3NRFA

Crystal structure of an apag protein (pa1934) from pseudomonas aeruginosa pao1 at 1.50 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
DAVMVFARQGDKGSVSVGDKHFRTQAFKVRLVNAAKSEISLKNSCLVAQSAAGQSFRLDTVDEELTADTLKPGASVEGDAIFASEDDAVYGASLVRLSDRCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ApaG protein
publication title Crystal structure of an ApaG protein (PA1934) from PSEUDOMONAS AERUGINOSA at 1.50 A resolution
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 19
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3nrfA00
3SB3A 3NRFA
chains in the Genus database with same CATH superfamily
3NYKA 2VW4A 4UZSA 2Q8BL 3B9KC 1SVBA 4X98A 1IRAY 3UYPB 2NY6B 1Q8MA 1QLFB 4O9HH 3WFHB 4QAWA 1K2DB 5AUMB 5MP6L 4C4BA 2FLBT 4MX7B 4F7TB 2YFNA 4HUVB 4Y19D 5CILL 1TZHA 1MELA 2ITDA 5DRXB 4O2EA 2NLJB 4KKLC 1EGJA 2J1KA 4FLSA 2WTRB 4JFOA 2H8PB 3KWVA 1QEWB 5D9SB 2EYTB 4MJIB 2QKIA 2ZCKH 4HWEL 5GQBA 2BSTA 5AVQB 3IDJB 1OP5H 1KJ2A 4NQDA 2ETWA 2Q3ZA 4AUUA 2VCOA 3HMWL 2DLFL 1XCXA 5LQBL 2IH9A 1QKZL 3VYNA 1YMMB 1MCPL 1BJ8A 2J57A 2WAQA 2ITEA 1JG9A 4GRLB 4ZYKA 1G7HB 1P5UC 4YVUA 1EO7A 2NPLX 5FC9A 1C9SA 1IAOB 2DI7A 2UWEB 3MRIB 4QY8B 3UBXI 3ZDYE 1G9MC 3JV4B 1YMHB 5I1GL 3CZNA 1J1XH 1CF1A 1TPXB 4I77H 2AW2A 4KUCF 5F1IB 3K6SB 2X2YA 3O0RH 1HYSC 1V7ML 3MCYA 3EYUL 2DTML 4K7PL 2A73B 4HC1A 3L4TA 3TN0C 1EAOA 3L3IB 3ARZA 1B4JH 2WXFA 3NAAH 4GI6A 4MVBD 1R9FA 4YVNA 1RUQH 3S3BB 4FFYL 1F3DH 1U95B 1R5VA 1KLUA 3EG9B 2XKNB 4PGCA 1RLBA 2Y72A 4FA7B 3ZZLA 3NJXA 5JYLA 2VGLM 4U05A 3CG8A 5ECGA 3C09B 1MDTA 4LKCA 4JRYA 1KNOB 1I3RB 1AHWA 4HHAA 5C09B 3U7AA 3ARUA 1W9XA 3AB0C 4H1LG 1I1AD 2OW6A 2VERA 3HS8A 1F00I 2Z1PA 3B3IA 4K3DH 4XO4A 3RPIB 1UWYA 1A6VL 3GM8A 2JB6B 2F54A 3G5XA 4J2QA 4BD4A 4K8RL 3R18A 4N2KA 1WO2A 1FVEB 1BYOA 5CJ8A 3L8QA 3V0FA 5TGBA 2ARJQ 1FNGA 3SODB 5C0FA 5LKNA 3HI1A 5EBLA 2FIRT 4LMQI 4KVPA 1HH9B 3H3BC 1NC4A 1JV5B 2H9GB 3H4FA 1ZHBA 2FEDD 5K33A 5DR5H 3OKKB 4WNJA 3QJFB 1LVEA 1GC1C 1I4FA 4JY4B 1SYVB 1IAII 4ZFFA 3IDXH 3OVUB 1T3FB 1Y0LA 1PX8A 1BZEA 3NSDA 3QNFA 1MQKL 3TT1H 5CNHA 2EDKA 3MKGA 5SWZE 5F2FA 2FJFA 4LBAA 1QNZH 4RFNB 2JKIS 4R4BB 5IM7B 1G1OA 3MUY1 4AYEC 4WY7L 1TENA 4JDTH 3SQOL 4PIBA 3VXUD 4PGEA 3KPSD 2WINB 3AROA 3LHAA 5GRJL 3RWIB 2YQGA 1P84J 3CHXA 5FYKH 5DMIH 5E9DE 4KZEH 1KUMA 2AITA 3LSOB 4LHUA 4JRLA 2ZX7A 2YK1L 2ZG1A 3U4BH 4X42A 4XB8A 4JO8A 3CFUA 1IC7L 3VD3A 4MMYA 3D2UB 5JNYB 1FE8H 1CS6A 4PJDB 1KGUA 1W0WA 3ZZ1A 3X11B 4KNQA 3A47A 1B9ZA 4XXCC 2Y2WA 1IMHC 3EH3B 2O6PA 5H94B 2BH0A 3D18A 1KJVA 1ND0B 4ZAKD 3UTPE 2K70A 2XN2A 5AW5B 1ZLUK 1R5WA 4Y7OC 1BG9A 1NCWL 3E3QC 2ZUQC 4BQ6A 5F8RC 3FQXA 4EO5A 3PNWB 4OZIB 1UG9A 1ZTMA 2LHAA 1IC1A 4N5UA 5HDLA 4UNUA 2HUEA 3RILA 1BYNA 3MLVL 4A39A 3O6FD 1B90A 4QNPE 4BZ1A 1RFDH 2PNDA 4G5AA 5E1AA 4DSYA 2BRRH 4F3FB 4CVUA 2A9CA 2XZAL 4HEME 5E6IC 3EGDB 3EAKA 4ALAL 1J5CA 3P77B 5LNDA 1ES0A 1CE1L 2KZKA 4KXCA 3NRPA 5C0IA 4XMXA 2A77H 1ZMYA 3PWPB 1FO0L 35C8H 2MFNA 5I5MA 4YHIA 4ZDHA 3TYFA 1T04A 1NOLA 4LEEA 2PETA 3MLTB 3QFJB 2CR3A 3E9UA 1MCEA 5D2LF 3TYGL 4JDEA 5GZOC 4PJDF 1Z3GL 1B0WA 1YUHA 2EIJB 3FFDB 1XR9B 4XPHL 5HYJA 2DBJA 3FTZA 3CH1B 1KYOJ 2AQPA 4AG4L 2F8VA 4HT1L 5JUEH 1U8KB 1DFBL 3RDTD 1V3JA 2APXA 5C0EB 4GKOA 4WIQA 4G5ZH 5IT2L 1UA6H 1KDJA 3BQUA 3IJ8A 4ZFOB 4L3FA 3JYCA 1BREA 3BEVA 4R7XA 1Z9SB 2OMBA 3E2HB 5MEOB 1X5ZA 4P5TA 3CN4A 2NNCA 2OMVA 1LP9A 1EZUA 1P7QA 3ZMNA 2N0KA 1GAFH 4DETA 5EO0A 2AEOA 1EAQA 1L0PA 5IW6A 3OKLB 3MV8D 3RX5A 2A7BA 3QAQA 3RGVA 3DMMC 1HESA 3CLFH 2RMNA 3O3EA 4XC3L 4WI6A 4X6EA 1NGXB 3CK0H 4HCIA 1KEGL 1G7LB 2V5MA 4OF5A 4YDLB 1KCRH 5DI8A 1JUFA 2QPEB 3CWGA 4WWKA 2J7LA 4YDIL 2KL6A 3NFSL 4K8RD 1CLYL 3VE0B 2Y24A 2Z0UA 4FADA 1M05A 3NH7H 3TBYB 1WIUA 2W07B 3HRZA 3Q2LA 1D5ZA 2XWXA 4KTDL 2BIQA 4ZOCA 5GRZA 5TQ2L 2XBDA 1UOKA 5FDYA 3TJEH 2GABA 4B60A 3HLAA 4RIRA 2ARJB 3C8KB 4DGIH 1H8SA 3G5VA 5MEND 2VDMB 1JDDA 2OCFD 2HFGH 2XUWA 1CLOL 4IYKA 2VMDA 4NZRL 4WAFA 4YE4H 1YLBB 3D85B 3FB8B 4LLYB 3U9UB 2ARWA 4DKDC 5HDOA 5FUOL 3CXDL 2AK4B 1UYWH 3SPGA 1YPZE 4PD4J 1F6AA 1UKQA 4ZXBC 5AB0A 7FABL 3X3GH 4PRPE 1NCGA 4YC2B 4PS3A 3Q06A 3BYTA 1OANA 4NQSA 3FB6B 2F68X 3S8FB 3LKOB 1NTDA 1EFQA 3LEVL 1IKFL 2EDJA 3Q1SH 3TBTA 2PYEE 3ILQD 4HIPA 1ZHNB 3TV3L 3BPCB 3OR6B 3IDGB 2FECI 5D7LD 1G9NL 1VEPA 2CLRA 5KBNC 4AKQA 3SYPA 3LV3B 3BQVA 4NI6A 1ACYL 1QR1B 3QQDA 4U3CA 4Y2OA 1NSNL 2ZUXA 3F7RA 4JFYB 4TSAH 1DSFH 4R7DB 3S97C 1P4BH 2NOYA 4A68A 1JGLH 2FQEA 3VA6A 1TFHA 2C7FA 3ZGIA 3BP7A 3H3PH 3RTQA 2Z93A 1NH6A 2Q76A 3QUYD 3UTSB 5E99H 5D5MF 2O6CA 1G5AA 5TE4H 4OQTL 2DJSA 2GJ6E 3O6LH 4FRWA 3Q44A 4PI0A 4E9QA 4BQ9A 1DVUA 1ZDSA 4N3UA 3TVMB 1HINH 4QJ4B 3MV7D 4MAYA 4OLUL 4OF7A 4S1SH 1UD2A 1EMTH 1IFRA 3LKQB 3RVTD 4XNXL 1I1YA 1GPOH 3AS1A 2CRYA 3TCLA 4OZGF 1SBSL 4PLKD 5C2BL 3HG1E 4XVJL 3EFFA 1QHOA 4DQOL 5IHUL 4NUMA 4Q8BA 3EJPA 4JAMA 4PVMA 1BQHG 2O5NA 2YMXH 3Q5OA 3FAWA 1IIKA 2CCLA 1OEZW 3QJTB 5D1QD 5EO1B 1DJGA 2E9BA 3BZ4B 5AVUB 3BZEA 4KJPD 2VDMH 4KKAC 1IJNA 4IRZL 5E2VH 3LRSA 3EOAB 4M7KH 1IAKB 5D71H 1FFQA 2X9ZA 3BKML 4JFHD 5B1KA 2AK1H 1IC5H 3NJIA 5TH2B 1CBVL 1MG2C 4N5ED 4B7IA 3GHBL 3ARGC 5KTEH 4JG5A 4XVTH 3LRHA 5LBSH 3GZPA 1URZA 3OHXA 3PWNB 3GIZL 3MUGA 2G9HB 2HLFD 3VI3E 5K59E 2F7OA 3IDNB 2D03H 4XC1H 4PJXE 2WQWA 1MF2H 1QWUA 5SWZA 2P52A 3OKMB 1VZIA 4JHUA 1U2HA 4G1EB 1HS6A 1OGPA 3NSFA 2QJDA 4DKEL 5GRYA 3GTTA 2X2UA 4YN3A 1DJWA 1JN6B 2IEPA 3UTQB 4OAWA 5DC2A 5E9DA 3LNHA 5BQDA 2AFNA 1TOXA 8PAZA 4YPGB 5I1KL 4K94L 3L54A 4W9JC 3ZKND 1SY6H 1Z5HA 2GG1A 4OZFA 3RX7A 1EJ8A 4XVUC 4Y1AB 3WO4C 3RZCD 4J3WA 3CJJA 1KCSL 1MWOA 2I60H 4N28A 4HWBA 4G11A 4NBZB 5DUML 4HKBB 2AVFA 4ELMB 2AQTA 2YO3A 5DZ9A 3MLUH 3TH2T 2BIMA 1T0MB 5IWLA 3LZNA 4XI5D 3TXAA 3N9GH 3ES6B 1DTUA 4KO7A 3RWJA 5ANHA 5F44A 2MCAA 4N2AA 3L4YA 2PN5A 2DKMA 1JMZA 5IMMA 2F2HA 5DU7A 5IBTL 4LRIC 2P42B 3IPEA 2BS71 3T0EB 3ZJAA 1CD8A 5C9KA 1EFXB 1D2OA 3ILDA 2FX7L 4FERA 3MX0A 4Y16B 2C3XA 2ZCKL 1ZLVK 4APQB 2F15A 4ZBJA 3CFQA 4TRPL 2QPDB 1AXTH 4DP0X 4UM8B 1LHZA 3LOWA 1BEYL 1RMFH 4N9GA 4HEMA 5L4IA 3T0DA 4BH8A 1EHLH 4PJCF 4Y19E 1EHNA 3IFOB 1ZLWK 4CW1B 1JF6A 3MKKA 1NEZB 2X6AA 1FC2D 4X80H 1XF2A 5AW0B 4E5XB 3WJLC 5EU4B 1U93A 3GI8H 1CICC 1IGMH 1U8LA 3O41B 3BLPX 3OQRA 3DUSA 4XX1E 3LQMA 4I5BB 5GS1A 3FB5A 1ETZB 4BUQA 4I77L 4WU5B 4M03A 4BSVA 2H3NA 3TF7C 1F4WH 4HPYH 4JB9L 1UB6B 5T1MA 2YXMA 3VFOB 5E8PA 4IS6B 2NXZD 2OW7A 1ZVSB 1B4JL 3SKJH 1P6WA 2BRQA 3WD5H 4A2FA 3S7GA 1UOLA 1UD3A 3O8XB 1PAZA 4PJIE 1DBMH 4ZMWA 5J57B 3ULVC 1UA3A 3QXVA 1EK3A 1JMXA 1MOEA 4V1DB 4MA3A 4CC0A 3RFZC 1S7WA 2ODIA 2IVFC 1GYUA 2Q87A 4K3DL 5BO0D 4HCGA 1OT2A 1AHKA 2V3FA 1CLVA 1CYGA 5CJOH 4N0FA 5J12C 4EIGB 1HILB 3RGHA 3LRGA 4XNBA 1K8IA 1QZNA 5D1ZI 1L6ZA 3UG3A 7PAZA 3MRGA 4NJ9H 1L9NA 1BA9A 1AGBB 3H6JA 5T33H 4RFOH 5T1LA 5DR5L 1FNSH 1EZVY 1FL3A 4P2QB 1A47A 4QTHA 3IDXL 2HLAB 5EUOA 4JPSA 4LNRA 3QIWA 1UOWA 4L5FH 5F7BA 1SXBA 2BP8A 5HDBB 3RDJA 1L9QA 3S3PA 2J8OA 2WGNB 4F33B 4JDTL 1KN4H 1TT6A 3HB3B 5DVKA 1CIDA 1R24A 2R2EA 4R5TA 4WI0B 5DMIL 5FYKL 3STLA 5C0ND 1SHMA 1HHIA 3REVA 1YG9A 3U4BL 4MCYA 4PRPA 3DSNA 3HEIB 4KHXH 1PIGA 3V4VB 3ZMEA 2WJ7A 1FE8L 1FV1A 1OO2A 1A3ZA 1T5WA 1V55B 4Q4IA 2PYFA 3A4DA 2PYEA 4H8QA 4AUYA 3SZKC 1I7ZA 5BRPA 1Q9OB 3VGGA 2YMTA 2XWRA 1T4WA 3QDMB 2WKOA 3V0WH 5ADPH 2D4FA 5IQ9B 5FO2A 1FGNH 4MJ4A 3VWJD 2XZQH 5H37H 4ECNA 2B39A 4MNQB 5JW3L 5KSAB 1TF4A 3QEQD 2ZXDA 4NQXA 2X09A 5C97A 4L29B 3JT0A 4XBGA 3HJ0A 2IO5A 3VFTB 2OMWB 3PHQB 5C08B 5CEZE 4M5YH 3FU8A 3MRPA 1VHPA 2VLJB 2EADA 3ZKQD 1RFDL 2R2CA 1S3KH 3FO2A 4WO0A 1CL7I 5DJ0B 1WUZA 1XGRB 4MMZC 5GISH 2WYTA 1K6QH 4PJHE 3P3UA 4WO4A 4FXKB 4FNLH 1BZ7B 2R69H 2QGEA 3MRCB 3ULUF 4MYWB 2D7TL 4PBXA 5GZNA 4JM2D 1JVKA 3DBSA 4WEEA 4G6AD 4HCFA 1J9SA 2JFCA 3HG1A 4CILA 2MSPA 1YYLL 35C8L 1R33A 2VL4A 1X5YA 4TQEH 3MNVA 3V5DA 2AGJH 1T21B 3CSBA 4FG0A 2F5BH 3I74A 2C1PB 2I9LA 4PG9A 2E47A 4GXUM 3WU1A 4OT1L 1A4JB 4HX1A 5IVXB 2BCKB 5C7XH 5DCCA 5JUEL 3QQ3A 5I5RA 3ULUH 1LO3L 3B5HA 3ZDZE 4DNLA 1H15A 2Y69B 1AHWC 1J05B 1ZS2A 1FYTB 2A6DA 3BWAA 5J8OA 1UA6L 1C16A 4EIUA 1F8TL 1CFQB 4LSTH 4YHLH 4WHTB 4FD0A 3IJHB 2FEEL 2DWDA 3VH8B 3RRQA 1TVBA 4JKWA 3V4VH 3V95A 2C7UA 3VI3A 4YSOA 1S78C 5D6CB 1VFBB 3FQ1A 4MTMA 4PJXA 1OARH 1L7IH 2Q1EA 1HE7A 1MQ8A 2H6UA 2ORBL 4XPFH 5JHLL 4JL1A 5KBLA 1M56B 4HEPA 4NHCH 4KV5F 2OX5B 3AXLB 3OMZA 1OZUA 3R7RA 2P5WE 4MQ7A 5JTWA 3CK0L 1KY6A 1ED3A 5HHPA 4D8PA 1FJ1B 3BKCH 5ICXA 2CALA 5DO8A 1MPAL 2G4GA 1NC2B 2B2XL 2NY6D 2JB5H 4WEBH 5DRWB 2A4ZA 4Q14A 3I75A 3MV8E 3Q13A 3UPCA 5K9OA 2H47C 1HEJC 2VJ0A 3N55A 4OU3A 3LQZB 3PAVA 5IHLB 4KMLB 4ONGH 5HYIA 4YDMA 1ZIBA 3FCBA 5I1EH 4K71B 3LN5B 1PZ3A 2R29L 4B53A 3KJ4C 5DK0A 3MBXH 2Q86B 1NMCB 1Q0XL 2HFGL 3I3BA 3B4NA 3GMQB 2BDNH 3IDYC 3M8OH 4YE4L 4J3TA 5F7EH 3UOAB 3WENA 5ABDE 1N7MH 1NBZB 1EAPA 3BUTA 3NIDF 4QHUB 3AS2A 2NY0B 3OMAB 4K3JH 8FABA 4LZKA 4H2CA 2XG4A 5ACMA 3P9LB 1GZQA 2BFVH 4FQ2L 5IB2A 4LT7A 1MLBA 4A7UA 2QPUA 5I17A 2A0LC 1YMMD 1UYWL 3GO1H 2NTSP 2F8IA 4OFVA 4GP5B 4GRLD 1CFTB 4C56D 2BVQB 3ZDXF 5MENE 5H35B 1OTSD 4I1NB 5AOIA 5FYKD 3LXAA 4QHLA 2W65A 1MCKA 3QCVH 3C60D 1JVOA 4AMWA 2H6PA 1KYFA 4JO4L 3DNKA 5E8DL 3SGDH 3RWHB 1FP5A 3FQRA 4AIEA 5DD3H 2HCZX 4ZFOL 1QUPA 3C09C 4P9MH 3E8UH 4TSAL 1G43A 3POHA 1JGLL 2WVTA 1GOGA 1BX2B 2OI9B 3SJVB 4DW2L 4NXKA 4ZMZA 5J6GB 1CGWA 3UIZA 3NZSA 3R4DA 4H8WL 2EE3A 4TNWF 4FTVE 4KRPB 2JTDA 4OJAA 5ANMB 5G55A 4HJGB 3RWGB 4PMEA 3VWKA 4EQ3A 5D7LE 1ZK9A 4NKDA 3VFNA 1NGWA 5C09D 2K9FB 3WS6A 1E2ZA 4UYQA 1EMTL 1GPOL 1FNLA 1S7TA 1B6UA 1UB5A 1MIEH 1OTUD 1YYCA 3DX9B 3RVWC 1O7SA 3EJUA 4QO1A 3UG5A 1DBBH 4U3SA 3SPHA 1XGYL 2JJWA 5GSVA 4OLYH 3NN8B 2OYKA 3IGKA 3MV7E 3WIIH 3G5WA 3OKOA 2E9GA 1L5GB 2ZIDA 3A6BL 3BQUC 3ZT5A 1MFCH 3DYOA 5KBKA 5IW3A 2AV1A 4M7KL 5D71L 5JXAL 5KYYA 2VDRH 3H55A 3CPLA 4U0RC 5IHWA 4YHZH 1AD9B 2AK1L 3U25A 2N0MA 2O6DA 3Q2CA 3ARBB 3RBSA 5KTEL 2ZSVA 5J9PB 4MD5B 2E8ZA 1ACZA 2O5YL 3GSNL 3QH3A 4PRNA 3T77B 5JPNB 3RGVC 3AACA 2W1NA 4G7VH 1RZ7H 3EH2A 3TWYA 1NFAA 2WMPA 3SCMA 2FQGA 4X5LA 4QJ5B 1QHQA 1AKPA 2IWGA 4XC1L 4K55A 1MF2L 4F8TA 4JFHE 5MHSE 1N4XL 1AIFA 1UT1A 3RPBA 4WWKC 2NZ9D 1JK8B 1UACL 2W60A 2R1WB 3D2UD 4HG4K 1JZJA 4FNSA 1PNDA 1RZIB 5EPMB 3TNMB 4TNFA 4MCMA 4XMZA 1TLMA 2JLLA 5D7HA 3RB5A 1ECZA 4CVXA 3WLWC 5KOMC 2QMKA 1PJWA 4K3EL 1WT5A 4MZRA 4PREA 5KVEE 5BO1H 1B0GA 5AZEH 1E6OL 2I60L 5D8JL 5B21A 5ID1B 1YQVH 1FNHA 3EZJB 2B0SH 1TCRA 1QMUA 4RVBA 1E5CA 3MLUL 2HFFA 2FIKA 4TUOB 4Z0BH 4CKVX 4H8HA 3T04D 1E9PA 3DV4B 5JOFB 5DGRA 2GBAA 2XVLA 3PFUA 3WTWA 5D7JD 3UC0H 3S4SB 4WFHD 5E5UB 3ASNB 3GXUB 4KUZH 3OJDA 4XOCA 5DEGB 5E4OA 2F53D 3WEBA 4TKWA 3PL6A 2IPKA 3F7LA 4K5NA 3CDGB 1G0YR 1ZJBA 4ZRGA 2YEQA 4FEMA 5EFIB 5K39A 4ANVA 1AMXA 5L6YL 1AXTL 2DQIH 1IAIH 4JKLA 4KK9C 5ID0A 4J23A 1HC1A 1UM6L 1HDMB 3PWPD 4PJHA 3T9WA 2P26A 1INDH 2XZCH 3CHRA 5DJ6A 1ZTXH 5C3LD 3HE6B 1FG2A 3DO7B 3MRKA 2CA4A 3QS2A 1LEIA 2A5UA 3IMUA 1IGML 4P9HC 5C6WH 3QNXB 4PJ8B 4R90H 4CNIA 4U4IA 3K2IA 1WFIA 5DZPA 2P5PA 3RURA 2E7HA 2K0RA 3VRJB 2FWOB 4HPYL 4U6TA 1EBAA 2XACC 4M6OL 4OFDA 5FUZH 4BE5A 1AGFA 2VN5A 1XB8A 2FZ3A 2UZXB 1WGVA 4J8RB 5C07D 3BAWA 2XN9D 3G5YA 2WIIB 3NEXA 4HK3J 5DFWH 2O6FA 1GA2A 1UM5H 2QVTA 2GEEA 1NJ9B 1G7PB 2X42A 4JFDA 5M95B 4NC1E 1J88A 3K72B 3NZHL 2HJFB 3UERA 3WEOA 3WTTA 5DSCA 3S2AA 5JW4R 4HUUA 2EIKB 2FB4H 3QJHB 3MLPA 5T1DH 3VUAA 2EEBA 1U8CA 3IPBA 4XPBL 1FZKA 5IGXH 3MR9B 3P4OB 2PTTB 4WRLA 4XP1H 3CLWA 5GJSH 4PJFB 4F91B 4X5XA 4ZX5A 1PZAA 2DJMA 3IRPX 4XTRC 3WLBB 5EEUA 3AY4A 3KJ6L 5DO2C 3TO4A 2D2OA 5DS8A 2P5WA 3PCYA 4IIQB 5CJOL 5IJDC 5GGUA 1MEXH 3QNZB 1HSAA 4WW2F 4FFYA 4JDVA 5HI4C 3OAYH 1SJXA 2BIIA 3IB4A 1Z9PA 1KELL 5IQ7H 1XO8A 2AZAA 2X4QB 3DOHA 2NX5D 2V9TA 3HI6H 3IRZA 3MV8A 3NIGE 1XAKA 2WO4A 4I3GA 4RFOL 3DTDA 1JWMA 3D85D 3FS9A 4AOFA 1FH2A 5HHOB 2VAJA 2B9AA 3L3JB 1N64H 4QEGA 1KC5H 3WMSA 15C8L 3NIFE 2QLVB 2J3SA 1ZD6A 4UILH 1DYZA 3IJSB 1TLKA 2X4UA 2VSKB 1RD6A 3IFNH 1EEZB 3LNIA 4Y89A 4GO8A 3W39A 4AVJA 3W56A 3IGAB 5GS0H 1A2YB 3EJCA 4WLCA 1KN4L 5DMGC 1WAEA 1QBBA 1GHFL 1VADB 4TPRH 3RQ3A 2K78A 2G3NA 3BH4A 1TTFA 4NNYB 4OSUH 3LKSB 2VDLB 3QIUA 1NBQA 4C83A 2VO5A 1A22B 3GUFA 3T4YA 2CMRL 4KHXL 3D30A 4U3XA 2WK2A 3WNPA 4FLHA 4LSPH 5MENA 2IGTA 1A9EA 4PJFF 5DEZA 4BEIA 3EBAA 2VO8A 2YRBA 2EDHA 3D50A 2DIBA 4E9WA 2V2TB 4J6RH 2XKSA 3EYFA 4AGNA 4LHQB 2NY2B 1NDTA 5GJTL 4I3RH 1FFOB 1F97A 5E2JA 2EH7H 2W94A 3ETBF 3V0WL 1EDYA 4P99A 1FGNL 1TFPA 1VFOA 3H9SD 4MDJA 3UTSD 1BVLA 2XZQL 3VFSA 1Y7VA 5AALA 1TVDA 3HBPA 1AXSA 1U4EA 3RWCB 1QFUH 4F2MA 1HZKA 4TQHA 5LGJB 1BLIA 3VB9A 3A24A 4KNTA 1PMYA 1HEHC 4NZFA 4PY7A 4DGWC 4DVBA 4FTVA 1WFMA 4Z78A 4YFLI 5MEPA 3SDYL 4M5YL 2YKLH 4FI7A 5D7LA 3ZE1F 2UY7B 3QEUB 5FKPB 3QXAB 3WNMA 3RUGB 4KK5D 5DFVC 1FRGL 2IH3A 1K6QL 1NIBA 2VRKA 5E5LA 4A2HA 2VXUH 4I89A 1XZWA 2D31B 2CLVA 4FNLL 5D7IE 4BQCA 3QEQE 2YAMA 3L5XH 2OR9L 3PDDA 1ULVA 1KIUA 3DPBA 3UIYA 1H6FA 5IVZA 4AENB 4RGMB 4HUKB 4JQXA 4AYMC 3RVVD 1O9WA 3B9EA 3QUYA 1F11A 5IQNA 4DUXA 5L88H 5CIPA 3C6EA 3GKZA 3MNWA 1EJOL 4ZQKB 1NUNB 3LH2H 3RTLA 2VR3A 4U1JA 3WIFA 2F5BL 3NCCB 4U6HB 3MV7A 1KMGA 4RNRB 1FFNA 3JWNH 3HAEH 3RNKB 4UNTA 1UCTA 1EDQA 5ETUA 3TL5A 4IHBA 3ZL2A 3O9WD 4FQHB 5CWSA 3CVCA 3PQYD 3ZKMC 3N85L 1C8QA 5C7XL 3ULUL 1B2YA 3CSFA 3QCTH 4G6FD 1J1OH 2SEBB 3HKZA 4ZTOH 2MOGA 2PTUA 2VDLH 1F4YH 1GOFA 1HQRA 2OKMA 4Z7VB 2BXYA 2LR4A 1FO0A 4MLSA 1U3HB 4NN5B 1DQDH 1KJMB 3GMPB 1S7QB 3LQAL 1OARL 2FO8A 5K9JH 4XPFL 2LOEA 3ARVA 3GT6A 5L7XL 2MNJB 4NHCL 4YHOH 2HRLA 4G8GB 4S10A 3TIDB 3CIAA 2GITB 2XPYA 4Y1AD 3UBXG 2HB0A 2V4LA 2Y36H 1BGXH 3D4YA 1SF5A 1Q9LA 3MUJA 3BIKB 3Q8CA 4DOHB 2R8SH 1OGAB 4UZGA 3T0EC 1Y18A 3BKCL 4RQQB 2X05A 1VACA 4GT7A 2JB5L 4NJAH 4WEBL 4Y4HB 1A5FH 3QIWC 4YLBA 2UX6A 4APQC 2XLLA 3BVNB 4ZS6D 4JJOA 4JPQA 2UXTA 3HNVH 3SE3C 4FLQA 4LB8A 4P5RA 4DUVA 5I1EL 2TRHA 4EI5D 4N0RA 4PQXA 3VFPB 1E4KA 1HCZA 5F3BA 2WOYA 4QKTA 4Y16D 2P80D 3M8OL 2ADJB 2Q6WA 5KSVB 3WL9B 4MDIA 4XGZA 4UQ3B 2OYMA 3GO1L 2GW5A 2O5XH 4FL4B 5F7DB 3L4ZA 2CJTA 3PABB 4ANUA 4I48B 2PW1B 5FB8A 4YL4A 1FVCA 2XWCA 4J3OF 1TVHA 3BVDB 4KXAA 4TUKL 4N24A 2NTFA 1IBFA 5F7YC 2EKSB 2W88A 3QBTB 3QCVL 4UQEA 1TZIB 4BIKA 2PP9A 3X13A 5EO9B 4JO5A 3S5LA 4P9ML 3E8UL 4FG6C 2Y3AA 2JIXD 1NGYA 1YEFL 1OW0A 4HKXA 2A1WH 4K3GA 4KNSA 4C56E 1YUKB 5DMKA 1GL4B 1Q4NX 3ZYOA 5DD6B 5IB3B 2V7HB 4NRXA 4ETQB 4FNPA 5DEFB 1VGEH 2G0KA 4L4VD 2AQRA 4FHJA 3V5HA 3KWXA 4KMTH 1RZKL 5D4JA 2WLMA 4KX8A 3CV5A 4URTB 3FFCA 1T1XB 4YBLB 5H8DA 4K9JA 3GRGA 3SY0B 4WK2B 1ZWIB 2X4OB 5D1ZB 3EHBB 1ACXA 2OXHA 2E7BA 2CO3A 3OWRA 3QCUH 2GQHA 2ZCHL 3LKPB 3MRJA 2WWMD 4MZ2A 1DBBL 4BCYA 3HFFA 3HC0B 3QHFL 2V2WB 4OLYL 4JPKH 3LXCA 3FO1A 3WIIL 3DURA 3CZKA 1TNNA 4GEIA 5IW1B 1OQXA 2KPNA 4OIAA 1OCZB 2QQKL 4OQTA 1KCVH 1KCUH 4NO0B 3WKYA 1ITBB 2VDRL 4GBXB 3STBA 1MI5B 2IC2A 4F7MB 1WS8A 4HXBH 2V5TA 7CGTA 1EVTC 2Z9TA 5KJRH 3U79A 1JGUL 1EERB 3NACL 3A4FA 5JQHC 4F7KA 4HK3N 2A4CA 1DJXA 3HZKB 3TURA 3ULUD 1LEKB 2QTEA 2R56H 4KXZI 4YNYB 5D6DC 2ERJB 4W6WB 3PRZA 3HB3D 1LK2A 2VDKB 4MCZB 4XWGL 4YDVB 5C7ZA 1II4E 4Y5YA 3JTSA 4L1HA 1TYJA 1FSKC 2F7QA 3D07A 3W82A 2H26B 2JK5B 3VCLA 1OT4A 3FC8A 2FCBA 2AKRA 2OM5A 5KSAC 4XXDA 3T4AA 4XT1C 4U1HB 2CBTA 2F8XC 3DUHA 1A4KA 4PWHA 3E1F1 4RWYH 3KLAA 3HHSB 1HWGB 1G4MA 3NQKA 5BO1L 3FCUB 2IPTH 3QDMD 4KBPA 5F1KC 5AZEL 3QHTC 4YO0A 1CG9A 1D6EB 1YQVL 2DQJL 2WLIA 3GMRA 3LIUA 5EMYA 4F8PA 3HLKA 2DLGA 4MNQD 5K9QI 4HWZB 5DRNB 1QX1A 5D2LE 1NCCL 4FXKC 4PJDE 4FQXD 5C0JB 1AHMA 2D7MA 4B97A 3GMLB 1U58A 5CBAA 5E00A 4AIOA 1VJSA 5C08D 2WSPA 2E7DA 5KUKA 4ZO8A 1PYWA 3CHPA 3UC0L 1HKLH 2I5YH 3ARQA 5CHNB 4KUZL 1IILE 2W91A 4RLDA 2NW2B 5I1DB 1V54B 1J0JA 4POUB 4ABQA 1OCWH 3FTUA 5EU7E 5FYLL 3O3DA 2WQSA 1ZY9A 2C5DC 2BMKA 1MCWM 4JRWA 1KIPA 4OKVA 4Y2LA 3KR3H 1I8IB 1IAIL 2C3HA 2ZSWB 1S4IA 1JYXA 4C58B 4G8EA 5L2KD 2WB1A 4MB3A 4DEPC 2CZNA 3VWJA 2B1HH 4GSDH 4MA8H 1U3NA 4FN0A 1NDGB 1NBYA 2QHRH 1JIBA 2XZCL 2Z7YA 3PLYA 4WFHE 3EYSL 3QEQA 2J56A 3QQXA 1IV8A 3CMOL 2F53E 4LCUB 4LL4A 1WD9A 2CKBB 5FLUA 1IZKA 1AZZC 1UJTA 1T2QH 1W2KT 1WTLA 3B34A 4XX5A 3VWKC 3WKPA 5LXGH 1W8EA 4WV1A 5CKAA 4OFPA 5F7KC 4DAGL 4Z7NB 1BSIA 3PWPE 2KH2B 5F97E 4ZD3L 4UT7L 4JQIH 2V7NA 1U8QA 1LO5B 1IQDB 1JK9B 2VDKH 2NT1A 4AYID 3HHMA 4QHKI 1F56A 3EYQC 2XWBA 2EDNA 2ZYIA 1BEXA 5JIIA 2NXYB 4BXVA 4X50A 4AW4A 1BZ8A 1KBKA 4LVNB 4R4ND 3MBEB 2EXTA 4Z7WB 3T0VA 1BMGA 5T1DL 2R1XB 1FF5A 2P5EE 3HAEG 4KFMA 5E94A 1DEEA 5C07E 2XN9E 2ENPA 4XP1L 5GJSL 4HALA 2DD8H 4NC2B 4OTXH 5HHQB 1UWXH 3APDA 1OP3K 1BQ5A 2K45A 2WXIA 3NUKA 1CL7H 4GRMB 1P7KB 2Y5TA 4M7JH 1F1GA 1NC2D 3SYCA 2Z34A 4R4FL 1SN2A 3BGFB 3BGMA 3BMWA 4XWOD 4XPGL 1SVZA 1CXEA 2GK0A 2WVSA 5DD0L 4X5QA 2UYLB 2X70A 2NY0C 1BQHA 1HXMB 1ZS8A 4WFEE 5DWUH 3UYOD 3SCMC 4FQCL 4BKLA 4RAVB 5SX5H 4UIMB 3D51A 2NY4C 4ZSOE 3KPNA 1F02I 2J5LB 2FLRT 1QSED 2WVVA 4ACTA 1NEUA 1F90H 3DSFH 4HLZH 2R0LH 4OI7A 6PCYA 2JI2A 4UILL 3REWB 2L7JA 3RX9A 2J5WA 1P6FA 3MNDA 5D5ME 2J88L 3IU4L 3IFNL 3UCRA 3FTVA 1A6ZB 4CSSA 2VC2B 5GS0L 1QLFA 1CD1B 3FOMB 4YWGH 1MW2A 2NX5E 2CKBH 3VXTB 3O6KH 4TPRL 3BISA 3D3VA 4MX7A 3PY9A 4OSUL 2FJGA 2QADB 4WDIB 3DX7B 4ZUTB 2AQ3A 3ORJA 3D4ZA 3MGOB 4CSTA 4OZGE 3LPPA 5D2NE 4KRPC 1HXYA 3VNYA 5HD8C 5ESQA 5IJKA 2GFBB 2LW3A 2EDXA 5AOMA 3AITA 5A7BA 3CZFA 3GLEA 1RIHH 1HNYA 2ZUVA 2VDOL 1AE6L 4ZX4A 3ULSB 1WD8A 4P48A 4I3RL 3K2KA 4QRSB 5F3HB 1RUPL 3SJVD 3PL6C 2EH7L 3UTTB 1X4YA 5J6HB 4IDJH 1H3PL 1M2OA 3DOSB 5FS5A 5L0QB 2R23A 5JLZB 1LO4H 2YXVA 4C56A 1F3DJ 1QFUL 1EEUA 1RJCA 2VE6A 3ISWA 5E70A 3VG0H 3I9GH 1AI1H 4KQ4L 1XGTA 1CTNA 3ML8A 4K5PA 4UCFA 4DP7X 4N2NA 4ZZKA 4JG0H 3C60A 2OP4L 1KXQA 1OK0A 2C9QA 2YBRB 3IU3B 2YKLL 4OGYH 4JFPB 4G83A 3VGDA 3NEOA 3WXWL 4PS8A 1QTSA 1BBDH 5LCVA 3WN6A 3IJEB 4LCWB 4QRRD 1NFIB 4JFEB 4L8CB 3OM3B 3H9SE 5B8CA 4LVOC 3L3IA 2VXUL 3UTSE 4G82A 5FYLD 2C3GA 4FDWA 4PY8J 4ODXB 5L8LB 1OQOA 4L3EB 3ZGHA 2EUWA 4ATTA 1U95A 3ARBC 1OHZA 3RWFA 1TQBB 2VLRE 3SDDD 4J3OG 4D2NA 3DV6A 5AW7B 1F5WA 3EUUA 4X4KA 3FT4A 3D48R 3GBDA 1TEYA 9PCYA 3CN3A 1A1OA 2GTZB 3LH2L 2DDQL 1FNAA 4ADGA 3KGUA 5IHBA 1I9RH 3NJKA 2Z7ZA 4LSRH 3P73B 2BW4A 2YPVH 4X4ME 3VO0A 3HS9A 2HVKA 1DVFD 5FUCC 1MCOH 1QUNB 1NPUA 2FECL 2ZAGA 1QBLH 1F4XH 2VC2H 5ICUA 1E43A 1PPIA 4B5ZA 1I9IL 1J1OL 2P43B 2C4XA 2X2HA 4CSPA 2NY7H 2XV2A 4ZTOL 3AT9A 2HFEA 3FUJA 3VFMA 2JI3A 2QSCL 2VDLL 3QIBD 1C1EL 1F4YL 2VDNB 3AY4C 2CHXA 5IIEA 4LSQH 4R7NA 4XCEB 2Y07H 2OSLB 2VR8A 3TO4C 4S2SA 3O11A 5BZWB 3PQYE 2JMRA 3MMEA 1VAHA 4IEFA 2XVKA 4FQ1H 1KGJA 3LZFH 4PG2C 2JKWA 4YHOL 3S5ZA 1SYVA 4L3CA 4XP4H 4KK8D 2PCFB 4QT5A 4LASL 1DJSA 32C2A 1EXGA 3WEXA 3PJNA 4PJCE 2QDVA 3C9NA 4HU2A 4LLMB 1BIIA 3DHUA 2PXYA 1ZT1B 4AV0A 2YIHA 3ZHNA 5I76A 4NJAL 2WLHA 3PIQB 4GG8B 2ADYA 1J5DA 2MPAH 1S7VB 1FFPB 5AW8B 4UQBA 3HNVL 5D1XC 5BRZB 1DQIA 4RMQA 3TBBA 1ZHKB 2YXWA 3BAKA 4Y1AE 2VL5A 4QRUA 5D2LA 5BZDA 1NAKL 4KKCD 4W9LC 1LQSR 4X7TB 3UL4A 3X11A 4DKAA 1NCAH 5HGHB 3VXRE 1T89A 5JHLA 4AITA 2ADIB 3QIUC 1CDBA 2YOAA 3L5WA 4NUQA 4JFXA 2VZ1A 5F1NA 4RMVA 2MHAB 1YEWA 1O6SA 4I8DA 4LRNL 2CO7A 2LAAA 4N3TA 4UIKH 5A2KH 4Z7UF 1FL5B 1XB6A 2EDRA 1IBGH 1AP2A 5AWNH 2VZTA 3MROB 3IF1A 5GRVL 2NW3B 1E8XA 4FGMA 1R47A 3GMMA 4LPVA 3KHOA 3ZT6A 5GS0D 2AZUA 3H7BA 3QK0A 2QGDA 1JHKH 2ZG3A 4NQUA 4QRPD 5IMOA 4MNGB 4IRJA 1X5FA 4HF5H 4PJ8D 4K5MA 4FXGA 4PJ5D 4XNMA 5D7JA 5G5DA 4H8UA 4IBTA 2DQDL 1WBZA 2G75A 4F24A 2R29A 2F53A 3D0LA 3P2DA 4NOFA 2CAKA 4Q9QH 4XHJC 5HJGA 2R7EB 1PY9A 1ZIAA 2QELA 1PQZA 4QTIH 5DUBB 5GRUL 2ITCA 3GMNA 2FSEA 3MRRB 3R06B 2VDNH 2A1WL 4XPAH 3M46A 3GI9H 4AM0Q 1R17A 5EEVA 1OCOB 4HWNA 4DP1X 4JVPA 4ZMVA 3C12A 2EDWA 3PGFH 3M86A 1WG3A 3KDMB 3UAJD 4NRZB 3IJYA 4W9FC 5F8QC 2FR4B 4JQXC 5I0ZA 2Y7MA 2B1OA 1XR9A 3QUYC 2IBBA 2CLZA 3TA3D 4PJ7B 3UXFA 1AS6A 3KBFA 5EU3B 4BZ2H 4IOFD 1D5BB 1I1FB 4RISL 2BNUA 5CD5D 2R4SL 1KJ3H 2P5EA 4L4VE 1NGQH 5C07A 4PSRA 2XN9A 5DTFB 3S3CB 1BP3B 5DEJA 2CIIA 2V8LA 4HA1A 1Q1JH 1WPCA 4N1HB 3WN5A 3VD5A 3MRQB 2V9RA 5INCB 4QRTB 2IOIA 5DK2A 4FJ6A 1AR1D 4ALAC 5IHZB 2I24N 4EDXA 3UACA 2LFGA 3BYYA 3I2CL 4HIHA 1HHHB 3TO2A 3GSOB 5SX4H 2FL5B 1CN4A 4M61A 3S3JA 1XF5B 4ZW8A 4ETYA 2HTLD 4ZX6A 2HT2D 4Y9CA 4HXBL 5EZIH 4G1MB 4APXA 1G7LA 1LMIA 4ZSOA 1WK0A 3GEFA 2JQAA 2UY6A 4BSJA 4ZJ9A 3JWOC 5FF6B 2IGFH 3S34L 1QI5A 3PGCA 4BFIB 1YEHH 2R56L 4Z76A 5K9KB 3CZGA 1D5XA 1ZVHA 1PX4A 3AFLA 5F7UA 4WUKH 3BO8B 3CQFA 2NY2C 3MUHL 1EEQA 1KTBA 5D5MA 1I7TB 1Q9KB 3DVGB 2J6EH 2WKGA 4HCRH 2NX5A 3IDIA 1P69B 2L7QA 5GGVY 2IG2H 5F9WB 3ULUE 1GGUA 3DHMA 1R3KB 4RGNC 3O3AB 1W72A 5IP4A 3TGXA 3SHSA 1AACA 4A7TA 2X2JA 4W1TA 4M4RB 1P1VA 4RWYL 4ZMLA 4OZGA 5D2NA 5HDRA 4AYFA 1E4KC 2IPTL 4M9PA 1MCFA 3FU6A 1KTJA 2A9BA 2QVMA 2YAEA 3DOIA 3GSNA 4GKZB 2VIRB 4EVNB 2ZCLL 2FGWH 4P5KB 1GZPB 4E0RB 2B1AL 3LN9A 4GYBA 5B39B 3WFDL 4X99B 4UM9A 5ABAA 2DRUA 3FRPB 2IF7A 1N0XH 2A6KB 5AL0A 1HJCA 4HJUA 4JX0A 2ZYSA 4LSSL 3MZGB 3D69A 4Z95L 2ADGB 3TCXA 2ATPB 4KKBC 2Y2YA 4XI5C 4A6YB 2I5YL 4KU1A 4A66A 2J1YA 3FT9A 1A4CA 3QDME 4I87A 3AM8A 1N6VA 1A21A 2P49B 4G2AA 1ET8A 3IMRA 3P11L 4XCNA 2CH8A 1FN4A 5F1SA 5E9NA 3QORC 3M17A 1HHGA 5KVMC 5FKAB 4RRPM 1OB0A 3ASOB 2IPUK 3H9SA 2MCG1 4GSDL 3U7YH 3UTOA 2FO4A 3ZTDC 4HJ0C 2BSDA 5F6HJ 2E27H 4ZFQA 3B7RL 4KKQA 4KV5E 2KZ1B 4LEOA 1CGUA 5E8EA 2VLRA 1C7TA 3QNYB 1E27B 1T2QL 5GGQH 5T5FH 1NKOA 1MCIA 4TTDD 4YSRA 3CU7A 1KCWA 4BRVA 4YHKH 4ZUWB 4CU6A 4NN5C 5L2KE 1MHEB 4NC1C 4UQ2A 4YFLF 1BW8A 4X4MA 4ORZC 5AVSB 5J06A 5M94B 5C6PB 3U4EA 1B3JA 3QDHA 2WLKA 2TSBA 3EUDA 1NBCA 3F85A 4JO3L 3D34A 4BUHA 4J3OD 4FA8A 1U3HD 4KJWC 5HJDA 1XTLA 1LTXA 3HZMA 4Y4HC 3SBQA 2VERN 1FL6A 5TF1H 3NIDE 1HXKA 2APBA 3LNGA 4G8GD 4ZPVB 4ZUVA 5AYUH 3V5KA 2DIEA 2OZ4H 1ITCA 3QI9B 4MMXA 5HI5D 3O9WA 5BJTB 2CE6A 3NTCH 3PQYA 4O2FB 4OTXL 2E6JA 3DLQR 4BFFA 4CBPA 1U3YA 4AJWA 1UWEL 3GS0A 3K46A 4RH4A 3L7EB 1CL7L 3QG7H 4OFIA 4PTTA 4M7JL 2ICEB 4LP5A 3VI4B 3ZDXE 1VFAB 2DZEA 2VXSL 3GSXB 3NCJH 4PP2B 5F7FA 2YOCA 5IEHB 3F7VB 4PJCA 2XTLA 4MLIA 2YGPA 5DQDH 5TD4A 3SOBL 5DWUL 3ZYIA 4Z9KB 4A6YH 1J86A 1YN7B 2CO6B 5DZNA 4FL4C 2OTUB 5F9AC 4Y5YC 1BIHA 2CDFA 4M93B 1YY8B 3VRIB 5J11B 1XXFC 1F90L 1MHCA 3DX4A 3DSFL 1RSFA 1HL4A 4A04A 5JW4M 4OIFA 4N0CD 4EF3A 2HKAA 5EOCH 2J44A 3L7FA 3X14B 2AQNA 3VXRA 2WM0A 2UUDH 3IFLL 4MJ2A 3ARXA 1V3LA 1MNUL 2W59A 3HC4L 4BWUA 2R9HD 2VNCA 3N1FC 3BP5A 3DROB 1P5VA 3ES6A 4TOYL 2CKBL 1QSEE 2VMFA 3K6IA 5CGTA 3EH1A 1U0QA 5EUKB 5ESVA 3WUWB 5DDHB 4P2RB 5DHEA 4EI5A 4ZTPH 3UTZB 4NENB 3M7OA 4PJ9D 2R2BA 1XCTA 2XG5A 4FFVC 5DA0B 1JBJA 3X1BA 2N7AA 2EIZA 4UUJB 2GUOB 2X1OA 1ZA3A 4Y2DD 1CZ8H 1RIHL 3BP4B 3HG4A 4YDNA 1GY1A 4GIAA 3VI4F 5AAMC 4MAUL 1Z0NA 3BWUF 5JO5A 5EU6B 2JCCB 4NO3A 1KBVA 3S88H 1MN4A 5BV7B 4NQED 5E8OA 3KPTA 5ALCH 1BOYA 5FGCE 5CN1A 2G4EA 4N85A 4JANA 3GIVB 3VG0L 3WS3B 1N12A 4PR5B 1TZAA 3S37X 4F58H 2Z65C 4JG0L 5AOZA 4AM0A 1N0LB 2VLKB 1AJ7H 4CVZA 1JXKA 2JWYA 5J7CC 5C6TH 2WQ8A 3SJVE 4PB9L 5D1ZD 2LTQC 1BBDL 4GW1A 3B37A 4LPTA 2KPWA 3KHQA 3N40P 2JIXA 1QQDA 4EN3D 2BOBA 5E0QA 4MBOA 3LN4B 4IRSB 3QYCA 2IAMB 4PRHD 1G7JB 1YCSA 2FYVA 1G1YA 1FIEA 4IU3A 4DK3A 4OGQC 1NGZB 4L4VA 4L8DA 4LMQE 1OM3L 1QA9A 2TSAA 4UT9A 4NQVA 4NO0D 4UINH 3L08A 1LEGA 4X7CC 3FSOA 4QRRE 5C0BB 3K91A 2DYPD 4GBXD 1GGCH 1MI5D 2DH3A 2HLEB 3FKUS 1I9RL 5C9JA 2H2PC 4LSRL 2JE8A 2YPVL 3ATAA 3QVAA 5FYLE 1AQ8A 5EWIH 1BQRA 3EGXB 5G2NA 2FWUA 1F1DA 1MCOL 3MLSH 4YFDB 3V9CA 3ZX1A 2VC2L 2XXFA 3NPZB 4GLRI 3RLSA 3FO9A 5B8CB 1M7IA 2DS4A 4ESKA 1Z66A 2H4EA 3U4KA 2X10A 3AAZA 4UMSA 2HFTA 5DWPA 2W9DH 1NUGA 3VRLF 4HIEB 3KGSA 2Z3FA 2WLYA 4LF3A 3W0WB 1U8MA 3RE0A 5L9DH 3VGHA 3BN3B 1JGDA 4YXHL 1ICTA 2EZ0D 1MJ7L 1X5KA 4HW6A 1X4XA 1C5DB 2VM9A 4AXWA 4X4YA 2OZNA 1PKQB 1E6JH 4FQ1L 2OTWA 3LZFL 3ZL4H 4L0YA 4UAHA 1J5IA 1RUAL 3OR7A 5F7NC 5HPMB 4BSWB 2YWZA 3C6SB 3X12B 4MJ5B 2NYYC 3OB0K 1Q94B 3FQNA 4M7ZC 5D7KD 2WTPA 5BV7H 5DUPH 1U92B 3P3TA 3M1CA 1H19A 3W57A 1XVSA 2APTA 2L3BA 4HIXH 4QRAA 5H2BA 3IAGC 2VMJA 1OAQL 4KRNA 3RIFF 1VPOH 2JELH 1CDHA 2EDYA 3OGOE 3KYNA 4HULB 2YPKA 5MERB 1VZHA 2ZTBA 3SGKC 4NWTL 4EEEA 3LPOA 3C8HA 3D0VB 5SV4A 5IFJB 2Q2LA 2NUPA 5FOBA 2O61B 5I1JL 4PH8A 3HMXH 5HHNB 2ZKMX 5CEXA 3IVKB 1NCAL 2W0KA 4U2YA 4YS4A 3AXHA 3BKYL 5DGQA 5HGBB 3Q2NA 1W6LA 2ICWI 5D96B 1TQWA 2YSSB 3MJ9H 3VGAB 2WD0A 4DO6A 3VXNA 3QDMA 5DJXA 1XF3B 4UBDD 3P9MB 5IJKC 1PZBA 1CT8B 1N67A 3MRNB 5AWNL 1QG3A 1B2WH 4PU2A 2FYYA 1QFOA 3QUXD 4FQXA 3UMTA 4HH8A 3IE4A 2OV0A 5BMFH 1MCNA 1PY0A 3UZVB 4HF5L 4XNQA 2NXYC 4NM4H 2X4RA 5DJ0A 1SFHA 3JTTB 4X6DF 5HGAB 3CN2A 4Q9QL 3ZTNH 4TNVK 3O81A 3MBEC 5HGDA 1OB1B 3V9FA 2VR7A 1ZCRA 5DJYA 4J39A 2KI6A 4QRPE 4MXQD 2J4WH 3GI9L 2FAUA 1D5MB 3MREA 1TZGL 1ZLDA 3TFBA 4AH2A 5L2KA 4PJ5E 3IKKA 3EJRA 1X6LA 1PTZA 3MCKB 4OD2B 5FYJL 3VGBA 1R6VA 4LLVA 1YNLH 4JJ5B 2WC7A 3EYVB 1XL6A 4MA1C 2EILB 2B3IA 1FNFA 3AGWA 3MLWH 4TSBL 4DZBB 3CUPB 1KT2A 4FQIL 3G7TA 2GT9B 4JN2B 4C59B 2B20A 4AE1A 4BZ2L 3OGCB 4X6FB 5F9JB 1S46A 4XO3A 3CVBA 3II1A 2J5LC 1J9CT 1KJ3L 2YN3A 1YEGH 4KJQC 2H45A 5J3HD 3CSYA 4K2UL 1KB5H 5CZVL 3BFOA 1LNUB 1GJWA 3CVHB 3VJ6A 4B0MB 4BM7A 3B2VH 1A4AA 3LZQA 4HS6B 5E03A 3GSVB 1DUYA 3NPSC 3OF6A 5EIIG 4A1RA 3VG9C 2HUHA 4PJFE 4ZQTA 3G6DL 1M1SA 1URLA 2JV6A 1GGBH 4N2FA 2BP0A 3IKCB 1DHKA 3FONA 4LK4A 2UVEA 3N42F 1MWAB 2QR0A 2YD8A 4PBWD 1E5AA 2PO6C 5EC2B 3LZLA 1OCRB 2B59A 4XVSH 4Y9GA 3US9A 5HP5A 3GSUA 1E9OB 4HUCA 4K5OA 3CD4A 4PRID 1AKJB 4POZC 3VFUA 3T6WA 3FQYA 5IB4B 1A0QH 4E9SA 1O9VA 5FV2A 3S96B 3KDPB 1FNEA 1YEHL 5A3ID 4M8UA 2XY2A 5JHDA 3BCFA 4NKIH 1GXEA 4YSAA 1BM3L 1USZA 1VGKA 2QADD 1SJHA 3MRDB 4WUKL 3T71A 2UX7A 3ZE1E 2PXYC 3GS7A 4PB0H 3FU7A 3JWNE 4TQ8A 5I66A 2ZWKA 1B0RA 4L4TB 1QSEA 3X1EA 2A83B 4RGOL 3SKMA 1XH3A 3O0LA 4BQ8A 5DJCA 1PZCA 3IAQA 8CGTA 3TZVA 4HPHA 2IIJA 3ZKXB 4CADA 3CC1A 2Q8AH 2FATL 1DBKH 1S9WA 2PKDA 3UBXA 4JO2H 4MZ3A 3UTTD 3H53A 1T89C 1T6VN 2BWIA 2YS4A 1LQBC 3L81A 3C5ZD 2X87A 2ZWZA 1YA5A 2FGWL 3RNQB 1H6EA 4QYOB 2FQFA 1XX9C 4WK0B 2Q10A 1MY7A 5DHXB 1JNHB 2ZUYA 4AYGA 2Q7YA 1UXWA 2VW6A 2E9IA 3BUBA 5LUMA 4M6MH 3I9AA 4GAJH 4NO5A 1TQBC 3BKJH 4IOSA 3KM2A 4JHAH 4MKTA 1SOSA 4LCWD 1BWWA 4IRJC 3IDMB 4W9HC 4XCYA 1RJLB 3CN1A 3CVHH 4OCXL 4L3ED 4IMKA 5LBVA 5IR1B 3BRFA 1XSIA 3AG3B 3SJVA 3JVGA 5FA3A 4OV5B 4XMKL 4BHUI 3T2NH 1M2VB 1TZOA 3SKOA 2FD6L 3U7YL 5I0VA 4ZOAA 1JXFA 3MODL 3SDCB 1XGPA 2J8UA 4PRBB 1UADC 1UZ8B 2BHYA 1MWAH 1IGJB 3QG6B 5I71B 1FPTH 5MI0C 2B4CC 3JWDH 2O5ZH 4KC3B 1IB5A 1Q1PA 3NZ8B 4LVHB 4WSKA 4X8XA 4AEEA 4QRRA 3LMJL 3DX3A 4Z8FL 3U82B 3LYRA 1WAAF 1XGQA 2Y23A 5EH1A 3P4MB 3D39D 4GH7B 1KPVB 2BWDA 3TBVA 3VQLA 4A38A 5L8JB 3G08A 1QFWI 4HSQA 3T2QA 4MJ6B 1J9TA 3EGSA 2OL3B 2CUHA 2ZKHL 3G5ZA 3SDDA 4BE6A 3FHAA 2OJEA 1MFMA 1T1ZB 5FYJD 1NFDB 1OSZB 3MU3A 5TFSH 3WN5C 1CJYA 2HXAA 2CA3A 3QXWA 4GQZA 1AD9A 2UZYA 2JQMA 3OAWA 4ODVH 2YARA 4U1KA 5TF1L 1WBYB 4H8WC 3GTNA 5AYUL 4PLJD 1G0XA 1UD6A 2YEZA 4NUGH 5INDB 3GLAA 1DVFA 3NTCL 1E4WH 4MS6A 1G6RB 4PMFA 3O2VH 4ZNCD 3OJ2C 3SGEI 1FG9C 2H1LM 3G6JF 5EN2A 5BVJB 4JN1H 2ODHA 2YC1B 3KPQB 1AZVA 5IBLC 5B7MA 3TBSA 3QIBA 3MFFA 4HWUA 2IALA 2K4WA 3BDBA 1OL0A 5GRWA 2J6WA 4G8GE 5DQDL 2FBJH 4PHXA 4QRQA 4A6YL 4F2FA 1E65A 1BJMA 1Q9WA 2P28B 4ZUSA 1JZ7A 4A2MA 2EKJA 1PKOA 1RULL 3UBGA 2UZIL 4MB1A 3KLDA 3OKDB 1NUFA 5C3IA 4DPAX 3TESA 1JF1A 1T83A 1QSFB 2A6IB 4G42A 2YR3A 2CHNA 3U0TB 4RZKA 2A9NH 2A6JA 3CPUA 4N0UB 4TYUA 1T1WB 5J13B 2EEFA 1PZ2A 4MSWA 1AQDB 5EOCL 3WNKA 2IOOA 5I8KH 1KY7A 3HNSH 5EF2A 4GRWF 5EC1B 3VD1A 3FCGA 4G6KH 4ES8A 1EXUB 1VCAA 3P0YH 1XIWB 2XWTA 3F7PC 5D2NC 2WXQA 3GDCA 4XAKD 4QF1A 3LIZH 3V6OE 1GKOA 2J72A 1NFDF 1OGTA 2DY2A 4HUWA 4W9ZA 5JOFA 4ANXA 5FM8A 43CAB 2RCSL 3EFDL 3EOTH 2PW2B 1L9OA 1ZT7A 3TX4A 3TIEA 4YIQB 2FO1A 3T65B 3Q5YA 4GG6F 4J3UA 3GZOA 3I6GA 5EFIA 2IV9A 1N10A 4NT6A 3S36X 1JF5A 4P5SA 1CZ8L 5BUAA 4DK6A 5KYNA 5AVXB 2OL3H 5CLYA 1N5AB 3AM8C 4MQSB 3T1FA 3H85A 4BK5A 1HDMA 3BW9A 2FBRA 2G5BA 3S88L 2R4RH 5A2FA 1C08B 4WZ9A 1OVZA 3TPKA 1A02N 3O3BB 3CHSA 3NJFA 1RU9L 4WW2A 3ZOAA 4AGLA 3I02B 1X7QB 4QRPA 1D3CA 1DVXA 3D1MC 4NZUH 5LWYL 1HZHH 1WP6A 4ZT1A 4PJ5A 2DQHH 1UM4L 3ROOA 4F58L 2WY3B 3OPUA 2YN5A 3C2AL 1AJ7L 3U2SB 1G6RH 1U91B 2MIZA 2R83A 1S3RA 1TMCB 4IOIB 4N2EA 3RL2B 3T6XA 4AZUA 2RD0A 4NQEE 3CX5K 1DBAH 3OZ9H 1HN1A 1WBXA 3WE6B 1QHPA 4X7DC 3EYOA 2OMTB 3BI9X 2Y1VA 4AIZA 5I6XC 5GSRA 5C86A 5CLTA 3HS0A 4UT6L 4EN2A 3KPPB 2AJXH 2HJFA 5K9QG 4NX0A 3UAJA 4AEFA 3V8OA 3F65A 3KLHD 4UINL 1MUJA 4IU2B 4BFOA 3O2WL 2X4NB 4OCRH 3TTSA 4AQEB 3VW3H 3TA3A 5IF0B 3JZYA 5EWIL 4PRHE 4DGVL 2CU9A 1R5IB 1K4CB 1I8LA 3LDBB 3HHRB 5DLMH 5F9WC 4F57H 4MMXC 2E76C 4XH2A 3RJDA 2SODB 4WSJA 2WLZA 5EBMA 4YX2H 4AEHL 1MI5E 1NOAA 3MLYH 4EDWH 4UF7C 5LAXB 3NCYS 2V5SA 2B5IB 2X4QA 3TPUA 4QOKD 3FCTA 4JFUA 4W6XB 5C0GA 1E6JL 2OQJB 3MBWB 4YSTA 4HZLA 4EUPB 1URIA 3HAEA 4K7FA 3F64A 2WNWA 3WJMA 4IDLA 2V9UA 3V52L 4UTBL 1RZJL 1EEZA 4NIYE 2WXRA 4X5RA 4S1DC 3E6FB 3CVIH 1S9XA 1I53A 1JPST 4HIXL 3RL1A 3UFIA 1C12A 1VPOL 3EW3B 4JY6B 1SMOA 2HG5A 1BOGA 3NFPB 5IFAL 3D33A 4WUUB 4O2CB 3HMXL 2X41A 1IM9B 4Y4FB 5D7KE 2Y1AA 4GKNB 1XHHA 2CDGA 2PCYA 1GS7A 4MQTB 3MJ9L 4IJ3B 1Z9NA 1ZE3H 4NKOA 1T0OA 3N5AA 3VSVA 4EZKA 4U1IA 4R2GB 3ZN6A 3QGVA 1NUDA 3BH8A 3OC5A 4LE8A 5EDSA 3ARDB 1CD9B 1OV8A 1J8HA 2NUTB 4KNUA 4N0YH 2JTYA 3DK0A 3DTXA 4H20L 4PJEB 5IOPB 4L2YA 4KOBA 5LGJA 1D9KB 1M57B 1A7PH 3FTSA 3GINA 1PFOA 1AAJA 5BMFL 4E68A 2P7TB 3B9AA 2HN7A 4IK7A 5FKPA 5HTSA 2CM6A 4WW1B 2R59A 3K0YA 3PHSA 3QJRB 1W80A 2ROYA 3ZTNL 4J6IA 5BZZA 3WY1A 2KUTA 4G6JH 1HI6B 4JFVA 2BOLA 1E4HA 3P9WB 4MS8D 2DLTA 3MJ8A 1BZ9A 2AEPL 3FRUA 3GJEA 4ENED 1YECL 5JIMA 5KVGL 3JUYA 3QI9C 2J4WL 3ARFD 4AQ1B 3T8XA 5SWSE 4D3CH 4ODUB 5KJ4A 5J1AB 1ZSDA 3H42H 2GB2A 4RETB 4YGAB 3TONA 1GOHA 1Y1UA 2CBPA 2R1YA 4JFZH 1LE9A 3CDCA 4U4BA 4WNQB 4JHZA 4JDZB 1N8ZA 1HIMH 5E5MA 4EUPH 1TZ8A 4GQQA 2YFOA 3PNRB 4IBSA 2RBLA 5AENA 1REIA 1X7TA 1MJUL 1V5JA 2F1EA 5F72S 2GTWA 3FHQA 2HMID 5EEYA 1S5HB 4Y5XB 2GVYA 4NAQA 4P2OB 1YEGL 3S3SA 2R0ZH 2QGBA 3OX8B 1KB5L 4M93C 5J11C 3MRHA 2IAND 2DWTA 1KBGL 3B2VL 3QO1A 3AQXA 2X6MA 3WKNA 4YAQB 4HKZA 3CQPA 1WGOA 2WWMC 5HYSG 3QJVB 4NN7B 5IREA 1GTFA 1DDHA 2VZVA 1BWMA 4QIRA 4LIQH 4P4KA 2GCYA 2WN2A 1MCRA 3DXAE 3BSZL 2EYSA 2DKSA 2WSKA 4G8GA 1T0NB 5IKCA 3WNOA 4XVSL 3HCVB 1RZFH 5AVRB 3N40F 5KZCD 3UPRA 2ZF8A 4OZHB 2FEJA 2X0WA 1A0QL 2DMHA 3DIDA 3FCSA 1Z32X 3U36B 3CFTA 4ELKA 3T6ZA 3KXFA 3HG5A 4HHGA 4NKIL 1WA0X 3O45B 2J21A 2AJVH 3BE1L 5HYQB 4OVVA 3C6LB 3P3SA 3VXMD 1MNNA 5I15H 3FQWB 2IH1B 5EZLA 3DX6B 1CYWA 4PRIE 4PGBB 5KYWA 2VLMD 2WUBL 4BDVA 4NDMA 2YJQA 3NCEB 5B4MD 3V6OA 4JQVA 1YPZF 2CDEB 2XETA 4I4WA 1ZA6B 2JKSA 4K4KA 4I13B 2R0KH 3QXTA 4XMPL 2Q8AL 5BS0B 1HK6A 4UNIA 5BZXA 3RI5K 1MXDA 3U1SH 3GBMH 3K4AA 2WBWB 3LQAC 5EU6D 1GW0A 1MAKA 2YPLB 3LZRA 4OLZH 3HPJA 5F7DA 1JZ8A 4NM8L 3BOVA 3OG4B 5IMLA 3FH5A 2Y7QA 3E6HA 3EO0B 3V0IA 1O5DT 1AO7B 2W9EH 1GCFA 1WTGT 2VLKD 1A6WH 4X6CB 4LLDA 1E9QA 3BKJL 4PJ9A 1AYOA 7TAAA 1D7BA 4BINA 4JHAL 3UTTE 1F3JB 2MNUA 4Y2DA 3FU5A 1DL7H 3DBXA 5BNXD 3NP3A 3SE9H 1CD0A 5CFHA 2E9WA 2Z35B 2JQZA 4IRSD 1UATA 3QULB 4NSKB 3U6RB 3RKDD 4H0IA 4JHBA 2MTPA 5FFLA 1E8WA 2VITA 4J28A 4AEIL 3MLZL 4NQEA 4NHUA 1TTBA 4LGSB 1HTYA 4XMUA 5B8CC 1SDDB 1MWAL 4I0PD 4XN9A 3FQTB 4XRCB 3T08A 2RACA 3JWDL 2O5ZL 4L3EE 4FYSA 1B6DA 3H2WA 2C9XA 1E42A 43C9A 2X4SB 4N68A 5ISZD 4HS8H 4P2AA 2XIDA 2DEXX 5CD3B 3BD4A 3QPQC 2YAPA 1WA2X 2Z31C 1Z5LB 3IYLW 5CP3H 4EN3A 3GD1C 3GNML 3LS4H 3BT0A 4PRHA 1XSKA 5B7EA 2NNAB 3GBNH 2NDGA 4M3KB 2Y4SA 1IQWL 1MJJA 4Q9BA 3CC5A 2CO4A 3PDGA 4PW3A 2WXNA 3QQ9C 4MD4B 5TDPB 4HP5A 4LSVH 3EDJA 3LEXB 1VKXA 2DYPA 4GBXA 4CC4C 1NIFA 1TU2B 4W9IC 2MOVA 3D39E 4NUGL 4R4NC 1C5BH 5D7SL 3PPEA 4Z7UE 2H0PA 3AU0A 2HVJB 2EIEA 1TJHL 3ZSTA 1E4WL 2ZPKH 4N8VB 3OKEA 4PY8I 1RIUH 2DQEL 3O2VL 5CEYA 1RZKC 4YNYA 4L9LA 1ANUA 3KBEA 4CU7A 4JN1L 5FYJE 1QVOB 4UDUB 3ZE2F 5JZ7D 2OSWA 2Z4QA 5D96C 5F7HA 1DLHB 2P1YA 2X4PA 4L37A 4HSAC 2FBJL 1E50A 5I1LB 5F21B 2E6PA 3PP3H 3NA9H 3FTWA 2YAFA 2EO7A 1DQJB 1QRNA 5DJAB 3IMSA 5HVGB 3IE9A 2QGCA 5E2UL 4OM0L 5FO8A 4D9QD 3QA3B 1KEMH 5GS2D 4KITB 2FH8A 2XTJD 1UWFA 3U46B 3OMNB 1L0YA 4NLAA 4RSYA 3HNSL 4HH9A 5I8KL 5FO9A 1E3ZA 2BIPA 3K80A 4GJTB 5TDOA 5CCJA 4K23H 1A7BA 3TZVC 5IMKB 3MGTA 1A9BA 5EOTB 1FDLH 3P0YL 1PBYA 1P5UB 5BXFB 3OQ3B 1RZ8A 2VLLB 1U33A 3LIZL 3EO1B 2EDEA 2PABA 3PWLA 4AL8C 4UV7H 4IMLA 2DL2A 3LPGA 4H13C 1H8LA 1GIGH 1JZ2A 1S5IH 4YSPA 3TN0B 5IG7B 4P06A 4LSUL 2LT9A 3KBPA 4ADJA 2P8MA 4J4PD 4OD3L 1EZSA 2A38A 3A6OA 4XAKE 4D0DA 5FK9B 3QR2A 4IQHA 5CUSL 3EFOB 5E23A 1NDGA 1ZK5A 1G7QB 4XPTH 5C8JB 4YDJA 4IMKC 4NNXA 3H56A 4L8SB 2BK8A 4TVSa 3QUXA 5AZ2H 3ALWA 3UJTL 5FO7B 1AR2A 1NCTA 4XNDA 1BQLH 4RMSA 5SWSA 3L1EA 3Q43A 1YNTB 5IK3A 3FT3A 1SQ2N 3N04A 1G6RL 5JXED 5KG9A 1TYEB 4OCYH 2E7LA 1DQQB 1SJVA 3T2OA 1JK9A 3WMQA 4PJIF 2B3RA 4B6ZA 3OZ9L 1WFUA 1YY9D 5GIRA 3HBZA 1IGYA 3OPZH 3MN8A 4RZCB 5IEKB 3BLBA 3BT2H 2WYZA 5J6SA 1EVUA 1WZ1H 5E2WL 2F74B 4EQ2A 1FA4A 4TL5A 4ZUUA 2KQNA 4FFTA 2FT8A 2ZE0A 5AW6B 4WKZA 1OGSA 3NP4A 3SDDC 4YK4C 3M1OA 4OCRL 4DP4X 1B88A 3OXRA 5IROA 5IQLA 3FQUB 5B38G 4Q4EA 4P8QA 3KVPA 3N44F 3PWUA 4F9PC 5I2IA 4G8IB 3QDJB 3FTGA 3DXAA 4LCYA 3RZWA 3UDWA 3S48A 5DLML 4QD2E 1R3LA 5I1AB 1BVKB 1GY2A 2NY5L 3FN9A 3KYKH 3W9DA 1G9MH 3NJMA 1WC7B 4YX2L 5I19H 2BOCA 4EDWL 2IAAC 1W6WA 1MH5B 3MTRA 3LH9A 1OSPH 4WHDA 3ENEA 4OKDA 1KPRA 4WI9A 4L4TD 2LVCA 3DVIA 2Z64C 3DO4A 1UEMA 3B56A 3KL3A 4UI2A 3ABZA 5I5JA 3CX2A 5F6IC 3Q7JA 4LDLB 3O4LB 3GYRA 1AS8A 3Q6FB 3L4UA 4LBEB 5ACZA 2X7LA 1KIRB 4PRIA 1UWGL 1HHKB 2D3NA 2KKQA 1JD9A 1SQMA 2W38A 3ME0A 3D09A 3PHAA 3WKML 1SLUA 1T83C 2ZUQB 4HFUL 2WQAA 4UANA 5DS1A 2WLLB 3FUFA 4JPVL 4QOKE 1DE4B 2DBLH 3ARED 2AJZB 2CJUL 4JVUA 1H9VA 3H54A 1G6VK 3BEWA 3DX7A 1UVQB 5E4IA 2BC4A 4NP4H 3B2XA 5E08H 2NY3D 4QMEA 3UJIH 12E8H 2HJKA 2ENSA 1QPPA 4P23D 4GSXA 4BK8A 3G6AA 3DHPA 4AJVA 2APFA 4NPYA 3SDCC 1GS8A 1H5BC 1ZLEA 5E6IB 1BZQK 2DMKA 3NRFA 3ZO0A 3TT3L 1ZV2A 1M42A 1C7SA 2XBTA 4XZ4A 1AFVH 4F7EB 3W5NA 5E4EC 4O02B 3FUNA 3HC2A 4WHYH 5J6HA 3HI5H 3SDXB 1YDPB 1I1CA 3C5ZA 3FOLB 4N0YL 1PCSA 4JO1H 1S8DA 1GC1H 1A7PL 1N2RB 3CDZB 4QLRA 5CCKH 2W0PA 4KROC 4Q6IA 4ABVA 2QQLH 3DX1A 1JD7A 2EEAA 5FFGA 1ZGLA 4JMXA 2ZD0A 1J1PH 5JHAA 4F15C 4P5MB 5DZJA 5HY9A 1KLGA 3OWEA 1JTTA 4Z7IA 1S7SA 3APCA 5DD5H 1M7DB 2A4EA 3UGXA 1A6UL 1BJ1J 3NRQA 4L3EA 5F0LB 4FZEL 5I1HH 4JLRB 2H32B 4PRDB 4GS7B 2CR6A 1AC0A 2WXLA 3LKRB 5BCAA 2YA0A 3HR5B 3CFNA 2RA1A 2BSRA 5HJ3B 5EZJA 4RFEB 3BP6A 4K7PY 4LSDA 2R39A 1IEAA 2GJPA 2IDQA 4J1UB 1J87A 1RJZB 3E9TA 5DHVB 5DQJB 5E8NB 1HIML 3KPOB 1A6AA 2J2ZB 3SDAB 3DMMB 1NIAA 4HGWA 4JCLA 2AJ3B 5ICYA 2P24B 5FM5O 3EDFA 5JORA 4U1SA 1F1AA 2VM4A 3TASA 2C3VA 4BFNA 3LZPA 5G4NA 2IQAB 4NRYA 2ZXBA 1K5NB 5DJ8B 4PWFA 1G94A 4JRFA 3UH8A 1L9RA 4MXWH 4GT0A 4OD1H 3BFQG 3D39A 3SDXF 2R0ZL 2K6WA 4WI2A 4Z7UA 2QLYA 3KPMA 3KPRA 5LNEA 3D08A 5DVNA 2JKTM 2ZYRA 4X5WA 2BSSB 3ECBB 2CGYA 4LARL 1T5XA 5BZWA 4M8QA 5E1IA 5LAPA 5IZ7A 4QTFA 2IADB 1FH5H 4PJGF 1XIWC 4Y5VA 1QSFD 2PCFA 1IBDA 3VI4E 3UEQA 3QUMA 3HUJB 4JZNB 1LL1A 3CSPA 1RZFL 4O02H 2EUVA 2CK2A 2IANE 3GJFA 4XNZC 2WBJB 3KCPB 2CHZA 3INUH 2XZZA 2ATKA 1EO8H 2BY3A 4YUEL 4PVBA 2AJVL 2EXWD 4H44C 2J25A 2MCMA 4JHVA 4U1LB 1A3RH 1OAUH 1QFWH 3S36H 4E9VA 3CFBB 5GGSB 4E9YA 2XY1A 4YBQD 5I15L 3FSWA 5FX3A 2YD1A 3W9EA 3KH3A 4X0KA 3CHOA 4HU8A 3V6ZA 4PRAA 3QEGH 5ILTL 5HSFA 3Q3GB 2H32H 1L9TA 3U1SL 3GBML 4HQQL 4N4YB 1ECYA 1RKRA 3KG5A 3U0PA 1SOKA 2Z91B 4P57A 1L4IA 4OLZL 3S37L 3VXME 2WUCH 3VXOA 2NW3A 1G84A 1JHTB 3SGEH 3QJQB 4PPTA 2X53A 5DHVH 5F71A 3VFVB 1ETB1 2VLME 3QFGA 1UXSB 1LD9B 4XP5H 2W80C 3TF4A 2W9EL 4KX7A 1IX2A 4ISVA 4JBSA 5KSUB 1FAKT 2PWDA 3OTTA 3B2DC 1RJYA 1XZ0B 3HUJF 1R3HA 2R7EA 1UASA 5B1JA 3IT8D 4Z3EA 5AOKA 5ITFA 3W11D 2ZKYA 2B7DT 1YEJH 3SN6N 3N91A 3VRLE 1ASQA 4J8QA 3L2LA 3QJUB 1J0IA 4QHMB 1J0HA 3CFJA 4HXAL 3QC5X 4A37A 1MFBH 1OAYH 3FT1A 1DQKA 4XZUB 1ESOA 3BGAA 3BJ91 5IB1B 4KQ3H 3RWEB 1QO3B 3FZUD 5EN3A 5C0CE 3HW7A 1P7HL 4XO9A 3V7AG 3PHOB 4G8FA 5DLLA 3U0WL 4OGAD 5CSZB 3ARGB 4NGHL 1E4XH 4DN3H 4YQXL 5KSBF 1D5BA 4OY9A 2B5IC 1UFUA 4HS8L 4FULA 3O2DL 2H2SD 1CFNA 3HZYA 5DURD 1JJUA 1DVTA 3D4GA 2XN0A 2PPAA 3IGFA 3QUGA 5EG6C 5DYOA 1T20B 1CU4H 3UADA 4LQFH 2CKNA 4P59H 1M71A 1N3NB 4KVNH 4NC0B 3I6SA 4WTQA 5GGVH 4H8VA 3QRBA 1T4KB 4UMGA 4PJBB 1E28A 5CCHE 2CHDA 2XPGA 4G9DB 2GBTA 3J2PA 4RMRA 4LSVL 5ISZE 2IXQA 2AEIT 1M1XB 4RWHA 3WIHH 1JZFA 5GGRB 4AKOA 3B2PA 1C5BL 3OAUH 5EEZA 3R7QA 4XCCH 3HE7A 2DMCA 4P4KC 2D0FA 4AV4A 3Q05A 3VACA 3IN2A 5KVGE 1KTLA 4Y4FC 4BFIA 1HOCA 3OMIB 1ODAA 4ABUA 2KDYA 1SDAB 3SYAA 1NEPA 3H0TB 5DJZA 3DRQA 2JKNA 3WXVL 1BD2D 3GK8L 5I0YA 4QXTA 3THML 3F5WA 4TVPH 5KN5A 1N6QH 5IFHH 1CK0H 4X6DE 2AANA 1YJDL 1JS4A 4FQPA 4QOKA 5EIIA 3NA9L 1TKWB 4UOQA 3HPLB 4IHOA 3AQDA 4Y0GA 2ESVD 1OAXL 1KPUA 2LE9A 1JXJA 1I3GH 4TSCL 4TULH 4NO2A 4JFSA 3KAAA 4R2GD 3TEYA 2HH0H 3LZOA 2XNAA 3SO3C 4GKZA 4JQVC 4LNVA 2W8CA 3ARDD 3MA7B 3LVEA 5I6MA 3HZVA 1XF4B 3ETSA 4X6BA 4E0RA 5I8EA 1D9KD 4RDQF 1CICB 1DJYA 4N2HA 3VXPB 5F1OB 1JI1A 3BXNA 2XTJE 2XYCA 2PLTA 4ZMNA 4ORGA 1IE5A 5ICZA 4M1CC 4R97B 4H8PA 2WN3A 3HG2A 5IJBC 2FJUB 1S5IL 3FPYA 3QZPA 5SWQB 4WJ5B 4PV9A 3MV01 1G7MA 1BQUA 4IBVA 4JPWH 5FGBA 5DQ9A 2A74A 1MFEL 4PJ9C 3ROLB 4EI6A 5FKAA 5FEBA 2GSGB 4KJYA 2I9TB 4DN4H 1LK3H 3OHMB 4ZTEA 4ZNEE 1FVDB 4GUQA 3MPCA 1KYAA 2E8YA 4XPTL 2I07B 3LRMA 5AZ2L 2XJKA 4PV8A 2DQGL 4UQCA 4XNUH 1E27A 1PD6A 2QVFB 3L3HA 1IFHH 3FTXA 3RFZB 4PP1D 3RVXC 4HIIA 3QUZD 4X7SH 2HAZA 3GUTA 4FP8L 3IXTA 3RG1C 3ZE0B 1L3WA 1KBBA 4OCYL 2XVGA 3ALPA 4F8OA 4FABL 1JV2B 1PDKB 4P2OD 2ZQKA 1SBBA 3K5SA 3I6LD 3KWTA 3K5RA 4PTUB 3EH5B 4IGBD 5J12B 5CINH 1QABA 1IT9L 3BVVA 3KEDA 3ARFA 4JRXB 3KNBB 3OPZL 4XMTA 2VR5A 3DRTB 3T2PA 1QWNA 2A3TA 1WZ1L 4H25B 4Z7OF 3L48A 2BP5M 4IJTA 5T3XH 5I6OA 4BCXA 5DVOA 4HKJB 4TM9A 5A1AA 4IKKA 4LKXB 3QRGH 4BZYA 1AGEB 1JSYA 5FYJU 2X89A 4Z7QB 4F7CB 1QOKA 1PF3A 4D9LH 4GW5A 2XYBA 3GSQA 1PZ5B 3SKNB 3AY2A 3L1OH 4EOWH 4B95C 5J0BA 1JZ6A 5KS9B 5T5NF 1KTKE 2X38A 4X5PA 1FUNA 2IANA 1TTGA 1RIVL 4AVKA 4FMFA 2GC4C 5HI3D 1U8JB 1G9ML 3C6LD 2WZ0A 5I19L 4UT6A 3CFCL 5JOPD 2PR4H 4X98B 4L9LC 4L2LA 2CO6A 5EV7A 5I1IH 2Y06L 2X1XR 3RA7H 5GRXG 2VKWA 3MXWH 3ARTA 4CMMB 4GKSA 5ITBL 1SN0A 1TZHB 5FCUH 5BS0D 2WZPA 3IS1X 2ITDB 4NI3A 4O2EB 5CMAA 5C0AD 5MEQA 3BUYA 4JFOB 4U3HA 3ZHLA 4FF9A 2QKIB 3BPOB 3OXSA 3ULVH 2BSTB 1YC8A 2JJTA 3DROA 5JW4N 4Q2ZB 1KJ2B 4NQDB 5B1BB 3TJHD 1EUTA 1VFMA 5E6UB 1HCYA 4A2EA 3VXMA 4NP4L 5E08L 1P1ZA 3BZFA 5I24A 3UJIL 3QZWG 4ZYKB 12E8L 5LG1A 1LMKA 4Z7QF 2VXQH 1WAAE 1NQBA 4MMZB 3PFQA 3OLGA 4PCTA 1LO2H 4YGVA 5BOPA 3FUKA 4TNWK 1OAKL 2EC9T 1X44A 4Z6AT 3AGVA 1IBBA 2BNRD 1AFVL 3N6YA 4WI7A 1MFAH 4UTBA 1F4AA 3HI5L 3D9AH 1X5LA 3QJXA 2ID5A 1S2EA 2IFGA 4YSUA 1A1MA 1QLRA 4BFBD 2GUYA 1QASA 2PWEA 3H4HA 1GC1L 5CCKL 2RQEA 5CGBA 1R5VB 2QQLL 2ADFL 1KLUB 4AQ8A 3K81A 4PGCB 2VABB 3KLLA 4O00A 1IKNC 1KGYE 3G6JE 3EO9L 5C0CA 1KIQA 4LKCB 4LOUD 4JRYB 1HYRC 1AHWB 4HHAB 5CSBA 4P3DA 5HHMB 3ZTJG 4BFJA 1MREH 1P2CA 3MJGX 2BY1A 4GKLA 4RAUB 4IM8A 3LN4A 2KYIA 1K4DA 5I1HL 2IFFH 3B3IB 2BVEA 1SM3H 3Q1EA 2F54B 3G5XB 4L1SA 4B50A 4HK0A 4Y9BA 2MMXA 3AU1A 5J89A 3L9EA 3EJYC 5TGBB 4JM2F 4XO5A 1EHAA 5C0FB 4I0PA 3JVFC 5TPWH 3HI1B 5EBLB 5FR3A 2JI1A 2PP7A 1UGNA 4KTEL 5IBUB 4O51A 3V4PL 3GM0A 1YEIH 3L3GA 4C4KO 1NC4B 5EZOH 1IEBA 4GRWE 4AUJA 3U30C 3NFNA 1ZHBB 5ISZA 4NXSA 5TE7L 4GINA 5B3NA 3SE4A 3ESUF 1LWJA 1XGUA 3B9KD 1I4FB 1KJ2H 4NFCA 5IROC 2FBOJ 4M1DH 4ZFFB 1QTPA 1NFDE 4MWFA 2FJFB 4MB4A 4YH6A 3WHE0 3K6OA 3RAJH 1HL5A 4S1QH 4MQXC 3I6KA 2CRIA 2C9VA 4PGEB 1N59A 2HJLA 3KJ4B 3KYMA 4M6NL 3A6CH 2EEXA 4GG6E 2XQBH 4KKLD 1JPEA 3RI5F 5EF0A 1GSKA 5LDUA 1BFOA 1Q90A 4KAQH 4LHUB 3S0PA 4W68A 1D6VL 3IDYB 4X6DA 2HX8A 3D6GA 4O02L 4LGRB 4MMYB 3C5JA 4HC1H 1HHJA 4Y4KC 1W0WB 5KWYC 4TNGA 5T1KD 3D18B 1KJVB 3DDGA 4UQAA 5A2CA 4TUJA 1IM3A 3CXFA 4AVIA 1ADWA 2C1OA 3K8MA 5DJDA 1KB5A 1R5WB 1A7NH 3F01A 1OAUL 2TRYA 1OHQA 1QFWL 4JW3A 3A21A 5KVDH 1KB9K 1AGDA 3FQXB 4ODWA 2WANA 25C8H 3TH3T 2VR9A 4XNAA 1HYSD 1SOXA 1PX3A 2Z0BA 2FWSA 2VDQB 4L8SC 3QEGL 4KKZA 3BSZA 3TN0D 1YYMH 4MRBA 1WWAX 4RX4A 1UZGA 4LLQA 3T5WA 3ZU8A 1S6NA 1MRFL 5E1AB 1G1CA 1XF3A 4HUXA 5KBDA 4HBQA 3VFGL 2XC8A 2WUCL 3PAYA 4I18A 4XNYL 4G9FA 1PG7L 4LQ1A 5IUSA 1OPOA 2Y9RT 1ES0B 1BAWA 4WHCA 5BQ7A 4DO5A 2G3ZA 5C0IB 4ZNEA 1PD1A 2JJUA 4OLVH 1K8DA 3ZBMA 1TTAA 3C5ZC 2F7RA 4K73A 3E38A 2ZAIA 1OAZH 2BERA 4YHIB 4ZDHB 3TYFB 2PPDA 4A7GF 2UWEF 1T04B 4E42A 3W2DH 3S98A 3U2IA 4JDEB 4Q6IC 3LEYH 3BDXA 4LAQH 1YUHB 3RBGA 5TK4A 1YEJL 3ESOA 5TDNA 5HYJB 4J4PA 4QCIA 2EDTA 1UXLA 2GHWB 1MFBL 1OAYL 1NLDH 6TAAA 3MCKA 4RDQG 3BQUB 2H0FA 1NGPH 1FGVH 1JHLH 3GSRA 4O5LH 3BEVB 4HD9A 3BFWA 4P5TB 4U0RB 3MXVL 2IDUA 2IBZY 3FNKA 2OMVB 1Q0YH 4IBZA 1LP9B 4F93B 1P7QB 5A6LA 2QSVA 5EO0B 5JXEA 4DN3L 4XXWA 5IW6B 3RGVB 1JNNL 2BX5A 3P0VL 1YEDB 2IWKA 4OM1H 3O3EB 3BUDA 3S5LG 3UAEA 5BUGA 1CU4L 1P4IH 3GGWA 4HS6A 5EBWB 4P59L 2XI9A 3CDYA 3N0AA 4KVNL 1THCA 5DI8B 2C9RA 3X3FL 3Q8EA 4WWKB 1MCSA 1E5UI 3HG0A 3GMOA 2VDQH 2XJLA 2OMYA 3GHEH 1J9QA 2X9WA 2XA3A 3CLEH 1M05B 1MWAA 4F8NA 3HRZB 4BZ1H 3BHBA 4G43A 4OLXL 3WIHL 3PG2A 4R0LA 1N6UA 5KOVC 1F13A 3HLAB 4RIRB 2LVEA 3G5VB 3BSGA 3GSWA 3QEHA 3SPVA 4PW9A 1RPKA 1XR8A 3GLZA 1JZGA 2RH0A 4N8CL 4U6XA 4Y5VC 2HT4C 1HWWA 4CGUB 1E5BA 1PIFA 4M43H 5CJQL 4NZJA 4TVPL 5CBEB 1F6AB 1BLNA 4HMCA 2IBGA 4JZOA 5IFHL 3H8NA 1AGCA 2QVIA 4RA0C 4AZ8A 5HYSA 4OFYD 3VXQA 3MV9E 2ZP9A 2BVPA 3V0GA 4NQSB 4L1BA 1BXXA 3KW7A 5E6ID 3V79C 1T7ZA 3PGDA 2ZOKA 3TBTB 1SGKA 1U8IA