The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
12
|
sequence length |
108
|
structure length |
108
|
Chain Sequence |
CPDSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
NMR Structure of the Natural Killer Cell Receptor 2B4:
Implications for Ligand Recognition
pubmed doi rcsb |
source organism |
Mus musculus
|
molecule tags |
Immune system
|
molecule keywords |
Natural killer cell receptor 2B4
|
total genus |
12
|
structure length |
108
|
sequence length |
108
|
ec nomenclature | |
pdb deposition date | 2005-03-08 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF11465 | Receptor_2B4 | Natural killer cell receptor 2B4 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins |