1Z2KA

Nmr structure of the d1 domain of the natural killer cell receptor, 2b4
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
108
structure length
108
Chain Sequence
CPDSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of the Natural Killer Cell Receptor 2B4: Implications for Ligand Recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Natural killer cell receptor 2B4
total genus 12
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11465 Receptor_2B4 Natural killer cell receptor 2B4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z2kA00
4P99A 1Q94A 2ZCLL 1AGFB 2DQCH 5JZ7D 2BK8A 1NEZA 1BX2A 1S9XA 1Z5LB 1OTTC 1JK8A 3MGOB 2BHUA 1R3LB 5IHZA 4IS6B 1XGRA 5J11B 3P73A 4PLKC 1CGSL 1QSFB 3P4MA 4B7IA 5E2WL 5F3BB 2Z35A 2VISA 3MUZ1 3G6AA 4TUJB 3GJFK 5DGQA 1WBYB 4RMWA 3LH2L 3ZT7A 4S0TD 3L3JB 2D2OA 1IARB 4PP1D 1PZ5A 1U8OA 3QFJE 1YYMH 2PTVA 4G8IA 5GGQL 3MRMA 4Z0XA 1ZLUK 3DUSA 1W0WA 2Z0BA 3D2UA 4KUCD 4ZXBB 3CZJA 3SDDC 3VGHA 5K33A 1JZ5A 4I9WE 2DM2A 4QRPD 2QQLH 1UWXK 1A14L 4R7DB 1BF8A 3TIEA 2ATPB 1NCAH 1WEJL 3LKRB 3BT2L 2AXFA 2VITB 3MRQB 4JPKH 4FABL 3VWJA 1HQRB 5ESAA 3GRWL 2VLRD 4GKSB 4LIQL 5HHOD 5GS1B 2J6EH 1FRGL 3KXFA 1RIVL 5F9OH 1G7LB 4ODUA 4E41A 2ADJB 5I2IA 1ZV5A 5CBEA 3WS6C 3PGFL 5C6PB 3G5VA 4Y5YB 3O6FC 2CXGA 4ZODA 2CR3A 3MCKB 4APQC 1SJXA 3MRDB 3MYJB 4PGCA 5D1XB 4G3YL 1FH5L 4TVPD 1EEUA 5C0JA 3BSZL 2Z92B 5D7JB 3JWOC 3CSYB 3MLWH 3NCEB 3DO7B 3BZDA 1A4JA 1JTOA 5CWSA 4R6UA 2W1NA 4JGMA 3EZ8A 2X1PA 2G5RA 3QWQB 1G6RH 2X09A 4NQTA 2NR6D 3P77A 3LY6A 3HRZA 4XNZB 2HN7B 3WD5H 3WIFB 1I9RL 2EZ0D 4K7FA 4IEFB 2F74A 2WAHA 4NWTL 3W11D 1P5UA 1AC6A 4AIZA 4OLYH 5K9OA 1AO7D 3NMEA 2VXQH 3LDBC 3SKMB 1BJ1H 3OPZL 3I2CL 32C2B 5B4MD 4M1GL 4PJ8C 1DLFH 4S2SB 1FNFA 3GJFH 5FA4B 4JB9L 5CFHA 4P2RA 4BSWB 2ADIA 1CXHA 5L0QC 1EV2E 2CIIB 3TF7C 1VDGA 1F6LL 4XVSH 4GT7A 4G6FD 4ZFOL 2IMNA 3B2UD 4P5KB 3SBWC 4NKIH 3LDBB 1KF9B 1O7VA 1RZJH 5D7IA 2R1WA 4NNYB 4TYUA 4UUJA 4HCRA 1AY1L 2IF7A 3L1OL 4UAOC 5EZOH 2H45A 1OTSC 1E4JA 3B2UC 2ID5A 1MJ8H 5AUMB 2WP3T 3PWNA 4XPHL 1JHKH 2DKSA 3NZHH 4K55A 2G60L 2BC4A 4I0KA 2Y36H 2X41A 1A2YA 3TO2A 1ZEAH 3P4LA 2A9NL 4HWEH 1XR9B 4WVRA 3QQ3A 1UB5B 3PHOA 4OLZL 5KW9L 2P46B 3IDMA 4G9FD 5ICZA 1P2CB 4AQ1B 3TYGL 4YHZH 2HP4A 3QHFL 1MFCH 1IAII 1NGXA 2VKWA 4OD3L 1J0HA 3QI9C 1F3DH 4UTBH 5C9JA 3KLHD 5AEAA 4R7DA 2MQ0A 2PYEE 4O51A 3WKNA 2V9TA 1KCKA 1YEJL 3FB8A 5CINH 1RZIA 1QPXA 1EBAA 1T0NB 2KUTA 8FABA 3IFLL 5DK0A 3FCTB 3HZMB 4YHYC 4WEBH 4ZDHB 4ZUWA 2AJUH 4BQ8A 5I16A 1XF3B 1HWHB 3W0WE 3N06B 3EO1B 3RA7L 1XGQB 3T8XA 1LD9B 3TBWB 3WE6B 5GS0C 1T7YA 3S35X 2GSGA 4HAGA 3RGVD 2FGWH 4JO2H 4BK5A 4Y4HB 3QPXH 2W0FA 3JTTA 5LCVH 5IV2A 2DTMH 2YWZA 2BVQB 5F7MC 4S1SL 2R8SL 3QCTL 4PD4J 1KLGB 2Y06H 1KUMA 3QNYB 4MQTB 2AEPH 4WI2A 5IMLA 1MHEB 5DD0H 4FP8H 5DFVD 1ZHBB 4PJ7F 4RFOH 2XWBB 3Q6FB 3P4OB 4J4PA 2R0KL 3MODL 4LRIA 5GZOD 5KVGL 2PW1A 5FOJA 2NY7L 5BOPA 2EYRA 2VLRA 3BZ4B 4J2XA 4S2SA 3V4VL 2R1YB 1BJ8A 2PXYA 2CKBH 4GRMA 5ISZD 5INCB 4JKLA 4NQDD 3RVTD 1QSED 4JQIH 5GRZA 4QRPA 3N85H 5CJQL 1FVEB 4XPAL 4TRPL 1NAMA 2Y7QA 4LNRB 3O2WL 2QHRH 4I3SL 3NIFE 3BD3A 3O4LD 2ZNWA 2WP3O 3GSRB 4LHQB 1U3JA 5FCUH 5EU7E 3DI2B 3LV3A 5CD3A 4F7PA 2YD2A 3NBNA 1OWRM 3P0VH 2QADC 4GKOA 4ODTH 3PWVB 3BE1H 1DEDA 3OAYK 3PQYA 5C0RL 1FLRL 3T3PE 4G7VH 3KPRD 1L7TL 3BN9D 4KJWD 4MJ6B 4DK6A 1MWAH 2VIRA 1MHHA 4YHIA 3O3DA 5I1HL 5E1AA 1ORQB 4LLVA 3SGKC 5E6YA 1DBML 1T7XA 4GW1A 3RWFA 2IALB 4FG6D 1ODAA 4M9PA 2AXJA 2AAVA 5C8JB 1GGYA 4HS3A 3C9NA 2EE6A 3MV9B 2DQHH 1U93A 3WUZA 3QJFA 5EFIB 4RIRA 4MHHG 3GJFB 2IBZY 3VWJB 2J3SA 1XH3A 3HA0A 5EBGA 4CVUA 1SYVB 4Y4FA 3CUPA 5EO0A 4NQEB 2FR4B 3NGBB 1T5WA 1EJOL 1JMXA 4NQDB 2J5LB 2VZOA 3I6LD 2GK2A 3PWVA 2MHAB 2QQNH 4FQ2H 3VFTB 3MRMB 4Z0XB 3MV9E 5T3XD 3LN4A 3SY0B 1H3XA 2GCYB 2CQVA 1FV1B 7CGTA 2DBJA 3EYSL 1NAKH 1S5IH 1XIWD 1OGAD 1YEHH 3ZYIA 3BDYL 2OJEA 4YFLI 1F00I 1R5IB 2XFXA 4OCWH 3LZFL 4FQJL 3OB0H 3VH8A 2JIXA 1R5VA 2UYLB 2P8MA 1MY7A 3F12B 3HZKA 1ZLWH 5A2LH 2VC2L 4GRMB 3JWNC 1K2DB 2DQDL 5I8EA 1FNAA 1NUDA 3K2UH 3Q1SH 3VA6A 5L2JA 2VLRB 3BZ4A 1KV3A 5DS8B 2VLKB 4LDOB 3QDJB 2ED9A 1HIMH 1PKQE 3LQAL 3N9GH 4PJEA 1Q0XH 4RMSA 1C12B 2E7LC 3Q6FA 2EDHA 3F7QA 4LEOB 1OCWL 3L3JA 3VFUB 1XAUA 4NHUA 3VFTA 3VXRB 5EBWA 1C7TA 2ICWA 5EUOF 2FEEI 2R69L 1MRCL 5KVMC 4FXGA 1NCDL 3GIVA 2BNQD 3ABZA 3OKMA 5DRNB 5HGGS 3RWHB 1Q9LA 4NWTH 1BEYH 4EOWH 3MV8A 5C07A 4DZ8B 4DQOL 1FDLH 1J0ZA 4U1GC 4GG8B 5IB4B 5JW5B 3U4BL 1KCVL 43C9B 4MNQE 1N7MH 5KAQG 1LEGA 3OBAA 5IQ9B 3DHJA 2G2RB 2Z8WC 4IOFD 3CLFH 4R0LA 5FYKU 5HD8D 3SCMC 2EIEA 4F37K 3U9PH 5JXEA 4TNWK 1TZHB 1MLBA 1Z9MA 35C8H 4M7ZB 3QEUA 1HSBB 1KEMH 4UDTA 4JFXB 1C08A 3MRKB 4TN9A 3PNWA 1RK1B 2F54D 5B38B 2XOTA 1DN0B 3D25B 4QHMB 3AAZA 1UKTA 1M1SA 3RX7A 4PP2B 2YXMA 5EZOL 3R8QA 3TA3B 1GAFL 4U0RB 3LQAC 2R2BA 2FATH 4LLYB 1M4KA 1MHPH 3R06A 1CF8L 2DI9A 2COQA 3BPLC 5AZEL 4K3GA 4IRSC 4RRPG 1GOFA 4NC2B 4KVNH 1LO5B 1BWWA 4H0GA 1LEGB 3DVNA 4L8CA 4JB9H 3OHXB 3QUZB 1JMZA 3GSWB 1PG7H 5IW3A 4UUJB 4OCMC 2BNRA 4K7PY 3T09A 3VXNB 5I8KL 3VFGL 5INDB 2UUDH 5JHLH 1C5BL 5DSCA 12E8L 1HDMA 2P43B 1OL0A 3FKUS 4H26A 4KC3B 3AC0A 1GZQA 2HTKD 4KTDL 4CVXB 1KSRA 3U2SB 2VQ1B 3QUXB 4ODVH 2KL6A 5I1JL 2GJZA 3G6DL 3OKDA 3T1FB 4I3RH 3SKMA 2YRZA 4J8RB 2PCPB 3AMKA 4PS4L 1J8HE 1N0LA 4G9DB 1A3RL 4RMUA 3MRJA 3WKMH 4CMMB 1UGNA 3PGFH 4NBZB 1H3TA 4PRPD 3WS3B 3LEVH 4PJDE 3O3UN 2L0DA 2WNGA 4OF5A 3QDMD 2FATL 3JV5A 2FJFA 3Q6GH 4MXVE 1KJ3L 3D39A 4PV8B 4IDJL 3MRRA 5D5ME 1UACH 3WIIH 4NQVA 4Y4HD 2IQAA 4O4YL 2XN9D 4LU5L 1IKFH 5DS8A 2NTFB 5K93A 2OSLB 1NCAL 4RMTA 4PGEA 3H7BB 4MNGB 1A6AA 2YUWA 1NCDH 4LLQA 5C0BD 4HKBB 1JPST 4YHNB 5FECB 2YKLL 2J1KA 1FE8L 1HHHA 3T3ME 3MX0A 4GKSA 1DP0A 1REIA 1Y18A 2LVCA 2X89A 3P2TA 1KJVA 2BNRD 3DYOA 2AV1B 3VGAB 1YMMB 3CMOH 5C0FB 2DI8A 5BCAA 3QT2A 2YSSA 4XHJC 1W72A 1Q72H 1KB9K 1RFDH 5LGJA 2OMBA 4MJ6A 1U8MA 3Q0HA 4ONFH 1H5BC 5LWYL 4NQVB 5DMJB 1VHPA 3RTQC 4NUJB 4WUUA 1IC4H 3IETB 4HWBL 4KGLA 3IU3A 1JTTA 4XGZA 2E7BA 1LO0H 1HWGB 1QA9A 3NACH 2JIXD 4G42B 3MUY1 3PABA 1N3NA 4Q9CA 3M8OH 3ULSA 5JO5A 4EN3C 2DQDH 4ZSOA 1HQ4B 2NMSA 3NA9H 5IMKB 4NNXB 3RBSA 4G6AC 4KK9C 2B5IB 4JZJB 4OUUB 2AGJL 5D1QC 3MROA 1YECL 5DEZA 4N1EA 2WIMA 3DV4A 5INCA 3RVXC 1KC5L 3O2VL 1UACL 3EO9L 4J3SA 2XG5A 3VGDA 3SDCC 2YZ8A 3UTQA 4JFDE 5F7FA 1KN2L 1AGEB 1JCKA 1S9VA 4XT1C 5FB8A 3BDBA 4P4KA 1F90H 4D94A 4OSUL 2ZCKL 5E2VH 3S3SA 1N8ZA 3L3DB 3O41B 3O6FB 3ZKQD 3IDNA 2AJYH 3VXNA 5HHVH 1J8HD 3VGAC 25C8H 3LHPL 3EDKA 1L0QA 3F7VA 4ETYA 4PJ5A 3T0EE 4ZOAA 3LOWA 5EWIL 2WWMC 2RIKA 4N0UE 3G5XA 5F1IB 3LRSB 3UTTD 1N0XH 4QF1A 1XGYH 3U36A 1Q0YL 4YQXH 5FO7B 1ZLVK 4KQ3H 4OKDA 3BI9X 5FF6B 3C5ZB 5EC1A 1SY6H 6FABH 1KEML 1I8LC 3PQYD 2CH8A 4M7KL 1EO7A 2H3NA 1UEYA 1F45A 3QA3A 3V4UH 3CXHJ 2NY5C 3MACH 3PL6A 4HKBA 4AG4L 3AXLA 4GSDH 1P7QD 3VXUA 1MCFA 5D4QA 2HT4C 4GAGH 2D31B 5DRZB 1A7QH 3NN8A 3QXDB 1KCRH 2B8OT 3WXWH 1JRHI 1XIWA 1ZS8B 1BBDH 1GVIA 4JHBA 5BVPH 3W39B 3JWDC 4Y2DA 3RWCB 2YR3A 1SJHB 4ZS6C 1U8IB 3VH8G 5IGXH 5HPMB 1UJ3B 2OS7A 4KAQL 3UDWA 1BQHG 3LIZL 4XMLH 4Y4FD 5BS0E 3OKOA 3V5KA 4OZIB 1EH9A 4RFEB 3PWLA 2IGFL 1OP9A 5HYSA 3QEQB 1YPZB 4WO4A 1KB9J 1CD0A 5F71A 1MOEA 3WO4C 4NO0D 4WU5B 3QUYA 1CTNA 4Y1AA 3VXUB 3HCVB 1JF6A 4ZNEA 3TBSB 3MGTB 3GIZL 1L7IL 1MRDL 2VJXA 3P3YA 5DTFB 3ZDXF 2E5EA 2WBJD 1WZKA 4MJ2A 3U4BH 1RUQH 1CZ8L 5HGAB 1AGDA 3UEZA 2W92A 5L2KE 4XX1E 5MEQB 2E6JA 4PJFA 5HHNA 2NY6C 1SVCP 3ZKMC 2Y72A 3MFFB 3M1BB 1T20B 3SE4C 4AEEA 2D7QA 4YC2C 1TZGL 1IT9H 4Z9KB 4HKJA 4NKMB 3G6JA 1NBZA 2I5YH 4KJQC 4DZBA 1P7KB 1OWWA 2CJUH 3B8SA 1AXSA 1MCSA 1CDIA 2IBBA 2A9NH 4O02H 1ZHLA 4IDLA 1KLUB 2AK4D 3L7FA 4MJIB 2EXWC 5K9QG 1FPTL 3ETBF 2VLJD 3LSOA 1HHKB 2MQ3A 3B9VA 2CDGB 2F5AH 2WBKA 3VD7A 2DLGA 4V2BA 4K8RH 4XAKD 2QQKL 1EFXD 3S9DB 5C92A 4HPYL 4ZUUB 2NXYC 4NP4H 3FAXA 4FQXC 3QWRD 5LGHL 4PRBB 3MR9B 5FM8A 4J4PD 3K4DA 4RBPH 4GAYB 1MCRA 4J6RH 2V5SA 1RVFH 3AREA 1G7PB 5DD6B 1IQDB 2O26U 4D2NA 1MH5A 4OFDA 3VXSE 3T0AA 2AS5M 3AY4C 3KPNA 3MRCA 3SHSA 5FGBA 4UTAL 4HGKC 2QQNL 2VLLA 5JXAH 3FB7A 1MIEL 3WFZA 4XC3H 5SV4A 3O3DB 1NMCC 2EKSB 1E6JL 1A1NA 5FYLD 5D7JA 1BJMA 2RFXA 3IDIA 3C60A 4LASL 4P23A 4Y16B 4FXKA 2CRIA 5ETUB 4NM8H 4CL7A 4OIAA 1WT5C 4X4MA 1R3KB 5T5FH 4OZ4A 4LVHB 4HH9B 4EN3A 4ZPVA 3EAKA 3G04B 4LPXA 5DVKA 4TQEH 4UQ3A 5GGTL 5E6IC 2X2YA 2FJFB 2OTPA 2NY4B 4XHQA 5BV7B 4H8WC 1BFVH 3L5JA 5AD0A 2VXVL 4ETQB 4HXBL 2OYPA 2ENYA 2PR4H 4KK6C 3MLVH 1F11A 1HCVA 3BP6B 4FA8A 4M61B 1GC1L 2EE3A 1JZ8A 5HGAA 3W0WD 3OQ3B 3QZWG 4OM0H 3FQXB 5LQBH 3ARED 2YPLA 4I0PA 4L4TB 3BSZH 3JV4A 3QULA 5JOFA 2V5TA 2D03H 4FS0A 1HKLH 3QXWA 3W9DA 1QHOA 1IGJB 2HRPL 3HAEA 2FL5A 4LNVA 2I60L 4PY7A 3VWJD 5JIPA 2C1PA 3OB0K 5CMAB 5LBSH 4MCYA 2IH3B 2VLJA 2HFGL 1JHKL 3G5YA 4UTBL 3F8UB 1JNHB 1LO2H 2F58L 1E4KC 3VD3A 3D9AL 4R96A 4DUWA 5A3ID 5HI5C 4Z5RA 2ITCB 5ACZA 4NYLA 3OKYA 1G9NC 4NGHL 4JGUA 5FUZL 3IAQA 1A9EA 1S78C 3CFKA 4C59B 3K1KC 3KPQA 3SPVA 5L7XL 1QFUH 1MPAL 1CL7I 1ZKAA 2WUBH 4H25A 1CD1A 3GMQB 4KKLD 1NUFA 3CFBB 4X5WA 4ZG1A 3MRIA 4MD4A 1T6WA 1RK1A 4KVCL 1VGEL 1MLCB 4X9FA 3GSQA 1F6AB 5CEZD 1MCWW 4KK5D 5TFSH 1KB5H 1T0MA 4FTVB 1FZMB 1ORSA 1TZHA 4XBGB 3BZEB 4RAVB 2UY6A 3VXRD 1CD9B 4OZHE 1X44A 2HFEB 3ULUD 1ZVSB 3OJVC 4MMXC 4E41D 1JF5A 5C08A 3OAYH 2Q76A 3RWHA 1FO0L 3ZTJH 1A3LH 1QFPA 3NABH 3PNWB 3L3DA 3O41A 5AYQA 3SN6N 2ITDB 4Z0BH 2DKUA 3MJ9H 1OHQA 3ES6A 2XACC 3OG6B 1IGTB 2MKWA 4GMTL 4UOW0 4I2XE 1BVLB 3I3DA 2DKMA 1CFSB 1I9RH 2HA1A 4N8VA 5HHXH 4PB9L 1G7HA 1MVFA 4U31A 2FLBT 4JO4H 1UZ8B 3ZDYF 3DIFA 4QRPE 1QR1B 4W70A 5KVEL 3P40A 2EIZA 4WNQA 1R5WB 1RUAH 1VGKB 1EX0A 1IGJA 3MJ7A 4NIKB 4XCNA 3GEWB 4QRSA 3SCMA 1AJ7H 1PLGH 4EIZC 1HZHL 4P2RE 4CKVX 2OMNA 5CWSB 5C0DB 1U8IA 1UKSA 3I2CH 2VN7A 3VXTA 2BNQE 4F2MA 4ZTOL 4HDIA 4LAQH 4X9HA 5F7NC 3ESVF 1NBYB 4PJ5D 1P4IH 1YYML 4JHZA 2DYPD 1P5VA 4XP6H 3MBEC 1QVOA 5JW4Q 1YA5A 3FONA 1CDUA 1MWAA 4Y5YA 1KJ3H 1WITA 1DCLA 1NANH 3T4AA 3VE0B 4ZFFA 4Z7VA 2FX7L 4PPTA 1RZFH 1UM4H 4X7TB 2ZSVA 5E2UH 4G8FA 3S98A 1FNGA 1IC4L 1VGEH 4O00A 5EBLA 4FQXB 1IGMH 1A6AB 3RWGA 2Z93B 2GUOA 4J3UA 3E0GA 3H7LA 5E99L 2P5EE 4M43L 5BO1H 2MHAA 1NAML 4BQ6A 4ZFGH 4LHUG 5C07E 4M1DH 3S6CA 5D7IB 3RU8H 1FO0B 4GMSH 4X6CF 1BM3L 2ICEB 1MJUL 4NQEA 2FR4A 1C1EH 12E8H 1DUZA 4R4ND 5JR1H 3TGXA 3QJFB 3K8LA 1H3WM 4YDIL 3ARZA 3VXRE 1ZHLB 5BQ7A 4KK8D 3PGCA 4XAWH 5B3JE 1T0MB 4FTVA 5I74B 5ABDE 1G9MH 4GW4B 1K85A 4ODSH 3A67L 5D8JL 2Q3ZA 3TN0A 4W4OA 2DL9A 2FD6L 3V52L 1TTGA 4IRJD 4IJ3C 3C2AH 1G7JA 1YQVL 1IGIH 1WAAF 1XGTA 1HHGA 4G8GD 4H0HB 5EU6A 1P9MC 5JR1L 3I6KB 1UFUA 3B9KB 1OLZA 4YE4L 2CDGA 3Q6GL 4BFGA 1JWSB 1KJMA 1S7XA 2I60H 3AY4A 5IB5A 5JMRA 4APQB 1MCEA 3ZKXC 4JG0L 4K7PX 4UV7L 3O4LB 4LKCA 5F97E 1FNHA 2PO6C 5ICXB 4MA8H 1TETL 1KTRL 4LLDB 4PJIB 3U4AA 4JM2F 5EC2A 3OF6A 3IRZA 5MEOA 2IPKA 4DEPC 5KSAD 1Y0LA 4LIQE 2YD7A 4NM4H 4EDXB 2FHCA 5EBLB 3BD4A 3VA2C 2NY5L 1TQBB 4XMPH 1IEBA 5IIEB 3ARFA 3J8F7 3W0WA 5I16B 5E8DL 4YIQB 1ADQA 2NY3C 2ARJB 2EDOA 1CDYA 4WWKB 4NZRL 2FO4B 2P48B 2XY1A 1QLEH 4XNYH 4JDTL 1V7NH 2VZVA 4ZUTB 5LG1A 4YEFA 2R0WH 4ONHA 2E7CA 4Z7VB 3KLHC 5B39B 1NGZA 3PF2A 2I24N 5D7LB 5DO2D 1E6JH 5CIPB 1I7RA 2SEBA 3QQ4B 3NTCL 3FONB 1K8DB 4GXUN 4HJJH 3MQIA 1DFBL 2W0FB 3JTTB 3UTPE 1JV5A 5DD3L 3TPKA 1I1AD 1U3HA 4QRUB 1RHHB 4UILH 2B2XL 1OARH 4X7DC 1V05A 2BSSB 1RVFL 3MNWB 2Z9TA 2X4SB 5JMOC 5IQ9A 3O6FD 3C60D 3VGBA 1MAKA 4JFED 4HULB 1HH9B 3QDJD 2MMXA 5F6IC 1B0RA 4QXTA 1LP9B 3MLTA 4CMMA 4LBEB 4APQD 4FFWD 4AT6A 1F3JB 3TVMB 1SQ2N 3F7VB 4LGPB 4WUKH 3GMRB 3V0WL 3NAAL 3HZVA 4S0SD 5ALCH 4P59L 3NIGF 1MIMH 3PV7A 2H41A 2HRLA 1QFOA 3U6RA 4U1HA 4UNUA 1DQMH 2IAMB 1JWUB 2D7TH 1JWSA 3MUGB 4PIRF 5SX4H 4X0KA 4L8BA 4O58L 4UOJA 1CR9L 1Z9OA 1EGJL 4NWUH 4NRZA 1JNNL 4ELMA 3SDXE 5JOPD 5E6IA 1F4HA 3V8CA 4R8WH 2AEIT 4D0BA 4XWOC 4QHKJ 1R0AH 1HSAA 5JDSA 3HNSH 4L3CB 3QEQE 5DFWH 5F6HI 5DMYA 3DXAA 2ADFL 4QTIH 4JQIL 2DLEA 3ARBC 4FFVD 5DWUH 2LTQB 4H88L 5TH2A 5D7JC 4D9QE 4R2GD 3N50A 4Z77A 1U92B 1AR1C 1GHFH 4LPWA 2DTSA 2J8UB 2FNBA 5JHDA 3HLAA 5FDWB 3TJHD 3I6GB 5GISH 2H2PD 3VMNA 5LGHH 3VWKC 3NZ8A 3T3MF 5EU6E 2HKFL 4JPVL 1MJ7H 4QOKA 2YSSB 2WBJA 3W5MA 2A9MH 1YNKL 15C8H 3M1BA 3MFFA 4RWYL 4JM2D 5J06A 3FB5B 2BZDA 4QRRD 2EDQA 3MV7A 2E6QA 5CKAA 4MA1B 3KXFB 3HB3D 1F2QA 1U3HC 5DTFA 3DTXB 1BZ9B 1T1XB 1E4XH 3O4OB 3U0TA 5IB4A 5FCSH 5T1KD 5E2TL 4OLYL 5ITBL 2YD5A 2NXZB 4N0UB 1U0QA 4YPGB 2Z31B 4OZFA 1EZVY 4OJFH 3VRIB 3RWGB 1KXQE 4NQXB 3CXHK 2OXGA 2GJ6A 4OCRL 2FHBA 3O81A 1URLA 1GGIL 4RGMB 4P2OB 1T1WA 4KKNA 2P4AB 1FFNA 4L3ED 5CEYA 2M2DA 5DD5H 4ZFFB 1UA6H 1V8HA 1CE6A 5C0IA 3QIBD 4F7MA 2J12B 5JLZB 1IAKB 3K7UA 2ZSWB 3H9YA 3U1SH 4XPBL 4MD0B 5FFLA 5DJCB 1UVQB 1G7IA 2X4QB 4S1DD 5C0ND 4NCC1 1YNKH 4RA3A 4TTDC 2FIKB 5JOPE 1G9MC 1WZMA 3G6AB 4QOKD 3GM8A 3VWJC 3C2AL 1CLOH 3BGMA 3OJMB 4Z6AT 3TO4D 4BZ2H 5TE6L 1MCLA 1BGXH 5D1QA 3KPRA 3HMXL 2ZUTA 4DVRH 3OHXA 1KIUA 5DVNA 3EO1A 1CICD 4Z8FH 1FVCB 4Y2OA 4YDIH 3DURA 5L2KD 2A6KB 5CEXB 4ZDHA 4L5FH 5BVJB 3LD8C 4OGYH 2NQCA 1ROWA 3ILQC 3L9RA 3UYRH 4BQ9A 4XBPB 4Y5XC 4JDTH 4CU8A 1I1YA 1A6PA 1WBZA 5ESVB 4KKLC 3MJ8A 1A6UH 1DDHB 1R3IH 5EU6B 1KTLA 1YNLH 2O5XH 3QIBB 1FFPA 2PXYD 3KPOB 4N90D 4LSSL 3TT3L 4S1QH 4Y89A 2J8UE 3STLA 3QH3A 3CFDA 4JRXD 3MZGB 2X4RB 3WHE1 3NH7H 1B4JH 1QPPA 4U1IB 5EOCL 1UM4L 3EDFA 3W0WB 3QFJA 1UWEL 1NC4A 1TVHA 2ZCKH 4UV7H 5EO1A 1FCCA 1K5NB 5HGHA 2VL5A 3PWJA 5MHSD 1XMWA 1A6VL 4OLEA 5CUSL 3FO9B 2UVEA 1NAMB 2Y7QB 4LNRA 4Y4KA 4OLVL 1WBXB 1T7ZA 5DI8B 2OR7A 4UI2A 4AJ0A 2VDKH 3QG7L 1W0YT 4CADB 1QNZL 1GYAA 2V7HB 5IVNA 4K7PH 3C6SA 4NOFA 2XQYG 4NKQB 2HJLB 1J8HB 4WW1B 1DDHA 4P0DA 4LLUA 2OQJA 1MHCB 2ADIB 5D9SB 4LCUB 4XCYB 1EVUA 2Y4SA 4NFCA 1HE7A 1DVFA 1OSZB 1XIWC 2PKDA 2X40A 2VDRL 2W9EL 1FFOA 2EKJA 1KEGL 1HKFA 5D72L 2WANA 1HI6B 1INDL 3NTCH 3IU4L 5DVOA 1TPXC 2C3GA 5J6GB 1I9EA 1OD9A 4HJGB 2J8UF 3O0RH 3RL2B 3D39D 4LIQH 5BS0B 1KN4L 3BO8A 3RIAF 4X4ME 1RUMH 1RULL 5K9JL 1LK2A 4MB4A 5EIQA 4M43H 5BO1L 2OJZL 3P0GB 3QIWC 5I6XC 1WFNA 1FCGA 4KJQD 4JFPA 3MNWA 5FYJL 2JJUA 5M95B 2GY7B 1WWWX 2FLRT 4TSCH 5F1OB 5E2UL 3CDYA 4PRDB 1C12A 3BGFC 4PRHE 1AO7B 4TSAL 3RKDD 5T33L 2QSVA 4O51B 2YN3A 4JRYB 1PG7X 2ERJB 3D0LB 4JJHA 4TVPE 5EA0H 2FJHA 4JFEB 4HKZB 3E8UL 4NKDB 1RZ7H 4LCYB 3ZYJA 4HJ0C 3OG4B 4RGOL 1QR1A 5J3HC 5EG6C 1WUNT 3MRGA 4UU9A 3OR6A 1U8HA 3OKLA 5TFSL 3GB7B 4B0MM 1HEZB 5IFAL 3CC5A 4GOSA 5FYKD 3QXVA 1X5ZA 3OTTA 4ZPVB 1BVLA 5C09D 1I9IL 1KPVA 1OAKH 4Z76A 4JY5L 2VH5H 3LN4B 5L88L 2AJYL 3LCYA 4XNQA 3MR9A 1YJDC 1VEOA 1B2WH 3RZCA 2VH5L 5L88H 1IM3B 3IDIB 3DRTA 3LKOB 1A47A 3HRPA 3S5LA 4PV9A 4TNVK 4ZFOB 3ZYZA 4UT9H 3LN5A 1MCKA 3O9WD 1G6VK 1R3JB 3L3KB 1NFDA 3SDCB 2XKNA 4PJCB 2CPCA 3VFMB 1AP2B 2MPAH 4AM0B 4LFHG 3GK8L 1MH5B 4OQTH 5F7KC 4PJ9B 3BWAB 1HSAB 4N68A 4MHHI 5C0AD 3TA3D 2DYPB 3UBXA 2K7PA 1B2WL 5BXFA 3MYZA 1D5XA 1S5HB 4GRWB 4OFIA 1WZ1L 4Z7UE 4R2GB 4OCSL 5I1DB 3K74B 1X5AA 4UINL 1MFEH 4C83A 3IDGA 1I8KA 5KVDL 5JXED 1CVSC 4B50A 1OW0A 3KNBB 4D9LH 3KXFD 4R4BA 5D2LF 3E1F1 4M6OL 3NFSH 1N3NB 1YNTB 3LRGA 3B5HA 4JFZH 1LEKA 2F5BH 4JM2B 2CO7B 4U1KB 2WINA 4RGOH 3LN5B 2OR9L 4JDVB 4L8DB 1KNOA 4QRRB 1P4LA 3RZWA 2VZSA 4YFDB 4PRIB 2QSCL 3TH4T 4MCYB 3E3QC 3VFSA 2UV3A 4F8TA 5JHLL 1DEEB 4LSPL 4W6YB 3D2UD 1KULA 4G6FB 4PY7B 1CU4L 1QFUL 2B1HL 2P5EB 3EFFB 3VCLA 5LKNA 1MVUA 3HNTL 5HDQL 4P48A 2B20A 1WTLA 2F15A 4ZFZB 1AJ7L 1PLGL 4GBXD 1TENA 1JGLL 3HMXA 4MQSB 3SDAB 3ZDZF 3D6GA 3I50L 2BOBA 3O9WB 4MQXD 4NGHH 3U9PL 2R0LL 3D39E 5GGUA 5FHAH 3S36X 4P5TD 4HF5L 6CGTA 4RGNC 4LASH 1JV5B 4PJBF 2AP2A 2VITA 3MRQA 3O8XA 3S96B 1UYWH 2EDDA 3TCLA 4M61A 1AE6H 1M7IA 2I9TB 1A6WL 2EEBA 3PHQA 1QHPA 1LWRA 3QEQA 2RR3A 2X05A 2EDLA 3KS0H 5DUBA 1W0WB 5HHOE 2RQ8A 4P2QA 1I4FB 1A6TA 1FNEB 5C0CB 2OJEB 4LFHD 3IFPA 2VE6B 2FSEB 3ME0A 1C5DA 2DLFL 5IIEA 3BKJH 2GSIA 3BESR 3LQAH 5DHXB 1CFNA 1WFUA 4X6FA 3SY0A 1KT2A 4LDEB 4NSKA 5C6TH 4CJ1A 4PJ7B 3QG7H 5HI3D 5I0DA 2YD8A 4FG6C 4LSVL 2DD8L 1NL0L 4KZDH 5ECJE 5TF1L 3D87B 5CIPA 1UZ6F 3RIAK 1KCSH 2BNRE 2V5YA 3T1FA 3TO4B 2Y5TA 3C5JB 5E9DB 3RVUC 4F7EB 1BEYL 4EOWL 1D9KB 4WFFD 1VCAA 4G80A 4E42B 3QEGH 5SWQB 2JCCA 4Z8FL 1KIPB 3P4NA 1QBMH 4Y5XA 1S7TB 1CT8B 1S7RB 4XAKE 3RDTC 4PJXA 3RUGA 5F9WC 1IRAY 4QTHB 2OJZH 3OKNB 4YBLC 5SX5K 1DEEA 4JM4L 3UJTH 3PIQB 5HJ3B 1A7PL 2A74B 2CGRL 4ZUUA 4OZHB 2BOCB 3V5HB 1R3IL 4KXZH 2PNDA 1U2HA 1J10A 4K7FB 1P4LB 2FWOB 4KJPD 5T1KA 1BP3B 1IFHH 1VENA 2EC9T 2ZKHH 1NKOA 3ZT5A 3U1SL 3BN3B 1QSEA 1YNTA 4NO2A 3PDOA 1MPAH 4PJGE 1P7KA 1RI8A 5LCVL 2VDRH 5ENWB 5D1XC 5T3ZH 1H8NA 2IH1B 3T0ED 2Z8SA 4PRHA 2ZOLA 1BQSA 1T5WB 3DGGB 5F1KC 4DWHA 3LB6D 3MROB 4WCYL 3NPZB 5F96L 4LVOC 3VGEA 1INEH 3TT1L 4JZJA 4OUUA 4OZGE 5T3XE 2APWA 3EYQD 3OWEA 3QCTH 2C3WA 1F4WL 1D5MA 1PYWB 4G9FE 1S7QA 4JKWA 2PW1B 1X6LA 1J1OH 3GSNA 4LMQE 2XPGA 3GKWH 1WTGT 2G5BA 4BJLA 1A1OA 3LEXB 4LL9A 2XTJB 3BYTA 2G9HB 3MRGB 2X4UB 43C9A 4PJBA 5EU3B 1V3KA 5JIHA 5E2TH 3N85L 4NRYA 3FN3A 1U6AL 3HZVB 4YR6B 2X7LB 4MQXC 1U8MB 4LSUL 3FFDB 4DTGH 1JIBA 5CJXC 3HAEB 2CKBL 2ENSA 3MRLA 2DQJL 3HI5H 2HFFA 5FIEA 3D2UB 4NZJA 2EZ0C 4OCRH 4ELMF 2C7UA 4JFPB 4OZGA 4P9HH 4LSVH 4QGYA 2FSEA 1CR9H 4UT6H 2DQFB 3L5WB 4GRLC 4OQTA 4G8FB 5TQ0L 3BFOA 3UTPD 4XP4H 1MCOL 3SEPA 4EIGB 1XGRB 1I8IB 1BIHA 1WC7A 1F8TL 2ZJSL 3CX5J 1IM9A 1N26A 3CFJB 5C0EB 3MXVH 4TULL 5DJDB 4URTB 1JPTL 3TJHC 3NAAH 5CJ8A 5ALCL 1OT1A 5C9JB 5FKPB 4JRYA 3C09C 1XGPA 3NZ8B 5D2LA 2A6IA 4JHAH 3IDYB 4JRYD 1PKOA 4ONHB 4CW1A 1Y6MR 3DUSB 4GLRI 3T65B 1FL3A 2Q20A 4PV8A 4Z7VE 1XGUB 1DQJB 2GJ6B 3PDOB 4F15C 1EJOH 2XKSA 5I1IL 1G1CA 1FAIL 3FQNB 4V1DE 4YPGA 5T1KB 3P4MB 2IFFH 3O9WC 3QIWB 5I6XB 1DBAL 5FYKH 3H9HB 1I1AA 4HC1H 2DM4A 2WWKO 1ZVSA 4NWUL 5HJ3A 3RY4A 5A2FA 1MEXH 1KCUL 5AYUL 4PJIA 1BVKA 1NMAH 4XPGH 3O4LE 3G9VA 5IMOA 3ULUL 1KG0B 1ZT7A 1TVBA 1CDBA 2CKNA 4GSDL 3L6FB 4OIBA 4YWGH 3BOVA 5HVHB 5C8JA 3KR3L 3OJDB 4NP4L 1EAPA 4LVNB 5JA8B 3KLAA 1R0AL 3G6JF 4H20L 4DOHE 2PXYC 1JUFA 4QTIL 1RQ5A 1HDMB 3BISA 4RFNB 1NLBH 4CN6A 5EOQH 5EWIH 2QL1A 4JM2C 2VIRB 3BVNB 4ODBD 4XPTH 4HWBA 4LEXL 5ID0B 1J1OL 2Q6WB 4YBHA 2HWZH 1XT5A 1S5HA 4D9QD 4Z7UB 2DLFH 4GW5A 3MNVB 4LSQL 4Y4KB 2EDWA 3KYOA 3TO2B 5A2JH 3KLDA 5BVJA 1EEZA 3QFJB 1NBZB 1KOAA 2VDOL 4WO4D 2YPVL 5H35A 3A6BH 3CFDB 2NY7H 4DZ8A 3ZDXE 5E5MA 1U8PB 1K3ZA 2EYSA 3TYFB 3WIIL 4JHWH 2HVKA 3MRDA 3MYJA 4PGCB 3MV9D 3VG9B 3EHBC 3HUJE 4JPKL 1SEQL 3UJJH 2ESVA 2ZUWA 2V5MA 5ESVA 1TTUA 1OGAE 3KLSA 5ALBL 5F9DC 3WEXB 1CICB 5I8CA 4GRLA 1IQWL 3QG6B 4P5TB 2EDKA 5DC0A 4X5XA 3DPBA 1BOGB 1PY9A 4KJYB 5BJTB 1R24A 1QFWM 1IGML 2W59A 5L2JB 1CD8A 4KK8C 1F4XL 3WDJA 3QRGL 5IV2B 3TZVB 3K80A 4Z18A 4CUCA 4GKNB 4U4BA 3V9FA 1DBBL 1ZVHA 4CRPA 4QNPF 3AU1B 4X4XA 4FXGB 5IBUG 3D18B 2D0FA 3NFNA 4FQPA 5FGSA 5B22A 2ICWB 5BZWB 2LQRA 4JDVA 4D9LL 3IFPB 4KRMB 2EDJA 1GL4B 3FCTA 1DQJA 2D3VA 3EYOA 3VGFA 3VD4A 1DANU 1NFIB 4WUUB 3TNMB 5C6TL 1R3KA 2HT3D 3TFKD 4FABH 3IS1X 1B6UA 1KYOJ 1SMOA 4YHZL 3BKCL 1TJGH 3BH9B 1ZT1B 3PJSB 2J88H 3DO3A 3HG1A 3BEWA 4OFYD 2VN4A 4I48B 5E56A 4F9LA 5GGQH 3ARDB 1N5AB 1LK3H 2EIBA 3OAUH 1UM6H 3LKPA 3MV7B 2AK1L 5A16A 1B90A 4HGWA 2AXFB 1CTOA 1NUGA 3HC0A 5D1ZC 5KVDH 3FOMB 1YMHB 4Y5VA 3LEVL 5DJZA 2DWEA 35C8L 1F90L 3I6GA 2BHZA 3DARA 3GI8H 4M8VA 4ODSL 4G8IB 5D8JH 2YK1H 3L5IA 1YEGL 2FX9H 2I26N 4PJ8B 3SGDI 3WFBH 1ADQL 1W8NA 1ZSDA 1NC2B 3DTXA 2XZQH 4KQ4L 3WN5A 1M7XA 4O4YH 2R1XB 4P4RB 4N90E 4GRWF 2C3HA 4B41A 4WUUD 4J3TA 1ZA6B 4OF6A 7FABH 2WK2A 1JK8B 1X7QA 1SBSH 4K3JL 1FVEA 4E41E 5F7DA 3CNKA 3OR6B 2B0SL 3F7RA 3WFEH 1DN0A 5I1AB 4PJAF 2ZOLB 2GJZB 3OKDB 3D0LA 5DQJB 5FA3B 3KPQB 3T0WA 1N59A 4K3EH 5ENWA 4ALAH 5I9QB 3VWKB 5CAYB 4X7FC 1T2QH 4QRTB 2HJFB 1EEYB 2XWBA 2OR9H 3MLZH 1Q72L 2R9HC 4OD2B 3D85D 1JNHA 3CSYA 3CCHB 5SX5H 3T77B 2V2WB 4DGIL 2LTQC 1TTFA 2BOCA 2P7TA 1MFDH 1M05B 4M6OH 1HN1A 2I07A 4LAJH 3LD8B 1FRGH 1S9WA 1G0XA 4KZEL 4HW6A 4U1SA 2EXYD 3ISWA 1HYSD 1NANI 3DROB 4MAUH 1FZOB 4JFFD 1RHFA 2R2HB 4L4TE 2E9WA 4F3FA 1LNUA 4U6XB 3KPMB 3BKCH 3BXNA 2IAND 3SJVB 3QDJE 1JWUA 3ARGC 3A67H 1FNSH 4JE4B 4RAUA 1N7ML 5E5UB 4ZSOE 1FZJA 2CDFA 3VXOA 4X83A 5E08H 4OD1L 2VRAA 2AJZA 3JV6B 3GMRA 4PJAE 4YHML 4Z7NE 4WJ5B 3CZFA 5DJDA 2BSRA 2X70B 5DC9B 1IM9B 1IGFL 2HWZL 2V7HA 2WQRA 3QI9A 2CSPA 2HT3C 4QT5A 4MWFA 5DMKA 3VWKD 2E9BA 5KZCB 2A1WL 2R4RH 2DQGL 4OGXL 4EI6B 4J1UB 3RGHA 4Q6YA 3WSQH 3E8UH 1YPZF 2OLDA 4DN3L 2C7UB 1OCWH 1I9IH 1GGTA 3WIHA 1J0JA 5E2JA 5M94B 3BIAX 4JQVA 2I9LB 4O9HL 1EUUA 2XKUA 3BKYH 3FB8B 5GGVL 3UYOD 4JDZB 1EHAA 4ODVL 3S37H 5IHUL 3DBXA 4NQDE 1EMTH 1N5YL 1GGBL 4TVPL 5J6GA 4K71C 3ELAT 4GUPA 1ZHKB 2WZPD 3X3FL 4G6ML 1FFPB 4RDQG 2ZP0T 3VXOB 1V5JA 1H3UA 4MNHA 7FABL 5HI4C 2O5ZH 5T1LD 4L5FL 2DLIA 4K2UL 2GJ6E 2P5ED 2VLLB 3W81A 1CLYH 3HZYA 3WN5C 3BQUB 5E8OA 2XZQL 4KQ4H 4HMCA 3HE6D 3KPPA 5HYQA 5FO7A 3DVGB 3UTQB 3IKCB 3KPRE 3TM6A 5IFHH 1L0XA 1N6VA 3EOTH 4Q9RL 2WSKA 4PREB 2CLZB 5CZXD 5HHPA 2DS4A 5M7QA 4WUUE 3VFNA 3MCLH 4BH8B 5D7JD 4M4RA 3WS6A 3L5XH 3V6ZB 5HPOA 2VL5B 1EXUA 5D1ZA 4Z77B 4LEXH 5HYFA 4PG9B 1WWAX 4N8CH 4NN6B 3ROOA 4DN4L 1OAZL 2PO6B 3WFHB 3VXQA 3TIDB 4G8GE 3CMGA 1CIUA 3S5LB 4JO2L 3MV8D 4U6YA 4X6BB 2BNQA 4C4KO 3QFJD 3O2DA 5FGCE 5J13C 3FFCB 1I3UA 5ANME 3VGGA 4PJXB 3RUGB 3CLFL 2J4WL 3W2DH 1NCBH 4L4TD 1N64H 2EYRB 2OZ4L 3SGEI 4GW4A 4JRXB 5CIPH 3H9SB 1NCCH 4PJ9C 3U7WH 3OKLB 1H15A 1RZ8B 5IF0A 3IRPX 3S3PA 3SGJC 3JTSB 4RX4A 1DBBH 2EXYC 4PRPB 5IB1A 1ONQB 1EO5A 3BW9A 5EORH 1J86A 4F7PB 1H5BB 4RFEA 2H8PA 2I9LA 4XC1H 1UCBH 1HH9A 3R1GL 5GRYA 3WLWD 1YZZA 4Z7OE 1AGBB 4RWYH 1BFTA 1CZ8H 4FQ2L 3S35H 5LAXA 4OLXL 4UV4H 4CN4A 1S7QB 4JFHD 3VDAA 3GI9H 5SX4I 1AQKL 4Y2DB 3RWCA 1X4ZA 5J7CC 5I1GL 2DMBA 5I17B 1UKQA 1JYWA 4QXWA 2F5AL 4RQQB 3BH9A 2HT2D 4J3OC 4FQCH 4PUBH 4NC1C 2D31A 5DRZA 2NY4D 3REWA 3FB6A 3QUYC 1OOAA 1R5IA 4FQIH 2IGFH 1MIEH 3MBEB 3CH1A 5IFHL 3F7PC 3U7YH 4YDLC 3MXVL 4K23H 2BDNL 1EHLH 1QOKA 3MLXL 4ZPTA 1PW3A 2VMFA 2YMXH 3KYMA 3IFNH 1VADA 3AU1A 3DLQR 3MREB 4P23B 3GHBL 5JDSB 3L7EB 3HR5A 3PV6B 1FLTX 4UQ2A 3KYKH 5IW6B 3WDHA 3X3FH 4M48H 3QEQD 4V1DB 3VFVB 4IRSB 4NNYA 3ARBD 1GC1H 4GAGL 5CHNA 3PP3K 1KELL 3HKFA 4G5ZL 4U1NA 4JPIA 3TA3C 4U1LA 2ED7A 3KJ6L 3FT2B 5MHSE 5TQ2H 2Y36L 1UH3A 4HIIA 3GZKA 2RCSL 4I77L 5IP4A 4KROC 2W38A 1BMGA 2X4RA 3GMLA 4X6DF 3N0PB 4JFDB 1GZPB 2I5YL 3MRNB 1CXEA 1CFBA 4KRPC 3CDGB 2R2CA 3WJJA 1EUTA 1RIUH 2Z8VC 5JHDE 4LPYA 4PGDB 1LP9F 5B38A 2Y23A 3GRWA 1EZVX 3CVIH 4PLJD 3UTTA 4TPRH 2V17H 4LQFH 3ALXA 3P0YH 5HYJE 3O2WH 3WL9A 1HSBA 5CJOH 2VERN 5IMKA 4XPAH 4M1CD 1D5BB 3BHBA 5DEFB 4S1RH 1CGYA 3SJVE 1FNSL 3PABB 4R26L 1E4XI 2AEPL 4ODHL 2A6JA 3GMNB 3HTLX 1FBIL 2V7NB 4XXCA 1YYLL 1F58H 4FQIL 3AS1A 4EI6A 3IU3B 1ZLWK 4Z7UA 5DT1L 1C16A 2ATKA 3OZ9H 1KENH 3L7EA 3PV6A 4LP5A 5FOBB 2NTSP 2F8XC 3F58L 1X5HA 4L9DA 3JWOH 3BRGC 3N1FC 1IZJA 3CDGA 4PBVC 5TDNB 4HXAL 3DX9A 3P9LA 1S7VA 5B8CA 3C6LD 4HIXH 4G9FB 2GYSA 1J88A 2CLRA 3MUGA 2A1WH 2R4RL 3KG5A 4WFGD 5GGUB 1QEWB 1MRFL 4JLRA 3CH1B 3L6FA 4BELD 1CFTA 4Q9QH 4U6XA 3BAEH 3BKYL 3RVTC 3FB6B 4X7TA 2BJMH 4ZQKA 2F54B 4ESKA 2Q8BL 1JNNH 4UT7H 1K8IB 3OKKA 4JFOB 5HHVL 1ED3B 2WM0A 2O61A 2C1PB 4JG0H 4P2OD 2I07B 3JUZA 3HI6H 3Q3GA 4N0FA 1QFWI 3RX8A 4OSUH 4PJHA 4EKXA 4POYA 1FGNL 1LQSR 5IW1B 4D0CA 1XR8B 4N0CD 1F4AA 3NCYP 4NZUH 4P49A 5FUCC 4QEGA 1MCPL 2YPLB 4I0PB 4L4TA 4APQA 5C09E 1F4WH 1AKJB 2D0GA 4O58H 4FFWC 2NY2C 1OB1A 4GS7B 2P45B 2FIRT 4K94L 4DGIH 5GJSH 3IFOA 3CFCH 4LCCA 2YS4A 5C0IB 3IXAA 1AGFA 1HXYA 2LV4A 3SGDH 1R24B 2G5BB 3V4PH 3T4YA 5E8EA 4M3JA 4EBQL 5E94A 4L1HA 3U83A 1EAJA 2Z4QA 4W4NA 4YDKH 4CVXA 2WMPA 4GW1B 2HFTA 3PGCB 4JO4L 4GG6F 3RU8L 4HUXA 4YE4H 3O6KL 5E24E 1T5XB 3TN0C 3GSNL 1ZAGA 5CZVL 4W6WB 2R0WL 2DQTH 1JPSH 4KUZL 4AENB 4OZFG 5GSVA 4ZFOA 2AGJH 4JY6B 2APXA 3G08B 4KTDH 4XH2A 1SJEB 3U0WL 1E28A 2DWEB 2BHYA 3GSWA 3T2QA 1ACZA 3MJ9L 3HE6C 3GNMH 2FD6H 5IF0B 3V52H 3WFHA 1FAKT 3RY6A 1QBML 1QRND 2EEAA 4OB5H 3V0VB 4L4VD 1D5IH 1IC7L 4LRIC 5DQDH 4BM7A 1Q9KA 1JPFA 3VXPB 3BP7B 2VABA 3TBTA 2VWEC 1A1MA 1RJYB 5C08E 1IJ9A 3EYQC 4CJ0A 1OW0C 4XP5H 1A9BA 5D71L 1VFAA 1ACYL 4Y0GA 3MRBA 5I73C 2ARWA 1NBYA 2FB4H 3BQUA 1AI1L 4N0YL 1OB1B 1D6VH 2FH6A 1TXKA 2IQAB 4O2FA 4LOUD 3ZO0A 4KU1A 3L7FB 4G3YH 1U42A 3MGTA 4KVNL 4WV1B 5C0DA 4YAQB 2QSQA 1A4JB 3ZL4H 4C56D 3NIFF 3IETA 3CXDH 5F88A 3OGOE 3Q5YA 3G6JB 1I7TB 5FUZH 4YPJA 2FO1A 3KAAA 1ULVA 3QSKB 4HS6B 2EIZB 1J18A 1OF2A 3MA9L 3QIWA 4N5UA 2W65B 1MSPA 4H8WL 4POZD 5E08L 4NQED 1ITBB 4F33A 2QADD 5EBWB 3CK0H 3P4NB 5DZNA 5F9WB 4PLKD 1BM3H 2X9WA 3BT2H 3QUKA 4X7CC 1FFOB 3GBNH 5TPWH 3NA9L 3VRJB 1I8LA 1FSKC 3V95A 3QI9B 4KROD 4O2EB 1PG7L 4ZO8A 4HJ0D 3PHQB 4MJ5A 3EYUL 3QNYA 4GRWE 5IMLB 1CBVL 3O45B 5KSVB 4I3RL 4K3EL 4ALAL 5BRZA 3CVHA 4R0LC 2DLHA 4JFHE 3ZHLA 5E5MB 4U2ZA 5F89A 3MV01 2X1WL 3IDJA 3RHWK 3VXTB 3F5WA 1UQSB 2F19H 1RZFL 4X6CB 5AD0B 5C6WH 1UB5A 5EUOA 3FQUA 4RNRA 1U3YA 2DLTA 5CZVH 2HVJA 2VC2H 2K1MA 1CQYA 1QKZH 5HPMA 1PBYA 4IMLA 1P1ZB 3DROA 3ZYOA 2WWMD 3QQ9C 3EW3B 3WFCL 5T33H 3F58H 4N5ED 2GTZA 2ORBL 4OCXH 5IQ7L 4L29A 3I02B 3EKCA 3G5XB 1J0IA 2RAMA 4PP2A 4W81A 4Q58C 4KH2A 5CP7A 5EU7C 4TTGA 4X99A 4P9MH 4Q7DA 5J1TC 1Y6KR 2A73B 4ZO7A 5JW3H 1N8ZB 1ZT4B 3P30L 3SPVB 3MRNA 4PR5B 5CJOL 2GIYA 5HD8C 1MCQA 4MYWB 2BNUA 4IIQB 5HTSA 5TE4L 4HIIB 4S1RL 3BDYH 3RAJL 2DQUL 3DX7A 1CK0L 3S36H 4G8EB 1VFAB 5T3XH 3QXTA 1P7QB 4O5LL 1LDSA 3RVVD 1ADQH 4MXQC 2LU4A 3SDAC 3JZ7A 4QF1B 5E1AB 3VJ6A 1ZA3A 4HS6A 1TQBC 1ZHNA 1YDPA 3QIUA 1RUPL 4PRHB 3M07A 3C5ZD 5DK2A 3QWOB 5BW7A 4JAMB 1Q9KB 1X5YA 5KOVC 1RJCA 1VACB 1F8TH 1MUJA 5C08D 2CK2A 4YFLF 1MWAL 2D7OA 1DTUA 3HI1B 4M6AA 3UPRB 4KDTA 2NY1B 2DMCA 3UTSE 2Z91B 2YN5A 4ODTL 5HGBA 4Z78B 4XMKH 5GGRY 5HHMB 2IBZX 2VXVH 3ULUC 3ARVA 4QRPB 3HG1E 1A6VH 4PGJA 4NPYA 4A6YL 2EDEA 3FOMA 3OR7B 3UX9B 1G7JB 3G5VB 4ENEC 2M8XA 5BXFB 1QYGH 3MFGB 2C3XA 1DLHA 3NA4A 5C2BL 5EPMA 4PJFB 4HFWB 3KPPB 3IT8D 5GRWA 5J9PB 1G7MB 2CDEA 4JZOB 4S1QL 1MFBL 3MTRA 4G42A 4TUOA 4JFQA 1HQRA 3IXAB 1R3JA 3SDCA 4FQCL 4PUBL 4U1HB 3MC0A 5DUML 5GRJH 4MNGA 3GJEA 5JORB 1A7NH 1YEKH 4FFVC 5C0JB 2R4SL 3ARGA 3QDMB 4LHUA 1QSVA 3JWOL 1UM5H 4NQDA 5BMFH 4K8RC 3O6ML 4FQJH 5H94A 1JI2A 1IEAB 3FQRA 1B0RB 4QXTB 3R1GH 4PRAB 4GFTB 3L3OB 5HSFA 2ESVD 2X4SA 4QRSB 1NAKL 1S5IL 2XN9B 3HMXH 4R9HA 5DK0B 5L6YH 1I8MB 3MRCB 1I3RB 3SDDA 5EORL 1VGKA 4WW2B 1MF2L 4R26H 4HPYH 5F6HJ 1IQDA 2YPLD 4I0PD 2C1OA 4GAYA 3G5ZB 2CMRH 3I3BA 1T83A 3B5GA 2UYLA 5DDHA 3CH8A 1QNZH 3F6IA 1T66C 2JELL 3TCLB 2NTFA 2P44B 1NGXB 1IAIL 3CVHH 3O8XB 1RK0A 4HGMA 4BQCA 4Z78A 4I2XA 3DVFA 2JELH 1QUNA 4HT1H 4NJAH 1VERA 3S3JA 4H20H 3UO1L 2D9CA 1B4JL 2UY7A 1E6OL 3RNKA 2HVKB 1KJ2H 4OBRA 3DXAB 3JWDH 1VKXA 3T2OA 3DVIA 1AKJD 2R29H 2KQMA 1XF4B 1YN7A 1DL7H 2BVOB 4ZS7L 1FG9C 5KSBF 3O3EB 3Q1SL 4WDIB 3TVMD 4HCRL 1Q94B 1A6UL 1SBBA 5BMFL 3C8KA 3MLVL 1QBLL 1K3IA 1NKRA 1CDHA 1IBGL 3KYNA 3Q2CA 3TYGH 3KPSE 5DO2C 5FCUL 2BVPA 4QHNB 2F53A 5HHOB 4G80B 3UTSA 3ULUE 1LO3L 1YEHL 2HLAB 3I6KA 3UJTL 1D9KA 1M6OB 4HPOL 3RNQB 2QR0B 1CLZL 1PDKA 3UPCA 2AEQH 5I1AA 3MUJA 1IT9L 1NGWB 1IAMA 5DD3H 4RSVA 1PGRB 1C08B 1KGCD 4QYOA 5D7SL 2X1QA 4DVBB 1IC1A 3FO2B 2FJGA 3JVGC 3C60C 4XXCC 5GRUH 1CG9B 3BP7A 3TBTB 3TN0B 4YHOL 4HD9A 4AM0A 5C7XH 3ROLB 1FZMA 3BZEA 4IJ3B 4DCQA 3EGSA 1NFDB 2P47B 5EU5A 4L4VB 5IG7B 4KMQA 3GSQB 1UWGL 1VPOH 2OZ4H 4XI5C 1CLZH 1YC8A 5I74C 1VFMA 2Q3AA 4Y7MA 3QXAA 2V5RA 4HZLA 4JVWA 4H25B 3FTGB 4F57H 1OM3H 4DAGH 5TQ2L 2MSPA 5KANI 2W0PA 1QFWH 1KCSL 4R7NB 1A9EB 3WHE0 5EH1A 2ADJA 1KXTB 1L6ZA 2AJUL 1GIGL 3GSVB 1OT2A 1GGIH 3VFRB 4Z5RB 5ACZB 1FIEA 4HQQH 2EYTA 1PSKH 1IEBB 3MLPA 5CILH 1A4KB 1UG9A 4F33B 1J5OL 3N1PC 4JGJA 1RZJL 3WNLA 1JVKA 4FZ8L 4LRNH 3ZT6A 3ULVE 2P5WB 4OCSH 4CGTA 4AG4H 4MDIA 1P4BL 3P11L 2DWDA 4MSWB 4I0PC 4UIKH 3AM8C 1T2XA 4WHYH 2G60H 5L6YL 3OKEB 4K94C 2D4DA 4TTDD 1G9ML 2M26A 3NOIA 2IPTH 1DQQB 4HLJA 4JZNA 4J4PC 3CD4A 2CMRL 4R4BB 5F96H 3TZVC 1AD0A 4K2UH 4X6DB 2VAAA 4M7JH 4WTZG 4OGAD 2EDRA 1BBJB 4OF0A 2LU3A 2ZG1A 3HNVL 1RUKH 2G75B 1FQ9C 3I84A 5T1MB 1SYVA 4FQHB 3QZWB 4UDUA 3T0EC 3DV4B 3HB3C 3F7YA 3T3PF 3RBGA 4K9EC 4N9OB 2DYPA 4JY4B 4FRWA 3C9NB 3IS0X 3V6OA 4XTRC 4O9HH 3WXWL 2WIIB 1QO3A 1MFBH 2JB5L 4YDJB 2GCYA 3QIUD 1QA9B 1TQCB 3FFCA 2UWEA 3MOBL 2F5BL 3QXAB 4HZLB 4P5TC 1K4DB 5HHQB 5BZDA 4U7SA 1J0KA 3NFSL 1OP5K 3QIUC 1IC5L 1E0OB 1YDPB 4OZFH 4X7EC 1RSFA 1H15B 3UAJD 3FB7B 5I1CL 4P2RB 4BSWA 3O3AA 2L4OA 1CWVA 1K5NA 2FX9L 1TQCC 3WFBL 3BKMH 4KK6D 4TNVF 1FNGB 1M7DA 2XQBH 1JNLL 1ZMYA 4PJ8D 2OI9B 4JKMA 2W9LA 2AQ3A 2KZ1B 3FO2A 4OGAC 4XAWL 5ID0A 4X7SH 3MRFA 1AIFB 4YQXL 5ICYB 3UTTE 2DD8H 2PXYB 5IVZA 1MWAB 4Z7WF 2VYRE 3IF1A 5MI0C 4PJ9D 2FB4L 4PTTB 2X9YA 2FBJL 3DMMC 4JZNB 5JO5B 1FHGA 4HDIB 3ZKND 4IHOB 3AROA 1QG3A 5DR5L 4Z7WB 3R8BB 3SE8H 3SBWA 1IAOB 3OAUL 3ZL4L 1HILA 4L9LC 4X4ZA 2W9EH 4CNIA 2QHLA 2E8YA 5J57B 5SWSD 4R4NC 2VDLL 1HNGA 2LU7A 4GUPB 4JANA 2DWDB 2IH3A 1AD9B 2VLJB 5IBTL 4BK4A 4IRSA 1MI5B 1AI1H 4QWWC 4X4XB 4LLWA 5CP3H 5EB9A 1QLRB 4IS6A 4RX4D 1RIHL 3HC3H 4YHKH 1SEBA 5JNYB 3TBWA 3WE6A 2P8PA 3VFPB 4LU5H 4X6FB 3D85B 1CCZA 2HAZA 4X6DE 3AS3A 1J9CT 4R3SA 2EYTB 4C54A 4UBDC 5C0CA 5E2WH 4QCIB 1X5FA 4J1UA 4HV8B 1JN6B 4XP6L 1SJHA 5CZKA 5EOCJ 2NX5D 1MRCH 3ECBB 3S97C 3INUH 5BS0D 2E8ZA 4M4PA 2OTWA 2GK0A 1T2QL 2D7MA 5DRWA 3ZE1F 3S37L 5INDA 2L7JA 4XWGH 5ICYA 1BZ7B 4D8PB 4YX2L 1XCTA 2CDFB 4YXHH 2HTKC 4OCYH 5HVWA 1PEWA 3BP5B 1FIGL 4QXUL 1A7RH 1NBVH 4ORGA 2DQFA 5I18H 5F88B 4Q6IA 2AJVH 1LO5A 4KRNA 3SE8L 5D1ZD 1U2CA 3L3OA 4WEUD 5FO9B 5F9OL 4QGTA 1H3PL 3MRJB 4X98B 4LHUB 4LLWB 1OTTD 1WGOA 4M6NL 1A02N 5L9DH 5J13B 3STLB 1FJ1A 5HHQA 5CUSH 3CFBA 1KIRB 2FYYA 4X5WB 4L8DA 5HDLA 2OTWB 5HVFB 1YYLH 1S9YA 1G0DA 5B39A 1JNLH 3SKJH 1TNNA 5JPMB 1BPVA 3B9EA 2APFA 3O9WA 3N1MC 2HH0L 2N7AA 4PJDA 1MJJA 5DC4B 5SV3A 4FNLL 2GFBA 1X5GA 4MNGE 1I8KB 2AABH 5CEXA 5CCKL 1U8QA 3RZCD 3QB7C 2W65A 3KGRA 2VUOA 3CX2A 4YHIB 3ZHDA 5CD5C 3X13A 1SM3H 2BNQB 5C9KA 3DJ9A 3MOAH 3ILPB 2F74B 4BQBA 4DEPB 4I18A 1DQTA 1N6QH 1S7UB 2DB8A 1OM3L 4F37F 2R1XA 43CAB 4PJCA 4OIIH 3D3VB 4LGSB 3VD5A 3K4AA 4MS8D 1AXSB 4P4KB 1NDGB 1T1ZA 2UZIH 3VWKA 1GXEA 2Z4QB 2UWEE 4P5MA 5IBLC 1HOCB 1CFVH 3DI3B 2ZUQB 4MSWA 1JE6A 4YBLB 4ENED 4HKJB 1TCRB 5DJAB 4JQXC 4NJ9H 5FKPA 3X17A 4K07A 2ZCHH 5J0BA 4ZUSA 1MCIA 2VSDA 3UXFA 5DLMH 2DQTL 5JQ6H 3LQZA 2NX5A 4TSAH 2YUXA 4G8EA 3DSNA 1GAFH 1AD0B 3CLEL 4ZOCA 2IWGA 5E03A 4X6EB 1KJ2A 2P8LA 5E8EB 1I1FA 2EE9A 5GGRB 3VFRA 3CGTA 4CMHB 1RZGB 1HXYB 2JCCE 1KBGL 4TOYH 4JHAL 4EN3B 1DUYA 1V3LA 4LGRB 3VE0A 1H3VA 1IQWH 4HZAA 3BEVA 1E28B 1JPSL 3FO0L 4WI6A 4XXDB 4AIXA 1D5ZB 3SO3B 1GSMA 1IEHA 4RISL 1O0VA 1NCTA 1JGDA 4PP1C 2RFXB 1N2RA 1D7FA 1CFNB 2DAVA 4HLZG 2CUIA 1JFQH 5C07D 5TE7H 2R0ZL 3IDXH 4GBXB 2Q8AL 4ZNEE 1LE5B 2FGWL 4OV5A 4X7SL 5TGBA 2X4NB 4CDGC 2RCSH 4I77H 5E6ZA 5ESAB 2EDTA 3MLXH 2E9IA 1YY8A 3TNNB 4ISVB 3HI6L 3RL1B 3ULUH 3LKQA 4QXGH 4Y4KD 4YHYB 3SO3C 2PYEB 2JJVA 5HHMD 4J8RA 4XP9L 2AJZB 4YUEH 3QJHB 3H3BC 1FDLL 1FZJB 4FFYL 5JDJA 4ZXBA 4K9EL 2HTLC 4PRDA 5DMGC 5C86A 3IFNL 1IGYB 1T4KB 4OFKA 4HIEB 1NLBL 5D9SA 5ADPL 1OAXL 5EC1B 5DSCB 3ARYA 3BX7C 3HE7C 5KSAC 4DKFL 3W2DL 4HXAH 3EFDH 4TVSa 3D1MC 5MI0B 2BNRB 3N9GL 1N6UA 2GJ6D 4XZUA 5ERWB 4C58B 5HY9A 4HJGA 4L8CB 1I7TA 1EJ6A 1UWGH 1VPOL 4MZ3A 1U36A 4PGDA 4WI7A 1KTDB 5IOPB 1LEKB 5E8OB 3A6CL 3LS4H 5SWQA 4MB5A 3S35L 4RWHA 4JHWL 3KNBA 4XVUD 1MLCA 4HCRH 2YEZA 3I75B 3VI4F 1ZHBA 3BUTA 1XGTB 4MD4B 1HHIB 4IRJC 4ODWA 1ZHKA 5DD1H 1UCTA 2QR0A 4GXVH 5GRVL 4M62L 4O02L 4BA8A 1C16B 2DQJH 3HI5L 2NXYD 1F5WA 3L3HA 2ADFH 3UMTA 3IJHA 3DVNB 2F53B 3DUUB 5FDYA 4OTXH 4IRZL 2VQUA 4HEPG 1YJDH 2X5PA 3RNKB 4KKAC 1TVHB 5EO1B 5HGHB 4A2LA 4OV5B 2GITA 3C8KB 4JR9L 3VFOA 4P59H 3QPQC 4XGZB 3FN0H 1NC2A 1L9NA 4G5ZH 1FLRH 1WLHA 4L1DA 1UC6A 2XY2A 4DVBA 1WIPA 1VB9A 3P0VL 1RJLA 2CK0H 5EOQL 3WDIA 2H26B 3REVA 2J8OA 1YEFH 3HPLA 5F1NA 3C6LC 1JTPA 5CBAA 1Q1JH 1TIUA 1GC1C 1I9JL 1TNMA 3MJ8B 1MIML 5CBEB 3KPLB 1CGXA 1KJVB 4DN3H 5D96B 5A16B 2WUCH 5B8CC 1Y18B 2CR6A 2NNAA 4UILL 3OAZK 2R23A 3EOAB 2LVEA 3PHOB 5GGTH 5KOMC 2ICCA 5KSUA 4W6XB 2BOBB 2XRAH 2VDNL 3T4YB 1LE5A 1CLCA 2G2RA 2QLVB 3QJHA 4YXKL 1FGVL 4JG1H 4QY8A 5IMOB 1IMHC 4PJ5E 2P5WE 1EO8H 3VDBA 2ERJC 3M17B 2XZCL 3V6FB 1N2RB 3GO1L 3K46A 5C0EA 4MD5B 4PD4K 5ACMA 1UT9A 4LPTA 5GSRA 1BLNA 5D2LE 5K9KB 3ZTNH 2DM3A 1IILE 2D9QB 4LF3A 4K23L 4MCZA 3K8MA 2X4NA 3FQNA 1S7SB 4G6MH 4F9LC 4X9IA 4QRRA 2GI7A 1AGBA 2H32H 5GPRA 1J8KA 1ZGLM 3W5NA 3QQ9D 4M6MH 1ZTXL 4JFYB 3HI1A 1Q38A 4GH7B 3AB0B 4JZOA 3DYMA 3QDJA 4XB7A 2WW8A 5F3BA 4R97B 2RB8A 1N59B 1NDMA 3L3GA 3W9EB 3QISA 2WBJC 1WSST 4E5XA 1K2DA 5D7KD 5EDXA 4ZAKC 1Z5LA 1MQKH 5D7LD 3THMH 1D9KD 1RZ8A 1OGTA 4HKXA 3QUML 1QBLH 2YOCA 5F44A 5E99H 2IPUK 3SOBL 1VEPA 1DN2A 4L4VE 1JPFB 4P3DB 3DX7B 2DDQL 3M45A 4PJBE 1TFHA 1JJUA 5J1AA 4EXPX 3ULVL 4KDVA 3WNOA 4PBWD 4OBSA 1BIIB 3EHBD 3RIFK 1NSNH 3V0VA 3RTQD 3FRPG 4OF3A 2XWJB 1MNUL 4OFVA 3QDMA 3GMPB 4FXKB 2PW2B 3QNXA 4I8DA 1FO0A 4PRPA 5C3TA 3QWOA 1BFOB 3DSFH 5DJ0A 1HHJB 4NDMA 4IOIB 2EKSA 3FQTA 4Y16C 1HINH 5EU4A 2XNAA 4XMKL 3SQBA 3U48A 4TUKH 2YD6A 3OF6D 3L3IA 4WTWA 4NO0B 4BKLA 5CSGA 4IM8A 2HKHH 1S3KL 4C56A 5FGBC 2WIIA 1YECH 5DHVB 4RZCB 2BMKA 1EHNA 4PJDB 4LLYA 1CVRA 4NZTH 3TWCL 4GQ9H 2VWEE 2X42A 4JCMA 4P9HC 5GIRA 1EDQA 4XPHH 4JN2B 3LKRA 1LO0L 3NACL 2FJHB 4JFEA 4L3EE 5IVOA 1ITCA 3DVGA 1BBJA 3DX6A 3TIEB 3ZKNC 4LSPH 1JFQL 3RWEB 4EXKA 1X5KA 2FEDD 2VLKD 3ZMRA 5KVEH 1AY1H 2BVTA 4JDZA 1AO7A 3LEYL 2DQUH 3VRJA 4MB3A 1CGSH 4IRJA 4YDLB 5ADPH 3O3BB 2H32A 4EJ1C 1G9NH 5GZOC 1RZ7L 4U3XA 1TJHH 2X44D 1NGQH 2Z92A 5EBMA 5DUMH 5GRJL 3O2DL 2C5DC 5IVXF 4KTYA 5E8DH 1DFBH 2JLLA 4XP9H 3EYFA 4WFGE 3QAZC 3RWIB 4QTHA 4QOKE 3OKOB 5EUOE 3V5KB 4OZIA 4NM4L 1Y6NR 1K8IA 3OKKB 3SDCD 1G9EA 1X4YA 4YC2B 4NN7C 5DEGA 1WZ1H 3AB0C 4JO1L 4IMLB 4X9GA 4LHJB 2MFNA 4UIMB 5C09B 4K3JH 1LO4H 1MCBA 4YAQA 1AHWB 5ISZB 1UVQA 2A83B 1G9NL 1UQSA 4FTVE 1T03L 4HK0A 4CU7A 3WXVH 1OP3K 1S7VB 5B8CB 5AG8A 1CF8H 3CVHB 1LILA 4N1HB 4X99B 4PRPE 3DBXB 1HZHH 5D7LA 3STBA 4RISH 3GI8L 1TDQA 3SKOB 1A5FH 4LBEA 5KAQF 3T0VA 2F54E 1JN6A 2NXZD 4BH7B 5I76A 3IKKA 3ORJA 2FO4A 3RVWC 1C5CL 1A2YB 1INQB 4CMHC 1I3GH 3DMMD 4G8GA 5D7KE 3BDXA 3QHTC 1SEBB 5JNYA 3DUUA 4PB9H 5DUBB 1ACYH 2E9JA 1JGDB 5ANMB 4P46B 3GRWH 5ETUA 4LOUC 1KLFA 3TBVA 4RBPK 4LLMA 4NO5A 2Q6WA 4YZFE 2OL3B 3FZUD 3LH2H 3KPOA 4GMSL 3X3GL 1E27A 1GPOL 3I9GH 4P5KA 3RGVB 4PYGA 4RIRB 3S7GA 1QLFB 4AMKL 2XWJA 2XTJD 4ZS6D 1WBZB 3BXNB 1A3RH 3DOSA 5CLWA 3RKDC 3LRHA 5T5NF 3ET9F 4KKBC 4M6NH 2GKIA 3WNPA 2A38A 1OAKL 1DQDH 1VFBA 3VRLF 1NMCB 3KWWB 4MX7B 2ZCLH 1FL6B 1ZVYA 4YHPB 4A6YB 1TVBB 3PWNB 4LSQH 5T1LB 1RMFH 5D2NA 3U0WH 2XNAB 5E4IA 2PYFA 3K2UL 5ERWA 5I18L 4Z7VF 1VADB 2PR4L 1RUKL 4OD2A 5J4MA 1WJ3A 3QUMB 1JPGA 4EI5C 1LO2L 2F58H 4GKZB 4QRTA 3WN5B 4HUXB 2NXYB 4P2QD 1A64A 3U46B 2IPTL 1VACA 4FQLL 3WIHL 3LKNB 1S9VB 4NUJA 4MGXA 4YDVA 2KPNA 3G08A 3GMOB 5CGYC 5SWZA 4YZFF 5ID1A 3TBYA 5KG9A 2YHGA 1R3HA 3F7YB 3CAFA 2JJSA 3O8XC 1JF1A 1U8LA 2IQ9L 2AXHA 3BP6A 5GSRB 5ADOH 4LCCB 2GUOB 3NFPB 1FN4B 2G75A 5C3LD 3PWPE 4P46D 4YHPA 5IFJB 4HK3N 5D7IF 3OGCB 1IZKA 1KIPA 1SHMA 4QY8B 5E94B 2BRRH 2IANE 1VFOA 1I8MA 3MO1A 3TCXA 3RP1A 4HIHA 2R23B 1FGVH 3EOAA 4JG1L 5KSUB 5D93B 2YC1B 2NY6B 3TBSA 4MNHB 1P4BH 3P11H 3ARWA 3CFCL 4NO5B 1II4E 1FG2B 5KS9A 3FFDA 2EH7H 4DUXA 2K7QA 1Q0XL 2W60B 2NW3A 3GJEB 5JORA 3MV11 3QDGA 4N0YH 4OFPA 4PJHE 1SMAA 2Y5EA 2P42B 4Z76B 4WW2C 2A2QT 3S34L 1CE1H 1LVEA 4G7VL 3GSOB 2EO1A 5FM5O 3RWDB 4M48L 4I3GA 2VZ3A 3D3VD 5KTEL 2Y07L 4TUJA 1BQHB 3MV9A 3GHBH 4LCIL 5I8OH 2BSSA 4KJYA 3GSNB 4WFHE 1YEIH 3BHBB 4DKEH 3RJDA 4D3CH 5DMKB 4DKAA 4XBEL 1G6RB 3F65A 3VG0H 5BRZB 3KHOA 3NH7L 3QXDA 1JF1B 1U8LB 1UXSA 1V7ML 5GGSA 3Q5TA 3U9UB 5D7IE 3WJLC 4AEHL 4HC1L 2XTJE 2BJML 3ECBA 3TNMA 3ULVH 1X9QA 1PVHA 1BGXL 3GKWL 4HWNA 1FYHB 4L4VA 3SDDB 1SY6A 2JCCF 1GZQB 2BX5A 2X4TA 2BXYA 3SDAA 1T0PB 3AM8A 4POZC 1WCQA 4HHAB 2AXGB 5ALBH 3DMMB 3V6ZA 2PTTB 3GI9L 4YGVB 3EFFA 4UB0H 4OCWL 3VCLB 4PJGF 4QNPE 5IJVB 4WDIA 4M02A 5A40E 4EN3D 2O61B 1DBKH 5FGRA 3U4EB 1U95A 1MI5A 4U1MA 4XZUB 3UTTB 1RY7B 2E6PA 5KJRH 5HYJD 2V7NA 2ZWLT 1VKXB 4J6RL 1B0GB 2BFVH 2OI9C 2DM7A 3KWWA 4MX7A 2YEZB 4P23D 4U1KA 4N8VB 3UC0L 2NY1C 5E7FA 5F7HA 1KTKE 3EFDL 5KS9F 4NKOA 5JW4M 3BKML 2VR9A 1FORL 3KLAB 5ACLA 1IGYA 1T4KA 4WEMB 1YEFL 2IAMA 5MENE 3HNSL 3QH3B 2A6DA 3H2WA 1S3KH 4KK5C 3IDGB 5IEKA 1ZT7B 4NC0B 2DQHL 4POUB 2Q76B 2VDOH 3JXAA 1CXLA 2OP4L 5D6CB 2NY0C 2HLAA 4RAHA 4HK3J 3UBXB 1DBMH 4BFIB 4MS8C 4NNXA 2R69H 1J1PH 3QP3A 4TSBL 3QWRA 3HRZB 5FYJD 4BUGA 1J87A 4FQ1L 3WUWA 1OVZA 3ULSB 1A0QL 3L3IB 1QZ1A 1P7HL 4ZUWB 4H1LH 2R9HD 2R2BB 4KXZI 1PSKL 1IAIH 1FFQA 3MBEA 5I1EH 4WUKL 2O5XL 3T0EB 1MREH 3MV8B 1Q0YH 2BERA 1ZANL 3BW9B 4N8CL 3SE3C 1DBKL 3MLRL 1A7BA 3WJJC 5H2BB 4KAQH 5KN5B 4RFOL 2Z93A 1U3ZA 1MI5D 3D3VE 3LPWA 1BFVL 5I66A 3FO0H 1K4CA 1SVZA 5D6DA 1T21A 3B9KD 2EIDA 2HG5A 4Q2ZB 5KJRL 2XZZA 3PG2A 3EOTL 4ZAKA 4Q9RH 4FN0A 5CGTA 4UTAH 1A7QL 4HFWA 2J2ZA 4G43A 3U0PA 4M6ML 5DJYA 4U33A 1S8DA 3WJLA 1WISA 3O6LH 3ZTNL 2JJWA 5D2NE 4HLZH 3VI4E 3IJYA 2QEJA 2VXTH 4NJ9L 1UADC 2NW2A 3HFMH 3CCHA 4WU7A 4XNXH 4LQFL 3H3KA 4XMPL 2PUQT 2ICWI 4WV1A 4ZOEA 3B8YA 4KY1L 2FHFA 43CAA 4GQPH 3VD9A 3B6SB 3IAGC 1T7VA 4R90H 1RIUL 4M1CC 3ZTJG 4LF3B 2ICES 3P73B 1U91B 3KVQA 3VG9C 4BZ1L 1F02I 5CGYD 3FRUA 1CGVA 5HHPB 1IL1B 3E3QE 2YA0A 4GXUM 3RHWF 1RUPH 3DGGA 4KKCD 3ARGD 1A1OB 3LEXA 2RJMA 3S4SG 1A7OH 2O5YL 4L9LB 4M3KB 2AEWA 1HOCA 4U0QB 1T1WB 2JF1A 4HX1B 4G7YH 3U2SA 4MAYC 4JR9H 3PL6C 3MRHB 5F70A 4FNLH 4NQXA 3JWDL 3ILQD 3ARBA 4S10A 4DK3A 3CDCA 5GRUL 3IDUA 1AGCA 1EBPA 5AZ2L 3T2PA 4N0UA 5CSZA 3LKOA 2BVUA 1RZKC 2Q7YB 3ILPA 4R2GC 5FYLL 4A2MA 2Y25A 5DJ2A 1NJ9B 3V0WH 5DVLA 3OKNA 4IRSD 1FC1A 3B9DA 2IC2A 2NY2D 5CD3B 4DW2L 1J11A 5LGKA 3SJVD 3I6LE 1I1CA 4RAVA 5FO8A 5TDPA 3MBXL 1P1ZA 2APBA 1MJUH 1YN6A 4XCFL 5DLML 1QSFE 4M1DL 5BW7C 5EUOB 2W0LA 3GB7A 3PP4L 5T1DH 4LLVB 3BPNC 3UC0H 5GISL 3IFOB 3HMWH 3TP4A 3SDXF 3RNQA 5I1KL 2E7MA 4PGBA 2B4CC 4OT1H 4OIIL 4Y19B 5IMMA 4JY5H 4PS4H 4F80A 3TIDA 1BD2B 1U58B 1A0QH 1E6OH 2QSCH 4X0KB 1JGUH 4QHNA 3B43A 3WFEL 4MA8L 1T1YB 5IGXL 4PLOB 4NFBA 4PG2C 2A73A 2O5ZL 1V7NL 4PJGA 3MJ7B 3BWUC 3T1WA 3EJZC 1BBDL 3VXUD 3WS3A 2P8PB 3VFPA 1F3JA 4D0BB 5IB2B 1XF4A 4WNQB 1K6QH 4GG6B 1MFEL 2NYYC 3PHSA 3BGMB 3EYVA 4DKDC 2H1PL 1AGDB 4H5SB 4NHUB 4ZD3L 4WI9A 1KFAL 4RNRB 1LEIA 4NN5B 1J7VR 1HILB 1R6VA 5DYOA 5FYJH 1T0NA 4KWUA 3VW3L 4D3CL 3T65A 3VXMD 1QEWA 2CRYA 3OXSB 3MOAL 4LCUA 2MNUA 4XCYA 1RULH 4U7KA 5DR5H 3RWEA 1J8HA 4CU6A 2ZUXA 1MVUB 1A6WH 3QDME 1U8PA 4O5LH 5GIRB 1WC7B 2NY4C 5BV7C 4OD1H 1LP9A 3A6OA 3MCLL 5ICZB 1C5CH 2J7LA 4GMTH 3R4DA 5EBMB 3IYLW 1FZOA 4PGZA 4JRXE 3GSOA 3G04A 2Z8RA 1A3LL 1P6FA 1EK3A 8CGTA 1EEYA 3HUJB 2ZUVA 3FQRB 4MNQB 4HJJL 1BQLH 1I3VA 5IM7A 5I1JH 1VEMA 4CAGA 3L3HB 3TA3A 5C2BH 5J8OA 3T0BA 4ELKB 1HXMB 4JN1L 4KI5E 2HLFD 3C60B 1ZLSL 5AAWA 5J12B 3EOBA 2I27N 4HS8H 1QRNE 3U0TB 3P30H 3QIWD 2DIJA 4KRLB 3RPIB 4MA1C 4DGYL 3EJYD 3PWUB 4WHCA 4NKOB 4F3FB 3E6FA 3SE9L 5IHUH 3MLYL 3MRBB 5GZND 3WUWG 1MLBB 3HAEH 3KPTA 3HS0B 5IHBA 4K8RD 3RRQA 1N6QL 5CHNB 4HC1A 5KVFH 3O3EA 3QZWA 2VOTA 4BSJA 2VZTA 4JEGB 4OM1H 1ZT1A 2VDQH 4PB0H 1GRWA 3SKNB 3NCMA 3OV6A 3LQMA 3H42L 2J8UA 3LKNA 5JHDB 3RZCB 5IB3B 3P77B 1S7WB 4TNWF 3O6FA 1WFTA 4C56E 3ROOB 2QV2A 4AH2A 4N9GA 4UINH 1NLDL 5DJ8A 1OPGH 2H2SC 3CC5B 2HFGH 2NW2B 5JPNB 1D6EB 2E7HA 3D18A 3SQOL 5F7UA 4MCZB 3QRFM 3RDTB 2V9RA 4HKXB 3E2HB 4Y5VB 4PBXA 4NQEE 1WICA 4PJ7E 5T1MA 5KZCD 5DVMA 4BZ2L 5C70A 1VESA 4LMQI 1YMMA 1CE6B 4KKCC 4XCCH 2Q8BH 4G7YL 5C0BE 5LQBL 5D6DC 1MFAL 5IKCB 5FM4A 4JLRB 1UM6L 5GZNC 2QQQA 3QUYB 4Y1AB 4EUPH 2NYYD 1KIQB 5TDNA 3QYCA 2H2PC 3FOLA 2ATPA 3TVMA 2OSLA 2AJXL 5E9DD 4KJPC 2KQNA 4WO4B 1WK0A 4YR6A 3I02A 1AKJA 4ZD3H 1X4XA 2AVGA 3MLTB 4PJAB 2CIKA 3FMGH 3QBTB 3V5DA 5I1LB 1ND0A 4LCWD 1FSKB 3GJFA 5D71H 2B7DT 1RZGA 4RGMC 1ZTXH 1F58L 1A6TB 1FNEA 1CI5A 1FFRA 5JA9A 4N0FB 2ZSVB 4LSTL 3VXMB 1CG9A 4XVTL 5B21A 2LAAA 3P9LB 3DX9B 2R56L 3DIFB 5DQDL 3O45A 2JK5B 3VU2A 3O0RL 5HI3C 3D69A 5C0AE 5FOBA 1G7HB 1P84J 1NC4D 5I30L 1J05B 2AKRB 1S9KC 4OZHF 3IGAA 4H1LA 5EO9A 4ORZC 3UBXI 2ZUYA 4I0CC 4HV8A 2VDNH 4KTEL 4RMRA 1CLOL 4MJ4A 4HH8A 5IBTH 1P9MA 1ZK9A 1LNUB 4IBLT 4DCQB 5I15L 4YHLH 3ZKSD 5H8DA 1KLUA 4ZFZA 2HLFC 3W11C 5KSBB 4XP4L 5JIKA 1I9JH 3GSNH 2CLVB 5I73B 2OK0L 3ULVF 4NKMA 3CIQA 1JWMA 4QRQA 1QLRA 1JGEB 2AK1H 2EO9A 3C5ZC 1XCQA 5CKGA 4PJGB 3BVNA 5DGRA 2J6EA 1HHIA 2OM5A 4PJXF 3RUGF 2H32B 3UROR 2QSTA 1FPTH 4NOBA 1I7UA 4AIOA 4L8BB 1CICA 4OF7A 5I8CB 4PJHF 1UWEH 4JO3L 5ISZE 2QKIA 5BOZG 1HYRC 1KELH 3IXTA 4ZOBA 3MLSL 3HG1D 1KTDA 5GS3A 5IOPA 4PGBB 5EZIL 3U7YL 1K6QL 2ZZUT 4JN2A 3TO4A 4JRWA 2IADA 5T5FL 5FUOL 2CKBA 3MXWL 4PFEA 4XPTL 4HQQL 4UDTB 4WW2F 5D1XD 2YMXL 3G9AB 4PJ7A 1A1MB 1INEL 3TT1H 3FJTA 3MOBH 4GJTB 3VXMA 3OJDA 5C7XL 2AV7A 3KYMB 2A9ML 1KXVC 4YGVA 1KB5L 1EEZB 3LEYH 3ALWA 4R96B 4U1NB 5I0ZA 1MQKL 5IESL 1MNUH 4ZYKB 2PTUA 1W72H 4Y19D 2BY1A 1F4XH 3QEHA 4EQ2A 3GMMA 8FABB 1MCJA 2CIKB 3CSPA 4V1DA 3OSKA 4I2XB 4KHTH 4YGAB 5E9DE 3W39A 3NCJH 1K4DA 3FAWA 4JFEE 4L3EA 4XC1L 4KY1H 5B39G 3D69B 1MRFH 1IAKA 3S88H 15C8L 5DDHB 2UWEB 3RVVC 2ZJSH 3JBG7 4EUPB 4LCWE 1RZKH 2C1OB 1LGVA 4NN7B 4OLXH 4I4WA 1A7NL 1JRHH 2HJKA 5F7LB 5C0CE 4R8WL 5CLTA 4NCDA 1QD0A 4P9HL 4ZUTA 5BVPL 2CDEB 2XYCA 4X8JA 2R2HA 2YPLE 1YEDA 1NFKA 3HPJA 1NCCL 4FFYH 3EOYG 3EYVB 4FXLA 1F6FB 2Q87A 4HKZA 1V7MH