3NRFA

Crystal structure of an apag protein (pa1934) from pseudomonas aeruginosa pao1 at 1.50 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
DAVMVFARQGDKGSVSVGDKHFRTQAFKVRLVNAAKSEISLKNSCLVAQSAAGQSFRLDTVDEELTADTLKPGASVEGDAIFASEDDAVYGASLVRLSDRCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an ApaG protein (PA1934) from PSEUDOMONAS AERUGINOSA at 1.50 A resolution
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords ApaG protein
total genus 19
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3nrfA00
3SB3A 3NRFA
chains in the Genus database with same CATH superfamily
4DETA 1MVUB 1RULH 3ILPB 1J1XH 1N2RB 3Q8FA 4MWFA 1RZFL 3WTSA 3C5JA 2NNRA 1DN2A 1JOIA 3NCMA 1OSZB 1F3DJ 3ARUA 4G8GD 3RPIB 3JV6A 4FQLL 2BIQA 3NIDE 2ZWLT 3U30B 5DRXA 2G3NA 3GZQA 3HC3H 3V6FA 4LIQL 3MRLB 3EFFA 1Q38A 3NGBC 4LSPH 3S5LB 3VTMA 5IIEB 3EYVB 3MCLH 1E90A 3N43F 5KSVA 5DVPA 5EU6D 5SX4I 2EYTB 3OGCB 3GMMA 3U9UA 3ECWA 1E4KA 3AZUA 5FFGA 2F7IA 5L2KD 1KELL 4LHUD 2FIRT 3O0RH 4JVWA 3ULVH 5DDHB 4FA8A 3VFSA 2J7LA 3IMBA 2NY0C 3ZL4L 1TCMA 2BP3A 3S5LG 5FXCH 2GJZB 1GKEA 3I9GH 3PGFL 2OR9L 2F53D 4ENZA 2PKDA 4KUCD 4RGMC 2A83A 3UBFA 2CK2A 2R0KH 2BM3A 2ZKHH 3OKMB 4HQQH 3DYOA 2XWZA 4DAGH 4JM0A 1E65A 5DVKA 3FUFA 4KH9A 3BUTA 1PW3A 4KVNL 3W11C 4QCIA 3SYAA 1M71B 3HMXH 3AFLA 4FTDA 4ZAKA 4AI7A 4BEIA 1TT6A 5EZJB 1BD2D 2WWOA 4TSAH 5FM5M 3KDMB 3HC4H 4FQCL 4LVHB 4ZUWA 3IWUA 4KPHH 2IG2H 5CJ8A 5KSAC 3VFTB 2BNQA 3BZ4A 3BZDA 4TRPL 3VJ6A 1ND0B 3KLHC 2XI9A 4Z78B 2BHFA 2WTRB 1YEJH 4ZW6A 1JV5A 3T6VA 1IEHA 1D2OA 4YXHL 1DVFC 4MMXC 2AW2A 3Q43A 1DQQA 4ZZFA 2BNQD 1I7TA 4WKZA 1NCJA 5DZLA 4XCCH 5HDBB 2L7JA 5JQHC 3HB3D 3HLKA 3NPZB 1RZKH 4UT9L 5FM8A 3VNZA 5KBLA 1QR1A 1E0OB 1JNLL 4KKBD 3FL7A 4I3SH 1YAIA 2YD8A 1W0VB 4PJ9C 2NNFA 1G0DA 4F27A 3ZE0B 5LB1A 2CR6A 5K9QG 1GXEA 2ZXBA 3KE0A 4U3HA 2R2HB 4F1SA 3FUIA 3ULUF 2HVBA 2OR7A 5A2LH 5LJYH 3RTQD 2HN7A 1I9IH 5K9JL 3SQOL 4RGND 4O02H 2YAQA 3GSRA 3O2DH 4FTVA 3LB6D 4YDJA 1MFEH 5DYOA 3QEQD 2HFFA 3ZX1A 2A9NH 3MRCB 1NPUA 1QABA 2BCKA 4N0CD 4Z5RA 1PZ3A 4FQQA 3VXOA 1SHMA 2Y2TA 5M95B 3L3OC 5E99H 3PV7A 2OQJA 2MQCA 2JLPA 4C57C 3Q13A 2R4SL 4OF8A 4K7PX 3BQUA 1ZLVK 4RDQG 2HT4C 2IFGA 5D9SA 3MRNB 1CMOA 3DX7B 3CN1A 1MCHA 4O02A 1OARH 4LBEA 2P80D 2CHZA 3QP3A 1WYJA 1R24A 1DE4B 3VFMA 4ADJA 3EO1A 3MZGB 3TS8A 3QCTH 3OKOB 4EOWH 4GW4B 3EJJX 2V5RA 5HGAB 3T8XB 1PFCA 1G0XA 1TCRB 4KMTH 1X5IA 3CFKA 3CN4A 3ZY7A 4NRZA 2FYYB 5BOJA 3L9EA 1NL0H 1GZPB 4B7IA 3LPOA 1I3UA 2UVEA 4O2FB 5DYFA 2XJLA 5JPNC 4X80L 3TONA 4MJ5B 4FD0A 5IQMA 3VI4F 3LN9A 1FH2A 4Y9GA 2MPAL 4QCIB 2H8PA 3CFCH 1EDYA 3PFUA 1B4TA 3NIGB 5JOPD 4OV5B 1WIUA 3A24A 3RHWF 5JW3H 4G7SB 4X98A 5EN3A 1HESA 3HMXA 3L7EA 4JREC 3VCLB 2C9PA 1K8IB 3L4TA 4G7RB 4QWWC 1L0QA 2ZWZA 3WJMB 3L48A 4QNPE 1R3JB 4NZTL 5AB0A 3T1FB 2VC2H 3V95A 3AITA 3QDGD 4BFKA 1JPGA 4KJYB 2OBGA 4OGZA 1R3KB 3KL5A 1N70A 2JKWA 2PCPA 2ZX8A 4WTQA 1IM3A 4L8SC 4OZ4B 2XKNA 3GI9L 4P3DA 4UOW1 4YO0B 5D5MA 5LN8A 4Z7NE 1U8LB 3L3GA 2Y7MA 4HKZB 4XP6H 4PGCB 4LARL 1I9IL 4PJEF 2O5ZH 5HHME 4B60A 1XL4A 3IJSA 1BLIA 3LRKA 2P4AB 2AQRA 3LEXB 2Z4QA 4ADIA 2QSQA 2GY5A 3H9SA 4DKAA 2R1YB 5K9QI 1KEML 2G75A 2P43B 3OGOE 2XX0A 3TNMA 1NBYB 4F2EA 3ASOB 3VMOA 1BGXH 1IC5L 4U0RC 2CQVA 2EIDA 4K23L 4R4BB 5FCUH 2Z92A 3RIAK 2CRYA 4WV1C 4R8WH 4U1SA 4AM0A 3D85B 4AV0A 3QPQC 1DJWA 2CZNA 3L8QA 4IIQA 4JHUA 2J6EA 1HHJB 1XH0A 4WU5B 1WEJL 2P1YA 3TURA 4PRIE 4XVJH 5JW4Q 1VGKB 2J12B 2KQNA 4Y1AA 3WE6A 4AV4A 4FG4A 1IMHC 1L4IA 2FT6A 3BD4A 2VDNB 1DVYA 4LP4A 2JF1A 4R0LC 3HPLB 4APQB 5TE6L 1JPST 2AEQH 3NJXA 1CFQB 3QUYC 4EDXB 4Z7WA 3F58L 4OCMC 2K8QA 1JZ7A 4Q4IA 3MBEB 3ATFA 4S1SL 4XGZB 3LNHA 4Y19B 5EUOE 2OMTB 1D7DA 2ERJC 4GKZA 2OMWA 1SJEB 3O2VH 2OA9A 3D0VB 1XH3B 4LSQH 1DUZA 4NPYA 1KPUA 4PJ9D 3B9VA 1VGEL 4NQSA 5KYWA 3EGSB 5GGUA 4JM4H 1A6VL 1SVCP 1IBGH 2QR0B 3ARGB 4MQTB 4A68A 3KEHA 2F74B 2K7QA 5HYQA 3FO1A 3B2XA 3P9MA 2WCGA 2HT3D 2NOYA 3ZO0A 1KSRA 4NLHA 2AK4A 4WNJA 1OALA 4M7LT 1ORSA 3TH2T 2Z31B 5KVGL 2GTWA 2HJKA 1EX0A 1IAMA 2J72A 2OPCA 4ODWA 4PJXB 5E9DD 4TXVB 3INOA 4H1LG 3NSYA 4RMSA 4XBMA 4LLYA 4XMVA 1C7SA 2CO7B 2XKNB 4OD3H 4P3DB 5D5MB 5IB2B 4JPSA 4D9QD 5DUBA 5DS1A 1YPZB 2EZ0D 3S34L 3V4PB 4ERSL 1RZFH 4PJFF 2FATL 1EUTA 1MHEB 4D8OA 5IW1A 5CZVH 4I0PC 4AYBA 2EVJA 1NCCL 1ORQB 4A7TA 2X5PA 4OV6F 4PJDE 1P9MC 3UTZB 1KB5L 1DP0A 3HC0A 4GUPA 4XN9A 5I8OH 3I6KB 4HZLA 2XZQL 4WGWB 1KV3A 3U7YH 1QZNA 4EQ2A 3ZDXF 2R1WA 1JFQH 4L8SA 3P77A 3VGDA 5BMFH 1O6TA 5I8CB 2JIXA 2DQIL 1MI5A 5L2KE 1X7QA 4HDIB 3LRLA 4XNQB 4TS6A 3QRGH 5F88A 3EXJA 3MBEC 4IU3A 4HG4K 3G5ZA 3V9CA 2QV4A 3ZDZE 4AITA 1EXGA 4ZDHA 3VGFA 3LRHA 2X1WL 2AV7A 3NQKA 3ES6A 1UQSA 3VMNA 3I50H 3G08B 3R1GL 5L88L 4PJBE 1G7LA 2E9JA 1USQA 3PNRB 4LLQA 3OKLA 2GK0A 5IEKA 4KTDL 1WJ3A 3QIWB 1FGNH 1SQMA 1UURA 3V6OC 5C09E 5JUEH 5DJ8A 4HBCL 4P2QE 5TPWH 1DVSA 1DQLL 5SWZB 4L9LB 2XDHA 3RWCA 2YBGA 3QIUC 4ORGB 4ONGH 4Z7WF 5TH2B 4XNUH 3VRJA 1HHGA 3VH8G 3FPYA 3O2VL 1OF2A 1JP5A 4KK8C 4YGVB 3EJZC 4M03A 4UTCA 1IGYB 3DUHA 4KK6C 4JFFE 1SDDA 3GSOB 2ADIA 1F3RB 5EBGA 1FO0L 3DYPA 3LN4B 4Y4FC 3DX7A 4ABVA 5IESL 5H37H 1IQWL 1XD1A 2B2XL 3OHXA 4H8UA 4QXGH 5C0BB 4GFXA 3SE6A 5I1DA 3BQUC 5CBEA 4LLVA 1RK1A 1U9KA 1M7IA 3IS1X 3CBRA 3KR3L 4RGOL 4BZ2L 5I8KL 3KDPB 1WEJH 1CDGA 1MJUH 4A7UA 8FABB 2X6UA 1DBJL 3CZNA 4GAJH 3TESA 4MNQB 4PYHA 4UOZA 4UNVA 5FB8A 1FO0B 1IGJB 2AC0A 3B9KC 3JVGC 2F7RA 1MW0A 5FX3A 4Z3GA 3VW3L 2MCAA 4RNRA 2AAAA 2ZTBA 5IW6B 3P73B 1KGWA 1OVZA 1JYVA 4WRLA 3H2PA 2UV3A 4J2XA 43C9A 2HTKD 2YPKA 3QEQA 1QR4A 1I3GL 2RMNA 1HXMA 2P42B 4N8PA 2E74C 1YNTB 2YA0A 3ALXA 4MNGB 3PABA 3UZVB 1T5WB 2QSTA 4NOFA 2CKBB 2HCZX 4Y16C 4OZIB 2YAOA 3FCTA 1DCLA 5IUSA 3KH3A 3F62A 4JM2A 5DK2B 1JNJA 5F7LB 5DFVD 3UGXA 1NJ9A 3MUUA 1BLNB 1QVOB 4JJHA 5JYMA 1MI5E 5L2KA 3AXHA 1NFKA 5GJSH 3GBDA 3ZT6A 1J48A 1FNFA 1ZV5A 2KDGA 3W1ZA 1CJYA 2VE6B 1JRHL 4LHJB 4K71C 3FDWA 1H19A 4XZUB 5CZXD 4BDVB 1D5IL 1J5IA 4Q97A 4HUNB 1T04B 5CMAB 2O61B 3KPSE 1MHHA 4XNQA 2VN5A 4R4FH 4NOBA 2EH7L 4H1LA 1RZPA 3UAAA 3MLRH 5DZ9A 3KW7A 1TJIL 4G6ML 2WYHA 1CDYA 3UBGA 1YEGL 5KZCB 4D0DA 3RL2B 1NBYA 3MA9L 4PVLA 3G6AA 1MW2A 2GSIA 3RIFF 2O1AA 1OTSD 3OMZA 3NRQA 3TCLB 2N59A 3OM3B 4AYGA 1WFIA 4WFED 1EIBA 1RIHL 2R1XA 4KX7A 3U4KA 3QFDA 3TBWA 4U1SB 1O6SB 1NSNL 2QFRA 4JAMB 4UAHA 3H42L 4S1RL 3SE3C 1LO3H 5FECB 4PD4K 3P3RA 4NNPL 3BP6A 4EOWL 5I0DA 5JOEA 1TTGA 1ZGLB 2HKHH 4I8DA 4FDWA 4P4KA 4HD9A 4K07A 4AEIL 4PUBL 4Z76A 1A1MA 2VUKA 2YJQA 4G9FD 2CBOA 4XRCB 2ED8A 2X41A 1ES0A 1Q0XL 2WXNA 4V2CB 4N2MA 4FQ1H 5D7JC 4JFEB 4WNQB 5GS3A 1N5YH 3BUBA 3E7JA 3A21A 2W9DH 4GG8B 1BSIA 3QORB 1L7IL 3WXVL 3BP7A 1T7WA 3QO1B 5D1QA 2O5XH 3I9PA 4F7TB 4Z77B 1U8KB 2ZP9A 4P57A 1SLVA 1KCVH 1ACYL 1WP6A 4XNBA 1FORL 3HE7C 3SDCC 4JFOA 3Q2NA 4YE0A 2CLVB 3ATAA 3OKKB 1WZMA 1FZKA 4I48B 2DEWX 3BXNB 1TQTA 1MFEL 3Q2LA 1BX2B 1HL4A 1OSPL 5INDA 3L1EA 3PWNA 2NZIA 3K0WA 2PF6A 2VGLM 4NYLA 5G5DB 3VXUE 2P8PB 4YHOL 5FV1L 4W9GC 5ISZA 1J1OH 5E4AA 2CDFA 4G7VL 4M93C 4CGUB 3DO4A 3A0OA 2FL5B 3FO2A 3JWNG 3VE0A 3IU3B 1OZTG 3BGFB 5GS0L 3GKWH 1BLNA 1A1OB 4QTFA 3V4VH 3GINA 3NRFA 1KGCD 1WS7A 3II2A 4JZNB 4LCWB 4M8QA 4AUUA 1SMDA 3PHOB 5BOPA 3CZLA 4IDJL 1B9KA 4A6YH 1T1WA 1YEDA 5GGQL 3S2AA 1T7YA 2KKQA 4PI2A 1ZV2A 3ARGC 3QSKB 5AWNL 5F1NB 2N56A 2VUYA 1KXTB 1B3JA 3EOAA 4OQTH 4W9IC 3P0YL 4A04A 1EGJH 3MLXH 4QTHA 1L9OA 1PX3A 2AJUH 2BS71 3RY5A 4M9PA 3P3UA 2YEVB 2ZCHH 4X5WA 3NJJA 3RVWD 3NFSL 3U25A 4EBQL 3G6AB 1OP3H 5F9OL 2CIKB 1K5NA 4OD1H 3SPJA 5CCGE 1SYSB 5EU5A 2VAAA 4UU9B 1D5BB 3SQBB 1RJCA 1BJ1J 3BWAB 1ET8A 3APDA 2DD8L 3GRBA 5KSBB 5IQNA 4JN1L 3ZKNC 1KJ2H 3ARFD 4HIPA 3UEZA 1G5GA 2NX5B 5E5RB 3U6RB 1ZLUK 1T03L 1E5UI 4I3RL 2AV1B 2CH8A 1G7PA 2XIIA 3CIAA 5GGVH 1U4FA 1TTRA 2RCSH 3D39A 4A2HA 1L7TH 5KSUB 2NSMA 3VG0L 4YHNB 3K6DA 1XGUA 5EEZA 3QORA 3CGTA 1JWUB 2IH9A 2HJLB 1RUPL 5ILTH 3CFTA 25C8L 3DI2B 1P69B 3F58H 3JWNC 1QBLH 4LSPL 3L3HB 4NO5A 3V7AG 1QUPA 4PRNB 1N2RA 5J12C 5G4NA 1U95B 3Q8CA 4ZUUA 3G5YB 1H8OA 1PX8A 2FO4A 4HGWA 1JZDC 2KQMA 4LHUB 3O4LD 5GGQH 1S46A 3HEIB 4X80H 3D7PA 4XAKD 1H3WM 5AENA 3B2VL 4KRPD 5EUOF 3BGMB 1H3VA 2Q3AA 1SEBA 4BKLB 2JJTA 4OZHF 4L8DB 4QRQB 5FF6B 4X5PA 5C0AD 2WXLA 2CDFB 5IQOA 4Y2DB 1D5XB 2UZPA 2VIRA 1CIUA 4K23H 5J11C 5GS0H 3V4UL 3FF8A 1XBDA 1A4KB 1HS6A 1FJ1A 2UWEA 4U49A 4Y5YA 3RUGE 5FIEA 3HHRB 1JZHA 5TK4A 1IAOB 3GB7B 3TF4A 1KB9J 2WO2B 2XN9B 3FQTB 2G5BB 2GBTA 4PJ8A 4YO0A 5ENWA 4ETQA 3EUUA 5J57B 2JV6A 1AGFB 4PBDA 1JGDB 2L7EA 1QW8A 2A83B 5PAZA 5LQBL 1XH2A 2R2BB 4BK5C 3H3BC 4LVNB 1FRGL 4WO4D 1H3TA 1AVAA 5JIHA 3CXDH 4MQSB 1MY5A 1XMEB 5TQ2H 4KC3B 3SD2A 2BSRA 1OAKL 4NQDA 3KLKA 1WWCA 3PABB 1Q9WB 2J1XA 3GMRA 4UINH 4BH8B 3GUTB 2AK4D 4KI5D 3QUMB 4XMUA 1J0ZA 3ULSA 2IGFH 3CFBA 1N8ZA 2VH5H 3CSTA 5FO9B 3RPBA 1H6FA 4L29A 5JOFB 1I7RA 4D9RE 1WG3A 2VABB 3E8VA 1FIGL 1KN4H 2ITEA 4LCYB 3GEWB 1JPTH 3LQAL 2I07B 3Q8AA 2PPCA 4XNMB 4B50A 2P5WB 3OAZK 4IRZH 1PYWA 3QYMA 4V1DB 1DO6A 3O0LA 1A8JH 1BZEA 5HYFA 3N3EA 1R5WB 1J0HA 1HTYA 5DRZA 4OLXH 4HK3N 1DN0A 1KIQA 3NFPB 4J4PA 3RX7A 4I0KA 4XWGL 1KTRL 1U95A 2VDRH 5E95B 4YHPA 4ZUUB 3LD8C 3M86A 2ICWI 2ITDA 1MNUH 3JV4A 1HWHB 1UT1A 2HFFB 3DMMD 2A1WL 3BMWA 4M6NL 3FAXA 2EDBA 4MCZB 5T3XE 1JZ8A 4PP2B 5ILTL 1JWUA 3DBXA 3ERXA 5DEJA 5EFIA 1XDTT 1ZXQA 1INDL 2PPEA 2X88A 1E4XL 3V5DB 1L7TL 1OT1A 5I1HL 3OG6B 2NY0B 2GJJA 3KL3A 5KOVC 1SJVA 4GQQA 3ZZSA 3OB0K 5KBNC 4HAKA 4XP4H 5EHFA 1ZLWH 5HYSA 1B4JL 3IBEA 1UACL 5IBUG 2HFGL 1UD3A 2YXMA 3IFOA 1F3DH 2FBOJ 2HG0A 2Q9OA 3VWKD 1VSCA 3S2CA 1CLZH 4LVOC 5CN2A 4I7ZC 4K3EL 1FGVL 2IANB 3CXHK 3EO1B 4GG8A 4X5LA 2C3VA 4OFVA 1EEYA 3P4MB 4WI4A 1JZEA 1BZ7A 1QRNE 4Y2DA 3HR6A 5SX5K 3EYQD 4JPWL 1IUZA 3UJIH 4YSOA 2R29H 1M56B 7CGTA 3WTTA 2XA8L 4ISVB 3MA7A 3IEAA 5T3ZD 2VXQH 4DZBA 4M7ZC 4NWTH 5IVXE 1M6OA 4BRJA 4RGMB 4DCQA 1HVXA 1T89C 1CVSC 3MRMB 4GAJL 2A9CA 5D93B 3TBTA 5MEOA 1R0AH 1SF5A 2B5IB 3K5SA 1YN6A 1N0LB 2VLLA 3MV9E 3VXTA 3HI6H 3S7GA 3EOBA 2ZWKA 3S3JA 1E4WL 4GQRA 4OGXL 1KYUA 4G72B 5TGBA 2BVPA 3VXRE 4HS6B 2VQ1B 5C97A 1F8TL 1UYWH 1NOAA 4MQXC 2VW4A 3S3BB 3GO1H 3WNJA 4DPBX 3ME0A 1NGQH 4ONHB 1AXSA 4A7GF 3QHTC 5D1ZC 3VFVB 4JZJA 3WIIH 5T1LA 4AVJA 1XGQB 1COBA 5HBBA 5TDOB 1JPSH 1JTOA 4Q2ZA 3CU7A 2C3XA 5A40E 2IALB 5MEND 2MOQA 3TTYA 5F1IB 1MDAA 3CK0L 1R5WA 2VSDA 4YDMA 5ADOL 1ESOA 4HPYH 1WCBB 4Z7OF 2ZCLH 2HT2C 4QRTB 1IJ9A 3AT0A 4WY7L 1FGNL 5JYLA 7FABH 2GFBA 5BXFA 4LPWA 2ARWA 4QHLB 1SY6L 3V8OA 3QZWG 4Y88A 1VZIA 3FN0H 3GRWL 3MLYH 4ORGA 1QRNA 4ZOCA 5ANHA 3UO1L 2NXZD 5DRNA 4KNUA 1T0OA 5CFHA 1WZ1L 3K2UL 1HCZA 4WZ9A 5IHHA 3E3QE 1G7HB 4K55A 2WNKA 1J9QA 4UQAA 5HVHC 1KYOK 4ANVA 5SWZD 3NIFB 2XY2A 3IDUA 4IBTA 3MUHL 3T2QA 4NIKB 5LBSH 1G9EA 4AGNA 4JFHE 2Z4TA 4P23B 1R3HB 4JO1L 3ZXAC 2J25A 5MHSE 1ZWIA 3S88L 3A5VA 4MMZB 1AD0B 1E5YA 2HVJA 4CMMA 1QP1A 3FUMA 3C8KB 3PNWB 4LZKA 5I8OL 2X9XA 4DGVH 5H35A 2O4EA 1QEWB 3WFBL 3KEDA 1XR8A 2YR3A 5AAPA 3L2MA 1GAFH 2DQHL 4AWJC 1GZQB 2CR0A 2VM9A 1TQCB 1KLFB 3CLEH 4NQSB 4N9GB 3WS3A 2R51A 4HGMA 3RNQA 2VLMD 1NDTA 5DEZA 2EH7H 2WUBH 3MRMA 3UAEA 2WGNB 5B22A 4YHKL 2VXQA 1EGJA 1CGTA 3SPGA 5IGXH 4ZX3A 4PW4A 4GKLA 3FB6B 4GSXA 4IIQC 4XO5A 3MA7B 1XEUA 4LMQI 3WDHA 2W95A 4Z7UE 5EV7A 1QVOA 1MWAA 3P0VH 3NIFF 5JORA 4EI6A 4MQ7B 1LMKA 4U05A 1FIEA 1TZGH 4LLYB 3VXMA 3GB7A 2EUXA 4AX3A 1PNDA 1UWXK 3V0IA 3CZJA 5FDWA 5C0DB 1BQHA 4YOKA 3BPOC 2WY3B 1JSYA 2D3LA 4P04A 4F91B 1NMAH 3O6FA 4NNXB 1U8HA 1Z7JA 2WKOA 4KK8D 3K8MA 1DANT 5F9WB 3OD3A 3X11B 4MA1B 1BAWA 1M1XA 4PGBB 3WIIL 4J1UA 1WTGT 5JHAA 3RDTD 4N86A 2WVVA 35C8H 5JW4N 1RZKC 1BQLL 2X2JA 4JR9L 4XE5B 5HHQA 2ROXA 4HKXB 4HIEA 4TUOA 1KJ3H 2WXOA 2WLJA 1T0NA 2EIBA 1KWGA 1TFPA 4Q0XL 3D3VA 5KVFE 5HY9B 3NDYE 4F7MB 1G1KA 3LCYA 2WN3A 3J2PA 1X5JA 3ENEA 5DRWA 1ZS8B 1IJNA 2CJUL 3U1PA 1I1CA 3ZE1E 5C8JA 4K7FB 5I1IH 5D8JL 4ZFZB 1I9JH 4HX1A 4CDGC 5LDUA 3BISA 4ELMF 5E5LA 4NZDA 1DQDH 1C5DB 1DBKH 3H7LA 1B4LA 3CVIH 3MFGB 3Q8EA 2YGPA 4LLUA 4AYFB 2C9VA 2EIZB 2RBLA 4OVUA 5C0ND 2OK0L 1W2KT 1DJGA 4BFRA 1ADQH 6PCYA 3R06B 4WO0A 4U7SA 3FRUB 3N1QC 2ICWA 3QIBA 5C1MB 4I9WD 4PJGF 3BSZL 4RFNB 4GI9A 1FFNA 1NMAL 3VD4A 1NEZG 3GRWA 1CYXA 3MRKB 1SOQA 3M45A 4KMQA 4YHPB 2VM4A 4E9TA 4C59B 1NCAH 4EZKA 1HEZB 3QORD 4W68A 3PPSA 4AL8L 3D4GA 4W93A 3SCMD 3SPVA 1I7UB 4M1CD 4QHNB 5A3IC 4GB9A 1QSEE 5DO2D 3L4WA 4L4VD 1AG6A 2P3YA 3IF1B 1AO7B 5K39A 1IGTB 4L4VB 3NH7L 1YNKH 1ZT1B 5HYSB 4PJDB 3W9DA 5I74B 5BPPA 2DDQH 1FUNA 5I73C 2WWKT 3OZ9L 3V4PA 3C6LB 4PMFA 4OM1H 4NRYA 5JHDE 3GJEB 3BSGA 1N3NA 1OV8A 1NM4A 3QIWD 2YEZB 1E28B 3KCPB 3QFJE 2ODIA 3WJMA 2L3BA 5KS9E 3UIYA 2J57A 5C08E 2CCLA 4XVSH 4Y5VB 5E03A 4KK9C 1AZUA 4MYWB 3EOYG 3PHQA 3QFJD 4KKLC 2WQSA 1MCOH 3FONB 4B9ZA 2H6UA 1OGAA 4G11A 4G8GA 4LLWB 4Y19E 1LD9B 2G3ZA 1EQWA 43C9B 3QUZC 3E2HC 1JZIA 4UWQB 4CMHB 3KHQA 4NKIL 5DU7A 3QULB 2N4IA 2WKLA 1NGWB 1YLBB 1X7QB 4HDIA 3UZVA 1YMME 2QPEB 1L0PA 4LCUB 3KPLA 3NVQA 3DKHA 2UXTA 2XYBA 3ZE0E 4PGZA 3OKNB 2K78A 4LCVA 3HZVB 3U0WH 5C09B 4S1QL 3KLHD 4H5SA 5HGGS 1LDPL 2GIMA 2AV7B 1DBBL 3VRLF 1HIML 4UMGA 2OJEA 4RMRA 3UYOD 2VDPL 5EU6E 4WFFD 3NRPA 4FI7A 3FW6A 3OV6A 3AWFA 5IMKA 2ZNXA 4HOMA 1A6AB 3GTVA 5KBKA 2D31B 4N2EA 3BIKB 3L3OB 5D7HA 3C6SB 3SQOH 3LIUA 2CRZA 2JFCA 4W9CC 3MLSH 4GG6F 5DC0A 43CAA 3X3FL 4MVBC 3Q48A 2ZX5A 3G5YA 4UDTA 3RJOA 5E2VL 5TH2A 5H2BA 2FJFB 2XIDA 1HHHA 3VRJB 3A67H 3VXQB 1HJCA 1J1PH 1HL9A 5CNHA 4FEIA 3CFNA 3HW7A 5GGTL 3PS6A 3GQFA 2HJLA 2AJYH 3HS0B 1NCNA 3Q2CA 1F8TH 1CURA 1JZJA 3AADB 4LOEA 5HHOA 4K94H 2YS4A 3MLTA 5JIQA 3POHA 1PVHA 1EO8H 1IIKA 4H8WC 4J3VA 4QY8A 4PJIB 3DVIA 1DJYA 4CU8A 1KDIA 1S5HB 3O9WA 5I1JH 3HE6C 4TRPH 1KJMB 4NHCL 4YNYB 5MENE 2W8CA 3CVHL 1ETZB 3UYRH 3FB5A 3BEVA 1JYNA 3UMTA 5BW7C 3RWFB 1HL8A 3E2HB 3ZSTA 3TCXA 2ZYHA 3WTUA 4FQJL 4KZDH 2PTTA 1UH3A 4F57H 1U6AH 4N0UB 4HOZA 2AITA 3NTCL 2VIRB 5C3IA 3RQ3A 1CFSA 4LPCA 5HVGB 2WQUA 2BSBA 3MV8D 4FJ6A 4ATTA 4CKQA 1YC7A 1RJYB 3MJ9H 2Q8BL 5JLZA 2DEYX 2PNDA 4XVOA 1P7KB 4QI3A 3S0PA 4UT6A 5HHXH 5CP7B 2JQZA 2KZ1B 4L4JA 3TT3H 1UASA 1UCTA 1KULA 4N90D 5I19L 1BD2B 3MLVH 3TIDA 5G5DA 1DBMH 4GBXB 2KT6A 2VC2B 4P4KD 2DYPB 1HZLA 2ZX9A 1JNHB 4U0QB 3BO8A 3HE6A 2HZHA 3RGVC 1IE5A 3P0GB 3TBSB 4FQ2L 1KB3A 3R19A 4AQ1B 4E9WA 1MJJA 1L0YA 3QZLA 5EEWA 2JI3A 5DJCA 2F8VA 3N1MC 4PY8J 1Q72L 1PF3A 3BAEH 1Y07A 2BP8B 1DVXA 4AK1A 3VXMD 4QIRA 2C1OB 4KDVA 3VYOA 1NMCB 3NFSH 1QLFA 1YECL 5AAWA 5JW3L 4WENB 1Y6KR 1T04A 5TE6H 1S7WA 4G59C 3CH1A 4XZ4A 5A2BA 1BQHB 4B9YA 4UM8B 3UYPB 5BJTB 1W8OA 4N2NA 4JO5A 1NWOA 1JN6A 4C47A 3GMOA 4GBXC 1ZSDB 2IFFH 3W56A 5GSVB 4QHKJ 3C6SA 3LNEA 1ECYA 3BW9A 3BFQG 2D9CA 4E5XA 2HKAA 1JRHI 2OZ4L 4POZD 1E4HA 4UT6H 3B3IB 4N0CC 3SDXA 5FUCC 1U8MA 1ZT7B 1JF5A 3H9HB 3D9AH 3RPKA 1A22B 5F3FA 2CIKA 4MHHG 1FYTE 4ICWA 4J6RH 2DMGA 4U6XA 5C0RL 1NLDH 3N1PC 4F7EB 3V6ZA 5MP6L 3REWB 4AYID 2UY7B 2C1PA 2XG5A 3NBNA 1M05B 2HLFC 3V7AE 4F7CA 5L8JB 4KWUA 9PCYA 2J71A 1S5HA 5KG9A 3VQMA 3TZVD 4CVZB 5J89A 3RX9A 4DERA 3V8CA 3QJHA 2AP2A 1CF8L 1RIUH 2QKIB 3HCVB 3IJYB 4RVBA 4ODHH 4GRMB 3HUJF 3KPRA 2J1YA 1RV6X 1NZRA 1PCSA 1FRGH 3T71A 2YD5A 3UG5A 1W72B 3INUL 1CICA 4N2KA 3ISYA 5JDSB 5IP4A 1BX2A 3H2WA 3TO4B 2HTLD 3NABL 5MEQA 3U0WL 2VLKE 2D7TH 1WDAA 4P2QD 4UANA 2MOVA 3ZIYA 4CNIA 1B6DA 4FULA 3BEVB 2YFOA 4HUWB 1CO1A 4P5SA 4ZFOL 4AEIH 3HN3A 1HHKA 2MPAH 4YBLB 1G7MB 5EPMB 1VACA 5I5IA 2FGZA 5FGRA 3TBVB 4Z7UA 1NBZB 1DVZA 2BNQE 4XN7A 1OHQA 2BRRL 5C0RH 3DROB 4G5ZH 4GIPD 5DJDB 4QOKE 3H42H 1ILUA 5K39B 3GXDA 4MFHA 4CSSA 2ZYSA 3PAZA 2Z64C 4QOKD 4TLUA 4TUJA 5FW8A 1ZHNA 2O6CA 1BOGB 2CXKA 4JKMA 4G8EA 3M17A 3WN5C 2FJHA 4DKEH 4PFEA 3KPQB 1ZLDA 1RZIB 4G9FB 3UGUA 2G5BA 1S9YA 3D0LB 5ENWB 1RUQL 3KDMA 4Q4EA 1SN5A 4LEBA 4UM8A 3PJSB 5BJTA 4L37B 2A9DA 3ASWA 1JJUA 4HXAL 1OK0A 2X4QA 1MFDH 3HLAB 5EULV 4GUOA 3VFUB 5B8CB 4WI9A 1C1EL 5L2KB 1Y18B 1S5IH 5TDNA 4FYTA 4ACTA 2HRHA 4CVXB 4TQ8A 4OCSH 1CLOL 3T2LA 4FTVD 3BWZA 4LCIH 1CXLA 2JVUA 4M48H 1ACXA 1BVOA 3B2UD 2Y1YA 4H4NA 1E9QB 1HNGA 5KEZA 3CV5A 4K3JL 1RPKA 1ZSDA 4W9HC 4WU5A 5D7EA 4ESKA 2BWDA 4DGWC 3QISA 4UIKH 4IRJB 4Y4HA 2GPZA 5INCA 1F42A 2EDRA 1S7VA 3OKEB 3X13B 1DEDA 3C6LD 4FABL 1TQVA 1YCSA 2V17L 3DK2A 3LJ3A 1CE6A 3BSZH 2WO4A 1NTDA 1HAUA 4EDXA 4XP9H 4APQD 1UA6H 4MMYA 2A73B 4UILH 3G3LA 5GRYA 5ADPL 4AQAA 2W60B 4A7QA 5H4ZA 4G1EB 2IH3B 3FPXA 2KLSA 4FQLH 4KJWD 1GGIL 2LLGA 1G9NH 3HE7D 4N2AA 4YXHH 5MENA 1PZUB 3DETD 5FK9B 1AY1H 2NXYD 5D8JH 2Y5EA 3BUYB 5JOPE 4QMEA 4X6DE 4LASH 4HAFA 3L1OH 1I8LA 2G9HA 3OMIB 1SPDA 4L5FE 3NGBB 1OAZH 1S7UA 2VDKH 3EGDB 2X1OA 1K2DB 2DBLH 2ITCB 3BQVA 4K3DH 4W9EC 4JKKA 5EFIB 1SM3H 4FCAA 4KNTA 5C0CE 2YAFA 2VKWA 4ODVL 4TNVK 3MRFA 4NO0B 4LEEA 5IG7B 3K74B 3STZB 3T9WA 5C0GB 1TNNA 3LKOB 4MCYB 4PHZA 1MRDH 2DMKA 2NW3A 4XTRC 4MZ3A 5BVPL 2FR4A 1PZDA 2R83A 1P7QA 4OJEH 3T0EB 2JJSC 2XXMB 5EOQL 5E8DH 1A7PH 1ET7A 4J12A 3E1ZA 3B6SA 4EI5D 4ZMOA 2EE9A 5EA0H 5FUCE 3WGVB 4BCXA 1CXFA 2I27N 3DOSA 5DFWH 4LEXH 5AW3B 2EDOA 4UUJA 1JV2A 2VLJD 3GHBH 4MXWL 4XXCC 4IRSD 4QRRE 5GRJH 2WXHA 2VWEC 3DMMB 4WUUB 2LLNA 4MBOA 4YVNA 5E0QA 5C0FA 2CKBH 4LSSH 1AO7E 1EAPA 1EAOA 4YUEH 4HWBA 4IJ3B 2K9FB 3C2AL 2YBRA 2YQ2A 3N40F 3HC3L 4M5TA 3TEWA 2Z93A 3G6JB 5DMKB 5C0IA 1KGXA 1KEGL 3GMRB 1YEDB 3HRZC 4ODBD 5F7AA 4L8BA 1E9QA 4OF6A 4PD4J 2A77L 1M57B 3HG1D 4JY4A 4TVUA 1JF1B 3DYMA 3PAUA 3RDTC 1TYEB 4JBSA 4MX7B 4BH7B 3C5SA 4HKJA 4DNLA 1U3HD 1LHZA 4UV4H 3DURA 3FSOA 1DSFH 2MTAA 1SMAA 4X4YA 4PMEA 4OI7A 4OIBA 1A4BA 3O8XC 4Z7AA 1KB5H 3TFBA 3GT6A 1TJGH 2NUTB 3GBLA 3GUFA 6FABL 4U1KA 2VZ1A 3QIBC 2KS0A 4G80B 4J3OH 5ESQA 4J4PD 1GRWA 1DSYA 4FN0A 3QIWA 1HILB 1ZS8A 1PKOA 3CBJB 4DSYA 5SX4H 1QSFA 4HEPA 4KHXL 5JXED 4TLKA 2Z0UA 1OP5K 2Q0ZX 4FP8H 1TYJA 2R23A 4PWIA 1E4XI 1L9TA 5JPNB 1F3JA 4OAWB 1QSFD 1BYOA 4X9HA 4XPTH 3FULA 5KANI 4L1SA 2JKXA 3SDDD 5D5MF 3SBWA 3MLYL 2DQTL 5L4JA 4LPXA 5ID1B 3QUKB 1FNLA 3RZCB 2Y9RT 5I1LA 3LNDA 3QNFA 2AQ1A 4K71B 5I2IB 3HS9A 5TE7H 4ODUA 3W2DL 1Y1UA 3QDJE 2WAHA 5EA0L 2JKSA 3GYRA 5A6MA 2G3XA 1JK8B 15C8L 3E6FA 2ZP0T 4JM4L 3TA3B 2ZSWB 4PJAB 1GJWA 2E6JA 3OSKA 4IJ3C 2GYSA 3MVSA 3O6FC 4JPQA 3FJTA 3OKMA 1A9BB 4I0CC 3VA6A 1L9SA 3VW3H 3AQZA 1CK0H 2BY1A 1NBCA 4ZQKA 3EJRA 1SM3L 2GJ6E 1E8YA 3ULUE 4QEGA 1RUAL 1C5BH 3HJ0A 1FG2B 5DVLA 3ZRCC 3B6SB 3OC5A 1BVLB 4N4YB 1QQDA 3IXAA 2LLLA 2PP7A 5I6NA 1HDMA 1C5BL 3IU4L 2E9WA 4Q7DA 4HYTB 3PAYA 2R2EB 4L1HA 4E41A 1I1YA 5ANMB 2R2BA 5AOJA 3ZU8A 1EAJA 4JKPH 2AI0H 2BXYA 4R7LA 4Y8AA 5C92A 5F9JB 4B0MB 2JKLA 4PJEE 5E6IC 1H0DA 2XA8H 3VXUB 3NCXA 3VD2A 2YZ1A 5C9JA 2OJEB 4PRDA 4X9IA 4CBZA 2XQBH 3KW8A 1BVNT 4K8RH 4BXSV 4U1JB 3NCCB 5F3HB 4BQBA 1LGVA 1CLZL 3UOAB 4WHYG 3SPCA 1RCYA 4LARH 2OMUB 1DBAH 2N7SA 3MV7B 1Z9NA 4BFJA 2P8LB 1OCOB 3N1FC 4PJXE 4YSRA 1EVUA 2CLZB 2OMYA 2VL5A 1F41A 2E0PA 3P0VL 1QRNB 3IDMB 2BCKB 4U1KB 3C08H 1X6LA 2R1XB 4BIKA 1EEZA 1YNLL 2I07A 1INDH 1IT9L 1IGIL 2VC2L 4TL4A 4FE9A 4Y19A 5LCVA 4B9FA 2JTDA 5HJ3B 2LU7A 1WGOA 5ETUB 5CBAA 1KFAL 2E8YA 5D2LE 1JXGA 3ZPDA 3G5VB 5F70A 3MRQB 3FTSA 1HCVA 1QSFB 5CWSB 4YDJB 5DJ8B 2WB1A 3IGFA 3F00A 1MY7A 4M8UA 4WEMB 1RUQH 2X4OA 1J8SA 1F58L 2B1AH 1AGBB 2E6QA 4YVUA 2WOBA 1AKJA 1N7MH 1Q8MA 2XY1A 2H2SC 5KVEL 1VJSA 3ULVF 1Z32X 1J10A 5JHLL 4GXUN 1NL0L 2WWMD 2C4XA 3EYOB 3O4LB 3RX8A 2WJ7A 1E5ZA 2GTWB 5EOCL 3V0HA 4I2XA 5FHBH 4DVRH 5CZVL 1EHAA 3VYNA 2EDFA 4PRAB 4JO1H 5IJVA 1UM4L 5T33H 2NR6C 4OSUH 5CILL 3GM8A 4MJ5A 1S3KH 2WBWB 5B1JC 1JFHA 3QS3A 3ZTEA 2A99A 2CGRL 5GGSA 3W81A 3A23A 5IB2A 3IMWA 3FU7A 1XSJA 3K7UA 4ZO6A 1UTDA 3SPIA 5AB2A 4E9XA 3KYOB 5ICUA 4QRPD 3NJHA 4ZO8A 1E2ZA 3EBGA 3Q2VA 4GXFA 4PRHB 3WHXA 3FT4B 5D7IE 4ONFH 2FQGA 1I82A 2E76C 3DK0A 3O6KH 4POUB 5FAAA 4NKDA 3QJZA 4OCNC 9CGTA 4LKCB 1GPOL 4K5MA 5JXEC 4NQEB 4OGAC 1RZJH 4IBWA 2NZ9C 1CR9L 3QARA 2H8PB 1V54B 5JZ7C 5E5MB 4DP0X 2CMRH 2V7NB 2OL3A 3IDGB 3ZTJH 4HH9B 1JGEA 1CF8H 3RILA 4N0FB 4OZFB 3TJPA 1CLVA 3MGTA 2WMPB 4CDHA 4X98B 2IXQA 5DCCA 5AW0B 3CU1A 1CLYH 3U2SA 4JUTA 1UJ3C 5D1QD 1A02N 3ZKQD 4X9FA 4R3SA 5FO8A 4Q9BA 1DJSA 1YYLH 2AEOA 2ZPKH 4UQ3B 3RZCD 5FO7A 2QGBA 5EZIH 2BP8A 1U3HC 4OUUA 2YO3A 4XOBA 1QOKA 1LEKB 2NT1A 4FLOA 3BHBB 4HIEB 3FQRB 2CE6A 3IETA 1TYRA 5C0CD 4JFXB 4MMXB 2NY4C 1G94A 5AYUL 3CFDB 4PJ5D 3OKYA 4CJ1A 3DX1A 1MQKL 4Z23A 3ILPA 4G9FE 5GSVA 2MMXA 5HDQH 1C12B 1VA9A 2WN2A 3C5JB 4HU2A 4TSAL 1JWMB 1V3LA 3DBSA 4GO6B 3WFDH 4YHYB 3N55A 4X8XA 3F3HA 3K6SB 2WXKA 2KERA 1RXLA 4M3KB 1LO4L 2G30A 2H3NA 2YEQA 3L2NA 1LEGA 4NNYA 1EJ6A 3L2LA 4ZO7A 3UMNA 3MU3A 1BBDH 4AKOA 1BJ8A 3NSXA 1YPZF 2O72A 3KPMB 4OCWH 3KMDA 4YDLC 3MBED 1W15A 2LV4A 1QUNA 1MIML 4F7CB 1TTCA 1T1ZB 4UT7L 4XNZC 4YWGH 1DBML 3VXUD 1RZJC 2R23B 3BUQA 3QUXD 1KTDA 3MLZL 2H32H 3APFA 2E9BA 5CEYA 1T21A 3AY4A 1P7HL 4YR6B 1SEQL 1MUJA 3PQYD 3GMQA 4YIQB 3ZHFA 4FLQA 2A4CA 3O9WC 5CS7A 5EC2B 2IDQA 3ZRSA 5DVOA 5T5FA 4WFHD 3NJVA 5DJDA 2X2HA 2HT4D 4NKDB 3IDYB 1MWOA 3IGAA 2Q6WA 4N8VG 1IGCL 1P4BH 4P3CH 3U30C 3MV11 3W9DB 1S9VB 2DW5A 3P4OA 1M71A 3SD5A 5FCSH 3QEHA 1IAOA 2BNRA 1WD9A 1FZOB 3VAEA 2MKWA 4D9LH 3CFCL 5EDSA 3QEQE 4GAGH 4CW1A 1GC1C 3VSTA 2YQBA 1NDMB 5EO9A 4P0DA 2NX5D 1MWAH 4D3CH 4RSVA 5E2TL 3L95B 1T5XB 4ZW7A 3I2CH 3LMJH 4K5OA 4ZUTA 3GTNA 1X4YA 1H8NA 1P84J 1QYGL 2MFNA 4N8VB 4U6YA 5JO5A 3WO4C 2ICEA 4V11A 1ERNA 1JPTL 2HX8A 2OSLB 3HE7A 4G43B 2DQCL 4GW1B 1A1OA 4LB8A 1N5AA 1HI6A 2NR6D 4Z3FA 2YRBA 3BPNB 3VXRB 4WJKB 2EDNA 1XB8A 1NC2B 2KZBA 3IDNA 3TIEB 1FI8C 2QQNH 3P54A 1NAML 2OMVB 1BVLA 3ARDB 5JHDA 3H9SE 5GGVY 2Q1EA 1JNNH 2B20A 3CWGA 3P77B 3KPLB 1KYOJ 5LG6A 1S8DB 3H9SD 3NJLA 3CVDA 4LRIC 2F19L 4GMSL 1WT5C 3RVWC 4RRPG 3QDJD 3CZGA 5IVXB 4AEHH 2Z0BA 4U4IA 5K1JA 1IGML 4R96A 1JZ6A 4MAUL 3VWJA 3NUKA 2NNXA 4YSTA 4ZMQA 1BQSA 4AQEA 3MJ8B 5DD3H 4DFHA 3EFOB 4QTIL 2A9NL 1GZHA 4NCC2 3VWJD 1OM9A 1TZIB 4HUUB 2ID5A 1MVYA 2RACA 3G9VA 1MI5B 1Z0MA 4PWGA 4K15A 4UU9A 3TEUA 3D3VB 1DDHA 3CAFA 1MRFL 2IADB 2Y4SA 2Y07L 3C60D 4JHWH 2DLHA 4KFZC 4JO2L 2F53A 4IMLB 1DN0B 5KSBA 3VSUA 3GIVB 4M7JL 4U1NA 2GBAA 1KG0A 1I8MB 4JQIL 3LSOA 2QL1A 3RX5A 2JELL 4TTDC 1BMWA 2OZ4A 2GBUA 4CBPA 4N0YH 2XWTB 2HWZH 4PG9B 2ZYIA 4PV9A 3L16A 1R1CA 3MQIA 3T8XA 2YN5A 5IM7B 4BD4A 4MXQD 3CX5K 1RIHH 5CEZL 2WW8A 5T3ZE 5GGRY 2GAZB 2KZKA 2W07A 4HHGA 1KGJA 1LM8V 4OZGA 3AS2A 3C75A 3CCHB 4HALA 2DM2A 2WZ5A 4JFTA 2CR3A 3QDMB 2D4DA 3ARRA 1KTDB 3Q9QA 2FO4B 4OM1L 1P7QB 2BVYA 3MLRL 3QEHB 4M00A 3NDZE 4BUQA 1P7QD 2DDQL 3S96A 3FTWA 1JUFB 1JZFA 3N0AA 3SJVD 1UB6A 3O6MH 3CFQA 3UTTE 5L4FA 1MW3A 2JB6A 1KT2A 1NGXB 3D33A 3QJVB 2BS9A 4F37F 2IDUA 2PWFA 3FO2B 4KXAA 4YZFF 2QQLH 1IEBA 4Z0BH 4FFVC 1NUGA 1OM3L 4JL2A 3WHE1 1QFWI 3NSCA 3TP4A 1NFIA 2Y36H 4XVUC 2HRPL 5DT1L 5HHVH 1IC7H 1BFOB 4U1LA 5KVGE 2MEJB 8FABA 4CW1B 3K2IA 4LHQB 3IAGC 5LHDA 3ZL4H 1TZ8A 3KYOA 5KVFL 3FK3A 3VI3A 1G5AA 4NLAA 5L6YL 3HNSL 3H3PL 1SXNA 5AVXB 4D9RD 2YGNA 2XQBL 4Q6KA 1H9VA 3Q1SH 3D69B 3AY4C 3P4LA 2Y5TB 2UXFA 1I7TB 1KLUA 1BZ9A 3IJ8A 4MASA 3NTCH 5DUJA 2JCCF 2OMZB 4K9EL 5E5MA 3L4CA 4BCZA 1RUKL 3WG7B 2OL3H 4LAQL 5CJQH 5GXBB 5F96H 5C0IB 3ARTA 5T8IA 2FVNA 3FT9A 4OZIA 4HSAC 3VVWA 3ZE0F 1NGWA 4GI8A 4L8CB 1JDCA 3QR0A 3MNZA 2AXHA 3EH3B 2YD4A 2BW5A 3KR3H 2HJFB 3BH9A 3PWUA 3E9UA 4GXVH 1G1OA 1A1NA 1M2VB 1BMZA 5D2LF 4F8NA 2AEPL 2H6PA 2FNBA 1UA7A 2EVGA 4A7VA 3BPNC 3QXAB 4X4ME 4RFEA 3TCLA 2JNZA 4HHAB 4RAUB 2CHNA 3UJJL 4P4KC 4ZMLA 2RJMA 1IU1A 1LL1A 2XVGA 2PW2B 5BS0B 1GCFA 3HHSB 1TLMA 4AQ8A 3ZDZF 2V0AA 4G8FA 4LLAA 1FL5B 5L8LB 2XKSA 1MOEA 4JX0A 4IRZA 2W1NA 1DJZA 1I85A 1UWYA 1N4XH 3VXSB 1JWSB 3GMNB 5KUMA 2FEEI 3H7BA 3UBHA 1FSKC 2UZIL 1E2VA 4ZFFB 1GPOH 3QQ9D 4PCTA 4TNWK 4Z7QF 1HSAB 3FUEA 2E4TA 2V2WB 3HS0A 5HGAA 3V6BR 4FC3E 4S0TD 5DMGD 1NM9A 1DFBH 1NFAA 3DJTA 3BQUD 2JCCB 5D1ZI 2ARJA 4F3FB 2J1ZA 1BEXA 3VX0A 2Z91B 4TUKL 1F1GA 5KSAD 3T0BA 4AEEA 2XV3A 3FZUC 4LSTH 4X83A 4A7SA 5MENB 4HUKB 5EU3A 4B5EA 4PCKA 4IRSC 2XFGB 4UTBL 4HCFA 4FQXD 2OYKA 1AD9B 1NIDA 4UQIM 2ENYA 3KYNB 3PP3H 4JDTH 4NRZB 3ATBA 2CJTA 4NQXA 5F7DB 3LS4L 1AHWA 1R34A 4AT6A 4FFZH 5EOCH 1EWHA 4PU2A 1TJGL 4M1DH 3ZYOA 3VFRB 3IGAB 5I75B 2HPTA 5HHNB 3MA9H 4K94C 4GW5B 2H26B 3CX5J 2VZSA 2VMDA 5J9PA 1EFXA 2WV3A 3L5XL 3WLBB 4IBZA 3BAYA 2FCBA 4GRWH 2PETA 3S34H 4ERSH 1PJ9A 4MA8H 3ABLB 5CIPA 1JNHA 5F3HA 3U1SL 3UG3A 1PD0A 3IVKA 2O6PA 1PU0A 5EBLA 1OTUC 4IGBB 4RWHA 1TVDA 3JZ7A 3PFQA 2BINA 2R0WL 5KVMC 5DWUL 3UZQB 3WAJA 4AY0A 2IBZX 4NT6A 5JQ6L 5K1NA 3FC8A 4N2DA 3CDGA 4HHAA 5F9WC 3LN5B 3UPRB 3L6FA 1LO2H 4WI7A 3DSFH 3IAQA 2LFGA 4HJSA 4UNUA 3EOAB 4XR8C 3ZTNH 5CLWA 4JY4B 4HCRH 1JZGA 3LEXA 1CPUA 3O3BA 5AZUA 3U46A 2DQUH 4G5AA 1IC4L 1HZHL 3SKOB 3LNIA 3FQ2A 1MFBH 3GXNA 4PV1C 4C56B 1NCBH 2H1LM 5DSCA 1DZBA 2ZONA 5EBMA 5DJXA 2YQ3A 4HZAA 1VZHA 4NKOA 4PM1A 4ZW3A 5J6HA 2O93L 1VB9A 2VB5A 2IQAB 1ZCRA 3RYMA 1MJ7L 2W60A 4ELKB 1XGPB 4GT0A 4ZPTB 1RVFL 4MB4A 4LSUL 2XTJC 2VERA 1XF3B 2Z31C 1LQBC 2BIPA 1Q9KB 2NLJB 2FX7L 2AEQL 1H6TA 2IQ9L 5BZWB 4YPGB 3PWLA 1NCHA 2X0WA 3L1OL 1PD1A 5KYWB 5DZOA 4XVJL 4V1DE 3WJLC 2FE0A 4QLWA 3FRPB 3IPEA 2O6DA 1J8KA 4YL4A 5KSVB 4P48A 3VTTA 3MBEA 4XGZA 1BXAA 2BFGA 5IFJA 1ID5I 3PNWA 3S5YA 3SODB 5AFAA 2C3WA 5F7DA 3DXAE 5GHWH 4UILL 1RU9H 4YFEA 5JXAL 2C7UA 2AXWA 3EGSA 1UZ8A 4L1TA 4LNVA 4XPHL 3WJLA 3P2BA 4BSJA 4ZNCD 4R0LB 2YC1B 5KVDE 1K4CA 3AQDA 2VYRE 3DX2A 1FZJB 4FXLA 4XPAH 5IBTL 5C71A 3VXTB 2NSQA 5FGBC 3DTDA 5F1KC 3K6IA 3SKUD 3IKKA 3MGAA 1OP4A 2R69A 1CDUA 2CBPA 4HLJA 4WKXA 1OTSC 2APTA 2VCOA 1T4KB 5ACMA 3MREB 5C0EB 5L88H 2KPWA 1R75A 3ZVVA 3VFWA 2J4WL 4RRPM 5DWUH 3BN9D 4ZMPA 3GGWA 5FLVA 4RBPK 4CSPA 4G8GB 2EKSA 4RQQA 2AABL 1YHPA 4FQIH 4U3SA 4MTMA 4RISH 4N0RA 3NOIA 5EZJA 1ROCA 5GIRB 4F7KA 5D1XB 5IF0A 5JR1H 4Q9RL 2JI1A 2IWGA 1MHPL 4YDNA 2R7EA 1ULVA 2QHRH 1OPOA 4X7DC 2WBJC 4NM4L 5DMGC 4CVWA 5FDWB 2N0MA 4ENEC 1ETJA 2O30A 1JFQL 1UOWA 2OX5A 1VZGA 4PN6A 3DTXA 1JXJA 4RZCB 4X6DB 1BFSA 4H8QA 32C2B 3R7QA 2UUDH 1L6ZA 4R7DB 4NC1E 1E6OL 1Y0LA 3OR7A 1H3UA 1F4HA 2ICWJ 3JWNH 3NK4A 4OZGE 4BZYA 1TVBB 4XMTA 2QSVA 1M1XB 3CPLB 3D0AA 3CMOH 3HOGA 1NCCH 2XA3A 1U8OB 3HN5A 4XNZB 1R46A 4GMTL 1MREL 3MODH 3PDOB 4NKMA 4XMWA 3GTTA 2F5AL 2XV0A 3FT1A 3QNXB 3UROR 5A16A 1GSMA 3WY2A 3O3BB 3U46B 2X42A 5LKNA 5F88B 1SVBA 1N8ZB 3AQYA 2WXGA 2Y2WA 5FO9A 1ZGLA 3RA7L 2V4LA 2PXYA 1USZA 5K1VA 4LBEB 3HUJE 3US9A 4QR7A 1TEYA 4Q6YA 4XC1H 2IOMA 1VENA 3ES6B 4NEHB 3KWVA 2YMXH 1AHMA 1VFAB 3X1FA 5FFLA 2OQJB 2FX9L 3LIZL 4NO2B 5DJYA 5KVGH 3B2DC 3LEYL 1Z3GL 3FFDB 3NAAH 4NQCA 1B90A 4YQXH 4LSDA 4W9ZA 3MUZ1 3TZVB 3H4FA 1YN7B 2MIZA 3DIVA 1RFDL 4QXUL 5ICYA 1EDHA 4K9JA 5AOIA 4KZEL 2ICCA 2ATPA 4HIHA 5DXWA 4TPRL 1KCBA 4LSQL 4PSRA 2BNRB 3IM1A 1TCRA 3QI9D 1BP3B 1IARB 4Y2DD 4F33A 2P49B 1QRKA 1JPFB 3LRGA 4PCYA 4HBQA 2K4AA 5ABZA 4I4WB 5T3XH 5TE4H 1QBMH 4BKTC 1A3LH 3LPFA 3IF1A 4PEEA 1N19A 1WBXA 1TITA 4N24A 1QLRA 3RKPA 2IH1A 5EO1B 1MQ8A 3BWSA 4HOWA 5KYNA 2YAMA 1LMIA 3MRRA 3R4RA 1E67A 4GXVL 2ZOKA 3MRGB 4BA0A 2XNAA 4LGSB 1AANA 4HFWB 1QZ1A 1N0LA 2VLLB 2WXPA 3DV6B 4E42B 4KAQL 4PGCA 3BVXA 3FSVA 3F8UB 4HS3A 4KTYA 4O5LH 4FMVA 2HA1A 4YHZL 1EMTL 4KZ0A 4WSGA 5CJXC 4P5RA 5IOPA 3NCBB 5EN2A 3DMMA 5AD0B 1NJ9B 3T3PB 1PG7H 3SE8H 4XX1E 3DVGB 4BELD 4Z7NF 3Q1SL 1Q72H 4MB1A 3CPLA 3GHEL 4EKJA 1QSVA 1OPGL 2WANA 5J9PB 3ZYZA 1AJ7L 4M61B 1BQKA 4MNGA 1KIUA 3H6JA 2W94A 3M6DA 3MMEB 4XAKE 1DDHB 5LGJB 5C6TL 3AXLA 5IR1B 4P9HL 4XCYB 4KKLD 5E00B 4H26A 5J12B 5DZVA 2LAGB 5HHXL 2VXVL 1I8MA 3MRJB 3J8F7 3IN0A 1D7BA 4HPOL 2P8MB 2MQ3A 4P2RB 3LHPH 4X5XB 3FOLA 4WUKL 3G04A 4Z0BL 1TG8A 1LEKA 1E6JH 1AI1H 4Z7IA 4UQ2A 1G6RH 4H8WH 4U6XB 1FF5A 3TNNB 3UC2A 2X3CA 1MHHB 4GSDH 1G7HA 1MFDL 2PWDA 4FXGB 1FNEB 1REIA 1JGVH 2PO6A 2EO1A 3V0AC 5FLUA 5E8NA 4DGYH 4PJCE 4XN5A 4OZIF 4Y1AE 5KW9H 3SZ6A 4AENA 4QHLA 4JHZA 1A4CA 2ATKB 1MFAH 3OLGA 3KAAA 3SE9H 1MQKH 5EU4B 3T0VA 1FL3A 1CN4A 1FBIL 2ADJB 2OZNA 4IDJH 1P0SE 4KXZI 3TA4D 4A6YL 3DXAA 3BIAX 1DQJA 3C8DA 3ZE1B 1CIDA 4H25B 2BIMA 3WHE0 5IM7A 4ZMNA 2ZG3A 3LPGA 5DR5L 4KQ4H 3VFPB 4XNXH 3V4VL 1FIGH 5D1QB 5T3XL 5TE4L 2H45A 4PRHE 2F7PA 4OB5H 4I9XA 4JFFB 3CSYA 5DI8A 5ELIA 3SDAD 1YYLL 4R90H 1CD8A 1XQ4A 3SDCA 3BP5B 1GW0A 2FJUB 3EG9B 1WWBX 5HGBB 2VDKB 4JQIH 2A9ML 3RL1B 4WHYH 4YHOH 4AOFA 3TM6A 1PD6A 1J5HA 3WLWC 1Y6NR 1BYNA 2D7TL 4GY4A 2ESVA 5SWSD 2NCMA 3UTSE 3FQTA 3W38A 4NRYB 3IN2A 3SZKC 3HZKB 1MUJB 5D7LE 2OYLA 4QXUH 2F54E 1N67A 2GI7A 5AW2B 1IEBB 3SGKC 1CR9H 1ACYH 1W72H 2FL5A 3VE0B 4DEWA 3X14A 4KKAD 1RSYA 2O5XL 1UADC 3O2WH 4AUYA 2FX9H 3LIZH 3PDGA 5DS8A 2Q6WB 3WKNA 2Z7YA 4X9BA 3H0TA 4NS0A 1GGYA 5E4IA 3MRDB 3K72B 3UDWC 3UL4A 4J23A 1C16B 2A4ZA 5DO2C 5G4MA 4MNHA 1Q0XH 5CP7A 4H20L 4QAWA 4PJ8D 5B39A 2DQGH 4X8GA 1S9XB 2R27A 5HDRA 5IOPB 5LBSA 1Y1DA 2PCYA 3QCVL 3CLFH 1QWHA 3DJZA 4Y4FB 3B4NA 1M7DA 3D51A 1VCAA 1F11B 4NUMA 3BAXA 1OAUH 1BQRA 1YYCA 3QJUB 4N68A 4X5WB 2OYPA 3U82B 3FQRA 1MZYA 3AUWB 1CG9A 1R6VA 4AJYV 3DPBA 4XVSL 4FMKA 4UT6L 5EU7E 4LRIA 3X3GH 5I30H 1KZYA 1YEJL 3LV3A 5I8CA 1E4KC 2AXFB 2NW2A 1E27A 3OKLB 2DJ4A 5F0PB 4GAGL 3NJGA 3AXLB 1JN6B 4JFQA 4DGYL 1DQIA 5KN5B 2Z4QB 4X7TB 4PTTA 1O5DT 1BJMA 1L0XA 3D25B 3I84A 4WHDA 2GCYB 4F8QA 2EQDA 1RURH 3WNMA 1JTTA 5D2LA 3MYJA 3UEQA 4AQEB 1M3IA 1U8OA 2CO4A 2NY2D 2UZXB 1GIGL 3GS0A 5E23A 4DAGL 1ZXKA 1I8KA 2FO1A 4YHNA 5BS0A 1L9PA 3MC0A 4QF1A 3EYVA 5KJRH 2BFVL 1CTNA 3KPRE 4JDEA 1YDPA 1DLFL 1A0QL 3U9PH 3LQZB 4N2HA 2F8XC 1FC2D 3KPRD 5J1TC 3U6RA 4KUCF 2W91A 3KXFB 3AWGA 3JVGA 4JN1H 2VMEA 3UPCA 4JLRA 3NACH 3I75A 3BT2L 3JV5A 3LH9A 1XCQA 4K8RL 4PTUB 2OI9B 2H9GB 1EHKB 5EMYA 3V0EA 2P24A 1UM6H 2J55A 3OWEA 4UB0L 5C0JB 4HP5A 1BM3H 1HE8A 3CXFA 3OR6B 3R06A 3RP1A 4R26L 3KPOA 4LIQE 2YSTA 4QHNA 1LNUB 1TPXC 4KRMB 3WSQL 4ES8A 5IJKA 2NY5C 2VTFA 4PJAE 5H94B 2WPGA 4Y4KA 4X7SL 2OTUB 4LRNL 5K9OA 3T0EA 2UUDK 1Q1PA 3K0YA 4YE4L 1JCVA 4ZAKB 5I1IL 4NENB 3T2NL 3WJJC 3MO1A 3P9LB 2H1PH 3UX9B 3S96B 4I13B 2APWA 2K45A 3KM2A 1IM3D 5IB5A 4NPKA 1IQWH 4NGHH 5EZOH 1QMUA 4YBLC 4OJCA 5BRZD 1UCBH 2VMCA 1U93A 4OD2B 2BHZA 5JMRA 4AVHA 5I1GH 4WFHE 2ZPKL 4BFIA 4IOSA 4G7VH 3WNLA 1PGRB 3B9KB 1HSBB 3ARFC 3GSUB 2R59A 1LD9A 1M3JA 1A7RL 1NGYA 3LRSB 2VDOL 1WFUA 3SDAC 3BVNB 2WUCH 1ZT4B 3DV6A 4F24A 5E6IA 1YEWA 1FFQA 3EYUL 5CMAA 4U0RB 1IX2A 2B14A 3ESPA 3QXUA 4LCUA 4YXLH 1ANUA 4PREB 3W2DH 1UWGH 3AT8A 4JFQB 4Y4KD 1XCTB 2QPDB 3Q05A 1INEL 2ESVE 2WBKA 3VDCA 2NQDA 3KLDA 3V0WH 2NDGA 4YDZA 3SJVA 1YY9D 4ZX5A 4OUUB 3L13A 3ESVF 3TH3T 1SLXA 1FL6B 5HHPA 2FJGA 1W0VA 2WSDA 2Z8SA 1T6VN 5D4JA 2JK5A 3P69A 5TJWK 1AYRA 1OB0A 5HJGA 3FTGA 4C56D 2WKOF 2F61A 2ZXAA 5CLZA 4LU5L 4YHKH 5AALA 3MRNA 4IRJA 1OO2A 2AKRA 4LL4A 4ALAC 2WLLA 2K70A 2X6MA 4CVZA 4PRPA 3FQXB 4JRYA 1CE1H 1P6WA 4TUUA 3WEXB 1O9ZA 1YQ2A 3UC0H 4YS4A 3PGCB 1SXAA 1JAEA 4PP2A 1OQXA 2D03L 4WEEA 1M4KA 3BP4B 1LP9A 5EUOB 4CGTA 3K6NA 1KJVB 1CDBA 1CCZA 4WUUD 3W0WE 3TWYA 1SOXA 2J88L 4XBPB 4KJPD 4L3AA 2I69A 3NIDB 1CGSL 4PLOB 1BEYH 4UV4L 4ZFQA 3B56A 3MROB 4HHWA 2VISB 3RWCB 4KNSA 4HZ1A 1P5VB 1FZJA 2XQYK 3FMGH 4CVUA 3DBXB 4FFYL 2BOCA 1X5AA 1CL7H 3CFKB 4TUKH 4PJGE 3Q5OA 4OLZL 1NCGA 4YGVA 1AS6A 3B5TA 4F7TA 3M7FB 1MLBB 5JQIB 2XRAL 1O6VA 4UB0H 1PZCA 1WK0A 4PY8I 5DD0H 1R19A 5DZPA 1Y6MR 1ODUA 4W9KC 1FNGB 4LCWA 3KH4A 1DBAL 3K71B 3ARSA 4EUPG 4YLBA 2IANA 2Q76B 3IXAB 5EO9B 2R7EB 3FTVA 2FQFA 2DYPA 1X5ZA 5IUCA 3NFNA 1II4E 3QJFA 1WZKA 4I18C 5GS1B 3ZZ1A 4PB9L 5KJRL 1PAZA 3NK3A 3GPSA 3NSDA 1R3LB 1WBZA 3QI9C 4LQFH 4WK4B 4WUUA 5ERWA 3RUGF 3QH3B 1RLBA 3CUPA 3U7WL 2HPOA 3L3DA 4QYOB 1U8JB 2Y5QA 1WD8A 3D18A 1FVCB 4G6AD 4IOIB 4ZUSA 4NFCA 1C08B 1Q94A 4JFFD 1RKRA 2XICA 3SO3B 4K0OA 3FF7A 4NO3B 2A9BA 3QEGH 4HT1L 2FUTA 1UD4A 3BPOB 3POCA 3NZUA 2WYIA 5DRWB 3DTXB 1MZZA 4X6DA 4Y4HB 4ZG1A 4S2SA 4K73A 1XR9A 4JDZB 2FWSA 4XXCA 1H6EA 2IDCA 1FO0H 3DURB 3AT9A 3LX9A 2GTZA 3QZMA 3TZVC 3QC5X 4ONHA 5GISL 3IDMA 2VXQL 4JFSA 5I0VA 3HNTH 3QB7C 1SYSA 4XC3L 1BM7A 2OKMA 2Y69B 3RGBA 1Q4NX 4OCRL 3L6FB 3EHBC 4XNUL 5F7YC 4LF3A 2V5MA 3QR2A 4DN4L 1O7VA 3DO7A 4MWFB 1Z2KA 1CB4A 2BJMH 2DKUA 5GRWA 1QG3A 1OGTB 2NRDA 5T3XD 3VFNB 2G0LA 3LSOB 4UIKL 3M07A 4UI2A 2F0CA 1SOSA 4QHPA 3B9KD 5DRNB 1K4DA 2F7OA 3SYQA 4HW6A 4JRXB 1UT9A 3G6JE 2ZSVB 4FL4B 1OM3H 5BS0E 4OCSL 4W9DC 3TZVA 2FAUA 4JNXA 1RK0A 3MXWH 4NN7B 3T0DA 2JWYA 4HJGA 1GS6X 2BSCA 2XBTA 1A2YA 3UZEC 3CHSA 1JZ4A 2WGXA 2DQIH 3HVDA 1IIIA 5FUZL 1CD9B 3BUDA 4MBRA 2YWYA 2CO7A 2VRAA 4G2AA 3KYNA 3HAEA 2YA1A 3FOMA 4FYSA 5CLXA 1AGEB 1KB9K 1NIEA 2XPGB 4GEJA 4ZMYA 1T3FA 1CWVA 4JFPB 1U2CA 1Z9MA 1CICB 1IVLA 5EOTA 1LK2B 1TZHB 3B5HA 4MRBA 3ISRA 4NQCD 4B41A 1WUNT 4MDIB 5AD0A 3NJNA 2HRGA 1UZ8B 5ERWB 4I18A 3NSFA 5J6GA 5HP5A 1K6QH 1S7QA 3I9AA 3ABMB 1PMYA 1HHKB 5KYXA 5DUBB 2IGFL 1TU2B 5BZZA 4Z78A 1NIBA 4IK7A 2O5YH 4ZS7L 2F53E 3C2AH 2R2EA 3T1WA 1MRFH 3OXRB 2VWEE 3LVEA 2CKBL 2P44B 2G2RB 3IU3A 2BVOB 1SNRA 2NY1D 4HCRA 1ZA6B 2E7CA 4XXDA 3D39D 3TEZA 3ZHLA 2AJ3B 3L4XA 2QADB 5D70L 4KJYA 1FFPA 5KYYA 4ZUSB 4A1RA 3VXUA 1EZVY 1PKQB 1J9SA 1N4XL 3BJLA 3CSFA 4HKXA 4AH2B 4E9QA 5IB3B 4N6RB 2GHZA 4NJAH 5T3ZL 3O2DL 5CXPA 1DQKA 3MGOA 1DCEA 1OCWL 3PWUB 2ICES 4M29A 3BAWA 4DTGL 4D94A 1UJTA 3X11A 2I9TB 1Y18A 4ZMAT 2DQEH 4P9ML 1A7RH 3MBXL 1WFNA 1EEUA 3FUJA 2QQNL 4Y7MA 4GG6B 1F0LA 5CCJA 3DOHA 2CM6A 3LY6A 4LF3B 2GK0B 2OULB 1J8HE 2EAEA 3BCDA 1V05A 1PZ2A 3VXSE 2PN5A 1AG0A 1I9RH 4Q6IA 1QNZL 3N41B 4HEME 3JV6B 2JI2A 2IAMB 2NX5E 1UZ6F 3GDCA 2XWXA 2NXYB 2X10A 3HMXL 3UAJA 1EVTC 2X40A 3QDME 2AK1L 4R8WL 3U0TB 4URTB 3STLA 5FCUL 3QXVA 2XPGA 1OKEA 5AYQA 5C0BD 2FZ3A 3QW9A 4YX2H 1SFHA 4P07A 2ZCKH 2P46B 1BZDA 1KEMH 3B8YA 4S11A 5HHOD 3IB4A 3W39A 1A3ZA 1J12A 2PP9A 3GSQA 4QHMB 3WNOA 3BT2H 4GKNB 5J1SC 5FGSA 1LWJA 4APXA 1P4IL 2CJ3A 1TQBB 2CGYA 1I1FB 4B3EA 4QGYA 5IT2L 4JFPA 1YC8A 1DLFH 2WC7A 3MRFB 4F8PA 2EVIA 1ZPLA 4EI5B 1AJ7H 4LCCC 3BKCL 4L4VA 1MFMA 1HE7A 1U8NB 4KKQA 1YYMH 4WW1B 5DJCB 1J5DA 3APNA 2DWDA 4WW2A 2TRYA 2WCSA 1ZVSA 4QYAA 5L2JB 4JPIA 3IDNB 3LNFA 4ZSOE 1YNTA 4HIXH 4PJ8B 3JWDC 1F00I 3WJJA 4O02B 4DW2L 1RH8A 4OW6A 2V9RA 4TNWF 4Y4HC 2JSFA 3V2AR 1FFTB 1XF4A 4FF9A 4AJVA 3QRBA 4E42A 1IFHH 3PL6A 4KH2A 1I9RL 4Y4KC 2G2RA 4EIBA 1NC4A 2O5NA 1BHGA 3T4AB 4ZXBB 1TF4A 3QDAA 1IM9B 4QXTA 2XWJA 3ARQA 5BQ7B 2J5LC 3ARFA 1PY0A 4HUXB 4JN2A 2NY3D 2P9RA 3H9HA 1RZGA 2J8UE 1RIVL 4G5ZL 4GSRA 3D52A 2QKIC 1QPXA 4MJ2A 4NHUA 4ZTOH 3IFLL 5A2JH 3LXCA 1VERA 4H8VA 1U8PB 1E9OA 3MRIB 4MD4B 1DUYB 2DQGL 2VMJA 3SQRA 2JIXB 4AG4H 4P4RA 3QUMA 1W6WA 2F5BL 3MJ6A 6PAZA 2I9TA 2JIXD 3D25A 4TKWA 1MW1A 1BZQK 3D30A 4TULH 4ZPVA 1IFRA 2GUYA 3PQYE 5C07A 1FV1B 4HJ0D 1KTLB 4AKPA 3RLSA 1PZAA 3QWRA 1MJ8H 4QKXB 3EXLA 1NGZA 1FYHB 1EXUA 1XGPA 3KPRB 2JB5L 4ZPTA 3HN8A 3O4LA 3R0NA 4YAQA 2X4SB 3P3YA 3BP7B 3VACA 1LE9A 2VERN 1I1AA 4XMLL 4AEHL 3L4UA 5ALBH 1MCJA 4IOFC 2XTJE 3SCMA 3C5ZA 1T22A 5F0MB 5CCKH 4HIHB 1XIWD 4J6IA 4P23A 1MEXL 4KRLB 4JFWA 4E68A 4GP5B 3U0TA 1PY4A 1HCYA 3T65B 5KBDA 5EBWA 4F9LC 3WY3A 1OT4A 1QLEB 4FOMA 1RU9L 3QO0A 5E9DA 2MHAB 3L45A 4BK5A 2FZ3B 4FADA 1LWRA 1AGDA 1U8KA 4P57B 1U8CB 4GMTH 2WYZA 4LESA 4WGVB 4TL5A 2NMSA 3MLTB 4OFDA 2YHGA 3WKQA 3H55A 4H0HB 3ROLB 3VI4E 1TQUA 5EEXA 3SDDC 3N9GH 4YDKL 1S7XA 1JHLL 1ZK5A 3FQNA 4PJ8C 4XPGH 3K1KC 5AW7B 4AEFA 1FDLH 4G1MA 1EZUA 4GSQA 1RJYA 3V9EA 3W5NA 3E6HB 5L4MA 1H3GA 1MFAL 4DKFH 1PCXA 3NEEA 5F6HI 4YPJA 2ESVB 3I6LE 4JFZH 1TJIH 4G6MH 3BPLB 1WAPA 2XXCB 4F2MB 1BD2A 3MI6A 4MD5B 1YEEL 4NM4H 1JGVL 4HJJH 2P48B 3W0WA 5LGHH 4D8PA 1CVRA 2D7NA 3KGSA 3QPKA 3WE1A 3KVDD 3G6DH 4FJZA 4FQIL 5LNEA 3TYGL 5KS9B 3RVXC 5FO7B 2BVTA 2Z7ZA 3DXAD 3KNBB 1QO3B 1ZA3B 4B9JA 2VJXA 2OSLA 2VOTA 2WP3O 3HE7B 4WUKH 5FHAH 5IW6A 1YNTF 4WEBL 3ZDYF 2WVVB 2IPKB 2ZG2A 2R1WB 4KTGA 5DTFA 4KUZH 1RY7B 5E1AA 1GGBH 1MAJA 3QUZA 3EJZD 5DD1H 4GBXA 4J8RB 3QWNA 1YQVL 2NT0A 1KXTA 1VFBA 4NNXA 3TT3L 1NC4B 1S8DA 1X6NA 3FBQA 1S7VB 3OKEA 4AYDC 2IOOA 2VSCA 3FB7A 3K4DA 3KLSA 3SJVB 4BXVA 2E7LC 5CHNA 4P23C 4BQCA 4MVBD 4WFFE 3FQXA 1SXZA 2RAMA 1XBRA 5ITFB 4F5CE 2FJGB 1QRND 2LR4A 1RI8A 5D72L 4Q89A 2ZAHA 1CG9B 4AQAB 4TNEA 1JHKH 2AI0L 1RJLA 5J13B 2DJUA 4NXKA 5D71L 4GLRI 5EDXA 1XXFC 4R97C 3IJHB 1ZLSL 3F7YB 1F6AB 4NHCH 1QNZH 1WAAF 4PJFE 4KJQD 2CO1A 3MRKA 3AAZA 2VLRB 1PJWA 1FPTL 2AF2A 2X4PA 3QEGL 4MXVF 2K6YA 3VTAA 2ENQA 3QGVA 2HT2D 1CI5A 2BLFA 5AVRB 3OAZH 1QI5A 3D09A 5DHVB 2CO6B 2H3KA 3B7UX 2VDNL 3V10A 3FTUA 2ZYRA 1BQLH 5EZIL 4F7PA 2J5WA 2YXVA 1M05A 2P7TA 1ZRUA 2QADD 3GBNL 3MRQA 2V9QA 4AC4A 4DESA 4U1HA 1JDAA 5KSBF 3HRZB 1ZEAL 3QUZD 4NPYB 1SDAB 4DVBB 4N2GA 4QT5B 2MQ0A 3N0PB 1WV7T 1ES0B 1XF5A 3QJHB 2IANE 1DJXA 5AVUB 4ETQB 5L7XH 2EDDA 3MV8E 3ZO9A 1WLHA 4XAWH 2EO9A 1IL1A 5E5UB 3LEVL 3MOAL 1HU8A 4MAYA 4OF0A 1DBBH 4ODWB 4PP1D 4U1IA 5JDSA 1FG9C 1ZGLM 4NQEA 4W1TA 1E5CA 3HFML 1W0WA 3V0VB 1DFXA 5IGXL 2K4WA 1HEHC 1UXMA 4N1CA 4KHXH 1YPZA 3SDXE 4WWKC 1A66A 3DVNA 1RERA 4RGNE 3NIGF 1YEKH 4L3CA 4BH8A 4F92B 3O6FD 1A6TA 4DP5X 1HXKA 4M43H 5MERB 4D0BB 3HVNA 3QG6A 3SDDB 4X99A 3HBGA 3ZKSD 1CXKA 2A0LD 5D1XD 1BAGA 4ZFGH 1MHCB 4M3JA 4FX5A 3SEPA 2A6IB 2KBGA 3CN2A 3DIFB 5DK3A 1AZNA 1NLBH 3OF6A 4NT6B 4GUPB 1HH9A 4NM8H 2GTZB 3ZE1F 2ATAA 3QDMD 5AVSB 3EFOA 5T1LD 1TXKA 2D03H 1NBVH 1SHWA 2EDKA 1C08A 1NGYB 1ZK9A 5E1HB 3TEYA 5IHLB 5CJXA 2BVEA 2VZVA 2H3XC 5F97E 3RY4A 2R2CA 5D7KE 3TJHC 4UQCA 5KN5A 1MCKA 4U3XA 3O2DA 1KIQB 3NFPA 1OY3B 4XCYA 3UTSB 4B6ZA 1M6UA 1THCA 1KGIA 4YSUA 3A4EA 3MR9B 4N25A 5CLYA 3TBWB 3BSHA 4F5CA 4R26H 5I71C 5L9DH 1UG9A 3UO1H 2EDEA 1HHIB 3TVMA 1CFMA 1XL6A 3Q3GB 4EF3A 4OIIH 2PLTA 4AW7A 3HG3A 3HNSH 3WEMA 4OZGB 2MCPL 2IC2A 1H3XA 3L7FA 3JWNE 3Q6GL 3VI3F 4U33A 5I2IA 4ZFZA 3KHOA 2BJML 1LLAA 1EBAA 3O81A 4UAOC 4CC0A 1G7PB 1IC7L 2C3GA 4XBGA 1CD1A 2M26A 1KZQA 2VSMB 2A5UA 2N7AA 2GSGB 1X5XA 4B9GA 1NGZB 1H5BC 3LKPB 1EPFA 2OCFD 1W6LA 3ZJAA 5HYIA 2P5WE 3S35X 3LKRB 5E4EC 1I3VA 2X4SA 2V2WA 2VDQB 3PL6D 3HRPA 4W9LC 4Y16A 3UERA 1AHKA 4AMKH 5CKGA 3O6ML 3VFGL 1LK2A 1TZHA 2N1KA 5F9AC 4BSWB 4K3DL 5AKRA 2H0FA 1MJUL 2CWRA 3DSNB 5IHWA 1BD2E 2FBJH 5JZ7D 4AGOA 5CZRA 2FH8A 3OMAB 3JWDH 4FLRA 4Y1AD 1M7IB 1T21B 1OT2A 3A4AA 2J8HA 2R56L 4KQ3L 3TIDB 2ZUSA 1KYDA 4X6FA 5EC1B 1FN4A 1U3JA 3WFZA 4XBEH 1OP9A 5J13C 3N9GL 5FF6A 3BCFA 4H0GA 4JR9H 4AM0Q 5L0QC 1KBBA 4OCYL 2Q3ZA 3PXJA 4OD2A 5EU7C 4CL7A 3WUWB 4HAGA 3DARA 4G43A 3GGWB 2GT9B 4UIMA 4JY6B 4AXWA 1GHFH 1P4LA 4P99A 4BWUA 1J0IA 2VLRD 3AABA 8CGTA 3T3PE 3UJTL 1A25A 1HZHH 2J73A 5HYJB 5D7IF 5FGBA 3F84A 5CCKL 1KUMA 1OAQL 2KMWA 4JY5H 4D0BA 3OG4B 5EU6B 5MERA 2YXWA 4R7DA 4IJTA 5DD0L 5B4MC 3TJEL 3LAFA 2BXZA 3GRGA 5CGTA 2C1OA 1YJDH 4HH8A 4WCYL 3SIKA 3MJWA 2XVKA 4ZMXA 1CYGA 1NCIA 3L3DB 4LEOB 4Q2ZB 5TK2A 1Z5YD 4Y5VC 1HXYB 4FQXB 5M7QA 5AUMB 2RA1A 3HG4A 3IJ7A 4FLSA 4IRJD 1P5UA 2ZXWB 3LDBB 4R7NA 2X4RB 2YD2A 3MV8B 5C08A 4BH7A 3ULSB 4ZK8A 2BSSA 1XR9B 2J1WA 4V1DD 1N6UA 2HN7B 4V2BA 1TEFA 2YUZA 4C56A 4LPVA 1VFMA 1RP8A 4NRXA 2YOCA 1EERB 1IILE 4Y9CA 5HY9A 4Z7WB 1T83C 1I8KB 5CEZH 4FQQB 4G80A 4IIZA 3VXOB 4ZFGL 4XBPA 3LS4H 4Y89A 1IZJA 5LUMA 3L9RA 1EHNA 4FNLH 3S88H 2EXWC 2JCCA 1UXSA 2AJZB 1MWAL 1OAJA 4D3CL 5CJ5A 3QE5A 4Y5XB 4W4NA 2UYLB 2DEXX 4Z7QE 2FD6H 3M1OA 1PQZB 3L1FA 1KEGH 1P9MA 3FU7B 3NEXA 4G7QB 4XWOC 1HCFX 1GS7A 4N1EA 5F6IB 2LU5A 4I0PA 1B0GA 3BE1H 3WD5L 2BZCA 3KPOB 5H35B 1T20A 1W72A 1HEJC 2Z31A 2FYYA 4G71B 4JW3A 1PG7X 3MX0A 5I9QB 2FYVA 3LXAA 2X9WA 2WTOA 2J6EH 2B3IA 1RK0B 2PABA 4JO4L 5I24A 3ATEA 4HD5A 3QJTB 4ANXA 1MFNA 3HKZA 1UD5A 2Z1KA 4DP6X 5TF1H 4WW2B 5DHMC 4A6YB 5ADOH 1ZHLB 1DLHB 3DECA 4A7GA 5LXVA 3EYUH 3WO4B 1T1XB 5DQJA 5IMMB 2AQ3A 3GK8L 1MIMH 3D4ZA 3MSPA 3T77B 2VDOB 3AU0A 1OPGH 3EO0B 1EZLA 3L3JB 3JT0A 5DJ6B 4HJEA 4XP1H 1OCZB 1NGQL 3HBZA 3OJDB 5HI4C 1CXEA 3VWKC 4E9RA 4QRRB 1PG7L 4I3SL 4P2RE 5GQBA 1UGKA 3STBA 4QYOA 4JN2B 2DH2A 3KPQA 4NGHL 1R3KA 5EZOL 1H0DB 2Y0SA 4M61A 2QLYA 4MSWA 1N0XL 4PGJA 1U3ZA 2ZUWA 5KYXB 5SWQB 1I3RB 2GHWB 1DYZA 4HEMA 1T2JA 3QUXB 1VF5C 2WLIB 4FFWD 3IGLA 3TGXA 2ED9A 1FAIH 3PL6B 1B3IA 1OTUD 1PLAA 3SDYL 5I28A 2H2PD 4KPHL 4PJIE 5AAMA 3V7MA 4HKBB 4F2ME 1G7IA 1SF3A 2H32B 1KTBA 3CX2A 4C58B 2BVOA 4ODTL 3PY9A 4LCYA 4JEGB 2Z35A 3NEOA 4LT7A 4N26A 1E6JL 5DD5L 2PTVA 5F7EL 1G7LB 5K5YA 3NCYP 4NSKB 3GD1C 2RFXA 4ZFOA 1GMIA 4EUPB 1I85C 3MBXH 5A6IA 1D6EA 3CVHB 3FUKA 2X4RA 1YY8A 3RBSA 5GGVL 4Y2OA 1PBYA 2VL4A 4XMKH 2ROYA 1XEDA 3IMUA 4BZ1L 1T03H 2X89D 2XN9D 1FLRL 2H6PB 4NZRH 1M2OA 5EZPA 1G84A 4P2CG 3MLVL 4K3JH 3S36X 1ZV9A 4YHYC 3VFMB 4Y9EA 4JRXA 5I1HH 1EXUB 4Y1SA 4B3VA 4ZW5A 2GEQA 1NEPA 3UACA 4HETA 3AVEA 3QDGA 1U4EA 1A5FL 1MXGA 2PCFA 1BBDL 2ZOWA 3APMA 4MJIA 2V2TA 2W92A 3C5XA 4A2MA 1OEZW 2ZX6A 4U4BA 4G6JL 3MFFA 4EBQH 2A1WH 4M6NH 4Y5XA 2AANA 5F7MC 1YN7A 1CXHA 4JJ5B 4W4OC 3BUYA 2YC1A 2X1PA 5HPMB 2FEEL 3T5WA 3U79A 4Z95H 4G7YL 4YL9A 3QORC 3ARED 3EYSH 1R3HA 3IJYA 4OZHA 2HFEA 2GC4C 5CILH 5DFAA 3CQFA 3V4LA 2EDLA 2BSTB 2NSXA 3NZHH 4AMWA 1MDTA 3GNML 1HH6B 4M4PA 4RCAA 4PJ7E 2CBMA 2FT8A 3W0WD 1D7FA 5JHLH 3ULUD 4E41E 3VRIB 4FG0A 1F2QA 1FJ1B 2UWEB 5I1EH 4N0YL 5GGTH 1BECA 4A67A 4E41D 4F9PA 3QJOA 2DBJA 2AXJA 4G82A 2OMXB 4YDVA 4FEMA 4UOQA 4HWNA 4HIJA 3X3FH 1EDQA 1G7MA 5EPMA 4WJ5A 2ENJA 2H41A 1CFVL 2WNGA 3TO4C 5JR1L 4Q9RH 4IEFB 4JRXD 3V9FA 1LK3L 4ACPA 4J3TA 3KNBA 1BZOA 2V37A 4GT7A 1QSEA 3N85H 4BHUI 1FLTX 2E7DA 3FONA 1QW9A 1YJDL 2X1XR 4JRXE 2Y25A 4NQCE 3ZT7A 3DHUA 3PYCA 2MNUA 1LK3H 4OFKA 3IWVA 3BEWA 3Q1EA 5F6IC 4KJWC 3QAZB 2AQPA 2RFXB 4FG2A 3T4YA 3V5HA 1JV5B 1NOLA 5CD5C 3WFHB 3MMEA 3SGJC 2G5UA 4O2CB 4L3FA 3C6EA 4OJDH 1NGPL 3GIZH 3L3OA 4I88A 2VDRB 2Z8VC 3F85A 2CGRH 2KI6A 2A0LC 2Z8RA 3F2LA 5D1XC 5ESVA 4I77L 2ISDA 4ZTOL 3WNPA 1F4YL 2ZUYA 3AG1B 3KYAA 3CMGA 5DJXB 2OSWA 2X4NB