3G6JF

C3b in complex with a c3b specific fab
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
226
structure length
221
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFSFTSSSVSWVRQAPGKGLEWVGLIYPYNGFNYYADSVKGRFTISANTSKNTAYLQMNSLRAEDTAVYYCARNALYGSGGYYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3 beta chain
publication title Structural and Functional Analysis of a C3b-specific Antibody That Selectively Inhibits the Alternative Pathway of Complement
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 221
sequence length 226
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6jF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6jF01
3TN0D 2Z8RA 2AEIT 5A2FA 1AO7A 4KV5E 3SJVD 1OP5K 4N68A 4UIKH 1YN7A 5DT1H 1G7IA 4P59L 4CU7A 3MUHL 3WO3B 3LV3A 4EVNB 4YR6B 4LL9A 5H37H 5IR1A 4JFYA 3G5VB 2X40A 3NFPA 5J6HA 1KCKA 5FHBH 2NTSP 3TH4T 2FLRT 2Q86B 4P99A 2ESVE 4YX2L 1U8QA 4G6FB 1TQCB 1G9ML 3NCBB 3DVGA 1RZ8B 3EDEA 4DVBB 3VFOA 4XCEA 4OD1H 5F97E 4KJYA 1NBVH 1QFOA 4NBZB 3LEVH 1ZTXL 4GT7A 4UBDC 2NY2D 5BOPA 4W6YB 5D7SH 2C1PA 5D93B 1DEDA 2VERN 2APXA 3CFCH 3B3IB 5T3XL 3VFWA 3B2UC 1ZLWH 3I6GB 3GMPA 4N0YL 4QNPE 5FYJD 1L7TH 3T4YA 3HC0A 5JQHC 4YZFE 5KBNC 4LEXL 1KN4H 3LKQB 3W0WA 4LHUB 1E4WL 5D8JH 4FQLL 4JANB 3QQ4A 1MHCA 3GZKA 5D7KD 3RI5F 4MNGE 4D9QD 1I8IB 2V5TA 1DQQB 3TBYA 2VLJA 1EVTC 1VFAA 4JRYE 1S7UA 2DD8H 5DT1L 4JFZH 4LLUA 3FRPG 1QSFE 1QBML 2YC1A 1ED3A 4CU6A 3OKLB 5IFJB 1ES0B 2X10A 4IOFD 3TO4A 3CIQA 4U0RB 1T03H 2HMID 5C8JA 4WHDA 1G7MA 5DMIL 4PP1D 5E8EB 3DX8B 1I3VA 1YYML 5HYQB 4HS8H 4X4ZA 1B4RA 5IMOA 4OD1L 4WGVB 3E6HA 2R56H 3LKPA 3UPRB 1GZQB 3VG0H 3QO0A 4U1NA 3V6OE 5I1HH 4HF5H 1CK0H 2GITA 4PRIA 4XI5C 2XWJA 4E42A 4JPVH 1F4WH 3CZJA 4M3JA 1L7TL 4PPTA 1CLOH 4QCIB 1D9KD 4ZQKA 4JR9L 2F74B 5F9OH 1N6QL 5D8JL 4MDJA 2I07B 2R0LH 4JFFD 4DN3H 2QEJA 2YA0A 3U4EA 3QIWA 4NDMA 4PGDA 3RWEB 1VEOA 1R3HB 4Z5RA 4FTVA 3LSOB 2Y07H 3QXUA 2HAZA 3WNMA 3F6IA 4TVPH 3MJ8A 4Q9BA 4F3FA 4P2RB 2Z8VC 2DBJA 2Z92A 4AG4L 3QIUD 3C87A 1U3HB 4PRNA 4FQXA 1Z3GL 4KU1A 4XP4H 2V2WB 3OB0H 3PG2A 5I8OH 3L3GA 4PRHA 3GUTB 1KB9J 1EEZA 2R56L 3BOVA 5E5MA 4S11A 3VG0L 4PJXB 2A6JB 3BGMA 2HT2D 5I1HL 2O93L 4JFXA 4JFDB 3LPWA 4LPXA 3BHBB 4YBLB 4HF5L 4N8PA 1WFTA 4WTZA 5FB8B 4LSSH 3LEXA 4K9EC 5IK3A 3INUH 5F9OL 3MBXL 1MCNA 1CD9B 1AGDA 4GMSH 5J06A 1WIPA 3DX9B 4LQFH 4U6TA 4DN3L 1JMZA 3VXTA 3LDBB 2B2XL 5I73B 3L5XH 1MJJB 3VH8A 2Y07L 3S35L 1A6TB 1IM9A 2HFTA 2CLZB 5EUOA 4M1CC 4UT6H 3RWIA 4JO1H 1DL7L 4U6VH 3GJEA 4GQPH 3GMNA 5CLWA 5I19H 2ADIB 4RAVB 4XP4L 3MXWH 4LLDB 4RFEB 3WFDL 2YPVH 3RBGA 3SPVB 5I8OL 4HPYL 3O41B 3DX7A 1S5IH 1JWSB 4NKDB 3U4AA 5K9KA 2CKBA 3KWWB 4POZC 5IF0B 5IB1B 4HPOL 2LVEA 4L3EA 3UYOD 1P7HL 5F96H 3DI3B 4GRMB 4UOJA 5C07B 3IU3A 5E6ZA 3EFDH 4OF3A 1MIEL 5BMFH 2X1XR 3OJ2C 4G7YL 4YHMH 4LSDA 3W5NA 2VDRL 5TE6L 2CSPA 3WHE1 4PGJA 4MB5A 3C6LA 5DO2C 5C0EB 2D4FA 3EYQD 4QRPA 5I1CL 3L5XL 3MJ7B 3W39B 2J8HA 5B3JF 5HVHB 3D87B 4UT6L 4JO1L 1ND0B 1UZ6F 1T5WB 1H8OA 4I2XB 1EFQA 3PABB 1A2YB 2EE3A 4ZPTB 5I19L 3UJTL 3I6KA 4PV9A 5FXCH 4M7KL 1A14H 35C8H 4K94L 1EO8H 4FFWC 4X8JA 4JKLA 4JDZA 5AWNH 1KCUH 1U8JB 3KPOB 2DMKA 3UTPD 4M8QA 2DAVA 3EGSB 3F6LA 1S5IL 1D5MA 4HXAL 5D7IA 5IW6A 3SOBH 5GQBA 3MA9L 2XTJC 4LVHB 1HEZB 2PO6D 5HGBB 4OLUL 3MFFB 4O02L 4JM2B 3K2UH 4NM8H 5ACMA 3EYOB 4XMPH 2GIYA 2CDFB 3C5SA 2R23A 4F15C 3RX7A 2CR6A 1KPUA 3N50A 1QFWM 4WU7B 5F9JA 2D03H 1ACYH 4JFHE 5IJVB 1UB5A 5I74C 1HDMB 3HNTL 2WBWB 1JHKL 1HYSD 1G7LA 1T0NA 3UDWC 3ARDD 4P2OD 5IFHL 3VXPB 3VXRE 4M03A 1ZK9A 4P2RE 5GGUA 1J8HA 2DI8A 4G6AC 1VENA 5E2JA 4WTWA 1A14L 35C8L 4OM1H 5T5NG 3FB5B 5DC9B 5EOTB 3VG9C 3W9EB 4NZJA 5JO5B 2CGRH 2JK5B 4JFQB 1AGBB 3QDMD 4JVUA 2VQ1B 1G7PB 3STLA 3VWKB 1D5XB 2Q7YA 3TVMB 1RZJC 4HGKC 4NN7C 4KRNA 4GBXD 1TZGH 3L3JA 1NCUA 1IEHA 5CP7B 1IC7L 4NNPH 3KJ4B 3ZL4H 4FMFA 4CADB 1S9XA 3U48A 1FL6A 2DOCA 1SJEA 4NQXA 4ZTOH 5IEKA 1RUMH 2BOCB 2F53D 3VI4F 1YEEL 4OIBA 2EC9U 5IKCA 3REWA 1W72L 2HYMA 2XNAA 5C0IB 1ACYL 1U3YA 5DVMA 3N1MC 1S78C 4I3RH 3UTSB 3FB6B 2GW5A 1LEKB 2R2BA 1B0GA 2CO7B 1F13A 4JKKA 1DR9A 4IM8A 3MCG1 5HPOA 5BS0E 3RWDA 1MCRA 2BOBB 1TTUA 4LSTL 12E8L 4MA3B 1I1YB 3FT2A 1P7QB 3MLYL 3R06A 4OM1L 4PJ9A 3VMPA 1E6OH 1JNNH 2GJ6B 3HRZA 1IGTB 3FRPA 3LH2H 4FQQA 3ZYZA 4X6DE 1KJMA 2F8OA 1ZLUK 3QXAA 4PGZA 4NO2A 2O26U 5J8OA 2VWEE 2V7NB 3VXMB 3RX8A 1J10A 5DRXA 4N90E 1QNZH 1VERA 3HE7D 4IRJD 4YNYB 5FM8A 3LKOA 4O2CB 4JVPA 1NCBH 4ZTOL 4U6XB 2AXGB 5HJ3B 5FYKE 4GG8B 3WLBB 1M6OA 1KXQE 3ELAT 5HGAB 5DD0H 3PGFH 1YY9C 4ALAH 4Y2DD 2EDDA 4JDTH 4KKAC 4I3RL 4JHZA 3QQ3A 3IYLW 4HS3B 5K9QI 1G1CA 1ULVA 5AAMA 1N6UA 3VXQA 5H8DA 1CQYA 5BV7B 3OR7A 5JDSA 4P4RB 1IC4H 5JW4N 3DMMD 1AO7D 3H7LA 1N5AA 3IB4A 2XG5A 1HCVA 3E6FA 3LH2L 4U3CA 3DECA 5IT2L 2ADJA 4P2CG 1F8TL 1W0VB 2VAJA 3GMMB 1EVUA 5IWLA 4TUJB 1MI5E 5DJXB 1T1YA 4HJ0D 1A7QL 1BOYA 2CD0A 5KVGH 5HDBE 4GRLA 4NC0B 5F9DC 1NCBL 2VABA 1OTTC 4OF0A 4Z7VB 4UTAH 2H9GB 7CGTA 5IOPA 4YC2C 2OP4H 5TDNB 7FABH 3PGFL 1YEJL 2EH7L 5D1ZD 3S6CA 4F33A 1J0YA 4PB0L 4JDTL 3WE6B 3WNNA 1IZKA 3RPIB 2XOTA 3I2CH 4NKMA 3W0WD 3EIFA 2J8UA 3VXUE 4GLRH 3BRFA 5C0DA 3IKKA 3GSRB 3OV6A 1DEEB 2PCPA 2XQBH 2VLJD 2W1NA 4YQXH 2B0SL 1ZT1A 4FABL 1WBXA 5F7DA 2X7LB 1LGVA 1JF1A 4JVWA 1XGTA 3VA2C 1OD9A 3M17B 2BNRA 3EYVA 3TO4D 5T3ZE 1INQB 5E2UH 1CXKA 4IIQB 1MCOL 5DMKA 1DN2A 4OF7A 1BECA 5E1AA 3QRGH 2Q8BH 3G5XB 2V17H 4OZHF 2MHAA 5ESQA 4DW2H 4PG9B 2OP4L 2XA8L 4JFOB 5IM7A 1SEBB 1CE6B 1I8LC 5KS9E 1DBJH 1NGQH 1YNKH 3RY6C 2FDBP 2DKMA 1CGSL 4U2ZA 2X4NA 4PRAA 4PRID 1MWAB 2I5YH 1JCKA 2B4CH 4LVOC 4NQTA 4D0CA 5EO1A 3O2DA 5HHME 2X4OA 1AC0A 3UTSE 4N1EA 4YHLL 1LK2B 2EE9A 5ALCH 1E6JL 3T8XA 3AMLA 2L0DA 3PHQA 1NUFA 3QIWD 2BCKB 2HKFL 2C3XA 4PV8B 5KSAB 1L6ZA 2DIJA 2GJ6E 4B7LA 4FTVD 3MOAL 2B5IB 2ICWI 5C9JA 5DI8B 4M02A 3TA3B 5T1DL 1JZ2A 2P5EA 2XWBB 3P4MB 3VGBA 5CMAB 2IQAB 4JRXA 4DZ8A 4LHJB 1XGRB 3H9SB 2E9WA 2OI9C 3QRGL 1FZJB 3GJFH 4DW2L 5C6TL 1XIWA 3GDBA 4LNVA 5ITBH 1DANT 4MB3A 5F7HA 4K71C 3RWFB 4HEPG 2ITCA 2B1AH 1S7WA 4LKXB 1NCNA 3HI6L 1I7TA 4CN6A 2B4CL 2VKWA 3MA7B 4X7SH 1FORH 5TGBA 3HZVB 4DGYH 2Z31A 1JZ5A 1BD2B 3A0OA 3QUMB 2BXYA 5CJOL 3MXVH 2XXMB 3ULUC 1LEIB 1PD6A 2HG5B 1DE4A 5E6IA 4HKBA 1URLA 1P2CA 1YEKH 3QDJA 1IM9D 1DQTA 4KRPD 5BRZE 4D3CH 1BX2A 3N0PB 4AZ8A 1KTDB 3BGFC 4OGXL 4XNUH 5MENB 3VDCA 2HFEA 1BQSA 4RMQA 3CNKA 5GZOD 5I17A 1HKFA 3RL2B 1L6XA 2GK0A 5GGRY 2QQLH 5K59F 5E9DA 4Y16B 4CVXA 5IW1A 4HGWB 4KUZL 3L3DA 4L3ED 1KENH 2NY5H 5DMGD 3T0DA 3VGHA 4WFEE 1JNJA 5I1LB 1MFEL 2B1AL 3GRWA 1QOKA 5BCAA 1JFQL 2BZDA 4Z0XB 1FORL 3KPLA 1AGCB 3WIHH 3LHPH 3DTXB 1F4XL 4DGYL 3FMGL 1YJDC 1ORQB 3NCCB 1CICB 4OZIF 1WLHA 3C6LD 4XNYL 5IHBA 4QRPD 3T0AA 4X83A 2KBGA 3FN0H 5DLMH 5KTEH 1MFDL 4GSDH 2WIIA 1ZVSB 2EE2A 5JIPA 1UM5H 5ENWA 1I9RL 2RB8A 5EZLB 3U6RA 4CJ1A 2ZSVA 5IQ9B 5DYOB 1WFUA 2EXWD 3EDJA 1IAKB 1MLBB 4G8EA 3IF1A 3CX5J 4TSCH 3QHFH 2LVCA 3P30H 4I0CC 2H32B 3FZUC 5E2WL 4PRPB 5JA9A 1JV5A 2X1PA 3IT8D 2BVOA 3QWRD 5CEYB 1C16A 3VFSA 3K4AA 2VZ1A 4X6CE 3TIDA 4WWID 3ES6B 1OVZA 4DQOH 5I1KH 2V9QA 4GQ9L 5LAXB 5IFAL 5DFWH 4PREA 5HY9A 2C3WA 3WIHL 3LHPL 3ULVC 3WFEH 3VWJD 1HXMA 3O4LB 1UB6A 4TSBH 3W9DA 5KOVC 4NYLB 4D94A 5I75B 1MFAH 3O8XA 3FN0L 3DIFB 1NAKL 2DQDH 2XACC 3FOLA 4NSKB 4TRPH 1NCTA 5DLML 2FECL 5KTEL 1D5BA 1UQSA 4GSDL 2NZ9D 4F9PC 1T1XA 1J8HD 3VD9A 4MCYB 1TETL 1IQWH 2DF3A 4ZDHA 1CLYH 1ZA3A 2FBJH 1CT8B 3BKYH 3P30L 4HDIA 3L95B 3Q6GH 3NTCH 1S7RA 4LVNB 5GRVL 2NZIA 5IROC 5CSGA 3O45A 5DD3L 3JVGC 1BMGA 4XCFL 4NNYA 4FQXC 1QFWI 1R3JB 4DQOL 2CIIA 3CFBA 4D8PA 3JWOC 4Z7OE 5IP4A 4PJGF 5JORB 1T80A 2QQNL 1OF2B 3WYRA 4EI5D 1L7IH 1KIRB 3MV01 1GRWA 1JHLH 1Q9LB 4ZFGH 3WFEL 4K55A 5H37G 4ODSL 4TSBL 3HTLX 1BD2E 4YHNA 5DRZA 1MRFH 2UWEB 2XN9D 4OQ1A 3FFCA 4R96B 1J1PH 1D6EB 1QHOA 5AZEL 4PJDA 2DQGH 5L0QB 1WJ3A 5D2NE 4G9DA 4RISH 4QXGH 3V6FA 1ITBB 1NEZB 2AVGA 4M62H 2CR3A 4MHHI 5D5MA 4U1KA 5DHXB 3VFNA 1MUJA 2XKUA 5TE7H 2QSCH 2DQFA 5F71A 4Z95H 5IG7B 3TYFB 2AJXH 4PJ9D 2NX5A 4XBPB 2UVEA 4PJHF 4X6FA 3G5YB 1P1ZB 1CLYL 1DFBL 3QIBA 2BVQB 3CVHL 1H15B 4AEIH 4DUXA 5ESVA 3KLAA 2FATL 3S97C 3HS0A 3F65A 3MNVB 3O9WA 3UBXB 3FO0L 3GFUA 4KROB 3BUYA 1YY8A 5CZXD 4ZTPL 3TEUA 1NLBH 2FJGB 3HLAB 3T08A 1V3JA 1L7IL 1CFNB 5IBLD 1MCLA 3S7GA 2ICWJ 1JHLL 2A6IA 3K2MC 4KAQL 3WS3A 1DQMH 2X4UB 4R0LB 2F58L 1F11B 1E28B 3D25A 5D7JA 1KN2H 5GISH 4X99A 3V4PL 5C09B 2BVPA 1FIEA 3B43A 4HG4K 3CC5B 4QXGL 2MCG1 3EJZC 3FO1A 2V5MA 4FN0A 1XCTA 4PJIF 1WCBA 4KK6C 2VNCA 3QUKB 5IBUG 1EDQA 4NN5C 1WWWX 5EU6B 1P5VA 1I9IH 1RZKC 5TE7L 4YGVB 4AEHH 2WUCH 2AJXL 3U1SH 3FHQA 3DXAA 1MAJA 4YWGH 2H26B 4X9IA 4WV1A 3WUZA 1JGEB 1XF4B 5I1EH 2EDRA 4K3GA 3SDCA 1K4DA 4PJ7A 3WHXA 5IMLA 2YZ8A 3SGDI 4XX1G 4XH2A 5DDHA 1D5IL 3LIZL 4DKDC 3S5LA 1AI1H 5ISZA 2DTMH 4TUKL 4P23B 3J7HA 5TF1H 3SBWA 2ZUSA 1TJIH 1I1CA 1OPGL 3FRUB 4NQCB 3VD3A 1QA9B 1DQML 3O4LE 1MQKL 3MOBL 4PB9H 1IARB 1KN2L 4JFEA 4HKZB 5FA4A 1BVKB 2QADD 5KVDL 1CVSC 2J3SA 4LCWB 1RJYB 3S9DB 4PTTB 2FWOB 1A9EA 3KHQA 4OF8A 1S7TA 4YO0B 4WHYH 5C0FA 4XNQA 4KWUA 3SHSA 3HI5L 2F8XC 2BNRD 1ZT4A 4WI6A 4L9LB 1EFXB 3AS2A 2AW2A 2AKRB 2NXYC 3TCLA 3TFKC 5GGQL 2K7QA 4NM4L 1QRND 3B9DA 2QHRL 5EA0L 3GHEH 3KPSA 4UT7H 2DTML 3LQZB 5LGJA 2X9YA 4OJFH 3VMNA 4KK9D 1N4XH 1LO5A 3O4OB 1DN0B 2R39A 2OMBA 2UWEE 5FO8B 4Z0BL 4FXKB 1TITA 2IBZX 3GMLA 3GB7B 4YHKH 2ARJB 5F8QC 3AU1B 4YIQB 3RWGA 2VAAA 5EWIH 5I0ZA 1SY6A 2VLLB 2O5ZL 3GEWB 3QFDB 4JO2H 2E7LA 2UV3A 4LAQH 2X4SB 1FL5B 4ZFOB 5J12B 2HLAB 4Y4HA 3REVA 3QHTC 1I7UA 1A64A 4LSQH 5EU4A 4Y4KD 2P5ED 2OTUB 1FC2D 4IRSA 3IJHA 1T66D 1HINL 1B88A 5FKAA 1P4IL 1MEXL 4PJ5B 4PJ8C 2FSEA 4XGZB 3GHEL 3TBTA 4BH7B 1T2JA 4QRSB 1YMMB 5J1SC 2DICA 2X89A 2JELL 2XQYK 2VDOL 2XI9A 2E9BA 1N4XL 1XIWD 1KCSH 1F2XK 3HR5B 1YDPB 2YN5A 3WFCH 1BIIB 3F58H 2LE9A 4P5TB 5C09E 3W5MA 2FECI 4XHQA 3L5HA 3ILPB 3IXAB 2MKWA 2CRIA 3H9HA 1A6VL 1ZKAA 3MRGA 1RU9H 4X5XA 5FF6B 5KSUB 1Y6KR 5EWIL 4MD5B 4P3DA 1JGDB 3QULA 1NLDH 5T1KB 3V0WH 1RQ5A 5E6ID 5GGVL 2Z91A 3KPPB 3QDJD 2EDEA 5D1XA 5KANI 1UCBH 2ICWB 3DX6A 1X44A 1FLTX 3I9GH 1S7XA 1UZ6E 3RGVA 4OB5L 1ZS8A 5I1AB 2W0LA 3D85B 1Q1JL 1HIMH 4PJCF 5GSRA 4NQDA 5EZJA 4L3CA 3C08H 4FP8H 3AAZB 5F7FA 2IAMB 1YN6B 2ZCLH 3K3QA 5E9DD 5ETUA 4O4YH 1KCSL 5IIEA 2GSGA 4BSWA 3KXFB 1HHHB 5H2BB 1G0DA 1J11A 3SDDC 3SKMA 2CJUL 3F58L 3WNKA 1LQSR 4S1SH 4QOKB 3WJLC 2XZQH 5F6IB 4OLZH 2QR0B 1FLRL 4LCWE 5I0DA 1FRGH 4OCXH 1NANI 5IB4B 4WW2A 5F7EL 1N3NB 1S3KH 1EEYB 4R2GD 2A77H 4YFLI 1NJ9B 5MEQB 3Q2CA 5GHWL 5FM4A 3V0WL 4I1NB 2DKUA 5DA0B 4ENEC 4NC1C 4TSAH 3BISA 5HHQB 2FLBT 4NJAH 4LCYA 2IH1A 3I9GL 1T20A 4V1DB 3A6OA 5TDOA 1VPOH 3T0EE 1RK1B 1CL7L 3G6JB 1KCVL 4JZOB 4U31A 3TN0B 1OM3H 1OAZH 2G75A 1JTOA 1X5HA 3T4AB 4HIHA 2ZCLL 5C0AE 1W72B 3LN5A 3AS0A 3SY0B 3IFPB 1UVQB 5FOBA 4J8RB 4KKBC 4S1SL 32C2B 4PLJC 1QEWB 4OLZL 1PYWB 1AXIB 5CIPB 4LF3B 3L3HA 4AH2A 3FO2A 5D1QB 3QH3B 1IGIL 5GS1B 1S3KL 5C6PB 4YK4B 2A77L 5JW3H 2PXYB 2D7PA 4F9LC 5ACZB 3O8XD 2GTZA 2V5YA 3BPNB 4JY6B 5DJYA 5IUSA 1CDCA 1TVBA 1MPAH 3RIFK 3I02B 4MJIB 1IFHH 3ARWA 1NC2D 1TJGH 1R6VA 1S5HB 3QDGE 3BH8A 4P9HL 4HKJB 1VPOL 5C0BD 5CZVL 4G9FB 5C6WH 4PJ5E 4G8FB 2QTEA 4MDIB 4MVBC 4OZ4A 1OAZL 4ETQB 3DV4A 4G8GD 1BFTA 4I0PC 1C08A 4EEEA 2BNQA 3JV0A 4EDXA 4L4TA 5B39A 5JHDA 4I3SH 3V79C 4UDUA 1T3FA 4X9GA 4ZNEE 2YPLB 5IHUL 1N59B 1G6RL 1UKTA 4DUWA 2NY0C 2VDKL 5J57B 3FFCD 3DBXB 4OCWH 3V7AE 3QJHB 4ZAKC 1PEZA 4M4RA 4G3YL 3DUSA 5DC0A 4QHKI 5IMKA 3PP3H 2IANB 3TZVC 4BFEA 4KDVA 3LS4H 4L4VD 3T3PF 3QT2A 5L88H 4HJJH 2Z31C 1TJGL 1FNGA 2NXZB 3VCLA 4LPWA 2NX5D 3GO1L 4B41A 2HWZH 2IFFH 4P46D 3MRHA 1XF2A 2VDPL 2XZAL 1KNOA 1M7IB 2QQQA 3BW9A 4X98B 4YAQA 3UJJH 3QIBD 3QRFM 1W0WA 4XNMA 4PG2A 1HSBB 3B83A 4MB4A 2XWTA 1OP3K 2ESVA 1M71A 4EIZC 1IGML 4I18A 1A1NB 4M5ZL 3KXFE 4BZ1L 2ZUXA 3NFNB 1KLGA 2AXFA 1LK3H 3OL2A 3TBSB 3QIUB 4LPVA 3M45A 4HZLB 3VI3E 1BQLL 3EOTL 5DZNA 3NGBB 3SE8H 5D2LE 5D7JD 3IDIB 4NRYA 4OCWL 4LLQB 4N0FA 4WEUD 1XCQB 1CFQA 4OCSH 3RWHA 4KTDL 3BWAB 3STBA 3TWCH 1RUAH 1YQVH 1I8KA 5L7XL 2P47B 4MNGA 3PQYB 1FE8H 5D6DC 4U1SA 4JLRB 2P8PB 1U93A 4AJ0A 2WQ8A 1KYOK 2D7MA 3LRGA 3H7BB 1OGAB 1UWEH 4OZIB 3G6JE 1A4JA 3DXAD 4ZUTA 5DJ8B 1EAJA 5GGVY 5MHSE 2P7TB 5CBAA 3MCLL 1GSMA 3SJVE 8CGTA 3SDCD 4KK8C 3PHOB 4ODTH 4HT1L 5ID1B 3GBMH 4HS6B 3MRPB 3FHAA 3QHZL 4Y19D 3LKSA 4D0DB 1BFOA 3T0XA 2WBJB 4JHAL 1LK3L 1NGWB 4Z8FL 3QEQA 3PGCA 1REIA 1X7QA 5ISZD 3VDAA 3MV8B 3EO9L 4K3JL 3TJEH 5I2IA 3SE8L 3HI1B 2AK1H 4PTUB 3WCYA 4RGND 1WZ1L 4JFED 3QEUA 3V5DA 5D7LD 5C0ND 2R2EB 2Q87A 2NY3D 1WBYA 2C26A 3CMOH 2AJSH 2MTPA 4JDVB 3H3PL 4L8SC 3QPQD 1FO0L 4L8CB 1ZHKB 4I9WE 3BO8A 3BEWB 1JZ3A 2OXGA 3AXLA 1UWEL 4QXWA 4YH6A 4M7JL 1VKXA 3RFZC 3SDYL 4KKNA 1OWRM 2H3NB 4QHNA 5D7KE 3WS6A 4D9QE 1T0MB 3SCMA 3F7VA 2NPLX 3RDTC 1ZWIB 5FKPA 5A2IH 2VXUH 4ODTL 4GJTB 3BDYH 4TPRH 5CWSA 3IAPA 5EBMA 3QUZC 4YHIA 3MRRB 3CSYB 2QSTA 4EZMA 1Z0MA 1VADA 2AABH 5GGSB 3TJHD 4EN3B 3QG6A 5IHZB 4NZUL 3D18A 3LPGA 5I8CB 3D3VB 3B8YA 4KKCD 2AK1L 3LKRA 1DLFH 2NY1D 3FFDA 4KJPD 4YHOL 4KJWC 1BOGB 5B38B 4UDTB 3FB7B 4MA8H 5JIIA 4LOUD 3C8DA 1XR8B 2IANE 3BPOB 2AJSL 4DGIH 3IJYA 1VGEH 3MRFA 3SDXF 4L9DA 4LPCA 4XWOD 2NTFB 1CL7I 3KYMB 4FG6C 4KH2A 4QGYA 1N64L 4XCCH 5LXGH 3QA3A 5F1SA 4G6MH 2PTTA 2ZG2A 3GJFB 2X5PA 3ZE1F 2YPKA 4YR6A 4Y4HD 4JFFE 4G8IB 5KZCB 5EU7E 4CGTA 1Z2KA 2EYTB 2JCCB 4X5WA 4K9EH 4I8DA 4ERSH 2Q86A 4JKMA 2E7MA 3WKMH 2OL3L 4IRSD 3ROLB 4NO3B 4OUUB 1KV3A 1RZ8A 4DVBA 3PIQA 2EEDA 2OR9H 2IGFH 2V5RA 4ZPVB 3BZEB 3BAEH 4HCRH 2NY4D 3B3IA 3I6GA 1AR1D 4NKIH 5C0JA 3O9WC 4PS4H 3LKQA 1U8LB 2DL2A 4LHUA 3RA7H 4ZO8A 4OZGF 4JANA 3LD8B 3IRZA 1EGJH 2HT3D 3MMEB 3RNQB 2X05A 4ZODA 2WWMD 3PQYE 3UP1A 1DVFD 1I8IA 4PJFF 1DQQA 5HHOB 4KI5E 3D2UD 1GGYA 2XY2A 4DAGH 5HYSG 5LXGL 2XPGB 3BESR 2KQNA 3P0YL 4NQVA 2O61B 4DGVH 1A1MB 4WWKC 2AJUH 4PJBF 5D1XD 2A73A 1YA5A 3OKLA 5IFJA 1ES0A 1IAIM 4K9EL 4OQTH 2IH3B 3RGVD 1J1OH 5E8EA 4HK0B 2N56A 2BP3A 5HYQA 1TCRB 4GKOA 4PR5B 2IF7A 3VXNB 3OAUH 3T2QA 4GKNB 5FAAA 3UPRA 4QHKJ 4R4ND 4R3SB 1GZQA 5IMMA 4WV1C 1CE1H 1XF5B 3X11A 3BAEL 1YEHH 3H42H 3MV8E 4H8WC 5F21B 3EOBB 5LQBH 1QRKA 1BJMA 2M26A 5GSVB 3WO4C 4M5YH 4PS4L 1TJHL 4YDLC 4KMQA 4F2MB 2F74A 1WGOA 2WSKA 4LHQB 4J1UB 2I07A 4WUUB 1K2DB 2ZZUT 4OAWB 4IJ3C 1BQHB 4FFZH 4PY7B 1JL8A 3RWEA 4QRTB 3N1QC 2VSCA 5EU3B 3LSOA 2KZ1B 2DI7A 1HSAB 4HUVA 5BVJB 3QUYA 5EORL 2ZNXA 1RZ7H 2MOVA 4OIIH 3PWLB 4LARL 3VXRA 4BFIB 4P2RA 4GG6F 2VXTL 4OLVH 3LS5L 4KKLC 1U3HA 1JI1A 4I3GA 5DHVH 3IDNB 4ODBD 2V2WA 5DEGB 4UI2A 3GUTA 2BHYA 4RFOH 3DMMB 3ZE0E 4XB8A 1NUNB 2OK0H 1S7SB 3S36H 2YUWA 4PJXA 2A6JA 1KSRA 1BAFH 2AJYH 4JFDA 1OP9A 3BHBA 4CMHB 5DGQA 3UTPE 1U8NB 1TIUA 2P45B 3BGAA 3OKDB 4GAJH 1IL1A 4MD4B 3BP4A 4P0DA 4LU5L 2N1KA 2ZPKL 1BZ7A 2HA1A 4J3SA 3I85A 1QSVA 2NW2B 3DX9A 5CJBA 4KQ3L 5D72H 1VSCA 3E3QE 1QFWH 4WFFD 1U8KA 3MBEC 4D9LH 1OTUC 3U7WL 1RZJH 2NLJB 1A6TA 1JPTH 1FL3B 1ZSDB 3KS0J 3VGDA 1RZ7L 5D1ZB 2PR4H 5E5UB 3K4DA 2JCCE 4NUJA 5BS0A 4Z7NF 1TPXC 2ADIA 3JWDC 3MODH 2E7LC 1MVUB 5JTWA 1IBGL 4RFEA 3SPVA 2EKJA 5JQ6H 3KPRD 4X6DA 3SE3A 3KJ6H 2IMMA 3MJ9L 5DJ2A 3O41A 5FV2A 2W92A 1JWSA 3MUZ1 1UJ3B 3BPLC 1HWHB 2W59A 2YMXL 2OK0L 3MACH 1NBYA 1V05A 3S36L 4NO0A 3KWWA 4X7TA 5IF0A 1BAFL 4UV7H 1Y18B 2BNQD 5IV2B 1AD9B 4L4TD 3KYOB 4LP4A 4GRMA 4M6OL 4Q0XH 4TTDC 4Y5YB 1FCCA 3SKOB 3QDME 2C9AA 4UU9B 5C07A 2XRAL 1DQDL 4HFUL 4PP2B 4GAJL 4XXDA 3BP7A 1V3LA 5HYJB 1VACB 4QF1B 6CGTA 1BHGA 4CN1A 4P9MH 2J4WH 5C0EA 3U0PA 3VW3H 1C5DB 2BFVH 2F53E 3MOQA 4S10A 5FOJA 4XBGB 4LPUA 5GS2D 1IKNA 1RZJL 4GW5B 3VFGL 1R5WA 3W39A 2IPTH 1KC5H 3Q48A 4I4WB 5T1LD 3QWQB 1T5WA 1X9QA 1P6FA 3PABA 1A2YA 4ZPTA 2HJLB 3O6KL 3L5JA 3LZFH 1MQ8A 1Y0LB 4XWGH 4GW1B 3VXOB 1YNTB 4ZOEA 2YUXA 1QFHA 1R24B 1KB5L 3LN4B 3EGSA 4N0UB 1HHIB 4C55A 2CH8A 2RBLA 1XF1A 5D71H 1KFAH 3H3KA 1EMTL 5HGBA 3MFFA 2BSTB 3PUCA 4Q0XL 3CH8A 3P77B 4JM2A 4JQXA 5C0CD 4MYWB 1D6VL 1WVZA 1QLRB 1GAFH 5LGHL 1FSKC 4UB0L 2CDFA 4PJCB 4QLRA 4WUUE 1F6AB 3ARGC 4PGBB 4BUGA 4N1CA 4WU7A 2YS4A 4ZXBA 3PL6C 5F8RC 1HDMA 1BF8A 1X3DA 2OJZL 3K4ZA 1RY7B 1AP2B 2FR4B 3I84A 2ICEB 1XGUB 4X6BB 1LDPL 2H6PB 3U0WH 4HH9A 5HHVL 1UYWH 2E7CA 2IPTL 3VXPA 2APFA 1LMKA 2BHZA 1XF3B 3PNWA 1NKRA 3U30C 5BW7A 2ORBL 5CGTA 3LZFL 4WW2C 3NIDF 3FB5A 5CS7A 4M9OA 5EOTA 5GS0D 1LE9B 3UZEA 5BVPL 2VZTA 5F7KC 1U92B 4O58H 5I71B 4JFQA 1JPGB 3MREB 2P49B 1AGBA 2VQ1A 1G7PA 1VCAA 1D5XA 3PV7A 1SVCP 3TVMA 5I76A 2OTWB 3V6BR 5GRWA 5AEAA 3QEQD 2H2PC 4CADA 2V7HB 5FUZH 2BOCA 3S35X 5EUKB 3QSKB 3DUUB 4S2SB 5TPWH 1J9CT 1QBLH 2WQRA 2J6EA 5KS9A 5JW4Q 3ARFA 1UXSB 3QCTL 5C0IA 2OZ4A 4NPYB 2W9LA 2VZ3A 4P3CH 5IHLB 3UTSA 3FB6A 4KMLB 5ADPL 1LEKA 4PUBH 3U0WL 4GO6B 1UYWL 4RFNB 2BOBA 5DJDB 4ODUB 1I1YA 1P7QA 4CNIB 3W0WE 2GJ6A 1FV1B 1IGTA 4WGWB 3PV6B 4O58L 2OJEB 5SX5K 4FQJH 4YPGA 3SCMD 1FDLH 3BQUB 2CRMA 2G2RA 3RZCB 2ZUQC 5FCUH 4M61B 5HBBA 2P46B 4NBXB 3NPSC 4X8XA 4MXQC 5CD5C 3EDKA 3VFTB 3CVIH 3WJJC 2YXMA 4OZFG 3HUJB 4FQ1L 2BRRH 3PWPD 3X3FH 1ZOXA 2AXGA 3DRTB 5HJ3A 3CXHK 4GG8A 5HYJE 5HGAA 3CLEH 2DQTH 4XVJH 5I9QC 3TV3H 3OKEB 3SGJA 4CW1B 2YD4A 3UTZB 1ZVYA 4HKXB 3HNVH 3MRIB 4PD4J 2IG2H 4PRIE 4XMKH 4GUPB 4HLZH 4P4RA 1P69B 4ISVA 2K9UA 2PYED 2VH5H 4O51A 3S4SB 3EZJB 1QBBA 2P42B 1GC1C 1PAMA 5EOCL 4PLKD 5BRZA 3GMMA 1JGLH 1CXHA 2DLFH 1RUPH 4RBPK 1U95B 4TUJA 5DJXA 4FTVE 3BD4A 1RZFH 4K23H 4Q58C 3OXSA 3CVIL 4FNLL 3ULUH 4Q7DA 3CK0H 3HMXH 2BRRL 4LASL 2H9GA 5FO9B 4APQA 4CN4A 4H5SA 3ZDYE 5TDNA 4ZD3H 2VJXA 5EZIL 3BKMH 1KTLB 3ARBB 2COQA 2DQTL 4NN6C 1OAXH 4RSVA 3WNOA 1BFSA 4LGPB 3WE6A 4L1HA 5I1GL 1QO3B 1BJ1H 4QRQA 5DD1H 3RPIA 1MCSA 4X4ME 1AD0B 2ZUUA 4JPIA 2X09A 1FH5H 4G7VH 1DEEA 1J0HA 1X5KA 2VH5L 3VMOA 4UQ2B 5EO9B 1WISA 4YDJA 1XZ0B 1ZHNB 2X7LA 1U2HA 3P11H 4CVZB 4JO4L 3BJ91 3Q6FB 2OSLB 4YXKH 5JHLH 3PWUB 4F7EB 1BP3B 3ZTJG 4TN9A 1INQA 5T33H 1WITA 1OAUH 3D0VB 1GIGL 4K23L 3EYUH 5EUOE 3RVUD 4O2EA 3G5XA 2Q1EA 4Y89A 3HMXL 3O2WH 4LIQH 1YPZB 5EIIB 1GGBL 5FK9B 3L1OH 1JTTA 2NQCA 4JFOA 3MRKB 1CE6A 1ZEAL 5TFSL 2FD6H 3BKML 3NCYS 4X6CA 2WMPA 3BRGC 3VE0B 1HQRA 1MWAA 1X4XA 3KYNB 4ELMF 4OI7A 1T21B 1RZIB 2ZOKB 2A2QT 3ZHLA 4XVTH 3V6OC 1FH5L 3U9PH 2DDQH 1IAII 3QWOB 4NKOA 3WD5H 2BCKA 1IM3B 2DQCH 4PV8A 3O2VH 3WFBH 1UM6H 1R5IB 2CKNA 5IVXE 1S7VB 1CGVA 3TA3A 4JN1H 4WO4B 4J4PC 4P2RD 2FEDD 2EZ0D 2MFNA 1KGCD 2XWBA 4QRPE 1U3HD 5CMAA 3KR3H 2IQAA 3ULVH 5T33L 3WL9B 2P8LB 1XGRA 4XCYA 3H9SA 3RUGF 3OXRA 4OV5B 1YJDL 2YD6A 1G6RB 4KXZH 3S37L 2J88H 4HH8A 5I1DA 5IJKC 4UNVA 1FZJA 1MH5A 3HUJE 3WS6C 3EO0B 3ZKNC 3L1OL 5L9DH 5HI5D 1K3IA 2FD6L 4HC1A 4JFDD 1KBGL 3F62A 3RWFA 3Q5TA 1K4CA 5CBEB 4BFGA 1A3RL 4LCCC 4LKXA 1EJ6A 2Y36L 4O9HL 4YBHA 4YE4H 5E8DL 5D7IE 1I9JL 3LQAL 4KVCL 4LFHG 1VB9A 3MA7A 4JB9L 4FS0A 3IDXL 4V2CB 1G9EA 5F1NB 5K9QG 4JKWA 1FVEA 3DETC 2DRUA 1Z5LB 1BD2A 1FNEB 1IC5L 3O81A 3ZKXC 2DDQL 5ALBL 1JYNA 4ODVH 3SGKA 4HWBH 1TQBB 1LEIA 5D2NA 3HAEH 2HG5A 2VMFA 3ILQD 2AXHA 3WFBL 4WUKH 5JW5B 3VFPB 2ERJB 3JWOH 1ZLSH 4OLWL 1JNLL 5B3NA 43C9B 1KTDA 3NH7L 3SDXB 3C2SA 5MENA 2VE6A 4J23A 3ULVL 3MGTB 3BMVA 3P9MB 4OFPA 1A47A 4TUOB 3RL2A 2J88L 2DIBA 4NZRH 3WHE0 3ZSTA 4E41D 2EEBA 2R69H 3AREB 3QAZC 3SDDD 5L9DL 4Y16A 3VRIB 3X14B 2GT9B 2LQRA 4HGWA 2N7BA 4HZAA 1TQCC 5I1LA 4YE4L 5D6CB 3QEGL 5C07D 5J6GB 2IPUG 4OCYL 1NSNL 4Z0XA 1WV7T 2QLVB 4N8VB 5DJCB 3VFRB 5JDJA 3DTXA 3DVIA 1JPSH 2D0FA 5GS0L 3QQ9C 4LMQI 4BQ9A 1ORQA 1CICA 1L0QA 5ESAB 4HWBL 3ULUF 1JUFB 4KMTH 3L3OB 5JZ7D 1N5YH 2FX8L 2XN9E 3TESA 5E08L 4CJ0A 4H20H 1ZVSA 3E8UH 5IQ9A 5DYOA 3DYPA 4PJFB 1IAKA 3BE1L 1MLBA 3DSFH 5MI0C 4CMMB 4NZRL 3S96B 2HVKB 1YECL 2H32A 4OD3H 1F3RB 5CEXA 4PRPA 2HT4C 2JJTA 1YPZE 3V8OA 1RURH 5E7FA 2ADGB 5CEYA 1LO0H 1P7KB 5B4MD 1RUKH 5SV4A 1QLEH 3ES6A 4JM2D 1RZKH 3TF7C 3VRJB 5LAXA 4OZFA 3UXFA 3L9RB 4NFCA 2A0LC 4UAOC 4Y8AA 3D39B 2ID5A 2RFXA 5C70A 1FO0B 1PFCA 1AXSB 4YFLF 1N8ZA 1NUDA 3DARA 3O4LA 3NFSL 4H1LG 4NYLA 4P4KC 2Y5TB 1CTNA 3V7AG 3G04B 2ATKB 2C3VB 1QKZH 5E6YA 2VXVL 3DIFA 4NSKA 4BZ2H 3EYFB 3QUXC 4MA1C 1GZPB 3E2HC 4O2FB 2FO4B 1CU4H 3WIFA 3N06B 3L7EB 4AQ1B 5IBTL 1I1AA 3DSFL 2ZP0T 1CT8A 2LV4A 3RHWF 1XH3B 1TFHA 3SKJH 4OD3L 5DJ0B 3QUYC 1RURL 2DM4A 2NYYD 3P4OA 3VWKD 2YD9A 4GG6B 1BM3H 3TVMD 2BMKB 1FQ9C 4DCQB 1R3JA 4XXCA 3DGGB 5DSCB 4XP5L 5JORA 1OF2A 1MNUL 3IJSA 1JMXA 3QNZB 2DL9A 3ULVF 1Q9LA 1ZT7B 1HE7A 1ZV5A 3O6MH 5L2KD 4HAGA 1WAAE 2UWEA 4R96A 5C08B 1D6EA 1T0PB 1NDMB 3DSNA 4AMKH 3VRLF 2ZG3A 4N0CC 1QKZL 3UTSD 1NEZA 4RMTA 4XPHH 4BZ2L 2XFXB 4OKVA 4XVSL 1LO2H 2D7TL 5L6YH 4I48B 3AB0C 2AEPL 3FN9A 3TYFA 5IG7A 2VITB 4HWZB 4XBPA 1F02I 1P7QD 4JQIH 2GJ6D 5DUBB 3G5YA 2JJUA 1P1ZA 5C0RL 2BVQA 5T5FH 4R2GB 3QG7L 1OAKH 1NPUA 3GBLA 3RY5A 3VXMD 1H15A 3X3GL 4EDWH 1W0YT 5EIVA 4V2BA 4PGCB 3FQRB 2BNRE 1EV2E 3CX5K 3UBXA 4JY5H 1WC7A 2FJGA 2PTUA 5HYIA 3HLAA 1WIOA 3J8F7 5CHNB 3SE3C 4JZNB 5HI4C 2VWEC 2FYYB 1QRNE 2CUIA 1XMWA 2X4UA 4R0LA 4HIXH 3HB3D 4AMKL 2VL5B 4POUB 2KL6A 5C09A 3IKCB 4LLMB 3CC5A 1NGPH 1EBAA 3FN3A 2YA2A 2HTLC 2BVTA 1A21A 1BZ9A 4W68A 1YEFL 4R26H 4JAMB 5L6YL 3N1FC 1ZHBA 1U8HB 3F8UB 3MRCB 4JM4H 3O3EB 4G80B 4YGVA 1PSKH 4KZDL 2JIXB 3OKKB 3FT3A 1AIFB 1OW0A 1X5YA 3GMRB 3NCEB 2H26A 5TE4L 2ZUTA 1H0DA 3HE6C 1KELH 1JGEA 1XF4A 2Y7QB 4YUEL 1UEMA 4YBQD 2R2HB 3VXSB 3ZT7A 3CPLB 1P6AB 2IPUK 1MHHB 2VXQH 4K8RD 5LCVH 5CP3H 1AE6L 2K7PA 3DPBA 1NC2B 2P5EE 2FJFB 4H0GA 4XPTH 1B6DA 3D39E 3OTTA 3OAZH 3FRUA 4QWWC 2H1PL 1K8DA 2VIRB 4WFED 4HKZA 4G8GB 1BVKA 15C8H 4FQHA 4GRWH 4JQXC 2GI7A 1NL0L 4IMKA 4LCWA 1RJYA 3SO3C 2D7NA 2FWOA 3LRSB 2NY6C 4CL7A 1CN4A 4IRZH 1KEGL 4UTBH 4LVEA 4ZXBC 4C83B 5CZKA 1R5VA 2DQUH 3MQIA 1F42A 4R7NB 5LBSH 4L9LA 1EFXA 2HVJB 3B9KC 4WHCA 1IEAB 3U9UB 4KC3B 2AKRA 1INEL 4X9HA 4X7CC 2IEPA 3QDJE 3T0EA 4U1LB 4LRNH 5EBWB 4L4VB 2EO9A 2R0ZH 4JPWL 43CAB 3IFOB 5EC1A 5C3LD 1DBBH 2AV1B 3WIIL 4URTB 3K7UA 3IRPX 1DN0A 2XTJB 4KHXL 1NDGA 4R6UA 3CFDA 3IS1X 1A6PA 4FXKA 3K8KA 5CJXC 15C8L 3UO1H 1H5BA 3GB7A 3P0VH 3WUWG 2A6DB 2DM7A 3DNKA 3RVVC 2ARJA 3AU1A 4YIQA 1SHMA 5I15H 5DHVB 1IGJB 3KVQA 3QFDA 2VLLA 3AS1A 2FNBA 3ARFC 4MHHG 4UTBL 2C5DC 4FQIH 1IILE 2X4SA 4JY4B 1KOAA 4NZTH 2X70B 2FJHB 5J3HC 1FL5A 1CFBA 4XPBH 5KSAD 5I1IH 5I74B 4N5EC 2HLAA 4BQ6A 4OCMC 2Q8AH 3V9FA 3TA3D 3GIZH 1C5BL 1RHFA 5F7WC 1D3CA 3MLWL 1A6AB 3RVWD 3H9SD 4MXWL 4R4FL 4U6YB 5EOCJ 4PJ5A 3BFOA 3PDOB 4XGZA 1MCCA 3VG9B 4RQQB 4BH7A 1RK0B 5KSVB 1P4BL 2WWKO 4QRSA 1D7FA 1IGCH 2AJVH 5C86A 3BIBX 4J3VA 2VZVA 5K93A 2L7UA 4LQ1A 3HR5A 1YDPA 1BIIA 4FQPA 3NZHL 4P5TA 1H3UA 4NN7B 3ILPA 3IXAA 4RX4A 4PRBB 4HULB 5T1MB 1F3DH 5JPMB 5DA4A 1FNHA 5KSUA 5FF6A 1BD2D 5I15L 4Q6IC 3V6ZB 1JGDA 4Z7WE 5F7NC 5T1KA 1WT5C 2XZZA 1IT9H 4O00A 4LEOB 1RFDH 4Z77B 5GRYA 4NZTL 3IETB 1KB5B 1IC1A 4LPYA 2J2ZA 4K7PY 2BSRB 2R0KH 2ICWA 3GIZL 3CFJB 3SE9L 1KTRL 3BZ4A 4DOHE 3VXSE 5MEND 1RHHB 5I1AA 2IFGA 3D85A 1DSFL 1AC6A 1JGVH 2B1HL 5AUMB 1OB1A 4DKFH 3CDGA 2FGWH 2OM5A 5E2TH 3O3BB 1JHTB 3NN8B 4QRRB 2UZIL 3LCYA 5ICXB 5C0BE 5C9KA 3C9NB 3CMGA 1KEMH 3KXFA 1HZHH 4NQEB 5H2BA 1MCJA 3P2TA 5GRUH 4G8GE 4DK3A 4HUKB 3FAWA 1L4IA 3TBWB 5KVFH 5ACLA 2PW1B 4MAYC 4APQC 3HFML 3GK8H 4R8WH 5FM5M 3MPCA 5IB4A 1NCAH 1N3NA 4C59B 1EEYA 1CICD 1NJ9A 4DFHA 5MEQA 1G7HB 1RMFH 1A6UH 3UAJC 1A3LH 3U46B 1OCWH 1N2RB 3AMKA 3NABH 1A6WL 3EOAB 4Z7QE 3FFCE 3KLHC 4X7EC 1MFCL 5HHQA 1GYAA 4I13B 4GRWF 4J3TA 1PKQB 2M1KA 4V1DA 2P5WB 4MQXD 1X5AA 1G0XA 3G6JA 3HCVB 1TZIA 1JGVL 4L4VE 3PXJA 4JZOA 1VESA 3TN0A 3FO9B 3LEYH 2OX5A 3T4AA 3GRWH 4PRPD 2X2YA 2NX5E 1F4AA 4Y1AB 4MWFB 1W72A 1HHJB 1SYSB 4TYUA 2EECA 3PXHA 3SY0A 1DQJB 3IFPA 1HZHL 1UVQA 4WVRA 3DYOA 3QBTB 32C2A 5M7QA 4NHCH 1BVLB 3QO1B 1QEWA 4F7CB 1MCHA 4UINL 5CIPA 1MRDH 5F1IB 4R7DA 5KVFL 4LF3A 3QPXL 1DBKH 2HH0H 2NR6C 3GSNL 3QH3A 3O4LD 4YC2B 2W9DH 1HCFX 3GK8L 4PJAE 5I66B 5EFIB 3ZDZF 3JUZA 4BQ8A 1HILB 1RMFL 3MROB 2IPKB 4QTIL 1WWBX 1OCWL 2O5XH 4JY6A 1NBZB 1Q9WB 1XT5A 3DI2B 4HIJA 1MHEB 2J8UF 4MJIA 4S1QL 3I6LD 3F7RA 1S5HA 2E6PA 2ZUWA 3C60C 5FA3A 1WSST 2JJSC 4G9FA 3MFGB 4G8FA 4MDIA 5IVZB 2YWYA 1DVFB 2WUBH 4ETQA 4UV4H 3D2UB 3JBG7 1A1OB 4LRIA 4QY8B 3JV4B 1GH7A 3TPKA 2APWA 1JRHH 4HLZG 4JKPL 1X6LA 3I75B 1OAQL 1N59A 4P57A 1RIVL 1EIBA 4Y19E 1KCRH 2HJKB 4KTYA 4HXBH 2IBZY 3RJDA 4JGUA 4A6YH 3DBXA 2EYSB 2GFBB 2XKNB 3QJHA 1MJ8L 3S3JA 1ZA6B 25C8H 5CD3A 1P5UA 3S88H 1UACH 2IANA 4HGMA 4LVOB 2DJUA 2CK2A 2ARWA 2EXYD 1GHFH 1KG0B 2AERT 4RGNE 5B21A 2E8ZA 4JFEE 5EC2A 5D7LE 5KANG 3R4DA 5FYLD 5D2NC 4KK5D 4WIQA 2E8YA 4X98A 1M7IA 4JFFA 3GI8H 3HG1B 1F58L 3LB6D 5SX4I 5LWYH 1HSBA 2PN5A 1F6LL 3ZKMD 2E3VA 2ILLA 5ANMB 5T3XD 5INCB 4YDIH 1HI6B 3NFNA 1QFUL 1YC7A 3NA9L 5JXAH 4KROD 4XP1H 3RVXC 3QIUA 5E2VL 5CCKL 4HZLA 2OI9B 4JFPB 3G08B 4XAWH 2HFGL 3HZYB 3NBNA 4Y5VC 4X6EB 3IDIA 4K71B 5C09D 1XCQA 4LBEA 1KTKE 4EBQL 2ICES 25C8L 2ADFH 1IKFH 4KHTH 5ECJE 5I30H 2AJZB 3BWAA 3PQYA 5EU6D 2AI0L 4JLRA 2P8PA 3F7QA 1NFDF 1PKQE 4KQ4H 4HMEA 1OGAA 3V8CA 4E0RB 4H88H 2CIKA 4RGMC 3UTTB 5F3BB 5DJ8A 4HLJA 2M8XA 2P7TA 3RP1A 3EO1B 2VKXA 4PJEF 3GIVB 3PHOA 2D7QA 4Y1AE 5ID1A 5IB5A 3ARXA 4HS6A 3MRPA 4YDIL 3BGFB 2IWGA 4PGEB 3EJYC 3W11D 4D0DA 2WBJA 1NGWA 1CXEA 2IJ0C 5J1AB 5F70A 5J56B 3LMJH 1PQZB 2DLHA 4JZJC 1T1ZB 1G7IB 3CH1B 4P23D 2FL5B 4I5BB 3MV8A 4WTXA 4NQCD 3HI1A 4XAWL 4GS7C 4LMQE 1FZKA 2VDQL 4HK3J 1Z9LA 4LCWD 3ARSA 1IKFL 4MNHB 4W4NA 4FFVD 4OCRH 3VFOB 3SDAC 3O6FC 4JQVC 1U8IB 4LSUL 3GMQA 4KJQD 1ZHKA 3C2AL 1PY9A 4HIIB 3FOMB 4OI9A 2C1PB 3R0NA 3RTQC 4H8WH 3V4UH 3VFWB 1Q9OB 3PWVA 5CSZB 2MQ0A 1T0MA 1ZANL 1A4KB 3RU8L 4HUWA 1OLLA 2HFFB 2PUQT 3RKDD 1ITCA 3CUPB 1AHWC 3NAAL 5KOMC 3TBYB 5BQ7B 4CUCA 1I1AC 5GGSA 4EN3A 1IRAY 2EO1A 1S7UB 3QUML 3TH3T 5IHZA 4LLUB 4ZUSA 2PTVA 4EUPB 4XPAL 2LTQC 5I8CA 3D3VA 3QISA 3BIKA 2P8MB 4UDTA 3FB7A 3C5ZD 4XC1H 5F88A 3QXTA 3L3IB 2AEQL 5MEPB 4TVPD 1XR8A 2VRAA 4RDQG 4WTZG 3MYJB 2ZWLT 2W0PA 2RAMA 3QXDB 4L5FH 3KYMA 1YUHB 1JPST 4JG1H 1WIUA 3OJDA 1RIUH 1V5JA 2LFGA 4N5UA 3GJFA 5DVLA 3LOWA 2XWJB 3TGXA 3RY4A 4O5LH 1LO3H 3CX2A 4QXUH 2EYTA 2JCCA 2VOTA 1RIHH 1Z9MA 4X9BA 1LP9F 1B6UA 3VH8G 3D5OF 3ROLA 3ARDA 2JB6A 4JPKH 4P2OA 3BKJH 3A6BH 1GCFA 4LCUB 1YMMD 3EHBC 1U0QA 4GMTH 4ZPVA 4HW6A 3BZEA 2VDLL 1JZ4A 4N0RA 5IQ7H 1C8PA 5DS8A 1B2WL 4F3FB 3HAEB 5SV3A 2AP2A 1EUTA 2DLTA 5FGSA 1UH4A 4FQXB 4J6RL 2OXHA 1SY6H 4RX4D 5FO7B 1W2KT 3R1GL 5GGTL 3I50L 4ZFFB 4RMRA 3GKWL 3MMEA 3ECBB 1MREL 3LKNA 4GBXA 5DXWA 3X12A 4L5FL 1FIGL 2E7HA 1SM3L 4JG1L 4LLVB 5T1KD 1U6AH 3ZT6A 3MZGB 4KZEH 4JFXB 4PJDF 1P9MA 4OIAA 4YXLL 1RIUL 2XPGA 1GGCL 2EDYA 1BGXH 3AVEA 2O61A 4Y4FC 1A1MA 4O5LL 2NY7H 1LO3L 4X0KB 3EYSH 4QXUL 1MFBL 1CDUA 4FZEL 1H3VA 3MRLB 5JXEA 5D5MF 3HNSH 4IOIB 2YHGA 3D85D 3GSQA 3BKJL 5TQ0L 4L1DA 1A7PL 1TCRA 3VXNA 4AEFA 3FONB 1MCBA 3WIHA 4GKNA 5CGYC 1BJ8A 2IAMD 1NAML 3DVFA 1ONQB 3FTGB 4DKEH 3F7PC 3KXFD 3KPRE 3EOBA 4OLYH 3V5HB 1EHLL 2X44D 1E4JA 5GSVA 1QG3A 4QOKD 3PP4H 1JE6A 3JWDL 4F2MA 1GGTA 2GQHA 2BNQE 3HE7A 5HGHA 2ZJSH 4J1UA 4WUUA 3GM8A 4L4TE 4OAWA 3DX7B 4K3DH 5DUPL 4NP4H 4PY7A 1X5ZA 4NT6B 4XVUC 5EU3A 4Q74A 4J4PD 2AXJA 4TVSa 1HSAA 5FUOL 5DJ6B 5JOPD 5BVJA 2NY7L 1KT2A 3IU3B 3RQ3A 3PWLA 4BFIA 1UCTA 4K3EL 3RHWK 1QHPA 5H94A 2HRPL 1HH6B 4NN5B 4UNTA 3IDNA 2FH8A 4V1DD 1YYLL 2J12B 5DEGA 1J1XH 4K7FB 2EDXA 3GI9L 4Z7UF 3AC0A 5MHSD 2PYEB 2ZKHH 3DMMA 4L4JA 1S7SA 1AJ7L 4L9LC 4FXLA 4JHWH 2C4FT 1YEIH 2FCBA 1I8MB 4DKEL 4FHBD 4OLYL 1HQ4B 4AL8L 3QCVL 3S34H 1SEQH 3T0EC 3CDCA 1U8NA 3PP4L 4DVRL 4PV9B 1N0LA 1WFOA 1HH9B 1AKJB 2WIMA 3OKDA 4MD4A 1L0XA 3VGEA 1MIMH 5GZNC 2FEEL 3G9AB 4JDZB 5EB9A 1MRCL 5D1QD 4M8QB 5C0CE 5FYLL 5HDQH 2NW2A 5IW6B 4AM0A 3ROOB 3TT1H 3JSSA 2FIKA 1EHXA 2PXYD 4GKSA 2NLJA 3CVHA 1FL3A 1H5BC 1ZSDA 4M1GH 5D1ZA 3V4VH 5IESH 1U58A 4POYA 3AM8A 2FHCA 4MJID 1QFPA 2C3GA 2DBLL 4I9WD 2Y06L 2DJSA 3MLXL 5KSBE 4RAUB 1PG7L 4G9FD 5FDWA 3JWNC 1V3MA 1I85A 2LU3A 2OCFD 2RQ8A 1I3GH 1OY3B 1XGQB 3T2NH 5MP6H 1T0NB 4UIKL 1YEIL 4WCYH 1Y18A 4MAUH 5IV2A 2NXYB 3KYOA 4Y5YA 3SKOA 5GGUB 4CKVX 4UU9A 5FHBL 4F57H 1KIUA 3BKCH 2YPLD 4NJ9H 2W91A 4ONOA 1FNLA 1ZHLA 4M48H 4XPFH 2PETA 5HYJA 2DS4A 4AENB 4QF1A 1PZ5A 4FFYH 4XTRC 4ZOAA 3QEQE 1NBVL 2MJWA 1OTSD 3LEVL 3TT1L 2VN7A 2W0FB 2VC2H 5SWZD 5I16B 4XBGA 4P5TC 4GW5A 4QTHB 5D7SL 4DTGH 2AS5M 2IAND 3CFCL 4I4WA 1PLGH 5IESL 5CEZH 1FL6B 1SJEB 3SO5A 4C56B 1EJOH 4B53A 4ZNCD 2HJLA 2BDNH 1KN4L 2NXZD 5MERB 4GW1A 3VXOA 4JJ5B 4K94C 1YNTA 1FNSH 2H2SC 3REWB 2V5SA 1AGEB 3CZFA 2V9TA 4TOYH 4XMLH 1R24A 4HBQA 1YNLH 3LN4A 3H3BC 1CLZH 3SQOH 2DD8L 2RCSH 4JFZL 3QI9C 4MAUL 3G6DH 2BSTA 4HFWB 3T1FB 2C7UB 3GMOB 1QLRA 3BKCL 4PJ8B 1W8NA 1D5ZB 1T03L 1GC1H 2Y6SC 4L29B 1KJMB 3DWTA 4OI8A 1CFTA 3QXAB 1KUMA 4HS8L 3QDHA 2KH2B 4NO2B 4PGBA 1KIQB 3WLWC 5CILH 4WI8A 1Q72H 3PWPE 3T04D 3F7YA 1AP2A 2FR4A 2ICEA 1XGUA 4X6BA 2H6PA 4DTGL 4X4MA 1HWGB 1CK0L 3T77B 2D9CA 4JPVL 1F4WL 1J05A 3PQYD 1EJOL 1CLOL 4ZYKA 4KI5D 5D70H 2WP3O 1M6OB 2IC2A 3R0MA 1L9NA 1T6VN 4ORZC 1OGAD 1FNSL 4XBEH 4M7ZC 1FJ1A 1U92A 2XV6B 4HQQH 4MZ2A 4TOYL 3RAJH 2R0LL 4XMLL 3MREA 3WN5C 2PYEE 3QQ3B 1CLZL 4HWEH 4ONHB 3VXQB 4EXKA 4TVPL 4GRWB 2OTWA 2ZSWB 2DQEH 2WBJD 4U1HB 4DZBA 1GL4B 5C2UB 1E4XH 3KPMB 3TN0C 1VEMA 2FX7H 3QFJB 4QYOB 5EUKA 1GC1L 4B7IA 3DUUA 4S2SA 3OHXB 4N8VG 3MV8D 1PGRB 4XCNB 1DJSA 2FGZA 2QHLA 1UXSA 4E41B 1QSED 5AYUH 4ZFOL 4NPYA 4NOFA 5DFVD 3IXTB 5L8KB 1JZ6A 4LLWB 3SDDB 4ETYA 3PWNB 1UWGH 5JOEA 1MFNA 1FYTB 4MMZC 4LSSL 4QHUB 1DZBA 4L8DB 5DJDA 2X4QB 4ACPA 5D70L 4ODUA 3IDYC 3INUL 4WW2F 3MTRA 4CNIA 1R0AH 1CDYA 4S1RH 4KRLB 4XBEL 2NY2C 3RAJL 2OJEA 5K9JH 4XP6H 4GMSL 5IVXA 2DMCA 4LQFL 1I7RB 3BQUA 4HWEL 4NKMB 2QKIB 4M61A 3GBNH 5CKGA 2YR3A 2J8UB 3VFTA 5IVOA 1O0VA 4U6VL 1MAMH 3BZDA 4EN3D 3HUJA 1OP3H 4RWYH 2VXSH 1TTFA 2FX7L 4GKZB 3DRTA 4Y0GA 4RMUA 3MXWL 1K5NB 3D3VD 5HHNB 2YPVL 3BT2H 1ODAA 3LY6A 2CRYA 5SWQB 3RZWA 1Q38A 2HLFD 4CW1A 1U8MB 4IOFC 1UWGL 3QWRA 3KPNA 4HKXA 3TNNB 3ALWA 2HMIC 5F96L 1AGFB 4MZ3A 4PP1C 1A22B 5HTSA 3EFDL 5DD6B 5BMFL 5BO1H 2XTLA 5IM7B 1C12B 3S4SA 1R0AL 4S1RL 3VWJA 4MSWB 3TP4A 4YHML 3MV7D 5K9JL 3MGAA 1KJVB 5KZCD 1WBZA 4N9OB 2F54B 3DJ9A 5EO1B 2XICA 1AQKH 3G6AB 1U95A 4LLYB 3GBNL 5LJYH 1WICA 3PHQB 2B20A 1D9KC 2DKSA 5DRWA 1SMAA 4F7TB 3CFKB 1T89C 1RZGB 1KGCE 4MX7B 5E94A 2VXSL 2EDTA 5FO9A 5EU7C 1T4KB 5LG1A 3ALXA 1EO8L 1KTLA 3ARBA 4I0PB 5AWNL 4MLIA 1KCUL 1TZHA 3SOBL 1QO3A 1T83A 4PJXE 3QIUC 3VGFA 4JFDE 1AD0A 3UBXI 3OAZK 1CLCA 4NM8L 3K2UL 1KJ3H 3H2WA 2NY0B 1VA9A 5HHOD 4UQ2A 4XMPL 4EI5A 2MKLC 5HYEA 4WI3A 1XZ0A 4TTGA 2AGJH 2ITCB 4LNRA 3Q6FA 2OSLA 4ZAKB 5L2KB 2XN9A 2HT2C 5A3ID 1I7TB 2D03L 3TZVB 2F19H 3PWUA 4J3UA 5JXED 3WDJA 1FAKT 1HOCB 3D0VA 2Z31B 4KV5F 3ZLQC 4OBRA 1NFDB 1XR9B 4NOBA 1CDIA 5E8NA 1OARH 1BPVA 1V8HA 1DE4B 3QEHB 1P2CB 1YPZA 3QFJE 2BSED 5EIIA 3GSNB 4MS8D 5E4IA 2VLRB 3B5GA 4PJEB 4H0IA 2CGRL 4E41E 3VE0A 3RIFF 3Q1SH 2PYFB 3KYNA 2HFEB 1HXYB 5IB3A 1CGYA 4PYGA 2ZOKA 4WUUD 1TZGL 2G9HB 3K8LA 1CIDA 2G5BB 1LO4H 2FBOJ 4NNPL 3T09A 5C07E 4M7LH 3ZL4L 4N5ED 4S1DD 1RUML 5HGDB 4QNPF 2G5RA 1R5IA 4YZFF 2EH8H 4YEEA 1PJ9A 3DO7B 3BIAX 1QBAA 2JF1A 4F7MA 1S7VA 5ABDE 5CINH 4JGMA 4MJ5A 4NC1E 1FGVH 3MJ6A 3WL9A 2P8LA 4XNXH 1G6RA 2ENYA 4JCMA 4N1HB 4I2XE 3EO0A 1U8OB 3TH2T 1UXWB 1E6OL 1JNNL 3F12A 3EYQC 4U2YA 5JOFA 4UILH 4JN2B 2AK4B 5HI3D 3U6RB 2J8OA 2CLRB 1P4LA 1I7ZB 3QCUH 1QNZL 4U3HA 5JNYB 5F1NA 5JLZA 1Z5LA 1FNEA 1WAAA 1U91B 2BVOB 2VLMD 1FGNH 5JW5A 2R9HD 3TIDB 5A16B 5DD0L 3JV6B 4ALAL 2PO6C 1T2QH 5D4QA 4HG4J 4ZO6A 43C9A 1FGVL 4EOWH 3SDXA 1LD9B 4L8SB 3NIGF 5GJTH 1S9KC 3MGTA 3E3QC 5J89A 1XGYH 1G6VK 3W9DB 1V7MH 5DVOA 1DBAH 3P9MA 4AK1A 4TUOA 1IC4L 2QQKH 4YGAB 3AREA 3BP6A 3P9WB 1NCCH 4ONGH 4YHZH 3X14A 5C3TA 3RDTB 1HYSC 2GT9A 4A6YB 3D1MC 1UWXK 3B5TA 1LP9B 2HTKD 3ARDC 3QUZB 4P2OC 1I3UA 4DN4H 2F5AH 2W07A 2WWKT 1BF2A 4N8VA 5DJCA 3VFRA 5HYJD 1QRNA 4HDIB 3L7FA 1SBSH 4EQ2A 5KVGL 1S7RB 5ESAA 2FRGP 4UTAL 1X5XA 1JUFA 3ARTA 1UA6H 3L3OA 1C1EH 4JO3H 5FM5O 5E7BA 5EDXA 7FABL 5L2KE 3Q3GB 1JZ7A 5BZDB 2FHFA 5GRZA 4ZS6D 1CYGA 3OBAA 4K2UH 4GBXC 3EJJX 1B0WA 5DUMH 4YJZL 3I2CL 4PJFA 2I9TA 1DTUA 4ZMAT 1V7ML 4KDWA 1BLNB 1P9MC 4LCIH 4PJDB 5CSBA 4CMMA 3S96A 2HVKA 4I77H 4YDVB 2XQBL 4MCZA 2X6MA 1NCCL 4ONGL 4YQXL 2ADGA 2VLRE 4G6KH 5FYKH 1P7KA 4U1KB 3O3DB 5E03A 1CG9A 3VRJA 4Y4KA 2DQFB 1RAMA 3VXME 3D39A 5E2UL 1FAIH 1FO0A 1AXSA 4HUNB 1I1FB 3S5LG 2Q8BL 1M4KA 4WJ5B 2V17L 3PF2A 2Y5TA 4FA8A 5ESVB 2C3VA 3KLAB 3FJTA 1DBJL 1NGQL 1YNKL 3O9WB 3S37X 4BA8A 3BEVA 1GZPA 3C60D 2I5YL 3HE7C 4IRJC 3N1PC 2FO4A 5DUML 3L7EA 4KTEH 2E27H 2GJJA 4LSPH 5ALCL 3ZTNH 4Q2ZA 3D25B 4LCIL 1XH3A 1VGKB 2R0WH 4OD2B 5J4MA 4WWKB 3MRJB 1MLCB 5J0BA 4Y2DC 2P48B 3ESUF 2EKSB 1CXIA 5DZOA 4MQTB 1YEDB 6FABH 2AK4E 4DCQA 3B9EA 3ORJA 4Z6AT 5DSCA 4Z7UB 5GRJH 1ADQH 5F1KC 3QNZA 3VU2A 1ZT7A 4QKXB 1S9VB 1NDMA 1K4DB 2SEBB 4Z7VE 1TMCB 3QP3A 2APVA 3WHXB 5JMRA 4XH2B 3BN3B 3BD3A 5ITBL 3TLRA 3FCTA 4MXVE 4YDLB 1T7WA 2XFXA 1RPQA 3EKCA 4I48A 3GHBH 4FQ2H 4OSUH 2OL3A 3C09C 1ZE3C 4IJ3B 2VITA 4HWZA 4X7SL 3FB8B 5T3ZH 4LSPL 5DUBA 4EJ1C 1RJCA 3WFHB 1H8SA 5CGMA 4XC3H 3MXVL 4M6NH 3BQUD 1CFSA 5GJSH 3RZCD 1J0JA 3ZKQD 1YEKL 4PGCA 4J12A 6FABL 4D3CL 2QBWA 4BH8B 1UM4H 1I4FA 4AQOA 5BJTB 1MHPH 1CFVH 2BVEA 4KFZC 5ADOH 5CHNA 2OZ4H 4XNUL 4XNQB 1ADQL 4JZNA 5GRJL 2AJ3B 5A2KH 1ORSB 2FIRT 1T6WA 2VL5A 3KLDA 3IKCA 4LLMA 4Y5YC 2QQLL 1KXVC 3TO4C 3BDXA 1KENL 2NY5L 1RJZB 4JAMA 5MEOB 3GHBL 4OSUL 5LGJB 4G80A 4Z7WA 2A83B 5E4EC 2JIXA 3WSQH 1AIFA 1QR1B 1K6QH 2GJZB 3MV9B 3GMRA 3MBEB 1CXFA 5TH2B 3BN9D 3M07A 4X7FC 1H3PH 3KPQB 2QV2A 5M95B 3DROB 1NAMB 5HVWA 1MCQA 4U7KA 3VXSA 2WW8A 4U6HB 2H8PB 3CPLA 3UJIH 1MHHA 1TPXB 1Q9KA 4Z76A 1NC2A 1UM5L 4XPGH 2FJFA 4X6DF 1A3QA 2EDOA 1EGJA 3NCFB 3QIWC 3H9SE 5DD5H 5C0BA 1I7UB 3BPLB 2YKLH 3ARBD 4TSCL 3QHFL 2VLKD 3GKZA 2VIRA 2YD1A 4ODXB 4WHTB 4G8GA 1B0RA 3DVNB 1M7DB 4H26B 4KVNH 4TNVF 4ORGB 3BP5B 3LRSA 1F4YH 5I1KL 1MCKA 4RAHA 4BQCA 1DANU 1EHAA 5L8JB 5IB2B 3MLPA 2J7LA 1KPVB 1K6QL 3AS3A 1CWVA 3V52H 4R7NA 4K8RH 2AEWA 4M8VA 2HVJA 1IEAA 2BC4B 3HPLA 5DFTA 1MFAL 3MRGB 3L5IA 4X5XB 3P9LB 5SX5H 2DQDL 4TRPL 4NZDA 4U1LA 4C4KO 3IAGC 2AV7B 4L4VA 43CAA 3IFOA 2ED9A 4XPGL 4XB7A 1NQBA 1A0QH 4K7PX 2AV1A 2Z91B 5MENE 2XA3A 1IQWL 4IHOB 4P46A 2EDKA 2YKLL 3U0TB 2FBJL 1JYXA 3BKYL 5A40E 3Q6GL 3NTCL 3WNPA 4KRPC 1S7XB 4JM2F 5B8CA 5HDBF 2CLVA 4B5EA 2A6DA 4JJHA 5HD8D 5DWUH 1FSKB 1MJ7H 4R90H 2R8SH 4PJAA 5DHVA 1IGJA 4L3CB 5GZOC 4PYHA 1PKOA 3ARGB 3L5WB 3PDGA 4GLRI 4JY4A 5IIEB 3PL6B 2FJHA 4YPJA 4J3WA 5J13C 4ZFGL 3MJ9A 3SKMB 4QHLB 4M93C 1JGUH 1MRFL 4MJ6B 1EXUA 1J1PL 1GGIH 2DQGL 3UDWA 4WO4D 5DMGC 2CRZA 4RISL 2A38A 4OCLC 4NQSB 1A6AA 4LK4A 3U30B 4U6YA 1U42A 5GGSY 4WW2B 4M62L 3PDOA 2E6QA 4RQQA 1RK0A 2MQCA 5KSVA 4JCLA 4RBPH 1MWAH 3WEXA 2QSCL 4Z95L 3U36B 3C6LC 3JTSB 4WI4A 2ZCKH 2XXCB 3Q5OA 4ONFH 5DRNA 3R8QA 3CSBA 4LCYB 5CLTA 1Q94B 2IH1B 4PRPE 1T20B 4HD9A 4LSVH 4AEIL 3B9AA 3LRHA 5F7YC 4U0QB 1MCIA 5JPMA 4Y19A 2VR5A 5KW9H 2G75B 2GCYA 5B39G 2EXWC 4BJLA 5KS9F 3SN6N 1NLBL 1UG9A 4BUHA 4D0BB 1FC1A 2W60B 4LEOA 3KDMB 3LN5B 4B50A 2CPCA 1U8PB 3IETA 1KB5A 3BXNB 3HPJB 2DB8A 1OLZA 4NWTH 4Y8DC 5GISL 2BSRA 3CFJA 5D7LA 1RHHA 4AH2B 1UZ8A 3ESVF 3WXWH 1RVFH 5AUMA 3VWJC 1I9IL 1KF9B 3I6LE 1KYOJ 4AEHL 2WUCL 3O3BA 1JHTA 4QRRA 3ARED 2D4DA 2GTZB 3U1SL 4EUPG 4NRZB 4GXVH 4YWGL 3C9NA 2ZCKL 2ZUQB 4NQEA 5GPRA 3BWUC 4ONFL 3S98A 3DGCR 2Y23A 3NPSB 4HX1B 5I1EL 1LE5B 2NZ9C 4LSVL 3U4BH 4Z78B 2DQHH 5DQ9B 3TBWA 4OZ4B 2PW1A 1EBPA 4UT9H 1U41A 3L3KB 3BZFA 4Q9QH 5A43C 1QTYT 1AI1L 3IFLH 5I9QB 5TF1L 1TJIL 3U46A 1T83C 3EOAA 4PB9L 1J87A 1X5LA 3C5ZB 2R4RH 3M1BA 1PKQA 3RL1A 4CBPA 1H3GA 4EI5C 3HCVA 1RVFL 3C8HA 5DK2A 3FO9A 3ABZA 5CKAA 5I1JH 1R3KB 5FYLE 4Y1AA 4MWFA 4GXVL 1HHJA 1SYSA 2Z4QB 1DQJA 5GIRB 5I8EA 5GZND 1BVLA 3QO1A 3A6CH 2C1OB 3D39D 5T3XE 2DQHL 5F1IA 2YWZA 1KNOB 4PJ9C 4UBDD 5HPMB 4Q9QL 5EFIA 4UT7L 3IAQA 4ELKB 1HILA 2XWTB 2ESVB 1IMHC 1CDJA 4OJFL 1N7MH 3B2UD 4NN6B 1KLGB 1DBMH 1NBZA 1Q9WA 1WFNA 2ED8A 3IU4H 3MRBB 5H35A 2H32H 1NFKA 4P9HC 5EPMB 4DEPC 4ZUVA 5D9SB 2I60H 4YHKL 1LHZA 5IBLC 1RJLB 2DQJH 2KDGA 2ARJQ 5IVZA 1DVFA 5EU6E 4JO2L 5I1JL 3D2UA 4LAQL 5JR1H 4AIOA 2CUHA 1A1OA 3K74B 4OZFH 4QY8A 3JV4A 1T04A 5ICYB 1QUNA 3HC3H 5DJAB 1EX0A 4MNGB 4OF5A 2GTWB 3I75A 4LSQL 5B3JE 4HMCA 4HUUA 1AY1H 4JRYB 1CD0A 4OCNC 5C7XH 3OKNA 1A4JB 1A7RH 4U1GC 3OPZH 1QSFB 4JRWA 2A74A 2UUDK 4WDIB 2HJKA 5C08D 3SKNB 1PW3A 1I8LA 1NGYB 1WUNT 2N7AA 4X6CF 3UYRH 2ZOLB 3KHOA 2GFBA 2Z93A 1N7ML 4XI5D 1ZA6A 5HDOA 5IWLC 1FCGA 3LAFA 4NQCE 3HZKB 1DBML 1BQUA 1T22B 3PGCB 3HZMB 3WFCL 3V2AR 4JEGB 2Z9TA 2X4TB 4OT1H 3O0RH 4GRLC 2I60L 5DHYA 1RU9L 3K8MA 1Z6JT 3HG1A 2LU7A 2WV3A 3ISWA 1NLDL 3DHJA 5INDB 1DQLH 3BYTA 2IADA 2QADC 5INCA 1HI6A 1JNHB 3C5JA 1UCBL 1N26A 1AY1L 4P59H 4JFPA 2GUOB 3G08A 4UOW1 1HHGA 3HZYA 1JPFB 3OR6B 1I3RB 1HIML 2R1YB 4X6EA 3UYRL 3ARUA 1GOGA 3C08L 4FP8L 4LCCB 4YX2H 4XX1E 5EBMB 4Z7OF 1ZAGA 4O4YL 4BK4A 2AJZA 4N8CH 4MQ7B 5HVGB 3FQWB 2XZQL 4HJGA 2W9EH 3GSVA 4TVPE 2JIXD 3ZKXB 3O0RL 4LHUG 4OZHB 3ZTJH 3MR9A 3LKRB 4M7LT 3HMXA 4KK9C 3VI4E 1FRGL 4N0YH 4OCXL 5F3BA 1MCPH 5TJWK 3IGAB 4LEXH 3EO1A 3GIVA 4M1CD 3GSUA 1QZ1A 4FQLH 5TDPA 4HWNA 3VXSD 4PGEA 2GEEA 4TSAL 1LWRA 2EDFA 1IEBB 5J1AA 5E8PB 3X13A 4NJAL 3QA3B 1PQZA 1T1ZA 1GOFA 3CH1A 2PTTB 2FL5A 4I5BA 2YPKB 1QBMH 3QAZB 5CAYB 4RIRB 3KPRA 4X5WB 4POZD 1OM3L 3G9VA 1YMME 4OF6A 4PIRF 4F8TA 2WLZA 5DMIH 4Y4KC 1H3TA 4MNHA 1YYMH 5L8LB 4N8CL 3PIQB 1U8IA 1T66C 2YD5A 4HIIA 2W9EL 2DMBA 1EZVX 3FOMA 4WFHE 3I3DA 5DO2D 1R3LB 1Q9OA 4QHMA 5CSZA 1MCPL 1XIWC 1A4KA 2VDMH 5C0JB 2B8OT 2NNAA 2HFFA 5JW3L 2EDQA 5IEHB 4JR9H 4M9PA 1N6QH 5SWZB 1S9YB 3CUPA 4IMLA 4NFBA 2WP3T 5E70A 2BY1A 4PBVC 5T1LA 5BQ7A 4MD0B 4KGJA 1MPAL 1C5CH 1NC4D 4FFWD 1IFHL 5SWSB 5MI0B 4XT1C 4EUPA 4NQVB 4HUXA 2A73B 2UYLA 5E6IC 2XKSA 2XTJD 3WKNA 4AG4H 2P8MA 4KDTA 2EIBA 1M1SA 1Z3GH 2YA1A 3L3IA 5MEPA 2IBGA 4QXTA 4UAOB 3KYAA 1T1WB 4I3SL 5C0CA 3DYMA 3MYJA 1F97A 4QOKE 5IMMB 3QXDA 1YUHA 3X11B 4WFGE 2X1QA 3RRQA 4P4KB 1GXEA 5BOZG 3IS0X 2VDML 1FNAA 3OKOB 5AD0B 3NA4A 3QUXB 3MBXH 4MA1B 3E2HB 4F9PA 3WFZA 3VFMB 5JOPE 4G6AD 5KSBA 3NIGE 4ZS7H 3LS4L 2WZPD 3V7MA 3OKMA 5L88L 1AQDB 4HJJL 1C5CL 4Y5XA 4LCUA 2B2XH 5KVEH 4LP5A 3S35H 4V1DE 4N9GB 4R2GC 4UUJB 4HUVB 1E27B 2HWZL 2IFFL 2ATPB 1IQDB 3QUYB 1DDHA 3OKYA 3QZWB 4HWBA 3VXRB 3EBAA 5IROA 1EK3A 1DL7H 3HAEA 3UJJL 3JVGA 4NC2B 5FECB 3HC4H 5F3HB 2JJWA 3C8KA 5FO7A 1KIPB 3WFDH 1QQDB 4MNQD 3TC9A 4HPYH 4ZFFA 1H9VA 3ECBA 2C4XA 3IDUA 1CD1B 4LLVA 2HP4A 1OGTB 2UWEF 4JE4B 4HPOH 2E9IA 3OX8B 4OZHE 4PFEA 3RWCA 1S78D 3UCRA 4CVWA 3WXVH 4WW1B 4X0KA 1QSEB 2EC9T 1IZJA 1MIEH 1IL1B 3BP4B 3MRLA 4OCSL 1RI8A 1BZ7B 4G7YH 3AB0B 2VDRH 5TE6H 4IOIA 4ZS7L 3TWCL 1RUAL 1YQVL 1U8KB 3FONA 5HVFB 3FT4B 1FE8L 4MJIE 5I1CH 2KUTA 3EW3B 5KVEL 5KAQG 4QRRD 1ONQA 3FTGA 4G9FE 1EO5A 2HN7B 2QSQA 4K07A 4NQED 4NUJB 3V5HA 3O8XC 5BS0B 4NO5B 4H1LH 3PHSA 1B9ZA 3HC4L 4PRDB 3UJTH 2W65B 4M7KH 4K94H 3QNYB 3GBML 2YRZA 3RVTC 4X6DB 4I0KA 5DJ2B 4HXAH 2X42A 1NBYB 2YPLE 3MA9H 4NO0B 3PWPA 4X7TB 4J2XA 1YY9D 3P4NB 4NT6A 3GSXB 2VYRE 1TVHA 3N85H 2FZ3A 4OLUH 4K3HA 4O02H 4U7MA 1G7QB 3TJEL 5DJ6A 4KKAD 3WXVL 3HKFA 5E56A 3GSOA 3OJMB 4XXDB 3BP7B 2DN7A 5SWZE 3CJJA 1HH6A 3B4NA 3MO1B 3EFFB 2IALB 2BNUB 2P5WD 3CMOL 4C57C 4PJGB 1AFVH 4K7FA 3U0PB 3VD5A 3HNTH 1JHKH 2PYEA 4L8BB 5SWSE 3HE6B 1R5WB 3EAKA 4Y1AD 5IFHH 4GAFB 1I8MA 4HMDA 3MV7B 5KG9B 2Y4SA 4EVNA 1HQ4A 3CAFA 3G5VA 3O3AB 4D2NA 5HHPB 1HH9A 1AKJA 2VXUL 3BDYL 4TPRL 3TNMB 1OTTD 4MJ4A 1MCWW 4P46C 2AABL 4PJHB 1C7SA 3ROOA 2EE6A 4E9LA 1MI5B 3CXHJ 3JXAA 3QIBC 3N85L 1BBDH 1ZGLP 5J11C 2FH6A 5B8CC 3CU1A 5K59E 1IC7H 1DLFL 3SO3B 4F37K 4MA8L 1OSZB 1GOHA 2NY6B 2YSSB 1LNUB 1YEEH 4NHUB 3D0LB 1H8NA 4DGIL 2X4PB 1AFVL 4U7SA 1W72H 4RAUA 4ZXBB 1VGEL 3U82B 1Y6MR 3GSWB 4FMKA 1XGQA 4XCCL 5D7JC 5A1AA 3B9KB 1OGAE 4HH9B 4OZIE 4G6ML 5CIPH 3VXUB 3PNWB 3T65B 1G7JB 2FHBA 4LSTH 4PJIB 12E8H 3MLYH 2DWEB 4ERSL 3WKML 4AENA 1U9KA 2AQ3A 3DX8A 5FYKU 5HXMA 4IDJH 3E1F1 3ARRA 2OR9L 1EEQA 1NMBH 4RGOH 2W0FA 5FYJH 5F89B 5I16A 4U4BA 4X4YB 2IGFL 1BBDL 5I76B 1G0YR 4QTHA 4HCRL 1NKOA 3SDCC 5J9PB 1QSEE 4NKIL 4C56A 4QCIA 4LGSB 1T7VA 5ID0B 5MERA 5KS9B 3RA7L 3ARFB 4JJ5A 1A6ZB 1JK8B 1AGEA 3SBWC 1EGJL 4OFIA 1I75A 4ZUUB 3HG1D 3DRQB 5F93C 4RCAA 5HHMB 4RGNC 4DAGL 1NMCC 4YFEA 1GJIA 1R3HA 2EDBA 1JYVA 4ODWB 1OT2A 1SBBA 5C0NC 4HFWA 4DGVL 2NY3C 3T1FA 2AJUL 2C7UA 2EICA 4NWUH 2HJFB 1T7XA 3GMOA 5FEBA 5HYSB 3MLTB 1DUZB 4OQTL 3QPQC 3QDAA 4JREC 4PJ8A 1D5ZA 1SJXA 1OOAA 4TNVK 3OAYK 1PY4A 1J1OL 4L29A 4ZO9A 5IT2H 4YPGB 1F8TH 2F9BT 1EUUA 3OGCB 1KIQA 1QLFB 4IDJL 2G2RB 3OQ3B 4ODHH 3OAUL 1NMBL 4RGOL 2KKQA 5FYJL 4DK6A 4YHYC 1CE1L 1BBJB 1YEHL 3H42L 1A7QH 1VHPA 3D3VE 4Q6YA 5LQBL 3T77A 5EIQA 5FB8A 2YUVA 4M5YL 5DF0A 2XYCA 3TJHC 4Q6IB 2KPNA 1YEJH 3UYPA 4PJGE 5CP3A 3ULUD 2EH7H 3H9ZA 4H0HB 3UTTD 4U1JB 4PB0H 3VFUB 4FFZL 4KKCC 2NY1C 4KJPC 2MPAH 4BYHA 3EZ8A 4RRPG 1MJJA 4ONHA 3OZ9H 5TF0A 4LOUC 3MV7E 3HHRB 4ISVB 2CLZA 2ZSWA 4OIIL 4NWUL 2I9LB 4U1HA 4O51B 4OLVL 2OTPA 3KPMA 2B0SH 3UC0H 4FABH 3QFJA 3MNWB 4QYOA 4XWOC 1YC8A 4RAVA 3OHXA 3CLFH 4XCNA 5BRZB 4LLDA 1YZZA 2ZUYA 4XNZC 4E41A 4ODHL 4OGAC 2DYPB 4PJHE 2X4RB 4RFOL 2OR7A 4HIEB 4Y4HC 3IXTA 4NKDA 4LLWA 3SDDA 3PWNA 4YEFA 1MCOH 4OUOA 3WJLA 5IB1A 2AJYL 1PG7X 5BXFB 3OXSB 1T5XB 3VI3F 1FYTA 4IRSC 3MX0A 4EIGB 4QHUA 4L8DA 4QT5B 4MAYB 4APQB 2X4QA 2XA8H 4H5SB 5D2LF 3ARQA 1BIHA 2DM3A 1CGSH 4NUGH 4ZFZB 5D72L 1I7RA 2NY4C 2I26N 3AROA 4QRQB 5HHOE 1QFWL 2WK2A 2MPAL 4D9LL 1AR1C 2QKIA 4YHLH 2EIZB 4U1MB 1E6JH 3MJ7A 3OZ9L 4JPIB 1A5FH 2VR4A 1JPTL 2JJVA 2PR4L 1ND0A 3IVKB