1Z2KA

Nmr structure of the d1 domain of the natural killer cell receptor, 2b4
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
108
structure length
108
Chain Sequence
CPDSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Natural killer cell receptor 2B4
publication title NMR Structure of the Natural Killer Cell Receptor 2B4: Implications for Ligand Recognition
pubmed doi rcsb
source organism Mus musculus
total genus 12
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11465 Receptor_2B4 Natural killer cell receptor 2B4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z2kA00
2EE6A 3V5DA 3ULVE 3I85A 2IC2A 4Z7WE 1R5WA 4FQ2H 5D7JD 3GIVA 4LLVA 3O4LD 5E24E 2NXZB 3CVIH 1IAOB 4G6KH 5DJYA 5EBWA 4G3YH 5EPMA 2F19L 4TULL 1YEIL 3OKNA 1ZTXH 5FHBH 1UQSA 2A74A 4ZUWA 4XRCA 1J8KA 2QQNH 4ORGA 2A9ML 4I0PB 4JQVA 4HZLA 1EV2E 4AEIL 2VLKD 3CH8A 1U6AH 3PV6B 1QACA 4EI5D 3EOYG 2CLVB 5JNYB 4PGCB 1LEKA 1I9RL 1ZS8B 3UPCA 2VLRB 4MD0B 3HNVL 1TQCC 3ZDYF 5T1MA 1U8PB 4I9WE 3JWOC 4FA8A 4XNQB 5GIRB 4JKKA 4UILL 1N26A 4TSCL 3WD5L 4X4YB 4YK4C 1H3PH 3C8KB 3QULB 5TQ0H 4NWTL 2EDQA 4XNZC 3D39D 4GRMB 4IRZL 3PJSA 2PUQT 3UJIH 4Z9KB 3RNKA 1MREH 3OJ2C 5FDWA 3MUGB 2APTA 5HY9A 4FFZL 3RWHA 4L4TD 1EJ6A 5HVGB 3MLSH 1I1AD 3RDTA 3LS4H 3T3MF 4OD3H 5JDSA 1ZHNB 3O45A 1NFIA 4KROB 5D5ME 4CBPA 1BREA 2QV2A 2BZDA 2Y5TB 5LVEA 2YBRB 3DXAE 1CICA 5T1KD 1RZJC 2R2EA 4KWUA 1KCSL 4DN3L 1ORSB 4WUUB 5FOBB 1U93B 3VGAB 1XZ0B 5D5MA 3ZDXE 1YNLH 2VDQL 3CCHA 3BP6A 3VG0H 4XBEL 3HZYB 3T77A 2B2XL 4U6XA 2DDQL 1BZ9A 5ISZD 4J3SA 1J18A 5HBBA 1IKFL 4EBQH 4K9EL 3U4BH 5CS7A 1XF4B 3QDAA 4PY7A 3PDGA 1JF5A 4RGMB 2FHFA 3LB6D 4C4KO 5L7XL 5EB9A 2EKSA 5IM7B 2EIZA 2AW2A 1IEBA 1PAMA 4NQDD 3OX8B 4XZUA 5C09D 2OTPA 1F90H 4YHLL 5EZJB 4XMLL 5FGBA 1SYVB 2X4NB 3UJTH 4LARL 4ZPTB 4ERSH 1GJIA 1JTPA 3H9SD 4R7NB 3R06B 3DVGB 4IM8A 1WAAF 2LAAA 4ZUSA 3V52H 4OGZA 3G9AB 3GI8L 4KFZC 2P5EB 1T5XB 2ZP0T 4N0CD 1H8SA 4NC1E 4HH9B 2YRLA 4R2GD 3THMH 1MIMH 1NGXA 1NLBL 3QEHA 4QGYA 5L8JB 3CFIC 2P24B 3QPQD 5EBLA 2XWBB 2HFTA 3OPZL 5GRYA 4S1DC 4KXZI 3CMOL 4GKZB 5AUMB 4ZFZB 2Q87A 2QHRH 4P59H 4KC3B 3QFDA 4MJID 2CSPA 2C3VA 5KOVC 3TCLB 1SM3H 1UEMA 1NC2D 3MCLL 4NWUH 5D1ZB 3X11B 3L3OA 1BJ1H 4HWBA 3T1WA 2VLJD 4OM0H 1S5HB 2BY2A 5CZXC 2EEAA 4DKDC 5E8NA 2XY1A 3A6CH 4PRPE 1D9KB 4R0LC 3SDDA 4L8DA 1HYSC 4L29A 4PUBH 4XPHL 4JHWH 1B9ZA 1EHXA 1KPUA 1PQZA 3SBWC 4PRPA 1SEQH 3UBXI 5T3ZL 5BQ7A 3D18A 5I74C 4L9LC 1CTOA 4OM1H 2CLZB 5KSAC 5EFIA 4MX7A 4N0YL 1L7TL 4QY8A 3T1FB 2FATH 3MR9A 4U1NB 2O5XL 2LU4A 5C07A 4WI6A 3MUZ1 3VGHA 4NJ9H 3GSNH 2XZQH 3INUH 5B4MC 4YNYA 2VXTH 1UWXH 4KDTC 3MRQA 4U7MA 2KPNA 3UZVB 3TO4C 4WI3A 5DC0A 3VFRB 4U6HB 2YA2A 2EO1A 2GFBA 2MNUA 3VXOB 2WWKT 3NACH 1RFDH 4X6EB 2E6JA 2HFEA 3T2NL 2Z91A 5JXED 4PJGE 3GBMH 4KKBD 3TN0C 4TUJA 4PRBA 5I1HH 1U8QA 2BMKA 4MXWL 4V1DB 4PG2C 1R3JA 1JCKA 1OAKH 1LO3L 2ZCHH 1NUNB 2F74B 4PJGA 1DTUA 2V5MA 2E27L 3LMJH 1C16B 4PYHA 1UFUA 4OCWH 5IMOB 4NZUL 4DGIH 2NYYD 1T1YA 5ENWA 5GJTH 1AQDA 1T04B 25C8H 4C55A 5H35A 2VQ1A 4GAYB 1BEYH 3ULVF 4NOBA 4Z7WF 5IFHH 1INDL 4XPTL 4HIIB 1RQ5A 1ZEAL 3QO1B 4KJPD 2CDGB 5MERA 1PY9A 1CD8A 1JPSL 3HI6L 1N4XL 5FYJU 5DURD 4OSUH 1WIUA 3UBXA 4JZOA 5DJ6B 5EZOH 1D5ZB 5CZKA 2C7UA 3GGWB 1W72B 4YHMH 1PD6A 5HHPB 4NIKB 3T4AA 4BH7A 1DQLH 3PUCA 4M1GL 1AHWC 1YMMB 3T0BA 4Z77A 5F6IB 5GHWL 4GFTB 4WWKA 4AYFA 3VXMA 2VC2L 2HG5B 2R0ZL 3WCYA 1CLYH 4I48B 4Y4HA 4TNWF 5KSUB 1HILA 1QPXA 3X3FH 3MRKA 3WIFB 4PV9B 1I1FA 1NGQL 2J1KA 4P2RA 1XF2A 5AZEH 1AJ7H 1K2DA 3DV6B 5SWSB 4KRMB 4KRLB 1P7QB 4CVWA 3O2DA 3G6DL 1JPFB 2V7HA 2NQCA 3BZFA 1OOAA 4YXKH 4J3OC 3WS6C 3IDMA 1GPOH 5D7SH 3VFVA 2BNUB 3F6IA 3QUYB 4LPUA 5F1IA 4UIKL 5JW5B 1JHLH 1LK3H 5IROC 4E42A 2A0LD 3PWPE 4P23D 4HWNA 3SE4A 1RIHH 1FIGL 1T4KB 2C26A 1YJDL 4WFGE 4NCC1 4PJIB 2XTJC 3TYFA 3ARFA 5J9PB 2XT1B 1PSKH 3PWPA 4WTWA 3L3IB 2VDOH 2X09A 4DGVH 1YEKH 2F53B 4PRNB 5F89B 4PLKD 3MLWH 3OKEB 4RGMC 3RPIA 3X14B 3KPRB 2CDFB 3OV6A 2VL5A 3P9WB 5DS8B 1GZQA 4L8SB 1FFPB 4LDOB 4ODXB 3OSKA 2A1WL 4DN4H 4KQ3H 4S1RL 5FYLD 4Q0XL 1YYLL 5EN2A 1LDSA 4OFIA 3HS0B 1NGYB 3QUMB 4W4NA 3CJJA 5EUOE 4GUPB 3MREB 3QDJE 1X5XA 2CLRB 1XH3A 2BVOB 4M3JA 4KKCD 1U2HA 1RUKH 1K85A 1EFQA 3DVFA 3TVMD 1I8IA 3O81A 5EUOA 4F8TA 4L8CA 1NGZA 2HJLB 2D31A 3QDJA 4CVXB 2HT4C 1TLKA 3QHZH 4L3EB 1F4YH 4BQBA 3VGGA 2C4FU 1HOCA 4YEFA 4N8CH 3RIFK 3C60D 5LGHL 2BNQB 3PWJA 1VDGA 1FYTB 3SDAB 2FX8H 1KTLA 2A73B 4UQ3A 1XR9B 3HPLA 4HCRA 3B9KD 3ZYZA 1FV1B 4K8RC 1VEOA 1EAPB 1UACH 1CD0A 1GYAA 4JY4B 3U0WH 3OF6A 5DJDB 3NGBC 5IV2B 5L0QB 4FQXD 3KPSE 2JK5B 2R29L 5GS3A 3CDGA 2KZWA 4JJHA 1X5GA 5JPMA 3KS0J 4DW2H 4PY8J 5F72S 4GW4B 3KYKL 5CJOL 4Z7UA 3BUYB 5FGCB 1N7MH 2NLJB 2AJZB 3KPSA 3N1FC 1XF5B 2IFFH 4XCEB 1QLRB 4D0BB 1D9KC 4D9LL 5TGBA 1I7TA 3NFPB 3ARZA 3GO1L 1KF9B 1RUMH 2NY5L 1AR1D 5I8OH 4OV6F 1K5NB 3S4SB 1MAKA 3D3VD 5B3JE 4M62L 4NKIL 4U1HB 4M93B 1I7ZB 4KV5E 4OCXL 4I18C 3L6FB 4KTEL 1WFUA 4LSRL 2FHBA 5CCKH 1FNEB 3MBXH 4CADA 1MQKL 5HYIA 2BX5A 1Z5LA 3GM8A 5HHMB 3ULUD 5TDPB 4I2XA 1ZXQA 2XZCH 4CGTA 2OK0H 3V5DB 5D2NE 4LLDA 1INEH 1NJ9A 1R5WB 3ARBD 3PDOA 1L9MA 4P3CL 3GIVB 1IT9H 4LLVB 2PKDA 5TF1L 3EYSH 4MXQC 4N1HB 1J8HE 5DJYB 5EBWB 3C5ZA 5EPMB 3G04A 3OB0K 3OKNB 1WICA 4ZUWB 1UQSB 2A74B 4KGJA 4XRCB 5D2NA 4ORGB 3RY6A 4NFDA 4NQCE 4HZLB 1KB5A 1D6VH 3M8OH 1JZ8A 2GSIA 3KVQA 3TBTA 1D7FA 2VOTA 3FFCD 5F7DA 3H3KA 1J8HA 3LEVL 4JPKL 3QEQB 1LEKB 1QTYT 4NQCA 1IAMA 3CU7A 5TQ2L 3IFLH 1UKSA 2JJVA 2ESVE 3QCTL 5T1MB 1V7ML 2VB5A 4CW1B 1N3NA 5ABDE 4Y16A 3VI3F 4FS0A 2VKWA 1Q9OA 1U8JA 2YMXH 3H0TA 3NBNA 2AV1A 2ESVA 1MCWW 3PJSB 5J4MA 1M6OA 1ETZA 4WHCA 4HJ0C 3RNKB 2WQRA 1EX0A 3IDIA 4XP1H 1Q72H 1F42A 2ENYA 5HY9B 1IAIL 3N9GL 4RAHA 4XBPA 3O3UN 3RWHB 4HS6B 3ULUH 3CAFA 4U7SA 3JV0A 4NOFA 2JJSA 3RDTB 3PV7A 3VWKC 3O45B 1NFIB 5J3HD 1BFVH 3QAZC 4OJFL 1P4BL 4YDLB 1CGXA 4O00A 2AJVL 2OXGA 3MRLA 1C5DA 1CICB 4U3XA 2R2EB 5CGYD 4LKXA 3RX8A 3IGAA 2X4UA 3DETD 1T2XA 3MRMA 1MRFL 5GS0H 5DD0H 5D5MB 5D7KD 1QRKA 1SBSL 1ZV5A 3CCHB 3BP6B 4YPGA 1A3QA 3T77B 3MO1A 4U6XB 4EIGB 1TCRA 5IVOA 1ITCA 1JHKL 1X4XA 1MCNA 5E1HB 4PY7B 5E70A 5I6XB 3RWCA 4UNTA 5C2UB 1UADC 4JN2A 2DLFL 2W0KA 1EXUA 4GRWE 4P2QD 1X44A 2EKSB 3K81A 3QJFB 4ODSL 2EIZB 1IEBB 4G7VH 4MHHI 1Z6JT 1QPPA 4XZUB 4OD1H 5A2JH 5EZIL 1S5IH 4J3XA 2YPLD 1BQHB 2HT3C 1OGAE 1OAZL 3O41A 1OP5H 2VAAA 5HHVL 3BP4A 4KDWA 3QXTA 5INDA 1KN2H 1V7NL 1QKZL 1FL3A 3HAEG 4LNVA 3S3JA 4HV8A 4ZUSB 3TWCL 1QFOA 3BEWA 4WEMB 4JFHD 1JNNH 1OAUL 4KVCL 3L5XH 4TVPD 2MTPA 1JNLH 2FEDD 1I8MA 3WJJC 1R3LA 4ZOBA 3SO5A 5MHSE 2BY1A 4NZRL 1NGXB 3QEHB 3BDYH 4PRAB 4Y2OA 3QEUA 3V6ZA 3I2CL 4L3CA 4WTZG 4L8SC 2F58H 4X5LA 5IIEA 4LASH 4QXGH 4UB0L 1QVOA 3QFDB 2C3VB 2X89A 1ITBB 4LAQH 4WI8A 5I2IA 4XWGH 3BH9A 3MRPA 5A3ID 1WITA 1UM6H 2GTZA 3L3OB 1N6QH 1CF8H 1BGXH 4J4PD 4LPXA 5E56A 4K3DH 4U3CA 1MLCA 1RZGA 1B0RA 2H32H 2J7LA 3HC3H 1LVEA 4M03A 6FABL 4M6NL 3W9DA 3SDDB 1CBVH 4L8DB 3QXDA 5J89A 3HZVA 1UJ3A 1A7QH 4NFBA 3SDAC 3T0VA 3GHBH 3SGKC 4BUHA 1XGPA 5C0AD 1DSFL 1KPUB 1PQZB 4WFFE 2A9NL 5BQ7B 3D18B 2IG2H 2FRGP 4MQXC 4YAQA 2DIAA 5BS0E 1OHQA 4MX7B 5EU6D 5C6TH 4EUPH 4QY8B 1ZLVK 3ARGD 5BV7C 3O2VH 1FLTX 1GAFH 3DI3B 5C07B 5TFSH 3MXVL 3PWNA 2HLAA 2AI0H 2E9BA 4MSWA 5SV3A 2IMNA 5BS0A 4PG9A 3DPBA 1H3UA 4Z7OE 2DJUA 3OWEA 1ZA6A 4LHUG 4WHTA 4LLAA 4YNYB 1YUHA 3VMOA 4QXUL 4PRIA 3MRQB 4YE4L 2BHUA 2YD8A 3EOAA 4S0SD 4DK3A 4RRPG 3RVUC 1DQQB 2D0FA 3OR6A 2GFBB 4HEPG 1UB6A 1NUDA 3VJ6A 5CP3H 3A6BL 2NY7L 2E7LC 4POUB 4TUJB 4PRBB 1JK8B 1U8QB 4EXKA 4JPWL 4WFED 1IM3A 4A6YA 2UUDH 3QXAA 2ICES 5FHAH 4HMDA 5DD5L 1R3JB 4FFWD 1NSNL 5F7NC 2A2QT 3DUUA 2FH6A 4PJGB 1B0GA 4WHYG 1QFWI 4X6BA 3RGVC 1DQMH 3ARDA 4IEFB 4TQEH 1T1YB 5ENWB 1YQVH 1AQDB 4LQ1A 4K9EC 5H35B 2CKBL 4Z5RA 4YJZL 4OLXH 3SJVA 3KYAA 4KHXH 3PXJA 1GGBH 5JUEL 1FH5L 4WTXA 4HAFA 4Y19D 1KT2A 2KKQA 2IH3A 4HBQA 4JQVC 2BRRL 4CJ0A 4PGZA 3L1OL 3SKNA 3UBXB 4JZOB 1Z9MA 2C7UB 3MRIA 1RVFH 4V2BA 3QIUA 2CIKA 2VABA 4NHCH 3D25A 3T4AB 4H1LA 1J1OL 2H8PA 4U1GB 2DQJH 4E41E 2Y06H 4PGJA 4B50A 1OTUD 4R96B 4O2FA 4X8XA 4OIIL 4Z77B 3KYNA 3NCYP 3VXMB 5FCUH 3BT2L 1DBKL 2AEQH 1EHLH 4FXGA 4Y4HB 3MRKB 4GMTH 1MCJA 1I1FB 1EJOH 5DJZA 4P2RB 1XF2B 1HHJA 3NFNA 1K2DB 1YEEL 2FGWH 1J5OL 3V4UH 3IFPA 2V7HB 3BZFB 3H6JA 3U46A 1CL7L 2CRMA 1LO4L 1CLCA 1UJTA 2J4WL 3IKCA 2MQ0A 4MJ5A 3IDMB 2J8OA 1HNFA 2VDKL 3VFVB 1JNHA 1QBMH 3BP7A 4IRJA 2R2HA 3S7GA 3KS0H 4PLOB 4E42B 5FFLA 5BMFH 3MV7E 4LPTA 2I24N 3DBXA 1L7IL 2C3HA 4N0UE 3TYFB 4FQQA 4QF1A 3ARFB 3MV7A 3PWPB 3QIWD 2H3NA 1KCVH 2B20A 4LVOB 1I8LC 2WBJA 3RUGE 3SO3B 4U49A 1T1WA 4N0UA 3CPLA 2XPGA 3RPIB 4LCIL 4XPBH 2EDOA 4L5FL 5GGQL 2VL5B 2MHAA 1GZQB 2Z92A 3O6FC 3MACL 3TFKD 4HLZH 3RUGA 1NMCB 4EXPX 4BM7A 1IC7L 3X12A 5EN2B 5DRNA 4QTIL 1GOGA 3QWOA 1KLFA 1A6TA 5FGBC 5ACZA 5DLMH 5IQ9A 2QADC 1RZ7L 1KBGH 3C6LD 4PRDA 4XGZA 5IBUB 1AFVL 3CC5A 4N0FA 1XH3B 3FAXA 4BJLA 5E2WH 5E99L 3CFCH 3LN4A 3WFBL 3BH8A 5GRZA 1I8IB 5EUOB 4TSBH 4L8CB 1NGZB 3Q48A 3B2UC 4EI6A 3V8CA 2D31B 3QDJB 2V5YA 4YIQA 1CDIA 5I19L 2X7LA 3CLEH 2V5SA 4OKVA 5GISH 4ODTH 4QRUA 4POZD 1FC1A 1HOCB 4PBVC 2NX5D 4H8WL 2RGSA 4DK6A 3PWJB 2XI9A 3HG1D 2I60L 1N2RA 1C5BL 1KTLB 2OJEA 2OZ4A 4UQ3B 3HPLB 2J6EH 1UB5B 4FFVD 5I75B 3PL6C 1AXTH 2RCSL 5CEYA 3HFML 1BD2D 4Y1AD 2DMBA 1QRND 4PJEE 2Y5EA 1GHFL 3HN3A 5DDHA 4JY5H 2EICA 2ZUQC 2E7HA 4N9GA 3CDGB 3P40A 3QPXL 1RZFL 1V3KA 4QNPE 5I1IH 3I9GH 3N50A 1KUMA 2AABH 4Z7UB 4PJEA 2HFGL 3BZ4A 2QSCH 4M6ML 2YXMA 4MQ7A 2X9WA 5TGBB 3WFDL 2V9QA 2Y07H 3SDDC 2PO6C 1I7TB 1NBVH 4HGKC 5ILTH 5E2TH 3HB3C 3HR6A 5A2IH 1BF8A 2QJDA 1UXSB 2FZ3A 5C08E 1PG7H 1TTGA 3EJYD 1TVHA 3WUZA 3UTTE 3G5ZA 3L3HB 1RMFL 4R4ND 2EXYC 4JLRA 1MJ7H 2HVKA 4HIXL 1EAJA 2IAMD 1ZLSH 4CADB 3RKDC 4WEBL 3BQUA 5C08A 2F54D 3OAYH 3F8UB 3SE3C 1Z5LB 5CJ8A 3UTTA 1A6WH 3TT1L 4I2XB 3NOIA 2M2DA 3K2UH 3PWVA 4LLDB 2QQLL 4G9FD 5JPNA 4NC2B 1CE1H 4K71B 4M9OA 4Z7OF 4WY7H 3QYCA 1O7SA 1NAMH 3JWOH 2PYFB 4PJDE 2ZCLL 3VD5A 1RUAH 1OP5K 3C5ZB 4GG6F 3G04B 5KANG 5D2NB 2OR8A 1CTNA 3SE9H 2GSIB 4XXCC 3TBTB 5E8DH 1E0OB 5H37G 1QFPA 4ZTOH 5JIHA 1EK3A 2CRIA 2NTFA 4G8GA 4PJDA 4M6OL 4KMQA 5F7DB 1J8HB 4UIMA 5FUCE 3PGFH 2FJFA 4WUKH 1WT5C 4NQCB 3G5YA 1YJDC 3BSZH 4PS4L 1GOFA 2BSRA 2ZKHL 5LAXA 1S9KC 4MB3A 2D7TL 1WBXA 2CK0L 1GGUA 5AWNH 1H3XA 5DRZA 2NY0B 1YY8A 3CSYA 4UU9A 4OIBA 1Q9OB 3QCUL 3LDBB 4MDIA 1AY1H 3STBA 3H0TB 1RZJH 3N85H 2ESVB 2LU7A 3MOAH 5KVEH 4U31A 1M7IA 4G8EA 1M6OB 1ETZB 5F7YC 2EE2A 4MD5A 1WFTA 3IDIB 3RU8H 1F6AA 3A67L 3MLUL 1MJ8L 3L3DA 2VR4A 5HHXH 3VMPA 2IPTH 4Q6IA 4R7DA 4OQ1A 2FB4L 3WHE1 4OZFH 4DQOL 1UWEH 1ZHBA 2CUHA 5EIQA 3CSBA 4MCZA 1JYWA 4GAJH 3BJ91 1OF2A 3MRLB 1JRHL 4QCIA 4U6YB 5FM5O 4LKXB 4RFOL 4XCFL 3IGAB 2X4UB 1L0YA 3MRMB 1XGYH 3QZWA 3O6LH 5CZXD 4YPGB 3ZDZE 5BRZE 3MO1B 5HPMA 1TCRB 3CDCA 4CKVX 3QIBC 1JMXA 4Y4HC 3ARVA 4YFDB 4HW6A 2R0LL 1Q9KB 2QBWA 5BRZA 4R26L 2VDML 3RWCB 3EFDL 4F57L 5HDQL 5ICXA 1EXUB 3WN5A 4PJAB 5EZLA 3P0YH 1EFXA 4FRWA 4FQCH 5D6CA 3WIIL 2HAZA 4LFHD 4GG8A 1E28A 1NAKH 5EC2A 3MCKA 4ZXBA 3O41B 4GRWB 5D7JA 2VAAB 2EZ0C 1MY5A 4UINH 2IANE 2VLKE 3BP4B 5INDB 1HDMA 3BI9X 1FL3B 4YDJA 3D69B 4HK3J 4HV8B 1KEGL 4RAVA 3BRFA 3BEWB 4WU7A 1W8OA 3L3GA 4J3WA 4HKXA 3TO4D 2K3TA 1OCWH 5K9QG 3BESR 2IANA 3ARFC 2NY5C 1U2CA 4XX1G 1I8MB 4HKJA 1NKOA 4B41A 1A6UH 2ORBH 3EDKA 1R3LB 1UXWA 4KY1L 1TJGL 3WDHA 4WVRA 3MOQA 1H5BA 1CZ8H 3Q3GB 3TN0D 1B4JH 3QEUB 3V6ZB 4L3CB 3D39E 2R69L 5IIEB 7CGTA 1UENA 1N0LA 1BFTA 3I6LD 2VH5L 3DSFL 4OCYH 3QG7L 1KN4H 5TE6L 3OGCA 1QVOB 3SDYL 3RX7A 1A22B 1LP9F 1KTDB 2GHWB 4L4TE 2VN4A 5I2IB 2AJ3B 3BH9B 1JN6B 3MRPB 1T0NA 5E8EA 2CKBB 3I75A 5FUOL 2VZTA 2FGZA 1QSFA 1CDHA 3F5WB 3FQNB 5EORL 3KGRA 4LSSH 1HSBA 2VQTA 1I1AA 1MLCB 1Q0XH 1SJVA 3PQYB 1B0RB 4FQPA 2LTQB 3BPLC 1HZHL 3GSUA 3QXDB 1BIIA 2OR7A 3HZVB 4P99A 5MEPA 1UJ3B 3QQ9D 4XC1L 5HDLA 1XGPB 4CJ1A 5ISZE 3UYOD 1MJUL 1IC4H 1C12A 4R8WH 1K8DA 4YAQB 4Z8FL 2DBJA 3B2VH 5ISZA 5TH2A 4CDGC 4NQDE 1FGNL 1WLHA 1NL0H 4XCYA 1JJUA 1F4HA 5DI8A 2FYYA 5DR5H 3PWNB 5C09E 2HLAB 2R0WH 3MLRH 1CT8A 2EYSA 4GJTB 1WWAX 2CK2A 5BS0B 3RIAK 2PR4L 2DI9A 4WHTB 4OB5L 3MLYH 1YUHB 3ARRA 3H9SE 2CKNA 4PRIB 4FOMA 4NQDA 9CGTA 4NQXA 1JE6A 5C09A 1J0ZA 3RVXD 3EOAB 4ALAH 1WSST 2IJ0C 4PJ7F 3OR6B 5HD8D 3U9UA 1BVKA 2XACC 4KROD 3HZMA 5GSVA 2ARJQ 2R2BA 3VJ6B 3H9SA 3DSNA 1Y6MR 5C0ND 4QRRB 4JO4L 3TNMB 1IM3B 4A6YB 3QXAB 2ICWA 4B7IA 3MX0A 4O02L 4WUUD 4HH8A 3CMGA 3DUUB 4OZIA 1A6PA 4YZFF 2L7JA 4X6BB 2EDNA 2D4FA 4MJIE 4P0DA 3WXVL 5BJTB 1OTSC 5D1QA 4Z5RB 4K71C 4I4WB 3SJVB 5ALCL 1NBYA 2Z8SA 4YDIL 5HHQA 1WZ1H 4MJIA 3UO1H 2FLRT 1KT2B 4MXVE 3QHFH 2IH3B 4JVUA 1IGIH 3FONA 3K1KC 4JCLA 3TBWA 3R8BB 1NC2A 4MDJA 1K6QL 3I02A 4OCNC 3SDCC 3BXNA 4PJHF 3MNZA 4HC1H 2OS7A 4WENB 3LKOA 3SKNB 5HVWA 3AS3A 4KRPB 4LSUH 3V7AG 1VB9A 1JVKA 2EDFA 2J12B 2Y23A 4JM2C 3QIUB 3MUHL 4JQIH 4NQEA 3CDFA 3D25B 4H1LB 2H8PB 3LS5L 3O0RL 3OGOE 3TT3L 2P5ED 2WP3T 4O2FB 2I25N 3KYNB 3LDBC 4JHBA 5K9OA 1X6LA 4XP4H 5IB5A 4M43H 1U95B 2YUZA 5D2LF 3NCJH 3ZE2F 3LQMA 1G84A 5MP6H 2FECI 3EBAA 2DQFB 3VGEA 4AMKH 4JHAL 4NM8H 5DJZB 4G6JH 1HHJB 3NFNB 4OM0L 2X9YA 4NQUA 5GQBA 3BP5A 3QQ3B 2YA0A 3G6AA 3IFPB 5HSFA 1AIFA 2YUWA 1JI1A 1HWHB 3U46B 1I3VA 3IKCB 5KG9A 4HQQL 4MJ5B 4BZ1H 4RDQG 3RIFF 1JNHB 1JGLL 4PUBL 3BP7B 3UC0H 4IRJB 2R2HB 1EEYA 3BDBA 3NABH 2L4OA 1E4WL 1F6FB 5L8KB 3DBXB 4ESKA 1IEHA 5DK3A 3T0EE 5FKAA 2RJMA 4FABH 5E7FA 1D9KD 3IAPA 5JXEA 4P46C 4ZNCD 5DK2B 5I1EH 4UBDC 4MA1B 4QF1B 15C8L 3MV7B 2H3NB 3HI5H 4YHOH 2WBJB 5GRUH 3CXDH 1ADQH 2JELH 3T0EA 1A7NH 4N0UB 2C3XA 3CPLB 3OAYK 1UYWH 2AJXH 2MHAB 2Z92B 2E5EA 1MELA 4MQSB 2IADA 3RUGB 4IDJH 1DLFH 3SQOL 3X12B 1NCDL 1RY7B 3WMSA 5DRNB 1TCMA 4DJMA 1DQJA 3UAJC 3O6KL 1A6TB 1RFDL 1EVUA 4ZFOA 5ACZB 4YFLI 3K4DA 3BAEL 1UA6L 4LU5H 2XICA 5IQ9B 1OL0A 1QBBA 4PRDB 3CC5B 4N0FB 2ZUYA 2P8MA 3DROA 4K8RH 4MB4A 2NY1B 5A16A 3LN4B 3BH8B 1FNFA 3SE8H 2W60A 3T8XA 1ROWA 1KTKE 5SWZE 2HN7A 3UTPE 4EI6B 4UV4H 4YIQB 2X7LB 4OKVB 3VD9A 4QRUB 1CDYA 3DOSA 3DGGA 4DGIL 2FWOA 2ZNWA 4ZQKA 5F96H 3MRRA 5SWZA 5GPRA 1N2RB 4KVNL 4V1DD 5IEKA 2OJEB 4RA0C 5ID1A 4ZDHA 3KR3L 5C0GA 1NFDE 3CFDA 5J12C 3IFNH 4AJ0A 2EH8L 4KK8D 3NFSL 3GJFK 4U1MA 3O11A 3NAAH 4OLYH 5EULV 1TETH 1TJIH 5DDHB 4ENEC 1WJ3A 2HTKC 4N9GB 5KS9E 1NFDA 4RFNB 3GSQA 5ICYB 3KLDA 3BKMH 5T5FH 3O8XB 4HJ0D 1ZK9A 4GMSL 1NCNA 4YHML 4PJEB 3BZ4B 1KCRH 4UDTA 4HT1L 3MA9L 3Q2CA 4MQ7B 3TA3A 1W0VA 5KS9A 4AIZA 5J13C 1PW3A 3D0LA 4HIEA 4I77H 4JFZH 2VXUL 3VWKD 3BPOB 3R8QA 5JHLL 3QHTC 4XXDA 4X9GA 4P23A 1TVHB 3B8SA 1N5YL 5F3HA 2QEJA 3G5ZB 2FLBT 5F7LB 4JLRB 3UZEA 2HVKB 3GHEL 3BQUB 3O6MH 5C08B 5AG8A 3ZE1F 1LDPL 5KW9H 2ZJSH 3UTTB 1D6EA 1YN7A 2D3VA 1UM4H 3PWVB 1QEWA 4XP5H 1BFOA 4PRHE 4ZD3H 3ZHKA 2VDPL 5JPNB 4GS7B 1S7VA 3CLFL 5SWSD 3HLAB 1HH9A 5I17A 1XIWC 5EO0A 2WIMA 1MEXH 3NIFE 2VXVL 1P7QD 4YDKH 2IMMA 3FO9A 3RL1A 4PRHA 1JWSB 3OKOA 4KI5C 1T80A 5DRWA 2HT3D 2NTFB 1XF3A 3QUYD 4G8GB 3RWIA 4PJDB 4UIMB 1HHGA 3TVMA 2ADFL 4JFPB 3IFOA 2K7QA 1PG7X 3G5YB 1T0PB 3CX2A 5I1LA 1MCDA 1P1ZB 4ZO8A 2BSRB 5LAXB 4UQ2A 1KB9J 1TENA 1LO2L 3OKLA 1E4XL 1WBXB 4DN4L 1WCBA 4ELMF 2R1XA 1YY8B 2DQGL 3CSYB 4LP4A 4UU9B 4MDIB 1KJ2L 3FN0L 1W72H 5BO1H 2F53D 4WI5A 3VRLF 4WW2A 4OCRL 4JPVL 5JZ7D 1M7IB 4G8EB 4LVHC 3KPRD 1NDGA 4R4FH 3UTOA 1ZGLA 2X5PA 3NIDF 1F6AB 4FQXA 2NTSP 3L3DB 1CQYA 4GQ9H 3ZT6A 4IMKA 4Q6IB 5KVGL 4YXHL 2JB5L 1ZHBB 1SBBA 5HGGS 5B21A 4MCZB 3ZKQD 4QRSA 1OF2B 3D3VE 4QCIB 4LPCA 2FX8L 1IFHH 3GMNA 3QZWB 1NANI 5T1DL 4N8VA 4GKSA 1SHMA 4UTBH 5HPMB 2UWEB 3D3VA 3GMOB 4H8WC 2JJTA 3N1MC 1K4DA 3ULUE 3GRWL 2BNQD 1CN4A 1U58A 1FYTD 3SDAD 1DP0A 1R3KB 3HI1A 3PABA 5BRZB 2B5IB 2VXQL 4G80A 1OD9A 3MZGB 5ICXB 2DOCA 3S35X 3WN5B 1DBJH 4MAYB 2NY3B 4MQXD 3FB6A 2BHYA 1SJEA 1CK0L 5D6CB 1T5WA 4GG8B 4KAQH 4HS8H 4YHZH 1E28B 5DFVC 5EC2B 3HC0A 4ZXBB 5D7JB 2MCG1 1HDMB 4KHTH 3KPOA 4YDJB 4Q9QL 5FYKL 3TPKA 1P4IH 4RAVB 1IGFH 4WU7B 5GRVK 4D3CL 3L3GB 3LRSA 35C8L 4MA1C 4HKXB 4QHLA 3SCMC 2IANB 4RMQA 3W0WD 3RVUD 4E0RA 4HKJB 3RQ3A 2AP2A 2X70B 1UXWB 2WBJC 4UOW1 5IK3A 4MMXC 5JW4M 5F9DC 2J3SA 1KPVB 3FO0L 1EO8L 4LLUA 2F19H 1YEIH 2ICCA 5E5RB 1G6RA 2A9MH 3RTQC 3O4OC 3W5MA 1KLGA 1DANU 4AEIH 4MD4A 3OGCB 3D9AL 4Z7VA 1FVEA 3HC4L 1JGEB 5HHMD 4QHUA 5E8PA 3WO3B 5ALBL 1I9RH 2VZ1A 1NGWB 2GAZB 2YOCA 1UZ6F 1MLBA 1T0NB 4PR5A 3HNVH 3I75B 1YN6A 3JV6A 3QI9A 4XNYL 1QSFB 2YD3A 3FB8A 5KN5B 3EDJA 4RWYL 1MWAL 5AD0A 1HSBB 3QWQB 4ZFGL 1I1AB 4TSCH 2OTUA 3WD5H 1OB1A 5BV7H 4NWTH 2P8LA 4IRZH 5D7KE 1X6NA 3GSUB 4X0KB 1BIIB 5MEPB 4Y2DA 2V2TB 2XOTA 3QEQD 2GY5A 4FFZH 4PJ9A 5EU5A 3IETB 4NN6C 1C12B 2DQEH 1K8DB 1KSRA 5C71A 4W6YB 3RWFA 2HMIC 3MRGA 4BSJA 3GSRA 3K8LA 4P2QE 1OWRM 5ISZB 3K80A 2G75A 3ALWA 4CVZA 1KCSH 2HJFA 4XCYB 4DN3H 4RFNC 1U8MA 2FYYB 1IAKB 3O9WA 3O8XC 2EYSB 2YPLE 2VDQH 4P2QA 4XBEH 2B2XH 5I1CL 4NQDB 2VWEE 2DDQH 4NQXB 2H32A 5C09B 5CEXA 2CMRH 5F1SA 1OLLA 3RDTD 1HHIB 2YPLA 1JTOA 2HA1A 4BK4A 4JFHE 3U9UB 3BPOC 1IKFH 4DEPC 4K9EH 1EDQA 4KPHH 3HZMB 5GSVB 3NA4A 3H9SB 4YBHA 1ZAGA 4LBEA 5I8KL 2OI9B 1HNGA 5L7XH 1PG7W 3QO0B 4YFLF 2ICWB 2FCBA 4JN1H 2Q6WA 1G6RL 4WHYH 3REWA 4YHLH 4X4ZA 3ISWA 4OZIB 4XMLH 4EUPA 4OLVL 4LARH 1KIPA 4R2GB 5HYQA 5HDBE 3HRPA 4HULB 1X7QA 3V7MA 2R4SL 5D1QB 5T3ZD 3GI8H 2AXJA 1NBYB 4LSPL 5HHQB 4IJ3C 1MCKA 1BZ7A 4LKCA 5E95B 4ONOA 2AV7A 1J0KA 3NIFF 3FONB 3WSQL 3TBWB 5HGBA 1JNNL 1NC2B 4MDJB 3I02B 2IGFL 3OPZH 1FZKA 3MNZB 2Z31C 5CP3A 3U2SA 3LKOB 3CMOH 3K8MA 2XWTA 3IU4H 4F7PA 1MAML 2QADD 5BW7A 4KZDL 5CINL 4F8QA 3P4OA 4KU1A 4NQEB 5F7HA 5C0AE 2MPAL 5E6IC 4XMKL 3B2UD 1WCQA 3WO4C 3HPJA 1OP3H 4LRIA 5K9OB 5IB5B 4HXBH 5EU6E 3SN6N 4EZMA 4AENA 4XTRC 2X1QA 4LCUA 4XWGL 5C0AA 3PHQA 4GAGL 4DWHA 2HWZL 4HGMA 4YX2L 2UY7A 1EEUA 1BFSA 3WXWL 1CF8L 5EU6A 5LJYH 1OW0A 3BP5B 2XN9E 3PL6D 1HN1A 1D3CA 4Q6IC 1AIFB 1X5AA 3U4EA 3JBG7 4XPHH 3C2AL 5KG9B 5T3ZH 3PP3H 3KPMA 5E8OA 4HS3A 5DD3H 3GHBL 1XGUA 3BIKA 5DZNA 1EBAA 2XN9A 1EEYB 4RGNC 4G42A 1L7TH 1DE4A 4WFEE 4D0DA 4P9MH 2O5XH 5FKAB 1A6VL 2VLME 1CGWA 5HHNA 4X8JA 3VDAA 4X98A 2K9UA 3SDDD 2PO6D 3GMMB 3N1PC 2D9CA 5IJKA 1R0AH 2EEBA 3ES6A 5DTFA 3T0EB 2ZOLA 1F00I 2B5IC 2ZUUA 5FKPA 3MGOA 1KYOK 4J12A 4EDXA 1RSFA 4MAYC 4R97B 5J06A 2EXYD 3T2NH 2YZ1A 5IKCA 1P6FA 3BWUC 5DEGB 1J0HA 5IQ7L 2IADB 5FO7A 3RKDD 3R0MA 4WW1A 1BQUA 1A5FL 4Y19E 2ITDA 1DQJB 2KBGA 2XQBL 4PJ5B 4MXWH 5C07D 4C83A 4KQ4L 1RHHA 5IVXF 2NR6C 1LO3H 4GRLC 2D9QB 2E27H 2BOCA 3DROB 4X6CE 4HUNB 5AAWA 1QR1B 4RZCA 5A16B 5EWIL 3VFSA 3FO2A 4NZUH 2W60B 3T8XB 2HN7B 2FO4A 5DURB 2A6JB 3HNSL 1G0XA 3DGGB 1INDH 2FWOB 4XPTH 5F88B 3LPGA 1YQVL 3WNLA 3DHMA 4ZQKB 1OY3B 5SWZB 3X13A 3BMVA 4JKWA 5I18L 5IEKB 2A6DA 5IR1A 4OLXL 2XTLA 5FF6A 5ID1B 1G9ML 1JPSH 1T2QL 4ZDHB 2GI7A 5C0GB 3CFDB 3WLWD 2IFGA 4HUMB 2VERN 2DM2A 4U1MB 1GGYA 3O11B 4RFEA 2GK2A 5F97E 1E6OL 4YO0A 2F8XC 1NBZA 1AP2A 1NFDB 3VW3L 3GSQB 4M1GH 3X17A 2X40A 1J88A 3MRHA 4EQ3A 1BM3L 5GHWH 4NHCL 2FX9L 4UDTB 5F6HI 2XZAL 2B0SL 2HVJB 4XP6L 3TA3B 1W0VB 2R0ZH 4PJCE 5KS9B 3AB0B 2VRAA 3D0LB 4HIEB 3I3DA 4CVUA 3T3PE 1NGQH 1H3WM 1REIA 4L1DA 4XXDB 2LQRA 4P23B 2ZWLT 1FE8L 5F3HB 2I26N 4PJCA 4R9HA 1T2JA 3HUJF 5GGSY 3G6DH 1DBBL 3C8HA 2J6EA 2MFNA 3GMPA 4OF3A 3GSOA 2VDNL 5ITFA 1SMAA 3QIWA 4UIKH 3VXMD 1D6EB 1QSZA 1BQSA 5D96B 1YN7B 3GFUA 1QEWB 1BFOB 2H26A 4X4XA 4Y4HD 1YJDH 4GBXC 1IJ9A 3C6SA 4P2RD 4ISVA 3ECBA 4MMZC 3OXRA 1HH9B 5I17B 5DA4A 2RFXB 3C09B 3FO9B 3RL1B 4PRHB 4LEOA 2FX7L 5H37H 4CMHB 3OKOB 4PYGA 1CE6A 2OI9C 5DRWB 2QLVB 3RWIB 1XF3B 1KCVL 3TNNA 1HHGB 1I3RA 3TVMB 3ZYJA 2A1WH 4ONHA 1A3RL 2DWEA 3IFOB 4HK3N 4S1RH 4Q0XH 5D4QA 1YYLH 3HG1E 1A3LL 1S7XA 3LSOA 4XH2A 4JKPL 4PLJC 5I1LB 4P5TC 5EH1A 4UQ2B 3VRIB 3DI2B 3OKLB 2EIBA 5JDJA 2R1XB 5IFAL 3ARFD 3PWPD 4Y1AE 1GH7A 1QRNE 5HDBF 1MCHA 5D1QC 4WFGD 2YPVL 1CD1A 4M1CC 1C08A 3PWUB 2IPKA 5IOPA 1NDGB 5IP4A 1NAMA 1ZGLB 2GSGA 4Y1AA 1K3ZA 2ZOKA 4DKAA 4FQXB 4UAOB 4Z78A 1VGKA 5LGHH 3W5NA 1EIBA 3CX5J 4K23H 4PJBF 1F4XL 3ILPA 3OHXA 4JFXA 4AEHL 1URLA 4QRSB 2FR4A 5IUSA 5E6ZA 3IU3A 4OQTL 1MWAB 4NQVA 4KK5D 1MCOL 3GMNB 1SVCP 2Q1EA 2R29H 3ETBF 2W0PA 3MCG1 3QDJD 4N8VB 3Q5TA 3QSKB 4GKSB 5GS2D 1VEMA 2QQKH 4MYWB 3D3VB 4BQ6A 2F54E 2JLLA 4HKBA 5CJOH 1J1PL 1K4DB 2PW2B 2W92A 3S88L 3Q6FA 1RZKL 1T83C 1U58B 5T3XL 1BAFL 2N1KA 3QDMA 3HI1B 4D9LH 3PABB 3S6CA 1EA9C 3LV3A 4AQ1B 4G80B 1L9NA 2OSLA 3QWRA 2F54A 1BZQK 3GO1H 1H3TA 2NY5H 3OF6D 1SJEB 1INQA 1T5WB 5JW4Q 1NBVL 4M62H 4NKIH 1XMWA 2DL2A 4OCXH 1KFAL 2F8OA 3HC0B 3KJ4B 4OCMC 1GIGL 1JZ7A 2FNBA 4KTEH 4LSQH 4JFQA 3KHQA 1PG7L 4HGWA 5C2BH 1A0QL 1LE5A 1CI5A 1MJJA 1MQKH 3DYMA 2BVYA 4U3HA 5ANME 3KPOB 4WWID 5MEOA 3KLAA 3QXUA 5L8LB 1SY6L 1YEFL 3LRSB 4H88L 4YEEA 5KOMC 4DTGL 4E0RB 4MJ4A 4X6DE 2V5RA 5ANMA 4ZAKA 3UBXG 5IK3B 3VXRE 2HFFA 4P3CH 4CN4A 3P73A 4CN6A 4NQSA 5DVMA 5C6WH 3K2UL 5TF1H 4LLUB 3RIAF 3D0VA 2VSDA 1G6RB 1XFPA 4X6DA 5GS2H 4OZGE 3VXRA 1KLGB 3EYFA 1TNNA 1C1EL 4MD4B 1RUAL 3T0WA 5J6GA 4Z7VB 2R9HC 1FVEB 3LEVH 4QHUB 5E8PB 4JPKH 3ZSSA 5KVDH 2F15A 4A2MA 5E4EB 4S1QL 1CCZA 5TQ2H 4OZGA 1AD0A 1MLBB 4X5WA 4PR5B 3MRCA 3QCTH 1OTSD 3JV6B 3QI9B 1V7MH 3PGFL 3B43A 3FB8B 4OIAA 5AD0B 4X6CF 3BSZL 1U9KA 2OTUB 3C5ZD 3MNVB 1OB1B 1HINL 1BPVA 3DX7B 1A1OA 1LNUB 1T1XB 4HPYL 4HWUA 1LHZA 2XKSA 1WIPA 2P8LB 1TDQA 4ZSOE 2ERJC 3PIQA 1J8HD 1UZ8A 4Y2DB 3N9GH 2GJZA 1RK0B 3S35L 4JM2D 3V8OA 1EBPA 2ADIA 4NQCD 4PJ9B 5EU5B 5A2KH 4M7LT 4ZSOA 3MJ6A 4KJQC 3RWFB 1KJMA 4R0LA 3LH2L 3MRGB 3BWAA 4OJFH 1P4BH 3GSRB 4K07A 1T7YA 1TQBB 2NY0D 3LHPL 4JDTL 5F70A 1DEDA 2AJVH 5I1JL 1KPRA 2G75B 1T66C 4CVZB 2HJFB 1U8MB 3SBWA 2ESVD 3FMGL 3O9WB 4L4VE 4L9LA 4U6TA 1SBSH 3C87A 4F15B 2QSQA 4F7MA 4KDVA 5TE7L 3AREC 5KSAA 3P9LB 5KSBE 4TRPL 1M1SA 1XGYL 2H32B 1EEZA 5CEXB 3FOLA 3D2UA 1JHKH 2WIIA 4L4VA 3ESVF 4XAWL 4QEGA 3LQZA 5KSBA 2P7TA 4PB0L 3TBSA 3NCYS 4LBEB 2DLFH 2MQ3A 5EU4A 1CD9B 4KDTA 4ODSH 3MYZA 5I73B 2Q6WB 3TO4A 5CGMA 3REWB 5EZIH 1J0JA 5HYFA 2DTML 1OAZH 3I6LE 4UDUA 4EUPB 3ROLA 1KIPB 5HHVH 5HYQB 4UBDD 4NDMA 3QH3A 3TN0A 1V7NH 1ONQA 1QKZH 2AJUH 4ODVL 4TPRL 5H2BA 3REVA 4ZYKA 4PTUA 4UINL 1FO0A 3GDBA 4PREA 1OAUH 4KVCH 1EH9A 5ID0A 4ELKA 5D6DC 5C0IB 4D9RD 4Y5YA 1BZ7B 4G9DA 5DUBA 2AV7B 4XWOC 4NZRH 5T1LD 1OQOA 5HGBB 1OCWL 5K59F 1CIDA 3UEZA 3UAJD 3I2CH 5BOPA 5T33L 1FZKB 3AVEA 3U2SB 2HT2D 2XWTB 4UT7L 1H0DB 4F7PB 3GMQA 5DVNA 2Z8RA 5FM8A 1OM3L 4UB0H 3UMTA 1UCTA 3P4OB 4U0QB 5CSGA 3UYRL 4PJFF 1FP5A 3IDYB 3IXAA 4L4JA 3OR7B 4LHJB 1X5KA 2X2YA 5J11B 3PV6A 2QQQA 2CD0A 5I9QB 3P4NA 2YR3A 3HRZB 4LCUB 5C0AB 5HYSB 3PHQB 2GJ6E 3BPNB 1HQ4A 1HH6B 6FABH 1U8PA 3SY0A 4M6NH 5I76A 5EU6B 5DQ9A 1AHWA 2DJSA 3TPUB 4AIXA 3PP4L 1XCTA 5JQHC 5I15L 3CK0L 3QULA 4OLWL 2X89D 3U4EB 2YHGA 2GJ6A 1DSFH 3S34L 2A9NH 2OMBA 5FCSH 5DQJA 3KPMB 5E8OB 4ENED 4HS3B 1PX4A 1XGUB 3BIKB 3EKCA 2XN9B 4OZHF 2D7MA 3H3BC 5GGTH 4G42B 1MFCL 1DE4B 4D0DB 3PQYD 4QGTA 1ZHNA 5DGQA 5E00A 3MXVH 4QOKB 3M17A 5HHNB 4X8JB 1SQ2N 1W0YT 5BVPH 4X98B 3B2VL 2Y5TA 1VFOA 1I7RA 2XTJE 1IZKA 1OTTD 3ZTJH 1NCWL 4QXUH 5IROA 1CXIA 4U33A 4EEEA 3ES6B 1P7KA 5DTFB 5A2FA 2UZIL 2ZOLB 1FO0L 5I1GL 5FKPB 4QKXB 3MGOB 1YEJL 3HZYA 4EDXB 1NLDL 5CUSL 5IKCB 3WLBB 1MAJA 1T89C 5FO7B 3A6BH 4WW1B 2NY7H 2X05A 4WU5A 2ITDB 4JPWH 2F8VA 4C83B 4JRYD 4QRPE 3V79C 1RHHB 3S98A 5DD5H 2NMSA 3B9EA 5FO8A 3AC0A 5E2VL 4ZS6C 1NSNH 1YQ2A 5BS0D 3NN8A 2BOCB 4PRID 4RZCB 3VFSB 3OX8A 3F7RA 1GRWA 4QRPA 2HRPL 3UTZA 4X4ME 4FQLL 1FRGL 4JVPA 2WUCH 4JO1L 2FO4B 1SYVA 3QUZC 2CKBH 5E7BA 4ZPTA 3K4AA 3EHBC 1FBIL 2OXHA 4KI5D 1VADA 4DVRL 4QRRD 1ADQA 5JUEH 3PHOA 1FH5H 4X4MA 4F9LA 4YHYB 3X13B 3ZZ1A 5EOCL 2XZZA 4KKAC 2A6DB 5IR1B 4G8IA 5FF6B 2BRRH 4TSAL 4LK4A 5FYJL 2MKWA 3L1OH 1MSPA 2W38A 5IHBA 1MQ8A 5TE4L 1RUPL 2X41A 1ZVSA 2GW5A 4RFEB 5E4EC 2DJ4A 4YO0B 1NBZB 1S9WA 3MNWB 1AP2B 4EDWL 4GKZA 3SJVD 4JQIL 4OIIH 1IARB 3LQAC 2IQ9L 1S8DA 3IRZA 3BT2H 1DBKH 3QUXA 5F93C 3RI5K 3V0AC 1WK0A 2VDLL 3V5HA 3FRUA 3V6OC 3ROOA 1YEEH 2IQAA 4V2CB 4PJ9C 5GGSA 1FFOA 1IVLA 3OXSA 5CAYB 5DUML 5F9OL 2VYRE 1D9KA 1FSKB 3NCEB 1CL7H 1LO4H 2J4WH 3GMPB 2YD4A 2DIJA 4WO4C 3GSOB 5ITFB 1JGUL 2VDKH 3QIWB 1NPUA 5TJWK 4BA8A 1G7HB 4FXKA 2H26B 4X4XB 4QTHA 3CGTA 1L7IH 4F15C 4I18A 2CLZA 2DKSA 5L6YH 4WDIA 2ATPA 4M1DL 4ACPA 4M7ZB 3C6SB 4ISVB 3T1FA 2W59A 3ECBB 3OXRB 4OGAC 1IQDA 4NZTL 4LEOB 3UXFA 1TPXC 3NZ8A 1M71A 2P5WA 1FPTL 3MV11 4LCIH 3VD4A 2E9JA 2KZ1B 1CE6B 3DUSA 2VWEC 5GGQH 4RA3A 1CQKA 2VE6A 3TNNB 3MACH 1Z3GH 5I73C 2NXYB 3IDXL 2DWEB 1IC7H 2F5BL 4QYOA 1S7XB 3LSOB 2H6PA 4QTIH 3MQIA 4XH2B 1JFQL 3VH8G 4NM4L 2R1YA 3FRPA 1DLFL 1RZ7H 4XNXH 1AFVH 3MV7D 1XCQA 5EC1A 1VFBA 5E99H 4Z95L 2WBJD 3KHOA 3JV5A 3WFBH 1QLFA 4MZ3A 5T5NG 1CD1B 2A77H 1KXVC 2J8UE 1QQDA 1TQCB 3CIQA 1CG9A 2IPKB 5IOPB 1MCSA 3E8UL 1NAMB 3RTQD 5I19H 2GSGB 4Y1AB 1AQKL 4U2YA 2ZOKB 3VXQB 4AK1A 4J3VA 4X6FA 4Z78B 1VGKB 4H8WH 4YK4B 5D9SA 5GGRA 5SV4A 2I60H 2J8UA 1C5BH 3ILPB 3PHSA 3SOBL 3PNWB 4FNLL 3RP1A 1ZLUK 4OFDA 3RZCC 2X1PA 4JFXB 5BW7C 2FO1A 2FR4B 5F96L 1KJVA 4X7CC 1F8TL 2APVA 2NY1D 4NQVB 1EUUA 3HFMH 4KUZH 2WINA 4YUEL 2WSKA 1GHFH 2FJHB 5JTWA 3VWKA 1HXYA 1UC6A 4LRIC 4P49A 3WS3A 4JFYA 1RZFH 43CAA 4HKBB 4KZEL 4WRLA 4ZPVA 3Q6FB 5HHPA 1VPOH 1MF2L 3QDMB 4M6MH 1GC1L 5T5FL 1G9MC 3WFDH 3GSVA 2XA3A 3LV3B 4NPYB 4RSVA 3CVHL 2OX5A 2OSLB 2E6PA 3I84A 4DUWA 2LAGB 1U41A 2JF1A 2V9RA 4OLUL 4BZYA 4B53A 4XT1C 5TDOA 3BD4A 5E94A 2FECL 1QFWM 4PV9A 4CMMA 5DC4B 1U3ZA 5FIEA 3QXVA 3O8XD 4HIXH 4JFQB 2O93L 1AH1A 1WWCA 4WEBH 5DHXB 1MJJB 1LE5B 1WWWX 2NY6B 1P7QA 5IMMA 5MEOB 4PJXE 3KLAB 3W11D 3EO1A 2XYCA 4Z7NF 4IRSC 2P8PA 3TT1H 1YC7A 1Y6KR 4W68A 1AXIB 3RAJL 1A64A 2QQLH 4PJIE 1GGCL 2V2WA 2ZJSL 1QSVA 2VITA 3LN5A 5IJKC 5ANMB 4ZAKB 5F1NB 2HFFB 4PJXA 4TTDD 4C59B 3P73B 4OUUA 4NQSB 3S37L 4NBXB 1F4WL 4WHDA 2ZCLH 4RIRB 2F53E 3D0VB 1Z9LA 4G5ZL 4H1LG 3ZKMC 3K8KA 4X6DB 3JTSA 3PG2A 3VXRB 3EYFB 2DBLL 3BQUD 5C08D 4M6OH 2FEEL 3OKEA 4R6UA 4OZGB 1A7BA 1AD0B 4PS4H 5AZ2L 1FCGA 3MRCB 2KQMA 3VWJC 2CK0H 1J11A 3KPPA 1DVFB 3ZT5A 4IOFC 4DUXA 3QCUH 1A1OB 3O3EA 4KTYA 1TZGL 4U1KA 4G8GD 2Z31D 3PIQB 1UZ8B 4WTZA 5DZOA 1FYHB 3B6SA 2GJZB 4ONGL 4RMSA 2ADIB 3MLUH 3A67H 4HG4K 1MJ8H 4ZSOB 1KJMB 4DQOH 1SMOA 4R0LB 2A38A 3BWAB 5E6ID 1NDMA 4KKLC 1LILA 4UV7L 5C3LD 1KPRB 2BY3A 1JRHH 3AAZA 3SGKA 4I1NB 4XTRD 4O51B 4RFOH 4XCFH 8FABA 3KLHC 4IOIA 2I07A 3QXWA 2XQYK 4D0CA 4L9LB 1CXEA 5L2KE 4F7MB 5HGDB 1G0YR 5KSAB 1R5IA 5DJDA 3KYMA 3HNTH 1H15B 2VR9A 4PJ8A 1EEZB 1L0QA 1UH2A 3FOLB 3D2UB 2HLFC 2WIIB 4L4VB 5L2KA 2R0LH 2BCKB 3LQZB 3IS0X 3TV3L 3T08A 3W0WE 4R26H 2VDMH 3ZKXC 5KSBB 3EFDH 2P7TB 2KH2B 5F7WC 5HDQH 3TBSB 2PF6A 2NLJA 4Z0XA 5EU4B 2AJZA 1KELL 1HXMA 2UVFA 2MJWA 3WIIH 3TO4B 1C5CH 3TH2T 3W0WA 2YD1A 1TZIB 4YC2C 3ALPA 3FCTB 5KSVA 4QHNA 5JW3L 3ROLB 5HXMA 5IBLC 1Q1JL 1P84K 2E7LA 1RZKC 4U1HA 3QH3B 5CMAA 1NC4A 3TN0B 1ONQB 5DJ2A 4W4OC 2NNAA 5H2BB 4LHUA 2MQCA 3L6FA 4O58L 1AO7A 4PTUB 4ZYKB 3REVB 1KEGH 1FO0B 4J3UA 4OFYD 4M7ZC 5BRZD 3VE0A 3MBEA 1FZOA 4PREB 4OGXL 3VFUA 2V17L 3QDHA 4ELKB 1NCBL 3RGVA 3WFCL 4MAYD 5K9KA 4RRPA 4TUKL 4Y5YB 1TJGH 3DO7B 4G9DB 5DUBB 3SGDI 1B0WA 1CU4L 1EPFA 3P4MA 1QO3A 4AY0A 1HKLL 4AQOA 4ZXBD 4HWZA 2R69H 4YXLL 3WNKA 4JDZA 2NR6D 4AT6A 1F11A 4GRLD 2VH5H 3DSFH 2NXYC 3GMQB 3QG7H 5TE6H 3QEQE 5IB4A 3SDYH 2Z8VC 1I85A 3IXAB 4QT5A 5C7XL 4YHNA 2IAND 5FUOH 4GKNB 1RJYA 1LO0L 5EORH 3QEQA 3P4NB 3DTXA 3HA0A 2PETA 1G7MA 1CIUA 2PCPA 5ACMA 1HQ4B 5E9DE 1DDHA 3MZTA 4JCMA 3SY0B 5I76B 4CW1A 2PW1A 3SGJC 2AGJH 5DQ9B 1AHWB 5D93B 3ZL4L 4BK5A 1XCTB 4FQIL 1HZHH 5BV7L 1VFAA 5GJSL 2SEBA 2GJ6B 4XC1H 5E9DA 5DJCA 2AVGA 1MJUH 2D2OA 2VN7A 1ORQB 2PTUA 5DQJB 3B9DA 1OARL 5D7LD 4KK9C 2WWMD 3HE7A 1QSFD 5L9DL 4Z8FH 1AGCB 4KH2A 5DHVH 4HS6A 1RIUL 4UT9L 4BSWA 1X5YA 2DQEL 3U9PL 3NIGE 1FGNH 3VCLA 4P4KC 1MVUA 5E00B 4NGHL 3M17B 3MODL 4JRXA 5F7MC 1WWBX 1IC5L 1HEZA 2PR4H 1I7RB 1YA5A 4OB5H 1T6WA 3OAZK 5LCVL 1P7KB 1NCCL 1DJSA 2W9DL 4POYA 3BHBA 5T3ZE 5J56B 1X5FA 4NCDA 2XTJB 1HYRC 2VIRA 3MV9E 5SWQB 2CMRL 1U3HB 4Y4KA 1BJ8A 4WU5B 4JO4H 1I8LA 3UROR 2AK4D 4X9FA 3NCCB 4KPHL 4O02H 1S78C 3AY4C 5FO8B 3TEUA 3IB4A 2NY6C 5FGSA 3NN8B 3O6FA 4S1SL 3MV9A 3QJFA 2DMKA 4HPOL 4GBXD 1KGCE 4PD4K 5GGVY 4JN1L 4QRPB 3BW9A 5JHDE 1KCUL 3UTZB 4K3EL 3Q6GL 1OWWA 3RWDA 1BQHA 2WWKO 3WXVH 3GBNL 1QBLL 1BQLL 3WFZA 4ZAKC 4PJIF 5JA9A 3LN9A 4NNPL 5ALCH 1VADB 4YDIH 3CH1A 4X7SH 5JHDA 3PHOB 2ZCKL 2DYPA 4G8IB 3QZWG 5B3NA 1K6QH 4PLJD 1EUTA 3BIAX 3G6JE 4NRXA 5DVLA 1IZJA 5HI4C 3RVTC 2NY4C 1AD9A 4PRAA 1ZVSB 1NEUA 2ZG1A 3LY6A 4FXLA 4O4YL 2WLZA 1S9WB 1C8PA 5D1QD 4AG4L 3LS5H 3O0RH 3IU4L 4GLRI 3G6JA 3TT3H 1DVFC 1T21A 4NN7B 4M1CD 3QT2A 1G6VK 3RJDA 3K74B 3PL6A 4F9PA 5C1MB 4TVPL 1S8DB 3NGBB 3F6LA 3RPKA 2AAVA 2HP4A 3ARWA 3QUXB 4HSQA 2XNAB 4HXBL 3K3QA 4JHAH 3V5HB 3FRUB 2G5BA 3ROOB 3JWNC 2IQAB 3KYOA 3OKDA 1JYVA 5GGSB 1FFOB 2ILLA 4NUJA 1R24A 4NQED 3OXSB 2C3WA 2D4DA 3X3GL 3WIHL 3KPLA 1ACYH 1VKXA 2PO6A 4HQQH 1AXSA 1P2CA 1JGLH 4NNXA 5SX4I 1E4WH 1W2KT 2WM0A 1WEJH 4EN3C 2DD8H 5C07E 4FXKB 1OT1A 3HCVB 4QTHB 1PFCA 5DD3L 4I18B 4JR9L 2APXA 4WDIB 2ATPB 4M7JL 3CVHB 2J88H 2EDXA 1DN0A 4P9ML 15C8H 1IQDB 3SE3A 1J0IA 4EI5C 4YWGL 1QD0A 3NZ8B 1M71B 3P11H 2P5WB 3O3DA 3DUSB 2EIDA 2VE6B 2FH8A 1GL4B 1R0AL 1M7XA 5TPWL 3SQOH 3CSGA 5IF0A 1N6UA 1NCDH 4QYOB 1DQQA 2H6PB 5F44A 3DX9A 3O6KH 2GEEA 1JGDA 4PPTA 5EU7C 5FOJA 4KRNA 5HTSA 2R1YB 3BAEH 1UA6H 4XXCA 1G9EA 1JK8A 1XCQB 5EC1B 1VFBB 2QKIA 5D70L 3CXHK 3T0ED 1WT5A 1QLFB 3WE6A 4M7KL 3AS0A 3VG9B 4XMPL 4I0KA 1QQDB 4RQQB 1CG9B 4Y5YC 3FKUS 3V4PL 2ARWA 4X6FB 5D8JH 4HUUA 5D9SB 1F3DJ 5GGRB 4PJ5D 1DFBL 3LD8B 5CILL 2J8UB 4KVNH 1CGUA 4I0CC 4LRNL 4C57C 4QXWA 4LAJH 3KR3H 4ZTPL 5JR1L 1AC6A 1KJVB 2EH8H 1F2QA 3NFSH 2WINB 1S7WA 3VWKB 1HXYB 1FQ9C 2YN3A 3QAZB 3WS3B 4JFYB 43CAB 4GMSH 3LB6C 3VXME 4ZPVB 5SWZD 3UTPD 4HT1H 5IMKA 2B1AL 3MA9H 4JG0H 3GSVB 4NRYA 4R96A 5D93C 2EH7L 2VXUH 1E27A 3DHJA 4BSVA 4P2RE 3IKKA 4CU8A 5JHLH 4BFGA 1UKQA 3QIBA 2W0FA 5TDOB 1N5YH 5E94B 2FBJL 3VMNA 1T66D 5E03A 3ZT7A 4CMMB 2YRPA 1X9QA 3GHEH 5D1XB 5IMLA 1N0XL 4F33A 5IMMB 3UZQA 3ARED 5K9JL 1LDPH 4N0CC 3EO1B 3OZ9L 3B83A 2P8PB 1OAYL 1ERNA 3TA3D 2I27N 1T7XA 1Z0NA 1Q0YL 4HHAA 5D5MF 1E4KC 1N64L 2VDPH 1OPGL 2V2WB 2VITB 3K4ZA 3LN5B 4Z7QE 3R1GL 4U1IA 4PJXB 3CLFH 4OUUB 1FAKT 1CFQA 3F58L 2VXVH 4OGYL 3MYJA 4BQCA 5FV2A 3ZDXF 1IAII 1F2XK 2MOVA 1JPTL 3JTSB 4MNQE 1P6AB 2JCCE 1U3HC 4OTXL 5TDNA 3I3BA 4JM4L 2ADFH 1EGJL 1UEYA 3Q5YA 4MNQA 4RX4A 1MPAL 2JCCA 1DUZA 3LKPB 1LO2H 1JF1A 1E4XH 3LKNA 3KPPB 4X80L 5FA4A 1KOAA 2DQGH 5EUKA 1CGVA 3L7EA 3WHE0 1YMHA 3E2HC 1KJ2H 3FN0H 3VA6A 4PRHD 3V0WL 2VNCA 4XWOD 3O3EB 4OCRH 3T0XA 4K3GA 4JPVH 1Z0MA 3ILQC 2BVEA 4U1KB 3FZUC 3VD7A 1KEML 4F9LC 1MOEA 1H3GA 4GXUN 3B6SB 3GB7A 4YR6B 4DUVA 5FYKD 2P47B 1NFKA 4M8QB 5KVGH 4YXHH 2JB5H 1S9YA 2Q3ZA 1NDMB 4EIZC 2PTVA 3DIFB 5JXAH 2VXSL 4K23L 2N4IA 3AAZB 2N7BA 5JW4N 1BWWA 3NTCL 3TCXA 4XP9H 1YEDA 3BGMA 1E6JL 8FABB 5CIPA 4IOIB 2I07B 4NN7C 1UB5A 2Q3AA 4WNQA 2EDYA 4LHQB 5T1DH 4D0CB 2I5YL 4ODHL 3U7WL 1FDLL 1R5IB 3KYMB 4Z7UE 3JTTA 5C3TA 3QUXC 4PJ8B 5BV7B 3OKKB 3GRWH 4KKBC 4FG6D 3C08L 5L2KB 2QQKL 5I8CA 3P3YA 6CGTA 5IG7A 2VXQH 4LSVL 4Z0XB 2G5RA 5ECJE 1MHHA 1ZLWH 3RNQA 1HXMB 1CK0H 1OVZA 3S3SA 5FECA 3W0WB 3P77A 5KSVB 1R5VB 2XRAL 4QHNB 1UXSA 3GKWL 5CMAB 1RURL 1NC4B 5DJ2B 1ED3A 2NNAB 3L3HA 4MJ6B 4Q9QH 1GC1C 4I2XE 5FYKH 4LHUB 1AO7B 4KJPC 3FQUA 4LSQL 1MHPL 3T09A 5C2BL 1ZT7A 4D3CH 2BDNH 4GH7B 35C8H 3MBEB 3VE0B 5DEZA 1BMGA 1FZOB 2LVEA 1D5IL 3VFUB 3RGVB 5K9KB 3MGAA 3FOMB 2CIIA 3C2SA 1NMAL 3FO0H 3UX9B 1EO8H 3P4MB 1QO3B 1EO5A 5IWLC 4HWZB 4JDZB 5FM5M 3DECA 4JGJA 4AT6B 1F11B 4OF0A 3SGEH 2PYFA 4ZS6D 2DAVA 4JGMA 5F9WC 3OQ3B 3BO8A 1UCBL 3D9AH 1D5BA 5IB4B 3HC4H 1QFHA 5GS0D 3G5VA 4XCNB 4QT5B 5ALBH 2H2PC 4F80A 5GSRB 4YHNB 3SDCA 2WMPA 3DLQR 4ODUA 1O5DT 4PJGF 4XNYH 3T0AA 1FGVL 1RJYB 4Z76A 5ESVA 5KVDL 3DTXB 3EHBD 4JM2A 4RWYH 1ZGLM 1MWAH 1A7PH 1G7MB 4ZFGH 2PCPB 3VG9C 2ZZUT 4QWWC 4PV8A 4KJWD 4KKAD 1DDHB 3IDJA 2WUBL 1X4ZA 2PW1B 1FAIL 1PX3A 2ZG3A 5DMJB 2E9WA 2C1PB 1VFAB 3LD8C 4JO2L 4HF5L 2SEBB 1F58L 5JLZA 5E9DB 5DJCB 3B5TA 4M48L 2OBGA 3CNKA 3QI9D 3HE7B 1JMZA 4YBLB 5FUZL 2DQDL 2BOBA 1VENA 4QHKI 4BSWB 2PTTA 3H7LA 5CZVL 4N1EA 3VCLB 1MVUB 1DANT 3BYYA 5FK9A 4JRXB 5EOQH 2EDWA 1ZANL 1HEZB 2E6QA 32C2A 4U6YA 4Y2DD 5I1CH 3OJMB 1FL5B 1UG9A 3C5JA 5LXGH 4P2OC 4N90D 4PJ9D 3ZE0E 4C54A 4JFFE 3BHBB 4E5XA 5DMYA 4P46A 5FYKU 4YHPA 3PWLA 3L95A 4D9RE 2VIRB 4PJAE 5LGKA 2XA8H 5HJ3A 5I8KH 4Y4KB 3RI5F 5KVFL 3SQBA 1Q9KA 2C4XA 4JFFA 4NKOA 3O9WD 3ZTNL 4BQ8A 1G6RH 1E4JA 1VCAA 2DICA 2R0KL 5D1XC 4O2EA 4P3DA 3O6FB 4PJAA 5GGTA 3MV9B 4OLVH 1BF2A 1U8OA 4LCCA 5T1LA 4LSTL 5B8CC 5CKGA 3BW9B 4OGAD 1UWXK 3K46A 3RWDB 2R4SH 3AS2A 3C60C 3SKJL 3J7HA 5HGHA 2AQ2A 2UZXB 2IBGA 2QADB 4Z7QF 4LSPH 3CH1B 3NCFB 2AJUL 5IEHA 3D69A 5JHDB 1YY9D 3FN9A 2DYPB 1A7OL 1JYNA 3LQAH 3STLA 5MI0B 3WSQH 5KJRL 3GMLA 2IGFH 1VGEL 5HVFB 4HUXA 4NRXB 5DEFA 1CL7I 4RAUA 4U1JA 1MAMH 1AD9B 5DSCA 2Y4SA 3Q3GA 4OFKA 1EMTL 4RNRA 2D7OA 4KZDH 5CINH 3EJJX 1KIQA 1MNUL 3KNBA 4XI5C 1NBQA 5I0DA 2MPAH 3WUWA 5F3BA 3G6JB 1T21B 2E9IA 3ZMRA 4XMKH 3WL9A 3I50L 1IE5A 5E2JA 3PL6B 5D7IE 1PYWA 1MCCA 2GTWA 4XPFL 1KTDA 4JQXA 1AR1C 5JQ6L 2AJ3A 3D5OF 3DARA 3PQYE 1JN6A 5CWSA 4GAGH 5EUOF 2HWZH 2CKBA 2ZUQB 4PP1D 4YX2H 1F3DH 2FIRT 4K7PY 3FQNA 3F5WA 3NZHL 1OGTA 5D7IA 1MFAL 2RQ8A 3WXWH 3WDJA 1HK6A 2G5BB 3KYOB 3OKDB 4MGXA 4ONFH 3MLZL 4NUJB 2X1XR 1R24B 3PQYA 3KPLB 3GNML 1H9VA 2DL9A 2CUIA 2HH0L 3C2AH 1VKXB 4M8VA 2PO6B 2BY0A 5L2JA 1AXSB 1A47A 3C8DA 1P2CB 4NNXB 2N56A 4LVNC 5ELIA 3ARBC 3OJDA 2I9LA 2H1PL 4X83A 4JRYE 3U82B 5GRVL 4LGPB 4XVUC 1BVLA 1A6VH 4MWFA 5GGTL 5GGVL 5IBTL 4K94L 1DN0B 2CUMA 4RMWA 4PJ8C 4PRIE 4Z7UF 4JRYA 1YEGL 4Y8DC 5BVPL 2E7MA 5IHZB 2MKLC 3O3DB 4R90L 3HZKA 1V5JA 2I9TA 2XN9D 5EG6C 4KI5E 5IQ7H 2PYEE 1RHFA 1MFEL 1RPQA 4QRRE 1XIWA 5IF0B 1A5FH 2BSTA 2VO5A 3DX9B 2XQBH 4CRPA 2JKXA 4FN0A 1JGDB 4IRSD 4KQ4H 2WNGA 4QOKD 2M8XA 1KCLA 2PYEA 3AXLB 2VMFA 1JWUB 4QRRA 4E9LA 2DQTL 3TNMA 5B3JF 3OMZA 2QKIB 2YN5A 4Q9RL 5EWIH 3BDXA 4KV5F 5CD3A 3MBEC 2VLMD 4U0RB 3WE6B 2R56L 1JZ2A 2W07A 4JFDE 4M9PA 3SJVE 1DBML 1J86A 3HNSH 3ZKMD 4G8FA 4U6VH 5J3HC 2B7DT 3VXNA 3T04D 2WUCL 4HUUB 5BJTA 5KTEL 2H41A 5I18H 2DRUA 4JFDA 1M05A 3TESA 4I4WA 4JREC 4BKLA 3SKMA 1G9MH 1PDKA 1T2QH 1CLOL 2VSCA 2Y7QA 4I3RL 4JPIA 4HWEL 4B5EA 1DQDL 1I85C 3SDXE 1E6OH 1S7WB 4G6MH 4IOFD 2OJZL 4KI1A 3NVQA 5I1KL 1BOGA 2EKJA 1J12A 1MI5D 5DUPH 4Y4FA 3VW3H 5GRXG 4Y5VC 1ZVYA 5EBMB 3SDXA 1BM3H 2FX9H 1IQWH 3M1BA 1MVFA 4LOUC 2X4SA 2XZAH 5M7QA 2B0SH 5IMKB 4XP6H 2XFXA 4NRYB 4HJJL 5HVHB 1HIML 3S36L 3I6GB 1E27B 1MCIA 3HMXL 4BSVB 4EUPG 1U95A 3DVIA 3QIBB 4KKLD 3SHSA 1KENL 2W0FB 2DQFA 1FE8H 1N6VA 3EGSA 3NA9L 1LD9A 1DBBH 3HE7C 3BN9C 2R4RL 3KLHD 2MMXA 3JWDL 4YBLC 4Z0BL 1NMBL 2ZUSA 3RKPA 4OFVA 2VDNH 5IMLB 3QQ3A 5LBSL 4F33B 3VXUA 5DO2C 1RAMA 3QCVL 4Q9CA 1CXKA 4HIJA 4WI7A 5E0QA 4AH2A 4HHAB 4JDVA 3NPSC 3Q1SL 1OAQL 4U1IB 2LV4A 3IDNA 3TZVA 1CFQB 3ZDYE 1Z9OA 4F37K 4P3WA 3FAWA 3EFFA 3O3BB 3MYJB 5L6YL 4J6RL 2FX7H 3ZE0F 3WV0A 5DK2A 2F9BT 3SCMA 5CGTA 4ZS7L 2IH1A 4F58L 3MLTA 4Y4KC 1TZHA 5TDNB 4PJAF 5EOCJ 5IBLD 5EOTB 1A3RH 3IJSA 5T3XD 1A3LH 4J4PC 2YS4A 4JKPH 1M7DA 4MNQB 2JCCB 1JRHI 3LRGA 1DUZB 3R0NA 5IT2L 3RTQA 1JF1B 4GRWF 1Z3GL 4RISL 1I8KA 3LKNB 1HCVA 3ARPA 3VRJA 3UPRA 5FA4B 5IFAH 5EUKB 3T3ME 4RMUA 3L7EB 1I9JL 1YMHB 3FTGA 1AC0A 4X9IA 4WI2A 4OCLC 4NQTA 2YPVH 4XNXL 3V4VL 1OP9A 1TNMA 2EDBA 3LZFL 3I3EA 2QHLA 3JVGC 5DK0B 1MIEL 4UNUA 3GB7B 2NXYD 5MI0C 4FQJH 2YUVA 3BKCL 3LPFA 3U48A 2A77L 4DZ8A 3MJ9L 3GI9L 1FZMA 5CEZL 1F4XH 1YNTA 1S9YB 2DQHH 4AEHH 3BPLB 4OLZL 1A8JH 1ACZA 4JO3H 5F1KC 4OQTH 1BJMA 2R15A 1YEDB 3BGMB 1DBAL 1MCOH 5CIPB 1L4IA 4WNQB 2ICEA 3RGHA 4F9PC 3DRTA 5DC9B 4KUZL 1PLGH 1P7HL 1TTFA 3LKQA 3JTTB 4LLQA 3GBLA 2FIKA 1J1PH 3S88H 1RZKH 5T3XH 1BAFH 5ICYA 3E1F1 3HE6C 5I8CB 3O8XA 4OD2A 5IG7B 1WAAE 4APQC 1JPST 4FFWC 4BQ9A 3S97C 1VPOL 4Y5XC 1B4RA 1MHHB 1YNKL 3RNQB 1IKNA 1QSED 1TXKA 5JMRA 3MPCA 5FECB 1XAUA 3L3KA 5T5NF 3P77B 4UOW0 3VFTA 1WAAA 1KFAH 4P4KD 4M6AA 4EOWH 1GIGH 3VFNA 3N1QC 3MRNB 1A0QH 3VFMA 2A83A 2Z35A 1ED3B 2NW2A 1NUFA 3QDMD 3FQUB 3U30B 1SY6H 1YEFH 1ZT7B 4H88H 1MFBL 3QWRD 4YQXH 4HLZG 4FP8L 4DTGH 3G5XA 2CIIB 4DKEL 1T7WA 3GJEA 3H9YA 3LEXA 1U3JA 2X4QA 4NO0D 12E8H 3E3QC 1FLRL 5HHOE 3AMLA 1F3RB 2B4CL 3VXSB 3HLAA 3HHRB 4G8GE 5E2UL 1CDJA 2NY6D 1C1EH 1CGSL 3O2WL 3BO8B 1D5BB 4UNVA 2EIEA 1JWSA 1AI1L 5HHOA 3QJHA 3OAUH 4M3KB 3G5VB 3VD3A 4S1QH 2XXMB 3SDCB 4MZ2A 2RHEA 2Z31A 5F7UA 4ODUB 4AEFA 2VAJA 4Z76B 5ESVB 4ZAKD 4HUVA 4JFPA 1S7RA 4JM2B 4PIRF 4U0RC 1NH6A 3AU1A 1B90A 1P1ZA 1JGVL 1HINH 4PV8B 3VFWA 1B6DA 3FT2B 3IDJB 4HPYH 4HUWA 5E6IA 2COQA 5LGJA 3VXRD 4XB8A 1ZGLP 2FD6L 5HI4D 3RVTD 5JLZB 3S35H 5SX5H 4NO5A 1YEHL 5GS1B 5CJXC 2PXYB 3TYGL 4S1DD 3BMWA 2CXGA 2OR9L 2EXWC 3LH2H 4N1CA 1DVFD 4JDTH 3LHPH 1GGIL 2BOBB 1EHNA 2PTTB 5I1JH 4RGNE 2G60L 3WKNA 4D94A 3CZFA 3FMGH 5FK9B 4OF7A 4NHUA 3TH3T 5M95B 1UKTA 2BVPB 2DM4A 4PBWD 4U1SA 4ZOCA 4J7RA 32C2B 2UWEE 5TE7H 5HDOA 4TRPH 3MRFA 4FQ1H 3C5JB 3VDCA 2YPKA 1NEZG 5HVHC 1QYGL 3VFOA 4E5XB 4HJGA 4M4PA 1RULL 1F3JA 1QHPA 4XAWH 4P46B 2UWEA 3B9AA 1UVQA 3HNTL 3GMOA 4YHPB 3EYUL 3L95B 3PWLB 3QUML 4PB0H 3U1SL 5EIVA 5HJ3B 1HYSD 3C6LC 3S9DB 4DFIA 4F7CA 1R3KA 4JFFB 4NKOB 4OFYA 1P9MC 4EN3D 3SKUD 3VA2C 2AJYL 4O2EB 5DJ0A 4P3DB 4MAYA 1AGFA 2DTMH 3U83A 5DHVA 5KSAD 1U8OB 4LCCB 4Z7WA 5T1LB 3C5SB 4WV1B 1LEIA 1S3KL 2X4RA 1C5CL 1VACA 2AXHA 1FFQA 2DLTA 4LCYA 1QBAA 3D2UD 4ODVH 4POZC 4TPRH 4HBCL 4OF8A 4L4VD 1A4JA 1FCCA 5DZLA 5HGHB 5B39G 4GRLA 1XGRA 4JG1L 5IEHB 5B4MD 3F65A 2GCYA 3QISA 1G7QA 4FFVC 1GZPA 2OMNA 5KBNC 4ETQA 3STLB 5I0ZA 2UUDK 3GMLB 1JYXA 2X70A 4HUXB 5T33H 5DEFB 4UT7H 1IBGL 1S7UA 4RAUB 4U1JB 5DSCB 1KPVA 1OM3H 5JMOC 2CPCA 3RUGF 4RNRB 1KIQB 3QRGL 4LVEA 3UYRH 3KNBB 5F71A 1HKFA 4P5KA 5K93A 2G9HA 3WUWB 5F3BB 2ICWI 5D7LE 1IEAA 3D85A 3WL9B 1QSFE 1BBJA 4UZGA 5J12B 2BVQA 5EDXA 1PYWB 1JGEA 2GTWB 4LIQL 5C0EA 3EDEA 3DVNA 4UT6L 1NGWA 2GAZA 5CWSB 4IMLA 4OZFG 4MB5A 3EJYC 5D7LA 5KN5A 1OGTB 5D7IB 4R4NC 1PBYA 2IAMC 3PP4H 4H26A 5I15H 3MRBB 3CK0H 4OLWH 1PVHA 5HPOA 3F7QA 4LQFL 5ADPL 3DXAA 2WP3O 4JKMA 2AGJL 3S34H 2D03L 5J13B 5E1AA 4YPJA 5L2JB 4X0KA 1YYML 1QFUL 4DZBA 4O9HL 2V2TA 4HIHA 1ES0B 4OV5A 3UTQA 3OJDB 2I9LB 1MFCH 3IETA 2AK4E 2BSSB 1RJCA 3RA7L 2O61B 1DL7L 1BVLB 2CRZA 2L0DA 4MWFB 2ID5A 5DRXA 3UYPA 5FYJD 4PB9L 3ULVL 1V3MA 1YPZB 4JRYB 1NCWH 4PJEF 2AK4A 1OAXL 2GJ6D 7FABL 1IAKA 3CSPA 3OB0H 2BFVL 2UZIH 2ADJB 5ESQA 1FO0H 5I1GH 3HZKB 3BE1L 3KDMA 1YEJH 4QNPF 2I9TB 4GBXA 1NLDH 5CUSH 1L6XA 1QP1A 1FVCA 4A2LA 2YUXA 1XIWB 2BSTB 5C0FA 1HHIA 2AKRA 2Q86A 2YD7A 1EO7A 1T03H 4OZIE 5E2VH 2PYEB 3QO0A 4H25A 3U30C 2LU3A 3WEXA 2HRPH 5CD3B 4FQLH 1FRGH 2ZSWA 4P5TA 4JO1H 3L5JA 2EDHA 2XTJD 2R8SL 4G8FB 4W6XB 3RY5A 1FBIH 5DD1L 4DVRH 1QOKA 2JIXA 1U3HD 3VXNB 1N8ZA 1I4FA 3EJZC 4K7PL 5EOCH 1GVIA 2CGRL 4JFDB 1M05B 4RGOL 4LCWD 4LVHB 4BKLB 4TSAH 3SKMB 2Y7QB 3QFJE 3UTSD 4X7SL 4JPIB 5FYJH 2Z8WC 4PJDF 3MOBH 5TE4H 1RUPH 4NQEE 4LFHG 4QRPD 2EDDA 4XB7A 5D72L 4X7TA 4ZOAA 3Q0HA 1BOGB 5H94A 3QFJA 3FQXA 4NN5C 2DQCL 4Y4FB 4EDWH 5KZCB 3ZYIA 2VDRL 3ILQD 1U92A 3FZUD 1RUQL 4P9HC 3SDXB 4UUJB 3M1BB 2IQ9H 2X4SB 4AM0A 2HRLA 3CFEA 2XFXB 1X5LA 4WJ5A 3F7PC 2EEDA 2HT4D 2VDLH 3WNNA 3QEGH 1T3FA 2FSEA 1TITA 2M26A 1T83A 3EGSB 5GS1C 2PXYC 3ELAT 4C4KT 5DUMH 5F9OH 1LD9B 2EECA 2F5AL 1JBJA 3GZKA 4HKZB 1JGUH 4K8RD 1T6VN 1R3IL 3T65B 3VXUB 5DD6A 1E4XI 1ACYL 3G9VA 4N5EC 3D1MC 4O5LL 3QUXD 4HIJB 1QLEL 2QR0A 3GIZL 5J8OA 4AH2B 4JDVB 2X4PA 1ZMYA 4M1DH 1WEJL 2UWEF 2DD8L 3IDNB 3TZVB 3QA3A 3UDWC 3EFFB 3CFKA 4NZTH 1T20A 3QNXA 1QR4A 3VI3E 2J88L 4JEGB 3SCMB 3ZDZF 1LQSR 3GMMA 1FPTH 3CFJA 2IH1B 3MLTB 3KWWB 1TZHB 2OP4L 1XGQA 3IDXH 2AEIT 3AM8C 3IJSB 5E08L 4G7YL 3P11L 2QSTA 4PJ5E 2F5BH 4ZO6A 2UYLA 4HWBL 1M7DB 1JFQH 2NXZC 4NM4H 3RTQB 3O4OB 4K94C 5DEGA 3DURA 1I8KB 4I0PC 4LCCC 1A4KA 3L7FA 4WV1C 3VRJB 3UPRB 4P5MA 3AMKA 4PJ5A 3FTGB 5B38A 4Z95H 2W65B 5E5MA 5FAAA 3QQ9C 3EO9L 3H3PL 5L88L 2O5YH 2P5WD 4ZFFB 4W70A 1VSCA 3NH7L 3U7YH 1WZMA 1QR1A 3E8UH 4K2UL 2YA1A 1KULA 4CL7A 1AQKH 3RX5A 4J2XA 4MXQD 4DZ8B 3L3JA 5CJQH 1FZMB 2A6JA 2AQ3A 4F3FA 1YNTB 3SOBH 4FNLH 3BFOA 2H2PD 2YZ8A 2FHCA 4U7KA 2P49B 5F88A 2DQIL 5D8JL 1F6LL 4QO1A 1ZLVH 1F8TH 3HMWL 5KVMC 4YUEH 3D48R 4NN6B 4Y89A 1G1YA 4QWWD 3RVXC 2ICEB 1G0DA 1D5MB 3DRTB 5SX5K 5HD8C 4JQXC 3RRQA 3LKQB 4KROC 4LLQB 1KJ2A 2XV6B 2FIKB 4K3JL 4KZEH 2DQUL 2Z4QA 5C0NC 1MF2H 4S10A 1GC1H 4OD2B 5AYQA 3CVHH 4I13B 2BNRD 3VGAC 2HKFH 4GSDL 4YHKL 3AREA 2HVJA 3DX6B 4OLUH 4JG0L 2EO9A 1A14L 3SGEI 3S5LA 3L3KB 3PXHA 4NKQB 3VFTB 1LK2A 4DEPB 1AE6H 3WJLC 3BD5A 3VFNB 4OCSH 2W91A 3VFMB 3EYVA 2A83B 1I75A 2Z35B 1MRDL 1FZJA 2NW2B 2P48B 3K0WA 2Q8AL 2XKNA 4P2OD 2X42A 3RAJH 1K8IA 3BD3A 3P30L 4M7LH 5JO5A 3G5XB 1GGCH 2MCPL 1JZ6A 3EDDA 2C3GA 3GJEB 3LEXB 3S37H 3GRWA 2X4QB 3MRJA 3MMEA 1F4WH 3Q5OA 4G5ZH 3JWDC 1KLUA 5GGUA 2H2SC 3FFDA 4M00A 3O3AA 2RFXA 5D1XD 2DBLH 4IJ3B 5D6DA 2NZIA 1MCEA 4XVTL 4X99A 5FDYA 5FYKE 5HHOB 3QJHB 4JKLA 3VXTA 1KC5H 4HD9A 3MLVH 5AZ2H 4P2YA 1D5XA 2Z31B 4OZIF 3KXFE 5HYJE 4HUVB 2Y25A 1S7RB 3FB7A 2DF3A 4MAUL 4QRTA 1RU9L 2B1HL 3AU1B 5I30L 4NRZA 1KG0A 3VRIA 3VFWB 4NUGH 3FQWA 4HUWB 5E6IB 3VFPA 4RWHA 3KXFA 5HYJA 5LGJB 1CLZH 3O2DL 1TZGH 2XG5A 2X4TA 3WO4B 4QLRA 5D1ZC 4RMRA 3RL2A 1IILE 1F02I 4DGYL 4CU7A 2Y9RT 1RV6X 4ONGH 4NO5B 4PGBA 3FHAA 4P57A 3PWUA 4WFHD 4XI5D 5FYLH 4DKFL 3BX7C 2ZUXA 2BHZA 2ZUVA 3C9NA 4MXVF 4UV7H 3ARXA