1Z2KA

Nmr structure of the d1 domain of the natural killer cell receptor, 2b4
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
108
structure length
108
Chain Sequence
CPDSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Natural killer cell receptor 2B4
publication title NMR Structure of the Natural Killer Cell Receptor 2B4: Implications for Ligand Recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 12
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11465 Receptor_2B4 Natural killer cell receptor 2B4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z2kA00
1U58A 4R6UA 3OMZA 5H37G 4LQ1A 4JO4L 1XAUA 5F88A 2BNRE 1BP3B 3AS0A 4JG1L 4MNHB 1M71B 1A6TB 1JGEA 1ZEAL 3RGVB 5J57B 2J12B 2NY4D 1XGRA 3L3DB 1A6WL 4KHTL 2KBGA 1QO3A 5D93C 3O3DB 5F96L 2EXYD 1I7UB 4JY5L 3GSUB 2HKHH 4JN2A 3LQAL 3I50L 1T83A 3PXJA 4LDOB 3VXOB 4NZRL 3HI5H 3UPRA 3DX6A 3GMRB 4UDTA 2YSSB 4PB0L 5F8QC 5EZJB 4OZFA 4MA8H 3REWB 3SDCD 1CR9H 1VGKA 1S5HB 2HWZH 5BV7B 2YUWA 4TSBL 5EBGA 1F4XL 2Z92A 3S4SG 2FZ3B 5IW1A 1HHGA 2ZOLA 1QLFA 2Y6SD 3FO1B 5LGJA 5KS9B 4C55A 4QXUL 1RZKC 1UB5A 5HYSB 3CZFA 1FNFA 3L7FB 4JAMA 4JB9H 2Y6SC 3BIKA 3WFBL 3L3KA 1CQKA 2G60L 2HJFA 2DD8L 1UH3A 5C0IA 4F3FA 1AXIB 5SWZB 4HDIB 4LSVH 3CFJA 4P5KA 2IH3B 4P23D 4OSUH 4OZFH 3HFMH 2X4SA 5C0EB 2VDQL 2DQUH 3P0VH 3E6FA 4JRYD 4YK4C 5B38B 4L3ED 4GRWH 2JELH 3WXVH 4P23C 4XXDB 4WEBL 4MJ2A 4JFED 3HKFA 4L8DA 1MJUL 4Y4FA 2E8ZA 2X1XR 2NW2A 1WBZA 4NKOB 1L7TH 1MFBL 5F6HJ 4JKPH 2XNAB 5LBSH 1T6VN 3SKMA 4WHTA 5CZKA 2AV1A 2DQDL 3O41A 1EEZA 1HI6A 3JV0A 3L3GA 1KIUA 4JQIL 3X3GL 2MQ3A 1IC5H 1GGTA 1WK0A 4R4FL 5CWSB 4N5ED 4JM2C 3QXUA 1PZUB 1UXWA 2CKBB 2EDQA 1KNOA 2ZCHH 4N5EC 4Q9BA 4Z7WF 1N7ML 3KWWB 2GSGA 2R2BA 1NGYA 3O8XD 4DZ8A 4YC2C 4HKZB 4M5YL 2PXYB 3ZE1E 4YWGL 3MGOB 2CRZA 2GFBB 3LZFL 1RIUL 3RVUC 2ZKHH 3HZYB 3O8XC 5GS0C 1UEMA 2LU7A 2GJZA 4WHYG 4I48B 4HPOH 4KRLB 3RWDA 4PJ7B 1ZGLA 3PL6C 2RHEA 5SWSA 5E94A 4NN7C 4O02L 1SEBA 3R8BB 1K8IA 1NANI 4HKBA 4AZ8A 2JJWA 4IJ3C 5CEZH 1U8NA 3KPPA 4BSWB 5I17A 1U8LB 3SDYH 5FCSH 1IM3B 1TQCB 2DLFL 4K3DL 2F19H 4K9EC 1FRGH 3EYVB 3I2CL 1G7IA 3CFDB 4BUGA 1BZ9B 3MOAH 1DVFA 1E4XI 4Y4FD 3BGFC 1IARB 1U41A 4M5ZL 4JQXA 5J6HA 5FUCE 3EDFA 1RJZB 3PABA 4P2QB 4HF5H 4JFZL 4RWYH 4WTWA 2JTDA 5IF0B 2ZZUT 2R56H 1YDPB 1J0ZA 3VGAB 4YDKH 2EYSA 1T4KA 1DBKH 5TQ2L 4HQQL 1NFKA 3W82A 4NNYA 2R0ZH 1ZSDB 4F33A 3S37X 5BQ7A 5JW5A 5JR1L 3D48R 5M94B 3VXQA 3DO7A 2I9TB 3QH3A 3IJHB 1VPOH 3WFZA 3IU3A 5CEZD 1QFUL 2BMKB 4WI8A 1DUZB 1LVEA 1JRHL 1BQLH 4LIQH 8FABA 5I2IA 3EYUH 5GGRY 3TH4T 2FEDC 5TQ0L 4HFUL 5C3LD 2GTZA 3ARFC 5C92A 3QRFM 4NC2B 2R23B 4JO1L 4O51A 3O81A 1NGQH 4PJ8D 1LK3L 1F4YL 5IEKB 1CF8H 1D6VH 3M45A 5KSUB 4HUWB 5IVXB 4X6DA 1IT9H 4JY6A 4PJ8C 5I6XC 4OZFG 5HDBF 3TZVA 3WNOA 3QIBD 5JMRA 3IB4A 5SWSD 3EYQC 2PW2B 4HJGB 1KIRB 3WKNA 1B0WA 3QIBC 4ONGL 2JCCA 3QG6B 4ZO6A 1EHLL 2FJGB 1N4XL 4R2GD 1D5ZB 3WMSA 3JZ7A 4JN1L 1R5WB 3BPLC 3CMOL 1VACA 4KUZH 5J0BA 5ACMA 1MCHA 1EBPA 4R2GC 1AGDA 4G6JH 2QQLH 4NQSA 3VXRA 4ETQA 4DKDC 1Q0YH 4U1JA 5DUML 1AGBB 2AJSH 2GYSA 1FZOB 5GQBA 4OF3A 1QSFE 4U31A 2Z35B 4KTEL 4KK6D 1J1XH 4NQEA 4NN6B 3JV4A 3OHXB 4KXZI 5IBTL 4F7PA 1RHHB 4U6VH 1OSPL 2FSEA 5LQBL 2VN7A 4KK6C 1U8HB 3MLSH 5C09A 4P4RA 5MP6L 3BKML 5HYEA 4LCYA 1WUNT 3H2WA 1UH2A 5FO8B 3STBA 2OI9B 1D5MB 4HBCH 4ETYA 3QI9A 1U92A 4H26A 2P48B 1IGFL 1NBZB 1RZIA 5GS1C 4FQXB 4GG6E 4ZFZB 2VXVH 4MA1C 4MNGB 1QYGH 3GMPB 3RWEB 2XV6B 4PJIE 3HC0A 3A6OA 1AXSA 1QR4A 4RSVA 3VWKA 1FVDA 2FECL 2VR9A 3CFKA 3FAXA 4OGXL 1LE5B 1T1WB 1NMBH 3TZVD 4FFVD 1T5XA 1W8NA 1YEDB 3DURA 1RVFL 1CD1B 4LSTH 3KYKH 4AENB 3TBWB 1RIVL 4X6CE 1C8PA 4R0LC 3IFOB 1WITA 4OKDA 1VERA 4ZUTA 3VXTB 1G9NL 3RZCD 5FYLL 4OIIH 4X7CC 1MCIA 1Q94A 3PGFL 4U6HB 4UV4L 5DRZB 4BKLA 3RZCC 2OMNA 3Q48A 4PJGE 1F58L 4XNUL 1YPZF 4X7SL 4LLDB 3IF1B 4HG4K 3C6SB 3PGCB 1SJVA 3KLDA 1MF2H 1NCDH 5EB9A 3GMMB 2J7LA 5E8OA 2VC2H 3V4UH 4ZXBA 2Q86B 3F7YB 3FONA 4NQED 3S37L 4JPKL 1X5JA 3D39E 3DHMA 5HPMA 3SDAD 4OFPA 4OZHF 2B1AH 5C09D 3C5JB 3G04A 5JW3L 4P2RE 3VFPA 5DD6A 2NY1D 3LEVH 4FNLH 4U1IB 1HQRB 1UWXH 1F3DH 4PRAB 3V6OA 2CDEB 3SDAC 4JKMA 2HP4A 3AB0B 3QI9D 2AJXH 2R29L 1WC7B 4JFHD 1HKLH 4ZAKB 3LIZL 3QDMB 2BSRB 2P49B 4X7DC 5FV2A 1JWUA 5BZDB 4H25B 1D5BA 3JWOL 5LKNA 1G7HA 1NFDB 1CFNB 4MD0B 2ILLA 4MD4A 4L8SB 4L4TA 2DKMA 2OJZH 4Y19B 4Z6AT 2CXKA 5F9JA 1XH3A 2R69L 4BQ8A 2A6IB 1V7NH 1A6ZB 1CLCA 4LRIA 1JPST 3BPOB 1RK1A 3J7HA 1NFIA 1RIHH 4AL8L 1P5UA 3GSOA 4YFLF 3T2QA 5MI0C 25C8H 3ARSA 3CLFL 2P5EB 4FQIH 3GK8L 5D8JL 5JZ7D 5I30L 5HGAA 3JV6B 1ZHBB 2HTLD 4KY1H 5D1QA 1NAKH 5HTSA 2EYTB 4G3YL 5TH2A 5HGHB 2YRLA 1RURL 2BY2A 1HWHB 1KCLA 2VISA 3MRCA 4F2MA 2AJVL 5DFWH 1XF2B 3OPZH 2P7TB 3P9MA 2APFA 1BF8A 4I2XE 3UC0L 2MSPA 4DK6A 3P9LB 2GUOB 3MRQA 1MWAA 1GZPA 3RA7L 2IBZY 2NNAA 2BSSA 1MEXH 3CSYB 1ZV5A 3IDYC 4LSUH 5CILL 3VA6A 3WLWD 5ICZB 1DFBH 3MLPA 3KDMA 4ZXBD 1OPGH 1FL3A 5D93B 5ELIA 4MB5A 4XPTH 1S9VB 2NY4B 5BRZA 4OKVB 4TQEH 5K9QG 1NEUA 5F6HI 3BEVA 4OF6A 4XI5D 4Q97A 5DWUH 2IGFL 3ZZ1A 5C6TL 1EHXA 1EO5A 4FG6C 5EU4A 2EIDA 1DTUA 3I6LD 3RL2A 4X99B 5FDYA 4XI5C 2YPLB 3MGAA 3N50A 1JK8A 5IFJA 3BW9A 5TE4L 5CD3A 2P47B 3MC0A 3SDCB 3GI8H 2FEEL 3KLSA 3ECBB 5BO1H 4PJBF 3EOTL 2ATPB 4XX1G 2V5YA 4LEOB 5KTEH 3MLRL 3DTXA 5J1SC 1KTLB 4L9LA 1FVEA 4OTXH 3HB3D 4HUVA 1JZ7A 1A7QH 2WUBL 3WN5C 4PJHE 4WFEE 4WU5A 3SCMA 2D03H 1UKSA 3HB3C 5K59E 4QXGL 3CCHB 1WWCA 3KPNB 2P43B 3V4PH 1SVZA 4XRCB 4YK4B 4X9HA 4RFNC 2XZQH 4ZTOH 4Y4HA 4P23B 5D1QD 3TBYB 2VLLA 2W07A 7CGTA 1UWGH 1JGUH 2FJHB 2BFVL 2EDFA 4JRYB 3QSKB 4UBDD 3DXAA 3PF2A 5IWLA 2B7DT 1R5VA 4GKZB 4AIOA 4B7IA 2VWEC 4Q0XL 5HVWA 2X1OA 2X7LA 2OM5A 1FVCA 4PJDA 5MEQB 5T33L 2V2WA 1U8JB 2DJ4A 4ODWB 4QRUA 5JLZB 1T3FB 4YEEA 3S3JA 4XCCL 4MJ5B 1BREA 4RAUB 3BT2H 2QL1A 3MOBL 5ALCL 1T7VA 1JGEB 4JM2B 5FM5O 3ZKNC 2B20A 2C3VA 3LKRA 5BRZD 1CE1H 1MHEA 3K8MA 1P9MC 1I7RA 2L0DA 2H1PH 3NCYS 3BEWA 1MWAL 3MGTB 4XMLH 2HFFA 2IPUG 4JN2B 2E7CA 4YLQT 3OTTA 4YC2B 2BXYA 4UDTB 4AG4L 5L2JA 1JNJA 4U1NB 3MROB 3HNTH 4LP4A 3P73A 1KJ3L 4OZFB 3GSNA 3O8XB 1G9MC 2G2RA 3BDYH 1N2RB 4CADA 4ZUSA 4GRWB 4XPGL 4NN5C 4NCC2 4ODBD 3PL6B 4F7MA 1BFVH 3WJJA 4CN4A 3H0TB 1A1OA 1WIUA 1HHGB 2OR9H 4EN3A 2WK2A 2Y07L 3QEUB 4PTUB 2A9NL 5ICYB 1J1OL 5H2BB 5ADPL 3WLBB 3CZFB 3GJFA 3BIKB 3HTLX 3OB8A 3B8SA 1MHHB 5C07E 5C0IB 4YGVA 4F3FB 1Q72H 3VU2A 1BBDH 3MNZA 5J6GA 3HZKB 2IAND 2JE8A 4ENED 4E5XA 2A74B 2G5RA 1EAPA 3GSNH 2NY7H 5AYUL 1R5IA 3L3HA 3B4NA 4ENEC 4LMQE 3DXAD 4FQ2L 4G9FE 3VFUA 3DIFA 3HCVB 4Y1AE 4MAYA 2FLBT 2OK0H 4FFYH 4GW4A 4URTB 4Y4FB 5IK3B 2VXUL 5I18H 2NW2B 1WBZB 4K23H 2G75B 4UNTA 3S3PA 4LPWA 3SO3C 4L29B 3H9YA 4I3SH 4APQD 4LKCA 5E8NA 3SKMB 4MQ7B 2AV1B 4APQC 5D2LE 3LN5B 3RGHA 1Q9WA 5E2VL 2VLKD 3K80A 1HNFA 2SEBB 3HMXA 4IOIB 1UXWB 4UINL 5CP3H 1P7KA 2DQFA 2FR4A 1V3MA 1KNOB 5KW9L 1CN4A 1K9TA 3ARFB 3IETB 4WI7A 2GSGB 2R2BB 3RWIB 1ZT7B 1QRNE 3RTQD 1TITA 1NGYB 3TF7C 4ISVB 3RUGA 5IT2H 3N85H 4PJ8B 1KPRA 3RTQC 3O2VL 3CUPB 4PJCB 1XF3B 2V5SA 2GJZB 4U6XB 5FUZL 3H3PH 5T1LD 3CXHJ 3C5ZD 3RWDB 1ZGLB 3THML 2NW3A 3QIBB 2AJ3B 5DJ6B 4PR5A 3HMXH 3L3JA 1ITBB 3C5ZC 3FQWA 1K8IB 1UZ8B 2CDGA 3EHBC 4M9PA 4DQOH 4HS6A 5C9JB 3KPPB 2ADFH 1HYSD 2WSKA 5EIQA 4ZYKB 4R2GB 4R7NA 1IC4L 4NJAH 1OGTA 4Y2DC 3DO3A 4YDLC 3NH7H 4HCRH 4XPFH 4ZQKB 5CLTA 5IVZA 4J3VA 2Q76B 2XKUA 3OJVC 5MEPA 4DCQA 1JV5A 1RZ8A 3QP3A 4I8DA 3EDDA 3TA3C 3CVHA 3GBML 1TQBC 4U33A 5FHBL 1CG9A 2AK4B 5IFAL 4J4PA 4LDEB 1EO8L 2ESVE 4HJ0D 1NKOA 1QSVA 3VMOA 3MLVL 3IU4L 1NPUA 2E8YA 3CDGA 3O4OB 5DQ9B 1MFDL 1WCBA 4HJ0C 3SE9L 4AM0A 3H9SA 3VXQB 1H15A 5GRUH 5GS1B 3MR9B 3MRFA 2VDLL 1IGCL 1P4BL 1I4FA 3IU3B 4EBQL 4MA1B 1IL1A 1KTDA 1EEQA 2X4RB 4NCC1 1LE9B 1E27B 5KJRL 1B90A 2NY3D 1B4JH 2GTZB 4M61A 1KLUA 2O5YH 1AD0B 1JNLH 1A6VL 5DQDL 4LVNB 3K46A 4RFEA 5HHVH 1J5OH 4OGYL 2NY3C 5GRXG 1QLRA 3QHFH 2CUIA 2DLIA 3TZVB 1CU4H 3HE6C 1ONQA 2VZ1A 2DQTH 1OY3B 5DUBA 4Z76A 4HGMA 4TTDC 3OKKA 4LF3A 4G5ZL 4PGEB 1FJ1A 1MCFA 1EGJA 4ZPVB 4NO0D 1Q9LA 5DVOA 2R0LH 4KZDL 2JCCB 2YMXL 3BKYL 4IMLA 4X5LA 3UJJL 3CFEB 1SJXA 3RZCB 3BH8A 3O3AB 1Q9KB 2VXSH 3VXSA 4NZUH 3PNWB 1KIPA 1CZ8H 1KB5B 1RUQL 2R4SH 2VJXA 4XNXH 3V5HA 2R1XB 1PEWA 3GI9H 1NL0L 2YPVL 4NQSB 5ESQA 2VO5A 1KENL 3VI3F 4ETQB 4YE4H 4J8RB 1NUDA 4U1JB 3B2VH 3SY0A 3EOYG 4J4PD 1BVZA 1LDSA 2WV3A 3KNBB 4OD3H 3KJ6L 3JV4B 3GO1L 4UTAL 1EGJH 1F13A 3IJYA 4M03A 3ZYOA 4F7PB 3RVWC 3T09A 5DK2A 5TGBB 3SDAB 3SKNA 5D7KE 1A7BA 3HNVH 5C09B 4ERSL 4LCYB 3ILPA 2NY1B 2VXQL 4DOHE 3K3QA 3OZ9H 5IHZB 4CDGC 3TH3T 3TJHD 4AMKL 1CLYL 3B5TA 3V95A 4UTBL 5FUCC 3QI9B 1TNMA 4GH7B 5F3BA 5IHUH 4R8WH 3NFNA 1QG3A 1FIGH 4Q9RL 1EUUA 1JI2A 4JZOA 2X44D 4X7EC 4I77H 3ULVH 5HDQH 3P4OA 1MJ7H 1FVDB 3NIDE 3QDGB 4GS7C 5AWNL 3CFKB 1FCGA 2BNQA 4Z7WE 1RZFL 2ERJC 1N6QH 1U0QA 1RMFH 1QHOA 1MSPA 5EA0L 4MZ3A 4U6YA 5EORL 2GAZB 2F54D 3MLWH 3UDWA 2IPTH 5B22A 4Z7VA 3MCLH 2ID5A 4AT6A 5I8OH 1WSST 2FGWL 4IM8A 4N0UA 5DT1L 5F7DB 4LGRB 5LXGL 3DSFH 1MJJA 4NQDE 4ZS7L 3CLEH 4EIZC 2Z4QA 2MCPL 5TDPA 1AFVL 3D18B 1BM3H 1X44A 3LSOB 1WTLA 4BKLB 4NRXA 3GRWL 1F4WH 3IDYB 3ELAT 5TJWK 5CHNA 1XIWC 3SDDA 1ED3A 1HHHA 4RFOL 4J1UB 4C58B 2AXGB 4A2LA 5J8OA 5E8OB 3ULVD 5CJQH 4ZXBB 3FONB 1WBYB 2CLVA 4N8CL 3U6RA 3GNMH 3PDDA 2O26U 5DZLA 2HH0H 4JPWL 3GMLA 1BFOA 3G04B 1HIMH 5GISL 5DD6B 4IRSD 3I84A 2X2YA 3INUL 5JHDE 1LP9E 4U1KB 4IRSC 5CZXD 1HH6A 4XH2A 3SQOL 2P5WD 2EYRA 4XVJL 1BEYL 1JWUB 3QJHA 3GB7A 1TETL 4YAQB 1FGVH 2PR4H 3FHAA 4MD4B 1OD7A 5F7LB 4X7TA 3JTTA 1OGAE 4JANA 4IBLT 4KKBD 2FYYA 2F8OA 5IR1A 5GRJL 4EIGB 1JNNH 3FB7B 4YX2L 1T0NB 4KKBC 4LCIL 3E1F1 4D3CH 2HLAA 4UDUA 3PWPA 4X6FB 5TDNB 1DQQB 2B0SH 1K3IA 1G0DA 5FFLA 4L4JA 1W72A 5KVEL 1KEMH 2FL5A 2LQRA 4ODSH 5D1QB 3U1SL 4HV8A 4FQ1H 1M7DB 4P9HC 4WUUB 4GKSA 1Y18B 1KC5H 5A43C 2VISB 3MRCB 4K8RH 4F2MB 1AQDA 3U30B 2ZPKH 3OKYA 3ULUC 4E42A 1B0GA 4ONFL 3MRQB 1GZPB 1SY6L 3IFPA 1QEWA 2BSSB 4Z7UE 5EZLA 3RVVC 3TFKC 5F1IB 5IOPA 1G7MA 3KDMB 1FL3B 1N0LA 4KKLD 4GLRI 1W72H 1QNZL 5GGQH 1YECH 1Q0XL 5BRZB 1AHWC 4P4KA 4QGTA 4KKLC 5C0BA 2C4XA 4KK8C 3G08B 1QBAA 4PRNB 4CN1A 1JZ4A 5EU4B 1HQ4A 2UYLA 3RL2B 3O2WL 3SDXB 1ETZA 3KPOB 5CD3B 1D7FA 4PY7A 4LVHC 2LU4A 4X8JB 1BFSA 1GHFL 1LO3L 1JPFA 3EDKA 1R24B 1EFXA 1YJDH 4NQUA 4K8RD 3GKZA 4PJ5A 4NP4H 1ZLSL 1WZ1L 1XF1A 3EYFA 4G6KL 5DEFB 4F80A 4XZUA 1TVBA 1CLOL 3SOBL 4K8RC 4PJAA 4WU5B 1OP3H 5KS9F 4NNXA 2XA8L 1H3XA 3KPTA 3LRSA 2BDNH 3PWPD 4HIHA 4NT6B 5JORB 1N0XL 3G6DL 4HIXH 1QD0A 2IANB 5CGTA 4P3DA 1S7TA 3NTCL 3S7GA 1UVQA 3BH9A 1HHIB 1IC7H 1C1EH 2YA2A 1PJ9A 1NSNH 1BZQK 5BMFH 1N59A 3LB6C 5AG8A 4IOSD 1I8KA 5HHPA 1PG7W 4U2ZA 1UYWL 3SO3B 5IJKC 1MAKA 2X7LB 4RISL 4PRHD 4PJDB 1MHCB 2VXTL 4P49A 2EDDA 3LKQA 4APQB 2J88L 5DVKA 1J9CT 2BC4A 2PYEA 1A21A 1MCOL 3D5OF 4E0RA 5IESH 5TDOA 3L7EB 2VLKB 1YPZE 2C3VB 3P4MA 5E6IA 4DN4H 1KCSH 4P4KD 4PGCA 5C0RH 5KVDH 2EE3A 1MIML 1DL7L 3BEWB 4G7VL 3MV7A 3W2DL 4CW1A 4ONHA 2HFFB 4KKNA 3IJSB 2N4IA 4PFEA 2R15A 2QV2A 1YNKL 1J05A 4KKAD 5L2JB 3O2DL 1HSBA 2IMMA 3CU7A 2VLRE 1CDGA 5AYQA 3RTQB 3GSNB 1RUKL 3MV9E 2G2RB 4KKAC 4OZHE 1G7JA 1PY9A 5C0CE 2P8MA 4ZUSB 1I85C 3VFTA 3MXWL 1EFXD 4Z7OE 1YY9D 4IOFD 4F7MB 1QFWM 5FGRA 4PJ5D 5KSBA 1K85A 3V79C 3OG4B 3IFNH 3FB6A 1A1OB 3TH2T 4PG9B 3VFRA 5DD3H 3RWCA 4PREB 4QXWA 4Q7DA 2R1YB 1YY9C 3C5ZB 3H6JA 4IOFC 1L9NA 5T1LB 1GPOH 2ADIB 5DC9B 4WI5A 1YEIL 4KU1A 4OCXH 5HHNB 2Q87A 2WIIA 3NAAL 3D9AH 4IRJA 4YXHL 4FQCL 4PJXA 3BJLA 2O93L 3QWQB 1MCJA 2QHRL 5JHLH 3SGDH 3BQUA 4DVRH 4YDLB 3QXAB 5J6GB 4E5XB 1EAPB 1X7QB 3STLA 1JN6A 1AGEB 1R5IB 4I0CC 1HSAA 3K81A 4G8IA 1K2DB 1J87A 2PUQT 4I13B 3CK0L 4O2EA 3VFUB 4FHBD 2AQ1A 1TQBB 1RZ7L 4CU8A 5GJSL 5EWIL 5HYFA 4MYWB 3LKNB 3TJEL 1V05A 3OR6B 1NLDH 1UZ6F 3C9NA 4PP1D 1ZHLB 3QAZC 4OBSA 3U9PL 1CBVH 2NY0C 4L8BB 4WV1A 4LKCB 4RGOL 2PYED 5E8NB 1RZKL 2CPCA 3ZT7A 4OD1L 4LASH 3WUWG 1JRHI 3FJTA 4PGDA 3CSGA 4JFQB 5IB1B 5JDSB 4J3TA 2BVYA 1H3UA 4QHKJ 5DD1L 2MTPA 3MLXH 3GSXA 1P7KB 5FDWA 1CDCA 4HUXB 1A5FL 2CQVA 1BMGA 2BVOA 3QUMH 3D0LB 1BIIA 4KJPC 5D7IA 2NY3B 1WBXA 1XGPB 3ESUF 1FO0A 3C2SA 5EFIA 3DMMC 1MCCA 2MQCA 4GQ9L 2YOCA 4HHAB 1GGCL 1HILA 4KK9C 5HHOE 4M7JH 3FQXB 5IMOA 3TESA 5IW6B 1XF4A 2NW3B 4PR5B 4TSCL 2NXYD 3QG7H 1F4AA 2AJYH 2F58H 3BAEH 3DGGA 1EMTH 3FQWB 4PJBE 4EDWH 2YC1A 1WCQA 2CDGB 3U0TA 4W6XB 4NO0B 4HS6B 1I7ZA 2NXYC 3BQUD 4LGPB 5E99H 1PX3A 2IBGA 5HI3D 1C12A 1RJYB 1G7LA 3Q6GH 4LVOB 1OGTB 5JUEL 3ARUA 1MCLA 1AR2A 5AEAA 1EJOH 5HI3C 4HULB 5F70A 4X80L 3QNZA 2CLRB 5MEPB 1FO0H 1JV5B 1S7RB 3BKCL 4PJFA 1QBLL 5EZIL 3VGGA 5L8KB 3EZ8A 4L4VD 2WMPA 3IAQA 5E8DH 5ILTL 2RQ8A 5E2WH 3WUZA 2ZCKH 2ZUWA 3KXFA 5GS0L 4WTZA 4JFOA 2C9AA 3FTGA 5TF1L 2XRAH 3WNPA 3I6GA 2H3NB 4QTIL 4GAFB 1MRDH 5D6DA 1KJVA 3L9RA 2QSQA 4XNQA 5D1XD 4PJEB 4QHLA 3L5XL 3T0DA 1BZ7A 3FT2B 5D1XC 2E6JA 2IH1B 1ACZA 4WDIA 3MRPA 1I4FB 1CGTA 5M7QA 4BFIB 1IL1B 1S9XA 1WIPA 3CXDH 4K9EL 2GJ6E 1XMWA 1T66C 4PGJA 1GGUA 1KJMB 2ADJB 4GS7B 3F65A 4M61B 3UJIH 2ITDA 1MQ8A 3W9DB 1IGYA 3WEXA 1EEYA 2ERJB 3HG1A 2AK1L 3NPSB 1QZ1A 3F62A 1CTNA 4R90L 2VZOA 2PTUA 5A2LH 3ARGC 3SN6N 3ZYZA 3M1BB 1OSZB 1YMHA 1Y0LA 4ZOCA 5FYJE 4Z76B 3IFLH 3UZVB 4LF3B 1MCBA 2F54B 3BD3A 2X4UB 1NDGB 3S36X 3U9UB 2XKNA 2DLGA 4HWNA 1EVTC 2DI9A 3QEGH 3EOAA 4RMRA 4X0KA 4WJ5A 2B1HL 1E4KA 2OXGA 4PS4H 1MVUA 3B5GA 1KIPB 4MWFB 4RGNE 5GSRA 4MXQD 3V5HB 1R0AL 5IQ9A 4TULH 3EO9H 3MV11 1CGWA 3NFSH 4QOKE 3N1MC 5HGBA 4LKXB 3SE4A 4Q9QL 2DKSA 1SMAA 1ZTXH 1FNAA 1X4YA 5ID1B 1FBIL 4U7KA 2HTKC 4YHLH 5DK2B 5HDLA 4KI5F 5IB5B 5GRYA 4WY7H 2P44B 3R0NA 4MJIA 1SYSB 3QULA 2RJMA 5E00B 4IRSB 3R8QA 3U83A 1ZVSA 4E9LA 4O00A 4UIMA 2HFEB 4L5FH 4N1CA 4JY4B 4PIRF 4M02A 3NFNB 3WFEH 2E7BA 2P5WB 1B0RA 4UNVA 1JHKL 4RMSA 1DEEA 5F7YC 4RBPK 5FF6A 4GRMA 1I8IA 2FX9H 2D4FA 1L7IL 3WIHA 4F58H 1QLEL 2Y1VA 3P40A 2UY6A 4KMQA 1G0XA 4M6AA 3LD8C 4LIQL 2ZUVA 4RRPG 3JUZA 1FGNH 2ORBH 4U6YB 2BSED 3JV5A 4H1LA 5JXAH 2BRRL 4FTVA 1I9RH 5T3XH 1BOGB 4YZFF 5JOPE 1CF8L 1D6VL 4ZFGH 3AROA 4QEGA 1T03L 4N0UB 5AZEH 1IT9L 3DGCR 5L8LB 2O5ZH 4OZGA 5FCUH 1MJJB 1MLCA 3C2AL 2Z4QB 5C7XH 3Q6FA 4DAGL 3WIHH 4Y4KA 3E0GA 1CIUA 2EE6A 4GMTH 1I1YA 1Z0NA 3MRMA 4LLQA 5CHNB 3O11A 1JWSA 1ED3B 1HHHB 3A6BH 2X70B 5C0NC 5MHSD 3TCLA 2IPKA 3LY6A 3IDMB 2C7UB 3QCTH 4HK0A 1CI5A 4F15C 2Y7QA 5F9OH 3U6RB 4NC1C 1LEIA 5E0QA 3O3EA 3L3IB 3TT3L 3Q2CA 5EUOB 2YPKA 3DV4B 3E2HC 3GMLB 3JTSB 3UZQA 5JIKA 2UWEE 2P8PA 3A67H 2FNBA 2HJKA 4WTZG 2OTWA 3SJVE 2CMRH 4KDTC 4XC3H 1FH5L 5T3XD 2BOBA 4PUBH 4JFFE 1B3JA 4JZNB 5JOEA 4F9LC 3FN9A 4OIBA 3ZLQC 1ZWIA 1XCQA 3K4AA 4OV5B 3GGWB 1H8OA 4CJ0A 4S1SH 1KB5L 1U8QA 1WAAF 1YMMA 3FQRB 3G6JF 5D2NE 3JTTB 4UOW0 3UTSE 5CJOH 4YPJA 3MCKA 3ARDD 5IR1B 3MBXL 5CINL 3S36L 3H7BB 5GRVL 3MFGB 4YHNB 5D96C 3TT1H 4M7LH 4ZOAA 3KPRE 2AV7B 2AKRA 1DLHA 1KELL 1F8TL 3PWPB 3ARDC 2FH6A 1W72B 2FX8L 1PYWA 2QHLA 4PRPE 3OBAA 5HVHC 4B41A 1KIQA 5FM5M 2QSVA 1HDMA 3VGHA 4LLVB 4GKNB 5CSGA 2BVEA 1A1NA 1L4IA 1WZMA 5FK9B 3W11C 4Z5RA 3WUWB 1BJ8A 4PRHB 1JHTA 1YY8A 1AO7A 4DN3H 3U0WH 1B0GB 4GMSL 3L5WB 2CIKA 5IOPB 1C5DA 3CFBA 3VXPB 2IQAB 4N90D 3KYMB 5I1DA 1VEMA 2Q6WA 1A3LL 4QRPD 4U1HA 3DX9B 3VI3E 2EIZB 3HRZA 1FFOB 4JM2F 4UAOC 1NCDL 1NCBH 1QBMH 4Y8AA 2OL3A 1INDL 4K2UL 3VJ6A 4OF5A 3NPZB 4GSDH 1ETZB 4PY7B 2GY5A 4QHKI 1EUTA 1P69B 3MODH 2ED9A 1JPFB 3C5SA 5EOQH 3TBSB 1BD2D 2XTLA 12E8L 3RNKA 4PJ5B 2HFTA 4QRSA 5HXMA 2D9QB 4OLUL 4GRWF 2ADGB 2VDOL 4NNPH 4NM8L 2BZDA 3SKOB 2Q8BL 4XGZA 2IFFH 3PWNA 3VCLB 1RZGB 4G8GE 5FGBA 1A02N 4PJAB 4OFKA 3WE6B 1D3CA 2XXMB 3FO2A 1B2WL 5T3ZH 4HIHB 2VZVA 4GKOA 5GJTL 3CIQA 1WT5C 2M8XA 2A6JB 1OARH 5H94A 1AC6A 1QVOA 2F53A 5DHYB 3BWUC 5DYOB 3U7YL 3T08A 5CJ8A 3DUHA 5FO7B 1FL5A 3F58L 3UEZA 3K4DA 5EU3B 1DUYB 3TO4C 2J8UE 1N59B 2ZOKA 3JUYA 1RIHL 4JM4L 1HCVA 4OCNC 4X5WA 3V52H 2X1PA 5E08L 2O61A 1AO7D 2VDPH 2VQ1A 5I1EL 3GMNA 4IDJH 4QXTA 5LJYH 1MI5E 1EV2E 2BC4B 2PYEB 3N1QC 1WFNA 4PRIE 4GXVH 1REIA 4V1DD 3LHPH 1A22B 5I74B 3MPCA 3OB0K 5EO9B 1HE7A 1HXYB 5DJXB 4F9PC 3KLAA 4JFDD 2VAAA 3HUJA 1U8IB 3NGBC 3QDJA 1H9VA 1MEXL 4JPIA 4ONHB 3KPLA 5GGVH 5LAXB 3ZTNH 5T3ZD 2VKWA 5I1LA 15C8L 5F9WC 3OKEA 4AYFA 4Z77A 5BXFA 4RDQG 3B5HA 1DN0A 1YEGL 5ISZA 5J4MA 4F57H 1HSBB 1RULH 1INQB 5E8PA 3WD5L 5CD5C 2CK0H 3VFNB 1TJHL 4XP5H 1OT2A 2ATKA 2MJWA 3DMMB 2OZ4A 1P7HL 1OAQH 4K7FA 2P8MB 3VFTB 3MYJB 4A6YB 2XQYK 1MCPH 5E56A 3BMVA 3KYNB 3LS4L 3BHBA 1JF1B 3VFRB 5D5MA 4FZ8H 3RWCB 3VXMA 2KZ1B 3FFCE 4PJCF 3ARWA 2BVTA 1ZLWK 3MV8D 2NXYB 3FN0L 4POZD 4XTRD 5F9DC 4JPVL 3RWFA 4MA3A 3B6SA 4LSRL 1EX0A 4L3CA 3DROA 2EH7H 4XTRC 2F53D 3BQUB 4POZC 2DBLH 5K9KA 2I9LB 1WFTA 3STLB 3HI6H 3OKNB 4OQTA 2OZ4H 4YQXH 3AY4A 5FECB 5DD0L 1G9ML 5F6IC 3WBDA 4TUOA 2I07A 4L4VB 3LVEA 1C5CH 4HBQA 4F7TB 3QUMB 2BXZA 5T1DH 1OD9A 2R2EA 3C9NB 1JGUL 2WBJC 4GG8A 4OCMC 5GHWH 2D7TH 3RNQB 5ETUB 4J3UA 1XCTA 5GZOD 3LPGA 4ESKA 1RQ5A 1XGTB 4PGDB 3AM8C 5BJTA 2E7LA 5D1XB 3NIFF 2A6KA 2NCMA 4OUOA 1DBAL 2LFGA 3JVGC 4OQTH 1FN4A 5FO9A 1UCBH 4FABH 3KG5A 4XXCC 3GSXB 5FDWB 5ISZD 3ES6A 1HEZB 4NHUA 1YYLL 2BVOB 4W4OC 1I3GL 1IAOA 3OKDB 3K0WA 1BIIB 4XPAH 4MDIA 4AY0A 2H1PL 3O6LH 2W9DL 1ZT1B 3AREC 4XCEB 4H8WH 5CAYB 3EGSA 2XG5A 3CD4A 1FO0B 1CFVL 1HINH 1ZA6B 1G9EA 1FYHB 2ZNWA 1HILB 3IKKA 4BFBD 1I9IH 5TE7H 2ITCA 3VXMD 3BPCB 1FNEB 4G6MH 4OLXL 4ZDHA 1ZGLM 5JW4N 5F7KC 2X9WA 4RGMB 2DQGL 3DSNA 2YC1B 5F3HA 3U0TB 3GM0A 3NACH 2NY2C 1BBJB 1SMOA 2AP2A 5EBMA 1T04A 5KS9E 1KGCE 4JFPB 3PP4H 3DX8B 3QEQA 1IBGH 4XWOD 1Q72L 1Q9OB 3LOWA 5EOCL 1J0IA 3BKJL 4LOUC 3T4AB 2FGZA 4KGLA 2NY7L 5I9QC 3AU1B 1CGXA 4QRTA 4R96B 3FFDB 5SWZE 4JFOB 3X12A 4RAVA 4WGVB 1QQDA 5HYJA 4NUGH 2DS4A 3H3BC 5CBAA 3HPJB 2FO1A 2OXHA 4JEGB 1Z3GH 3MUHL 3P77B 4Z8FH 4I3SL 2JB5H 4GRLC 3DOSA 5AUMB 4ODUB 1WISA 4XAWL 3PWJB 4JDVA 5I1HL 4WDIB 4Y5YA 5IMMA 2X9XA 5LWYH 3AAZB 3LKOB 1AGFB 4BH7A 1VDGA 3PQYD 3QO0B 1GGIL 2DTSA 1XFPA 4AEFA 4KGJA 4OGAC 4XT1C 1EEUA 1XEDA 4S1DD 3OKMB 2ITDB 3F12B 3LD8B 1EEYB 3WEXB 3AVEA 4S1DC 4BFEA 4XP1L 5EU6D 4ZG1A 1NGPH 1X5KA 1PSKH 1HNGA 1U2CA 3Q3GA 3WXWL 1AP2B 1KTRL 2I26N 3UBXI 3UO1L 3EO0A 3N85L 1GGYA 4HS8L 1Y0LB 5IB3A 4PD4K 2MFNA 3IXTB 4K07A 3DV6A 2X41A 1D9KA 4DKFL 1KCVH 3CC5A 4X98B 2FJFA 3VFGL 5DJDB 4I0PA 1J8HA 4FZEL 3T4YB 4WFFD 4X0KB 4WJ5B 2EEDA 1TDQA 5HHXH 2WQRA 1B6DA 1MVUB 3QXTA 4XMKH 1KYOJ 4PJ7E 3QEQD 1Q38A 5F21B 5IQ9B 1A8JH 4CVXA 1CDIA 1XGQB 2ADFL 4EZMA 4F15B 1QSEA 5CJXC 1RUAH 5DUPL 5DRNB 5C0AA 2W65A 4I18A 1VB9A 4U49A 4WHDA 2R0KH 1DANU 2FD6L 3E2HB 5HYJD 2B8OT 4LSQL 1AIFB 5J1AA 5J9PA 3MLYH 3CX2A 4G8EA 4XP9H 2RB8A 2ZSWB 4XVUD 2XY1A 1NLBH 4ALAL 4D8PA 5AZ2L 3OAYK 1ZVSB 1PFCA 1VKXB 2NPLX 4XVUC 4WO4A 5C2BH 5ENWA 3WS6A 1VEOA 4P2QE 5GZND 4POYA 5BVPH 4J6RL 2P4AB 2F74A 1DEEB 2J4WL 1JBJA 5I73C 5FF6B 4GRMB 2X4QA 2VL5B 1NAMA 4LK4A 4NJ9L 3D2UA 3GKWL 5D96B 2VL4A 3NABH 5B3NA 1YUHB 3ARDB 1HK6A 1NANH 3OXRA 5HVHB 5BW7C 1ZK9A 3CX5J 1KT2B 1QSFA 2HFGH 3T0EA 5KVGL 2RCSH 1D9KD 1J5OL 2XWTA 4JDZA 1TENA 4I0PD 4BSVA 1J8HD 4X4ME 1MLCB 1UKQA 1E4XH 1CU4L 1TZGH 2MMXA 5IVXE 1YEJH 1NC2A 1NAMH 4EXPX 3O4LD 2Y72A 3OAZK 5E2TH 4HMCA 4RMVA 4GG6A 1OM3H 3I9GH 5TFSL 2BOCA 1QSED 5CIPB 5C0AD 3TCLB 3NA9H 4PB9L 4PJIA 5E5MB 2XZCH 1KJ2B 1IQDA 2R4SL 2CLZB 4NPYA 2Y7QB 4YEFA 4UAOB 2IQ9H 4XBEH 1LEIB 2AEPH 2R4RL 4M1CD 1S7UB 4QRPB 4RGNC 1A7NH 4WI9A 5I1CH 3MO1B 4NQVA 3D69A 4JHAH 2UZXB 2JK5A 4M1CC 2HJKB 4KPHH 4MD5B 4DVBA 3FO0H 4X6CA 5F7UA 2BOBB 4WO4D 5E8EA 5DTFA 5SX4H 5I15L 3QZWA 3QCVH 3BJ91 2IMNA 2A38A 1A6AB 1A4JA 1BD2B 3SDXF 4N1EA 3FT3B 1I1AD 1ZLUK 1U8QB 2RIKA 4UT9L 4ZPTA 3D2UD 5JXEA 4XPBL 1RZJC 3MCKB 1I1AC 3A0OA 1U6AH 3QWOB 4H0IA 1MAJA 1QACA 4WUKL 1DLHB 3DVNB 3T0ED 1JE6A 5EIIA 3TO4B 1PYWB 3D39A 3QXDB 3ZKQD 2E27L 3EAKA 4MNGE 3JWDH 1U8KA 5ITBH 3GM8A 1X4XA 1MQKH 1A1NB 1CGSH 1JP5A 2HKFH 1JJUA 1FLRL 4PV8A 2ZCLL 3TEUA 4HW6A 1JHTB 2AJUL 4XPHH 4NHCL 2XWJB 1FFNA 3TM6A 3S88L 4KXZH 2W0FB 3DJ9A 5IQ7H 1TXKA 4V1DB 5AD0A 3NGBB 2YD8A 1F4WL 3KYOA 1WF5A 4H20L 3H9HA 5F9WB 2GSIA 4FFZL 2X05A 4JFDB 4D9QE 2FO4A 1IM9D 4G9DA 1G6RA 2DQEL 4X8XA 2OTPA 3VJ6B 4KVCH 4N0FB 1D5IH 1DJSA 2NX5A 4B0MM 1FNGB 5K9JH 4ELMA 1OTSD 1DQML 2K7QA 4P9HL 1JZ8A 1E6JH 4ZNEE 1LWRA 4KI5E 4NFCA 1NBVH 5E6ZA 1SM3L 2DDQH 1KN4H 4KVNH 1OTSC 3JWDC 1Y6NR 3EDJA 1MFNA 3ULUL 2NZ9D 1MCNA 1MFAH 3T8XA 5D6CB 1YN6A 1FL6A 4I2XA 4XGZB 2FHBA 3EW3B 3OJMB 3CDFA 4X7FC 3CAFA 5HHMD 1BVKA 2RGSA 4OCYH 3WCYA 3ZSSA 3MV8B 4TVSa 2PR4L 1E6OL 4ELKB 3FO2B 1G6RH 1X3DA 1VENA 3LKPA 3QDME 2APXA 3O0RH 5H94B 2F53B 1ZANH 4I9WE 1S78D 1NFDE 1CFTB 5FKAB 4UT6H 5A1AA 1FL5B 4OCSH 1SJEB 5D2NC 5F6IB 3MRJB 4Y19E 2AERT 1S78C 2D0FA 3RU8H 3UJTH 4K71C 1O7VA 4XMPH 1IGIH 4KMLB 4OBRA 4X5WB 3OJDA 5KVFL 1KEML 3P4LA 1CGYA 4QCIA 1TMCB 2X4NA 3GMNB 4N0CC 4LPYA 2EKJA 2HRPH 2P5EE 3SKJL 4O2CA 4DGIL 3Q1SH 2B4CC 3LPWA 5MEOB 1OLZA 2LABA 4K8RL 3PGDA 1X6LA 2FHFA 5JO5B 4G7YH 2OJEA 2P24A 4M7LT 4PJHA 4NDMA 5B3JE 5JMOC 4PY8I 3KLAB 4RIRB 2VAAB 1FZKA 4DW2L 3MRNB 1S9YA 1U8MB 1WVZA 6CGTA 3KPLB 5I1LB 5H35A 5F9AC 4Z77B 5BXFB 2J8HA 5ISZB 2NX5D 1T0MA 2J6EA 5GGQL 5HJ3A 5FB8B 1NGWB 3LKSA 2PW1A 5L2KA 3FB8A 4M6ML 1U2HA 5CCKH 2ICWB 5I1IL 4MDJB 3BP6B 4P46A 2HLFD 2Y06H 4K7FB 1LHZA 4JRWA 1MCRA 1IJ9A 3QJFA 3HAEA 4LPCA 2YEZA 1KF9B 5GSVA 4C83A 2WWKT 1KYOK 4NQXB 3L3OB 5J11C 3QZWG 3P11H 4QF1B 2IAMC 5E24E 3OKLA 4OLVH 1T5WB 4D0CA 3WDHA 1TCRA 4R7DB 2YPLE 4HUMB 4CU6A 3DROB 4NP4L 2J6EH 4UIKH 1EXUA 3QUXC 3VG0L 3TIDB 1IKFH 4YUEH 2XQBL 5TPWH 4IHOB 4K3JH 4LEXL 2FB4L 4HJJH 1S7QB 2W92A 4NRZB 1K4CA 3HNSH 2Q20A 4HIIA 3HAEH 4JO3L 4S11A 5I9QB 3C60A 3LDBC 5DD5H 3VFSA 4U1LA 1DBBH 4GG8B 5CP7A 5A16A 1CT8A 1QOKA 3CZJA 5F1KC 5BOPA 2YKLH 1D5XB 1HZHH 3H42H 4GRLB 1YEFH 4JRYE 4NO2A 4Q2ZA 4WI6A 4YXKH 2UUDK 2A6KB 4JRXD 3HZVB 2ZWLT 4ZD3H 5DS8A 3H7LA 2PF6A 4M1GH 1K8DA 4QT5A 3UCRA 1UQSA 1QKZH 4PJEF 1Y6MR 4TNWF 4WW2C 3NCFB 1LO2H 4YHOL 3PQYB 3V2AR 1IAOB 1JUFB 2W0LA 5BZWA 5L2KD 2DIJA 1AY1H 3WNKA 1EZVX 5K9OA 4P46D 2OR8A 1XGUA 2G9HA 4G9FA 4PTTB 3S34H 4Y1AA 5HPOA 1KFAH 1UJ3A 3EGSB 1OTTD 4OFVA 1HXMB 1DP0A 1UB6B 2W9LA 3ZL4L 4BZ1L 4YHMH 2YD7A 3QA3A 5EU6B 4GXUM 4U7MA 4Z95L 4NO3A 1OTTC 2Q7YA 2VR4A 2DWDA 5LGKA 3IDIB 5F7EH 3P4NB 3U4EA 1PQZA 3DECA 2NZIA 4Y2OA 4JFXA 3ZDZF 5D2LA 1U3HD 1NEZA 4PJ9A 5F3HB 3IDGA 4L8CA 4N0YL 4ZTPH 3KHQA 2D7MA 1CFSA 4GRWE 4XBGB 4HUUA 1G1CA 1U3HC 5IKCA 2HN7A 3ARBC 3UAJD 5EBMB 5EC1A 4U1SA 1MFCH 1IILE 4GAGL 3MREA 3QEQB 2RAMA 3L1OH 5DLML 4R26H 3UAJC 3RJQB 1T21B 3NA4A 5DO2D 1FAKT 3U36A 4GT7A 3QUZD 1IGML 5I8KL 4KH2A 3X3FL 1KEGL 1A7OH 5A3ID 4MCZB 5DO2C 1DE4A 4RAVB 4A6YL 3QUZC 1I1RA 5HYJB 3DRQA 3LH2H 1CICA 2E6PA 5CBAB 4RNRB 3TPKA 2GCYA 4OB5H 5C2UB 4P9MH 4DFIA 4PRDA 1FV1B 3NIGF 5D72L 3VXUB 5I1JH 3SGJC 2Z31A 3T04D 3V4VH 4ZUUA 2CUMA 4MA7L 3QNYA 2I25N 4Y5YB 4QRRA 5I73B 4G42A 1B6UA 4BH7B 1YEHL 3SPVA 2OS7A 2HT3D 3BE1H 5CMAA 4D9LL 3X17A 3V6FB 1CL7H 2XFXB 2WZPD 1CFQA 4ZO9A 4Y1AD 5EZOH 1NCNA 2DTML 2UVFA 3GHBH 1S7WA 2AI0L 3GMQA 5EOCJ 3MNWA 5EU7C 2HT3C 3BSZH 3NCEB 5ANMB 2RFXA 3T2NH 2XPGA 1NCTA 5KN5A 4WGWB 5B4MC 5CEZE 4EI6A 5IB3B 1BVLA 2H8PA 5KG9A 2ESVA 3TYGH 2VLJD 2NLJA 4AIZB 3HAEG 4PJ9D 3LEXA 3RGVC 4I0PB 1J8HB 4B53A 5C0GA 4QHMB 4ZOBA 3S35X 4HIEA 4IRZH 5IBLD 3WNLA 5E7FA 4PJCE 1NMAH 3WIIH 3U7WL 3DBXA 3IVKB 5I16B 3DPBA 2YUVA 3WL9B 1T89C 1EMTL 1FC2D 3P30H 5ERWA 3JBG7 1H5BA 3T0XA 3O4LB 5BVJB 3U82B 4CVXB 3L95A 3ULUF 3V0WL 5C0JA 5MERB 5ESVA 2WWMD 1QSEB 4NZJA 1LK2A 5C0AB 5BV7C 4P2CG 1DQLL 3MRIB 3MACL 4NFBA 1EJOL 4ORGB 2WWMC 4I1NB 5D1ZA 1H3PL 2A1WL 1YNLH 4KTYA 4AH2A 5J1AB 5J9PB 2AGJH 2DWEB 4PJGF 4WFHD 2P46B 2O5XL 3PWVB 2H45A 3U0PB 4QYOB 2CJUH 1TVDA 1GC1C 1ZA3A 4MSWB 4D8PB 2YD2A 5EUOF 1T7XA 1JTTA 4LIQE 2UZIL 2W60B 1U8OB 1VHPA 2AK4E 4POUB 4QRRD 4WO4B 2C1OA 4YDIH 3U4AA 1K4DA 5CEXA 3UTTD 1UXSB 1N5AB 4GW1B 2F74B 4Y16A 1CLZH 1U95A 3SE3C 3NIFE 2CIIA 5D7JD 2X4QB 8CGTA 1I1AB 1OB1A 4O9HL 5DK3A 1AJ7L 3IGAA 4OT1H 3D2UB 5DURD 3DUSB 5IMLA 1XZ0A 1X5AA 1EA9C 1IAIH 3GIVA 1PZ5B 2WANA 1OCWH 4DWHA 3T0EB 1TZIB 3V5KB 3OL2A 4BSVB 1UM5H 4KTDH 4F8TA 1ZVYA 4YO0A 1MAMH 1CDYA 3Q5YA 3ALWA 4J7RA 2IPUK 4JR9L 1MCKA 5CSBA 1XGYH 1IE5A 4CMMA 4JVPA 3BXNB 1AE6L 1KG0B 4PBXA 4TPRH 2X40A 3VWJA 4UMGA 1WFOA 3GBNL 3MA7B 2FX7L 5TF0A 1IQDB 3PJSA 4K94C 1VEPA 5D1ZD 4F7EA 4DZBB 1AR1D 4TULL 4WHCA 4QRQA 1K5NB 2MNUA 3FB5B 4Z7WA 3TBTB 4G80A 3TWCH 5C71A 3FQTA 1IM9B 2G5BA 4FMFA 1AR1C 5DK0A 1GOFA 3MRDB 2V2XA 4KWUA 1QFHA 1M6OB 5E8EB 5DTFB 3QXWA 1ZOXA 4HGWA 4DFHA 4JHWL 2C3XA 3TN0A 4HH9B 4NKDA 4M62H 4ZFOL 1TQCC 1MUJA 3CVIH 4U0RB 3C87A 3H3KA 1A4JB 1V7MH 1UJTA 2V2TA 4LFHD 4KHXH 1MREH 4Y5VA 4ZPTB 1N8ZB 5C09E 3VW3L 3STZA 3PHQB 3CFIC 3O6KH 3HN3A 4LARH 3WFEL 2DB8A 5HHMB 4OCRL 4AEHL 3VD4A 1I9JL 3O6FA 4MXVF 4JFHE 4ZS6D 5E4EC 3S35L 3VGAC 1O5DT 1F3JB 1H0DB 4PYHA 5EIIB 5IJVA 3B9EA 3SBWA 4HT1H 3VH8B 1YEKH 4HEME 1I1FB 2VR5A 4K71B 5DXWA 3T2OA 1AI1L 1R3IH 2JIXA 5I0DA 4UV7L 4Z78A 3MLUL 3QDGE 4PV8B 2ORBL 5JHDA 3BZ4A 5F1NA 4RMTA 2E9JA 4RWHA 5AG9A 2DMKA 3QUKA 2Z91B 2X1WL 5I1GH 3MJ7A 1FFNB 4FXLA 4XP6H 3JSSA 3N9GL 1HHKA 2DYPA 2V7NB 4IEFB 5C7XL 1JGDA 4KK5D 1FPTL 1OGAA 5AD0B 4GMTL 3KYOB 1ES0A 3C6LD 1P7QA 4MQTB 2NY6D 4LRNH 2QSCH 3H9HB 3MUGA 2GSIB 1UM6L 3C6LC 2NY6C 1TIUA 4UILH 5CJ5A 2NX5B 3ORJA 4ELMB 2DQIH 5LCVL 1JPTL 1IAKA 2ICCA 5DJ0B 3TN0D 2BVPA 3I3EA 2OP4H 5DZOA 4O4YH 1URLA 5HHQB 2ZNXA 2XT1B 1JFQL 4NYLB 4JG0L 1E28A 1PG7X 3PDOB 4YDVB 3T8XB 5HGDB 5SV3A 5DJ8A 1FL6B 3LEYH 3FOLB 3MA9L 4P3CH 4UOJA 4OGZA 4TUKH 4ZFFB 4KUCF 4OZIB 4S1SL 1KJ2L 3RWGA 1ACYH 4HX1A 4LFHG 4NN6C 3RDTA 5J3HC 3QIUA 1P1ZA 2ZG3A 3EJZC 1ADQA 3F5WA 4LAQH 2A9MH 3LDBB 3GSQB 4G6AD 5CUSH 4OLZL 3LQZA 4K3EH 4MAUH 1OTUC 1F02I 1MY7A 2EDOA 2OI9C 5JHDD 3PIQB 1UACH 3EFFA 3WSQH 3WFHB 1PW3A 2EKSA 2A77H 4XVTL 4G6AC 4HWUA 2H26B 1J86A 2L4OA 5FA4A 2VDRL 2DLTA 4FQXC 3QFDA 3S5LA 2DLEA 3K8KA 2DYPD 2FIKB 1NC4D 3MRGB 4QTHB 3VXNB 3ROLA 4J3OC 1WEJH 3ZT6A 3CJJA 3CPLA 4XP4H 2VWEE 4X4YB 1A2YB 2OJEB 2J8OA 4WUUE 4GAJH 1P7QD 1YYMH 2EO1A 3QCUH 2Q8AL 4N9GA 5DEGA 1A3RL 1GZQA 3TYFA 4OCWL 4HXBL 4GAYA 4JRXB 1ADQH 2VDMH 1FAIL 4WW2B 1S9YB 1PKOA 3I3DA 2YZ8A 4BZ2H 1G84A 2LVEA 1Z9SA 3IXAB 2NYYC 1UA6L 3SHSA 3U46A 3LKSB 1AGCA 3UYRH 2PW1B 5L2KB 3QFJA 5ACLA 5I8CB 1AQKH 3QHZH 4P46B 1GIGL 2PO6A 4S1QL 5BRZE 1R3LA 1X5FA 2ZJSL 2CGRL 3QJFB 1UM4L 5E1AB 3E8UH 2Y36H 2FDBP 1KPVA 4HPYH 5T1MA 4PGBB 5EOQL 1TCRB 3T65A 2FBJH 1ZS8A 2VDKL 2I60H 3SDXE 1U3HB 4YPGB 3RDTD 5BCAA 2BVQA 4OD2A 4EDXA 2H32A 4JCMA 1A0QL 1BIHA 4P5TA 4JG1H 1DBJL 1ZEAH 1MPAL 3BIBX 1KSRA 1A6WH 4KHTH 4HIIB 5F96H 4PGZA 4JY5H 3ARYA 2VLRA 3I50H 2HG5A 4ZAKC 4NZRH 5DA4A 1GOHA 3QUZB 2P8LB 3MV9A 2Z9TA 4OZHA 5CP7B 5C0CA 4S2SA 4QKXB 4PB0H 5A16B 3IDXL 1CT8B 2IANE 3FCTB 4RQQB 5LVEA 4Q6IA 3BYYA 2MQ0A 3NCJL 32C2A 4NO2B 1CXEA 4TSBH 4WWKA 3VRJA 1F4XH 1EIBA 2H32H 2QKIA 2VDPL 1ZVHA 5HVFB 3BPOC 5GXBB 3WJLA 4QT5B 1UQSB 4PJDE 4QXUH 4IMKA 1FORL 2VH5H 1RUML 3TBVA 3LHPL 2V6HA 3RY6A 2E5EA 2G60H 1KB9K 2DD8H 3QFJD 4KJYA 1NDMA 4M1DL 4EUPB 5FYJU 2VLKE 3ZTNL 1UJ3B 2AXFB 3RAJL 3ZYJA 3HLAB 5DJAB 3O9WD 3RWHB 3QA3B 5K93A 2YD1A 2CK0L 4ZSOB 4WEBH 3KPSD 1JZ3A 4NO3B 1MJUH 3O9WC 3WDIA 3FRUA 4JDTL 2AEQL 1F11A 2I27N 1MFBH 1NCCL 2VLJB 1MFEL 2K1MA 3IDGB 4H0HB 4TUJA 3MMEA 1CFSB 1NCAL 2NY4C 5J89A 4HG4J 4P5TD 4HUUB 2EXYC 3G6AA 2HN7B 4CL7A 5EC1B 3TO2A 2X4TA 4JQIH 2BK8A 3X3GH 2GTWB 1K6QL 1S7VB 4UUJA 3W39A 3MREB 4R4FH 2VLRD 2DM3A 1W8OA 3UPCA 3U36B 1PD6A 3SDCC 3MV9D 4MLIA 3CU1A 4YQXL 1FLTX 1N7MH 3MRKB 5DJCB 3VFVA 4YNYA 4YR6A 4GW5A 2EEAA 4TNWK 2X1QA 1P4IH 3OV6A 4M5YH 1F6AB 5HHOA 4XC1L 4YWGH 3LZFH 1RIUH 2GCYB 3EOBA 1IQWL 5J06A 4ODTL 1CK0H 3S5LG 1SEQL 1MCSA 2D7TL 4PJBA 1H3TA 2YXFA 5DJ2A 1TJGL 3QNYB 1OAYL 4W68A 5CSZB 4QRRB 4O02H 2IJ0C 3UTTB 1LDPL 1A9EA 3SPVB 4JE4B 5GGRB 5D7JB 3VFOA 4OUUB 1PKQB 2DLFH 3GMQB 3K2UL 3ABZA 2AVGA 4K3DH 5DURB 3I2CH 4LCUA 1FE8L 2RFXB 5L88L 1A9BA 2FATL 2XPGB 3ARVA 3B2UD 5KN5B 3CH1A 4QY8A 1J1PL 1FHGA 3RIAF 4M5ZH 1SJHA 4WNQA 2D31B 3LEXB 1WLHA 3GUTA 4JFZH 1M05A 2R8SL 3VFWA 5TE7L 2N7BA 2KZWA 1KLGA 3RHWF 3NIDF 1S7XB 5TQ2H 4HQQH 1CDHA 1EAJA 1T83C 4P5MA 1W2KT 5KSAA 5JR1H 5ERWB 4G8FA 3QQ9D 5C0JB 2GJ6A 1OP5K 4E41A 1XR9A 4OI7A 4D0DB 3MJ8B 1QFUH 1FYTA 1S7SB 4LGSB 4CRPA 5I75C 1JRHH 5EBWA 3HR5A 5D1ZB 2XZAL 2WUCH 3P0YL 5TQ0H 1RD6A 1IBGL 1KPUA 3EO1A 3C8HA 5HHOD 4JO1H 1NGXB 3ZHKA 3OAUL 3MOQA 4RDQF 1LK3H 4MX7A 1F4YH 4UT7L 5DRWA 4X9FA 1PY4A 4YHIA 1ZA3B 4ODHH 1BPVA 4PLJD 3GHEL 1IGTA 4N68A 4LHQB 1BWWA 3WFCL 3A6CL 4WENB 1BWMA 3RKDD 3RVTD 5CEXB 1NGZB 1FIEA 3AMKA 4ONGH 5C0FA 2JB5L 3RKDC 1EHLH 3RVTC 3V7AE 4CU7A 1N4XH 4IIQA 5HD8D 1RJCA 4PJEE 4Y4FC 3GSRB 4QOKA 5IMLB 4JN1H 1XZ0B 3CMOH 1ZHKA 1A1MB 1BHGA 5E4EB 1EZVY 3SGEH 3V6BR 1LP9F 4CNIB 5HD8C 3GIVB 4LVEA 4FQLL 1DBML 3QRGL 4FFWD 5FKPA 2X4PA 1SBBA 4YHPA 5DUMH 4KTEH 5EG6C 3T1FB 4P2YA 5IBTH 3QO1B 4YXLH 5ITFA 1SBSL 1I7TB 1IEAA 1OSPH 5LQBH 3B3IB 5MP6H 3BKMH 5SX4I 3ZDZE 4J3WA 5DC4B 3QQ3B 4JQVA 1LO5A 4E41D 3D3VB 2F54E 1FYTD 4NWTL 1ZHNA 2AABL 1CXFA 5D4QA 3O6ML 1IGFH 5I76B 3TVMA 3MFFB 4J12A 3PJSB 2A83A 5A2KH 4DGYL 3C6LB 4JZJA 4XVSL 4LLUA 2NY6B 2PTVA 5DVNA 5EPMA 4FQJL 5IHBA 4G80B 3BPNB 3FQTB 3K1KC 1RUAL 2ICES 4MVBD 4OGXH 5DR5L 3PWLB 4Z7UF 3RL1B 2JJSA 2AQ2A 4BYHA 1DCLA 2KPNA 1A6UL 3GFUA 3X13A 5C0DB 3DLQR 3F7VB 4R3SB 3ULVE 5FHAL 2FLRT 4PLNC 1RVFH 1ULVA 1NJ9A 1B9ZA 1DVFD 1W0VB 5CKAA 3WIFA 1MUJB 3IKCA 1RIVH 2BNUB 1P53A 4JKWA 3NIGE 4I5BB 4YHZL 1HH9A 5FYJL 3MNVA 4H5SA 1G9NH 2V2TB 5CEYA 5GRWA 1DVFC 5FYLH 3GMOA 2ZUSA 4Y5VB 4H88L 3PGFH 4UV4H 5IG7A 2QQNL 1EH9A 4JQXC 1V3JA 1F58H 4XNUH 4X6BA 3SO5A 5DDHB 2CKNA 3VD9A 3QIWA 4HXAL 4LLMA 3RPIB 4JGJA 5I71B 4LU5L 4GFTB 1N3NB 2P5WE 5HDOA 2ZUYA 3U2SB 3FMGL 5IJVB 1T2QL 5DHXB 1MJ8L 3O4OC 5IGXH 3S37H 1DQDL 2A73A 4JPKH 3CDYA 3SJVA 2DQJL 3VGFA 1SHMA 3OKOB 4JFFA 5JW3H 2VQTA 5I19L 4WU7B 3PV6B 1W0WA 1RU9L 3MJ7B 5IP4A 1I8LA 3G5YB 1OVZA 2IFGA 2R29H 5FA3A 1LO4L 2DYPB 1TZGL 1NC4B 3LIZH 4LVNC 1RZJL 1YEJL 4N0UE 5FYLD 4LCCA 5C1MB 2GHWB 4I4WA 3MUGB 3ULUE 3D85B 4U7SA 3TZVC 1OAKL 4FFVC 5EO0A 1BOYA 4O5LL 2R69H 2GT9A 4HS3A 3V0VB 4PRPA 1OF2B 4AL8H 2BVUA 4PG2A 4HWZB 1IAKB 5KSVA 2Q7NA 2PETA 3O3BA 2BVPB 2YD5A 5CZVL 2VYRE 2XWBB 4MMXC 3CLFH 1FSKB 3GK8H 1YC7A 5I30H 4JHAL 3VXRD 4GJTB 3RVXD 4KPHL 1NUNB 1IEBA 1E28B 5EUOE 1YQVL 4G3YH 5D71L 3T0AA 4YDJA 1RURH 5JQ6L 1OAXH 1MELA 2AJVH 5JPMA 4EI5A 2HT4D 1ZT4A 2EH8L 4KAQH 4OF0A 2C1PA 1CQYA 4FQHB 3UC0H 5IFHL 3RWGB 3RA7H 2HT4C 4DKEL 5L7XL 2DLHA 4Z7OF 5FOBA 2QBWA 4TSAL 3UXFA 5DJZB 3S4SB 3E3QE 2CRIA 3D6GA 1P4LA 2NY1C 1QR1B 4MMZC 3ZDXF 4RBPH 3MXVL 3QI9C 1R6VA 1ERNA 2IGFH 5C6TH 1L9MA 5FEBA 3BD5A 5C8JA 3JWDL 5FA4B 2E9IA 3PWPE 5DRXA 3QFDB 3S5LB 3VWKD 3R1GL 3W0WA 43C9B 4P99A 1H8NA 5TE4H 4DTGL 2PTTA 3WNMA 2DL9A 3VWKC 1JZ6A 3EOTH 4OLWL 3HE7A 4NRYA 1LO0L 5F7NC 2Q3ZA 5DZNA 3WHXA 4N9GB 3MLRH 5L6YL 4LCWA 5DMGD 4GAYB 3KPQB 1MCWM 2WUBH 2OMBA 3GSVA 4PRHE 4L9DA 4KQ4L 4LHUA 5DMGC 1F5WA 5JZ7C 4QXGH 4JFYB 5ICXA 2HTLC 1HYRC 1X5YA 3EYOA 3U46B 3QXVA 2EC8A 3U4BL 3QFJB 3LS5H 4NWUL 3H9ZA 3I02A 3SE8L 2FHCA 4NBXB 2CXGA 4XHJD 5JPNB 5INDB 2DF3A 1DDHA 1PAMA 2BFVH 5EBLA 5FYKU 3O9WB 1I8MA 1UWEL 4M8QB 5D70L 3ARZA 4X4XA 4XHJC 2B4CL 1KPVB 1E4JA 3KPSB 4NKMA 4Q0XH 2PYFA 4EI5D 1MI5A 2GIYA 4HIJA 3WLWC 4PRIA 3IDNB 5T33H 2Z93B 1XF5A 4MNQA 4ZXBC 3QHTC 4XCCH 3MLZL 1U93B 4NZTL 4ODXB 2H32B 4P5TB 3MOBH 1NH6A 3F7RA 4PJ5E 5ALCH 4KMTH 1KCRL 1WZLA 3ROOA 3DVGA 1FNSL 4M93B 1RPQA 1IC1A 3V6OC 1CGVA 4MXVE 4PJAE 2C26A 1MWAH 3ZKMD 1FZMA 4EVNA 2HVJA 4M7KH 3MV01 1UH4A 3MV9B 4L4TD 2H6PB 1EVUA 4AG4H 1VFOA 2ENYA 4S2SB 3W0WD 2ED8A 3MJ9L 4Q6IB 2F5BL 3QUYA 3B8YA 4XPGH 4QHUB 3ME0A 2X10A 3HE7D 3OGCA 4M43L 2VZ3A 4LRIC 4JREC 4LCWD 3I6KB 3RPKA 3HC4L 4WEUD 2VUOA 2HRPL 2HJLB 2Y07H 3QWRA 3Q1SL 2A9NH 3EFDL 1J1OH 3TBVB 5ADPH 3GJEA 1DQJA 4OZ4B 4HMEA 4P2OA 4UU9B 1VADA 1KOAA 4L3EB 1P2CA 2Z8SA 3LV3A 5BS0A 3LN4B 4YBLC 5D1QC 4JFEB 5LG1A 4KJYB 1UG9A 4LMQI 5B8CA 1LD9A 4UBDC 3HI1A 1LNUA 1T1XA 2H2SD 3UX9B 3DYMA 2VITB 4U1GC 5AYUH 3U30C 5GGTL 4U4BA 3B9KA 1U58B 1MH5A 1JHLH 4FQ2H 5F88B 5CCKL 1C5BL 1MI5D 3D0VA 2JF1A 3UYPA 5IEHA 3LRGA 4PRID 2E6QA 3JXAA 1XGRB 4MNQD 1QO3B 3R06A 3KPMA 4KZEL 4DGVL 1II4E 4KC3B 4KRMB 3UPRB 2VDNL 3G6AB 1CE6A 3DX6B 2H9GA 5E2VH 3V9FA 4Z7NE 4XNMA 5EC2A 1NUFA 2X4TB 3W39B 2Y5TA 1VGKB 4ZUWA 5I75B 3F7PC 4UIKL 4GBXA 4UINH 2Z92B 1KCKA 5HVGB 1EBAA 4YUEL 5TPWL 3K1DA 1CL7I 5IW1B 1M71A 1A6TA 2IG2L 2ZOLB 3LQMA 1QLFB 4M6NL 5LGJB 2VLME 4K7PX 1DN2A 1ZAGA 3UTZA 3BVNA 1UB5B 3O3DA 3SCMD 1I7UA 3HC3L 4L9LC 4JAMB 3QUYD 2Y23A 3GSUA 5GS3A 1I3UA 1N64H 1CDUA 5KBNC 3VXOA 3L3KB 3O3UN 2HJFB 3O2VH 4BUHA 1WIOA 3SCMC 6FABH 3GMRA 2YSSA 5FUZH 3CFJB 4P5KB 4L4VE 4Y4HD 5EZJA 2EZ0D 2X4SB 1P84J 1S5HA 3E6FB 4P2OD 3ARQA 5BS0D 4Y4HC 2EZ0C 3L5JA 4L8DB 2YN5A 5F93C 2FZ3A 4MJ4A 3JWNC 3VFOB 3FO1A 2BHZA 5IWLC 5KS9A 2APVA 1FG9C 3PHOA 1QKZL 4YBQD 4D94A 1IC4H 5HYSA 2NR6D 4Z0XA 3B9KD 3L7FA 3GJFH 1LO2L 4LCUB 4WHTB 1BGXL 2OTUA 5C08E 2FBOJ 2D7PA 4KKCD 4NM4L 4YBQC 1Q1JL 3O41B 3OB0H 1EEZB 1HI6B 2NR6C 3CH1B 1MOEA 3L3GB 4V2BA 3C09C 2CRMA 5I0ZA 2IH3A 1SJHB 3GBMH 4NQCA 1PLGH 3MX0A 5FHBH 3EYSL 5C0EA 5IFAH 4BQBA 4XCFL 1EO8H 2V7HA 4XXDA 1KLGB 1P6AB 1S5IH 2J5LB 3MLVH 4NKOA 4ZUVA 3C8DA 3IU4H 5DSCA 4P5MB 3IDJA 1MFDH 4HKJA 5ADOH 4DZ8B 1GOGA 4A2MA 3SE9H 2XNAA 1QA9A 2R0WH 4G8FB 4TOYL 2I5YL 4GBXD 1JGVH 4E41B 2VDLH 1IGCH 1P4BH 3WO3B 4EBQH 1FYTB 4EN3D 4LBEA 2IBBA 1ZLWH 4Z7QE 5EBWB 2IC2A 5KJRH 2OR7A 4KQ3L 3WJJC 5CWSA 4EN3C 1KPUB 3EO1B 5SWSB 5E94B 1A6VH 5DQDH 1SEBB 1IAII 2CKBA 3MBEA 4MX7B 4HKBB 5DRWB 4OGYH 1U8NB 2MKLC 5I17B 1XR8A 1BJ1J 2EC9T 4HKZA 1GGBL 3HMWH 2PXYA 4Y89A 3VA2C 3MGOA 1G7IB 1HYSC 4G5ZH 4MAYD 4OLYL 1DVFB 3OSKA 3T77A 4KZDH 5I1JL 2YMXH 5C0FB 3BKYH 3RIAK 3NCBB 4ODVL 3UJJH 4I48A 2FIRT 4MAYC 4NC0B 5J6HB 2UWEF 1N5YL 5E2UL 4KRPD 3PABB 5FYKL 5BV7L 3RHWK 1RUQH 5A2FA 1QFWL 2EYSB 1T4KB 4UQ2A 1NL0H 2YPVH 1DLFL 1U8LA 5FKPB 1IM3A 4NQCD 4NNYB 5JW5B 4KROD 4F33B 5BQ7B 4YHPB 1GC1L 3OGOE 3DO7B 5FAAA 5TE6L 3QH3B 1BZ9A 3KJ6H 4KROC 3CVHH 2APBA 1OW0A 1OWWA 3BRFA 8FABB 5I2IB 4ERSH 1RJZA 3RIFF 4HWBA 4P2QA 2ED7A 4O51B 1OQOA 3ZT5A 1YDPA 4K7PL 1CLYH 3CFCL 3PP3K 4UTBH 3KLHD 4AIXA 5J13C 1NMAL 2BX5A 4Q9RH 4X6DB 4JY6B 4OFYA 4EJ1C 3P30L 3UBXA 2DIAA 3T3PF 2M2DA 4JZJB 2I9TA 2ICEA 3MBED 3T0WA 4WTXA 3BZFA 2MPAL 3GRWA 5AWNH 2BMKA 5M95B 3AS1A 2MKWA 1RZFH 4NC1E 5MHSE 2PXYD 5EA0H 5EORH 1VACB 4X4MA 2CKBL 5IV2A 1NJ9B 4HK3N 4ELMF 4LSSL 1AGDB 7FABL 5IEKA 4LHJB 3R0MA 4LVOC 3AFLA 3VXRB 5KSUA 4HUWA 2FGWH 5DT1H 3MNVB 2CD0A 3S6CA 5LXGH 5CEYB 3GMOB 4R4ND 2MCPH 3GZKA 1AFVH 1BQHA 4YDIL 5IW3A 1QPXA 4HSQA 1F4HA 4NQEB 4K94L 1KIRA 3GRWH 3QG6A 3TIEA 4J4PC 2FSEB 3DHJA 2FJGA 4P4RB 4RFOH 1D5ZA 1QFPA 3H9SD 4OZIF 1DQTA 1C7SA 1R5WA 2A73B 1U92B 4DUXA 4H26B 2EDLA 1ORSA 1KULA 4HK3J 1MNUL 1RZIB 3TJHC 3V0AC 1A47A 4JPWH 3V7MA 1AGBA 3C08L 4OFIA 1UM5L 1DSFL 2V9QA 1FZOA 3HC0B 3INUH 1AXSB 2EO9A 1CXKA 2CSPA 3BD4A 3VWKB 1A64A 1RHHA 3SQOH 4XVJH 3KHOA 1BEYH 4OFYD 1TETH 2J8UF 1U42A 1T5XB 3IRPX 4HWBL 3NPSC 3WFDL 5I1KH 1XGYL 4YHKL 4I4WB 5FO8A 3DURB 1PDKA 4J23A 5F71A 2GT9B 4ZUTB 1QRKA 2CDFA 4HC1L 5T5NG 1O7SA 4CN6A 1SY6A 4WW2F 3PDGA 1JVKA 3FAWA 2VSCA 4LCIH 4MNGA 1Q94B 3RWEA 3VXSD 5KSVB 3RX7A 3TWCL 3ARTA 2QSTA 5KVEH 3LMJL 2D0HA 5DMIH 5KVMC 3U1SH 1U36A 2BHYA 4QRPE 1T1WA 4TYUA 5JW4Q 3OR7A 3FZUD 1CD9B 4HAFA 2YK1L 4EI5B 4AENA 3TBWA 2C1PB 2OBGA 3IFOA 5HPMB 3ULVC 4BZYA 2AQ3A 1IKNC 3FZUC 1UADC 3Q5TA 2CR6A 4OJFL 4ONFH 4KHXL 4O58L 3OAYH 1P6FA 3VFPB 5FOBB 2CR3A 4U6HA 5DRZA 1BD2E 1SQ2N 2WIMA 3WS3A 3SGKA 4LARL 3TP4A 1JPSL 2VABA 2F8VA 4AK1A 1QNZH 4HKXA 2XTJD 5EU5A 3IF1A 5HI5D 1Q0XH 4ZNCD 3PGCA 3NBNA 3MYZA 2QEJA 1D5BB 4Y5XA 2PCPA 1G7HB 5HI5C 5CZXC 1CTOA 5C8JB 4ZNEA 2Q86A 3F7YA 4L4TB 5DRXB 1P84K 4OF7A 3IT8D 3ETBF 5F9JB 1XH3B 3W0WB 3O2WH 2BNQD 4JREB 2EDJA 1AXTL 1CXIA 3C5JA 1LO3H 3KR3L 1RK1B 2XIDA 4U1IA 1NFIB 3HE7B 3GSOB 4PRAA 2CDEA 5I1GL 4K55A 5IUSA 4LCWB 3N06B 1ZLSH 2CH8A 1I3VA 1WZ1H 4G6KH 5EDXA 5HGAB 1WC7A 3GSVB 4YBLB 3DI2B 3SOBH 4UZGA 3QDMA 2BSRA 5D9SA 1ODAA 1A7PL 5BZDA 1F90L 3UDWC 5TH2B 4M7ZC 3UBXG 2QADD 4NKIL 3T0VA 2XA8H 2X42A 2QSCL 4L8SA 3OAZH 4FMKA 4U1GB 3G6DH 3T0BA 3DVFA 3BN3B 3P9MB 4V1DE 1NQBA 1KN2L 3NTCH 5FGCB 5LGHL 3SDDD 2W0KA 5EOTA 1MWAB 4JFDE 5EBLB 1I8MB 2NNAB 2DQIL 3BO8A 2DRUA 5T3ZE 1UYWH 3O45A 5T5FH 3SDDC 4NKMB 4XB8A 5IROA 2PYFB 3O2DA 2XY2A 4RISH 1BJMA 3WYRA 3JV6A 1ZHBA 2VXTH 4MXWH 4O4YL 4MNQB 1T1YA 1LMKA 2EYTA 3BEVB 1EPFA 3AS3A 5HGHA 4NGHL 1BQHG 3RY5A 1CXHA 4D9QD 3QPXL 2P7TA 1X5LA 3DVGB 1JK8B 5IFJB 3BW9B 4LSPL 3P9LA 1MIMH 1DL7H 4G7VH 3RP1A 3W2DH 2V17L 1P5VA 1ZLUH 3MV8E 4TTGA 2VTFA 4EVNB 1KBGL 2AEWA 3DTXB 1YNKH 4L9LB 1FVEB 3O2DH 4HUVB 2F53E 5AAMA 2A9ML 4OKVA 5C9KA 4K3EL 3E3QC 2OSLA 1RUKH 2B2XL 3SCMB 3D87B 2KQNA 3QUYB 1MHPH 2IF7A 3NZHL 4KJQD 4JO2H 4MHHI 3OGCB 3MZGB 2YPLA 1VGEL 2WM0A 4N8VA 3ET9F 4Y4HB 1FDLL 2VLLB 3QDMD 1DQJB 1YEIH 1WAAA 3G6JA 1VADB 3ECBA 3NAAH 3DXAB 2ATPA 5BS0B 1R5VB 2QJDA 4FQCH 5I8EA 1KCUH 4Y0GA 4B7LA 4C56A 1JPGA 1IFHL 1KTLA 2C4FU 3HI1B 1FVCB 1TJIL 4Z0BL 4K3HA 2V2WB 4YFLI 4QRUB 3BP5A 3B9KB 1MH5B 3CCHA 3I75A 3CK0H 3C09B 4NBZB 5JA9A 3KPNA 1RZ7H 5GJSH 5EWIH 5ISZE 1GYAA 4OQ1A 4KFZC 3TJEH 3LKRB 1MHEB 4P23A 3TBYA 1YJDC 1I7RB 3M8OL 2FJHA 5C0BD 4RGOH 2EDBA 4P4KC 1RZKH 1WWAX 4GKZA 1D6EA 4OD1H 1X6NA 2H9GB 1MCWW 3P73B 2I60L 4ODWA 2Y5TB 4ZUWB 4MJ5A 4CADB 2X9YA 4RAUA 4GBXB 1QPPA 2EIBA 1RUPL 4WFGD 5D7SL 1A5FH 1MRFH 4JM2A 4EN3B 1T2JA 1GXEA 1JMXA 4EOWL 3UTZB 1C08A 4UB0L 3BVNB 1MIEL 3ZDXE 2C5DC 3MGTA 3GJFB 4PJ7F 3W9EA 3UTPD 1RV6X 1TPXC 2QR0A 4YGVB 1JI1A 1YEEH 3MNZB 4GQ9H 1GGCH 1R3JA 2YPLD 3MROA 4U1NA 2VOTA 3HS0A 3O8XA 4XNZC 3L3HB 1N2RA 4TSCH 5FUOL 1FC1A 3DIFB 3TV3L 1MRCL 4MAYB 3PL6A 4C56D 4XCNA 1S3KL 4GW4B 3H0TA 5HI4D 3QEUA 4PTUA 3PHOB 5ICYA 2VH5L 5H2BA 3UYOD 5HY9A 3WLBA 2N56A 4KRPB 1RFDL 4Z0XB 4WVRA 5JUEH 5FXCH 5HI4C 2OTUB 2P42B 4PP1C 4X80H 1VFAA 1MHHA 2XN9A 2EDKA 1H3GA 5EZIH 3BKCH 1QBLH 1Q9WB 3HZKA 5JIIA 1T7ZA 4JHZA 2A74A 5E6ID 3WKML 5ILTH 2DMBA 3PQYE 4NQCB 4Y7MA 5J7CC 4KROB 1ZKAA 1NCWL 4HUNB 4RMQA 5E9DA 4AEIL 4P59L 5GS0H 3MV7D 4CAGA 5I74C 5E6IC 3HCVA 4LPXA 2V7HB 3GIZH 2DQFB 2FR4B 5TF1H 5CKGA 4QTIH 5IK3A 1S9WA 2OX5A 1X5XA 4ZUVB 5EU6E 5DSCB 1GRWA 3IDJB 4HKJB 2DQHH 2X4OA 1H8SA 2G75A 5J13B 1BAFH 4L29A 1QA9B 2JLLA 3RUGB 3L5XH 2HKHL 3TCXA 4MQ7A 1KPRB 2V5RA 3ARPA 3HI5L 1F2QA 3LN5A 4JM2D 4LBEB 4K9EH 1G7QA 2XOTA 4MA8L 4WFFE 1CR9L 2SEBA 2JKXA 5IVXF 2HWZL 4IOIA 1JNHA 3SGEI 3L3JB 4IRJD 5DVMA 3MBEB 4J3XA 1IAIM 4QLRA 3HRPA 3QEQE 1K3ZA 2AK1H 3ARFA 4R90H 4D9RD 3IETA 4IRJC 3RVUD 3RWIA 1ZT7A 2QQQA 1XR8B 2FWOA 2A0LD 4ISVA 4R7NB 2YRZA 1P4IL 4MB4A 3BQUC 5GS0D 4JB9L 4DKAA 4PJ8A 5IVZB 3PL6D 5I1AA 3CUPA 2EECA 4PJCA 2A0LC 4DCQB 3T77B 1XF3A 5C6PB 1FG2A 1RZ8B 3J8F7 5HYJE 1CK0L 4U6XA 4N8VG 4LSVL 5KOMC 3CVHB 3UPAA 4OSUL 2B1HH 3HFML 1CG9B 3QIBA 2AJ3A 2DQUL 3P0VL 5DJ6A 1GH7A 3VXUE 1UFUA 2JELL 3WXVL 1UZ8A 1FFRA 2XN9D 1R0AH 4UQ2B 4WV1C 5C9JA 2UUDH 4OM0H 3WO4C 1L7TL 3CDGB 1LEKA 4ZYKA 3W5MA 4Q9QH 1WCBB 4JKPL 5E9DD 4BSJA 4AM0B 3H9SB 5LBSL 1BQUA 1H15B 1OAZH 1YQ2A 4ZQKA 1FBIH 1HHJA 2Q76A 2KUTA 3MRFB 2FECI 1PX4A 1UC6A 1KTDB 5GIRA 5ANME 1IC5L 2AK4A 1KLUB 2W59A 2JJVA 4RFEB 3S3SA 2ZCHL 2D7QA 3K8LA 4OFDA 5F1OB 1J8HE 4S0TD 1A7RH 1QLRB 5F7HA 2OYPA 5DQ9A 1JHKH 2LU3A 1GL4B 5IM7A 4BM7A 3UBXB 1ONQB 4Y8DC 1L7IH 2ICEB 5DUBB 1QLEH 4P0DA 3OKKB 5GS1A 1FJ1B 1J7VR 2ZKHL 3MR9A 4LLAA 3BZFB 2FEDD 4RGMC 1Q9LB 4K7PY 3O4LE 3ARFD 4IMLB 4HPOL 2X4RA 1LE9A 1E27A 3BH8B 2JJTC 1QSEE 2WUCL 3PUCA 2L7JA 4XAKD 5C0AE 3VXSB 1AD0A 5IV2B 2BRRH 1C16A 5CEZL 3DYPA 4ODHL 5ESQB 1T03H 3EYQD 2UZYB 3SDYL 4MXQC 3C2AH 3SY0B 2MWCA 1BQHB 2F19L 3KXFD 4R0LA 4DAGH 1FRGL 3V6ZA 4PGEA 3MOAL 1EHNA 4ZPVA 3IJYB 3TIEB 3CFEA 3SKNB 3RZCA 3RIFK 1V8HA 3O3AA 3ILPB 4X83A 1Q9KA 3DWTA 4HF5L 4RWYL 1M4KA 2R56L 3PNWA 5D6DC 3FKUS 1KB5A 4CDHA 4YDKL 2R1XA 2XTJB 1DBKL 5F3BB 1ORSB 3TT3H 4I3GA 4M6OH 4J8RA 4W4NA 4EKXA 4JZOB 2R0ZL 2AK4D 3D25A 2J2ZA 4FP8H 2QQKH 4TVPH 1VPOL 3T0EE 3KNBA 1FH5H 3P4OB 1NFDF 4YXLL 3S97C 3HG1D 5TGBA 2WQ8A 4W6WB 3SDAA 2BNQB 2LAGB 1BQLL 2C3HA 3EYUL 2VUYA 5IHZA 2R39A 1NGQL 1KB5H 3X14A 5A2IH 2Q3AA 4M7ZB 4Z7VB 4AT6B 4BH8A 4GQPH 5H8DA 2CDFB 3MBXH 5CINH 3S36H 2QADB 5TDPB 1KELH 1F8TH 3NZ8A 4PBWD 5DJYA 3FOMA 2YRPA 4NRXB 1E4KC 2FX8H 4RMUA 3QDGA 5ESAA 2BY0A 5B3JF 3R4DA 1FCCA 3OF6A 2F15A 3SDDB 1QP1A 3OR7B 1YC8A 4TVPD 4KUZL 2GAZA 1G0YR 3SE4C 5JW4R 4H1LH 2CLVB 2EDRA 1Q8MA 2VRAA 3P3YA 4G6JL 2QQLL 2NTSP 5F7DA 3IS0X 2FEEI 1Q0YL 4GMSH 4OM1H 1H3VA 4MJID 1BFOB 3BWAA 2AJSL 3D18A 2KQMA 3LSOA 3WS3B 3UTOA 1J1XL 2VABB 4HKXB 5EU5B 1A3LH 4U6VL 1HH6B 4XH2B 2EYRB 3MLSL 3QJHB 3GB7B 5HHME 3VGBA 4J1UA 2AXGA 4Y5XB 2PCPB 5CLWA 1INDH 1INEH 4K2UH 5EUKA 5IGXL 4HBCL 1WBYA 4X7TB 4JANB 4NCDA 2FYYB 3LRHA 1CYGA 2XZZA 3NFPA 4DJMA 3VI4F 2VXVL 3CMGA 4MQSB 1QYGL 1A6PA 2HLAB 12E8H 4UDUB 2JB6A 2NMSA 4W6YB 4FTVD 4OLUH 4R97C 3GSWA 4U1KA 2VDOH 4NM8H 2FL5B 2Q8BH 5J56B 5HSFA 2B5IC 4HV8B 1BX2A 1G7PA 5D9SB 4JGUA 3VG9C 2VN4A 1NMBL 4YAQA 3VE0A 3OWEA 1B2WH 3WN5A 4GKSB 4MZ2A 4X6EA 3T3PE 4Y4KD 5GJTH 2APWA 1AQDB 5DI8A 4LSTL 3KYKL 1TFHA 4PP2A 3DARA 1VA9A 3QDGD 3U7YH 3F58H 3OF6D 4PD4J 4Y4KC 4E42B 5EOTB 5D7LA 4OIIL 3FB7A 1QEWB 3IFPB 5EZLB 1T0NA 3BO8B 4JM4H 1G7MB 4X6FA 5TDNA 1DQQA 3O45B 5I66A 5E08H 2NX5E 3PE9A 4J2XA 3CSBA 4ELME 2XA3A 4FQQA 4P4KB 1T1YB 1VFMA 5I1EH 1MF2L 2VB5A 5C0BB 1M7DA 4WUUA 2KL6A 2AAVA 2VC2L 1Y18A 1OAXL 3V4UL 1HQ4B 2UYLB 4KAQL 2B1AL 3NMEA 5EO1A 3BGAA 4FNLL 3LEVL 4M4RA 5F1IA