2HT2D

Structure of the escherichia coli clc chloride channel y445h mutant and fab complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Synergism Between Halide Binding and Proton Transport in a CLC-type Exchanger.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 42
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht2D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht2D01
5CIPA 4XP9H 1WBXA 5DJXB 3VWJB 1TQCB 3HG1D 3BFOA 3NCMA 5IMLA 5FYKH 3HAEB 3QFDA 3BP7B 4ZSOB 3O8XC 1IGML 3VFWB 3CVHH 5JHLL 4J8RA 3B83A 4JM2B 4I2XE 1T89A 3HG1A 4HH8A 5IBLD 5LBSL 2P48B 4PRAB 2BNQB 5LWYL 4M7ZB 1WAAE 4UOJA 3WIFA 1JHTB 2YSSA 3PHOA 1DDHA 1MUJB 5I1IH 3SQOL 1F4XL 5ANMA 4RFOH 4ZUVA 4K3DL 3IJSB 1C1EL 3CDYA 3J8F7 3VDCA 4TSCH 1HHJB 1VFOA 1BVKB 2BRQA 1JYNA 3IDUA 4O02H 5DVOA 1T4KB 2N1KA 3ILQC 4HFUL 1YY9C 1S9XB 3WKMH 3T0EC 4WWKC 1DE4B 2EDYA 3U4AA 2ICEB 4APQC 4R7DB 1I7TB 4X4MA 1ZS8B 2MOVA 1S9YB 2DQDH 4Y5VA 1HINH 1KT2A 1UXWA 3B2VL 3QUYC 3JV5A 4PJEA 3M1BA 1G0YR 4ALAH 3KLHD 4KDWA 1BFSA 4BQCA 1AC0A 1FSKB 1CGSH 1JNNH 4HZLB 1K4CA 1NCAL 2VERN 3EJYC 4GW5B 2Z93A 3OBAA 1URLA 4DN4L 4JN1H 3BGMB 4B50A 1KNOB 5E03A 1NAMH 2DQGH 4MDJB 5BXFA 4M8QA 4V2BA 3PGCA 1KEMH 3MRNB 5EBMA 4YR6B 3LQZA 4OBSA 3DBXB 3DVNA 2JK5B 4PJBB 4WI9A 3MJ9H 4K2UL 5IM7B 3W0WB 5EU3A 2JJWA 1UGNA 3GIZH 5I74C 3AS1A 4WU7A 2XWTA 3PWLB 5CINL 3SDXB 2VZ1A 3PIQA 5C0DB 4MD0B 1RULH 1VEMA 3LRGA 3LKQA 4DZ8A 2XPGB 1Q0YL 3F7VA 4BQ9A 1KLGB 1CYGA 2APVA 4X7EC 4MJ5A 5JNYB 4GKSB 4XGZB 2VDOH 4OT1H 5IFHH 4DN3L 1BOGB 2K7PA 5IMOB 3WCYA 1F3RB 4HH9B 5DJDB 1AD0B 1AP2B 3O6KL 4JFPB 5MERA 1R5IA 1LE5B 2VQUA 1I8LC 3EYQD 3BP5A 3N06B 4TQEH 5GRVK 1AY1L 4W4OC 2X9WA 1CXLA 2LTQB 1D9KB 5DD3L 4Y5XA 1VERA 5B39B 4OZIA 3MBXH 3QCVL 4XB8A 1RJZA 1CXHA 5EIVA 4Y2DD 4WI5A 3TFKC 1FG9C 3ARFC 3SDCB 3SO5A 3NCYP 5ADPH 3HNTH 3H3KA 1BIHA 3C5JA 1L7IH 2FIKB 3BZEB 4EOWL 1SYVA 4LPVA 4Y2DA 2OI9C 4E41B 4LSTL 4FQJL 4LRIC 2X09A 3IFOA 3H9ZA 4N0YL 3STLA 1T1XB 1N0XH 4Y19D 5F7YC 5ICZB 4OF6A 3NFNA 3V4UH 5GPRA 1B0GA 3AB0C 3J7HA 4RX4A 3MYJA 1RURL 3ZL4H 1DBAH 2I27N 5E94B 1CZ8H 3KDMA 1EMTH 3MV8D 5HYSB 4XCEB 3R1GH 2DYPA 4P46C 4PJAE 3OKNA 5DJ8A 4MXQD 5K33A 4Z7QF 1BZ9A 5I1AB 4YC2C 4UU9A 3MGAA 3MV8A 4WHTB 3BD3A 4F7PB 5C6PB 4JRYE 1AJ7H 1OAYH 2GSIB 3QXDB 2OK0H 2H26A 2RCSL 2P5WE 4ZFFB 5FK9B 3AC0A 1OWWA 5HGHA 1HCFX 2M2DA 3KJ6L 4ZQKA 3BZFB 4WJ5A 1A7QL 2QSCH 3QAZC 5GISL 4PJIE 1P9MA 5HYEA 1HSBA 3D69A 1QLEL 4U6YA 3LKPA 4L8BA 3X12B 1J1PL 4LLUA 2BCKB 4PTUA 4RDQG 3EYSL 4F37K 1DL7H 3EOBB 3IAGC 4FHBD 4JEGB 1G7LB 4GLRH 3FOMA 3VMOA 1KLUB 4JO4L 3S37X 1AGBA 1XF5B 4UQ3A 5C0GB 1S78D 1UACL 2ENSA 2G2RB 4LNVA 3WO3B 1MH5B 1U8MA 4QTHA 5IWLA 4HLZH 4RAHA 1ZT7A 2K3TA 4GAYA 4FTVD 12E8H 4OD3H 3H0TB 1W0YT 5TGBA 4Z7WB 3CC5A 1OAXL 4W4NA 3C87A 2JJSC 1MHPH 3L3JB 2FBJL 2OMBA 3TT1L 1EO5A 4FTVA 1A1MB 3W9EA 5IB5A 4G3YH 1N8ZA 4YXLL 4X5WA 1A3LH 2QR0B 4N9GA 1KIQA 1QACA 2NY6B 2YA2A 3U0WL 3HLAA 5D7JD 5FOBA 1NGQH 1JPFB 1JBJA 1KCRH 5FUOH 1KULA 3LN4B 2E9IA 2B1AH 5C08B 1LE9A 3OV6A 5IB1A 3O4LB 1R3JB 1G7MA 1P7KA 1VACB 4P9ML 1N5AA 4MA8H 3WLBB 2LU4A 4R2GC 4RGNB 3G08A 1PG7X 1R0AH 2W65A 1DANT 2Q7NA 1G9MC 5EU6B 1N7MH 4RDQF 4Z7OF 5D9SB 5MEQA 3CFBB 3LZFL 4RRPG 4KK6D 2ERJC 5IVXB 4YDJA 1YMMD 3KLSA 3B9DA 4TOYL 1WIPA 3C5ZD 2X1QA 4JZJC 2ZOLA 5KSBE 1OTTC 1YMMA 1CD1A 3WFBH 3SE9L 2CDGB 4G6KH 3S5LB 5E6ZA 3C5ZA 2E9JA 2YD8A 2CMRH 4NWTH 3DX9A 3MJ7B 3RTQC 2MCPH 1FZOB 2JF1A 4J3OC 3BRGC 3MFFB 2A9NL 2CGRH 4LCIH 3BH8B 4LNRB 5A1AA 4EN3B 4GMTH 1XF4A 4LOUD 1H5BA 5J06A 1UQSB 5D7LD 1AD9B 3DJ9A 1EXUA 4KWUA 4QCIA 3QH3B 5KVEL 3VFOB 4BELD 2XI9A 4MQXD 2IQAB 4NHUB 2VDLH 2AJSH 2VWEE 3QDGE 5I1LB 4KV5F 4MDIA 5H2BA 4F37F 5C0NC 3QDMD 4X80L 4FZ8H 4HLZG 4TNWK 4C83B 4N1CA 1GZPB 4V2CB 5KVGL 2V2WA 2VXQH 5JOFB 4QRQA 1P6AB 2XWJA 3PF2A 2CK0L 3QDMA 3HPLA 3PP4L 4KKLC 1UVQB 4PGBB 3QUXC 1BMGA 4Q0XL 3GB7A 1F4WL 2HFEA 3QIUB 1JF1A 2G5BA 3V8OA 5KS9F 1JHKL 5E6YA 1OP3K 4JVPA 1BBJB 4OLXH 4CVZA 2WLZA 4OI8A 4U31A 1A2YB 1CLYL 1MCRA 3T04D 4NRYB 1E4XL 1YUHA 2B1HH 4QHMB 5KJRH 5BZDA 3QPXL 1R3HA 1HXMA 4A6YH 5C6TH 5KW9L 4JFZL 4PS4L 4NQXB 2X9XA 2AQ3A 3SKOB 1DUZB 2CKBB 3TYGH 1UC6A 4JG0H 4NO5B 5I73C 2GSGB 3HR5A 4D9LH 4R9HA 3GJEA 4FP8L 1JNJA 1QHPA 3NIFF 4WCYL 4EDXA 2H32B 1A7BA 2LABA 4Q9RH 4D0BA 5HJ3B 3B4NA 2C3XA 4W6XB 3U9PL 4HIEA 5DHXB 3VWJD 4J3VA 4PJ7B 1UYWL 1YECH 1C08B 2XTJE 3NCJL 2DL9A 4XX1E 2HFTA 2RR3A 1X4YA 3VWJA 4OGXH 4XNXH 1G9EA 4XHQA 5CSZA 5KVFL 3EYFB 1NBZB 4HMDA 1S8DB 3RX8A 2BNQD 4GXUM 3HAEA 5EZIL 3BP7A 2PKDA 4DKEL 3VFWA 1D5XB 2FWOB 1MFAH 3JUZA 5MHSE 4HG4K 5IR1A 4PRAA 2BNQA 5T3ZD 2DQFA 4QGTA 2Z92A 4EI5B 2ZG3A 1PLGL 2OYPA 1B0RB 1JHTA 3LEVH 3A6OA 5TF0A 4OLWL 4RRPA 3VG9B 2H2SD 3FFDA 5JIHA 5T1KB 1CWVA 1UZ8B 4LBEB 4HS8L 2Z31B 5DO2D 4LSRL 3IJSA 1RZJL 4PGCB 4OZGF 4M7KL 3QUMA 4WEUD 3WN5B 4G8GE 3IDYB 3JWOL 5I2IB 5JHDE 2ENYA 3ARGC 3P9MB 2EO9A 4I2XB 1LK2B 1UH4A 4HK0A 3MRBB 2EC8A 4HSQA 3MODH 3VI4F 1J0HA 1S9XA 3ROLA 2VITA 3S88L 1DE4A 3ARBB 1T0MB 1X5JA 1JGDA 2P44B 1I7TA 3DV4A 4KQ3H 1TTGA 4TNWF 1ZS8A 1S9YA 4BSVB 1IEAA 3Q6GH 5A3IC 4G5ZH 3BHBB 4FFYH 4JFXB 4QHKI 2NW3B 4TVPE 1NLDH 4D8PB 1CL7I 4WFGD 3CK0H 1G7IB 1T7YA 4J6RH 5F88B 1CDGA 4MNQE 4HZLA 4S0SD 3QHZH 3BGMA 1EAPB 4NGHH 2YXFA 1KNOA 5JMOC 1OL0A 4MDJA 4NO0B 5AG8A 5E08L 3MRNA 5GGRY 1J9CT 3DBXA 1KC5L 2JK5A 2ICCA 4PJBA 2EEAA 4WFHE 4I77L 3W0WA 2H3NB 3MUJA 1MEXL 4F80A 3GI9H 1Q94B 4LSPL 3TCXA 4JFYA 1KG0B 1J87A 3SDXA 3KYKL 1UT9A 4H1LG 5C0DA 4NP4H 3RVTD 4HXBL 5LG1A 4ZFGL 4MD0A 3KPLB 2XPGA 4IRZH 5L9DL 1IL1B 3V6ZA 1KLGA 1GSMA 4E42B 4HJ0D 5JNYA 4GKSA 1U92B 4XGZA 3O2DL 2AXGB 5J13B 5IMOA 4KZDL 4HH9A 5DJDA 1AD0A 5J11C 3HI1B 1AP2A 4JFPA 4XBGB 5KANG 1LE5A 2XN9E 1ZLSH 4CW1B 2HWZL 4I48B 4TPRL 1T89C 1CDIA 4FQ1H 4YDKH 2EXWC 3LRHA 3SDCD 3RNKB 1G9MH 3OXSA 5B39A 2YBRA 4M62L 4I1NB 5E95B 2DLFH 1IC4L 4E41D 4HBQA 4O4YH 2W1NA 5I30H 3SDCA 4UIMB 1CIDA 2AW2A 5KG9B 4M9OA 3BZEA 5HHNB 3T8XB 3QNZA 4E41A 2VYRE 4U6TA 2XNAB 5HVGB 1MPAL 3MXWH 2BVUA 1T1XA 1DQML 3BO8A 4PRNB 2XZZA 3UZVB 5ICZA 2Z8SA 3L5XL 3B9KB 1P1ZA 4L3CB 4IOFD 1YNKH 4JLRB 1NKOA 5E2WH 1KEGH 1CFSA 4Y5VC 3NABL 1CU4L 15C8H 5E94A 5E99H 1KB5H 2Y36L 3UX9B 5DRWB 2PNDA 4QEGA 4EVNB 2NZIA 2CXKA 1I9IL 4WEBH 4OGZA 1LNUB 2GTWB 2HT2D 1WLHA 5GS0L 2FEDD 1YY8B 5I1AA 1YYLH 4WNQA 2DAVA 4NZUL 4OCLC 1W72H 4WHTA 4F7PA 2WUCH 4M43L 5T3XH 1CD0A 4HUMB 1B88A 3KXFE 1PY4A 2GSIA 3QXDA 3KR3H 2ATPA 5C0BE 1IILE 4ZFFA 4WHYH 5FK9A 1CFBA 3BZFA 4YBLC 1A6TB 1AR1C 5EU4B 4LP4A 25C8H 2ZUUA 3WDIA 4XC1L 3GNMH 4XMPL 3SGDH 3X12A 1VFBB 3GRWH 3KPPB 5MP6H 3W39A 2D2OA 4RA0C 3O9WB 3EOBA 1QBMH 4PJAB 1N4XH 1HHGB 1BQHB 1TJHL 4BZ2L 1G7LA 1A8JH 2GI7A 3RPIA 2FHBA 3AGVA 1KLUA 3VFVA 1XF5A 5KVDL 2X4OB 4JRYB 4RMTA 1KTLB 2P5WB 2E7LA 3O4OC 4H5SA 4M5ZL 3INUL 4U0RC 1MH5A 3Q2CA 1OQOA 4HUWA 4PJIB 4X9IA 3UTZB 4L8SB 5D5MF 5BMFL 5D2LE 4JPKL 1MJ8H 1A3RH 4Z7WA 5LXGH 4NPYB 1U41A 1XFPA 2I60H 2VE6B 1E27B 1TVBB 3MOAH 4H1LA 1N64H 3ORJA 3SKUD 3TWCH 4FFWD 3OKKB 4GXUN 5C08D 3DUUB 2X41A 1ZGLM 3O4LD 2QR0A 2A6JA 3BAEH 1T83A 4AEIH 1JPFA 5DUMH 1H9VA 5IJKA 3T0WA 1ZGLB 2R9HC 1IKFH 4RGND 3OAUH 5C08A 1NUNB 1YJDL 2GYSA 1BAFH 3O4LA 3IRZA 2A1WL 1N6QL 1VACA 1ES0B 2FECL 5EU6D 4J4PD 2L0DA 2XT1B 3WLBA 4KVNH 4G8EB 2CXGA 5IT2H 4YFDB 2VXTL 4M4PA 1NFIB 3G5XB 5BVJB 2ZUXA 2WBKA 3UDWC 5EU6A 3MJ8A 4J4PA 5GGTL 5L2JB 4XHJC 1HHHB 1OY3B 5D9SA 1TQBB 3CFBA 5EWIL 3V0VB 1M71A 3R8QA 3PWUB 5IVXA 3ZKQD 5BCAA 2FR4B 4XWOC 4W70A 1YPZE 4YFLI 4OD1H 5D5MA 3GI8L 4YIQB 1WZ1L 1IGFH 1GC1L 2NY2B 3GSNA 1OTSC 3S5LA 1NCDL 3VXOA 3TH2T 2BFVL 4LSVL 4AK1A 3MJ7A 1WC7B 1CDJA 4RFNC 2BVPB 1S9KC 2R0WL 3MFFA 4JR9L 3RVUC 4PR5B 1DFBL 3MUZ1 4LNRA 1P4BL 2Q8BL 3CSYB 1YA5A 1K6QH 4JGUA 3T2OA 3BDYL 2DWDB 5CFHA 2ADIB 3CZFB 4LP5A 1UQSA 3NTCL 4CBPA 5DUPH 4NN7C 4UQ2B 3QH3A 3VFOA 1HKLH 5KSBB 3N1MC 2IQAA 2W9EH 4NHCL 5F7FA 3F65A 3RZCC 1FO0L 3P9LB 5HI3D 4C83A 3B2UD 3ULUE 5GS2D 2MCG1 5JOFA 3P4NB 4EIZC 2GY5A 1H3PH 4NQDD 5EBWB 4KUZL 4G8IB 4D9QD 1G7HB 3ZMRA 2LE9A 4X8XA 4F9LA 1UVQA 1YNTB 5D1QD 1D5IH 3QIUA 2IH3B 4XVUD 5DRNB 4EI6B 3FQWA 1GHFL 3WXWH 3QZWB 3QDGB 3CIQA 4JM4L 5AWNL 1A2YA 5B38B 1JTTA 4X6DB 4NRYA 3NIDF 1MREL 3OJDB 4QHMA 2A74B 2E7CA 1TTFA 4PJCF 2YEZB 3DYPA 4NQXA 3H9YA 4NM4L 4P99A 3SKOA 2Q3ZA 4ZO6A 4NO5A 1CGYA 4CN4A 3TBSB 4HEPG 5D7IE 1XR9B 4LLAA 5CJXC 1LP9F 1JWSA 1WTGT 2H32A 4WFED 5HJ3A 1MHHB 3VWKB 1MCFA 1I9EA 1C08A 2YK1L 3RL2B 1BJ8A 3VRIB 1BFVL 3DRQB 4MCZB 2DTML 1MCWW 3EYFA 1FORL 1S8DA 1QNZL 5F9OL 1PFCA 1DR9A 3TYFB 2A6DB 3CSBA 2FWOA 4HIXH 2PXYC 4U1MA 1WWBX 3P73B 2AK1H 5T1KD 2IALB 1FNHA 4GFTB 4EI5A 2XTJB 3F7RA 1IAOB 1KN2H 3H3PH 4NSKB 2V6HA 4ESKA 1IBGH 4DZBB 3T0AA 5FECB 2HJLA 5T1KA 5DTFB 5ALCL 1ZVSB 1GOGA 2W0FB 3BP6B 4LBEA 1MNUL 4PGCA 3WN5A 3OSKA 2Q76B 2H41A 4JFHE 5I2IA 1RUQL 3R8BB 2OZ4L 4Y4KD 4F7MB 4I2XA 5FCSH 4YUEH 1LK2A 3HMXH 2E27H 4YHNB 3MRBA 1K8DB 3FL7A 1WAAA 2WWKO 5T33L 1NQBA 2HYMA 3T1WA 4LQFL 1LP9A 4Y4KA 1T0MA 4ONGL 4P23B 2GIYA 4EXKA 1ADQL 1B4JH 4DGVL 1NMAH 4KDTC 5D8JH 5TDPB 4LASL 3BHBA 5CGYD 2B0SL 4WHCA 4GQPH 3SKMB 3HE6D 3OR6A 4JFXA 5JOPD 2NW3A 3K2UL 4G8GB 4WI6A 4NBZB 4D8PA 2ARJB 5JHDB 1T1ZB 3PWNB 1G7IA 2Y07L 4L5FL 5F88A 1QLRB 3QRGH 4HIIA 4RNRB 3HE6A 4ZS6D 4NO0D 5IG7B 4Q9QL 1MRFH 3MNWB 5DQDH 1UB5B 2OQJA 3TBYB 5TQ0H 3ZDYE 4NFBA 2HLFC 4GRWE 1TZHA 1D7FA 4L4VE 4NBYB 1FNGB 4NO0A 4P5TB 3QQ4B 5CJQL 2OTPA 5F1IB 3LD8C 7FABH 4FABH 1CLCA 3WXVL 2VN4A 3BQUB 3E3QC 1IVLA 4OQTA 2EE3A 4UT6L 4DOHE 2KPNA 1S7QB 3WFCH 4TRPH 4LCUB 4ODUB 1C5BL 4MNQB 4G6MH 1Q94A 3IKCB 4MS8D 4O5LL 2D9CA 5HTSA 3EO9H 4I5BA 5GJSL 1KG0A 1OM3H 4PG2A 4KDVA 3QCUH 3BKCH 3GHEL 2MFNA 1P4LB 1W0WB 4XZUB 5D72L 2HMID 3LN5A 1MCPL 1MCEA 4U3XA 3FTGB 1JYXA 3KPLA 5EOQH 3AVEA 4RMQA 1KACB 2XACC 4NJ9L 2VAAB 4E42A 2XICA 3GIVB 1U92A 4AMKH 1NDGA 1A7OL 1DQQB 4ZTPL 4XBGA 5DEFA 4JM2C 4RGOL 4CW1A 1J1OL 4I48A 3RKPA 1UCBL 4TTDC 4KRMB 4AYFA 3RNKA 2IBGA 1LVEA 4TSBH 4KMTH 1A7NH 1VSCA 2VH5H 3MLSL 4LSSL 5JOEA 3H3BC 4HPYH 3DWTA 4I18C 3PL6C 5KG9A 3ZT5A 5HHNA 1LDSA 2A9MH 3T8XA 5HI5C 1X5KA 1ZA3A 2IGFH 3S37L 2HT3D 2XN9B 1PKQE 1JE6A 3V6OE 1II4E 1Q9OB 2WV3A 5BV7B 1XIWB 3QQ9D 2NYYD 1DBKL 1KJVB 3HZMB 4LCYB 5DD5H 3RKDC 3BDXA 1S7WB 4MXWL 5GSRB 4L3CA 4JLRA 1JPSL 1KIUA 1W8NA 1IGJA 5ITFB 1MIEH 4I0PB 4AIXA 4DKAA 4HCRL 2YR3A 4KQ4L 3QUZC 4JHWH 5E6IB 4Y4FB 3WNKA 1HYSC 1V05A 4EVNA 3HUJF 2YPVL 4OLVH 3V5DB 1WF5A 3RU8L 1YY8A 3QI9D 35C8L 1NMBH 5F7WC 3F7PC 4NOFA 3SKNB 4FQLH 1ZT1B 4EUPG 3CNKA 3QI9A 2J1KA 4Z7NF 3RP1A 4XPFH 5ETUB 1T1WB 1A6TA 4Z8FL 5EU4A 2KQNA 3UEZA 3JWDC 2BOBB 1VFBA 4JRYD 3KPPA 3O9WA 5A43C 4PJAA 2FL5B 3U9UB 2P5WD 4IS6B 4PGDB 5DMIL 4ZMAT 5F7DB 5J3HC 2X4OA 1WFTA 4JRYA 4M00A 2YUXA 3REWB 3BZ4B 1QFUH 3KXFB 1Y6KR 4OZFH 3C60B 4XVJL 2EDKA 5C0BB 2P5WA 3FRUA 4XMLH 2UWEE 2EE9A 5C3TA 4PJIA 4O58H 2XQBL 3NCEB 5IKCB 4HJJH 3UTZA 4L8SA 2OLDA 4HUXB 3EOTL 2HAZA 2XZCL 3U6RA 4PPTA 5JQ6L 5KTEL 2VE6A 1QSFE 4PUBH 1E27A 3SDAC 1TVBA 1MCJA 1AFVL 2LTQC 4R3SA 5MEOB 1D9KC 4IRJD 2CDEB 3AFLA 4LSUL 4M93C 5HVHB 1C16A 1EX0A 3DECA 4UT7H 1ZGLA 1N5YH 1DQLH 3CH1A 3FAWA 4IRJA 5D2LB 1I1YB 2ZPKH 1ES0A 1IGIL 4WI7A 2FDBP 5DEGB 1XH3B 1BWWA 4NUGH 2J6EL 2B4CH 5FA4B 5A16B 4JDTL 3G5XA 5BVJA 3OKLB 2WIIB 4UOW1 2K1MA 4JFOB 1CL7H 4KI5E 5L2JA 1HHHA 3NOIA 1NEUA 4PV8B 5FIEA 1NH6A 5C0AD 1F45A 3PWUA 3HI6H 2C1PB 3S96A 1A9EB 2X4TA 5E2TH 2NY2D 2UVEA 4L3ED 4X6DF 5C0AA 4YH6A 4XPHH 4WY7L 1FH5L 3S4SB 1A6WL 2ZUWA 4GSDL 2OM5A 4YIQA 4GBXB 1OAQL 3RWJB 3ET9F 5EO0A 1KELL 1T66C 5E2UH 2APWA 1XCTB 1Q0XH 2AJ3B 2CK2A 3HC4H 4F15B 2FHFA 2AGJH 1WC7A 4R7NB 3QHFL 4YK4B 4PR5A 1ORQB 3VXUE 4XP9L 4G9FE 1F11B 1RMFH 2ZCLH 2ADIA 3WDJA 3CZFA 3ZDXE 1HH9B 4IIQB 1YPZB 2PO6C 2NTFB 5FYKL 2EH7H 4UQ2A 5HD8D 2X89A 1F4YH 5GHWH 2DRUA 3CVHL 1NGPH 1OP5K 4AEHL 4HHAB 4P57B 3FQRB 3MRKB 1BD2D 1A6VH 4AH2A 4EUPA 4ELME 3KS0J 3LKOB 5EC1B 5GGUB 3K4AA 4CMMB 5M7QA 2E7LC 5I1IL 4G8IA 3HE7D 1G7HA 5E7BA 2N56A 1S7VB 3B5HA 3QDGD 4MXVF 4PRPE 5FYJH 1BD2A 1YNTA 4RFOL 1FRGH 3MRPB 1QFOA 3Q5TA 5DRNA 4WGWB 4EI6A 3OKOB 4F9PC 1RIVH 1QSED 2OL3H 3KHOA 4TSCL 3X14B 3QZWA 3QDGA 1YEKH 3ZDZE 3H9HA 2HG5B 3LB6C 5B38A 4O02L 2ZUVA 1AHWB 3OAYH 4X6DA 1UEMA 3MUGA 1QSEA 4PJGF 3WKML 2A74A 5HPOA 2NY6C 3FB7B 4G6AD 1NPUA 4ODVH 2DQDL 1HINL 1RZFH 3MPCA 1MI5E 4K23H 2D7TH 2KH2B 1MRDH 5FA3A 2GW5A 4FXGA 2WNGA 1RZGB 3HAEH 4ALAL 4RGMC 2EKSB 5CS7A 1EEZB 4N0FA 1YDPB 1MHHA 2JLLA 3PWPE 5M94B 1CGSL 4LLVB 3B6SB 3VWKA 1JNNL 5J1AA 2V2XB 1GGYA 3W9DB 3RWIA 3VRIA 3H42H 4OLYH 4JN1L 2F19H 5GRVL 3QFJD 4MCZA 2IH1B 5JW3H 3MJ6A 5DJ6B 1NAML 2DQGL 2MQ0A 1EVTC 2CUMA 4RAUA 1B6DA 1OB1B 1KEML 4ZAKB 5EUKA 5GS3A 1AIFB 1EA9C 4JO1H 2XTJD 3QFJA 5D7IB 1P5UA 4C4KT 5ADOH 3SBWA 4WFFE 4M6MH 1XGYH 3PP3H 5DURB 3MJ9L 1Z6JT 1M7IB 3T3PF 3GIZL 2QADB 3OAYK 5IGXH 3P73A 3QWOB 3T0DA 2IALA 5CCKH 5D96B 1IAOA 2Q6WB 2J3SA 2EYRB 3DYOA 4U7KA 2EDTA 2DM2A 5FECA 2DICA 3CDFA 1RULL 5DTFA 1ZVSA 3FHQA 3BP6A 2QHRH 5MHSD 1A7RH 1NGWB 4OIIH 4EN3C 2Q76A 3HR6A 2VDOL 4OT1L 5IFHL 2F58H 4F7MA 5JMRA 4P23D 4YHNA 4KUCF 3VH8B 1ACYH 2ADGB 5IFJB 3BPNC 5GRUH 3L5WB 1A6UH 3WFDH 3DO7A 5ENWA 3RIFK 4TQEL 1I8IB 5EIQA 3OJVC 4P23A 2F8VA 2H8PB 3UTPD 4PGZA 5TDPA 1QRNB 2XXMB 3MBXL 3SKMA 4LEOB 5HI3C 2IPKB 3S98A 4DFHA 2ARJA 2D03H 3JWDH 4WHDA 5ADPL 4QOKE 1T1ZA 3HNTL 3KJ4B 3PWNA 3QIUC 1WWAX 1BF8A 5CZVH 1PG7W 1L7IL 1QLRA 4O51A 3MV9D 2ARJQ 4MLSA 5IG7A 2UY6A 3MNWA 1XGTB 2NLJB 3TBYA 1N0XL 1VGEH 2A0LD 4GRLD 4MD4B 1PEWA 4K3EH 5SWZE 5C9JB 4MA1C 3HPJB 3QQ4A 3V4UL 3VXNB 1R3KB 3BQUA 3B9VA 4YO0B 2X4PB 3JXAA 4KHXH 3ZL4L 5IHUH 1DBAL 3ULSA 1CZ8L 1Z5LB 5HDBF 1EMTL 4ODUA 3F12B 4KUCD 3SDYH 4MX7B 1JPTH 5J7CC 3IKCA 3R1GL 2WAHA 3AM8A 3B8SA 3IFLH 4Y16D 4K71C 3FZUC 4ZNEE 4ZPTA 1P4LA 1W0WA 2WSKA 4XZUA 3PGFH 4GRWB 3S35X 1AJ7L 1AGFB 5D6DA 4L4VB 2BERA 4JPVH 1OAYL 5E4EB 3L6FB 3DROB 2OK0L 2WWMD 2ESVE 1R6VA 3RVWC 4GXVH 1EO8H 5A2FA 2JTDA 3GIVA 2QSCL 2YD3A 1HE7A 4MB4A 1FL3A 4DOHB 4OCWH 1RV6X 2OCFD 1DQQA 2CRMA 1QRKA 3QJHA 1DL7L 5F96H 2I5YH 2FX7H 1G9NC 4KKBD 4NZTH 4LGRB 5I19H 4ACPA 4NNXB 4EI5C 2AXFA 2FJGB 5BJTB 1J11A 5FHAH 3ARSA 3VG9C 5B3JF 3HHRB 5C6WH 5FGBC 2Z31C 4U6HA 1LDPH 3LSOB 5DVKA 12E8L 4OD3L 1Q9OA 4Z5RB 1EDQA 1MHPL 3QG6B 1UEYA 1XIWA 1KJVA 4LCYA 4JGMA 4Y2OA 4MMZC 5E6ID 3QNXA 4G3YL 5JIKA 3ARBC 1F13A 5GSRA 1KJ2A 1DQDH 3LKNA 1A3LL 4B53A 3SGJC 4I0PA 1UM6H 1SEBB 2GAZA 4TN9A 3RIFF 3V2AR 4XPAH 1NGQL 5E6IA 5D1ZC 1KCRL 3GK8H 2GY7B 5FUOL 5FYJD 2B1AL 3NCCB 3TEUA 2GJZB 1NANI 4JKMA 4JRXD 3FRPG 1U3JA 3V5DA 1PKQB 4MA8L 2D7PA 1UADC 2KL6A 4X5XB 1G0XA 2PW1B 3ME0A 4JQIH 3SKNA 4JRXA 4GAGH 1R0AL 1TETH 1N7ML 1RHHB 1T20A 1P53A 5ETUA 3IFNH 1T1WA 2X4QB 3IETB 1XF3B 3GSQB 3RWFB 4LGSB 4PJ5E 1O7VA 2BOBA 1IC1A 4PP1D 4JO3H 2IAMB 3KXFD 2FL5A 3C60D 5BW7C 2R23B 4IS6A 5F7DA 4Z0XB 5GRZA 4EQ2A 3FKUS 3REWA 3ARDC 1GZQB 3WFBL 1J86A 3KXFA 3RUGF 3C60A 4G6KL 2BC4B 1FL6B 1T5XA 4HT1H 1A4JB 2NY0D 4N8CH 4LIQH 2CMRL 4NWTL 1DBMH 3BPOC 2MCPL 4O2CB 5EA0H 1KTDA 1F8TH 1U8IB 3RJDA 4XCYA 43CAB 2CGRL 4KGLA 4LCIL 1WT5A 4HUXA 1CGUA 4LEXH 5I1HH 4GMTL 3VFGH 4JG1H 5J13C 4DVBB 4ZODA 1Z2KA 4PGJA 5ERWB 3ZE1F 2VDLL 2AJSL 5DJ2A 1ZV5A 2FGWH 2EEDA 4FZ8L 5MEOA 4RISH 3Q5OA 4K9EC 5H35A 3RWCB 2CDEA 3CVIH 1TJGH 3O3EB 2UWEB 1C7TA 2VXQL 3IAPA 3LDBB 5I71C 3BJLA 1UA6H 3DMMB 1N3NB 3WO4B 4E5XB 5I6XB 4UILH 5D2LA 2OBGA 1I1YA 5F1OB 5DEGA 4HFWA 1U42A 1XH3A 4KTEH 1QSFB 3TF7C 1KXVC 1CBVH 5A16A 3S36X 4GRMB 4OLXL 5C0JB 4OM1H 4JFOA 3U7WH 1KCLA 4ZUTB 4NWUH 4PV8A 1KIPB 3B9KC 2B1HL 5KJRL 4YAQB 4A6YL 2FHCA 5C6TL 3CFCH 4UINH 3HN3A 2H45A 4GBXD 4YWGH 4M7JH 4FQHA 4KJWD 3TYGL 4JG0L 3RGVB 1SEQH 2YPLE 1CICD 5JR1H 1MF2H 2APFA 3S4SA 2DIJA 1DANU 3IGAB 3FO9B 3MV01 4Q9RL 4GBXA 3CJJA 3MRMB 3RWJA 1N6UA 2NPLX 1I8MB 1WQVT 5HHPA 1J05B 1YECL 4PY7B 1IM3B 4R7NA 4YGVB 2BHZA 4S1SH 1F11A 5KSVB 4OGXL 4XNXL 4WTZG 3VDBA 2P5EE 1HH9A 4IIQA 4YDIH 3FRPA 2NTFA 1Y0LB 2PTTB 3O9WC 3BMWA 4HHAA 5KSUB 4P57A 4UIKH 1MFAL 4MAYB 3ARXA 5B21A 2E9WA 3FQRA 5I0ZA 3MRKA 2YS4A 1IT9H 1GJIA 3LKOA 5EC1A 3LEVL 5GGUA 3VXUB 1CDUA 1FG2B 4G9FB 4MNGA 5E1HB 2MWCA 2KQMA 4QO1A 1OD9A 4L8SC 4IRSC 3MRPA 4HWBA 1SYSB 2CKBH 4OLUH 1MCHA 5HHME 3OKOA 4CVXA 5JA8B 5CP3H 5IVNA 1QBBA 2HG5A 1T21B 2ADFH 2QQNH 5IIEB 1AHWA 3FO0H 4UT9H 3MODL 4ELMB 4OUUB 1DEEA 4JQXA 5GZND 4BSWA 5JW4M 1FBIH 5CD3B 2HFGH 5FYLD 1F4HA 1NGYA 4KQ3L 3O2WH 1JWMA 4PRPB 3Q6GL 4G5ZL 3SO3B 4FFYL 5F44A 1FPTH 1ZTXH 1QR4A 4PJ8D 1RZGA 1NLDL 3RFZC 1P84J 2X44D 3CK0L 1EVUA 4J6RL 4LLVA 1G9NH 3A6CH 5D7KE 2P8PB 3EYUH 2NXZD 1IAIM 4PJ8A 5D93B 1WFOA 3W9DA 1Z9LA 3GSWB 1X5ZA 3CFIC 3OAZH 3QHZL 2Z91B 1HNGA 4JRWA 2HRLA 3BEWB 3S9DB 3N1GC 4NGHL 1IC5H 4WV1C 5DJ6A 4FZEH 4OGYH 4GMSH 5DURD 5J1SC 2YZ1A 1MI5B 2QADD 3TJHC 1OB1A 4ZAKA 1AIFA 1M1SA 2C4XA 2HFFA 5D7IA 2ZUTA 4H8WC 3PWPB 2DMBA 1M7IA 1RPQA 3GI9L 3QWOA 2Y72A 4JKKA 4UNUA 2Q6WA 2EYRA 5T5FH 2O61B 4NP4L 4FQCH 3IDGA 2CIKB 4P3WA 3VXSE 5DUBA 4IRZL 1NGWA 1Q1JH 1X3DA 1T0NA 3D87B 4P59H 3BPLB 5DHVB 2UUDH 2EDXA 3VH8A 1XCQB 2DJ4A 2ADGA 1QRND 1X5GA 5IFJA 3OAZK 1ZLSL 5IEHB 4FQ1L 4P5MA 1I8IA 2J8UF 4YDKL 5FDWB 2H8PA 2VNCA 1G9ML 5F70A 1FIEA 5TJWK 1QRNA 3WNMA 3K7UA 4WTZA 5INDB 4LHUG 4FFVD 2DLFL 4Y1AE 4S11A 2IPKA 3VXPB 4O4YL 5I30L 2NY1B 3U4EB 1I9RH 1VKXB 4AEEA 4X83A 1KFAH 3CXDH 3STZB 4U1JB 3C08H 4KROD 4N68A 1DZBA 1HSAB 1SMAA 2IQ9H 3VXRD 2YMXH 2VWEC 4GS7B 3BYTA 4OV6F 5MENE 3MXWL 1KIRB 1C12B 1XGTA 5TE4H 4UDUB 5AZ2H 5CZKA 5HHOD 3N1FC 4PRBA 1RJYB 5C07E 4MD4A 3VXRA 1JZ3A 5DJ0A 3H9SE 5I16B 1TZIA 3VXNA 1YNKL 5J56B 1R3KA 2DQHH 1L0QA 5E2WL 1YNLH 1KEGL 4YO0A 5JDJA 3HTLX 2X4PA 1S9VB 4YQXH 15C8L 4QOKB 3EHBD 4YHLH 5E99L 3VGAB 2AERT 1KB5L 2E8YA 4P49A 4WEBL 4L4VD 4Z7VE 3NA9H 2BHYA 3IS1X 3VWKC 1YYLL 3BI9X 4FQXB 3U36B 1W72L 2WUCL 4Z9KB 5T1DH 1AGFA 1I1AD 5SWZB 5T3XL 2DN7A 4L4VA 4K9EH 1NGZB 3MLRH 4GKOA 1YZZA 3PQYE 3L6FA 3DROA 3KR3L 3O3AB 5C0RH 1KCVH 4PFEA 5C0CD 3MV7D 1RAMA 3MJGX 4G9DB 5DQ9B 4UNTA 1J88A 3MUY1 3TA3B 2LAGB 4XH2B 1I1AA 1VFMA 25C8L 2NY4B 4NUJB 3UJJH 1PYWB 3GNML 3BDBA 4XPGH 5KSAB 4WGVB 2P8MB 3GSRA 3GEWB 2AJUH 3GRWL 5MP6L 4OI7A 1QBML 1HZHH 1N4XL 3WNPA 4LKXB 5IEKB 5JTWA 4NNXA 4ODHH 1J8HE 4X6BB 2A6KB 3UROR 5BJTA 1MOEA 2F54E 1UWEH 2ZOKB 1ZHKB 1X4XA 2ESVB 5HGAB 3SCMD 1VENA 3WFZA 1IKNC 4U1SA 5EUOF 2D31B 1FE8H 2GKIA 2W0KA 3GSOA 3L3KB 3LSOA 2Y06H 1ETZA 1MJ8L 2P46B 5FFLA 1A3RL 5LXGL 4GW4B 2UY7A 2F8XC 2I60L 3QG6A 4IMKC 4MHHI 3MOAL 1N64L 3TWCL 2D7NA 1HHIA 4MWFB 4POZC 3HZVB 3QULB 3MC0A 2G60H 4OKVA 3BAEL 4Y4HB 3QPQD 2R39A 4WDIB 4AEIL 5DUML 4GW1B 2DBJA 2DI7A 4OFYA 1DLHB 3FB8A 4JJ5B 1IKFL 3OAUL 4X8JB 2AJZB 1BAFL 4YDLB 2GJZA 4UDTB 3NAAH 2FX8H 5ANME 1GL4B 3V6OA 4KVNL 1KPUB 4NQEE 5IT2L 1MIMH 4X5XA 3UAJC 2PW1A 4HIHB 5F9WB 4OZHE 2Z8VC 3PWJB 2G75B 1RHHA 2IAMD 4GAJH 2VRAA 1LMKA 3TT3H 4P5TC 3IETA 2X4QA 4X6CE 1XF3A 3GSQA 1ZHLB 1EK3A 2ZUYA 5CWSB 3BQUC 4UZGA 3RWGB 4KKAD 2IAMA 3T0BA 5JW4N 4X4ME 2FX9H 1EZVY 4OD1L 5EUOA 4Z0XA 1H8OA 5BZWB 4HEME 1GZQA 1G6VK 1IGFL 4WW2B 4WO4D 1FL6A 1A4JA 4ZXBB 3MROA 3X13A 1E6OH 5IBUB 2UZYB 2L7UA 4O2CA 7CGTA 2FD6H 5HYQB 1RJCA 3WKNA 4QY8B 1E4KC 43CAA 4PJ5B 1Z9OA 4WO4A 1K6QL 1GYAA 3D85D 4DVBA 4KI5F 1JGLH 5DUPL 1P69B 1FAKT 1HKLL 3P2TA 4XTRC 5ERWA 2W9EL 2BX5A 3OXRB 1AGCB 3D85A 3DMMD 4L8CB 1Z0MA 3OHXA 3RWCA 3RWDB 3TZVD 1EJ6A 3O3EA 2YD9A 4ZOCA 3CXHK 4N0CD 1H3PL 1IARB 2HJFB 3DMMA 1N3NA 4E5XA 1U6AH 4HUVB 1PVHA 4KY1H 5F6IC 5CZXC 3TZVA 3VI3F 1D5IL 3V79C 1QSFA 1XF2B 1MJJB 1I85A 4R97B 4GRMA 3WXWL 1OLZA 5E8DH 5DMYA 5BV7C 3FQNB 1XIWC 4RZCB 2X4SB 4WENB 2VLLB 2OX5A 2XY2A 2RFXB 1KIPA 1EHAA 1LO2H 4YAQA 4D0CB 4I0PC 4XAKD 1S3KH 1OF2A 4OM0H 2Y6SD 3NFPB 4Y4FC 2R0ZH 1AKJB 3BRDA 1JF6A 2C1OB 5CHNB 4KI5D 2UYLB 3UBXG 5F6HJ 3TO4B 3FO9A 2VXUH 3KWWB 5FUCE 2YD5A 3S6CA 1I8MA 1NCTA 3BESR 5IV2B 1TVHB 1J05A 4PY7A 1KXQE 1QFWM 1IM3A 1B3JA 1X7QB 4YGVA 3I50H 1TCRA 2YN3A 2OR7A 3BP4B 4MAYD 2D9QB 3WFEH 1DVFD 5D71H 4I4WA 1Y0LA 2DLHA 5CMAB 3D25B 4YDVB 2GUOB 2SEBB 2YPLB 3AROA 4Z7UF 2PTTA 5IUSA 2HVKA 3EDEA 5HVFB 2VZ3A 5KSUA 1P6FA 3VXUD 1WJ3A 4MAYA 4Y19E 1JNLH 4HIXL 1DVFA 3BN9D 1OAUH 1H15A 2AK1L 5EBLB 3RDTC 4QXTB 1AH1A 4M1CD 1KN2L 3H3PL 3VXUA 1IBGL 1JMZA 3GSVB 3A67H 3IJYA 3VRLF 3NBNA 3MV8E 3QIBB 2P5EB 3OMZA 5DS8B 3EZJB 3EFFB 4YLQT 3C2AH 1Z9MA 1T21A 1RJLB 2JELH 4YUEL 3HMXL 3C8HA 2E27L 5IIEA 3PNWB 3TCLA 3E8UH 5L7XH 2EE2A 4P2QE 1BM3H 1E0OB 2DJSA 3LEYL 4XVSH 4G80B 1B4JL 1CTOA 4PRPA 1NMAL 4U05A 5D8JL 3RGHA 4TULH 1WBZB 2YXMA 5HHMB 3FB5B 1ODAA 4YFEA 1UJ3C 3C2SA 1U8QA 5CD5D 5IQ7H 2J5LB 1X44A 2Z8WC 3QRGL 3WJJC 1PDKA 2P8PA 4UV7H 1C5DA 5F93C 1A14H 4Z7UA 5GRWA 1MI5D 1MRFL 5DQDL 1NANH 4Z76B 2Z91A 3BEWA 5F3BB 5TQ0L 5DC4B 5FUZH 1U93B 5DXWA 3PWPD 4JFDD 3VFTB 1MI5A 2QQKH 7FABL 4FABL 1I1CA 3TBTB 4ZYKA 2Y7QA 4Z7QE 2NZ9C 3FB6B 5GGRA 3PWPA 4JFDA 5C2UB 2APBA 3WFCL 3RVVD 4TRPL 3V5KB 4G6ML 1YEGH 3EO9L 1OM3L 4HC1H 5JXAH 4HK3J 3MYZA 1U95B 2O61A 2OTWA 3QCUL 3BKCL 4F15C 2CIKA 5EOQL 4P2OB 1X5IA 1VADB 3QXWA 4YK4C 5DA4A 1D5ZB 3HCVB 4KRNA 3CLEH 4M61B 3UBXA 3GKWH 4AMKL 4IIQC 1AI1H 2EECA 1NFDF 4GT7A 5JUEH 5DHVA 2V17H 1FO0B 3CMOH 3B8YA 4DWHA 5KZCB 5DD0H 1H3GA 1XCQA 4R6UA 5FDYA 4JHAH 5E00B 1TXKA 5IEHA 3TVMC 3U83A 3C6SA 2VLJD 5FDWA 1IGTB 2NY1D 2NXYD 4TSBL 4KMTL 1A7NL 3P9WB 1KUMA 3VXSB 3GBMH 1JCKA 1YMME 1CFNB 2VH5L 4IJ3C 4ONHB 1JYVA 4ZTOH 3VXPA 4F8QA 4HPYL 2NY7H 1GCFA 3MLTB 1A6AA 1JPST 2IWGA 3U4EA 4TVPH 1VKXA 1A1NB 4UB0H 1S9WB 2CRIA 3BKYH 1J0KA 1FN4B 3STZA 4U1JA 5CILH 2A9ML 4NT6B 4EBQH 1HSAA 5I18H 1CGXA 2IGFL 3PDOB 4MQ7B 4ODTH 5CJ5A 1MQ8A 1KIRA 2GQHA 3ULUC 4HGKC 4NC2B 5DD5L 5DJYB 4HIJB 3T2NH 1RJYA 3WLWD 4NC1C 3T3MF 4KRPB 4H25B 3MLZH 3D39E 4Y1AB 4ZFOL 5D7LE 1MIEL 1P5VA 2FYYB 3MLXH 5CKAA 1S9VA 4JHWL 4HWZB 4QOKA 4FQXD 4YHPA 4CU8A 1EPFA 2QL1A 1ZHBB 3WIHH 5F21B 3MQIA 4OLVL 3AXLB 5MENB 3EGSB 4XI5D 4Z7OE 4FQXA 3U36A 1FYTE 4EXPX 2EXYD 1NMBL 2BP3A 1OGAE 3MBEB 3TA3D 3UMTA 5C07B 3K46A 3KPRD 5F1NB 2NY4D 3HZKA 5E8PB 1J10A 3MGOB 4FQLL 1JJUA 3H9SB 4JO2H 4R0LC 1SY6A 2C26A 1TENA 5C09D 4XPFL 4G9DA 5DQ9A 3TA3A 3KPRA 4ZAKC 4NUJA 4U0QB 1PYWA 3DGCR 5KSAA 1QP1A 3U4BH 5C09A 4X9HA 4Z7VB 2R8SH 4LKXA 5C7XH 4XCNB 3SPVB 5IEKA 1MFCH 4ZNEA 1ZANH 4KK8C 4BKLB 6CGTA 4Q6YA 5BV7H 4X6BA 1WFNA 2HVJB 5D96C 4AIZB 2OTUB 5BS0E 1QFUL 4HQQH 2ZOKA 1ZHKA 3F7YB 3PQYB 5HGAA 2CR3A 1MFDH 4XMLL 4O58L 2DQEH 5CAYB 4HJJL 1MWAB 4WEMB 3L3KA 5DRZB 2BSRB 4ODWB 5E5MB 4KV5E 1KV3A 2AAVA 1KTKE 2ZSWA 5B3NA 3BT2H 1IAII 4PUBL 3LVEA 3SDDD 5K59F 1J8HB 3OB0H 4JQVC 2DOCA 2ZG1A 5IQ9B 1F90H 2NR6D 2F54B 3W82A 2DF3A 2PR4H 4P4KB 4MWFA 3HZVA 3RVXC 3GJFH 3I6KB 4C56E 2AKRA 4UT7L 1DLHA 4JJ5A 5FB8B 1DQLL 5KS9E 1N5YL 4KGJA 2AJZA 2LU7A 4LCCB 1UG9A 3ZKNC 3KJ4C 2ZPKL 4OCSH 5T3ZE 5IJVB 4NUGL 1KPUA 4XP5H 4QNPF 2B4CL 4HIHA 5IMLB 4JCLA 3W5MA 4OFPA 2FEEI 4HMCA 4PLJD 3QO0B 3G9AB 4MJ4A 4XCCH 3MRDB 4OF7A 3ZHKA 2G75A 3MOQA 1CL7L 2W0PA 2XG5A 1B9ZA 3RNQA 5J6GB 3SE4C 1RIUH 1ZHLA 5LKNA 5CWSA 3WIFB 3HI6L 3DVGB 2YSSB 3NIFE 3WHXB 1EEYB 3O6FC 4K7PX 5E2TL 5ANMB 1CS6A 1GIGH 3ZTNH 2JJTC 5IOPA 4XPHL 4NQEB 5FCUH 3ZYZA 5BZWA 4OZHB 4XPTH 1K9TA 4PJ5D 5IMKB 4WW2A 5E2UL 4WVRA 1NL0H 1NAKH 1Q0XL 3HC4L 3UJTH 4OGAD 2AGJL 3GJFK 4X6CB 5E4EC 3O2DA 5HYQA 4NQVA 1CIUA 4PJ5A 4BZYA 5BQ7B 1RMFL 3UP1A 2ZCLL 1LO3H 5HGBB 1ZGLP 1S7XB 2C3GA 1GRWA 2EH7L 2VMFA 4AENB 1F4YL 1PKOA 5GHWL 4Q58C 2P24A 2PTVA 3LH2H 1NGPL 3OXRA 3O41B 1DSFH 3CSPA 5F7KC 2HTKD 5K9QG 1DBBH 1U2HA 4L8CA 4HAFA 4ZOEA 1A6VL 4L4TE 1ITBB 4YXHH 4OZGE 4KMLB 5I1DB 4JJHA 5EU7C 1Q8MA 4HUVA 5LCVH 4H26A 4N0RA 5FYJL 2ZCHH 4IOIA 4U1KB 1FRGL 3L9RB 3VG0H 3VI4E 3PGCB 4BK5A 1MJJA 4WUUD 1RIVL 2OL3L 1A5FH 3LQZB 1YEKL 3G6AB 3FQNA 5B4MC 4RZCA 2X4SA 1U8HA 2ILLA 2VLLA 3AREB 3TC9A 1XZ0B 2XKUA 5I9QB 1AKJD 5GS0D 1X9QA 1RY7B 5K9JH 4WU7B 1PEZA 3DSFH 1J8KA 2UV3A 1VCAA 5HDOA 3TO4D 4HV8A 3MACH 2P45B 4HG4J 3NFPA 4ODVL 3PDGA 1N59B 1AKJA 1RZFL 3OL2A 5DT1H 2BOCA 2DJUA 4K23L 2C1OA 2EEBA 4TVSa 2D7TL 5EZJB 4DZ8B 1MRDL 1EO7A 2CR6A 2UYLA 4RMUA 3HS0B 3F7VB 1MCDA 2HT4C 3TO4A 4MJ5B 4QT5A 3KWWA 1E4JA 5IV2A 3HI5H 3I3DA 3MA7B 1TVHA 4LRNL 1X7QA 5HDLA 4GG6F 3H42L 2YPLD 4ODXB 4OLYL 2F19L 4MYWB 2R1WA 2ICWI 3CCHA 5ACLA 3BP5B 3TH3T 5JW3L 3WUWG 2YRZA 2OS7A 2BJMH 1MCOH 4PRHD 5CMAA 4Y5XB 4YDVA 2SEBA 1AXTH 2YPLA 4JO1L 2WBJD 2FCBA 3D18B 1YEEH 1CQKA 3ARWA 1CXFA 5ADOL 4M6ML 1XGYL 4NQCE 3FQTA 4PRHA 5IGXL 3HB3D 4J7RA 4I3SH 5DI8A 5CCKL 5EBLA 1UM5H 2P5ED 4QXTA 3ULUH 4Y2DB 2J4WH 5C71A 3WHE1 1HN1A 3MFGB 3PUCA 4ORGA 1TFHA 2X5PA 1EV2E 4UV4H 2VKXA 8FABA 2JE8A 2P5EA 2QHRL 1A7RL 5DS8A 4BQBA 3DETC 4OIIL 3NFNB 3EFFA 1JFQH 4N1EA 5I76B 2F58L 4Y19B 1RJLA 5HYFA 5DJZB 3PNWA 1GGBH 4LMQE 1ACYL 1IEHA 3KDMB 1QYGH 1YYMH 5GRUL 4NFDA 1A6UL 3WFDL 3OKNB 3DXAD 5DJ8B 2M1KA 4PJXF 2P47B 4G80A 2B5IB 3QYCA 1AGDA 3TH4T 4DCQB 1BECA 1TPXB 3MV8B 4KAQH 2GITA 5I6XC 1DBJH 3DXAA 2H26B 2VZSA 3JWDL 2D03L 2Y4SA 3ZE2F 4NO3B 5CZVL 5DK2B 3D69B 3SHSA 1F6AA 4X7TB 4P2QB 1TDQA 4XC3H 4PTUB 4DQOH 1VGEL 5F3BA 4LLWA 4OV5B 1MAJA 5AD0A 4K3EL 3BRFA 3VFTA 4UQ3B 3EJZC 5D7KD 1MAMH 3TPUB 5E9DE 4KHXL 5IHUL 3FB6A 2JJVA 5I8EB 3RGVC 3TLRA 3VFPB 1U8MB 4QTHB 3EO1B 3V5KA 4KK5C 3SDYL 1JPTL 1GGCH 2AQ2A 4P2OD 5DYOB 3IFLL 2OXGA 4CADB 1U95A 3CC5B 4PJDF 4FMFA 3PGFL 4P2OA 4DAGH 1VADA 4JPVL 1YEIH 1V3MA 5KZCD 2VDRH 3HCVA 3QHTC 4S1QH 1I3GH 4FG6C 4GXVL 1EO8L 5E5UB 1KIQB 3SKJH 4OCWL 1NLBH 2FO4B 1FO0A 1U2CA 1LK3H 5CEZH 5LGHH 2N7BA 5F96L 2I5YL 2FX7L 4NZTL 5IB1B 5E00A 4LSQH 1G7MB 5I19L 1P7KB 5CSGA 5D7JB 1ACZA 5GIRB 2P8LA 1I9JH 5D5ME 5FHAL 3WUWA 3GSUB 4ONHA 2PTUA 3BXNB 2W65B 3W11C 4Y89A 2BVYA 2XZQH 5I75B 2W9LA 4KMQA 2XIDA 1A1NA 3QWRD 1LDPL 1FN4A 4MB3A 1U58B 1V7MH 4NT6A 2X40A 1TLKA 3PDOA 1MAKA 4MQ7A 4YDJB 3O45A 2VAJA 1K85A 3MA9H 3QWRA 1PG7H 3P11H 5DJYA 4HIJA 4LVHB 1QFWI 2ZOLB 4WRLA 3P4MB 4I3GA 3V6BR 1DQDL 1CFQB 1CD1B 1YMMB 4NKQB 2FBOJ 1MQKH 1ZLWK 1RUKH 1BZ7B 1SHMA 1UM6L 3DV6B 3QIWC 2FYYA 4XPAL 4PJDA 1EBPA 4ZPVB 3SO3C 5DRXA 3UO1H 4HWZA 3LV3A 4NZRH 3GK8L 1CXIA 4QRSB 5I8KH 4LVOB 1R5WA 4PREB 4PTTA 5H37H 5I66A 3D5OF 3K3QA 4ZUUA 5GRJH 3H9SD 1EBAA 5MENA 1XF4B 3EGSA 3IXTA 5SWSD 2VSDA 3TN0D 2OR8A 1M7XA 3MBEA 4NQDE 5C07A 3QEHB 4JQIL 1NAMB 3MMEA 2AXJA 2YRLA 4GAGL 4HWEH 3MGOA 3P3YA 3H9SA 3D39B 3KLAB 3OKEA 4RWYH 5J9PB 4NJAH 5D7LB 4YJZL 4JDZB 3IFNL 2BXYA 2D0FA 4EDWH 1A6PA 2V2WB 1G84A 1OOAA 5JXED 1DLFH 4JO3L 3C6LB 3PQYD 2BHUA 3SPVA 1DUYB 1FYTB 4BKLA 2CD0A 3MR9B 2C3HA 1OGAB 2JCCF 2HVJA 4K07A 2H2PC 5E8OB 1XEDA 4AIZA 5JXEA 3NGBC 2AEWA 2OTUA 2RAMA 4TUOA 3PQYA 3LQAC 4MAUH 1PX3A 4HT1L 1RI8A 2GCYB 4N8CL 3HFMH 4LIQL 2GEEA 4XNMA 1DBML 3CX5K 2OZ4A 5EA0L 1F8TL 3RRQA 1GGIH 4ODWA 1J8HD 4HBCH 4WFEE 4NN5B 4LEXL 5I1HL 5E5MA 1XT5A 3BPLC 4JG1L 3VFGL 2F54D 4OKDA 1X4ZA 4OCRH 1ADQA 3V9FA 1J8HA 3HR5B 4WTWA 5GS1B 4NCC2 5IQ9A 5BS0B 2F54A 3EJJX 2FGWL 4EDXB 1FCGA 4QRPD 4P4KA 1UJTA 4RISL 2IMMA 3CVIL 1TJGL 2BNRD 4HUUB 1UA6L 2VR5A 4LCCA 4UILL 1ZSDB 3QUKA 5DA0B 4CJ0A 5LQBH 1S7TB 1UH2A 5IJVA 2BNRA 2CUIA 5CSZB 1FNLA 1MCIA 1QFHA 4KTEL 3NIDE 5T1LB 1CBVL 4JHZA 4RIRB 5T3XE 4PJCE 4ZOBA 5JDSB 4OM1L 3QO0A 3MRDA 3FO1B 3U7WL 4FQ2H 5H94B 3QRFM 4NWUL 5IR1B 2AVGA 5J6GA 3UTTD 2DQFB 4C56B 1S7SA 5E24E 2Z92B 4DJMA 4NQED 1MHEA 4X5LA 3CFCL 4UINL 3DVGA 5KS9B 1DQTA 3WHXA 1EEYA 1LP9E 2J88H 3Q5YA 4YWGL 3NIGF 4AZ8A 3FFDB 4M7JL 4K8RC 3UTTA 4BH7A 1SEQL 4NQEA 4F57H 1IGYB 5JR1L 1MF2L 4F3FA 3QUMB 3OB8A 4OZHA 2LVEA 5IMKA 4PV9A 5DDHA 5F1SA 3QCVH 4Q9BA 3I9GH 1WISA 3ULVH 2VQ1A 4HK0B 4X6CA 1OHQA 5JOPE 3ROLB 2A2QT 4S1SL 4F33A 5TDOB 5BQ7A 2VITB 2EXYC 4XNUH 2EH8H 2OMNA 1AQDA 1JGDB 5HGBA 3DV4B 4YDIL 1S7XA 1IEAB 5KSAC 3VW3H 4AENA 3BWUC 3O41A 3QQ3A 4UIKL 2FATH 4LGPB 3ZE0F 1IT9L 4MGXA 2WM0A 2MNUA 5I1DA 4BUGA 3O2VH 4L3AA 2HTLC 4JANB 3UXFA 3GZKA 4U1KA 1QA9A 2PF6A 3L9RA 3MSPA 3KYNA 3ARED 5EH1A 3D1MC 5HY9B 2CH8A 2CKBL 2E7HA 4OLUL 3CLFH 2EYTB 3HC0B 3G6AA 2ADFL 4BFEA 2QQNL 3CFKB 3AREA 3FO0L 1XZ0A 4UT9L 1Q38A 4HCRA 4O9HH 2DQIH 4HUNB 1ZEAH 4YEFA 4L4TB 4OZGB 4KJQD 4JFYB 2UVFA 1FBIL 4FQIH 2HFGL 4Y4HC 3IDNB 2X1OA 1BREA 3O2WL 2Z9TA 5TH2B 4B5EA 1PZ5B 4Z0BH 2X6MA 1N59A 3O8XB 5GZOC 5EZJA 5I8OH 4GUPA 4X4YB 1FPTL 1ZTXL 3BPCB 4YDLC 3I6LE 3HS0A 3V5HA 3FMGH 3V6ZB 3GBNH 3S34H 2YUWA 3O6LH 4D2NA 2R69H 1G9NL 4QRUA 3A6CL 3MA7A 3EYUL 5F9WC 4PJHF 2F5AH 5TE6H 1X5XA 1B0WA 4ODXA 5B8CC 1IC5L 2W60B 5F71A 3TP4A 1FIGH 2O5XH 4FZEL 4GMSL 4OGYL 5GSVB 4QKXB 4KK9C 1DN2A 5D6CA 4U1IB 1MVFA 3OXSB 3V4VH 3QXAB 2YBRB 3D18A 3QQNA 4LVNB 1T04B 4UI2A 2YN5A 5I1KH 2CJUH 2FLRT 3Q1SH 4LU5H 3DI2B 3MUHL 2AEIT 4D9RE 5C70A 3QNZB 1OT1A 4WW2C 1MELA 2ZUQC 1FFQA 5T5FL 4ZXBC 5T1MA 1GAFH 4FQCL 1QLFB 3BO8B 2P43B 3MRIB 4XWGH 1Q1JL 2ADJB 1P1ZB 3SE3A 1H3WM 4P59L 4PJFF 4NQCB 5I76A 3WS6A 1CFSB 3EKCA 4Y19A 5DJZA 2CIIA 3LIZH 2B7DT 3VRJA 3DNKA 1Y6MR 4H20H 3AMLA 1RUAH 4WNQB 4DCQA 4N8VG 1A1OB 4G6JH 1IAIH 4HWNA 3O0RH 1OT2A 4PJHA 4IEFB 1I1FB 1MCCA 3SOBH 3TBWB 3T08A 3BGFC 2J6EA 2ATPB 4P2QD 1RD6A 1I9RL 4JN2B 1WIOA 2MHAB 4NO3A 2I24N 1KFAL 1Z9SA 4G7VH 1CG9B 3CXDL 2CLZA 5DK2A 3C08L 5DGQA 2IQ9L 4X7TA 5C3LD 2YMXL 1H3UA 1OW0A 4P2QA 3W39B 1A22B 3LN9A 4A6YB 5TE4L 5AZ2L 4M1DH 3NVQA 1FL5B 4OV5A 3RPIB 3LQAH 3C8KA 3VFVB 4OD2B 1JN6B 5DLMH 3EDJA 3ULVF 2X1XR 2Z35A 4OCXH 2DQHL 2C7UB 3HUJE 3RY6C 1YNLL 3TPUA 4H5SB 3U0TB 3KS0H 4U6XB 5I8EA 3UC0L 4YQXL 4G42B 3VFPA 4YHLL 2AQ1A 4HUWB 4X9FA 3SE8H 3EO1A 4P3DA 1OTUD 5DYOA 4X0KB 4JKLA 3NA9L 2X4NA 1PSKH 4M7LH 5FYKD 4CADA 2XKNB 2E5EA 3VMNA 4Z7NE 1I8KB 5HYJD 5T1DL 2HA1A 2V5YA 1IJ9A 4K9EL 3MLRL 4H1LB 4E0RB 5D1XD 5C0RL 1QOKA 1KCVL 2BDNH 1KJ3H 4PJ9D 3CVHA 2A83B 5E9DB 4JFFE 5HYJA 2A6JB 2FO4A 2OI9B 3UJJL 3G5YB 4Q2ZA 1U3HC 4XPGL 3RAJH 2AJYH 3U82B 2AJUL 1HZHL 1HQ4B 5ECJE 1N6VA 1FHGA 5D7JA 5GIRA 2R2EA 2VIRA 4ODHL 2V5TA 5C0AE 1Y18A 1F2QA 4PLKD 3L3GB 4DKFH 1UWEL 4NQSB 5E1AB 1BQSA 3GSUA 2F9BT 3BXNA 4L3EE 1M05B 3MJ8B 3QIBC 4KKCD 1T3FA 1FE8L 1RFDH 2J8OA 4P46B 5FM4A 4BSJA 1FZKB 1U58A 1M71B 4PY8I 4K8RH 1U9KA 2Y06L 1L9NA 1CXKA 4YC2B 1HI6B 3L5HA 3ZKMD 3WNLA 5IW6B 4ONOA 5C2BH 1T7VA 5F9JB 4ZD3H 3NFSH 3TPKA 3TNMB 3P4MA 4ETQA 5D5MB 1CFQA 3C9NB 4N5ED 1EUUA 3GSNB 1BZ7A 2G60L 3DV6A 3VXOB 5SWQB 1SY6H 3AMKA 1X5YA 4ZPVA 4QRSA 3U7AA 4PREA 3BKMH 1NEZG 2YWZA 4NFCA 1NC2B 4QWWC 1WWWX 4R4NC 1CF8H 3NAAL 2FX8L 1P7QD 2DDQH 2MTPA 1V7NH 3MCLH 3D39D 2J5LC 1BD2E 1QHOA 1MIML 2DLEA 5EO1B 3QEHA 1NAMA 3WJLC 1I7RB 2XWBB 4N8VA 2UZIH 1P7QA 4NO2B 5ESAB 5ELIA 2Y1VA 3D39A 3KLAA 5J9PA 5D7LA 3C6LD 4GAJL 4JDZA 3TT3L 4HGMA 4X6DE 1VEPA 3NCBB 3MJ9A 1FYTD 1QSEE 5INCB 1OGAD 4R4FH 5IHLB 3OZ9H 3C6LA 3FN9A 2FX9L 2DKSA 5B22A 1QO3B 2R4SH 1DUYA 1FYTA 3QNYB 3MR9A 2G5RA 1OGAA 4PLNC 4NQDB 1CGWA 5E8OA 3OX8B 3FQWB 5KBNC 4UBDC 3G04B 4QHNB 1NUDA 5D1QB 2GCYA 1E6OL 1JV5B 3IKKA 3VFUA 4QXUH 5IHZA 1QPPA 1JTOA 2FD6L 3EOAA 1OD7A 1HKFA 1RK1A 4NCDA 1JGEB 1KXTB 4H88H 5BS0D 1VPOH 3NH7H 4POUB 3SGKC 1JGLL 3ROOB 5I17B 1Q9KB 3F6IA 4OI9A 5GS1A 4UMGA 3QFJE 5BS0A 5CJOH 2Z4QB 4X4ZA 1JWSB 2W59A 4MXVE 3BD5A 3G6JF 3VD5A 4HUUA 5T1LD 5FXCH 5BO1H 1U6AL 4S1DD 4KY1L 1ZSDA 4BZ1H 4MVBC 1KJMA 1MLCA 1S7TA 4M6AA 1WBYB 3ECBB 2ARWA 3ZTJH 5DMGC 1EGJH 5T1LA 4PJGE 4C56D 3AY4A 4RIRA 3UZQA 5JDSA 5E8DL 3FO1A 1KBGH 3RTQB 3ZSTA 5C8JB 5H94A 2CLVB 4LFHG 4U1MB 4KRPC 2EDJA 4C56A 1KYOK 4L9LA 5JZ7C 1LO2L 5F72S 3QG7H 1KB5B 4Y5YC 4HKJB 4QHKJ 5KS9A 3RL1A 1S3KL 32C2B 3WE6B 4OM0L 1J0YA 1BF2A 3GMMA 5AYQA 1NBYA 2R0ZL 2HJLB 1UFUA 4YBQC 3VGHA 3VGFA 1X5AA 1IGYA 4R8WH 3G5ZB 2VXUL 4PJCB 2WQRA 1E28B 3UTPE 2ZKHH 3MBEC 4L29B 1HHKB 4RMWA 1VFUA 4NBXB 4YEEA 3CPLB 5HI4D 5GGVH 3I50L 1E6JH 5GXBB 2C4FT 5TDOA 4RBPH 1LP9B 4Y4KB 4X9BA 2YD1A 1FVEB 3WFEL 3T3PE 1T22B 3JV0A 5D71L 2GTZB 3BVNB 3MV9E 3QXVA 5DVNA 4MJID 2NY3C 3OR6B 5C0FB 4K55A 2JKXA 4KJPD 9CGTA 1INQA 1JNLL 3RA7H 4GAFB 1OAUL 4LLMA 3G6DH 4GKNB 4BFBD 1K3ZA 4HIIB 4YHZH 2Q86B 3HE6B 4N9OB 4JPIB 1DEDA 2Q7YB 4NNYB 4QHLB 3U48A 4NRZA 1L0YA 2OQJB 3A67L 4JANA 2IPTH 5I73B 1PX4A 4RQQA 3MRRB 1TZHB 4OAWB 5HY9A 4OJFH 3GGWB 4L4TD 4RA3A 2EYTA 3HC0A 3C2AL 2GFBB 2H9GB 3CSGA 2JELL 3CFKA 1P2CB 5MEPB 3WSQH 3E8UL 3O3UN 5L7XL 5IESH 1BM3L 3O8XD 4L4TA 4OZGA 4P4KC 1ZXQA 5HVWA 4I5BB 4XVSL 5HXMA 3DI3B 4OBRA 3IDNA 4EZMA 3ZTJG 1FLRH 3UTSD 5TH2A 1PZ5A 3LN5B 1NBQA 1QFWH 3O8XA 4TULL 4X4YA 3BPCA 1OP9A 4M1GH 2EICA 1D6EA 1T1YA 4QTIH 3UTSA 3HA0A 5JIIA 4X9GA 5IQ7L 1NDGB 5FGCE 4K94C 2YUVA 3KYAA 4UV7L 3PV6B 3VCLA 2QKIB 4W6WB 1A14L 4JZOB 5DEFB 5GRYA 2BSED 3QDJE 5FUZL 2W60A 4HGWB 3ILQD 2XZAH 4CN6A 5GSVA 1YY9D 5HDBE 4U1IA 1MJ7H 2V5SA 3T0ED 3QXAA 4WWKD 3ARGB 4B7IA 2EKJA 5IBLC 4LFHD 3KPMB 4APQD 4JPWH 4M3JA 1T04A 3FONB 5DFTA 2RIKA 3T0EA 4WWKA 5GRXG 3QUYD 2Q3AA 3QT2A 3MREB 1YEGL 3O6MH 4HC1L 1ZA3B 5JXAL 1IC7H 1QLFA 3QB7C 5FYJE 4NQCD 3MRIA 3QUYA 3EJYD 2BVOA 3E6FA 4JRXE 2ADJA 3CLEL 3PE9A 3U1SH 4R4BB 3GKWL 5EZLA 5CLWA 2X1WL 1IGJB 1AI1L 5JUEL 4NQCA 2V17L 3CMOL 4AL8H 1FNAA 1T5WB 5DD0L 2WW8A 4JHAL 2EDFA 4BUHA 1BQLH 3VGGA 5B3JE 4XVTH 3ZHLA 5IHBA 1A1OA 1Y6NR 5EORH 5FKAA 3KLHC 3GBML 1S5HA 1I1FA 3TBWA 4ZTOL 2XY1A 3BUYB 2NY7L 3QI9B 3NPSC 1D6VH 1L6ZA 4J1UA 4JN2A 4TVPL 2MHAA 1DN0B 4UB0L 5DFWH 3BKYL 1CG9A 4JKPH 2L7JA 2VZOA 4M5YH 5CILL 3D0VB 4EBQL 5I18L 3DRTB 1DP0A 1NC4D 1RUPH 4XP1H 4ODTL 3F58H 4A6YA 3AREC 5I9QC 2W38A 4O2EB 1FL5A 3T2NL 3DUSB 3MRCA 3RBSA 4OD2A 1JN6A 1NC4A 3MLZL 3VDAA 1CT8B 5EIIA 2C7UA 3MLXL 3FRUB 5F8QC 4YBHA 3U0TA 4U6XA 4G42A 1EEUA 1YEFH 3BMVA 2CDFB 3WIHL 3N9GH 3FT2A 1I8LA 4X0KA 5J89A 1FFPB 1CGTA 3TFKD 2BVQA 3ARFD 5I0DA 2XKNA 3U6RB 5LVEA 1NCWH 1I8KA 1X5HA 1HH6B 5E9DD 4GO6B 3I3EA 2DQJH 5FO7A 5AYUH 3ARFA 1JPGA 4E0RA 4JO2L 3HUJB 2F5BH 1G7QB 1OVZA 4R3SB 2A83A 1U3YA 5E9DA 1F6FB 2A6IA 4BQ6A 4Y5XC 1C16B 2CO7B 4RFEA 3G5YA 4LRIA 4LDLB 3B3IB 1I4FA 3EYQC 5F3HB 4O2FA 3U4BL 1XGQB 3CH1B 2D4DA 4KU1A 3RUGE 4IRJB 1HQ4A 2R8SL 5AAWA 5C7XL 1MFCL 2W9DH 1G6RH 1ZANL 3LKRA 2BY1A 5BV7L 4DEPC 4Y2DC 3L3GA 4NNPH 4HQQL 4NQUA 4P46D 4NQSA 5E1AA 4WU5B 1U36A 4ZUWA 1M05A 1MFDL 3BGAA 4LAQH 4JFFB 3WEXB 4XNYH 3HKFA 2DQEL 3ZYOA 4P46A 1CN4A 3ZE1E 1ZE3C 1FZKA 3QXUA 3DO3A 2AP2A 1LWRA 3K1DA 1HI6A 1CCZA 3S96B 2LQRA 2A77H 1WTLA 3V52H 2X4TB 5IW6A 3BT2L 5F9JA 4UTBH 5C0AB 4BM7A 4P2RD 3TNMA 1F90L 1EUTA 4WHYG 2PR4L 3C9NA 5JORA 1NC2D 4YBLB 4L3EB 5EO0B 5SWQA 3KPOA 2MSPA 4AQOA 4P2RA 2WUBH 4MXQC 1NC2A 2VB5A 4P9HC 4MNGE 1OARH 4OCSL 5ALBH 2EDQA 1P9MC 4XP5L 5EO1A 1UM4H 1OW0C 3UYRH 1FVCB 5DVLA 1I7RA 2XWBA 1IMHC 4NO2A 5ESAA 4XCCL 4U0RB 4NKMB 2GJ6D 5EDXA 4AH2B 1RIUL 4QF1B 4EUPB 3WIIH 5F7MC 5INCA 1M7DB 1MWAH 2JJSA 4N1HB 1LHZA 2DQUH 1A0QL 4NCC1 1MFEH 5IWLC 1GIGL 3ZTNL 1QO3A 1BD2B 1RIHH 4PG9A 1S78C 3QNYA 5FCUL 1J0ZA 4URTB 4NQDA 1OQXA 4OZ4B 3OX8A 4XPTL 4KXZI 5FYLE 5HHQB 3HE7B 1BJ1H 5CP7B 4NDMA 3G04A 2VXSH 4QHNA 3AS3A 4HX1B 1NL0L 3H9HB 1NAKL 5D1QA 3D0LB 4R2GD 3UJTL 1JV5A 3MUGB 1QSEB 4LMQI 1JGEA 1IM9D 4V1DE 1LO3L 1MCSA 2BVTA 5CIPH 4G7YH 5FAAA 4JVUA 2G9HA 3ALXA 1T0PB 2VTFA 3ROOA 2FO1A 5I17A 2R0KH 4UAOC 1Q9KA 5FA3B 3LH2L 4K94H 3SGEI 4FXGB 1DSFL 5D7JC 1DBBL 2Z4QA 4PD4K 4N0FB 5E70A 4YHYC 1BFTA 5J1AB 4FMKA 3FFCD 3QISA 4YXHL 1OTTD 1LEGB 3RWIB 2E7MA 5E0QA 5KVMC 4XRCB 5FF6B 4MQTB 1HILA 5LCVL 4JZJA 1U8JB 2P49B 3IT8D 2ZCHL 4CU6A 3RTQD 1WBYA 5DJCB 3FFCA 3ECBA 2EC9T 3VG0L 3WMSA 4RAUB 3N1QC 1I3RB 5EUKB 3OPZH 1A5FL 3QFJB 4XMKH 4MJ2A 1OAZH 3RTQA 5C8JA 1OWRM 4ZFOB 2CLVA 4KK6C 2VO5A 3DYMA 1B6UA 1KB5A 3D9AH 4HKJA 4MB5A 2QLVB 32C2A 3C5ZC 5C0ND 3MACL 3WE6A 4OFIA 5T3XD 2QQQA 2V7HB 4NN7B 1YN7B 2P7TB 3PGDB 3IB4A 5DT1L 1MCWM 3GKZA 1QRNE 3T2PA 1W72A 4PJGB 4WIQA 3RHWK 3G5ZA 4PJCA 3T1FB 1H5BC 4KKLD 3TESA 3ARZA 3QUXD 1E28A 4TUKH 2EZ0D 3HI5L 2JIXB 4L29A 5F97E 1FJ1B 1HHKA 5L88H 3K80A 3CPLA 1VHPA 5EU5B 5L2KD 4LOUC 4XBPB 2DI9A 3DO7B 2FZ3B 1UXSB 5ENWB 4FRWA 3GUTA 3GRWA 2VXVH 1A64A 1QBAA 1FVEA 1CE1H 3NZHH 5ESVB 4MQXC 1T22A 2BJML 1MCOL 3VXRE 2GTZA 3BVNA 2R15A 5L2KA 1AXTL 2H1PH 5EOCH 1ITCA 1YEEL 1H8SA 5C0FA 5HHOE 2O5YH 4OZFB 5L6YH 5E56A 4GKNA 2EYSA 2AV7A 4I3SL 4BK4A 2Q86A 3ULUL 2J4WL 4JPIA 4KH2A 4O51B 2Q7YA 3IDIA 3P4OB 4NNYA 4QHLA 4HXAH 3AUVA 4UV4L 3MRRA 4OAWA 3ARTA 1EFXB 1FGVH 3MV9B 4LPWA 1SJHB 3GGWA 1JFQL 1R5VB 4KVCL 2GFBA 2H9GA 2J8UE 2VABB 4GRLB 5EOTB 2JB5H 4X7FC 1P2CA 1NCNA 5MEPA 3ULSB 1GGBL 5GS1C 2VDNH 1QYGL 1YYML 5C0CE 3MV7E 1CDHA 5FO9A 3V95A 2QHLA 4ZPTB 1RHFA 2Y5TA 3DSNA 4KAQL 4R90H 1DBJL 3H6JA 4Y16B 2ZJSH 3VWJC 4CVWA 3QR2A 1TQCC 1SJEB 4CDGC 1FL3B 1F58H 3PV6A 2QKIA 1XGUB 4XC3L 3EOYG 3VXQB 3L3DA 3QJHB 4DQOL 4JZOA 4JFED 3ARGD 1KB9K 1ND0A 3I6LD 1GXEA 3S35H 4HGWA 4M7ZC 2AXFB 1VESA 2FGZA 4NC0B 5C0IB 2AJXH 2CPCA 1MAML 3ARGA 3KPMA 3FONA 3T4AA 2RBLA 5A3ID 1BBDH 4U6HB 5FGCB 2XFXB 3WDHA 1GGCL 4HS6B 1HEZA 3MREA 2H2SC 4LPYA 3RHWF 2APXA 4BJLA 1Q9WB 1H3VA 1MJUH 5DFVD 3KPQB 3QDJB 5DO2C 4S1RH 4DAGL 1T7XA 1JZ5A 1YEIL 2VDRL 4S1QL 3QNXB 4D9RD 1I3GL 1KJ2B 2WANA 3GSXB 3LKNB 4R4BA 3H7LA 2AV1B 2GAZB 3SKJL 1NLBL 3TO2B 5DGRA 4P9HH 4ZUSB 1T5WA 5AUMB 1LK3L 4H0HB 5F7EH 3B5GA 5CEZL 5LGHL 3MRQA 1RZKC 4LSQL 3QO1A 1FSKC 2CQVA 2R2BB 3LY6A 3VA6A 3IJHB 1I9JL 2YD6A 5EUOE 3LD8B 1ZMYA 4CNIB 4JRXB 4BYHA 3BUYA 4YHKH 2OL3B 2XZQL 5MI0B 2X4RB 2DMKA 2VLRE 4L1HA 1T20B 1DN0A 3UCRA 5DWUH 1INDH 2B39A 1J12A 3D0VA 1V7ML 2X7LB 4JE4B 3DRTA 2DLIA 4Q7DA 2V5RA 3H8NA 3LHPH 3MA9L 1PG7L 4P5KB 1K8IB 3P11L 4PJEF 4O2EA 1T03H 2Y5EA 3DUSA 4LF3A 2AABH 3FOLA 2P1YA 3W81A 2BXZA 1BFOB 1CT8A 1OSZA 1WEJH 2VLKD 1TITA 1MQKL 1RUKL 1YQ2A 3BIKA 1T5XB 3T4YB 2EXWD 3E1F1 3UO1L 1C5CH 4MCYA 5F9AC 4NZRL 4AEHH 5I8KL 3MXVH 3D2UB 3E0GA 2CDFA 1KTDB 2VLKA 1A02N 1F3JB 3C8DA 4XCYB 4JB9H 3W2DH 1FFPA 5GRJL 1TTUA 3RVTC 5DD1H 2NY0B 2KZ1B 4XXCA 4KJYB 1HH6A 3CUPA 4HJ0C 4HWEL 2WMPA 4RWYL 3HUJA 5DJ2B 4I18B 4NJAL 1G7QA 1FDLH 3PL6B 3IYLW 5H35B 4RWHA 3MLYH 4EDWL 5DEZA 3DX6B 3VFSB 2Q20A 4X6FA 3B3IA 1MRCH 4LVNC 3P4LA 5F3HA 1DLFL 1XGQA 3I3BA 1EH9A 3SDCC 4YHMH 1IEBA 3VXTB 1SM3H 4XAWH 4HFWB 2NY5C 4JFFD 3ZT7A 4XAKE 1LQSR 4WU5A 2MKLC 3QUZB 4MAUL 3SJVD 1F3DH 1RZ8B 2OSLA 3HFML 1CXEA 4JFFA 3WEXA 5ABDE 3HMXA 1AC6A 4WTXA 5F7UA 1GGIL 2APTA 4HBCL 3SJVA 4AM0B 4OZIF 3RUGB 2EDHA 5JIPA 1AR1D 3S36H 4FQHB 4OCRL 4IOFC 2PETA 4GJTB 4GKZB 1FZJB 3FCTB 5C86A 4L3EA 5HHPB 3VI3E 3UTQB 1CICB 3IU3B 5DMKA 4GG8A 2HT2C 3WS3B 1U91B 2CO6B 2FEDC 5EB9A 5CEXB 5LQBL 3CFEB 3WNNA 3IXAB 3Q6FA 3UJIH 2XRAH 5C1MB 1FVCA 4OZFG 4OTXH 3ARQA 4FQ2L 4NKMA 5FGRA 5F1KC 4QF1A 2E7BA 3MRGB 1M7DA 3L5JA 2J88L 2YD2A 1UKTA 4MLIA 4MNGB 3QSKB 3SDAB 3CXHJ 1YEJH 1PY9A 2ITDB 4F57L 2R9HD 1QQDB 3F8UB 1VDGA 4OZ4A 3LMJH 4CVXB 5HHQA 3HE7A 5CP7A 4M93B 4HX1A 1CDYA 4U33A 5BVPH 3D0LA 3I9GL 3ULVL 1A6ZB 1JNHB 2CUHA 1I7UB 5ACMA 4Z7UE 3SY0B 4BA8A 5EN2A 3HC3H 1JZ6A 1DEEB 3H7BA 4XNUL 4BSWB 2EH8L 4XHJD 3K4DA 1NGYB 1T83C 1JWMB 1XGPA 1FCCA 5IJKC 3LPWA 2EDOA 4FFWC 5I15H 3JV6B 3VW3L 3QA3B 1BGXH 3UDWA 2QSVA 4RX4D 3UYPA 5FOJA 3F7QA 4XWOD 1PZUB 2FATL 2NNAB 4JFDE 1W0VA 3VRLE 1A7PH 5EC2A 5CUSH 1QBLH 4RGNC 5IB2B 2DYPD 4PJ8B 5F8RC 1LEGA 1SJVA 3O2VL 1UZ6F 4JVWA 4LCWE 4J4PC 1OTSD 3CFJB 4XRCA 3THMH 3U0PB 5FF6A 4KTYA 4V1DB 1U8JA 4J12A 4QRTA 2NXZB 5DJCA 3I02A 3HZYB 5T3ZH 4EJ1C 3GMNB 3RVUD 2LVCA 4WI4A 1I3RA 1IGCH 1MFNA 2VDMH 4NYLB 3CLFL 2HFFB 3QUMH 4TSAH 4ZFOA 3HMWH 4O9HL 2DQIL 1ZEAL 4NOBA 3RZCD 1HXYA 4FQIL 1S7UB 2X42A 3D6GA 3PXHA 2PCPB 2PO6B 2V7HA 1YN7A 2P7TA 3PGDA 4LVEA 4Z0BL 1Q72H 3IDGB 2JIXD 5I8OL 4LHJB 5DUBB 5HBBA 3RZCA 1I3VA 3FMGL 4PJGA 3GBNL 2V9RA 3S34L 2WINB 3O6LL 5IW1B 3V7AG 4HKXB 3T1FA 2VLJE 3NMEA 1T0NB 4WW1A 2R69L 2QQLH 3F62A 2JIXA 5IROA 1RZKH 1W2KT 2X70B 1FJ1A 2F5AL 3QCTH 4Q6IB 5TE6L 3VE0B 4PB9H 5EU5A 5ITBH 4Q9CA 1PQZB 4XBPA 1CGVA 1YEDA 2FZ3A 1UXSA 5DSCB 4P5MB 1JZ7A 1FIGL 2O5XL 3BW9B 4QRRD 5ESVA 3R0MA 1FQ9C 3V4VL 1CQYA 1QZ1A 5AG9A 1XR8B 4F9LC 3B2UC 3TJEH 5I1KL 4OZFA 2CJUL 4QRRA 4YZFF 3PP3K 1WCQA 3NA4A 3NZ8A 4U1NB 3Q1SL 4LU5L 3IAQA 3MX0A 3ARYA 1EFXD 1GOFA 2AK4E 2ED9A 3P4OA 5D1QC 1GAFL 3F6LA 1NFDE 1F02I 4XVUC 1TJIH 1RVFH 4PRBB 2VC2H 4KROB 4XWGL 3VXRB 1EFXA 5CJXA 4RGMB 5DJ0B 3MV9A 3HAEG 2VOTA 1TZIB 1SJHA 3D3VE 1R5VA 5HHOB 4R96B 43C9A 2VABA 4GRLA 5EOTA 1INEH 5JQHC 3KPRE 4OCNC 3LEXB 3LIZL 2OJEB 1WIUA 5C09E 2RGSA 2I26N 4H20L 1KLFA 2PXYD 1RUAL 1FVDA 2J7LA 4G6JL 3DOSA 1IAIL 3JTSA 1FNEA 3O0RL 2VSCA 3SOBL 4FA8A 3BYYA 4Y16A 2PXYA 3D48R 4W6YB 1SJEA 2J8UB 1OP3H 3U79A 1UKSA 1I1AB 4G7VL 2VUYA 5LJYH 3T3ME 5DK3A 1XGUA 1NCCH 3GSRB 2ZCKH 4A2LA 3K4ZA 2NY5H 4JFQB 1I3UA 2AI0H 3MCG1 3MV7B 4TUJB 5C0CB 3VXQA 1JIBA 5IB4B 4M1DL 1YQVH 5TFSH 4E9LA 3LQAL 5DLML 2FLBT 5C0IA 3EZ8A 4OCXL 2FEEL 3QEQD 1FV1B 4KTDH 2V2TA 4Y0GA 5DC0A 3VXME 4LPXA 1ZLVH 3BSZH 1LD9B 3SE8L 4U1SB 3QDJD 3BPNB 2XFXA 3GSOB 5IMMA 3QEQA 4HS6A 3WN5C 2WQ8A 3IDYC 3SCMB 5BOPA 1ETZB 1PSKL 4M7LL 2QTEA 2WBWB 4KDTA 1Q9WA 4D94A 1QFPA 3OGCB 3KPQA 3QDJA 3SN6N 4C59B 1AXIB 2M8XA 4JM2F 4YGAB 2DIAA 1CLZH 2EZ0C 1HHIB 4KXZH 4Y4KC 2ITCB 3GSXA 2BDNL 1KJ3L 3G5VB 2HLFD 2AV1A 3Q0HA 4OKVB 3IDXH 3TO2A 4ZUSA 1E4WH 4YHIB 3RAJL 5AUMA 2AJYL 3FB8B 5HGDB 4D3CH 2R2BA 5CGYC 4YX2H 4MA1B 4FS0A 4U1HB 3IJHA 3HE6C 4JDVA 3L3HB 5KN5B 4DKFL 3CX2A 4CNIA 3SGEH 2VDKH 4FNLH 3P0YH 3BN3B 5FO8A 2OL3A 2X4RA 4LHUB 1QKZH 1ZLVK 3CDCA 4ZS6C 4X6EB 1RFDL 5K59E 3NCFB 4ZOAA 3TGXA 2X7LA 4K8RL 3ZSSA 4K71B 5FM5M 2VLME 1PAMA 4LARH 3LCYA 1LO4H 5GGQH 5C2BL 4P5KA 1K8IA 4YHOH 3DX8B 4ZD3L 2XTLA 5DJXA 1ZHNB 5EUOB 3NFSL 5B39G 1GPOH 2ZP0T 1BFOA 3D2UD 4JM2D 4PG2C 4H1LH 3T4YA 4TTDD 1SY6L 4ZSOA 2VLRB 3MROB 3X13B 4MS8C 5JLZB 3HRPA 4QNPE 1TZGH 3D2UA