3NRFA

Crystal structure of an apag protein (pa1934) from pseudomonas aeruginosa pao1 at 1.50 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
DAVMVFARQGDKGSVSVGDKHFRTQAFKVRLVNAAKSEISLKNSCLVAQSAAGQSFRLDTVDEELTADTLKPGASVEGDAIFASEDDAVYGASLVRLSDRCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ApaG protein
publication title Crystal structure of an ApaG protein (PA1934) from PSEUDOMONAS AERUGINOSA at 1.50 A resolution
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 19
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3nrfA00
3SB3A 3NRFA
chains in the Genus database with same CATH superfamily
3D09A 4JFFB 3TF7C 2JH2A 4S1DD 4GO9A 1C5DB 3R8BB 5B8CA 3WJMA 3BYYA 5FM8A 4YDIH 1L6PA 4WUKL 5KJRL 1ZLEA 1UZ6F 3IN2A 3C6SB 3DDGA 2UXVA 4F15B 1SLVA 2YPLE 5EZPA 2EDWA 2YOCA 4Y4FC 3ARGC 1ACYL 3GKWH 3LN4B 4PD4J 3WLWC 2E9JA 2DD8H 1GYAA 2XJLA 3K4DA 3MJ8A 1NCUA 1S7XA 4ES8A 3LPWA 4JAMB 2GAZB 2EE3A 1TETH 3D39B 2Z7YA 4WU7A 2YIHA 4EEEA 3PL6B 3EO0B 2XWRA 4Z7VB 2X89D 5LGHH 3RJDA 32C2A 5C6PB 4N22A 3P3YA 3T2QA 3J2PA 4ZX4A 1VERA 2YC1B 4JO4L 2HFTA 4W4OC 4JO8A 2HTKC 1HESA 3X14A 1IM9A 4AGMA 4XN8A 3MFFA 4LXFA 2NTFB 1DBBL 1XCTB 2RR3A 1A6ZA 2YGPA 3VDBA 2OYKA 4BD4A 1OGTA 3K6SA 3QIBA 2G3NA 2VTFA 4XBPA 4M02A 3PABA 1UA3A 1AACA 2LU4A 5I9QB 2R29H 4PSRA 1K5NB 4YSQA 3MUGA 2O5XL 5I28A 5HGAB 1ZTXE 3LNHA 3MJWA 3VFTB 2ZD0A 2F74A 1A4JA 2P5WB 3INOA 2F53B 4XP6H 3V2AR 2XWBB 3L5XH 3NZ8B 4GBXD 4JVUA 4TVUA 1I7UB 3I6KB 1IILE 2CHXA 4KKAD 2MCG1 4KROD 1BZOA 3TTYA 5HJ3B 1JYVA 3QUYD 3EJQA 5FUZL 1OZTG 5BS0A 3SQBA 4ENEC 2F9BT 4KK6D 5K59F 4BM7A 3QRBA 1G7LB 3U1QA 2BOBA 4XCCL 2DL2A 1CGVA 3EDFA 2EDKA 3WY3A 4NN5C 4QYOB 2Q7YA 1KBBA 5SX5H 3D0AA 3NIGF 4GAYA 4GKLA 1ZHBB 2R83A 3QULA 4W9HC 4KV5E 3PGFL 2V3DA 4X50A 5JTWA 4NZUH 1MLCA 2X4TA 2PO6A 5D2LA 4WAFA 3TZVC 1J12A 3SDXA 3WAKA 2HFFB 4HCRL 4Y2DB 3GSUA 1RVFH 4ODVL 1MFBH 3F85A 4L3CB 4PWIA 5FOBB 3LQMA 2A0LD 4BK5A 5D1XA 5FW6A 2WWOA 5E23A 4FLOA 4BWTA 1HCYA 5KSAB 2IGFL 3OAUH 5C08D 3CK0H 1HQ4B 3TV3L 4U3SA 2OTWB 3MRJA 4FA6A 3Q2NA 3FH8A 4FNQA 2HPTA 3PAZA 1JZEA 3VM5A 4QJ5B 4OZFB 4XBEH 1Z0MA 1J5IA 2QMJA 4P9HH 4HV8A 1ZA6A 1DDHB 2IPUK 4B0MM 1HKLL 1S46A 4BCXA 4J7RA 4YDZA 1M7IB 2VDKL 2X28A 1C7TA 4P05A 4D8OA 3TT1L 1E0OB 3LH2L 3P4MB 4Z7WF 4LASL 3SYCA 4OGAD 2PP8A 2AJZB 3MRBA 5C0ND 3F58H 1INEL 2CD0A 5AUMB 1LK2A 2HN7B 3TIEB 1PD6A 4KDTC 1OTTC 1J0YA 4HX1A 5ESAB 2Q6WB 3LIUA 4S1SL 2H3KA 5D7KD 1AHMA 1TVHB 2Y7SA 4PJHE 4O58L 1J05A 4XAWL 1JTTA 2LE9A 5CWSA 3RIAF 3HE6D 3WFBL 3CLEL 4F7MA 5LGKA 4HKZA 1QABA 3ZKMD 5ADPH 4DO5A 1URZA 3CV5A 4PJIA 1PLGL 3T0EC 5D4JA 3KWXA 4ZUTA 4Z3FA 3E1F1 2O6CA 2VISB 1OAUH 1SDAB 3VFMB 4JHWH 2D4FA 3HS9A 3P9LB 4JFVA 2YD5A 5AVRB 3IB4A 5IM7A 1RMFL 1NFDA 3HS8A 4UT9A 5EIQA 5F7AA 4DZ8B 5KSBF 2H2PD 1J9RA 4QHNB 3JWNE 3SDYL 4PV8B 3VD3A 4JQIH 2AEPH 4JKPH 3FFDB 1P4LA 4K8RD 5ADOL 3JTSA 2NY3C 2HZHA 1SDDB 2CNYA 1OW0C 5BV7C 3BQUA 1RFDL 3CXDL 3GRBA 3M1BA 2QQLL 4M7LT 3VE0A 3MTXA 3RPBA 4RMBA 1XR8A 4X7SL 3MCG1 5IB4B 4MAYC 4WWOA 3TP4A 3TM6A 4MDRA 2G5UA 4ZD3L 5FV2A 2R0ZH 3SQRA 2PXYD 2L04A 2JKNA 2QHLA 1QSZA 3ASWA 3DVNA 4ELMB 3OG6B 5K9OA 5KAQG 1MJUH 4MWFB 5KSUB 4BZ2H 5DQ9A 4B9JA 4K7PX 3X3FH 2Y06H 3SDAB 4IRZL 3N0AA 4FQLH 1QFHA 2YGQA 1R1CA 4RWYH 5LAXB 1MJ8L 4JBSA 3LDBB 1UH2A 4P2AA 1P7KA 2ITDA 4PJHB 2WUBL 2IDUA 4NOBA 3DO7B 2BWDA 5BZZA 4QMEA 3SPCA 1BQ5A 3SE9H 3LS5H 3TA3C 1CXIA 4KJWC 1MHCB 4BINA 3MLPA 5ENWA 1ED3A 2EO9A 4KITB 3RWDB 3QXDB 1XR9A 5L2KA 1FZOB 4R4FL 5J3HD 4YDLC 5TPWL 4ODXA 5T3XD 5MEND 4JFWA 3PWLA 4YOKA 2I9LB 1DDTA 5CGYC 4P4KB 4EO5A 5FDWA 1OALA 3U30B 4KZEH 4NDMB 3S3SA 4ZW3A 2FO1A 1DYZA 5I18L 2OP4H 3JTTB 1FIGH 3ABKB 1QX1A 1R4XA 1RZ8B 5I0DA 2VL5B 1NKGA 2AEIT 1AI1L 4MA3A 4PJ7A 1J0JA 1CFVH 2OKMA 2D7NA 1Y6KR 4JM0A 3HMWH 5FM5O 1MQKL 4OF8A 3GSOB 4I3RL 3U82B 3FO1A 5LBVA 4IHOB 4KH9A 4PI2A 4XVTH 5F89B 2X05A 1TVBB 3ESOA 3RU8L 5JIIA 4P2YA 2OMUA 3RVUD 1FYTE 5I1IH 2EILB 1NMAH 4QTHA 2WP3O 1ZT4B 3DUUB 4Q9RH 35C8H 4G8FB 4DOHB 4DP1X 2B16A 4XPFL 4GRLA 4PJBA 3HZVA 1ADQH 2V6HA 2X2HA 1XZ0A 3FUIA 4KXCA 4HQQH 3RTQA 4HALA 3U36A 3GI9L 1GSMA 5EFIA 4X6FB 5LN8A 1NGWA 3PPEA 4E42A 1ZTXH 3HUJE 4XMZA 3UBXI 1CBVL 5EBMB 4XC3H 1QACA 3JT2A 4NI6A 3L1OL 4PVNA 3WXVL 1JUFA 4Y88A 1CLZL 2X4NA 1IGFH 2B1AH 3C6LA 3KPRA 4WZ9A 3TYGH 3LKOA 5EF3A 4NRXA 5C6WH 3EKCA 2NZ9C 1J10A 3O6LH 1TZGL 4MA8L 1UXWB 4P5KA 4XP1L 2V4LA 3U6XA 3W9EA 4HK3J 2K9UA 2H6OA 3ARDA 4G8GA 3F04A 2NR6A 4WI7A 3LVTA 6PCYA 5FKAA 2VXQA 3L1FA 2V9UA 5E8OB 5FWRA 2IH8A 1T0MA 3WTSA 5HBBA 2AAVA 2QQKH 1DVFA 12E8H 3BMVA 3HC0A 2IPKA 5AAMA 1MEXL 3BGFB 2Y07H 3H3KA 4Z7IA 2R2BA 1H8LA 2A6IA 3ZDYE 1MRFL 2EXWC 2QPFA 3JUYA 2XACC 1AHKA 4E9LA 2X6AA 4WRLA 4Y7OC 3DX7A 1T20A 1TTUA 3VXPA 1MCEA 3CZJA 3GXIA 1MVUB 2ZXWB 4U3CA 3RWGA 3R06B 2GY7B 2OL3A 1Z3GL 3VI3A 3VXQA 3TCLA 4EBQL 2NW3B 2P49B 3QEGH 4ZAKB 3UYRL 1ZANH 2CK0H 2K4AA 4DP8X 4ENZA 1MF2H 5IJCC 1D6EB 2C34A 4L37B 3QXTA 1GSKA 2VLRA 4LCIH 3LB6D 3QQ9D 3PV6B 4BFOA 1KJVB 4HIEA 1ORSB 3BAKA 2CZNA 5IHZB 1XTLA 5AZEH 2ENQA 2XOTA 1L9MA 3NCYP 4FC3E 4P4RB 3VI4A 3DX6B 4B97A 4HJTA 2XWZA 4HFWB 1LQSR 3O3AB 4G7QB 5DEGA 3HKFA 3I6SA 3K0WA 1AZBA 1TJIL 2AJSL 4MQXD 3K3QA 43C9A 2CIIB 4EN3C 1E40A 3VD4A 3EH3B 3VG0L 2O5ZL 4ETQA 1UKSA 3DO3A 1BW8A 2CGRL 1OCCB 2QADB 2YD9A 3ZJAA 4ELDA 1GTNA 3ZHKA 4NUJA 2GKIA 5TJWK 5J6GB 5LDSA 4BFGA 1A7QH 5EU5B 4OGXH 1OGAB 5SWSD 5IW3A 4FI8A 3PGDB 1IFGA 2V2XA 3JWOL 1U36A 3GJFA 3Q9QA 3I74A 3BRDA 1AMYA 3DVGA 4XN2A 5DHEA 1R0AH 1H0DB 1VGEL 1EJ6A 2LT9A 5GISL 2OMTB 2L7UA 2E7BA 4G7VL 4NC1E 3BZDA 1L3WA 3HS0C 2GC7C 1LDPH 3L6FB 3RB5A 3JWNH 5AOKA 3UCRA 1IZKA 2R29L 5GS1C 4F8OA 1UD5A 5CGTA 1Y0LA 4NC0B 4ODUB 1XGQA 3EFFB 4MAUL 1NSNL 3FW6A 4Z0XA 3GB7A 5HYJA 1DLHB 1S8DB 2OTPA 4DKDC 1KCUH 1H8NA 1U2CA 3J07A 4GSRA 4P3DA 4YO0B 5GRJH 1FVEA 3LZFL 4JPIB 4YWGH 4F7CB 1NDTA 2GITB 3BLPX 5E08H 4MASA 3T2LA 2ATAA 5CCKL 2VOTA 2OS7A 4LSSH 5F1IB 5JHLH 5JPNC 2WJ7A 4WLCA 3QQ4A 5ALCL 2Q86A 4AW7A 4BA8A 5IMKB 1JXJA 1DSFH 4HOXA 3FBQA 1XH2A 4XTRD 3SCMC 2W95A 5E4IA 1U8NA 1I1AD 4NN5B 2F1EA 1HZHH 2CHWA 3GMPB 4QHLB 3N42B 5HDBF 1WBYB 3H7BA 2IOOA 4K3GA 2CIKA 5ICXB 4WWKD 5IJVA 1P4BH 2YSSB 4U6VL 4YEFA 2NNCA 3BAIA 3UP1A 1IQWL 1DANU 1YY8B 5C0JB 1KV7A 4EUPB 1X5JA 1CU4H 1DUZA 3AADB 2KQMA 4UIMA 2X6BA 5MEPB 1X9QA 3UTSA 1KN4L 1NM9A 3B56A 3FYEB 2A6DB 4C57C 4P49A 4UNUA 4MJIB 4X5XA 5CU9A 3GMMB 3VGAC 5FPIA 5JW5A 3CK0L 1EZLA 4WUUE 3X3GL 1O5DT 3CXHJ 2P43B 4RGNB 5A2CA 3O6FA 1MWAA 5IVZA 3DX1A 1BYNA 1CZ8L 3MU3A 4RFNC 3T0AA 3U48A 1TQWA 3FQ1A 1LEKA 3QA3A 2YXMA 4UB0H 4XE0A 4N8CL 1D3CA 2VT0A 4XXWC 3B3IA 2BP8A 1AGEA 3I84A 4ZFOL 3O3UN 1KC5H 3FO9A 3HZMB 4PLJD 5FO8A 2DQFA 1IC0A 4WNQA 3BFOA 2LHAA 1GGCH 1G9MC 3H4FA 2BDNH 3IFNL 1JF6A 3QJHA 3QR0A 3WD5L 2VC2H 4RMTA 1CE1H 1S3RA 1HZLA 3JWDL 4ZMNA 3HBZA 5D5MF 2R1WA 1G7JA 1O9ZA 1O7SA 3KGSA 3WEXA 1NBZA 3C60C 1EHKB 5JHDB 3ZE1F 3C2AL 4MJ4A 2DWSA 1E7UA 3DRQB 4Y8DC 3SJVA 2EP6A 4O5LL 4Z7UE 3VCLB 1ZKAA 4AH2A 4FG0A 1PZUB 2WTRB 1AY1L 2ITEA 4XP4L 4AMKL 5DD0L 4P5MA 4G9FD 3T0EB 4MQ7B 3RFRA 3FFCD 2QQNL 4HHGA 4MS8C 3CDGA 3NK4A 3HR5A 3FF8A 4BV1A 2NOYA 4Q74A 1TZIA 5DUBB 3V0WL 4NM4H 2ED8A 2OJZL 1MFEL 1BJ8A 2DJUA 2R69H 2XXGA 4QRRD 1H5BC 3QORA 4PJCE 1SY6A 1UKTA 3D2TA 4FNPA 4MJHA 4P2RD 3THMH 1OY3B 5D2NB 3DK0A 1A9VA 4AL8H 1DO5A 4AM0Q 1H3PH 4H20H 43CAA 5KUMA 1M3IA 1T89A 3HMXL 1HDMB 1T83A 4G70B 4A39A 1KV3A 3EYSH 4PRPE 1ZD6A 3L3OA 5DJZA 2AXGA 1VEPA 3FN3A 2CCVA 5DZAA 1UTDA 1BD2A 5F9DC 5FKPA 3ARBD 5AZUA 5D70H 1AP2B 2HP4A 1TJGL 4UZGA 5K1NA 2VR5A 1C16A 5AAPA 3FZUC 1FVCA 4L3AA 3HB3D 5LNDA 2X1OA 5FCSH 1F2XK 1R3HA 4LLQA 5I6XB 3VWJA 2MFNA 3DRTB 1GYWA 2G75B 3HJEA 4YGVB 2K7QA 4JO1H 4RFOH 4W1TA 5IBTH 4E5XG 4FKHA 3FU0A 5SWZB 3QFDB 1VKXA 5ESQB 4P2OB 8FABA 1FFPA 1T2JA 4RRPM 1VACA 4UDTA 3SE4C 3HZYB 1WUNT 3Q6FB 4L48A 5CSBA 2CRYA 1KBKA 2WCGA 4HAGA 2YWYA 1HN1A 1YMHA 3AT9A 1MHPH 3FQ4A 5ANME 4U7KA 4CSSA 2FJGB 4FNLH 3O6MH 3T4YB 4GW5A 1IO4C 3LRLA 3L13A 4WDIB 2A3TA 1I9RH 1QBMH 5ISZE 3D85D 3MLSL 2FSEB 2DI7A 4OD2A 3GBNH 1CK0H 4YDLB 5MERB 1S9VB 4HXBL 4N85A 5T1KB 2M1KA 3LRKA 3VXMB 2GHWB 4NHCH 4J3OF 1KCWA 3T8MA 4KO7A 4EIGB 3OJDA 5LO7A 3P4OA 1IT9H 1D6VL 3DXAB 3S2CA 5FYJL 1HHHA 4JFQA 4DETA 2XVKA 1NC2D 4HSAC 3RGBA 3TH3T 3TO4A 1HHGB 1F3RB 3KW8A 1X5KA 3TEWA 1KZYA 3CLWA 2B59A 2D7OA 2XICA 4YX2H 1BHGA 5HYEA 2BMKB 3QRFM 4OJYA 1RZJC 3ATEA 2WZ0A 4XI5C 3ARED 3HNVH 3ROLB 2W0FA 3MRNA 2Z91B 4AOFA 1P7QB 2XBZA 4MCZB 5EEUA 3Q8AA 1GYVA 2YD4A 4Y5XC 1DUYA 3VAEA 2OM5A 4BFIA 3LPFA 2NNAB 4TPRL 5IQ9A 1UB6B 1U8PA 5EEWA 4C56A 5B1KA 3WN5A 2H8PB 4XNZC 2X41A 3H53A 4HIHA 2AQTA 3I3DA 3DIFB 3QQNA 1BM3L 2HVJB 2ZXEB 4K9EC 3SYPA 4HQQL 3GXUB 3KEDA 5C0EB 2R0WH 3O2WH 5MHSE 3WFEL 1TQBC 5D2LF 3I02A 4NQCD 1ROWA 5KTEH 5DRZA 4GS7C 5KYWA 5IVXF 3DMMD 2DLEA 2OJEA 1R5IA 2EO1A 4N2MA 4O51A 1PKQE 2AJXH 4KZ0A 5EORH 5IEHB 3ZO0A 3VX1A 1PU0A 1UXSB 3MRRA 3QDJA 4ZUUB 2AVFA 1KBPA 3RNKB 4NQVB 5I26A 2ESVD 2EECA 5E94A 4CVZA 4JPWH 5DK0A 2ATKA 5D7EA 4M48L 4RNRB 3DX8B 5H94A 1BREA 3N55A 3ZDZE 3FONA 5BRZA 4WCYL 4LARH 3DV4B 1SXNA 5EO0B 3AU0A 2MCPL 2R23A 2Z7UA 3BP5B 1FGNL 1J87A 3PQYE 1YPZA 4GI6A 3RY6A 4WGWB 2YUXA 4N0UA 1AOHA 1X5YA 2NY4C 3MV11 4U1MB 2BNQD 4AV4A 4AGLA 2GBTA 4KQ3H 4G9DB 3VH8A 3G7TA 1UM6H 3MCKB 3CFTA 3OKLA 1CTOA 4LZKA 3TU6A 5C0CA 3QI9B 3MBEC 5CJBA 3WJJC 4JE0A 1JV2A 4XP5H 3ZKND 2VW6A 3FOLB 4PLKD 4CN1A 5CFHA 5F3BB 1JHKH 5JORA 3WIAA 4GKSB 4GMTL 3TBVB 4J2XA 3OC8A 3BD3A 5J11B 1GGTA 5DWPA 1OAXH 3VXNA 2APWA 1NDMB 5C9JA 4JFYB 5IQ7L 5I1JH 3B7SA 3MNVA 1NIBA 1N67A 1ZSDB 2FBRA 2V2WA 3HI1B 4PY8I 3WUWG 4V33A 4X8JA 1K4DA 1WA0X 2BVOB 1SXBA 5E95B 2I5YL 2A9CA 4ONGH 1H19A 4AYGA 2VAJA 1F3JA 2J56A 1PKQB 2GTZB 4PEEA 5HHMB 4P3CL 2BOCA 3PPSA 4R2GC 4Q9QL 1CL7H 5T3ZL 3N85H 3ZL1A 1NPJA 2JV6A 2B9AA 3KYNB 3O4OC 1PX3A 3VNYA 4MJJA 1CF8H 1D5MA 2DWDB 3IWUA 3UFIA 5I74C 2EUWA 4MRBA 4QXGH 3KW7A 1DFXA 4U1LB 1NBVL 2C3GA 4QTFA 5B39B 3LY6A 2UZIH 1G94A 3I2CH 2J25A 4PJAE 2WBKA 4RRPG 1KCBA 4EN3B 2GCYB 3RZWA 1Q9LB 4HW6A 5J89A 5FYLL 1SJEB 1OM3H 3DJSA 5F88A 4HJJL 2DQHL 4MNHB 4TUOB 2V17L 3E3QE 5DURD 1AQDB 5FYLD 1S7TB 5JYLA 2DN7A 1CFQA 4OCYL 4B60A 1JN6B 5GGQH 4AQ1C 4FQQB 4I77L 4HHAB 2C4XA 4G6ML 2OQJB 4PH8A 3DSNB 5E5UB 3UG3A 5JA8B 3X12B 1E67A 1JPFA 3CU7A 3OHXA 1NDGA 3L4YA 3U79A 4LSTL 4U3HA 5JQ6L 4CW1A 4D8PB 4AK1A 2RQEA 2EDOA 3HS0B 3ETBF 5D4QA 4JM2B 3S4SA 3QUZA 5GS1B 3MLVH 1DZ0A 4JVPA 3LV3A 5F21B 5GXBB 2FEEL 3BUTA 3CZNA 3RZCA 4HH8A 1G7MB 5ESVB 3BOVA 5AW7B 5JMOC 5E08L 1NC4A 4CSTA 3QDMA 5D4IA 4ZXBD 1L5GB 3CSPA 5JNYB 1PD1A 3WSQL 2FGWL 3U6RB 1NAKH 4LSRL 1U8LB 1UWGH 2FX8L 2R1YA 5AW5B 2XVBA 5JPNB 2QTVA 1AO7D 4D0BA 3QDGD 1N2RB 1KGWA 2YQ3A 3L4XA 2B39A 2QMKA 5CJQL 5FUCE 1BP3B 4URKA 2EIZA 1GZHA 3ALXA 2D0GA 2KPNA 2UWEB 1NCBH 5DLMH 2OTUB 1QMUA 4NCDA 1G7HB 1B2YA 4PG2A 4PJ7F 4YL4A 4P9HC 3WIFB 1AQHA 4QJ3B 3QT2A 1QFPA 3EJTA 3UERA 3QCVH 2Z4TA 3FTSA 3MFGB 1THCA 1N6QH 4AQAB 3ARXA 3GSNH 1E27A 1CR9H 2YUWA 4AGPA 3L3KB 3QZLA 1CU4L 1OHZA 1MCBA 4OFQA 1ZVHA 4OLUL 1LJMA 5JHAA 2CLZA 2ENYA 2V0AA 4GO8A 4DZBA 3Q43A 3VXUD 1BOGA 2G0KA 1XX9C 2NYYC 4I18C 3O0RH 4A7VA 4FERA 2DW5A 3ILPB 3UC0L 1RZIA 2WNGA 4OLXL 3W37A 4Q14A 4ZFZA 1JCVA 4NI3A 4QD2E 2D7TL 4QT5B 3QZPA 3ZPDA 4OI7A 4FS0A 5KUKA 3ZK0A 3UTZA 2IALA 2WVSA 3TNMA 5BJTA 5IHUH 3OKEB 1YNKH 3R19A 4JQVA 2OMNA 3G5VB 5AVQB 3S9DB 3GSRA 1R47A 4OJFL 1T5WA 4WKZB 1IL1A 2BXYA 5D7JD 5E2VL 4AT6A 3AMKA 1JGDB 3MNMA 4ZI8A 2W0KA 1NKRA 3MXWH 3DKHA 3QW9A 1LEGB 3ZT5A 5KSVB 4X2UA 2RALA 1JHTA 2JIXD 2DDQH 4I9WD 4U0RB 2ZKHH 3CFNA 2DQEL 2OMWB 4ONHB 3VD7A 1JZDC 5LNEA 5FA3A 1TJHL 3KGRA 1OF0A 4HUKB 2NW2A 5KW9H 1I8KB 2A1WH 4YIQB 4GUOA 2WGXA 4X80L 2A6JB 4JZOB 2B0SL 2QZQA 2WD0A 3OPZL 4NRZB 4R7LA 2XZCL 4FG6C 5IHLB 3L7FA 4PRHB 4XZUB 5KANI 4F91B 4G1EB 2IBZY 4IRSC 4MXVF 3DGGA 3TWCL 2J6WA 1BXUA 2UXGA 2GJZA 2P8PA 5TE7H 1E2VA 1NTDA 3TA3D 2YSTA 3ATAA 4PN6A 4NPYA 1KEGH 2FLRT 3LSOA 3MLZL 4HS8H 4RLDA 3KXFD 2W1NA 2W65B 1BZ7B 3QFJD 1SBSL 5JUEH 5KVEE 3BSGA 3REVB 4RGOL 4GKNA 1ONQA 3FRPG 2GK0A 2J5WA 2C4FU 1XH0A 2W81C 2CDEA 2PYFA 5EV7A 4NZTL 3VXSA 4ZOAA 2XWJB 2P48B 4Y4FD 3ARGD 5FO9B 1G9HA 2IFFL 3WLWD 1DVUA 2EYSB 5F1OB 1RU9H 2VKXA 2FD6L 2ENPA 2XV2A 5KVGL 1NLDL 1BWWA 2E6JA 4KO9A 2NX5A 1YY9D 1P7BA 4JANB 3RX5A 3WN6A 4U1NB 4FA8A 2C1PB 4S11A 1OB1A 2FR4A 1CTMA 2XWTA 3PXJA 2HG5B 2R8SL 1RQ5A 3UOAB 1YEKL 3QJZA 1AIFA 1Z9LA 5IQMA 4IS6B 4ZS7L 3NRFA 2BH0A 1E4KC 3WDJA 4PVLA 1CICB 1RIUL 1SVZA 2PPDA 2HKFL 3H9SE 5HJBA 1FZKB 4LCCB 4N90D 1QHPA 5I75C 1SLUA 5E8EB 1NA8A 4D9LH 4QIRA 2PCXA 4RETB 2CO1A 4X7TA 5AWNH 5FECB 3IPFA 2XIBA 5GGSA 3IBOA 2QVFB 4G8EA 4YLCA 3GMOA 2XHNA 4FQCH 2VDQL 4W9IC 4CGUB 1A8ZA 1U3JA 3BGMA 3TTSA 5EWIL 1AZVA 1KGUA 4JY4B 3RTLA 4HHWA 2ADIB 1GZPB 1IIKA 1M42A 1XGYH 3QQDA 1S7WB 5T1MA 1EFXB 5HDLA 5JW4N 2ISDA 3FCSB 1QWUA 3S36L 3GXTA 4AKQA 5JW4Q 1M71B 1QATA 1BX2A 3T8VA 2N0MA 4YSDA 3ZE0E 2DF3A 3LQZB 5L0QC 2AQSA 3KJ6H 4P46D 5F8QC 4ANVA 4AK2A 3F7YB 3TZVD 1K5WA 3GIZL 3QXWA 4RMRA 2ZCHH 4H0IA 2VJ8A 2YA0A 3Q3GB 3RLSA 5L8LB 3NIGB 5C6TH 2DBLL 2FLBT 4Y5XB 4PW4A 4LVNB 4ZMTA 4X4ME 2QHRH 3CDZB 5I15H 5FFLA 1F4YL 3MLXH 5GJSH 3P30H 3ETSA 1OANA 4OCRL 5C09B 3G6DH 4UOZA 3WHE1 3H1ZA 4N2IA 5SWQA 1N5AB 1TQBB 4NX0A 3ABGA 4WO4D 1KELL 1BLNA 5EOCL 1M4KA 2AJXL 4PI0A 2BNRD 4FXKA 4IMLA 5FIEA 2BCKA 2CPCA 5DZJA 1EVUA 2GIYA 1KYUA 4BQBA 4PTTB 1OLZA 4CNIA 1CDHA 2Z92A 4MZRA 1FL5B 4Y5YB 4JPWL 3G3LA 2JKSA 4Z7WB 3W0WD 1ZGLP 2ZQKA 1JERA 3CMOL 4ELKA 1TXKA 4KKCC 2XYBA 4CILA 3DA0A 1BG1A 1OT4A 1OTTD 5EN2B 4EF3A 5IB5A 3QG7L 4NM8H 4TV3A 4S0SD 4ZUWB 2W07B 1H3VA 3AWFA 3CPUA 4XMKL 4KNTA 2XPZA 2H32H 1MI5B 2NY4B 4XN7A 2VDOB 4A1RA 3BSZL 2E9BA 5AL8A 2BIIA 1GZQA 2E4FA 3RIFK 2EYRA 4WFHE 3ZE0B 4M00A 2XFXB 2APSA 1GXEA 4R0LA 1YQ2A 4UAHA 5IROC 5I24A 4N0FA 3UACA 3CSYB 2AABH 2ZPKL 1MFAH 3MCLH 1PF3A 4XPTL 4K9JA 3F6LA 3Q8BA 2PR4H 3MV8D 1G5AA 1P84J 1UFGA 5CEZL 1CFMA 5JDJA 3GIVB 1A1OA 2F8OA 4WTXA 5C0RL 1Q0XH 3ARPA 4M6OH 3SOBL 1MCWW 2DLIA 5CEZD 2XV6B 4G80A 5DMJB 4PREB 1EMTH 1V05A 2Q76A 5MI0C 5EULV 1KJMA 3TEUA 1DSWA 4N1EA 2NY3D 1IRAY 3Q0HA 4MSWB 2MNJB 2W0PA 2X9ZA 4MMXB 5BRQA 3IGFA 3P73B 4N8VA 1IARB 3SGEH 1SOSA 1AGCB 3NIDF 2EC8A 1UOWA 4IKLA 4MAYD 5HVHC 1ZLSH 3RDTA 3SDDA 5IR1A 1UWEL 4LAQL 4RQQB 2RCSL 2G5RA 5FYKD 1YMME 4R2GB 3OXRA 3NA4A 4X99B 2EQDA 5EBLB 1IGTA 2FJHA 4OIBA 1RZKL 2F5AH 2G60H 3TN0C 4KVPA 1OPOA 3BJ91 4WV1A 5IFHL 5CIPA 4ALAL 1N12A 1T66D 3UMTA 4WHTB 2DWEA 3JWNC 1C7SA 4AITA 4GAFB 4HLJA 1NEUA 4YZFE 3S36X 2W9DH 1Q1JH 4UQ3A 4P5TA 5DQDL 2H3NB 4BSVA 3N0PB 2QQQA 2WQAA 3K4AA 1KJ3H 3MR9A 4RCAA 4XCFL 5KZCD 4POZD 3EH4B 4GMSL 4KJWD 1OM9A 2IFGA 1QEWA 3QNXA 1F3DH 5HPOA 3IDJB 4QF1A 2WOBA 4UNTA 3BUYA 3GK8H 3RL1A 2XZAL 2XA8H 4X6EB 2BP3A 1H6TA 1WBXB 3MRLA 3SKNB 1BFOA 4NO2B 3V0VA 5KS9A 3M1CA 2F58H 4JDEA 4TKWA 1JPST 2O6DA 5CGYD 4N2BA 3VFSB 3L81A 1HKFA 1YEJL 5KVEH 2AV1B 4D94A 4LPTA 4F57L 5GGUB 4L8SC 3MROA 3HG4A 1PVHA 1Z5YD 2FL5B 2X89A 3CFJB 3O41A 5DMIL 2AFNA 4P23C 4U1GC 4J3OC 5E99H 4R96B 3LJ3A 5E7BA 1GVIA 1M7XA 4Z76B 1UWGL 2LFEA 1IEHA 4K2UH 2DEYX 3IJYB 1KB3A 1KTDA 3SKMB 1NWOA 2W8CA 1IBYA 1BQLL 2ZYSA 4LKXA 5IF0B 5M7QA 4P2QD 3CPLA 3FQ2A 2KZWA 3GSXB 1HZKA 4J8QA 4Y16D 5FHAH 1ZHLB 4JG1H 1IBDA 3EOBB 1KIRB 4OIFA 4NUQA 4NN7C 3OD3A 1BXAA 2XN2A 4U7MA 3PP4L 2YPVH 5AW3B 3WEOA 3EGSA 4K7FB 2D4DA 4MXWL 5JA9A 4P9ML 4DW2L 2MIZA 4CRPA 4WI8A 2GVYA 4NAQA 1FNAA 4TM9A 3R4DA 4XCNA 4MJ6B 5JDSA 2R0KH 2EIEA 2E8YA 2DQDL 3BAEL 4OFVA 5D8JH 1DBAH 3FN0L 3O0RL 3K8LA 3IXTA 4BWWA 4I18B 1CD9B 1OARH 4PS4L 5ALBH 3KJ4C 3ZKSD 3GMRA 1ZPUA 2OXHA 5IVOA 3EYVB 3TEZA 2F68X 1HVXA 5C0BB 3CCHB 4QRTA 2NSXA 2J1XA 3G08A 5CEYB 3UO8B 5BCAA 3AVEA 2NZ9D 4ZUSB 2DWYA 5E6IB 1JNJA 3BVNA 1WZ1H 4GP5B 1KGCD 5DMKB 1TDQA 4J6RH 3WGUB 4XAKE 3AW5A 4HCRA 1ZS2A 4RMSA 4CMMB 3VRJA 3K71A 1FN4A 1GOHA 1GCYA 4UT6L 5C08A 2YZ1A 1J1PL 1WAAF 4LPUA 5A6LA 5AVTB 1HNFA 2CO6B 3A21A 1JP5A 2DH3A 4JFED 4AYID 4K55A 3OTTA 5E5RB 3RL2A 2EXWD 3NSYA 4UILL 4BRJA 4AL8C 1FAIL 5CCGE 4JVWA 4OF3A 4F33B 2WBJB 5IHWA 2WWMC 3OF6D 2M2DA 1YPZF 2BY3A 1AANA 5EOQH 3ZKXC 5GIRA 2J44A 5I1AB 4IRSB 3CC1A 4DN4H 1I8IA 1QYGH 2AGJH 3LNEA 3SSGA 5GZOD 3IF1B 1FP5A 3VX0A 3QXVA 1BF8A 2OI9C 1JCKA 1UB5A 1GCFA 4N6RB 3E6HA 1T2QH 3GMNA 4M7KH 4FTVD 1NQBA 2WINB 2HLAB 3V9EA 1UUNA 1G6VK 3V5HA 2J71A 2GK2A 1K8IB 3V0AC 3II1A 5J7CC 1Y6NR 4J3UA 2FCBA 4NJAH 1BGXH 5D71H 3C5ZC 3VU2A 5IOPB 4ADJA 5DTFB 1QFWM 4L9LA 5ITFA 1G7IB 3LTVA 4MD5B 1M9WA 2DMGA 1N5YH 5F1NA 3UGUA 1MCNA 1UGKA 2VXUL 4M8QB 4LPYA 4OV6F 3V5KB 5LXGH 3LD8C 1HS6A 4LSUL 4KKLC 5I1CH 2FJFA 3BRGC 1XXFC 1XH3A 2VLLA 3FQTB 1TG8A 1RZ7L 4G6AC 5AYTA 1B4TA 4PPTA 3E2HC 5IKCA 5C07E 4H5SA 1WA1X 2B20A 4EDWH 2WYTA 4PVMA 4FFVC 4F7EA 3VWKC 4AEIL 3ZQWA 2VH5H 1L7IH 2VUOA 3NCYS 3UH8A 3BIKB 3I50H 4JM4L 2J43A 2OZ4L 5IQNA 1NEZG 3QNZA 2WXGA 2APXA 1A3RH 1F90L 3MUHL 2X4OB 4PIRF 4TUKH 1WUZA 1RUPL 4JRYB 4M7ZB 5T1DH 5BZDB 1H3GA 3P4NB 1ETA1 2H1XA 1SJHB 4UM8B 1U3NA 3FXIC 1JVOA 1JF5A 4J23A 4D9LL 4YSCA 4NQED 4JHZA 4KK9C 4FNRA 2H0PA 1WK0A 5I8KH 4K3JL 2BINA 4DUWA 4PS8A 1MFDL 2N7SA 3NSXA 4QHUA 5JIHA 2EVHA 4PCKA 2APVA 4R97C 4LLDA 1MFNA 3C09C 1FNSL 4IRZA 4FXGB 1E5YA 2HJLB 4NHUA 1NMBH 4KMTL 1V5JA 1Z9PA 1IAIH 2AV7B 3I6GB 4GEJA 1RHHB 1TQSA 3RWJA 4RGMC 2QPUA 1OAJA 3SCMD 4XNQA 3H9HB 4JJ5B 5EUOF 2A6KA 2AS5M 3UBXB 3NJLA 5KYUB 4HH9A 4OZGE 5T5FH 3JUZA 5MENA 1WVZA 2G4GA 3MA9H 4J6IA 5FO7B 4ISVA 4FFYH 3IDGA 4WY7H 5EIVA 3HHMA 4PCSA 8PAZA 4XNMA 2OJ1A 5HDBB 1MIEH 2Y4SA 4BQCA 3SGDH 3QUMH 3LNIA 3ZRFC 5AYUL 3PXLA 4YDKH 2D7MA 4Y9CA 1S9WB 4QWWC 1CLOH 3RB7A 1KTKE 1S7RA 2DQGH 5EUKB 2XY1A 5C0AE 1XF2A 1N59B 5AB9A 5DVOA 3ULSB 5ICZA 1NGXA 4OU3A 5F9OH 1QRNE 2NNXA 4Y0GA 5DCCA 3U25A 4QRPA 1WT5A 1ZK9A 2E46A 3WY4A 2YQGA 4JFUA 5E5MB 4AIZB 3WTVA 1G9ML 1MJJA 1QFUL 5DC0A 4U1IA 4ZSOB 4IBVA 4XB7A 3WIHH 2H9GA 1KN2L 2AEOA 4N9GA 2ZOOA 5DDHA 5JQIB 3UJJL 3KPLB 4QAWA 2BK8A 4S2SA 4NSKA 5F6HJ 2R56L 3PWNA 2AQPA 1TEGA 3FUDA 4NO5A 4X6BB 4NXSA 1OP5K 3QYNA 3EDDA 4N0YH 5DUPL 3C60D 1X5LA 2TSBA 1MNNA 4FQHB 3AU1A 3DSFH 1OLLA 1A7NH 1PG7L 4Y19E 1BEXA 2CLVB 3FQWA 1JWSA 1NCWL 2XC8A 3ZE1B 1JBJA 5KBPA 3OMZA 3I3EA 2XG4A 3DROB 3RGVC 1QUNA 1YVLA 4OT1H 1EJ8A 1YN7B 3Q1SL 2JCCA 4MS8D 3V4PB 3IVKB 1T21A 1K8DA 4GG8A 4OQ1A 3CU1A 5DEFA 4XPHL 2R39A 4AM0B 2C3VA 2NZIA 2NQCA 2FSDA 3O3BA 3UO1L 5E2WH 5IB1A 1ZGLB 1B6UA 1F11A 1NM4A 1UKQA 2P80D 4OUOA 2EXSA 4CL7A 2NY6B 4PJ5A 4YHPB 3NZUA 5IV2B 5D6CB 2A73A 1AD9A 3FRUA 1E9PA 2Y1AA 5FUOL 4DT2A 3WNMA 2HT2C 1QRNB 3K72B 4GW4A 1PEWA 2CO7A 4UQAA 3ZTDC 2IDTA 3L95B 3PIQB 2ZSVB 1CFSA 1G9NH 4MNGA 5HVHB 4JFDB 5DO8A 1C5BL 2DIJA 4ZUVB 3UROR 3MRIA 4QRAA 2WN2A 5JW4R 2PCFB 4MDJA 2PCPB 5CZVH 4OCWH 4XN4A 3GI8H 3RWCB 3DV6B 3ZN6A 2CKNA 4M1GL 2OYMA 5T33L 3TN0B 5IJBC 5BS0E 2E9WA 3B9KD 2WZPD 5HGHB 1PZCA 4Y4KD 2K70A 3HBQA 5H37H 3WJMB 3VD2A 2HJKA 3D7PA 4KK8C 2G9HA 4N2NA 3FOMA 3ULAB 1RZFH 1IM3D 5KYYB 2L7JA 2YD1A 4LVHC 1HSBA 1IAOA 3QR1A 1ESOA 4PY7B 5C8JA 4WVRA 1OTSC 3W2DH 1S7XB 5GS0L 3SDXE 1KLGA 1O6SA 3FT0A 3L9YA 2HVBA 5C86A 3WTUA 1I9IH 1TFHA 3MO1B 4WU7B 5JIQA 3MRQA 3HAEG 1NOLA 2GW5A 32C2B 1IFHL 1AGBB 5BZXA 3S37L 2ADGA 3O9WC 5T1LA 4B9CA 3LRSA 4OI8A 4QTIH 3WFHA 1IM9B 1FIEA 3GUTB 1I8MA 4X4YA 1A6ZB 4XPAH 2SEBB 4FQ2H 1A1MB 1OGTB 3K6SB 4XBPB 4YSEA 1MUJA 4B9FA 1RZJL 3PABB 3UEQA 3VACA 4K94L 2MQ3A 4AXWA 4ZW7A 5F9WB 2QGCA 3MUGB 1BA9A 5FFOA 4GRWE 4XI5D 5CJXC 3V8OA 2WOYA 3QHFH 4E0RB 1A4JB 3NEXA 4FE9A 2OK0H 4XX1G 4KPHH 4U3XA 4CC4C 4LCYA 2ILLA 3REWA 4ORGB 4WHYH 5BS0B 5I1EL 4K9EL 3MACH 4UTAL 3OMAB 4BZYA 5L9DL 2BOBB 2OBGA 4JS7A 3LXCA 2OYPA 3JYBA 1PKOA 4GFTB 4N2LA 4TLKA 4Z95L 2PYEB 2H2SD 4UZSA 4PJIE 4HPOH 3CVHA 4WWNA 4GAYB 1GW6A 4OQTA 2FX7H 5IB3A 3P0YH 3BDYL 4KKZA 3BH8A 4UNIA 4B50A 5I5IA 2X4UB 4YHLL 5D2LB 2H41A 2P7TB 3R1GL 1IGIH 3ECVA 3WUWA 1ECYA 5IVXB 3MLTA 1CGWA 2BSTB 1EO8H 5DHYA 1NFDE 1KIUB 5D1XB 4FHKA 4W9DC 4DK6A 4WWKA 3KLHC 4FMKA 4U3SB 3MRJB 4MDIB 5I23A 4DQAA 4KKBC 4HAFA 4KRPC 1VPOH 2VDOL 5EO9A 2YLKA 1E6OH 1K9TA 3TGXA 2GSIA 5A2FA 2FB4L 2AJVL 3LKQA 2XBTA 2YUVA 5E56A 1RL1A 5HHQA 4F37K 3U7WL 3JV6B 2UX7A 3DTXA 3S3CB 3MRBB 3MBED 4FLHA 3QG6A 3B2VH 4Q6YA 5DD6A 3ARFC 2PW1B 5ES4B 4DKFH 5KAQF 1F6FB 1FC1A 2FE0A 1I3RB 4ANXA 3WEAA 1Q0YH 1MAML 2CR3A 2Z34A 4P5SA 1RERA 1AXSA 1SYSB 4UT7H 2JXMA 3S5LG 4ZFOA 3ZKXB 1CI5A 3U4BL 3NCJH 4LU5H 4M3JA 2IWFA 4LRNH 2F7QA 4G5AA 4MMZC 5HVFB 1PGRB 4HKZB 2HFEA 2GIMA 2ZF8A 4K07A 3KS0H 1OD7A 4F9LA 2WIIA 1L3NA 4OLWH 5DFTA 3D06A 3MTRA 4ZUTB 4DPRA 4PWEA 1EZSA 3P2TA 2YRZA 1Q94A 5CXPA 4UINL 2MOGA 2RB8A 2QDVA 1SOXA 2YXWA 3T2NH 2ZCZA 1W9XA 2XWCA 1AOZA 3BT2L 1WHOA 4G9FA 4JHVA 4MNQD 5E2UL 4G8IA 1HE7A 1A7RL 5A40E 3RYMA 5D1QD 2WYZA 2WXLA 3MLWL 2W60A 3QEHA 4XHQA 3M7OA 3UG5A 1JNHB 1K6QH 3JTSB 1NFAA 4QRRA 3E2HB 4L1DA 4EDWL 4P2RA 3BQUB 1CDUA 3CFCL 3VE0B 3H6JA 3QE5A 4P2CG 2JELH 1XR8B 4I85A 3VWKB 3TURA 3DHPA 4BZ1A 5BUAA 3JXAA 4ACTA 1MCSA 2ZP9A 1HILB 1KXQA 4E2OA 3DVNB 2ZX5A 4DVRH 2CA4A 5K9OB 3EJJX 1TF4A 5C3IA 5DQ9B 3U0PA 3LN4A 4G7RB 4N5EC 1KWKA 4HD9A 1UM4L 2Z6FA 3ARBA 1EK3A 3OB0K 4JAMA 3DPBB 3NJVA 4POUB 2X2UA 1JXKA 1E4WL 1P7KB 4I88A 4S0TD 2E7DA 5MEQA 4PJBE 1BG9A 4G6FB 1J1XL 2PWDA 1YECL 3GQFA 4XC1L 4Z7VA 1XV8A 4KUCD 5CEXA 3WS6C 3TT3H 3NIFF 5DZLA 4BDVA 2WSKA 3D33A 2YC1A 3HI6L 3CZGA 4TMPA 1ED3B 4YVUA 3NJGA 5E4EC 1XTMA 4TNGA 4I2XA 2QSTA 3TBTA 1PSKL 3K1DA 1RUQL 1XR9B 1WITA 3ECUA 5L2KB 3KPRE 4P99A 4ODXB 4RGMB 3PWLB 1K5NA 1TITA 1MQ8A 5FDWB 3QUXC 1PMYA 2AQNA 3NAAH 1I53A 2V37A 1YRKA 3VFTA 3WG7B 2V3FA 3T3MF 3HJ0A 3D85A 5D7SH 2WXKA 5HYSA 5KVDE 1BCIA 2F53A 5HHPA 2XWBA 1XGPA 2WTOA 3I6KA 4A7SA 2BS71 4MA3B 4PJ7B 4L05A 5B1AB 2X4RB 5HJ3A 1CDBA 3L2NA 1FZMB 3EBAA 4PJ8C 2ZX6A 1G0YR 2YBRA 1X5AA 4HC1L 4NUGH 4HIQA 1ZE3H 1I3UA 2MOVA 2NYYD 2IDCA 2CRMA 3FO1B 3BIBX 4KJYB 2C3WA 2NY1B 2JI3A 1XBRA 4QYOA 2DKUA 2OMUB 4M4PA 2EE0A 3PDGA 4HBCL 5A2JH 5FUCC 1EEYA 1ZHBA 4GY4A 4ZTPL 1NH6A 2CG9X 4PJEA 4QTHB 3MNWA 4B9ZA 4OBSA 1BOYA 2B5IB 3VI3E 2WXNA 4AQEA 1NFIA 3AREA 2ATPA 3TBSA 4TUJB 3Q2CA 2XBDA 2HFFA 2ICEC 2P24A 4IBQA 1JTPA 4GRLB 2EEBA 3HZVB 1GHFL 2J1ZA 5FOBA 1XZ0B 3PHSA 2BIPA 2VN6A 4G42A 3RTQB 3U36B 4FQXC 2VLRE 3NP4A 1U3YA 3UDWA 1HQ4A 4R83A 2ZNXA 1UUSA 1IGML 4WEMB 4WHCA 5BW7C 4GRWH 4ZMAT 3GBLA 1FFOB 1WG3A 1LM8V 4FLRA 4KFZC 4OZFA 4LK4A 5SX4I 4DO4A 3VI4E 1XGRA 1AQKH 1M7IA 3C8HA 3SN6N 4EXKA 2EVFA 2X4NB 3C6LB 4JY6B 5DJAA 2APBA 2H1LM 1A6UH 2P8LA 3LKOB 1H3TA 4YVNA 4U49A 3AFLA 2QSVA 4FG6D 5AVWB 3Q44A 2AJZA 3W9EB 4P5KB 4JW3A 1NGZB 3RGVB 3ATFA 4G8GB 5FB8A 5E1AB 4DGWC 4DGIL 1SXSA 1XGZA 3D18B 3IXAA 1DVXA 4KZDL 2IO5A 2Y5TA 1T0MB 3DYOA 2Q6WA 5FW7A 1DVFB 1GGBH 4NAMA 4PGJA 3HC0B 4E9YA 1B88A 1TVHA 1GIGH 3QB7C 4GIOA 4ZDHA 3O6KH 1IE5A 5DD1L 1T1XA 3GTVA 2D7QA 1NGPL 1D5BB 3AQXA 3DX7B 3S34H 1EEUA 2BNQA 1EEQA 3IJHA 1WWWX 2H26B 2OL3B 5CLYA 1QHQA 2FRGP 1EJFA 2M8XA 3DBSA 3RPKA 2OR9H 1B0WA 1LO2H 2WV3A 5HYJE 3EYFA 2EEXA 1O9WA 2VDRB 1Q72H 5KYXA 4FLQA 1QQDA 4G83A 4Y2LA 4LVOC 1YNLL 3IDXH 2A5UA 2VLRB 3FUKA 5I6OA 5JO5A 4O4YL 5D1ZC 3FFDA 1XGTA 1ZV9A 4ZMPA 2APTA 4ZNEE 3GPSA 4FFZL 2XG5B 3LXBA 4FKKA 2VLKD 3ZGHA 1SN0A 1NUDA 4GI9A 4NKQB 1GS6X 4LL9A 4MS6A 4NP9A 5DEGB 3UADA 4F9PC 3GBML 4UYQA 3H4HA 4YXKL 43C9B 1S5IH 3BO8B 2YKLL 2YPLD 4V11A 3D2UD 3W2DL 2O5NA 5TE4L 5KSUA 4ETQB 2WLLA 2HTLC 2ZX7A 4FHBD 3SDAA 5GGRB 3HNTH 2H1PH 5I19H 1SFHA 1AS8A 2PPCA 3UTSE 5AVSB 3UYOD 3VVWA 3B7UX 1JFQH 4ZMXA 2I32A 3PREA 4TSCH 1RZQA 2V2XB 2QSCL 3GJFB 2Z31C 1XL4A 3O9WB 4WEUD 4J3XA 4KQ4L 4KO6A 3CX5K 1CXEA 2X7LB 4KY2A 1NCNA 1YJDL 2XKNB 5AAWC 4JG0H 4Z8FH 5I71B 1UVQA 2BOLA 4NOFA 1U8HB 5IP4A 1SEQL 1CGYA 4Q6IC 1BVNT 2R4SL 1U92A 4RX4D 4NGHH 3QXDA 1Y0LB 2A9DA 2F54B 3SE3A 2YFOA 3SYQA 4Z0XB 1KOAA 1AHWA 2YGOA 2WZAA 3BKYH 3GB7B 5F0PB 1K3IA 1N4XL 1E9QA 2I9LA 3X17A 5ILTH 2E86A 2LAGB 4A6YH 1FVEB 2C9SA 4Y8AA 4NDMA 1LP9A 4BE6A 2LTQB 5CZKA 3TWYA 5BOPA 3LKRB 3RBGA 5JLZA 4YDVA 1F86A 2Q86B 4X6DF 3SJVE 1PTZA 4CVXB 1DLFH 3HI5L 4NWTL 3ZT7A 3W5MA 4ZXBA 2YA1A 3FKUS 4AEFA 4E9WA 1KACB 3APMA 4IHOA 1YYCA 1QBBA 3B5HA 4LIQE 5F89A 5E9DB 1LO3H 3DETD 2KERA 2D3LA 1LO4L 1AFVH 2JK5B 4NT6A 5ABDE 4GB9A 5IJVB 1T7XA 3CFIC 1MN4A 2ED6A 1KIPA 3DUUA 4G8FA 1DUZB 5G4OA 4UIMB 3G5XA 4BQ6A 3EH5B 4BE5A 3S96B 3QIWC 4X5XB 4KKCD 1CN4A 4F20A 1DQLH 1C08A 1B4LA 3O6FB 4NBZB 3KYOA 1P6FA 1Z32X 1E8XA 4KRPB 2CQVA 1FG2B 3R4RA 4IMKC 3RX7A 4JO2L 2IPTL 3IFLH 1LEKB 1MCCA 4FMFA 3VXUA 4MA1C 3KG5A 3MHZA 5IFAL 1ET8A 3NSCA 4H0GA 4FYQA 1HT6A 2FUTA 4I48A 4A7GA 3B3IB 3V4PL 5AW2B 2DLGA 2BP8B 1AGEB 4IDJL 4AZUA 3M8OH 5FO8B 3FO9B 1OGSA 3KPMA 5KVDH 3NT0A 2DQFB 1OIOA 2VXQH 3K6DA 5AYQA 3WKMH 4AWJC 1CDCA 3OX8A 1J5OH 1CF1A 1RJYA 2E27H 5IESH 2NY2C 3ZRSA 3QJHB 5H2BB 5CSGA 2YAQA 4KHXL 4FJ6A 3EH2A 2X6UA 2R1WB 1G7JB 2JB5H 4GI8A 3WMSA 5L4MA 3VMPA 3JQOB 2VUKA 1AXIB 1NBZB 2IOMA 2WLYA 3ETBJ 3QJXA 5D7JA 2BM3A 1GL4B 1EXGA 3GMLB 2FECL 2J4WL 3SJVB 3VD5A 5B4MC 2ZUQB 4PJDF 2VL4A 4OZIF 4P8QA 3A0OA 4Z6AT 2JCCF 3RHWK 3QWOB 1JDCA 3ZT6A 1EHAA 5A7BA 4PJFA 4ZTOH 5ICYB 3IPBA 5DC4B 4GAGH 3DVIA 5DFAA 3CDGB 3FQXB 1MVUA 3KYAA 3EHBC 3HR5B 1DFBH 5AW4B 1A4KA 3RVXC 3NIDB 2Y22A 3R06A 1JAEA 5D7IE 4FQIH 4OR1A 4RAUB 4UQDA 3RI5K 4X7FC 3B37A 1XFPA 3QORB 4ZAKA 3G6JE 2NDGA 3S7GA 1FV1A 4NEHB 1SOKA 3D8MA 3POCA 3QJSB 4Z7OF 2CKBA 43CAB 1A14H 1D6EA 2AK1H 5D4HA 1FG9C 1PQZA 3HBGA 3TA3A 4TNWF 2NZ1A 1H8SA 4FGMA 4YXHL 3QVAA 4FDWA 3L3OB 3KXFA 5DD5H 5DJZB 5DK2A 3HE7D 1ROCA 2AXGB 5IHZA 2HLFC 1YEHL 3S48A 1I85C 1BD2B 5FKPB 4GXVL 1KNOA 4NZDA 4P4RA 4L4VB 5GGVY 4A55A 2VE6A 3PWJB 4DVRL 4HFWA 1C16B 3O3AA 4KNUA 1FVCB 5IMOA 3TJEL 1NIAA 4LHJB 3ZOAA 3KHQA 1RLBA 3NABL 4IBWA 3T4AC 4Y4FA 3ARGA 2CIIA 3GJFH 4Q7DA 4C56E 4WW1B 5E8DH 4TOYH 2QPSA 1OP9A 1F1DA 3H3PL 3VA6A 3WLBA 1VKXB 4XMPL 3BP7A 2JJSC 1A7PL 4OJEH 8FABB 3FTVA 1OSPL 2H5UA 1VACB 4JFPA 4UDTB 2DM4A 1OGAA 4QLRA 5F6IB 2VCOA 4P23D 1MHEB 3LHPH 5BRPA 3OKKA 5F3HA 4W4OA 2WNKA 3OR7A 1XDTT 4U2YA 3CE1A 1E28A 5D7LD 1AG6A 1H0DA 3HPLB 4GW5B 5AOLA 1KENL 3QDJE 5E4EB 3JZYA 2VIRA 2R15A 3L6FA 5CN1A 4NNYA 1D2PA 4OD2B 1BSIA 1LWRA 2JKXA 4XBGA 2WSDA 4IBZA 1MELA 3NA9L 3QUXB 3PWVA 1C9SA 5BRZE 1DLHA 3LVEA 2JKRM 2FYVA 1SM3H 3UJTL 4JGJA 5HDWA 2EIBA 4JPIA 3P4OB 5DT1L 3VYOA 4NKDB 4JFQB 4N0UE 3H9ZA 5PAZA 3M17A 3TO4B 3D4YA 5F1IA 4PJ8B 4MCNA 1KGXA 2FQDA 5IBUB 1T03L 5C0CE 4LPVA 4ZFFA 2CMRL 2W0FB 3MRNB 3HG1B 1F02I 1S3KH 4Q4IA 4UIKL 3OMNB 1VEOA 5L4IA 3VRIB 4HFUH 5AVZB 5I5MA 3F7QA 1AYRA 2E7LC 1HAWA 1WBYA 3DK2A 4DP4X 5IQ9B 2AAAA 1FYTD 2R4RH 2X4SA 4C56B 3WN5B 4DP6X 5ICXA 1MWAH 5CM1A 3MC0A 3TZVA 1IVTA 1YY8A 1XO8A 3ZU8A 3ZO9A 2ICEB 5MEPA 1CLYH 1KT2A 2ZKYA 3NQKA 4B7LA 4M6ML 4MJIA 1L0PA 4LPCA 3W1ZA 4EMZA 3UPCA 5KYWB 4FFWC 3VFGH 2OJEB 5CBEB 3TVMC 4O51B 3M88A 3UPAA 4NNPH 3MV9D 3R0MA 1HE8A 2G9KA 3MRRB 3QDJB 4RZCA 4XO8A 2FT7A 2UX6A 4EVNB 3IKCA 2NPLX 3JV4A 5E94B 1UOVA 5IY5B 1TSRA 2Z8WC 5CINH 4CVZB 5DK0B 4CBZA 2WWMD 3KHOA 5E9AA 3NCCB 2NXYB 1I8LC 3KPSB 3VD0A 4BFJA 3FONB 3KR3H 5BRZB 4A7QA 4P57A 3BKMH 4GRMB 4NRYA 2R23B 3X1BA 4PRIE 1Q9OA 1YPZB 1JFHA 4KDTA 3WY1A 3IBEA 4LIQH 4Y2OA 5JHDA 1RAMA 1E30A 2WXJA 4BKLA 1MG2C 1G1CA 3H56A 3OKLB 3L8QA 4NQDE 2DQTH 2GIXA 4XMLH 5C0CB 5EU3A 3RA7L 3ULVE 3FH7A 4NBYB 4JB9H 1ZIAA 4LT7A 4R8WH 4PLNC 1JV2B 2BSRB 3C5ZD 4UT9L 5TDOA 5JXED 2HRGA 1ZCRA 2GJRA 5JORB 3T0EA 4KY1L 1TTFA 4PUBH 2WW8A 1SXAA 1MW0A 3BSZA 4GIPD 4QRQB 4APQC 3FAXA 2AJYH 2A77H 4XO5A 2Z1PA 2EKSA 5E6ZA 1Q72L 1MIMH 3K2UH 3MV8A 4RAVA 4G6AD 5I6LA 1MCOH 3U1SL 1O6TA 4WI3A 4FF9A 3QDME 4X8JB 1K4DB 1E3ZA 4FFVD 1N19A 3T1WA 5EIIG 3E6FB 3N41F 2PPAA 1IAKB 1F3JB 5D1ZB 3AGVA 3O3DA 3OV6A 2QPDB 2B1HH 3CH1B 4QI3A 2BOCB 3HIZA 1OW0A 2BFGA 4PP1C 2Q7NA 4HJGA 4XVJL 3QFGA 1FPTL 2EH8L 4MAYA 5EU7C 1S7SA 3W81A 3FCGA 3T65A 2VJXA 3WNJA 1TR7A 4NZFA 4ICXA 2C8NA 2Y2WA 1LNUA 3C5XA 2NY0C 2FX9H 4KK9D 1TQCC 3NJMA 4YGVA 4AJ0A 2G75A 2JSFA 4KO5A 5F88B 4TSAL 5F7DB 1X4YA 5I19L 5M95B 5ELIA 4TNVK 2ZCLH 4WI0B 2DYPD 2SODB 2WM0A 2I60L 4KI5F 1CFQB 1T04A 4MYWB 3WHE0 5LCVL 2G3XA 4E9RA 2CA3A 1IC7H 2J88L 2R27A 3MBXL 5CKGA 4B9PA 3NZHL 2Z31B 3L3IA 1RSYA 3GXNA 3IKKA 1A4AA 1JPFB 3MQIA 3W5NA 1GJWA 5MP6H 1HL9A 3OHXB 1NDGB 5I8OL 4CW1B 4KTYA 4XVOA 4Q6IB 3S4SB 3QUZB 4D9RD 4WDIA 1OP5H 4HZ1A 3VQMA 4H1LA 2Y1ZA 2ZNWA 4RSVA 5EU4A 4XMVA 5KN5A 3P4LA 4Q0XH 2XTJE 3RVWC 1F6AB 4TVSa 3LKPA 3PAUA 5MERA 5EUOB 4FMVA 4YH6A 1RURL 2W38A 1D9KC 3VXMA 3QDMB 1NLBL 4A04A 4KHTH 1FYHB 2D03L 2EADA 2ZSWA 2LV4A 2WAQA 3MXVL 2R1YB 2IDFA 3BE1H 3DXAA 3U83A 4H8HA 2KZBA 1IEAB 4QWWD 1HEJC 1TZ8A 4D0BB 4G1MA 3OAWA 1I3GH 1REIA 3D52A 4GEIA 4H40A 4NKOB 4C59B 5L4JA 4QRUB 1QI5A 1J1OH 3K2IA 3HNSH 2E6PA 1Y1DA 3GRWA 3Q6GL 1F4AA 4E41E 3KDMA 2Z91A 3FUMA 4P2QA 4AYFA 2JF1A 3JWNG 4WK2B 4GBXC 4TQHA 1E5BA 1E27B 1MCIA 5DYFA 3QUYC 1FUNA 2P3YA 5GGTL 5J9PB 4KK6C 5TQ2L 1TEYA 2CBOA 2KBGA 2ZG1A 1P4IH 3QCTL 3HC3L 3IAPA 3QIWB 5TDNA 4G43A 4K71C 1OHQA 3DIDA 4PJEF 4WUUD 3TJHD 5C0EA 3SGJC 2VZ3A 4ZFZB 2A38A 5J56B 1J5DA 1BFVH 3U6XS 3BKJH 3VFRA 3P0VH 1XEUA 5F0MB 3DOSB 1OD9A 3QBTB 4N3UA 1XAKA 4HGWA 3GDCA 2RQ8A 4GKOA 1GPOH 2HAZA 3R0NA 3IJEB 1E7VA 3RNKA 5HHOB 1IL1B 3DGDA 1IAMA 4M7LL 1RSFA 4G6KH 3STLB 5EU6E 4R9HA 1LD9B 1T0OA 3MOQA 1JZ5A 4LLVB 4DEPC 3AC0A 2IQ9H 2NX5E 2K9FB 3IJ8A 3DX8A 3WGVB 1JHTB 1LDSA 4X9YA 3I85A 5AOJA 2DLFH 1OP4A 1BVOA 3MLRH 4GG6F 3LS4H 2R0LH 3C08L 2NW2B 4OM1L 5AW0B 1ID5I 3HAEA 2VR4A 2OL3L 4U1MA 2ZX9A 1OAQH 2XQBL 1BMZA 4NWUL 1I7TB 2CDFA 3MCKA 3TBWA 2YQBA 4JFEA 4OCSH 4OGAC 4AEHL 2LU3A 3H2QA 4HJEA 5C0NC 2AQQA 2VDRL 4PCTA 1KXVC 1NIEA 1J0IA 3CHQA 3DGGB 3FOLA 4JRXB 4FQJH 3PWPE 3M07A 1TO4A 2Q87A 3SGKC 5IJDC 4N0RA 2GJZB 2P8PB 2TSAA 3EHBB 4GKSA 1WV7T 3OF6A 4F8TA 2FTAA 3F00A 3HC4H 4LVEA 4U6XB 2NTSP 2XQYG 1B3JA 4NPYB 4PTUA 4G6JH 3LN9A 3MJ9L 3NACH 4N28A 1U8QB 1D7CA 2EE6A 1G7PA 3HE6C 1A6AA 2IAMC 4PB0H 4AE0A 1E6JH 4KTGA 1ZSDA 1L9RA 1GC1H 2WQWA 2DQCH 3CHXA 4GKNB 1ONQB 3NTCL 5AKVA 4KK8D 2GK0B 1J9QA 1HHIA 2NY5L 4O2EA 1OVZA 4PRPD 2YRPA 3IDMB 2A99A 3VXSB 3LQAC 2NSMA 3GXFA 2IH1A 3NFSL 5F2FA 3APDA 2FATL 1V7NL 3BXNB 2Q8BL 1X44A 2ZUYA 3KYNA 2ZOTA 5F9AC 1LL1A 3N91A 3K91A 4KVNL 3C9NA 5F7NC 2AI0L 2VXSH 5GGVL 1SPDA 2NX5B 3RG1C 4HG4K 5B39A 5EBGA 3WTTA 3D5OF 3KWVA 2VSCA 4ODWA 4EN3A 2FR4B 2VAAA 3L9RA 1Q9LA 3CUPA 4ZOCA 3ULVH 4K8RC 2X9YA 4MHHI 5KOVC 3IMBA 2TAAA 3SBQA 1AIFB 2F7OA 4TUUA 5F93C 4LDCA 5ITBH 2HRLA 4Z7QF 2WC7A 4BFRA 2OQJA 4XZ4A 3DSNA 4A67A 3ZZLA 2PXYC 3BH4A 4J3BA 3P77A 1FDLL 5FCUL 3S35H 2F54D 5J1SC 1MRDL 1ZE3C 2KDGA 4K23L 5LDUA 4X7TB 1HIMH 4D8PA 3GHEH 2KC0A 1ETZA 1N7ML 4G8EB 5ISZD 3GMOB 2X2JA 3QEQD 2HA1A 5INCA 5CP7A 5GS1A 4AENA 3LPPA 4QEGA 3NPZB 3AY4C 3G04B 4HIPA 4NQEA 3C75A 1WFJA 1AGDB 3FBKA 3NK3A 1JPTL 3EZ8A 4ESKA 1B3IA 1UURA 4BWUA 3KYKH 1NWPA 1T6BX 2HG0A 3LXUX 1L5GA 3A6BH 3QC5X 4QJ4B 3MGAA 1X4ZA 2FAUA 1C5CL 3UIZA 4AZ8A 4NBXB 1BX2B 2WUCH 2MOQA 3GSQB 5ETUA 5JPNA 3P3UA 2V8MA 1N2RA 1LP9F 5J3HC 2PN5A 4LGSB 1S3KL 2BIOA 1IKFH 3SCMA 3O4LD 5JIDA 2LAAA 2UWEA 2FUQA 2OTUA 3VVVA 4M93C 3H2WA 2P5EE 2WLHA 1WICA 3WIFA 2EIMB 3FUFA 3OHMB 5AOMA 4AVJA 1SLWA 4J39A 1TMQA 3FT2B 5I8EA 3MOBH 3SKJL 4AQAA 3IDIA 4OIIH 4Z3TA 3L3KA 3CLFL 4UU9A 5JPMC 4KKBD 3A6CH 4Z3GA 4LESA 5E2JA 5LBSL 5BO0D 5SWQB 1A0QH 5MHSD 5D93C 2RIKA 1BLNB 2ZWYA 5IHHA 3ILPA 1HCFX 5J13B 2EAEA 4FXKB 3MGTA 2OSWA 2BCKB 3SE8L 3ULUE 4B3EA 3NEOA 4JHUA 4GKZA 2Z8VC 5K39B 4XNAA 4UOQA 1A7OL 4YMPA 4HUVB 2CJ3A 1AZRA 4CNIB 5B8CC 5KBDA 2Z92B 2CBQA 4F7TB 1S7VB 3ARFD 5A7EA 3DPDA 4DF9A 4XXWA 4EUPG 1JGUL 4ELKB 1S7QA 1MW3A 1OE3A 2ZX8A 1INDL 1PZAA 3OR6A 3OWEA 4JGMA 5BO1L 3T2OA 5E8PA 4LL1A 4TLTA 3V8CA 5KYNA 4ODSL 5HY9B 5G4MA 5J1AA 3L9BA 1LEGA 4WI6A 5KSVA 1UOLA 1DBJL 1F4XH 4I3SL 3RUGA 4HWBA 4ONHA 2OMWA 4JCWA 3PQYD 1QNZH 1YEDA 4YXLL 3C60A 1RD6A 1WEJL 1WCQA 1GZQB 1FH5H 2EYRB 3BD4A 1WRFA 2YAEA 4YIQA 3OB0H 3KWWA 3NSFA 3QQ3A 3FO0H 3NH7H 3SIKA 3KLDA 3CVIL 4NQSB 3W82A 1XBDA 5IMMA 4KQ0A 1SY6L 1KBGH 5KS9E 5D6DC 3V6OC 3S8FB 1X5GA 2IC2A 3IS1X 4PRHA 4PJGA 4UF7C 3GC3A 3TONA 1KG0B 1X9RA 3O11B 1W2KT 3CQPA 1A1OB 5C7XL 3QPXH 4NJ9H 1T5KA 1E5UI 2X1XR 1EA9C 2WQUA 3COOA 4G80B 2DJ4A 2CBPA 2Q76B 4P04A 4PJFF 4YPJA 4N1CA 1KJMB 1XB8A 3U0WL 1H5BA 4AGQA 5I0YA 2ZCKH 5EG6C 1NKOA 1RULH 2EDYA 2KH2B 4X4KA 5F7YC 3RDTB 1UASA 5IR1B 2YMTA 1DN0A 4K3DL 4XODA 2M26A 3HFML 4XR8C 2DRUA 3TCXA 5B3NA 3OXRB 5LGYA 4L2LA 1IGTB 5CMAB 3V4UH 3EG9A 4S1QH 4AIOA 3SKOA 1V55B 2X38A 2FJHB 3VSUA 1JZ8A 3OSKA 1RUKH 2XY2A 2EYSA 2FQFA 5CIPB 2X3BA 4F58H 4F8QA 4L3EE 3QR2A 3SDCC 1L9TA 2NY0B 4UQ3B 4P5TB 1UATA 4U1NA 4BSVB 2PP7A 2XXFA 4AE1A 3ZDXE 4E36A 4WFEE 5GGSY 2WZPA 3VTAA 2DQIL 1NAMB 3MR9B 4TULH 4YHKH 1HHKB 3UAFA 1QEWB 3L4UA 4IS6A 3WIIL 4B0MB 1UZGA 3BUYB 1RK1B 1TTAA 5CGBA 1IM3A 3NIFB 3SE4A 4MCMA 4MQXC 3MRLB 3APFA 1MAKA 3PE9A 1BFOB 3V0VB 1S4IA 4ZNCD 2ZXQA 4DKEL 3VSTA 5AFAA 1XT5A 3MV01 2YK1H 4M5ZH 2X5PA 5IZ7A 2Y1VA 2V2TB 3L08A 5AKTA 3MROB 3CZUB 1KCSH 2GSGB 3WENA 4ECNA 1V7MH 1ZVNA 3O41B 1PNCA 3CBRA 4YGAB 3V0GA 3ZL4H 3I9GL 2P45B 1MNUL 4TL4A 3T3MB 4N20A 4OF5A 3QIUC 4WK4B 3E80A 3L7EA 1FBIH 1GZPA 4Z1PA 4ODBD 1KTDB 3VRLE 1EFXA 2E47A 1J88A 1CPUA 4LKXB 4X8XA 3M6DA 3CPLB 2Y3NA 1OCZB 4XVSL 3EFDL 4OD1L 3N1GC 2ICES 3IS0X 4H8WH 1CTNA 5DVLA 3FMGL 4YEEA 1EXHA 4YS4A 3QYCA 3Q3GA 4QXTA 1OAYH 1ZVSA 2P42B 4H8UA 2BY0A 5C92A 5K9JH 3EYUH 4Y5XA 1X3DA 4GBXB 5DZVA 3CDZA 3T0WA 2J5LC 4G3YH 2DIBA 4HMCA 4KROB 3VUAA 3QUYB 5JDSB 5LVEA 4FQXD 5D7KE 4GAJH 1LEIA 1YSOA 4HEPG 5C09A 4MLIA 4S1RH 4K71B 4XPGH 4UTAA 4KAQL 4ZRGA 1A1NA 3U9UA 2ODIA 2Z93A 1I1AC 3LKSA 1GY2A 5A43C 2OXHB 2V3EA 4L4TD 3CZLA 1FAKT 2Y2YA 5J1TC 4QRTB 3CX2A 3G08B 3LIZA 4ANUA 3T09A 4PTTA 3O3EB 1GOFA 5A3IC 6PAZA 1WFUA 5DHVB 2E7CA 1U3HC 4Z7WA 3SBRA 5BZWA 2FHBA 1WS7A 4H8VA 3VRJB 4DEPB 2QKSA 2VR3A 1FN4B 1PNDA 4JN1L 5C08B 2LGNA 3L3JA 4PJ9D 5AB1A 2O61B 4BBWA 4ZUWA 5IGXL 1QFWI 1KIQA 1OQXA 4LSVL 3MLYL 2QSQA 4QGTA 1BXVA 1F1AA 3RL2B 3PU7A 1HWGB 3Q8CA 2HUHA 4NQTA 5F97E 4AUJA 3S88L 3U4EA 1I9JH 3KLQA 2BHYA 1O7VA 4AQ8C 1G6RB 1VF5C 4ODTH 1FLTX 2VDKB 4I9XA 5GIRB 2OSLA 5CD3A 3MBEA 3GZPA 2R2HB 4WGKA 3WJJA 1A47A 1FRGL 2GSMB 1Y1UA 1UB5B 4DAGH 2KQNA 3E6HB 3GMNB 4FN0A 3KVQA 3QH3A 1OKEA 4L8BB 3ULUH 3MUUA 5D1ZD 4DGUA 4X4ZA 5DC2A 3HE6B 1E4XI 5KSBA 5T5NG 5L6YL 1CO1A 2ALWA 2ZP0T 1BIIB 4MSWA 4D9QE 2XWDA 3P73A 2IF7A 4P59L 1JMZA 2A83A 1EDYA 2A9NL 2VRAA 4L9LB 4X9BA 3BDXA 2F08A 4X5LA 2D9CA 2NDFA 3OLDA 5JXAH 4X99A 3X1EA 5EBLA 1G43A 2FJFB 3UTQB 3SYAA 1XH3B 2VLLB 1TLMA 2HTLD 3BKCH 2PUQT 4DN3H 5T3XE 4GLRI 3T3PF 5IKCB 5GJTL 1QLRA 3IEAA 3WTXA 2X1QA 4F7EB 4WHTA 1D5RA 1DANT 1AZCA 1NEPA 4YHIB 3FH5A 5FLUA 4LDOB 2VM3A 3GJEB 5B3JF 3QNZB 3TH2T 4KI5C 4WUKH 5KJRH 4R4NC 4WF7A 3UZEC 2IV9A 4WSJA 4APXB 4FD0A 3ZUNC 1JRHL 3FTUA 4QRPE 4AQ1A 3ARBC 1ACYH 3U2SA 3H9SD 3S97C 1TJXA 4HJUA 2PXYB 3IDYB 3V9CA 2VZSA 1WBXA 3ZTEA 3PJSA 4NO2A 3TBYA 1UT2A 5J06A 1HXMA 1A6TB 4UMGA 3OAZK 2WVVB 2BNUA 4LLDB 5K93A 3CGTA 3EGXA 4H0LC 2AV1A 2MPVA 4JO4H 3TJPA 1NJ9A 4NHUB 4PRBA 3H7LA 5CLXA 2IGTA 3BWAB 4FZ8L 4MB4A 5CO1A 2FL5A 2NUPA 1A6WL 1ORQA 1B0IA 1LMIA 4RIRA 1DBBH 2K45A 4QNPE 4R96A 1HI6B 1UCBL 4N2CA 5AOZA 1PIFA 3B6SB 3RWJB 3V4VB 3FQRB 4NZJA 5DYOA 4XNQB 3DTUB 4NFBA 4X6DB 3SKMA 4C4BA 5HGGS 2A6KB 1TQUA 2O5XH 3N1QC 4TVPL 3H85A 3NP3A 5IF0A 5M94B 3AJ7A 1Z0NA 1UWXK 1JK9A 2CWRA 4O2CB 4K7PY 5MENB 4ISVB 2DBJA 3IDGB 1HINL 4OZHF 1KIRA 4XNMB 1B2WL 5ABZA 5EA0L 5CJ5A 1IFRA 5FUZH 1GMIA 3MPCA 4K7FA 3ZE2E 3QUKA 2AJUL 4XCCH 1FLRL 4EZLA 1DE4A 4PJ5E 3N3EA 4LKCA 1S7RB 4IK6A 4MJ6A 1XF2B 2IPUG 1M2OA 2MWCA 5ICZB 3HG2A 1NGXB 2UVFA 1LO0L 2I26N 1A0QL 1THAA 4HXAL 1A3LL 1G4MA 1QHOA 1UCTA 2OW7A 1V3JA 1U8CB 3PGFH 4I18A 4U1JA 4HC1A 4LSQH 4MNGE 4XCYB 4DVBB 1AE6L 1T0NB 2NXZC 3GYRA 4U1IB 4Y4HC 3CAFA 2H9GB 4HCRH 4ODVH 5DDHB 3GDBA 4I3GA 3CCHA 5C0BA 1R33A 1VEMA 2NY2D 4S2SB 2Z7WA 3ARYA 3OZ9L 4HKBA 5CEYA 4ZQKA 3Q05A 4ZUSA 2AEQL 3PWNB 3FQYA 2IGFH 4NO5B 3FSAA 3TV3H 5AW6B 2ZXAA 5DMKA 4KGLA 2AMUA 3AAZB 2YJLA 2WTPA 4HIXL 5EOTB 3DMMC 3FQWB 1HKLH 3IK2A 2VDKH 2CO6A 1F42A 2NSQA 4YBLC 3NQIA 4UM9D 3TT1H 3LH2H 3ECQA 2XG4B 4LASH 3ZY7A 1SN5A 2HWZL 4EI5C 1Z9SA 1PZ5A 4WO0A 1INEH 2AK4D 2YQ2A 4G11A 4D0CA 4WFHD 3UTTE 2JCCB 3O45B 5IREA 4F33A 2YAFA 1T21B 2CO2A 4TRPL 1K8DB 3RVXD 2HPOA 4WW2F 5G2NA 2F18A 4PBDA 1BF2A 5JHMA 2C3VB 4X83A 4UNVA 3O3BB 4PJXF 1JVKA 5IB1B 4IRSA 4LLYB 5C0FA 4PRNA 1F11B 2MH4A 4KJPD 1MCLA 1VADA 4O58H 4N6RA 4XAWH 1AS6A 5FM5M 3WFBH 3CLEH 2Y7QA 2A73B 1AD9B 3FRUB 1F0LA 4V1DD 4Z7OB 3MYZA 1PLGH 1ETJA 2ZCKL 3BT0A 4GW4B 4MD0B 4NYLB 2CO7B 1JWMB 4WKXA 2FWSA 3SODB 5JW3L 4G5ZL 2LVEA 4M5TA 3MRDA 4JFOB 4HIJA 3VFOB 2LLLA 3ZKNC 2YD3A 1VFAA 2MNWA 1PLBA 3BW9B 2GABA 4YHOL 2CM5A 5I1GL 4MD5A 4MDJB 3A22A 2AQ3A 3WNKA 1QTSA 1RMFH 1YMMD 4JPKL 3MKKA 1W91A 2RAMA 2OFQA 1DEDA 2G2PA 4KUZL 5CLZA 4ZK8A 3SDYH 1DVTA 3CNKA 3OAYK 1DQML 4AYSA 5IIEA 1DQKA 1E3FA 3ELAT 4IJ3B 4Z7NF 5ADOH 5LGJA 2HJKB 1KBVA 1KEML 3SQOL 4LLWA 4X9FA 1RFDH 1GYCA 3CXDH 2HKHL 2QQLH 3FOMB 2XVLA 3MREA 1QW9A 4X7SH 2N7BA 3T1FA 4DGVL 2RACA 1F1GA 1HSBB 1IAOB 1URLA 3VFNB 2VZUA 1CI3M 4AX3A 4ZD3H 5C8JB 4LFHG 2F8IA 4LMQI 3QZWG 5EN3A 1TOXA 1N0XL 2X4OA 3MV7E 4HS6A 5BUGA 3KLKA 2VLKA 1E4KA 4MMYB 1JVLA 4ZMYA 1O6SB 4JRYA 2F2HA 1WIUA 4GYBA 3MUJA 2EDJA 4IRZH 4UM8A 3ZTNL 4LEOB 1MJ8H 3DECA 3D2UA 4BKTC 1USQA 2ADGB 5CP3H 1I7ZB 3WO4B 3UZVB 3LRSB 4HT1L 2KMWA 3WFHB 2WUBH 4JR9L 1HL4A 1BAFL 1JE6A 1V7ML 1X5IA 1XQ4A 3AITA 2G30A 3GNML 1I8MB 2WQSA 4X4YB 1D2OA 2LQRA 5SWSB 1EZVX 2HJLA 1A3ZA 4X6CF 3VXRD 3QUGA 1A4CA 4URTB 4CKVX 4LP8A 2ORBL 2CALA 5I0XA 5T3XH 1F4HA 3BD5A 1I3VA 4MJ5A 1RHHA 5FAAA 4OCNC 4R4FH 5LG6A 3BPLC 5TPWH 1DBKL 2CBTA 1XSIA 1WE5A 1RIVL 2DQUL 3S0PA 2Z4QB 3BWSA 2XZQH 3FU7A 2H0JA 5DHDA 1WJ3A 4LCYB 2WXPA 5I18H 3REWB 4ZMQA 3N5AA 3GGWA 5FO7A 4Z3EA 1T22B 3N9GL 3BFWA 4HMDA 3UAAA 1AI1H 5GRUL 3VXOA 4UV7L 5GS2H 1MQKH 1DO6A 4WJKB 2HCZX 1S9WA 3AB0B 3CVHB 4I3RH 5IB3B 4FFWD 1IX2A 2N4IA 4EJ1C 3TVMD 1HTYA 1QP1A 4S1RL 2CU9A 3SY6A 1D5IL 3RU8H 1F58L 1WZKA 1KTRL 5DJ8A 1PYWA 2UYLB 3WUWB 1I1AB 4MVBD 2KYIA 4G9FE 5E5MA 4N8PA 4AIZA 3NOIA 4JFXB 4YC2C 3GWJA 3W39A 4UTCA 4ZSOA 5F1SA 4NFDA 4AGNA 5K69A 4WWKB 4XPFH 3D50A 3IJSA 1IBFA 1HNGA 1IAIM 4HLZH 3IETA 2XT1B 1JYWA 2BW5A 2OX5A 3O8XC 4HDIB 5EO9B 5I8CA 4QRRE 3GI9H 1YEWA 4P2RE 4BHUA 3CDYA 4XAKD 2GSIB 1SYVB 3L4ZA 2CHDA 1N64L 3LKQB 2FWLB 1CBVH 3ARSA 2JJTC 5HHQB 5D5MA 5I1HL 1KXQE 3L1OH 5EC1B 2CLVA 3WXVH 9PCYA 1GW0A 2V5SA 1CLZH 2B4CL 1USZA 5DD6B 4XMXA 3ILEA 4R4BB 2NUTA 1SUJA 2JJVA 1TZGH 4MA8H 4XP1H 4IKNA 6FABL 1DVYA 3RUGF 2EDXA 3V4PA 3PHAA 5IROA 2JXMB 4ZFOB 3D39E 3AWGA 4APQD 3IGKA 4OKVA 4DFIA 3M7FB 5F7FA 4IGBC 4Z7VE 4O02B 1ID2A 2YD6A 1KSRA 2HFEB 5D9SA 1MEXH 4OW6A 1MAJA 2WIIB 2VXVH 5SV4A 4ETYA 5IV2A 4PJGF 4ADGA 1MRFH 1Q94B 3MRHA 3NG5A 2JB6B 3EFOB 3N41B 3WEMA 4G9FB 1B0GA 1Z3GH 2O6PA 3NN8B 1EEZB 1W16A 4G8IB 3FFCB 4JFDA 1TSHA 4EBQH 4LQ1A 3MLUL 3UYRH 2N59A 1RP9A 2Q3ZA 4F2MB 1LK3H 2W60B 2D3JA 3QEHB 2PCPA 1DJGA 2P5WE 2YARA 5JOPE 1HQRA 3IMTA 2F53E 2IXQB 3RWCA 3DV6A 2MEJB 1F8TL 1NAML 4QRRB 2X4QA 3TN0A 4P2RB 2YPKA 4OTXL 5C07D 3FFOA 5HGHA 2WZ5A 3C8KA 3ZTJH 2J55A 5HSFA 5BOZG 1OGPA 2V8LA 4I1RA 1T5XB 2HVKB 3V55A 5KYYA 1QLEB 1AR2A 2GTWB 4XNUL 3EJUA 3TC9A 4LOUD 5FYJE 1WCBB 3HE7A 3U0PB 1TJIH 2AJSH 4PY7A 4F93B 4J1UA 5GPRA 4L1TA 2MQCA 4OLVL 3ARBB 5DFWH 2VO8A 2O5ZH 2OV0A 3VG0H 1IBGL 1N3NB 1H8OA 2QGDA 3HB3B 3WY2A 5MEQB 2CGRH 5JHLA 3MO1A 1T3FA 1YY9C 2FYYA 3IU4L 3RVWD 5DJCB 1AGBA 4ZO9A 5EHFA 5CEXB 4RDQG 4U1KA 3Q8EA 1D9KD 2YHGA 4OGYL 4BDVB 3JWOH 4Y5VC 1GAFL 2VLME 4OVVA 3AQZA 3HTLX 2Q3XA 4L8SA 3GUTA 2JFCA 5EB9A 2PWHA 3PDOB 5HDOA 1VGEH 4I2XB 2SEBA 4P23A 5GISH 1A1MA 2J6EL 2B1OA 3TBTB 3BEVA 3FT3B 4G7VH 2DTML 4F1SA 3SO3C 2F1BA 2HLEB 4WTWA 2VDLL 4LNRA 5AOIA 5F6HI 5D7LA 3ZGIA 1UJ3C 3IWVA 2J8UF 4MAUH 4JMXA 1NSNH 3BHBA 3DX9A 5KVFL 4E0RA 4KDWA 3FHQA 3BGAA 3D85B 3IFOA 3U46A 5HYSB 3NJIA 5HHPB 4AG4L 1XGPB 3LZFH 1E3XA 4ORGA 2B14A 5CCKH 2YBRB 3P3TA 4K7PL 2HKAA 1DBML 1X5MA 4HJ0C 1RJZA 3W11D 5AALA 5ALCH 1TNNA 4LEEA 2EXTA 4XNXL 1EQWA 2EYTA 2K4WA 2Z1KA 3F62A 4CSPA 2EVGA 2D0HA 1NC2B 3ZR5A 5C0AD 1T6WA 2PYEA 3EZJB 1XF4A 1S78D 2BNQE 1EXUB 1EEYB 2IVFC 5DQJA 2XIDA 4EXPX 3CIAA 4JFZL 2K1MA 1G1YA 4P46C 2XXCB 3MNWB 4PJEB 4LSQL 2X4UA 4AQEB 3RFZC 4BGDA 1CMOA 1NFIB 2P7TA 2ATPB 2WO3B 3AREB 3CXFA 3FT9A 2C4FT 3LH9A 3FRPB 4J3SA 4LSPL 4U6VH 5IVXA 2P24B 1IQWH 1J7VR 2C3XA 3FJTA 1U2YA 2BSTA 3UAJD 3KH4A 1KIUA 1O7DC 3IFPA 4G42B 4R90L 5ERWA 1FYTA 1KN4H 3Q9PA 4UV4L 1XD0A 3X3GH 4MDIA 2X0UA 4UDUA 4X5WA 5I0VA 4U05A 1LWHA 3ZYJA 1CZ8H 2BP5M 1T4KA 4OZ4B 4ZS6C 1G6RL 3QAZC 4WO4C 2WXRA 7TAAA 4P06A 2Y6TE 4NQCB 1HK6A 1XGRB 2F19L 4N8CH 1Q1PA 3DMMB 3GFUA 4Y19D 5DJAB 4GG6B 2P8LB 1I31A 3JV6A 4GPVA 4N5UA 3A4DA 3EDEA 3MV9A 4YBLB 1AXTL 4ELME 4FX5A 5FHBL 4CA4A 1CT8B 3IFNH 1QPXA 2PW1A 5FB8B 3WD5H 1CD1A 2ESVB 2QVIA 5CR1A 3IXAB 1I3RA 5DC9B 5PCYA 3RNQA 5T3ZE 4AIXA 2J7LA 2Y5TB 3JWDH 2IV8A 3BP4B 4FXTA 1BQHG 1BQUA 1SYSA 1RH8A 1OCWL 4ZDHB 2A7BA 3C2AH 4W93A 2ODHA 3LMJL 2J3SA 2IAMD 4O5LH 3QXAA 2WZ6A 1T1XB 3QZOA 1JPSL 5FYLE 3SZKC 1DCLA 3PHQA 4BUQA 1I1YA 1AY1H 4XP4H 2BNQB 4AMKH 3LQAL 2Y25A 2EDFA 2YAPA 5DD0H 3IJHB 4LE8A 3KLAA 3PLYA 1OF2A 3CZKA 3QIBD 2QQNH 2V33A 2ROXA 2CGZA 3B3BA 5DUML 3C5ZA 4W6XB 1JXDA 4TTDC 5I1KL 3V0WH 4TQEL 1XMWA 3EYFB 2W91A 3VO0A 1NCOA 2OJZH 1MFEH 5KYXB 3Q8FA 1QVOB 3TASA 4N6QA 4FG4A 1QQDB 3NEEA 3PP3K 4RVBA 1OO2A 4K8RL 1NBCA 2FH6A 3BSHA 5JO5B 4LHUD 1JNHA 1ZWIB 5CUSL 2ZAGA 1XGTB 2ZWZA 4L8CB 1RZGB 3HMXH 1ZT7B 3Q48A 4HYTB 1ZGLM 3CFDA 4GOSA 2DEXX 4LO9A 3VWKA 2GBUA 1CFBA 3P40A 3QQXA 5IWLA 1HILA 4NP4L