH 5I6PA 1LO5A 4LDEB 1AGCA 4KX8A 3LMJL 3MRDB 5E2TL 1LP9E 3QDMA 1XIWA 4G9FA 3H9HB 3D85D 5MHSE 1OGPA 3B37A 4X5QA 3S8FB 3BPCA 2OQJB 3HI6L 3QPQD 1U8JA 4Y19E 4XN9A 4Z6AT 3ZSTA 4UBDD 3BUTA 2PTTB 3RGVC 4HIJB 2CZNA 4KTDL 3CLEH 1MELA 3OBAA 2WMPB 3DC0A 4MDIA 4A39A 2VDOH 1YG9A 3MO1A 1DQIA 1G7QB 3PIQB 3VG9B 5F7WC 4NNPH 1QSEE 3MRBB 3I2CH 3QQ9C 2HJFA 2J43A 3A6BL 3D3VA 1P5UB 3I9GL 5C0IA 1WFNA 3S3BB 4UAHA 3K6SA 4F92B 3GMLB 3KEDA 4D7BA 5LXVA 1HHKB 5IR1A 2E6QA 4AIOA 2F54A 3AUWB 3BP7B 1BGXL 1VAHA 2ESVB 2X88A 2NZ1A 4XT1C 3FSOA 3B8SA 1SYSA 5C08B 2A4EA 3QG7L 5EOQH 1JWMA 3SDCC 1CE6A 1XR8A 3ORJA 5BXFA 5IJKA 3C09C 1XCWA 4FFTA 4PP2A 1OKEA 4UQ2B 3U4KA 4NBYB 1EHLH 4MMZB 2EEDA 5E4EC 2WWMD 4CC1A 3D30A 4JHBA 4LBAA 3ALXA 1GYVA 3OKDB 2ZKYA 4AGMA 1F58H 5F7MC 3SCMD 4WI4A 1WBXB 4HPOL 4W9KC 4FHBD 5ABZA 4ANKA 2N7AA 4IRSD 3N1GC 7FABL 4EIBA 3MCYA 5L2KB 1ODUA 5E6ID 4XNZC 4NC1C 1X5HA 3LV3B 1HCYA 4S1SH 4PIRF 1UFGA 1PD0A 1YO4A 2Y3AA 3O8XB 4P23D 5J11B 5FGCB 4R84A 1ZT4A 3AG3B 2CMRH 2B2XL 1YMMA 4GG6B 1PCSA 1F56A 1W72L 5GSVB 4L5FH 2BP8A 3FN3A 2YD8A 4OB5H 3UJTH 5AOLA 4LVNC 1Q9WA 2M8XA 2NY0D 4M7ZC 4AUUA 4LVOC 4NRXA 1F11B 1RLWA 1A7OL 2E7DA 2V0AA 4E68A 4G7VL 4HS8H 5JHLH 4A63A 2IBZX 1QEXA 4QJ4B 1KGJA 1IGTA 5HI4C 1GZHC 2B1HH 2DPKA 4KY2A 1PTZA 3HHSA 5I30L 2FGZA 4HUUB 4PJDF 4N8CH 2Z34A 3TONA 3L7EB 5AFAA 3V8OA 1CF8H 3M86A 2A83A 3Q1SH 2R2HB 2EKJA 1M71B 1G7HA 4NO2A 1N6QL 3EYFA 1CLYH 2KQMA 4M7KL 3VFGH 4X98A 3EJQA 4LLVB 4BA0A 3MA7A 2V2TA 4ANUA 3TTYA 2A74C 1DBBH 3CMOH 3K8LA 4DW2H 5F96H 2P4AB 1E8YA 1IAOB 4ODVL 3JWNH 2BSRB 4OCRL 4PTTA 1F3DH 2ZOTA 3UDWC 5I76B 2E7BA 4OFVA 4TVPH 5K69A 1KCWA 5IB4A 1NAMB 1QNZL 3QUZC 2OX5B 2JKLA 4H0GA 4LCWD 4I3SL 4WO4A 3WG7B 2X0VA 5E8PB 1OPGL 2ZCKL 3OB8A 4YDLB 4G1MB 5CKAA 4H20L 4OLUL 3ZT7A 1XH3B 1WZ1H 1MPAH 2IPTL 2MSPA 1LMKA 2X0UA 2F6AA 3G08B 4FFZL 2EZ0C 2W0FA 4WU5B 4EN3C 3VD7A 1N12A 2J1KA 3AMLA 5DHMC 4OZFG 3VDCA 2Q6WA 2ZG3A 4JFOA 4GRWE 5HSFA 2ENYA 5CJ8A 4XAWL 1Z3GL 2CBOA 2JIXB 5KG9A 2CDGB 3RVVC 4JAMA 4YSSA 3O3EA 4HMCA 3MACH 1FFNA 4YK4C 3HBZA 3K6FA 4LDOB 2IIJA 2EE0A 2EDNA 5M95B 4PRAA 3T4AB 1U3NA 2JCCF 4XXDB 5D1ZI 1LWRA 4LHUB 4M6NH 1QHOA 3IN0A 2DLGA 3RVWC 3W82A 2CKNA 4GT7A 4PJ5E 4EIGB 2NNAA 2C7UB 3NTCH 2OCFD 5IHZA 1C9SA 4UILH 2EDXA 2WXQA 1X5AA 4MAYC 1QO3B 4HP5A 5T1LB 3VXTA 1YECL 2F2HA 4GLRH 4ZFOL 3MCKA 1XGTA 1KGUA 4PLOB 4KO6A 2VLME 1FO0A 1UZ8A 1WFOA 4YHOH 2XRAL 4FA8A 3ZO9A 1HHJA 3KLAA 4EI5D 1ZLDA 4KRNA 2ZAIA 3D25A 3EYVA 1P7QA 1N18A 2ZUXA 5SWZD 3MA9L 1D7BA 4K7FB 4IRJA 4C4UA 3X3FL 3E9TA 5EU7C 4L9LA 5JYLA 1KF9B 1YPZB 2PCFB 3CX5J 2PUQT 1E5UI 2VIRB 3F85A 2DI8A 4G80A 2EACA 4FQJH 4WV1C 3QDGE 1MF2H 1IAMA 5D72H 4O4YH 4WEUD 3KPPB 4K15A 4XTRC 1A2YA 2FECI 1EUTA 1IIKA 2AEWA 4HXAH 1O7SA 3VU2A 4YXLH 1J0JA 4Y5XA 5DEJA 3P02A 2GTZB 3QFDB 1G87A 4RFOH 4O02H 2G4GA 1I7ZB 2NZ9C 2ZXQA 2DM3A 3F83A 1E4WH 5F1NB 4F58H 2IWGA 4XZ4A 4NUQA 4WNQA 5HI3C 3SKOB 2R29L 4KZEL 3VE0A 1E28A 1QPPA 2BSTA 1A6WL 3HN8A 5F7LB 3IS1X 4DP4X 3DTUB 3QWOB 3BEWB 1DLHB 3QZPA 1ZLVK 5T1KD 2ADFH 2YAHA 4NKOB 1NJ9B 2KLTA 3FO1A 3DGCR 1HHGA 4LEEA 3C60D 3RUGA 5IB5B 5IB2B 3EAKA 3UJIL 5B3SB 3G9AB 3IF1B 4MJHA 1HX0A 1OK8A 4HWBH 4MAZA 4LARH 3VXQB 3K2UH 2RHEA 2X1WL 2XNAB 1UVQB 3M45A 4KK5D 2YPVL 1YEFL 5GSRB 1BVZA 4UAOC 5HYJA 1T0OA 4OZHB 3ZE0F 4F93B 2JJVA 5GS1B 1EX0A 1KIPA 3L3KB 4E2OA 2VDMB 2IADB 1DQVA 5JIIA 1PF3A 3K0YA 1NCCL 3OKOB 4K9EL 3OLGA 4XVSL 5CJQL 1JTPA 4MQ7B 5INCA 3T0AA 3VI3F 1AD0A 2C3VB 1AP2B 2VUYA 4JY5L 4JDZB 4NKMB 3VGAB 1ZOXA 3RWHA 3SKMB 5DJXB 5DEZA 4HAGA 1UXSA 3D69A 2VMJA 5FO8B 4NCC1 2WANA 1AR1C 2E9IA 2NXYD 2HKHH 3O6FC 4WQOA 5CO1A 5DGQA 4AH2B 3EW3B 4OGXL 2JVUA 4OM1H 5TTRA 3GUFA 4G1EB 4Z7QB 3F7QA 4LSQH 4I5BA 1JGVH 3IJSA 3LEYH 5EIIG 5FCUL 1ETJA 5GGVY 5EO0B 1GZQB 3FDWA 2PCYA 1DO5A 4F7TB 3ESUF 5I6NA 2HTLD 2Z7WA 1BD2A 3OSVA 4KVNH 5IQLA 4EZJA 5T3ZE 3NCFB 5DHVB 5JPMA 1FYTE 1N7ML 3CAFA 3X3GH 4UU9A 4URKA 1D9KA 3ZHDA 4WFFD 3ZHFA 2DYPB 1U8PB 3DX0A 4PPTA 5LGJB 5FDWB 2HFEB 4G8GD 2N0MA 3TYGH 4R7NA 1MVFA 3A4FA 5GRVL 1VFMA 1R24A 1NEZG 2FX8H 3F01A 4D0BB 2BM3A 1XCQB 2OYMA 3FRUB 1MCWM 4H1LH 4U1NA 3STLB 5I0WA 5JA9A 1U8QA 4H5SA 3RVXD 1C5DA 5IGXL 2J3SA 5EDXA 4HPHA 1I7TA 5DQJB 4L8CB 4IEFB 1HDMA 3L4UA 4X6FA 1TETL 4P2OD 3L2LA 2NCEA 5LN4A 2EC9T 3ALPA 1XGPA 2DQGL 3DPBB 2XKNB 2ENJA 5C0EB 4WCYL 2ZSWA 4M3KB 5E95B 3NZ8A 3FFCA 2HSIA 5DZJA 4F7EB 2FH8A 2QQQA 3CHQA 1LEIA 3WLWC 4NQCD 5F6HJ 4QRUA 4DZ8A 1JK8B 3WFZA 2Q7YA 4FMKA 3BCFA 4NPJA 4YXHL 3NN8A 1ROWA 1FORL 1Z9MA 1D6VH 4PJ7B 1O9WA 1OE3A 1BQKA 2Z9TA 3IXAA 4R4NC 5DEGB 4X8CA 5FGBC 3U79A 1KLFB 1S2EA 4E42B 1AQDA 3CU1A 5IFAL 5A7EA 1EERB 1NMCB 4MBRA 2HVBA 4WRLA 4EDXB 4F9PA 4OZFA 4ONGH 4DKFL 4X8XA 2C3HA 3BVDB 1HXYA 5DJZB 3GTNA 1PZDA 4IYKA 2VN4A 1YRKA 2G2NA 1S7RB 2HVJB 1PFOA 3GSUB 3QH3A 2EYTA 1UB6A 3FL7A 5D1QB 3WL9A 2XBTA 2VXQL 5L0QC 1AHWA 4ZS7L 4HLEA 5BVPH 3BAKA 1H15A 4JFZH 3TO4C 5JDJA 2FJHA 1EH9A 4R4FL 1EJOL 1NBVL 5DTFB 4PWEA 1SN0A 4X4KA 4Z5RA 4TN9A 4FTVD 1YYML 5DJAB 1JZ3A 2X6BA 3QCVL 4HDIB 5E56A 4OCLC 4YHML 1NGWB 3UACA 4PJDA 2NTFA 1V7NL 2UXGA 5DFVD 1LDPH 4PRPB 3T3PB 2N0KA 3BWUC 3WS6C 1URLA 3WDJA 2ICWI 1FH5L 3BGAA 3FH7A 1QRNE 4NP9A 4UT7H 2PCPB 1J10A 2EVHA 4K5PA 5HHQB 2EEBA 4L48A 4PLKC 1CGUA 3QEGH 4JO2L 1EEYA 1YA5A 2NY4B 1YEGH 3ZTEA 3SSGA 2Z1PA 4JM0A 1KBWA 2ZTBA 1IQWL 1IGJB 2EIZB 5J4MA 2VE6A 4NT6A 2APFA 2J44A 5M7QA 3HI1B 3GGWA 4AJYV 2MEJB 4PY8I 5CLZA 3MLUH 4OAWB 4C58B 2AV7B 1TO5A 2FJUB 4OD2A 3TIEA 2AJUH 2C9VA 1ADQL 2B2XH 4U0QB 2QBWA 1DANU 4BKTC 1XO8A 5SWSE 1W72H 3HN5A 2Y1ZA 1ECZA 1MCPL 1U6AL 1NFKA 4MA1C 5I1HH 4MAUL 4MCZA 1R5WB 4JVUA 4NCDA 5KAQF 2PCXA 3KPMB 2BNUA 5BS0E 1RULL 4G7VH 5DLLA 5AW5B 3T0XA 1OP3H 3CBJB 4A6YB 3DJZA 2P80A 2XWBA 2FBJL 4BK8A 4OQTA 4X4ZA 2E76C 2BMKB 3T04D 3NSFA 1JGLL 3UYPB 4B7IA 1PZCA 1ZHBB 4Q9QL 4LEOA 1CDHA 1SXZA 2J6EL 2WTRA 3LKQA 3S36L 2Z31D 3GSWA 3QRBA 2XXCB 5A2CA 2GCYA 4NOFA 2JCCA 3BP4B 5D4JA 1E9QB 2VXTL 4V1DA 3ZDYF 5GGSB 1KGCE 2H8PB 4CKVX 2MOVA 4M7KH 3VM5A 3JUZA 1QYGH 3MV8B 3GSRB 2WBJA 1KJ2B 1DVYA 2E56A 3NJNA 4PY7A 1BQRA 4H13C 3WE6A 4O2FA 2J1YA 4XHQA 4WENB 2OCCB 2XWXA 5EBLB 1J5HA 1RZPA 1UENA 4UIMA 3RRQA 2X2JA 3GSQA 2VAJA 3O2DH 4PCSA 4CNIA 2EXTA 2XTSA 3QNZB 4K5NA 5ILTH 1PQZB 4BFJA 4DGVH 1GTNA 4OCRH 3RL1A 2GK0B 5EIIA 5KUKA 2Q5BA 3C08L 2YJLA 5GZNC 3GJFB 1KULA 2LTQC 3CH1A 3BYTA 2G60L 2LLNA 3BZEA 4I3SH 4HU8A 2QDVA 3ARGD 5DURD 3IRCA 1OPGH 3LEXA 2CLZA 3FTGA 3DO7B 4H20H 2DY2A 4OLUH 3AABA 3VYOA 3WNJA 2IPTH 2E0PA 3DYPA 1X4YA 1X9LA 2ZOKB 4ES9A 4YC2C 3SN6N 4LKCA 5LQBH 2G3XA 3JV0A 1NFDE 1WK0A 5A1AA 2HX9A 2YFNA 2BOBA 2WVSA 1NEZA 3EDEA 5FYKL 3V4UH 3LY6A 1Z3GH 4PVMA 3S37X 1KWKA 3GJEB 2OP4H 4TQ8A 4HT1L 1ZIBA 2IDUA 2O6PA 4OF6A 1A7PL 4X8GA 4YDVB 5C0BB 5KAQG 5KSBE 4ZFGL 3HE6C 4NXSA 4ZS6D 2X6MA 2ISDA 2ICES 3D3VD 3GBMH 1DLFH 3ZZ1A 4RZCA 5DVMA 3WCYA 3QIWC 5DMIL 4U1LA 3BLBA 5KTEL 4X4YB 1F18A 2F54D 2XI9A 4WHYH 1SJEA 3AXLB 4XPBH 1MRCH 1E4JA 5D5MB 3SGEH 3UAJD 5HGDB 4Z77B 2HT2D 2XRAH 1XVSA 4IIQB 3MRPB 5MENA 1DJIA 1F8TL 5D96C 1G9MC 4YHNB 1NDGA 5EORH 3VXUB 1J8HD 4N2MA 4QRPA 5D7LE 2EVFA 3TA3B 2ICCA 4HS6A 4ZFZA 1JPSH 2APWA 3MRJA 3VI3A 4W1TA 5ESAA 5FX3A 3NSJA 1Q9LB 1MFNA 4JM2C 2PWDA 3RTLA 4PYHA 1E27A 2CU9A 1OZTG 5HHOA 3NCYS 4Y16C 2GJZA 5J9PB 4Z7VE 2Y07L 4TNVF 2YFOA 5AOMA 3MBWB 5ITBL 2GW5A 1P4LA 1T22A 1XSJA 3G5ZB 3HZMB 4OZGB 4PWFA 3ATDA 5F7DA 4FQXA 1T4KA 2D7NA 4PB0H 4M8QA 3FB8B 4F1SA 2ZYHA 1DP0A 2GIMA 2X3CA 4OZ4B 3GZPA 4KHXH 3W0WD 2CUHA 1DANT 5CFAA 1K8DA 1ZY9A 3PABB 3GQFA 5JYMA 3QT2A 1NWPA 3BH4A 3MFFB 1RLBA 1JHKL 4Q56A 2XFXB 3BKMH 1F1DA 3O3UN 1OP4A 2A9DA 1NC2A 4B9GA 3DVNA 2MCPL 3EYSL 5FEBA 4JZOA 5G2NA 3UZEA 4MWFB 5ESQB 2FWUA 2Z8VC 3DMMA 3K46A 3OKKB 1JCKA 5FDYA 3VD5A 1PKQB 3B5HA 2ZSVB 4PW4A 2XC8A 3AY4A 4MNHA 4OCMC 4GIOA 4NQEB 3D39D 4HBCL 4ZW8A 2FATL 4GXVL 5CINL 1HEJC 1DVFB 2DKSA 5L4IA 3SE3A 1TTAA 5DO8A 2EAEA 5EBWB 1HC1A 4JO1L 3DV4B 3HC4L 3LKSA 3QO0B 4QCIA 1KPUA 3TNNA 1BDYA 1CFQB 3U2SB 4TMPA 2PO6A 4GW4A 5CJQH 4XVSH 1KYOJ 2B39A 2P5EB 3QEQE 3ARDD 3MRGB 1DSYA 1X44A 1XB6A 3WFDL 5KSVA 4L4VD 4S2SA 5ACZB 3AS3A 2X53A 4RZKA 5JHDB 3PNRB 3CDFA 4HXBH 5A6MA 5CGYC 5AB1A 3IKCB 4PRBB 2VT0A 4JM4H 2NX5E 1SXAA 1Y6NR 2VYRE 3M17B 4LLDB 1VJSA 3QP3A 4GI9A 5KVFL 3GXUB 1MCQA 3RWCA 1MCWW 4LSTL 4BQ8A 3DETC 4OKVA 4OSUH 5DQDL 3HB3B 4FQCH 4DN3H 5K9QG 3MDJA 4LCIH 3VXPB 3WJLC 4JB9H 1MNUH 4JZNA 1DBAL 2IQAB 3ECBB 2BIIA 4AG4L 1DQQB 1E50A 4YLQT 4XOBA 3U7WL 7TAAA 2ATPB 3ZYJA 3II3A 1YY9C 1AAJA 3TN0C 3R7QA 2Y23A 3S37L 1KCVH 5CP3H 3IJ8A 2EDHA 4LLMA 4U7KA 4HWEH 5ISZE 1J1XL 2K4WA 5J57B 2RH0A 5DMKB 2XTJD 2R9HC 4Z0BL 3NZUA 1THAA 2Y5TB 3U7YH 3QRGL 4M56A 5GGRA 3C5JA 3CFEB 4P2QA 2H45A 3RVTD 5BVJA 5AKSA 4JFFE 1CWVA 4RMSA 5C7ZA 5AUMA 1FN4B 3BO8A 2DQGH 5I6KA 5H35B 3KMDA 2VLRD 5FHBL 1EFXB 5AL8A 3KPNA 2MNUA 1K2DB 3CFJB 2QVKA 4RISL 3FZUC 1I1AC 2BCKB 4X6CF 5HYFA 5E23A 4RFNC 3VQ2C 4CJ1A 3B6SA 4Y1AD 1P7QD 1T6VN 2K6ZA 3DJSA 4PRIB 4ORZC 1A02N 1LO0L 1FORH 3DBXB 2A7BA 3GJFK 2Y6SC 1BSIA 4QF1B 2WLMA 3ULVF 4UT9L 2QVFB 5IFAH 1UZ6E 4Z7UB 5DD5H 5KVEL 4DKFH 2OJEB 2OFQA 3B1TA 4Z76A 5FK9A 1GKOA 2XWCA 3IE9A 4KXCA 4X80L 1MLCB 1YJDC 1H19A 4Z7NB 2Q8AL 3SE8L 3GBNL 4RGND 3BEVA 3LN5A 5C0AB 1ES0B 1W6LA 2CDEB 1D5MB 2VXQH 1LO3L 1MRFH 1OB1A 2FLRT 2HAZA 4Y4KA 1FZKA 3DRQA 2H2SD 4ZS7H 5F6IC 2JTYA 1JN6A 4L37A 4QHNB 1DTUA 1FNHA 1XXFC 2CWRA 3VRJA 1QSFB 2BC4A 3HAEA 1A66A 1SVCP 4R4FH 3BQUD 1NBVH 2Y22A 1UQSB 1HAUA 2ZP9A 3NK3A 5EU6A 1FL6B 3P4MA 2P44B 2EDDA 1A4KB 1U8HA 2G5BA 4GO9A 3O3AB 4P49A 1F02I 3MBED 1TMQA 3D4CA 1EZVX 2CO2A 1E4XL 2HT4C 2C9PA 1V7NH 4PCKA 4MS6A 3ZU8A 3O81A 2BIHA 2BSSA 1XL4A 2NW3B 2YUXA 2DH3A 3T65B 3GMMB 32C2A 3TCTA 3BXNB 3H53A 4NN5B 3FQ4A 1P1VA 2ITCB 3CWGA 4PHZA 5DU7A 4JO2H 3L5WA 1LEGB 3QR0A 4GAYA 5GRUL 2ZAGA 1JF1B 5LN8A 3FCBA 4JL2A 5CIPH 1IQWH 4AI7A 5JHMA 4UQCA 1IJ9A 1ICTA 1OAUL 1CCZA 3REVB 3DXAE 2DWDB 4ZX5A 2NY5L 4RA3A 3F7YA 1ORSA 4GAJH 4XO5A 5EUOB 3IFLH 3I50L 2Z65C 3MMEB 1TNNA 5CN2A 4C55A 5BUPA 1ADQH 1OSZB 1V54B 1NFIB 3B7TA 3AS1A 3VWKB 1MCPH 1U6AH 1WGOA 3BX7C 5JNYA 3PJNA 4U3HA 2KLRA 3H9SE 2X4SB 1DBJL 4HUWA 5DC0A 5AD0A 3QARA 4J4PA 5GS0D 4G72B 1VCAA 3GKZA 1YEHH 1YN7B 3I6KB 1VRSA 3JTSA 1DQLL 3BH9B 2EECA 4KTEL 5A16B 3QUZB 4X7TB 1A65A 3OKLA 4LCUB 4BH7B 4KKZA 4ATWA 1JGLH 4JO4L 3EJYC 4EZKA 4HGMA 5I19H 5CGMA 2MTAA 3KXFE 1JVOA 3CFTA 1OTTC 2WN2A 4Q9QH 4C56A 1M2VA 2EDJA 1F4XL 5B38A 1BVLB 3Q3GA 3WXWH 1DL7L 2VZ1A 4HHGA 4YR6A 2E7CA 3WMPA 4XMZA 3T6WA 1CI5A 1LLAA 2LV4A 3L3OA 1CFTB 4M3JA 5GRXG 5C7XL 3L8QA 3C6SB 2F68X 1D2OA 5ETUB 5FYKE 4MD0B 5IB1B 2DYSB 1JZJA 4I48B 4I9WD 4N9GB 3SKNB 4ZMQA 1F6FB 4QJ3B 1T1YB 1N67A 2UWEB 1LE5B 1B3IA 2H2PC 4P48A 4BSVB 1XF3B 3MOAL 1E65A 2M83A 4JFDA 5HDBB 4BM7A 5IIEA 1RZ8A 5D8JH 1JNNL 2BY1A 2YBRA 3LKRA 4MXQD 1ZVSB 4DJMA 3NH7H 3U0PA 2DTML 1F45A 4L3CB 4N6QA 2J71A 4MAYB 2G60H 2A6JB 1W0WA