3G6JF

C3b in complex with a c3b specific fab
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
226
structure length
221
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFSFTSSSVSWVRQAPGKGLEWVGLIYPYNGFNYYADSVKGRFTISANTSKNTAYLQMNSLRAEDTAVYYCARNALYGSGGYYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Complement C3 beta chain
publication title Structural and Functional Analysis of a C3b-specific Antibody That Selectively Inhibits the Alternative Pathway of Complement
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 221
sequence length 226
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6jF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6jF01
1Z5LB 1DQJA 3B4NA 3D25A 1A6TB 3H9HA 2VABA 4LLUA 1AC0A 1TPXB 1ZWIB 5T3XD 3E8UL 1PX4A 2KQNA 5HHNB 3TO4D 5ID1B 2RCSH 1RZKL 5BCAA 4EQ3A 3M8OL 3UZEA 3SDCD 3HC4H 2DQFA 5T5NF 3W0WB 4R4FH 4N8CH 5EIIB 4NWTL 4QRRB 1S9KC 1OT1A 2X9XA 1RSFA 3MJGX 5IJKA 3AREC 3DHMA 3K8KA 1JZ5A 1GGIH 4I77L 4CMMA 1NUDA 4RNRA 4U6HB 43CAA 2AEQH 2IAMB 3MRQB 4KAQH 3V4PL 1MVFA 1U8QA 4PJHF 1QEWB 4NNYA 3TF7C 4Z8FH 5DA0B 5HHVL 4ERSL 4D9RE 4NKDB 1HZHH 3SQOL 1U8LA 4R6UA 3OQ3B 3KNBA 4N1HB 4Z7UB 2WUCL 3X11B 3DRTA 3PL6A 4F80A 5FUCE 3QDGE 4P49A 4X9GA 4KI5F 5IT2L 3MFGB 4ZUVB 4HK3N 5C2UB 4RZCB 4DKDC 4WDIA 1JV5A 4KMQA 3FB8B 4D0BA 1FL5A 3QUZB 4JRXE 2FDBP 3HR5A 1J8HD 1QFHA 4EBQL 4POZD 4PJIF 1Z0NA 4LHUD 3GMNA 3MRLA 4JAMA 4Y16A 1MHHB 4EIZC 5HHXL 4OLVL 3V0WH 1CLYL 3FKUS 5I30L 35C8L 4N1EA 3JZ7A 4N0UA 1EFQA 1IKNC 1JPFA 3MPCA 5C6TH 2OTUB 4FQQB 4QXGH 1MNUH 4XTRD 3HG1A 3PHOA 5ADPH 1R5IA 4OUOA 2MOVA 4KTEL 2GSIA 5MP6H 5IG7A 3D39B 3HI1B 1BJ1H 1A2YA 3RVXD 4FTVA 4LEXH 1S3KH 4XNMB 5GS3A 3MLPA 4TUOA 5F96H 5CZXD 2VLKB 1IAKB 2AGJH 3G6JE 5CP7A 4DAGL 3ET9F 5IBLD 3NFNA 5IK3A 5EC1A 2LTQB 1FJ1B 4NQDB 3L3DA 3QEHA 5F6HJ 4YIQB 1VESA 3MJ6A 1FO0A 2WP3O 1UM5L 5F6IC 4HT1H 3UC0H 1F58L 1SJEA 4BELD 1T4KA 1INEH 3EJJX 3N85L 1HSAB 1EEQA 2GJJA 4PG2A 1H8NA 5E08L 1PLGL 2NLJB 4PBWD 3RL1B 3MRIA 1FYTB 3NBNA 1XGRB 5JXED 1FNGA 5T3XE 1BEYL 3V4VL 1Q0YL 2VLLB 1CFQB 4YC2B 3G5ZA 1N0XH 4IOFD 1U8JA 2ZG1A 3SKJH 4NKMB 2LE9A 1HXMB 2ATKA 4UTBH 3VW3H 4U7MA 3ROOA 4DVRH 5I0ZA 4RMQA 1MFBL 5C0EA 4AL8L 1J9CT 1GGYA 3QUYD 4XMPH 3JV4B 3SDDA 3NPSC 2FEEL 4JQIL 4F3FB 2CK0L 1NUFA 4X8XA 3EYSH 4L9LA 2Y7QB 1KJ3H 5DMJB 4ZXBB 1WSST 4NNXB 3V8CA 5KS9A 1A4JA 4F7PA 5JIKA 1E6JH 4MHHG 3GJFH 5I1LA 5T3ZH 4LNRB 3JXAA 1U3HB 1DDHA 5D1QC 3GK8L 1MJ7H 1MCHA 3ZDXF 2BVQB 2PETA 1TQCB 3BPLB 2PXYC 1I3RA 5HHQA 1SJVA 1KXVC 3WUZA 1W2KT 5D9SB 1J8HE 2ICCA 5EO1B 4K94L 2FO4A 5T5NG 3UTTD 1BLNA 5DRXB 1UACL 3O2WH 2X4RA 1YQVH 4MJ6A 2W65A 1FVCB 2NR6C 3WUWA 1MCIA 1NBZB 2HKFL 5I6XB 3NA9L 5EOQL 4H1LB 3MLSL 1BPVA 4MXWL 4F2MB 5EU6D 1FV1B 5FIEA 3IJYB 1CLOL 4M62L 3NIDF 4QWWD 5DRNA 5EO0A 1JRHI 3VFVB 2W9DH 5ACLA 3MRHB 4C59B 2FBOJ 5HI5D 1FSKB 3OKLB 4HFUH 1TQBB 4APQD 3FRUB 3ZE0E 2W0LA 3VDAA 4KK5D 4OLZL 3QO1B 1YECH 5HI4D 3EJYD 3RWFA 4QY8B 5DGRA 3VXUB 2YK1H 4DZ8A 5DUML 3UZQA 2DLHA 5IB4B 5DUBB 4GAGH 1N59B 4XB8A 3UJTH 1GAFH 5IWLC 5FUOL 3JV0A 2JE8A 3TGXA 2YA1A 5C0BA 2CGRH 4X8JB 3GSRB 4K9EL 1CN4A 4Q2ZA 4PJGB 1VSCA 3SKOB 3GRWA 5JQHC 3T2OA 2D4DA 3RWHB 4WO4C 3ARFD 1QPPA 4R2GB 3RZCD 3T0EB 5T1LB 4PRPA 4U6XA 2XNAB 2FD6H 3KYNA 2AQ1A 2DM7A 2VQUA 1E6OL 3ES6B 4NQCB 3D0VB 1QRKA 4NSKB 5F97E 5D2LF 3F6LA 4CJ0A 5ITFB 5C0DA 1I85C 3CC5A 3ORJA 4AMKL 3DRQB 1PG7W 2HG5B 2GSGA 4JPVH 3VFUB 2HFGL 3LQZB 4BFBD 1KG0B 25C8H 2NY4C 2X4OB 2A9MH 3F7VA 2EXYD 4HPYL 4BKLB 3OB0K 4PD4J 5I1AA 3TCXA 3ARZA 3BMVA 1I7UB 2XTJB 4EI5B 4OLYH 5CIPB 3V79C 5IB5B 1BQHB 1KCVL 3QQ4A 3LQAL 3WO3B 5MENA 1LNUB 1OSZA 1CFBA 4MAYA 1OAUL 4YXLH 4BK4A 2GCYA 2W1NA 1CGSH 4YGVA 4I48A 3RI5K 4ZS7H 1CF8H 5T1KA 3QI9D 4KU1A 3T0AA 3KPTA 2IEPA 3I50L 1CFVH 4PJDF 5FCSH 2AXFA 2VDQH 1CXHA 1GPOL 3ARYA 4FQIH 5CINH 5GISL 3H3PH 5DZNA 1WIOA 4YHML 5HBBA 3UTTE 4PLKD 1A7BA 2V5SA 5ACMA 1OAKL 5IOPA 1K8IA 3TBWA 3K1DA 3O6FD 3QCUH 4FQCH 3BEWA 1KB5B 5F7DB 1NAMH 5HD8C 4NM8H 5I8KL 1IZKA 1G84A 5FKPB 4PJ9B 1XGUA 4OT1L 2JJTA 1P1ZA 3BYTA 4GW4A 4JREC 3QUMB 1YPZE 4PB9L 3P77B 5EU6E 1B0GA 1FCCA 2X70A 4L9DA 3HLAB 1A5FH 1T2XA 1AXSB 1H3WM 3BP5A 3CMOL 4RRPG 5EOTA 5I76B 2B5IB 3QDAA 2BY1A 3T4AB 4DGVH 1LK2A 1QA9B 1F2QA 7FABH 1I1AA 4X5WB 4GS7C 3BDXA 4BQ9A 4PGBB 4XHQA 5TGBB 1ZXQA 4GAYA 3W81A 2EDDA 4BZ2H 2KH2B 4HIEB 1UA6L 2ADIA 3GIZH 4OIIH 3F12B 5CJOH 2Z35B 4TSCL 4XB7A 4NUJB 2NZIA 3CX5K 2I9LA 2Q86B 3DGCR 2B2XL 2BSRB 1G9EA 4O2CB 4MD5B 1ACYL 5FM5M 2Z4QB 3RNQB 1J1XL 4EKXA 2VXSH 4HPOH 5GGUA 4PJCB 4G6FD 5IM7B 4Z7VB 3K0WA 3MACL 1GHFH 1K3IA 5I15H 4RFEB 4YAQA 1KPRA 3RKPA 1N6QL 2W9LA 4D9QD 4PBXA 4P4KB 5IIEA 2EH8L 3MRJB 3BRDA 5EOCH 3U0WL 1FGNL 4Y4FC 4EDXA 5J6HB 3GZKA 3HNVH 1AGEA 2HJKB 1YMMB 3HRZB 2GI7A 5FDWA 1A6WH 1EHXA 4PTUB 4QRUA 5I1EH 4D0DB 2KKQA 2AEIT 2XWJA 3JVGA 4G5ZL 3QULB 4RIRA 4FQJL 3IXTB 3BJLA 4X98B 1RHHA 2AJUH 4LLAA 1U42A 2YWYA 1PBYA 3GFUA 3UTZB 5HSFA 3KPLB 1JNNL 1QKZH 4IRJC 5F88A 4DFHA 3WLBB 4YHYC 5E56A 3VMPA 4I3SH 4F9LA 3PV7A 3ULSA 5DMIH 1P7HL 1KNOA 2AP2A 3G5VA 4PJ8B 4QF1A 1BFVL 1XCTA 4G8GB 3RUGF 1VFUA 2DQTH 1IC7L 4YHOH 3RVUC 1F2XK 4LDOB 5DURB 5I19H 5B8CA 3N1FC 4UIMA 5DGQA 3ZHLA 1H3PH 4P5TD 4RX4D 1QRNB 4ZFZB 5BJTA 3WLWD 5DJXB 3SQBA 2DB8A 3BOVA 2NW2B 2XZZA 3WD5H 4M7JL 3CFDA 3FL7A 2NYYC 3IDUA 3O8XA 4LCYA 5JOPD 1YDPB 1ZA3A 3P0VH 3EO1B 2AJ3A 3GJFA 3VJ6B 4Q58C 1GZPB 5SV3A 4YDVA 3ESUF 5DSCA 4DGIL 4JG0L 3VRIA 4XWGH 4NDMA 4P59H 4J8RB 5E2VL 5DD1L 1U3ZA 2HT2D 5C92A 1UEMA 1FO0L 3DROB 1UWEH 2H1PL 1H15B 1X6LA 4QGYA 3R8BB 4ETQB 5CZVL 4TSAH 2D7MA 4ZUUA 5DJZB 4HJGB 4ORZC 1Q1JL 3O3BA 3KPOB 1BOYA 1MRFH 4K3DH 4MA3A 3T65B 1TIUA 3HC0B 2VXQH 1HQRA 1NDMA 1JYXA 1FIEA 4HH9A 3GI9L 1RZFH 4ZPTB 2D7NA 2CDGA 4GRWB 5F3HB 5GRWA 1KJ2L 5GS1C 1OLLA 3CFCH 4J3TA 1PSKL 4UU9A 1U41A 5DLMH 5FGCE 1QR4A 3AB0B 5JW5B 3F5WA 1NC2A 4EI6B 4HULB 2DQGH 4WU5B 1I7TA 3WFBL 4NYLA 4GKOA 5HHMB 1KTKE 4ZUTB 1UXSA 3ZHKA 4NP4H 3A6CH 2E9JA 4JKPL 2CO6B 3BT2L 5GGRA 5F7LB 4OAWB 3O81A 1XF5B 4DUWA 2P8LA 3IDYC 1FNLA 4MAUL 1GC1L 3TN0B 4XNQB 4D9QE 2VB5A 1KUMA 3LEXB 1E4XL 4XP9H 4HFWB 5J0BA 2A73A 4GXUM 5D5MA 5DD5L 1SVZA 3VWKC 3S34H 1GOGA 1JZ8A 2LVCA 2NMSA 4YDLC 3GMRB 3FB7A 1GOHA 3L3OA 4FXKB 2R0ZL 1UT9A 3BQUC 4HJJL 3RVVC 1MFDL 1EMTL 2QQQA 4RMWA 5B3JE 5E4EB 1WBXB 5BS0B 5JXAL 5I73C 2VKWA 3VXTB 2MJWA 1WITA 2DKSA 1EBAA 2KQMA 4CU6A 2VZ3A 4K3GA 3MFFB 1C16A 5IB3A 4F7MB 2H26B 1T2JA 3MV11 3IFOA 4Z77B 4OCYL 2H2SC 4BQ8A 4O9HL 4MJ5B 4ONFL 3N1GC 4M00A 2BVOB 2LFGA 3QWQB 5EU4B 2FZ3B 5GGVH 5EG6C 1OCWH 1PYWA 5KSAA 3Q5OA 1MPAH 5D1XC 1CR9H 4WV1C 1CGXA 3CPLA 1HILA 4QRQA 3MRDA 4GW5A 5KVEH 4QCIA 4XNYL 5HHPB 3I3DA 3OJDB 4LSVH 4WU7A 1WBYB 5TE7L 1OARL 3O11A 1I1YB 3BH8A 5H37H 1D5IL 1AO7B 1U8OB 1UVQA 5I18L 4LDLB 3W2DH 2XTLA 4H1LH 2GUOB 5IHUH 1MCCA 1J05A 3HMXH 3UJIL 5JOPE 5C0AB 1HXYB 3OX8B 3V5HA 3BN3B 4MDIB 3OR6A 5TDNB 1MHCA 4IOIB 4LP4A 4NIKB 1QYGL 4OZ4A 4P46A 3FQWA 1DQMH 4JY5L 2X4NB 4L3ED 2HH0L 2Z31B 3CNKA 5HYSG 2VDML 3TA3C 3GRWL 1NAMA 1SEBB 2P46B 4ONHA 5F6HI 2FJHB 4QOKA 1JHKH 1QSEB 4XWOC 1TDQA 3NABH 2PKDA 4ZPVB 5IMOB 4PRPD 2BNUA 4JPWH 3LN5B 1CQYA 2C7UB 4KKLC 4ZS6C 1DN2A 1EH9A 5TPWL 2BRRL 3BP7A 1CDYA 5DA4A 3TBVA 1OD9A 3AAZA 4B41A 2GT9B 1E4JA 1VGKA 2VO5A 3KPQB 1OGAB 1ZGLA 5I71B 4N0FA 5JPNA 2P8MB 3T0VA 2X5PA 3C8DA 3TNMA 4MSWA 5DRWA 4K7PX 2DAVA 5IVOA 1G9NL 1JF5A 1NCAH 1T0NA 3DOSA 3EIFA 3CDGB 2HVKA 2EE3A 2M26A 3VGAB 5DF0A 2DQEL 4PGJA 3G04A 1NGWB 3DX7A 3LKPB 3SGEI 1L7IL 1Z5LA 5KS9E 1ZGLP 1ZA6A 1OM3H 2IPKB 1REIA 4NBYB 4TVSa 3DX8B 2FJGB 3HC4L 2G5BB 2CRMA 2PUQT 5TFSH 4R4FL 4ZSOB 4MAYD 5CMAA 1NLBH 1ZWIA 4J3SA 2DM4A 4LPWA 5CIPH 5HHNA 5ID1A 2D0HA 2AEQL 2WBWB 2IJ0C 1DFBH 1FFPB 5T1KD 2COQA 4KAQL 4UI2A 1CXLA 1KCUH 5DJYB 3W0WA 1TZHB 1NSNH 2IPTL 32C2A 3CVIL 1NPUA 5EIIA 4QRRA 2P5WB 4Z8FL 3MRQA 4XNXH 1F5WA 3PDOB 2IALB 3GSXB 1CGTA 1OY3B 3OMZA 4KZDH 5DUPH 4UAOB 3BD4A 3DX9A 5JW4R 1I9IH 3WEXA 3INUH 1F3RB 5EIVA 4PV8A 1QEWA 2YR3A 2ED8A 1CIUA 4QRPB 1OTSC 3DVGB 1ZLSL 2RR3A 2E6PA 1PX3A 1I8IA 4X5LA 1KB5H 2QLVB 5EU7C 1P7QD 2XY2A 2GITA 4Z7UA 1R3IH 1WGOA 1H8SA 1V7MH 1VERA 3QUMH 4ZUVA 1NFDE 1X7QB 2YRLA 3ILPB 1I1AD 1JMXA 3FB8A 3V0WL 2CR3A 2APXA 3QUZA 3W9DB 1LO5B 5C6TL 4QXGL 4HWEH 3KPNB 2C3WA 4PGDA 3ARDD 3LRGA 4JJHA 5MP6L 4L3EE 2NCMA 5C08D 2D9QB 2UZIH 2BJML 3O3DB 1LO4H 1YY8B 3MV9B 1KF9B 4FQQA 3WIHH 4LEXL 3ETBF 1S3KL 3VRJB 2CLVB 2V5MA 4JDTL 3P0YH 1ZS8B 1MOEA 5F96L 1ZAGA 1TTUA 2Z8SA 2PO6C 3TZVC 2HP4A 4PRPE 2AGJL 2XWTA 5J7CC 5BRZB 3KPPA 2Y1VA 5F21B 1LD9B 3DWTA 3X12B 1MY5A 1QBBA 4YFLF 3O2VH 2VLKA 4HT1L 3DMMA 3UC0L 5LGJA 1IAKA 1INEL 4GRLD 3I9GH 1FJ1A 4JO1H 3QEQB 3BPOB 4LMQI 2P42B 4X6CA 1K85A 4WIQA 4WWKD 1RY7B 3MBXL 3FRPA 5L9DL 2AQ2A 2MTPA 3FT4B 2NLJA 2NY1C 4QT5B 2WM0A 1S5IL 1N0XL 1U6AH 3AMKA 1V3KA 5EBWB 4PGEB 1FYTA 4UOW0 2WIMA 5FYLE 1A0QH 3WO4C 4W81A 1OGTB 4DVRL 3F7RA 5HGBB 1T66C 2I24N 4XMPL 3SCMB 4KH2A 3B9VA 4OZFB 5IJVB 4NKMA 5ESQB 1HXMA 2VIRB 1ETZB 3EYSL 1HIMH 4DGYH 1WC7B 4FG6D 3QEUB 3WUWG 1BVKB 1JUFB 2UUDH 1AHWC 1Z0MA 4BSJA 5T3ZD 1MIEH 4JDZA 1X44A 4WI2A 2CSPA 2Y7QA 4ZXBA 1Q9LB 4NNXA 5JLZB 1CDGA 2DBJA 2V5RA 3ULUH 1WTLA 4LNRA 3D5OF 1U3HA 1P6FA 3HKFA 5EU5B 4WHTB 1UH3A 3WKMH 3L3HB 4YDJB 1F6LL 3PP4H 3T77A 1AGDB 4EXKA 3OAYK 5ERWB 3S36H 2VDLH 1B0RB 5F9JB 2R1WB 3DUSB 1G7IB 1CU4H 3MJ8A 1YQVL 3NN8A 5J6GA 5D9SA 4E0RB 5EO1A 1JPST 4UTAH 4S1QL 4XBGA 5DRXA 2Q6WB 2FIRT 1BZ9B 3QIWC 2D7OA 3OHXB 3BD3A 5C08E 4NN5C 4O2FB 1TMCB 1NBZA 4HFUL 4H1LA 1NC2D 2YA0A 3MRKB 4GBXB 4GRWH 4F2MA 5IVXB 1DP0A 3IJYA 3HE6D 1ZHKB 3VFVA 2LU3A 4B7LA 1YECL 3MRHA 2ZCKH 2Z93B 5EU3B 3MV7E 3OKLA 2EE2A 3WMSA 2YK1L 3SJVD 4G8FA 5CD3B 1PEWA 4P3CH 4OLWH 3FRUA 1MQKH 3E3QE 3QO1A 4OZHB 3UJTL 1GAFL 4FQLH 2QL1A 5JNYA 3S4SB 3D9AH 3VFTA 4QY8A 3VXUA 1MAKA 2CGRL 1ZVYA 3V7AE 4ONGH 5DUBA 5I66B 3QDMB 1XR8B 4NQSB 1AIFB 3KVQA 2WBJB 3NTCH 4X8JA 4Y5YC 1OT2A 4Q9BA 1S7QB 1EVUA 1J1PH 5C0JB 1VFBA 3SKOA 3SO5A 3RWHA 2JTDA 3SGEH 1XIWB 3HZMB 4ODTH 4MX7B 1Q72H 4RMVA 3T0EA 1JWUB 4OZGB 2XNAA 2FX8H 1RJLB 3QP3A 3ES6A 3D0VA 1PKQB 2Q7NA 1T21B 3O0RH 5JDSB 1P4IH 1RHFA 5ABDE 1AR1D 5J8OA 1P9MC 5ITFA 25C8L 4HZAA 3O6MH 1QSFB 1JZ4A 4TVPL 2OP4H 3QUXD 2E7CA 2HMID 3DRQA 2IADB 2HG5A 5FYKD 1DVFD 2IANB 4N8PA 3LQZA 2X4OA 4ENED 3T8XB 2EIZB 1FRGH 4NQXB 3T3PF 3TO2B 4M3KB 2V2WB 4BKLA 1YUHB 5T3ZE 4PGCB 4YXLL 3GSNB 5DQDH 2CMRH 2QADC 1CGSL 1I7UA 5FUCC 4EI5A 5CIPA 2O5YH 1CD1B 3CXDH 4ZS7L 5IB5A 1BQHA 5I1JL 2VDQL 5CINL 4FQIL 1KENH 2RFXA 3BHBB 3H3PL 1NFIB 1QLEH 5D5MF 4XP1L 5B21A 3F7PC 4YHKH 2DMCA 4YR6B 4OB5H 1N7MH 5D6CB 3ZT7A 4I3RH 5KTEL 4FQCL 3C5ZB 2GQHA 1NAML 2FGZA 4XHJD 2NY3C 4UT6H 3VFRA 5BW7A 1N64H 3RPIB 2J3SA 1MFNA 2P5ED 4LLVB 3NCYS 3MGTB 4HUMB 1KB5A 5I73B 1EEYB 3LIZH 4RWYH 5GGSY 5FFLA 2MPAH 1A5FL 4NRZB 5FKPA 4PJ9A 3RX5A 4F33B 1VACB 2W0PA 5SV4A 5GRJH 3QUMA 5GS0D 1RURL 3P77A 2R0LH 2ZKHH 3ARSA 1AJ7H 1I3UA 4OCRL 3SKNA 3HLAA 5L2JA 1FGVH 1AXSA 4BZ2L 4NT6B 3MYJB 4XVTH 3SJVE 3GIZL 3BGAA 5I76A 3QQ3B 3W9EB 4G8EB 4U1MB 3T4AA 3OPZH 5CJOL 5D7LE 3L5XH 4X5WA 3CMGA 4L8DB 1CI5A 1T1XA 1FFNB 3EFDH 3QWRA 4Z7WE 1KULA 5SX5H 4PRHB 2VR4A 2BVEA 2HFFA 5E2WL 5DK0B 3REVB 1YEJH 3F12A 2MFNA 3WIHA 1EGJA 3RDTD 2Z35A 2VXSL 1NMCC 4NUJA 1SVCP 1UQSB 4DZBB 4HIHB 3ZE1F 1GHFL 5I15L 4IJ3B 2RIKA 4G80B 1A3RH 2MNUA 4LSTH 2BSRA 4F15C 4MD5A 1ORQB 3RBSA 2Z4QA 4CJ1A 3RNQA 3W0WD 3P11H 3QXVA 5FDYA 4QRRD 4PJCA 3TO4C 4NRYB 4Z7VA 1RMFH 1X5LA 2Y36H 1CZ8H 2AJXH 1MY7A 2IAMD 3HNVL 4HZLB 3SDCC 4H88H 3U0PB 1VENA 2NY5C 1A6WL 12E8H 2WSKA 5I1EL 4P4KA 2GJ6B 1MRDL 3MRJA 4FN0A 5DEZA 2BNRB 5KZCB 2VH5L 3VXRE 4EZMA 5J6HA 3SDYH 1MCWM 1BZQK 3I2CH 2HJKA 1YMMA 3HRZA 1QKZL 4JM2D 4L4TD 4PTUA 3KJ4B 4D0DA 4LSDA 3WFZA 1BQSA 1S7WA 2APWA 3GBLA 2M2DA 3IXTA 4X98A 4I3SL 2VISB 4NBXB 5L0QB 5FYKE 1OP3H 4YLQT 5DMIL 2WV3A 2ERJB 3UTZA 1QG3A 2XOTA 4PLJC 2DQTL 5IQ7H 5F7WC 3ARXA 2FR4A 3WLBA 5IFHH 3QUZD 3TV3L 5I19L 1KBGL 2A6DB 1MJUH 3SE8H 1H3PL 2XKNB 5EIQA 2M1KA 3FB5B 1HH9B 4G8GA 1FCGA 4UDTB 5IB1B 4FMFA 3PGFH 1F4HA 5DMYA 1DTUA 5LBSL 4B5EA 2J8UE 1IAII 5B39B 1A3QA 1I1FB 3I6KB 1INDH 4QHMB 4ZUSA 5C0CB 3P0VL 2P47B 1QRNA 4X7CC 5GGTA 4RA3A 4ZFZA 1O0VA 1CE1H 4U1IB 1JJUA 4HWBH 5JIIA 4EN3B 3D39D 2P45B 4LLWA 2B1HL 4WHDA 2P5EE 2WIIB 4XTRC 4JZJB 3UTQB 4P59L 4M1DH 3EO1A 4N8VG 5IF0B 1TCMA 3VJ6A 3ZHDA 3B2UD 4FS0A 1GZPA 3BWUC 4KQ4H 2VLKD 3CLFH 3RVXC 3RIAF 1UJ3C 4D8PB 1GRWA 1RAMA 3GGWB 1EJ6A 2PR4H 2VDKH 4NQDD 4NQUA 3TBYB 1MRFL 3DROA 4K3DL 5CZXC 2RJMA 4JFFD 2EDHA 2VXQL 1NGQH 3WN5B 1ZLVK 2JB6B 3CSPA 3OL2A 1P84J 2DDQH 5IBLC 3WFHB 4ETQA 5F7HA 1WZ1H 4HJGA 3KPOA 2AJZB 4LAJH 3HC0A 1BFOB 3O4OB 1RZIB 3ZKXB 2DQGL 4ZPTA 5F3HA 4NP4L 4M8VA 4PRDB 4X4MA 1G1YA 5JW5A 1A14H 1LDSA 4EI6A 3LVEA 3W0WE 1M1SA 5JXEC 1KV3A 1T1YB 4XP9L 5E6IB 4QRRE 4OFDA 4ZUTA 2P48B 3FMGL 4NCC2 4OAWA 1XF5A 2BDNH 3S34L 3BKJH 1VEMA 3TN0A 2X4TB 4XNQA 3NMEA 4LKXA 5CILH 4OZFH 3LEXA 3UDWC 2VAAB 4NJ9L 1M4KA 2IFGA 5T33H 5E7FA 3HB3D 2X9WA 4ZXBD 3QUYC 4FZ8L 3GMRA 4L4TE 3TZVB 4FXKA 1NEZB 1VEPA 4KMLB 3WJJA 1KFAH 4Z7UE 1F6AB 2WZPD 1WBXA 3OG4B 4EXPX 5BS0A 1W72B 3MODL 3VXTA 1FZJB 2FB4H 3MFFA 2RGSA 5GGVL 1OCWL 5EC2B 4IDLA 4F7MA 2H26A 4X7TB 4FQ2L 2Q87A 1HHGB 4JFQB 4X6CF 2NY6B 5KVEL 3G08B 2HLAB 1HH6B 4LSVL 3OKOB 5EU4A 5AZEH 4QTIH 2HTKD 2EDTA 3C60B 1PQZB 1F4YL 2R4SH 1MFEH 2UWEE 3ZKND 3Q6FB 3W2DL 2FHFA 4K94C 3KWWB 3GMOA 5IHUL 3C6LD 1GXEA 4HEPG 4PJBE 3H9SA 1HKLL 5D6DC 5GRUH 4Z7NE 5CSZB 2FNBA 1MCQA 3LPFA 1EERB 2ZJSL 1I1YA 1AO7A 3D39E 3EZJB 1MI5A 2GUOA 5C0AA 1HXYA 4QWWC 5AYQA 1M7DB 5JR1L 1MJJB 1BJ8A 1WCQA 5HI5C 3QJFB 4HMCA 5TDNA 2VLKE 4L29B 2L0DA 2UZYB 1TVHB 4NWUH 4NQDE 5JA9A 2EO9A 5HI4C 5DHVA 2QJDA 3EJYC 2X4NA 1JHKL 5DT1H 4JFFE 3RWEB 2PYFB 2R0WL 2Z31A 4L8SC 4LCUB 2VKXA 2HA1A 4TQEH 4LHQB 1UM4H 3IDGB 2KL6A 4JPWL 4DTGH 4MQ7A 1SEBA 3IDMB 1LE9B 4KKCD 3DJ9A 2L7JA 4Q6IB 1QSEA 1G7LB 4AIZB 2F9BT 2V9RA 3AUVA 4D3CH 4R2GD 5T1LD 5IMOA 4K9EC 3LRHA 1JPSH 3S37X 3LN5A 4WEBH 43C9B 4YBHA 4NQCD 4X5XB 4C55A 4PJFB 2BZDA 1KB9K 2GT9A 4RMRA 2HVJB 1K5NB 4CADB 3NZ8B 3VFMB 4HC1H 4LU5H 1OGAA 5I75B 4WI3A 2BVTA 2P8MA 4HGWB 3CX5J 4GKZB 5DD0H 3VE0B 4Y5VC 4KMTH 3EHBD 3AS3A 4XMLH 3DI2B 2NX5A 5D1ZB 3CDGA 1NLBL 2F54D 2XTJD 4EI5D 4Y5XB 5T1MA 3L5HA 4G6AD 2IPKA 1DFBL 1WAAA 1KCUL 3QBTB 3VI4E 1M6OB 4ZSOA 3GSNH 1HDMA 4WFHD 2EEDA 2ICWJ 5DEGB 1MRCH 4JHZA 3VXMB 4XNXL 1FFPA 2BHZA 1NLDH 3LQAC 2F5BH 4M4PA 5DJYA 5E8DH 4KZDL 5DUPL 1TZHA 1C08B 2YHGA 1I9IL 3NIGF 5CFHA 1OPGH 5IEKB 3QI9C 4M1GL 4XPBH 4AH2B 5IWLA 2PTVA 3GSXA 2IALA 4Q9RL 3FJTA 1KB5L 3MRBB 4PJDE 1AXTH 1Z2KA 2DMKA 2PYEB 3G6AA 4PLKC 5EBLB 1R3IL 4QRPA 1IAIH 4PJ9D 3DVGA 3QUML 4WO4A 3O6FC 4W4NA 3MOAH 4GLRI 4LDEB 1J0ZA 4LGSB 4XCNB 2RBLA 2DQUH 3U7AA 2J6EH 5I17B 3GKWH 3Q3GA 4RFNB 1B0WA 1OSPH 1A7PL 4QEGA 5CLWA 4P2CG 1X7QA 3ILPA 3W9DA 3RWCB 4PP1D 4RGMC 1LO5A 3WIHL 4OM1H 1HHHB 1EGJL 3KPNA 1IGFH 4Z0BH 1NJ9B 2Y07L 5FYJH 1L6ZA 3P0YL 3TFKD 3FRPG 4HWBA 5I1KL 3PWUB 4BZYA 3O3DA 4WTXA 1YY8A 5LWYH 3MRGB 4PJGE 3VRJA 4GQ9H 4LVNB 5IKCB 1X9QA 3KPRD 3FQTA 2CLVA 1BJMA 3O2VL 4MZ3A 4Z7OF 3LS4H 4JRXB 1HYSC 1GIGL 5F89B 3QXUA 5BRZA 4S0TD 3I9GL 1WBZB 3KYMB 4KDTC 1LD9A 4P4KD 1G9MC 4AG4H 4NQCE 2NXZD 2NZ9D 2AXJA 3L6FB 1F4WH 3VGGA 5BV7C 1JZ6A 3PWVA 4HWNA 4R97C 1IEBB 2AJSH 2C26A 5A2JH 3SE9H 4E5XA 3QEQA 1BF2A 4U0RB 3WFEL 3T1WA 3RIFK 2YWZA 1QFUH 1IGMH 4QHKI 5CBAB 2F54E 3RTQB 3QB7C 3ILQD 5CJQH 1BD2D 3FT4A 3PL6C 2XTJE 3CDCA 3OB8A 3VD7A 2D0FA 4PJ8D 2ZUQB 4G8GD 1MIML 5DMKA 5EBWA 4HJ0D 4PGEA 4WFHE 1MAML 1TJGL 2YSSB 5DURD 1HIML 1OGTA 4DGYL 5HGBA 3QDJB 2MHAB 1DBMH 3S3JA 5ANME 4PG9B 3SCMA 5GGTL 4Y16C 1QRND 4OZFA 5IJVA 1YY9C 4NRXA 3BP4B 1KN4L 3C8KB 5ETUB 3QHZH 1FG2A 2FBJL 3P4MB 1ETZA 1OAXH 1WC7A 4X83A 1X5YA 5H37G 1A1NB 4H1LG 3WLWC 3ULUD 3IDJB 4X6DE 2VR5A 1JUFA 3K2UH 4PJCF 3GDBA 2EKSA 3SDXF 3WKML 3TIEB 4M8QB 3PP4L 1Q9LA 3S36L 4M6NH 5JLZA 3HNSH 1FLTX 2VDLL 5ID0B 3KDMB 4JZOB 2C1PB 4M61B 1RQ5A 4C4KT 2YKLL 4ZFFA 3UPRB 1CU4L 3CZFB 4BUGA 4HKJA 3ULVH 2BY3A 4WHTA 5EU5A 4YDJA 1L9MA 2G60L 3T2NH 2X7LA 3ARUA 1N6VA 3FQRB 4Y4FA 5KAQF 3FCTA 3U9UB 1DSFL 5I8OL 2HT2C 3PDGA 4X9BA 1G7IA 3TBTA 1TJIH 3OJVC 4E0RA 5F72S 1DE4B 3VXPB 2DJ4A 1YYMH 3HC3H 2ARJQ 3QA3A 2Q6WA 3GHBH 4PG2C 4PJEA 1M7XA 3X13B 4U31A 1BZ9A 2J5LB 3OHXA 2ZCKL 4NQEB 2ADGA 2D7PA 3MRKA 5BMFH 4GBXA 3NCJH 5IVXA 2DTMH 2AK1H 4H5SA 1IQWH 4P3CL 5DO2D 3IS1X 4GRMB 5HHMD 3KPRE 1GGUA 1MQKL 2AV7B 3WDJA 4Z7VE 4H0HB 3D9AL 1J8HB 1F3DJ 3TN0D 5CD3A 4N90D 4ONGL 2NTSP 3H7LA 4PJAE 4D94A 4OCLC 2YPLB 5SX4I 1EHLH 1FL3B 1GC1C 5IVNA 3NTCL 1MF2H 1KLGA 5I66A 4NZUL 4EOWH 3QDMA 1XR8A 4NQSA 1X4YA 1AIFA 5AYUH 4ODTL 4TPRH 1WTGT 2EYSA 3MX0A 5A16A 1ONQB 1S7QA 5C0JA 1TNMA 2A9NH 2XZAH 2DQHL 1BD2E 2GK0B 1BQHG 3H7BA 4OFIA 1P4IL 2YN5A 4NCC1 1W72H 3MXVH 4JVWA 4MX7A 5ILTH 1BX2B 1A9EA 1JWUA 4FFWD 4G8GE 3KYKH 4OZGA 4M7LH 3O6ML 4MWFA 4GSDH 2OP4L 1NDGB 1PKQA 2CD0A 1X5IA 4UILH 5C9JB 4HC1A 5A2IH 2OS7A 4ISVB 4LARH 2VOTA 1FAKT 1MHEB 1IAIM 3GSQB 4GRWF 1DBKL 3CGTA 1QRNE 3QIBB 3I75B 3U46B 1QSFA 4HIIB 3LMJH 5DQDL 2CMRL 3U4AA 1F4XH 1AO7D 2IADA 2O5YL 3CXDL 4XNUH 2IANA 4XP4H 3ULUE 3T8XA 3TO2A 4NQXA 5IFJB 1YUHA 4PGCA 4L5FH 5EA0H 2Q1EA 4LPXA 3GSNA 4FXGB 4OB5L 3WNOA 3GNML 4JFEB 1SBSL 1WEJL 4L3AA 4Q7DA 3DVNB 1JGEB 3MGAA 2SEBA 1N3NB 3V9FA 2UUDK 4M5YH 2J8OA 3BHBA 4UT6L 3IDIB 4YR6A 1N64L 4B50A 3VWKA 3C5ZA 3NCMA 4JY4B 2D03H 2DQIH 1MAJA 3LIZL 4UT9H 1IKFH 2MPAL 4HWUA 3EYQD 2XN9A 1QSED 5GRJL 3R06B 2H6PB 4HKZB 4LLVA 4RBPH 4HG4K 2ZKHL 1SMOA 1EEYA 1AJ7L 4PUBL 3BKYH 4X4ME 2ZG2A 4NRZA 2J6EA 3QAZC 4F33A 1VACA 4XVTL 5IHBA 2VZ1A 4E42A 2XICA 2KUTA 5HHME 3DURB 3OPZL 4YZFF 3L5XL 3BKML 1MFAH 1QO3A 2ATPA 3EFDL 3QNXB 1JGUH 4AQ1B 4WI5A 2WQ8A 5MHSD 2AK4E 3VG0L 5CKAA 1YEJL 2CUHA 2W60A 1DLFH 2LAAA 4N90E 4G8EA 4U1MA 2OK0L 4AIXA 4ODHL 4JRWA 1TITA 5KAQG 4L8DA 3CX2A 2GFBA 1OQOA 5I1GH 4P3DB 4PRHA 1XZ0B 3BN9C 5J1AB 2EDEA 1A3RL 3QUKB 4LSTL 5EUOB 3REVA 4PP2B 2ZUSA 2NTFB 3B6SB 1R5WB 3P11L 3MA7A 4CW1A 2YXFA 3RWJA 3VA2C 4YUEL 1UQSA 3DYOA 4DZBA 1RMFL 2X1XR 2AJXL 3L1OH 4G80A 3S35H 4H88L 3BJ91 5CJ8A 1ORQA 2R4RH 2X4UB 12E8L 4MAYC 1EZVY 4APQB 4NN7B 1MELA 1WWBX 3ZYIA 2G5RA 2P5WD 5C09D 2Q7YB 4NRYA 4IMLB 3SDYL 4ZAKB 3I2CL 4HZLA 4W4OA 3KLAA 1JP5A 5BXFB 2GJ6A 4L4VB 2EXWC 1RUQH 3FT2A 3TA3A 2Z0BA 1F00I 3EDJA 4QRPD 3C08H 3OKEB 2K3TA 3QPXL 3LAFA 3VWJB 5C7XH 3GSUA 5IQ7L 4YEEA 3AU1B 3L3JB 4FHBD 4TOYH 2A6JB 3BKCH 1CICB 2ZUVA 1AO7E 2JJTC 5IFHL 3ARFB 2VISA 2XXCB 1A6ZB 2X1QA 3H8NA 1MJUL 4RGOH 3SE8L 3RZCB 1CWVA 5DTFB 1HNGA 4UINH 3PGFL 1JZ7A 1GGBH 4UDUB 3GMPB 3U30C 4MB5A 1U92A 4WW2B 2A6DA 2ITDB 2XKNA 1INDL 3MO1B 1K6QH 1QZ1A 3FB5A 1HH9A 2DJUA 2R39A 4UDTA 5DQ9A 5IB1A 1I1AC 3EO9H 1CE1L 2VNCA 5FO9A 1MCBA 4HWBL 4U1JB 4A2LA 1IEAB 2JCCB 1WAAF 1I1FA 3I6KA 5E1AB 3MV9D 3CSYB 4P2OD 3PHQB 5JIPA 5C0CA 5DJ0B 1JF6A 3WBDA 4U1IA 3AXLB 3QFDB 4LEOB 5IW3A 3B8SA 4PJXF 4CBPA 1BGXL 1QSEE 1W0WA 4KQ4L 4HIJB 1IJ9A 1V7NH 2YD4A 4PRID 3T3MF 4EJ1C 3CLFL 1RZJH 4NHCH 2WIIA 1BIHA 4JZJA 1V3LA 5BRZD 4P4RB 3CFKB 1WFOA 4Y1AD 1JNJA 4J23A 5KW9H 4KRLB 5GZOD 2PN5A 1Z3GH 1NGQL 4EVNB 4D8PA 3ZKSD 3GGWA 1WZ1L 1OLZA 5CEZH 2CH8A 1A6VH 3E3QC 1KTLB 2DLIA 1K4DB 3TBYA 3SOBH 2ARJB 3QEQD 2APTA 3TCLB 4DOHB 4UV7H 5MHSE 3WN5A 2CJUH 2JB6A 4OCNC 5D7KD 3WFHA 2OJEB 4JFPA 1LK3H 1D9KB 5DHYB 3JVGC 1UKTA 5SX4H 4M6OH 4PLOB 2VWEC 3C6SB 2VZVA 4I2XB 3RQ3A 2ESVB 1RZIA 2C9AA 3HAEB 1NGYB 3IGAB 3WNMA 4BA8A 5JORB 4PRDA 5TQ2H 5SX5K 4F9LC 3BDYH 2BDNL 4JVUA 2FGWH 2GTZA 1BVZA 1N5AA 3BKJL 3ELAT 2C4FT 4UOW1 5IQ9B 1T1YA 4XXDA 1BJ1J 5E6IA 1LQSR 3QNZB 1FFOA 1D5MB 2DJSA 2P5WE 5C09E 4ZTPH 2ICWI 1JPTL 1KC5L 1S78D 1RIHL 4JHWH 2CIIB 4IRSD 3DXAB 5CUSH 2JK5A 1AGBB 2ZCLH 1EO8L 4MA1C 4FG6C 4QRPE 1IGTB 5FGCB 1VPOH 1UYWH 1HSBB 3O8XC 3TZVA 2FB4L 4JANA 1NEZA 4IHOB 2PTTB 2NXYC 4TN9A 5BZDB 4X9IA 2CKBB 1YEKL 2QQLH 2X4SB 5AZEL 3OXSB 2R4SL 1X4ZA 1MFEL 1NCTA 2IMMA 1HHGA 4JFQA 3G08A 3OAUL 4OCXH 1UFUA 3SE4A 2HLFC 5DXWA 1HI6B 3C60A 1PQZA 2CK2A 1MCSA 3Q6FA 5LGHL 2AI0H 3KWWA 1S7XB 3MV9E 3OSKA 3LN4A 5J13C 4FQXB 1MWAA 1C8PA 4M93C 5CSZA 5E2JA 3WL9B 3STBA 4PRIE 3A6OA 1KYOJ 5I74C 4TRPH 5BRZE 3HE6C 2EYRB 4FFVC 5CSBA 1M7DA 1F97A 1MJJA 4Y1AE 2M8XA 3RAJL 3QJFA 3AS0A 5DT1L 1PG7L 1LO0L 2W9EH 4L29A 3ZYOA 1TVHA 4TQEL 4XX1E 4XCCL 1UM4L 2YPKA 5D7IA 3WNPA 4DTGL 1JWMB 4P5TB 1A4KB 1HCFX 2DI9A 1I7ZB 2KZ1B 1U91B 3MNVA 3QEQE 1HQ4B 3RWEA 3X3GH 4AT6B 4D3CL 5D7KE 3QPQD 4LCUA 2VL4A 3F62A 2WBJD 5JHDA 1IM9D 1JPSL 4YQXH 1FNFA 3IDGA 3IFLH 1JBJA 4OD3H 1Q9KA 4Z9KB 4Q6IA 5I1IH 1XIWD 1G7LA 2PCPB 4AIZA 5FUZH 3EZ8A 1NGZB 5HDQH 5BZWA 2VAJA 4HQQH 3D18B 4OBRA 43C9A 3ZT6A 2GJZB 2JJWA 4X5XA 2X40A 4PJEF 1CTOA 2VXTH 4KMTL 5KSAC 1UWGH 2CIKB 3SO3C 5HYFA 4XMLL 3VFOB 4H8WH 2KPNA 3NZ8A 3VFMA 4LPCA 1AR1C 3DBXB 1H3XA 4JFHD 3DPBA 5EZJB 4JPIB 2FH8A 1A9BB 5IVXF 4HGWA 4NFDA 4GKZA 3DSFL 3VE0A 1C5CH 4NC1E 5D1ZA 5DJ6A 2HMIC 3DTXB 1WCBB 3GSNL 5LJYH 3ZDYE 5F7UA 1MRCL 4Y5XA 1AGFA 1FFRA 1KJVB 3BVNB 5DVMA 1T5WB 1NLDL 3F8UB 5E8DL 1UWXH 1M6OA 4PY8J 3IVKA 1EO5A 5DEGA 1OPGL 4XPBL 3VXMA 5H94B 3BD5A 4OCWL 1GZQA 4P46C 1DANT 4KJWD 4BH7B 3C5ZD 2C4FU 1C08A 1K8DA 2N4IA 4X4XA 1AXTL 2BRQA 3HZKB 1MCEA 2QQNH 1IAIL 3HPLB 4NKQB 3H0TA 4AH2A 3MOAL 4RDQF 2QQKH 4XHJC 3MRBA 2DQUL 4QHUB 1D5BA 2PYEA 4L8CB 4J3WA 2J6EL 3H9ZA 1S9WA 3BP6B 3GKWL 5D70H 3S6CA 3GO1H 1OSPL 4OZGF 3UO1L 3RU8L 5TE4H 3TYGH 2R2BB 4XCNA 1KIPB 1A7RH 1B9ZA 4N9GB 3B5TA 5I17A 1ED3B 3RJQB 4MNGB 5GS0C 3Q6GH 4J2XA 4WTWA 3EOAB 4OM1L 1IGFL 3ZTJG 5A40E 4E9LA 4Z0BL 3IU4H 4Z95H 4OZHE 4LPYA 5FYJD 4LSRL 2OTPA 5ISZD 5LWYL 3CJJA 2XZQH 3PXJA 4OSUH 1NFKA 1NJ9A 3NIFF 5FV2A 3PWUA 1KPUB 4OFPA 3D2UB 3QDGA 3MRGA 1NFDB 2LAGB 1S7RB 4UUJB 1TPXC 5TDOB 4W68A 4AG4L 4CN4A 2LABA 1F4WL 4YXHL 4JRXA 2HN7B 3WXWH 1IQDB 5F89A 2I27N 1OW0C 4ZQKA 3AFLA 2J88H 5JO5B 3KYMA 3EYVB 2GJ6D 1JHLH 1LMKA 3SE9L 2BNRD 5KZCD 3L6FA 4OZFG 4KUCD 2IAMC 4TNVK 3V6OE 4L3EB 1VFAB 1QFUL 1IGML 4YBQC 1D5ZB 5D7SL 1IEBA 1NBYB 3ZDZE 4CVXB 3QO0B 4JKWA 3DX6A 4TNWK 3T1FA 1QVOB 3HA0A 4Y4KB 1KEGH 1B90A 3CUPB 4JM2C 5IUSA 4ZDHB 1IAOA 4D2NA 2CLZA 5HVHB 5IMMB 1T22A 4G6KH 4G7VH 1DBML 4R90L 2DL9A 2Q8AH 3G6JA 5BQ7A 3HUJE 1F8TH 3VFPB 4ELME 5ECJE 3QUZC 3QHZL 2EDJA 2YSSA 1FLRH 3BGFB 3PIQA 1XT5A 2O5XL 4P23D 1FIGH 1DBBH 4QYOA 3R1GH 3NGBB 3RGVB 2MHAA 4YHNB 3WE6A 4PS4H 4L1HA 3MBEB 5BVJB 2E7LA 5C0CD 2N1KA 3K2UL 1FL6B 1FVEB 3C8KA 3O6LH 5ETUA 1UGNA 4BSVB 3P4MA 4EN3D 1JYNA 5EOCJ 3HNSL 3KPSE 4P2YA 1PD6A 1ZHLA 4LLYB 2E9BA 1P5UA 4P9MH 1TNNA 3IDJA 4IDJH 3QISA 3ULVL 3UTPD 1NCNA 4K55A 2ZUWA 3TIEA 3V8OA 3T2NL 3TO4A 4TUJB 4OM0H 5C0FB 5ID0A 2E27H 3KDMA 3GSWB 2C1PA 4M61A 1IEHA 3SDCA 2XIDA 3UPRA 3B2UC 2YRPA 3CZFA 1EVTC 4U1LB 1XH3B 2IH3B 4RMUA 4YDIH 1YYML 3FQRA 1J18A 3MNZB 1DQDH 5D7JB 3B2VH 3HC3L 3U9UA 1QHOA 4JPKL 1BQLH 3GHBL 4ODVH 1FBIL 1DANU 4F9PA 3ARGB 5E7BA 1YC8A 5FYJE 2NY2D 3PG2A 5FGRA 1U3JA 1FYHB 1DE4A 3BRGC 3UJJL 3VXPA 5LQBL 5ISZE 2W38A 2WINA 4Y89A 4JN2B 4N5UA 2B1AH 1ORSB 2AK1L 2DTML 5DC9B 3X13A 3MOBL 2X6MA 5KVGH 4IEFB 1WIPA 4JFDD 5IEHB 4LLQB 4RDQG 3QXTA 1P7QB 4LSUH 4F57H 3IJSB 3DI3B 3HAEH 3RIAK 4J4PD 2XPGB 1A64A 4GRMA 2FH6A 2AEPH 1JZ2A 2AV7A 1BIIA 4H26A 4X7EC 3PWJA 5E2TL 1B2WH 3ZE2E 5IV2B 1NGPH 2FSEA 2VE6B 1EHLL 3MRNB 4YC2C 1J8HA 2FLRT 4NZTH 1MF2L 4JN1H 4EOWL 2GJ6E 2I07B 3S5LA 5L8LB 3P4NB 2CPCA 4MNHB 2BNRE 3ARDB 3SKMA 5AYUL 1FH5H 1UZ6F 4TPRL 3NCEB 4XC1L 4ZO9A 4G3YH 3G5YA 1FL3A 1XR9B 1HKFA 3P4LA 3O4LD 4HIXL 2A9NL 4A6YB 3PNWB 4XC3H 3ZL4H 3ULVF 3HB3C 4ZXBC 5FOBA 4FQHB 1R6VA 5ILTL 4LL9A 2ICEB 3MV7B 1CD8A 3KYKL 1ONQA 2NQCA 4Z7QE 4M7LL 1U3HC 5CP3H 4GUPB 3AVEA 1KB9J 2GK0A 2YPVH 3MRMB 3BPLC 4UILL 4WY7L 4ZFGH 2CKBH 3TYFB 2NY6D 1NL0H 5C07D 1Q9OB 2H2PD 1BX2A 2J4WL 5K59F 1QLFA 3WSQH 5F9WB 4GRLB 4HF5H 3C60D 4XPFH 4HH8A 1J86A 3LMJL 1NDGA 1F4XL 1H0DB 5ALBH 3T2QA 4ISVA 3TVMD 4XNUL 4XP4L 1MHEA 1MWAL 2HTKC 5C0CE 3DHJA 2RB8A 3I6LD 4GMTH 3I75A 3ZKNC 2VITB 4URTB 4I5BB 4L5FL 4WWKB 3KLDA 2BY0A 3C6LC 5I6XC 5KVFL 4KVCH 1V05A 4GG6E 1D5XB 4M5YL 5IFJA 3Q1SH 1B4JH 1UENA 4Z18A 3UTPE 2Z91A 1SYVB 1FSKC 4FXGA 3ISWA 4JFEA 3C87A 1CDCA 3DVNA 1TQBC 3MLXH 1X5KA 1JGEA 5D93B 4JRYD 5HPMB 3JUZA 2D03L 2DQIL 1IKFL 3IDIA 1UG9A 3UDWA 3IFNL 5L2KB 1I9RH 2EKJA 4MA1B 3KYAA 5IHZA 1RVFL 4JY4A 3QUYA 3L3GB 4BFIA 1CT8B 3AS2A 2D7TL 2EIBA 2FWOA 1XF2B 4POYA 4XI5C 4POUB 3U9PL 3SGKA 3R06A 4QRSB 2H6PA 4HKZA 3VI3E 1L6XA 2E7MA 2DWEB 4KKCC 4JFDE 2OLDA 1MFAL 4R2GC 1JGUL 5BVPL 2K7PA 2IH1A 1U2HA 3U2SA 4OFYD 5F1NA 3DURA 5TF0A 3ZKMD 3MNWB 1DN0B 4OF6A 5CGMA 3QNXA 1Y0LB 4BM7A 2VDNH 4KROD 2H8PB 1DEEB 3QDHA 3L5WB 1EK3A 3FAWA 1BM3L 3DUUB 4N5ED 5D6DA 4GXVH 4X6EB 4P3DA 4LFHD 4MD0B 1MCWW 1XZ0A 4FZEL 5J1AA 3L1OL 4CN1A 3QUKA 3S35L 4RISL 5EUOA 2X1PA 2F74B 2R4RL 3O4LE 4PP2A 2Y5TB 2NTFA 1R5WA 1YPZA 1ZOXA 5KSBE 2XTJC 4EI5C 3E6HB 1T20B 3KS0J 4G6AC 5TF1H 3RHWK 5KG9A 3FO9B 5D7IF 4ZOBA 2X4UA 4XPGH 2PW1B 3SJVB 5ESAA 1FQ9C 4APQA 1KELH 2VQ1B 1TJHL 1L0XA 5D7LB 1RUQL 2Q7YA 4O00A 3WNLA 4IMLA 4HMEA 5C07E 4Z7WB 4ZAKA 5I1CH 2VDOH 3ARBB 3C08L 5IVZB 1WICA 5C7XL 2VDRH 1SM3H 4TTDC 1RULH 4L8SA 5BXFA 3TH2T 4ODSH 5BW7C 4L4VA 4TOYL 3BKCL 2PYED 1R3KB 2ICWA 1OVZA 1VKXB 4HSQA 4M1CD 4U1KB 1T5XA 1KEMH 3RA7L 4RGOL 3OKEA 4PJ5B 5HDLA 4DN3L 4Z5RB 3VXOB 3VWJA 3I6LE 4LOUD 1GGBL 4O02H 4U6VH 3AU1A 3L3JA 5ESVB 2A6JA 4YNYA 3QQNA 5B38A 4PJ9C 2Q3ZA 3ARFA 2FIKB 3FO2B 1A6ZA 3RZCA 5DTFA 1K6QL 2HJLB 5DQJA 1NH6A 2EDQA 3MR9B 4UDUA 1CE6B 3RY6C 3GMPA 4HCRH 5D96B 4LPTA 2DYPB 1MCKA 2Y25A 1TTGA 4WW2A 3MREA 1PFCA 2VC2L 2ITDA 4U1HB 3S96A 2B5IC 3VXRB 4C56D 4JRYE 3MO1A 2F8XC 1XCQA 4FNLL 1C12B 4KJYA 4WTZA 1LP9F 2IMNA 4KV5F 3QUXB 4Q0XH 4U1JA 4PP1C 1FPTH 1QFWH 1IEAA 2JCCA 1OL0A 5E8EB 4PJHB 4WNQB 1UCTA 2CXKA 1DVFB 2B0SH 3CSYA 1KCLA 2ZP0T 4NN6B 5DD6B 1T7WA 5DJ0A 3AXLA 3QFDA 4LEOA 1A22B 2Z9TA 5KW9L 2IPUK 4FFZH 5F1OB 4KZEH 3U4BH 2BSTB 4HIJA 3BH9B 5LXGH 5DJDB 4R4BB 2E5EA 4UBDD 2YUWA 1EEUA 4BSWB 1T7XA 4P4RA 2ZNXA 3BMWA 1ZHBA 1A6VL 4M6AA 3CFKA 5CEZD 2YOCA 3SOBL 4PJFE 4UV7L 4EVNA 2CJUL 3O9WB 4I9WD 5GJSH 1VADB 2OZ4H 3B3IB 3QI9A 4P4KC 1N4XH 3TNNA 2CXGA 1JZ3A 1S7VB 4PJIB 1KTLA 4TULH 2HWZH 5TJWK 1K4DA 4M6OL 3TCLA 4ZUWA 2OJEA 1EJOH 3DNKA 1QP1A 2VL5B 5LKNA 2P5EB 5DHYA 3O6FA 4NQVB 1RJCA 3RTQD 5IBUG 4YJZL 1I8KB 2PNDA 5TQ2L 3D48R 3BDYL 3C6SA 4I2XA 4MNQB 5E24E 3HAEA 3MA9H 1IM3B 1NGYA 2BMKB 5DHXB 2R69L 4PY7B 3ILQC 5CHNA 4HDIB 2FX7L 1DL7L 2EICA 4MXVE 4WHYH 4XAKE 5DYOA 5JORA 4ZTPL 3IFPB 1LE5B 2YMXH 4LAQL 1X5XA 3LB6D 4PJ8C 5F7FA 4XVJH 5FECB 2BXZA 1UM6H 3QDJD 5CWSB 4HBCH 1XF4B 1HINL 1BHGA 5IQ9A 4ZODA 5CUSL 1ZMYA 3QNZA 2WP3T 1CDIA 1D5MA 3V2AR 2IBZX 1EV2E 3C5SA 2VXVH 1RZ8A 2CIIA 5K9JH 1BWMA 3DXAA 1OAYH 5I8EA 3OJ2C 2PYEE 1WIUA 1AGBA 3RDTB 5T3XL 2P8PB 4Q74A 1IGTA 4NM4H 3MJ9H 4OGAC 3KAAA 1HSBA 4XVSH 3VGFA 3GMQB 3ULUC 2EC9T 4K8RH 2NY5L 3OR7B 4IHOA 1YEFH 2PTTA 5CP3A 1G6RH 2MQ0A 4KDTA 5FYLH 1CYGA 5BZDA 1YA5A 4K3EL 1A6PA 4CVZB 3UROR 4X7DC 4YX2H 1RD6A 4OCXL 3Q48A 2X4SA 5AD0B 3OXSA 1RZGB 4PJ7E 2E6JA 3WS6A 2BSED 2HRPH 4D9LH 3K4AA 2AI0L 5FYKU 4AY0A 2C5DC 4C56E 4NO0B 3OAYH 2R29L 4JM2B 1RJZA 4L4TB 1GH7A 1KACB 4IS6B 3CVHB 3JTSB 3RL2B 3VGDA 1ZLWK 4NQED 4TRPL 4FQXA 3G6JF 3I6GB 3WL9A 4JQVC 2EDYA 3AB0C 2W9EL 2E9WA 4M5ZL 5DO2C 4IMKA 4DQOH 3LZFH 3MJ7B 1JPGB 3CH1B 4OLEA 4L3CB 3TT1L 3QG6B 4MQSB 5CEZE 4G6JH 4JG1H 1KCRL 3X3GL 2UWEB 1Q8MA 2YPLD 3TN0C 5B22A 4I9WE 5AWNH 4LP5A 3A67H 3VXQB 4PJBB 2L7UA 2P4AB 1YNTB 4P5TA 3IFLL 4RX4A 3AY4A 1I7ZA 4OD3L 1U91A 2DOCA 2XKUA 4DK3A 4HG4J 2IFFH 1HQ4A 4AT6A 2P44B 1JI2A 4HXAH 4HQQL 4Q9CA 5C0RH 3DV6B 3MLVH 4A6YH 5C3LD 3WJJC 3SGJA 4LQFH 2YN3A 5E4EC 3MLTB 4K3HA 2PCPA 5MEOA 4C4KO 4XPTH 1NGZA 1ODAA 3S88L 3D18A 2HTLD 1FAIL 3FO1B 4H8WL 1TZGH 2R0KH 2OXHA 1T7ZA 4HWZA 3UYOD 1WFTA 3U4EB 3FZUD 4FFWC 1VHPA 4JFFB 3QDJE 3BSZH 4GKSA 1P4BH 2XRAL 2OL3B 2CIKA 2XT1B 3QIBD 3VFOA 2JJSC 1CQKA 1U8KA 5EN2B 3O45B 3B9AA 1ERNA 1L7TL 4OQ1A 1H9VA 3DBXA 5EZJA 5HI3D 5T5FH 4JPIA 5D1QD 1A9BA 6CGTA 4TSBH 4OZIE 4RFOH 4C57C 1GSMA 2PXYD 3DTXA 1WCBA 4KHTL 2LU7A 1JFQH 4Z76B 4O51B 3STLB 1EUTA 4QXTA 4JFED 5HJ3B 5HVGB 5EWIL 1KJVA 5E2UH 3BVNA 1T5WA 1CGYA 3SKUD 3BESR 1GGTA 3HMWL 1KXQE 5I2IB 3JUYA 2QQNL 2UYLB 3ZLQC 5H94A 2AJVH 3E0GA 2MCPH 1QFWM 3E6FB 2OTWB 4JFZH 2BSSB 1N2RB 4HEME 1W8OA 2QQKL 4YO0B 4BH7A 5D2LB 3FONB 3OKNB 5LAXB 2W0FB 3CSGA 3HPLA 5D70L 1EAPB 2Z31C 5TE4L 3TYGL 4NFBA 3SPVB 3ZE0F 4QHUA 3EYQC 1A7RL 1J12A 5L8JB 4L8CA 2AJYH 3KLHD 3BP6A 4F7TB 3MZGB 4NQEE 5I1HH 3Q6GL 4KJPD 1V8HA 1VDGA 1G6VK 4QRTB 2R2BA 1OAZH 2EC9U 1KIPA 3IU4L 4N9GA 4Z95L 4G42B 2VLRB 4HCRA 4LVEA 4H25B 4MNGA 3V5DB 1T89C 2XZQL 2EEBA 4HD9A 4OSUL 3EOAA 3QIUB 4Y2DB 4AYFA 1JWSB 1VB9A 3B9KB 3BXNB 5GGRY 5EZOL 2CDEB 4PJDB 2YPLE 5I71C 3UYPA 1I1CA 2IQAB 4XPAL 4KK6C 3C6LB 1Y6MR 3IKCB 1OB1B 2A74B 2CR6A 3VGAC 1CGUA 3ZZ1A 3LEVL 1NCBL 1KPUA 2ZZUT 3UBXB 1E4WL 3GBNH 1BQUA 2VZTA 1NFDA 1S7RA 1D6VL 4JFOA 5TDOA 2NY0D 2JELH 1JHLL 4M6MH 3L5IA 5C8JB 1AH1A 3G6DH 3T09A 4ZAKD 3PGCA 1J87A 5DDHA 1IQDA 5J9PB 2OZ4A 1I4FB 4P9HH 5JO5A 3EYVA 3UTOA 1R24B 1TTFA 5FHBL 5ITBL 4L4VD 3E1F1 3B5GA 3MUHL 4TUKH 5EBMB 1IAMA 2ARWA 5FKAB 4L3EA 1VFAA 3QHFH 3KHOA 4J3VA 1D5ZA 3VWJD 4IOSD 1NBYA 4UAOC 4CVXA 3MSPA 4LIQE 2CDFB 1CICD 1QVOA 3MUGB 2VYRE 2WWKT 4Y4KA 3GSVB 4ZOEA 4G6KL 4G7VL 1V5JA 1XF3B 3CUPA 3VD9A 2BC4B 4JGUA 2Q8AL 5ICZA 4KWUA 4AENA 5KVDH 1S7SB 1DQQA 4K7FB 2DWDB 4JFEE 4P5KA 1FIGL 5IMMA 1DBBL 1WT5C 5ALCH 3R1GL 1OTUD 1C7SA 4PS4L 3C5JB 1TLKA 3UZVB 2Y72A 1BBJB 1AE6H 3VFPA 1P5VA 4HUVB 1ZVSA 4ONOA 4DCQA 4MCZA 5I16B 2FATL 5HD8D 4YHNA 3RGVA 1YPZF 3MBEA 2XACC 1UWXK 2X4QB 1T7YA 4IDJL 3WFDH 1FL6A 2F54B 4BSVA 4U3HA 1U95B 3JWOH 4NC2B 5CKGA 4OM0L 1BWWA 2IG2H 5FYKH 3MJ9A 3KHQA 2E27L 4KUZH 5CEYB 4LLYA 1BREA 4YHIA 3QXDB 5GSVA 3CLEH 4DKFL 2WUBH 3BUTA 3REWB 3TBSB 4WJ5B 4YDIL 5GIRB 2I9TA 1DQDL 3MRPB 3VXSD 5AZ2H 4GAJH 3ZTNH 1BQLL 2NW3B 3GSWA 2H32B 5ANMB 3GKZA 4UQ2B 4U1LA 5GZOC 3RUGB 4LNVA 5K9KB 4LHUG 1QD0A 3SDAB 3S5LG 3F7YB 3MNZA 5D7JA 3LHPH 2B1AL 2RAMA 3N9GL 1D9KD 2VN7A 1DQJB 3ARGA 1U8IB 2VABB 1JN6B 4X6DB 3BPOC 4LLUB 4JCMA 1V3MA 4F57L 5CZKA 1U8MB 5EUOE 4JN2A 3UBXI 1ZKAA 2ESVD 2VZUA 1IFHH 3I85A 1ORSA 1ZLVH 4X6FA 1Q0XL 2AEPL 2DQFB 4X9HA 1B2WL 1MVUB 1P7QA 1KSRA 5C0GA 3IJSA 1UC6A 4NZTL 4CMMB 5GS0H 1CG9B 2XPGA 4JN1L 1RZKH 4HKBA 1A3LH 1FH5L 1U58B 2VE6A 3MRNA 4G3YL 3SCMC 2A1WH 4I77H 5F8QC 1DR9A 3T04D 3JWDH 3RWGA 3DXAD 2I07A 4L4VE 4XC3L 3ZL4L 4MNHA 3EYUL 8FABB 3ARDA 1S78C 2D31A 1ITBB 1CD0A 2HKHL 3KNBB 5C08A 5HHVH 3DRTB 1XR9A 4OV5A 3EO0B 3V6ZB 2E9IA 1Y6KR 4OF5A 4A6YA 2YPVL 3IDNB 1G9ML 3KPRB 2DLGA 4C83B 4ELKB 3SQOH 4ZFGL 4ZYKB 3WNNA 4D0BB 4FQHA 1NL0L 4NQTA 2AKRB 5BV7L 2WUCH 1BFSA 2ICEA 3MV7A 2VJXA 4R4NC 5IT2H 1T04B 3WSQL 5L7XH 4X4YB 4HF5L 3CFEA 4GUPA 2NXZB 4JAMB 4LK4A 1LEIB 3O6KL 4PJAB 4G7YH 2OSLB 4F58H 4OV6F 1Q9OA 3GJEA 3K80A 4QKXB 1LILA 1TXKA 3MYZA 4BQBA 3U6RB 4EBQH 3VMNA 1YQ2A 4GMTL 4GRLA 1H3VA 3HG1B 2D9CA 1R5IB 2JCCE 1ZEAH 2BFVH 3R0MA 1NKRA 1CLYH 4KVCL 1WV7T 35C8H 4FQXD 3C9NB 3Q1SL 4FTVB 2VITA 4WWKA 4XXCC 4KGLA 5LVEA 3CVHH 4B7IA 1AP2B 1BD2B 3CXHJ 4KTEH 4TUOB 4QHLA 2V9QA 4GBXC 3HI6H 1QTYT 1UH4A 2JJUA 3HI5H 1IGYB 3NFNB 4MB3A 4AEIL 3UP1A 1R3LB 2UVFA 3OAZK 3GM8A 1I9RL 3VXSE 5F7EH 2HT3C 4JM4H 1EX0A 1MCOL 1SYSB 5K33A 4ZO6A 1OTTD 4DAGH 5LCVH 1T1ZB 4DOHE 4WWID 1RJYB 3QCTL 3IRPX 5J89A 4I0KA 4LHJB 3HCVB 1F58H 3L3GA 1CT8A 3MLRH 3N85H 3STZB 2CKNA 3PABA 1FNGB 3U7WH 1KJ2B 4I2XE 1EHNA 2I5YH 3QPQC 1Q38A 4YXKH 2ESVE 2WBJC 4QRSA 4QTHB 5JOEA 2DWEA 3K3QA 4LASL 3VMOA 2ICES 1PEZA 1XIWC 4N68A 1U8JB 5HGGS 1ZK9A 2KBGA 5KSUB 4UZGA 5IFAH 3LV3B 2VDNL 3MLUL 1YC7A 3ROOB 1Q0YH 1ZT1B 3DIFB 5EH1A 1FORH 3MNWA 3SDDB 1DN0A 2OJZH 3EAKA 3FB6B 1JE6A 4GXVL 3C2AL 5B3JF 3BQUD 4ZO7A 3RVVD 3V6OC 1S9YB 2H8PA 1DEEA 2OL3H 1MFBH 5MI0C 3S98A 3DXAE 3L5WA 3ARWA 2HYMA 5IW1A 5I1LB 3DUUA 3K4ZA 4AJ0A 2DLFH 4K71B 1I75A 2CK0H 4LCCB 5DWUH 2MKLC 3O3AB 2R9HD 4HK3J 5B38G 1I3RB 2F74A 2Y9RT 1A7NL 2Y5TA 3AM8C 1P69B 2V7HA 2DM2A 3HE6A 2VLMD 3BZEA 3GK8H 3E6HA 4E41D 5I1CL 1PGRB 2VDOL 3FO9A 2FO4B 5D1XD 2AK4B 2VDRL 3OKKB 3CH8A 2PW1A 3SJVA 1RULL 5E03A 4O4YL 4OCSH 4ODSL 2FEDC 4R8WH 5D7LA 5C0ND 4WTZG 2DLTA 4MJ6B 1S9VA 4MLIA 1KEML 1IMHC 4Z7WA 5TE6L 5EZIH 3ARBA 1R3JB 4KJWC 3C5ZC 1NMAH 3PWPD 4O02L 1X6NA 3F7QA 4U6VL 4V2BA 1UACH 5GGVY 1R3KA 4R0LB 3QZWB 4JHAH 1N0LA 5J4MA 1VKXA 4OD2B 4U1KA 3WFCH 2ZNWA 1NCCH 4PJ5A 4Z5RA 2HKFH 3P2TA 4F37K 3QJHB 4OKDA 4Y4HB 5ESVA 4HCRL 3FO2A 2PW2A 3U36B 4DKAA 2HJLA 3V7MA 1F42A 3MR9A 2X42A 4JO2L 1CE6A 4Q0XL 1FE8L 2DYPA 5J56B 1FPTL 4OLZH 2F58L 2F19H 3TJHD 3GIVA 4U1HA 3VXRA 4FQ1L 4K3JL 3FQUA 4XWOD 1C12A 1H8OA 2FECL 1Z9LA 4Q2ZB 5JZ7D 5MEPA 1IBGL 3QUXA 3U7YL 4FFZL 1NBQA 4KZEL 3U4BL 1J88A 3PWNA 5E8EA 4KKLD 4WNQA 3D2UD 4RQQB 5FUOH 1DVFA 3WKNA 5DD6A 4OIAA 4CDHA 4YDKH 2R1XB 2YUZA 3HAEG 4MS8D 4IJ3C 5GZND 2BSTA 3ROLB 1T3FB 5DJDA 4R4BA 2OZ4L 3BRFA 4BSWA 4G9FE 1N4XL 5SWQA 2YA2A 4C58B 2HWZL 5E00A 1S5HB 2G9HB 4W4OC 2YC1B 1M05A 3O9WA 5KS9F 2J8UA 1HHKB 4XNZB 3JSSA 4S1RL 3BWAB 4KKAD 5I1AB 3KS0H 3BE1H 4Y4KD 5E6YA 2ITCB 5GS2D 4AMKH 3WIFB 3NVQA 3VD3A 3MA9L 2VL5A 2BERA 3KJ4C 2P5EA 4NQVA 5C2BH 1AQKH 4LPUA 5F9OL 1I8KA 4P2QB 4HPYH 2B8OT 3AMLA 2J2ZA 3UMTA 5L0QC 1W0YT 4QXUL 2ADFH 2QEJA 2ERJC 1JI1A 4MB4A 4MNQA 4XVJL 4I48B 1UM6L 4HBCL 1IM3A 2BMKA 3LD8B 2V17L 2GKIA 4PY7A 1KCVH 2VLME 2H45A 5KBNC 1GL4B 4DUXA 5DJCB 3EDFA 3W11D 3IFPA 1LE5A 4E41E 3NOIA 3RGVD 5CWSA 5ACZA 3I02B 2VXVL 1XF4A 1DEDA 4R26H 3MBED 1BP3B 4Y19D 5DFWH 1OAYL 3TBWB 1KCKA 3Q2CA 4DVBB 1GPOH 5GISH 3MJ9L 4YHMH 4ZFOA 3KLSA 4WCYH 4XAWH 4XVSL 4AEEA 1QUNA 2RCSL 1NFDF 3Q5TA 1MUJB 3PWPE 4KRPB 5CJBA 4ZG1A 3LOWA 4K8RD 1A6TA 5J12B 4H0GA 4N8CL 4I3GA 3RDTA 4EN3C 3J7HA 2P8PA 5FYLL 5GRVK 2DKMA 5FYLD 1SY6H 5I8KH 1GGIL 4YX2L 4JZJC 3GMQA 3MMEB 5EOTB 1OW0A 3ULVC 3EOYG 1LK2B 2HRPL 4D9LL 4FOMA 5C09B 4MNGE 4CVZA 2ADJB 4MJ2A 4U6HA 5D7JD 2IAMA 3CMOH 2H32H 4YK4C 3WS3B 5K9QI 3I84A 5AD0A 2DQDH 1RZGA 4U1NB 3ME0A 4ZNEE 3ARGD 1HZHL 3KXFD 4K7PY 3WN5C 3FN9A 2IF7A 4NO0A 2I9LB 4ODWB 2F53B 1B6DA 2KDGA 4NKDA 4JM2A 4L4TA 2NY2C 4WGVB 2YEZB 4IS6A 2DQJH 3SHSA 3CVHA 4YPGB 2XA3A 3NCBB 3O4OC 3X11A 4NBZB 4WUKH 3ZKXC 5A1AA 4DQOL 3LZFL 3I6GA 2EE6A 4DKEH 4RZCA 1ACYH 3RJDA 4G6JL 4L4JA 4HXBH 4RRPA 1RFDH 4I18B 4K7PH 5HHOD 1JF1B 1AGCB 4JR9H 5AWNL 3A67L 3MJ7A 3CH1A 4IM8A 4L3CA 5E6IC 1BZ7B 1MNUL 3QG6A 5ADPL 1S8DB 1J0HA 4QRUB 2X89A 4EDWH 4CL7A 1MHHA 2IFFL 5FF6B 2MQCA 2UWEA 4RIRB 1FGNH 4X0KB 3RP1A 1RHHB 2GIYA 2NY1D 3VXQA 2ENSA 4KQ3H 2OTUA 4P2OB 4PJBA 1YNTA 5KJRH 5F88B 3LSOB 4FQJH 3D39A 4PRIB 3MV7D 3HI1A 3DV6A 3G5VB 3F58H 1YMHB 1TZGL 3MLTA 4XNMA 4Y1AB 3PDDA 1I3VA 1R0AH 1OP5H 3OGOE 1P4BL 5B8CB 2V7NB 2WBKA 3N06B 2YD9A 3RKDD 1BFVH 2BNQB 2NPLX 4NQDA 1IC7H 5EPMB 5BJTB 2NY6C 4YIQA 2H2PC 5T5FL 1UADC 3U4EA 4JFFA 4M9OA 3SE4C 4TSBL 3HE7B 4Y19E 4RFOL 5J1SC 3CFDB 3C60C 2OL3A 4NOFA 1HSAA 3O45A 3TVMC 5EU7E 1CXIA 2R15A 5E2UL 4NO3B 4YDVB 2OM5A 3RL1A 2DLEA 4M7JH 5I9QB 2XFXB 1NCWH 2DI8A 3SKJL 1XGRA 5INCB 4O51A 3STLA 4UTBL 5HYJD 3VW3L 5HJ3A 1LWRA 2AJVL 3S97C 2EDRA 2VLLA 4JFZL 3MLZH 1BMGA 1CFQA 3MLWH 1HCVA 5HDBE 4JG0H 3G9AB 3QWOB 5I2IA 5L2KD 2UYLA 5DVNA 3O3BB 4LRNH 1KJ3L 1RIUH 2VTFA 3E6FA 1N2RA 1HQRB 4YO0A 4HH9B 5JDJA 5D2LA 5FM5O 1E6JL 3FONA 3OKNA 4IRSB 3JV4A 5LAXA 5T3ZL 5CZVH 2W0FA 2AJYL 3KXFE 4F3FA 5A3ID 1MJ7L 2EZ0D 1EAPA 5AAWA 4N8VB 3SPVA 1OAZL 3S7GA 4Q6IC 1UXSB 1KJ2H 3MOQA 1FHGA 2BVQA 3PQYB 4F7EB 2VERN 3P73B 4QRTA 1MCFA 3O2WL 3WFBH 4LCWD 1WF5A 1MFCH 4XMKH 4G42A 1OF2B 2VLRA 2OI9B 4JKPH 1PW3A 4LRIA 3BZ4B 5HHOE 1C5DB 5D5MB 3V0VB 3V5DA 5F7MC 3N1QC 3ZKMC 4XPHH 5MERB 3VFNB 4BFGA 1UCBH 3BXNA 3L3OB 3NPZB 2CDEA 1YJDH 2W9DL 4PJDA 5I75C 1FVCA 2IQAA 4BZ1H 5D72H 3C6LA 3CIQA 3IKCA 2A74A 3HMXA 5D1ZC 3QR2A 5E8OB 1FV1A 4N5EC 5DEFB 3CFJB 1FFQA 3FQXB 4Y5XC 3TP4A 2XWBB 3G6DL 2V2XB 3VRLE 2EDNA 3KR3H 3IFOB 4J3UA 3UBXA 1YN6B 1NC4D 3R4DA 5I8CB 4P9HL 2C4XA 5F3BB 3TIDB 4X4ZA 2QSCH 4GAGL 5D7LD 4TUKL 3PV6B 3ARBD 4OCYH 3QHFL 1HILB 4QRQB 3MRDB 4GW5B 4ONFH 2YD5A 1I4FA 1ZANH 3GSOB 4GJTB 1FP5A 4QCIB 4RMSA 4ZNCD 5IB4A 4G9DB 1N59A 5EBMA 1AR2A 5FKAA 4W6XB 4PJ5D 3LH2H 4P2RB 2EO1A 1IM9B 3GSRA 3NCCB 2D4FA 4XNYH 4PJGA 5KVDL 3V5HB 2FD6L 1FZMB 3MUGA 3OR6B 5TE7H 4WGWB 2LV4A 1D5IH 5ALCL 1MHCB 1XF3A 4LOUC 3NCYP 5T1LA 2BC4A 3UJIH 4XCEB 1HK6A 1AE6L 4OZ4B 1FNAA 1S7SA 3BPNB 2DYPD 4K7FA 4NQCA 2DWDA 5HYJE 4RFNC 2WWMD 3FOMB 2K1MA 1VA9A 3VXRD 4NSKA 2VZSA 4JPVL 5F7YC 3C5JA 3EFFB 3DECA 4QHKJ 1QYGH 2A9ML 4HUVA 5MI0B 4LF3B 5L2KE 4ONHB 3JWOL 1J11A 4K07A 3H3BC 4ACPA 2IG2L 4JY5H 4OLYL 5FYKL 5I16A 4KUZL 3VFUA 2HH0H 2ZSWB 3MROB 1KG0A 3T0BA 2X4QA 2BK8A 2VDMH 4GH7B 2BOBB 5ICXB 2F54A 2JKXA 3PF2A 1U95A 4QHNB 4M3JA 3BW9B 1RZJC 1G0YR 1SY6A 5AZ2L 5M7QA 4GAJL 3BP7B 3ZTNL 1CF8L 4M7ZB 5CEYA 4LVNC 2OMNA 3QXDA 2HJFB 4KI5D 1LNUA 3P9MB 1CFVL 3REWA 4BH8B 2BY2A 3HUJB 4YHLH 4ELMB 4Z7WF 1VGKB 3TBSA 4HS8H 3EYFB 4WJ5A 1E4KA 5GIRA 4UBDC 1ROWA 3MRPA 3O9WD 4MYWB 3LHPL 2BRRH 3K46A 2NW3A 5JPNB 1U8PB 2H32A 3QCUL 1DLHB 4MDJB 4MSWB 4O2EB 5ANMA 4LCWE 4G8IB 2APFA 4DW2H 2V9TA 3RUGA 5K9KA 5DFVC 5E5UB 4NM8L 3F7YA 5ICYB 1IFHL 4YFDB 1ZA6B 2GYSA 2DIJA 3E2HB 4Q97A 3KPSB 4J7RA 5C3TA 5F7DA 5MEQB 1U8IA 1G9NH 4U0RC 1JN6A 4X6DA 1AC6A 5CMAB 1I8MB 1U8MA 2DQEH 4MNQD 5GS0L 1L7IH 5DK2B 5DMGC 1B6UA 3RTQC 4QNPE 1R3HB 4P99A 4DGVL 5IESH 1A3LL 32C2B 7FABL 3K74B 1MVUA 1CK0H 3RY6A 5J57B 1N5YH 4MMXC 2ZUQC 4G6MH 2A1WL 1CG9A 5H35B 1IZJA 3B8YA 4HX1B 3JWDL 4OIIL 5D2NB 4S1SH 1F11B 3QFJD 3RWIB 2YUVA 2EDLA 1QA9A 2IPTH 3CVIH 3DX9B 3HS0B 3LB6C 4ZFOL 3WEXB 1U58A 4PV8B 4PGBA 5TGBA 3V7AG 4HUKB 5ISZB 5H2BB 4HIEA 2E7LC 1KT2B 5DZLA 1I8IB 4LLDB 3GBMH 4KVNH 2XY1A 4WFGD 4PLJD 8FABA 1N8ZB 3D85D 4BQ6A 4HPOL 4U0QB 1J7VR 2BOCB 2H9GB 2GITB 2Q86A 4PJ5E 1E27B 3EO0A 3V6ZA 3KGRA 1ZLSH 4O2CA 5L7XL 4LVHB 4CUCA 3IDNA 3KPRA 3PUCA 5CLTA 4C83A 5EOCL 4ELKA 3WJLA 4ZYKA 4KTDH 5FM4A 4G7YL 5IM7A 2EIEA 2J8UF 4F58L 2AKRA 4MA7H 5D4QA 5CAYB 2EC8A 4UNVA 4JGMA 4RFEA 3OKMB 1T83C 1T04A 2DIAA 4X4YA 4AM0B 1I8LC 2B4CH 4PGDB 1LEIA 1ZEAL 2BFVL 3R0NA 4PJAA 2OSLA 3ARRA 4HK0B 3BIKB 2AJUL 4NO0D 4YBLB 1YEIH 3U6RA 3RX7A 4F9PC 1Z9OA 3CVHL 3QULA 2ENYA 4PJHE 3HI6L 2BJMH 2OR9H 2WK2A 3HI5L 3RRQA 2XWTB 3C9NA 5E5RB 2J5LC 1CXKA 3KPLA 4YHOL 5FGBC 3KPPB 4I0PB 1EA9C 1KIQB 1AP2A 1BD2A 4KK8D 2JF1A 4JDTH 5F7EL 4JM4L 4V1DD 4PJ8A 4KI5E 3DMMB 1X5GA 5LGJB 1IGYA 2EYTB 3D69B 1F90H 4OF3A 5HYEA 1QACA 2ZSVB 4UNTA 5LCVL 1R3LA 2X89D 4CMHB 3L3KB 4P23B 3WD5L 4POZC 4ZD3H 3L3IB 4X6CB 1SYSA 4U33A 4BJLA 3MLRL 4PJIE 2X10A 1T1ZA 3BEVB 5DJXA 2W91A 3U7WL 1RJYA 5I1DB 2I5YL 4XH2B 1ITCA 4XBPB 4YXKL 2NW2A 4HBQA 5KSVB 3HCVA 3LKQB 4R3SB 1YDPA 3O3EB 4XWGL 4GG6B 3STZA 1NGXB 3MBXH 4TYUA 3K4DA 5L9DH 1KJ2A 5IFAL 1D7FA 3T4YB 4MNQE 1UWEL 4QTHA 1S9XB 2VUOA 4YH6A 3VCLB 1S5IH 1A8JH 1FORL 1QOKA 4YK4B 4TSAL 5FYJU 4J8RA 1F45A 2OJZL 3CFIC 5KSUA 3LV3A 1H15A 1ZT1A 2HTLC 2OL3L 4JM2F 1RZ7H 1RZFL 3DIFA 3QFJE 5GPRA 2QSVA 4H8WC 2DLFL 3CFCL 3FB6A 3VG9B 5DJZA 4Z7UF 3FZUC 2EDWA 2NY2B 5DLML 4JDZB 1S9YA 3T65A 5DWUL 2ED9A 4M7LT 2R23B 2XQYG 3QIBC 3W5NA 2O61B 4WFGE 3RVTD 5FXCH 4O5LH 1O7SA 3A6CL 4JFDB 5HI3C 2UY6A 4JQVA 4LCCA 1EEZB 1Q9WB 3BO8B 3F6IA 3T77B 3FFCD 1OP9A 3O3AA 4U1SB 2ZPKH 5K9OB 1CVSC 4WU5A 4OCSL 2WQRA 3MCG1 5E6ZA 4R8WL 4HAFA 4LQ1A 2UWEF 3MJ8B 3L7FB 3NN8B 3TLRA 5J6GB 4U2ZA 5EZIL 3ARVA 4WFFD 2AK4A 2XKSA 4PJBF 3OKKA 4IOFC 1NMAL 2C3VB 4XBGB 3VD5A 5E94B 4Z7NF 5IMKB 4HFWA 4JHAL 1P2CB 3WFCL 1P84K 1NCCL 1R3JA 4NHUB 1L0QA 3NA4A 3QEGH 3QRFM 4S1QH 5DK3A 3HZYB 3O4LB 3CAFA 3OTTA 4R0LA 3QZWA 5C1MB 3SGKC 4U4BA 4OD2A 5KSBB 1HE7A 3T08A 3OF6D 4XP6H 5F70A 2VN4A 4DEPB 3BUYB 3QJHA 4Y4HA 4G8FB 3KLHC 5E9DB 5FK9B 2VLRD 1KTDB 1MPAL 4KJPC 2F19L 1M7IB 3ZDXE 4Z77A 4V1DE 1CR9L 3C09C 5JNYB 3U36A 3FAXA 5C07B 5ELIA 4MJ5A 3VFTB 3QIUD 4Y2DD 2BVOA 1XGTB 2FZ3A 5B4MD 3B9KD 3EDKA 2VUYA 4K23H 4RGNB 2JJSA 1T0MB 3VU2A 3TVMB 2B20A 3HMXL 4YDKL 3S3SA 3D3VD 5HHPA 4DUVA 3OJDA 3N1PC 1QHPA 1WBYA 1VFBB 4JO3H 1U8OA 4ALAH 4HLJA 4RQQA 1QNZH 5J06A 2R1XA 3OX8A 5DC0A 1H3UA 2QTEA 4MDIA 1DQML 1FZOB 2A6KB 3NIDE 3J8F7 2J8HA 3ROLA 3X3FH 1T3FA 4IOIA 4LVOB 3GB7B 3OGCB 2LVEA 1K9TA 4APQC 2NY7H 2NY0C 3MRFB 4JRYB 4NN7C 1T2QH 4I13B 4KK5C 3ALWA 4UOJA 1S5HA 3BE1L 4ZAKC 2G9HA 4W70A 1J0IA 3EDEA 2YC1A 3H42H 3NABL 1HHKA 3P40A 2DI7A 1J0JA 5C2BL 1AQKL 3VI4F 1ACZA 3BWAA 3CU1A 4WUUD 5FO7B 2VQTA 3RVWD 4JFXB 4TVPH 2ADFL 1IC1A 2FJHA 2ITCA 3WIFA 3VWJC 3IF1B 6FABH 4ZPVA 5J11B 1CICC 3ZYJA 1AD9B 2E7HA 4OUUB 4P2QA 1OQXA 3ARFC 2C7UA 2RFXB 5FHAH 5GQBA 3UCRA 5HYQB 4XVUD 3RZCC 3FFCE 4OI7A 5HGHB 4DK6A 4R26L 4WEUD 2I26N 1T89A 4X7SH 5DJ8B 1CFTB 1NCAL 1G7JB 5I1JH 5DJCA 4WW2C 3SE3A 3N0PB 5A2LH 3VFRB 3KPQA 4XP1H 1OTUC 4WCYL 4XAWL 4WFFE 1JGVH 4I8DA 4K2UH 3I02A 4KROB 1OM3L 5D2LE 5KTEH 5TFSL 3CZJA 3HNTH 4DVBA 5JMOC 1SY6L 1NGWA 3UTSB 2W59A 1IGJB 3LKPA 4J3OC 1MUJA 1NUNB 5KOMC 3BFOA 3DX8A 2FJGA 2EXYC 2G5BA 1NSNL 5CCKH 3PP3K 1HHJB 3SKNB 5L2JB 1J0KA 3L95B 4FFYH 4OBSA 3MMEA 2DQDL 1RURH 4HKXB 1KLUB 2VLRE 1X5FA 3INUL 4OCRH 3TEUA 4KRMB 2P5WA 4Y0GA 5C09A 3SDAD 1T1XB 2ADJA 2HFFB 3WS3A 3PDOA 4J1UB 4U1NA 4PJGF 4MA8H 4EUPB 2DQJL 4PRNB 4QLRA 3LKRB 4WUKL 3S37H 4ODWA 2F53A 1V7ML 1D9KC 5E2WH 2XI9A 3RIFF 3D3VE 5D8JH 4DKEL 2WWKO 4RA0C 1HYSD 2Q3AA 4NO2B 1DCLA 2YEZA 4HXBL 3OG6B 4YPGA 1RFDL 4K7PL 3SDXB 3ZT5A 3TT3H 3TPUB 4JR9L 3C2SA 4CDGC 4N9OB 1WT5A 4DN4H 2BP3A 4AK1A 5BOZG 4HWEL 5LGKA 3UXFA 4PJ7B 4EDWL 4KY1H 5DJ2B 5GRYA 4I18A 2UZIL 1JF1A 1AGCA 4C56B 4MGXA 1LO4L 2FRGP 4KQ3L 1BZ7A 3QG7H 3W82A 4DWHA 1MCNA 1S8DA 2UZXB 5KJRL 2C3XA 1UB5B 1MRDH 5FF6A 3D87B 1S7WB