3O2WH

Crystal structure of the 1e9 phel89ser/leuh47trp/meth100bphe fab in complex with a 39a11 transition state analog
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
214
Chain Sequence
QVQLVQSGPELKKPGETVKISCKASGYMFTNYGMNWVKQAPGKALKWMGWINPYTGESTFADDFKGRFAFFLETSATTAYLQINNLKNEDTATYFCARGTTIVRAFDYWGQGTSVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the 1E9 PheL89Ser/LeuH47Trp/MetH100bPhe Fab in complex with a 39A11 transition state analog
rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
molecule keywords Chimeric antibody Fab 1E9, light chain
total genus 38
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2010-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o2wH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o2wH02
2WBWB 4PPTA 1WCBB 1NSNH 3QQ3A 1J11A 4EUPH 5IQ7L 1UH2A 4P57A 2UVFA 4L4VA 2QSQA 3ILPB 4JZOB 4OV6F 3RWHA 2VABA 2DKSA 1VA9A 1EMTH 5FYKU 1Q9OA 1R3KB 5EC2A 4PB0H 3QB7C 4JQVC 2W60B 5ERWB 3BGFB 4Y5VB 3H0TA 2IQAA 5E00A 3TH2T 3W0WA 2YBRB 3B9KA 5I17B 1G0DA 5CMAB 3CD4A 4P5TB 3K74B 1AY1H 1XGQB 2FX8H 3DVGA 3T3MF 4Q9RL 4P48A 3TCLB 3K81A 2GY5A 5EU6B 1UYWL 4AM0B 2Z4QA 2JB6B 4JRXA 3MJ7B 5I1DA 4UQ2A 5DK0B 1RPQA 2VLJA 3VXSA 2J6EL 4HS3A 2ICWJ 4HUUB 4P2QD 4CKVX 3ES6B 4XHJC 3U30C 2VKXA 4XC1H 2YHGA 5ENWB 4OCMC 4YQXH 3VGHA 5T1LD 2YD1A 1OQXA 3QP3A 3W0WB 4LLYA 2PW2B 2EC8A 2C1PB 4CNIB 5ILTH 3FQXA 4AMKL 1KCVL 2B0SH 4EXKA 1U42A 4J3VA 1HK6A 3BPOB 2AJXL 4L3EE 4V1DB 5D1QC 4F7CA 4JRXE 4YEEA 2OK0L 2ZP0T 4NBZB 3RVUC 3O3EB 2XKUA 3FHAA 2CK0H 1G0XA 1XR8A 1K3IA 3IGAA 3Q1SL 1T22B 5D1QA 2VKWA 3WN5A 2F74B 2Y23A 2IAMA 3SKNB 2HN7A 4EIGB 3ESVF 5EZOL 5JW4Q 3OB8A 2ZWLT 1VESA 1YECL 5B8CC 4MD4B 1WFUA 3MRFA 1G6RA 1UXWA 3CVHB 1XGTA 3N9GH 4U6YB 2ZCLL 4EI5B 1XGPB 1CCZA 1QSEB 2WWKO 4I3GA 5JW3H 4LLQB 1JZ4A 3FMGH 2XWBA 5EORL 1JZ3A 3PXJA 4P2RB 1KACB 3GI9H 3MLVH 3CFIC 4RIRB 1QSFB 3HZVB 2YMXL 4PIRF 1EGJH 5B4MD 1NUDA 1D6EB 1ZGLM 3GSQB 4RGOH 5KSUA 2CKBB 4GO6B 1PYWA 4XCCL 2R1WB 4O2CB 4X6FA 3R06A 3PGCA 3S34L 3CMGA 2HLAA 4PRHA 2BSED 1ZVSA 3KPRB 5C08D 4ZPVB 4TQEH 5T3XD 1TIUA 3MRPB 4UBDD 4X6DE 4M4PA 1P7QB 3MV7E 4BJLA 2GAZA 4UNTA 3LS5L 2C1OA 4GXVL 1UACH 4WU7B 4DVBA 4XBPA 1Z0MA 3QNXB 1N3NB 3MRDA 2NYYC 4PLOB 3S3JA 4LSVL 3BYYA 3HB3D 2E5EA 3NPSB 4YHNB 2Z31B 3ZE0E 3AXLB 1I8MB 4ODBD 1HKFA 4H88H 5T1LA 2UYLA 3S37H 1R3LA 2EIZB 3SDAB 5C2BL 1V7ML 1FQ9C 4XNXL 2Q76A 3B83A 2IMNA 4AENA 1DE4B 3OKLB 4IHOB 1OL0A 1RV6X 3RPKA 4KJPC 4XNMB 3LQZA 1EAPA 3D48R 1XF2A 4BFGA 1W8NA 1S7RB 5FGCE 3X11B 5D4QA 1T1WA 1S3KL 1MCCA 3T1FA 4S1DD 5INCA 1F6AB 3MCLL 4KZDL 4OGYH 4F7MA 1BEYH 1XAUA 2DQDL 3PV7A 1H0DB 1JP5A 3BAEL 3MBED 3LN4B 1IM9A 2DRUA 2Q20A 3O6FB 1GPOH 3MRGB 4L4VB 3G9AB 4NUGH 3RGVD 4TSCL 1AHWC 1T89C 3P4NB 5JPMB 1RFDH 1NGYA 3OKMB 4L1DA 4NO5A 4AEHH 1AHWB 1X3DA 3BPNB 3H0TB 5I1CH 1YQ2A 3KG5A 3TA3B 4A6YB 2R2BA 3QUYB 5FUZL 1DN0B 4KDWA 1FIGH 5JZ7D 4KPHH 2P5WB 2G9HB 2EO9A 5C6WH 1X4ZA 1P5UA 2B20A 2Y5TA 3O9WC 3LD8C 4OGAD 3VRIA 4ZNCD 5DJ2A 1S7WA 4IRZH 3QWQB 2PXYB 5F7DA 1AO7B 1FNHA 4FRWA 5FB8A 5L6YL 4RRPG 3T1WA 4ETQA 4NO0B 5DJ0B 1KEGL 1BQLL 1ORSB 3D3VD 4U1HA 3EFDH 2LE9A 3SDAD 1QEWB 3RTQC 4PRNB 3TPUB 1ZE3C 3GJFB 3CUPB 1KULA 3O4OC 4YHLL 5CLTA 1G9ML 4Q2ZB 5MERB 1GOHA 1XIWC 4YC2C 1IQDA 3DRQA 3N06B 1B4RA 3C5ZA 4ZUUA 4ODSL 4WUUE 1I9RH 2Y4SA 2YZ1A 4K9EH 4R97C 2EDBA 5HI4D 5C6PB 3LDBC 2WBKA 5BMFH 5LKNA 4K71C 1LE9A 4DGYH 1J0IA 5ITFB 4ONOA 1RUAH 3IDJA 1IGCH 5FYJE 3W81A 3QSKB 5DS8A 4DKFH 1DDHA 1XFPA 3RWIB 2Q7YB 4Y7MA 1FDLH 3BQUA 3OF6A 1F11A 4OGZA 5E6IC 5C07D 5GGVY 1WWCA 2FD6L 1XF1A 3U7WH 1UKTA 4KMTL 4WHYG 5JPNA 1IAOA 1QRNE 1F3RB 1OGTB 5D6CA 5D96C 5EFIA 1V3LA 3MJ9A 3OJ2C 2NLJB 3PIQA 3IKCB 3IJSA 2R1YA 3WXVL 4RWYL 3DRQB 2R15A 4Z7NE 2Z0BA 3LRGA 3CXDH 4KQ3H 4Z78B 3DURA 3GRWH 1ZSDB 4LSPL 3SDXF 1T1ZB 1QSZA 3EOAB 3IRPX 3G5YB 4Z7QE 5DTFB 2ICWA 2W07A 4PLJC 3OG6B 2I60H 3HR5B 3OAUH 1BLNB 2CKBA 2C3XA 1A1OB 3OX8A 1DFBL 4MNHA 1JMXA 3BPLB 4UT9H 3IETB 3DUSB 1QBML 3O3BA 5DEFA 5I75B 2C4XA 1LEIB 4MDIA 4ZFOB 1WSST 5C0NC 3OBAA 2RBLA 2XNAB 1KTKE 2NZ9C 4JJ5A 3TVMA 3F58L 3TNNB 2OCFD 4XHQA 2W91A 3GRWA 4YUEH 1JGUH 1BFTA 5BS0A 1C16A 1KXTB 2WNGA 1J86A 3TYFB 3ILQC 1MREH 2Y9RT 4D0BB 1QLFB 2W65A 2Q1EA 4PD4K 4LNRA 3SE4C 1G7PB 4RAVA 4GW4A 2X70A 4APQB 4JZNA 1WC7A 5I8OH 4TUOA 2V9QA 4LKXA 1F42A 4NKOB 3NFPB 1OAQL 1MFDL 3U79A 3PP4L 2KQMA 4PJXF 1U8KB 1CLYL 2CH8A 3CIQA 2ZUWA 4BUHA 3NH7L 3GGWB 2R2EB 4P4KB 1S78C 1JF1A 5E0QA 3HLAA 2XKSA 5EUOF 3TBTA 1MRFL 3VXPA 4P2OA 1N8ZA 2I9LA 4PV8B 1HXMB 4QOKD 3QDJE 4XP9L 1HZHH 2RIKA 5B3NA 3D2UA 4ZOEA 4AJ0A 1URLA 4OIAA 3SQBA 5E8DH 3HCVB 4GQ9L 1A14L 1EO8H 1U2HA 4Y2DC 1G7PA 4U3CA 3RWDB 4K8RD 5DD6A 2DQUL 1KOAA 1NAKH 4GG6A 4K3JH 3QEHA 4F58L 1FG2B 1KJ3H 1JPSH 2OZ4H 3BIAX 3SGJC 3HMXL 2X05A 5C0DB 1TZGL 3WNKA 3SE8H 1EPFA 5BQ7A 4ZNEE 3OKMA 3PJSB 4PJCF 7FABH 4WGVB 1UWEL 4JRYA 4DK6A 5DJCB 1QNZL 2EH8L 3H42L 5C0JB 1B9ZA 2WBJC 5FYKH 3AU1B 1KT2A 3RBGA 5I0DA 2ED8A 3I6LD 1EBAA 4R4BB 1F45A 2GTZB 2V17L 5J6HB 1MH5B 4ZDHA 1QLRB 2J8UA 1NANH 1FJ1A 1R3JB 3QCVL 1T1YA 4UDUA 1LD9B 5FAAA 3WKMH 2AXHA 4DK3A 4LVOC 2IH1A 3KPOB 3QDHA 2HAZA 2ZUQB 5C92A 3ZDZE 4RGND 2FHFA 3W9EA 1LMKA 3FQTA 5DFTA 2GCYB 3KWWB 1KLUB 4ZUTB 2J1KA 3D9AL 2X4TB 3QNYB 2DTSA 4XPHH 4IM8A 1UCTA 4PBXA 5HHXL 5IROA 3L7EA 1HZHL 4MJ6A 1XCTB 5CIPB 4MXWH 5D7JC 4Z95L 3KPNB 3QCVH 4I77H 3WXWL 2AXGA 4U1SB 8FABB 4ZUSA 3JWDH 1YZZA 1KTDA 3T09A 2PXYA 2P5WE 3LEYH 3OMZA 1Z3GL 5E8OB 4ZYKB 1T22A 5I18L 1KC5H 3VH8A 4NHUA 1LEKA 2C26A 1YN6A 5E2UH 3SKMA 1E6OL 3DVNB 2FJHB 4NO2A 5EZLB 4JPIA 1PY9A 4KKCD 1ZLUK 4XBGA 3OR6B 1SEQL 1WITA 2FHCA 3VDAA 2F5AL 3A67L 5CEXB 6FABL 2PCPA 2GT9A 2KQNA 3PGFH 4XPFL 4JG0L 2RFXA 1AQKL 1G7JA 2HWZL 3KYMB 3CZFB 4MCYB 1IM9D 4ZFOL 2R4SL 3K4DA 4YDLC 5LGJB 2X7LA 2X9XA 3N50A 2YR3A 5ESAA 5DJXA 5GRZA 5CD3B 3N0PB 4J4PD 3V7MA 3LMJH 1AQDA 3DMMD 4U1LA 4TOYH 3EAKA 1BZ7B 1AGFB 2W59A 3VFWB 1F3JA 1BJ1J 3AVEA 3AS1A 3RDTC 3OAUL 1G7IB 2D31A 4KVCL 5BVPL 2Y72A 1L0XA 3CVIL 3LEXA 4L8SB 3X17A 1J05B 3LHPH 1QBMH 1XGYH 3UO1L 1EO5A 3C60A 1Z5LB 2CUMA 3B9EA 4NKQB 2ESVA 1D6VH 1F02I 4BK4A 2GTWB 1KF9B 4O9HH 1G7JB 3NFNA 1A8JH 1RHHA 4Y4KD 4XVTL 1E4KC 4FFWD 1A9EB 4D0CB 2UY6A 1W0VB 3L3GA 1MHPL 5FDWB 1T0NA 4YIQA 2PW1A 2ATKB 3AXLA 5IJVB 1I8MA 5EWIH 3C6LB 4P2CG 3CMOH 5AG9A 1YEFH 5B38A 1G7QB 5GSRA 4CVZB 3DTXA 5CKAA 5DMYA 4NQCE 4XMKH 1A22B 4JPWL 2CPCA 4OT1H 2Y7QA 5GS0L 3MV8D 5SWSA 2FJFB 1FZOA 1HE7A 1RULH 4YHML 1J05A 5B4MC 1U8PA 3SOBH 3NCMA 2X1WL 3CFEA 3L7EB 2AJSL 5D7KE 3LKRA 1FLRL 2EKSB 3KXFA 3T2QA 3OKKB 5HPMA 3D0LB 3M1BA 3S36X 2PTTA 2X4OA 1YY8A 1TTFA 4RMTA 3QIBC 1DVFB 2Q8BL 5MHSD 3F12B 5J3HC 5BVJA 35C8L 5T3ZE 1AGCB 4JPWH 1FO0L 1X5IA 1BFOB 3FO9B 2VZUA 1D5MB 4PRNA 4MS8D 5A3ID 2HYMA 4CW1A 1CD1A 2OI9C 1AR2A 2EXYD 3IJYA 3VFRA 5LGHL 2AJSH 4UI2A 3MC0A 2CIKB 4XPGL 2AJXH 3C5SB 4PG9A 4NNYA 1GHFL 1JFQL 2NXYD 1I7RA 3ZL4H 4QRQA 1RQ5A 3WL9B 2LU7A 4LCCC 4P3DA 4NKDA 3O8XC 2EYSA 2NY4B 3EO9H 2AABL 3V6ZA 35C8H 3O3EA 4NZTL 1WQVT 3NAAH 4G6FB 3VXUD 5FEBA 1AC0A 3L3KB 4IRJD 1TPXB 3ZKNC 5DUPH 5DJ6A 2DD8H 1J88A 4LIQL 2X2YA 4JN2B 3FCTB 4P3CH 3RIAF 4R96B 3K4ZA 3THML 1KPUB 4NZRL 4HUMB 3SQOH 4XMLL 2EXWD 1J1PL 1XGTB 4LLWB 1NCBL 1RK1A 3RKPA 4YHMH 5EO1B 2VXVH 2GKIA 1U8MA 3NFNB 4XP6L 4WY7L 2VL5B 5CILL 3QDJD 3TEUA 1IFHH 4NC1E 3H9HA 4UUJB 1T1ZA 3MCLH 4NBXB 5C0AE 1ZVYA 4UILH 1PKQA 4LDLB 5EA0L 3D9AH 5T1MA 5DD3H 2DQCL 2Y07H 5H94B 4KI5F 1SJXA 5IEHA 2IPTH 4P3WA 4WEBH 1S9KC 2CGRH 4X9FA 1AIFA 1U8QA 3WDIA 4RCAA 2C3GA 3KPPB 4X9BA 2ZJSH 4M7ZC 5ALCL 4E5XA 1VFUA 1EDQA 3MGTB 2CD0A 3FL7A 2R56H 4HXAH 1BVLA 4O02L 5EIQA 2APWA 1T2QL 1YNTB 5HI3C 4JKWA 2LV4A 3BGMA 4JFFA 4R0LB 4KU1A 3CZFA 4MCYA 2YZ8A 1EBPA 3TNMB 3UYRH 2QLVB 2Z92A 5D7IF 2NY3D 4DGIH 2O5ZL 2AAVA 1AJ7H 1MCWM 2WW8A 2JK5B 3F65A 5ESQB 3T2NL 5JMRA 5IHZA 5CJBA 4ZUSB 4GAYB 1Z0NA 4CVUA 4U1MA 1IILE 2FH8A 5JHDA 2OR9H 3T0AA 4UDTA 4L4TD 1M6OB 1H3TA 1JHTA 5C8JB 2P8PB 43CAB 3DECA 2FB4L 4U1HB 4MXVE 4YHPB 4F7PA 3EOAA 1FFQA 1T7ZA 1RZGA 2V2XA 2WV3A 3AC0A 5D93C 4M6NL 4LPXA 5DEGA 3GMLA 4WY7H 3UBXI 3S4SA 3G5ZA 2LU4A 4OIIH 2EDYA 4JFDB 5HGAA 3GUTB 3LRSA 4DGIL 4M6OL 4Y4HA 2XWBB 4M1CD 5EA0H 4G7YH 3JTTB 5DRNB 4MD5A 4HC1H 2IPTL 1SJHB 5GS1A 2HJFA 2IBGA 3NCCB 2AEPH 3TYFA 4HGWB 4V2BA 1S7SB 4HBCH 1RK0B 1U3HB 5EWIL 5DC4B 4NRXB 5F9WB 2XRAL 2DQJL 1U8NA 4YDJA 3BDBA 1YY9C 5BJTB 3DX9A 4I1NB 4PGBA 2DM4A 1AE6L 4UT7H 4DKEL 3N1QC 2EDHA 3LKSB 1U93A 4W4NA 1L6ZA 1KLGA 4Z7UA 4Z0BL 4BSWA 3HE7C 1UXSB 1B0WA 4ZDHB 5SWZD 4N8VG 2OTPA 5ETUB 2R0ZH 3DRTA 4M4RA 4QTIH 5D9SA 1PQZA 3RL2B 3SGKA 3WSQH 3K3QA 4X4XA 4YWGH 4MX7A 2E27L 1JMZA 4QTHB 2PXYC 4XCNB 3ZE1E 2NR6C 5I1JL 2R1XB 3WD5H 2APVA 1OAXL 2VDLH 5SWZB 3MV9D 5AZ2H 1KNOB 4WENB 4OM1L 4Y4HC 3V0WH 5AZEH 2DYPA 5HYJE 5DHVA 3HKFA 5I76B 3MBXH 1AI1H 1DANT 1WT5A 2D7PA 1C16B 1TLKA 1U58A 1R5IB 3EYSL 4Q9BA 2CO7B 1MWAB 1E4XI 3ZL4L 1SY6H 4PRPB 4RFOH 3FN0L 4RMSA 4Y16C 1MHHA 4ELKB 4U31A 4MDIB 3EO0A 2UWEF 4GW4B 5EOTB 4GJTB 4KHXH 4JFPB 4X9GA 3H9ZA 2ORBL 3Q6GL 4NQEB 1BGXL 1QP1A 5IM7A 3OR7B 2IWGA 1JRHI 5D7KD 1X5GA 5KAQG 1UQSB 1DBKH 5BMFL 2G5RA 1KTLA 3IFPB 4M61B 3SGEH 1CGTA 4PJ7A 3L5XL 4OZGA 4BSVA 1AH1A 4GOSA 3OAZH 4FFVD 3TC9A 3V7AG 4MB4A 3BIKA 2Z8SA 4QXTB 4PJXE 2E7MA 2ZCHL 3ARDD 3O45A 5TE4L 1LO3H 5GRUL 5ACMA 3HS0A 1F3JB 1D3CA 2E8ZA 1G7MB 3QXVA 3H3PL 5DEFB 1NAMA 4Y2DB 1CE1H 2V2TA 3OQ3B 1Q8MA 4F7EA 2JCCA 4YWGL 1OGAD 4OI7A 3SKNA 5F1NA 5H8DA 1O7VA 1XF3A 2A1WL 3CVHL 3VRLF 3NIGE 1P4LA 4LEXH 3G6JE 1N64H 3I50L 2EZ0D 5DMIH 4JZJA 3X12B 4ZUUB 4UU9B 2AEWA 4WHTA 4GRWF 3O2DH 3UTTD 2BY1A 2IEPA 4WTWA 5JOPE 5FF6B 3MV8B 4L8DB 4P23A 3T04D 4JFXB 3O8XA 3MRCA 1X5KA 3BQUB 1IJ9A 3HRZB 1U6AL 3CFBB 3RUGB 4U0QB 2ENYA 3FT3A 1RZ7H 4M7ZB 2EDWA 4X99A 2Q86B 2D7TH 2Y06L 4LU5H 1NQBA 5D2LA 1FCGA 2VUOA 4OB5H 3S5LA 5GRWA 3NPZB 3DO7B 5IFJB 3FMGL 1NFKA 3F6IA 2XICA 1XMWA 3T0EA 1INQA 3D85D 5KJRL 4HFWA 4PJCB 1CLOL 1H15A 3FO2A 3L5XH 3BP6A 4Y8DC 5HGDB 4MXWL 4RMVA 3ZE2F 3QT2A 5K59F 3SDXA 3K2UL 4EN3A 3QZWB 3EDDA 4K7FA 3IDIB 3QI9A 3UEZA 1MCKA 2ZUVA 1ZGLA 3L3DA 2ERJB 3SEPA 3IU3A 2BOBA 3QDGB 2BNQA 1HDMB 4XI5D 3SO3C 3BISA 1IGYA 2MKLC 3NN8A 5MP6L 3WUZA 5I19H 2BVEA 2D03H 3DI2B 4GMSH 3OKYA 2V5SA 1P2CA 5AYUL 5DQ9A 5TQ0H 1G9MC 2VDPL 5IW6A 3LKQB 4OJFH 3E3QC 2MHAA 5JHLH 3MLUL 1MCBA 2DI9A 3SO5A 1N59A 3HG1A 3LQAH 3PQYA 5D8JH 1S9WA 5E99L 3RI5K 3LN4A 3OSKA 3QRGL 1A6PA 2G5BB 3OKEB 4JAMB 5MENB 3TVMB 3PABA 3VWJD 1FYTA 1GZQA 4X5XB 1EUTA 3KPOA 4WEUD 4DJMA 1FZMB 5D2NC 1YYLL 4XNQB 3S35X 2I07A 4QTIL 3IJYB 1RJYB 3CFBA 4O2FB 5DUBB 1QNZH 1CD8A 3BZFB 3MUGB 4U1KA 5EO9B 5C07B 4U3HA 3BP5B 4Q9RH 2EECA 4LDEB 5KSVB 5AYUH 1UVQA 2F53E 2XY1A 1QFOA 3D1MC 3WJJA 5F7EH 4MJIE 5E1HB 1U3HC 1I7ZB 4O51A 5F96H 3GRWL 3ZSSA 3MV9A 1DEEB 2LABA 1CD0A 1EEZB 3KLHC 5IEHB 3L6FB 4MJIB 3FOMB 4HQQH 1BOGB 5HDBE 3HNSH 3STBA 2IFGA 4S0TD 1U8NB 3V4UH 4I18B 4XMKL 1CXLA 2X4SA 1CLZL 5D1QD 5CFHA 5IMLA 1I4FB 2XYCA 2E6JA 1CICC 5IVXB 2AV1B 1GGCH 4ZS7H 25C8H 4O2FA 5DUBA 1OLZA 3FT2A 1KJMB 3GMQB 3OJVC 2VXUH 4X6CA 12E8L 5HHQA 1HKLL 4X7FC 2CLRA 1DSFL 3C09C 5F3HB 4V1DA 5CJOL 5HDLA 5JHLL 3A6BL 3QG7L 1LNUA 4BZ2L 3T0XA 3G04B 1PYWB 4HIJB 1YQVL 4PJIE 5FGRA 2YUVA 3VXOA 1C7SA 4WW2F 4PS4L 3RNKA 1QVOB 2FGWL 5BVJB 5DMJB 2JCCE 3ZSTA 1IGJA 5B3JE 1ADQH 1HHKA 4QO1A 4RX4A 1U3YA 2XPGB 1GGIH 2DLIA 5EU3B 1ZHLB 1QFUH 3EKCA 4TNWF 1X5YA 1T0PB 5CIPH 4LOUC 4YH6A 2UWEB 3H7BB 3IVKB 4ZFZB 4GW1A 5A2JH 3HC3L 3W0WD 2E6QA 1HYSC 4GRMB 3UTSD 4YO0B 5I73C 4OT1L 1UM5L 1SJHA 5GS1B 1JNLH 5IR1B 4DEPC 1KJVA 1NCWH 2DQUH 5CJQH 2H32H 1CR9L 2OR7A 1S9VB 1FLRH 1KLUA 4ZUTA 4P46D 4DAGH 4CMHC 4PJ7B 5I8CB 1ZANH 5IESL 3SY0B 4PJIB 4R2GB 2B7DT 4NIKB 2P5EA 3ARDB 1F6LL 2VXUL 4AH2A 1A6WH 1B2WH 5EN2B 1XZ0B 1F6AA 1LO5A 3AREC 3CFDB 3FTGB 3ULVF 2VISA 4PJGB 4X6BB 1Q72L 4EN3B 3G5VB 4QRUA 1ZLSL 4P9HL 3UAJC 4HUUA 1RZIA 1GXEA 4JZOA 2EYTB 2X4PB 4XP4H 3BKCH 5BW7C 1FH5H 1EEQA 2G60L 5DMGD 1EHNA 4GLRI 4XVJH 5HGAB 4PG2A 1NLBL 3DUHA 3WFCL 5I1KL 1LO0L 1JZ6A 3I6KB 1JNHA 1DN0A 1MCPH 1TVHB 1NEUA 3U2SB 3BWUC 3O4LE 5I1CL 2ADFL 3GBNH 5D5MF 1KJ2B 3H9SE 5E8PA 5H35A 3GI8L 1P5VA 1U8OA 2BP3A 1QLEL 4TSCH 1N59B 3HG1B 3OXSB 1IM9B 3SDCC 2AP2A 1A47A 4PGCB 3RIFK 2BSTB 1C8PA 1NLDH 2GSGA 1CICA 1ZS8A 3F5WA 4Y4KC 2XZZA 1AXSB 3LQAC 4HEME 2HFGH 4GAJH 5FGBC 3EFDL 4JFFB 1L7IL 3BZFA 3MUGA 4U1KB 5C07A 4J12A 5AUMA 3PL6D 1LK2B 3TP4A 1FO0B 4PUBH 4IRZL 3C87A 4NYLB 5TDPB 2DICA 2RCSL 2YC1B 1K5NA 5DZLA 2FZ3B 2VXSL 4P9HC 3QI9B 3IDIA 4G9DA 2ZJSL 3QO0A 5ALCH 5CAYB 5E08L 4JLRA 4IRSB 2DN7A 4JFHD 2EDJA 3RY6A 2X6MA 3ULUD 3IFLL 4OTXL 2P5ED 2COQA 2M26A 4HHAA 4DCQB 4WI2A 5DFVC 3O6FD 1NBVL 1VEPA 3BVNB 3OGCA 2VWEC 4M8VA 4NWTH 1RUKH 3ARDA 4KJWC 4XBPB 3KYOB 3STLB 1IGIH 2WZPD 1NCTA 2F15A 3D2UB 5D5ME 2G2RB 2WUBL 4PTUB 1SYSA 4C56E 4HFUH 4KAQL 2UWEE 5C6TH 2VAAB 3QHZH 1BLNA 3PWPA 1M1SA 3FO9A 1KV3A 1T3FA 3L3IA 1X5FA 4H0GA 1I9IL 3A6CH 5CBAB 4MCZB 2VE6B 5EO9A 3OXSA 1AD0A 4NP4L 5SX4I 4FQCH 4PLJD 4YHIA 2F53A 3MFGB 1N7ML 5HYQB 5I1AA 3L5JA 2H2SC 5D6CB 2JIXA 4JKLA 5F44A 2OL3L 4MVBD 3MCG1 2Q8AL 1MFEL 5E8EA 1QSVA 2EDXA 5DHYB 4G9FE 1FYTE 4RBPK 4Y2OA 1V3KA 4AEIH 4NQDA 4YE4H 4K3GA 5DD0H 1CT8B 5K9QI 5HY9B 4ZFZA 4G9FA 1D5IL 4MHHG 4WCYL 3FQUB 4QLRA 2E3VA 1YEKL 1YMHA 3RGVC 5HXMA 3WIHL 4FQ1H 4K23L 1SVZA 2RAMA 2L4OA 4W4OA 1AE6H 3RRQA 2ORBH 4MAUL 4NFBA 1GOGA 1DVFD 4QRRD 1AD0B 2GEEA 2E6PA 4KI1A 5KOVC 4FFVC 4XH2A 3HLAB 5L2KD 4Q58C 3BVNA 1RZJC 4NQTA 4F9PC 3V6OC 5C08A 4XPBH 4CU7A 4ZXBD 2MQCA 3NIFF 3AROA 1KLGB 4WFED 3T0DA 3MNZA 3MRIA 4DVRL 5B22A 1A7RL 3ARUA 4HT1L 5DHYA 1PD6A 1F90H 4OGXH 2R8SL 3IVKA 4J3OC 1XR8B 3IGAB 3WIHH 4ELKA 4Q0XL 4FTVD 4XX1E 1IZKA 3FCTA 4MWFA 1FFNB 3V52H 3C5ZC 1F5WA 5EC1B 4U3XA 5BRZA 4E0RB 2ZPKL 1D9KC 1XIWA 2XV6B 2AV7B 1ZTXL 4KJQD 5I6XC 3C6SA 3C5JA 3P30H 5TE6L 3UDWC 4ZFGH 4BH7B 3UPCA 3QYCA 1FHGA 3LOWA 5A40E 5MEOA 2YPLA 3SDDA 4L8CB 1SM3H 3EJJX 3MX0A 3Q5YA 4Z7VA 5A2KH 5J89A 3MXWL 3FHQA 2QTEA 4N9GB 1G9EA 3O9WB 4FFYL 2FD6H 1EK3A 5DJ2B 4P23C 1MIEL 1L0YA 5CBAA 5E2JA 1KCSL 4X6DF 1BIIA 4G43A 5D7IA 4JY6A 4W81A 1YEDB 3SGEI 2DF3A 3VXUE 4DN3L 1C1EH 4NQCA 3WXVH 3SBWC 3RZCB 1MHCB 5KVDH 3GSUA 3CX2A 5AZ2L 3C60C 3IJSB 4QRRB 4I0PB 2Z35A 4HCRA 1WAAE 3ECBB 4Y5VA 4Y4HB 4PJHA 3BUYA 2ZZUT 2HP4A 3ARBA 4JFFD 5C0IA 4NFDA 5T1LB 4BA8A 4WRLA 2R0KL 1BBJB 2CUHA 3O0RH 4GUPB 4HJJH 3GO1H 4K3HA 3MUY1 4P5TC 4JFXA 4I3RH 3WIIH 1QRND 3MXVL 5ALBH 3BX7C 5KVGH 3BP5A 3WXWH 3V0VB 5L9DL 2JTDA 4X4ME 4Y19B 4Y88A 3HTLX 3GMPB 2B39A 3TJEH 3QIWD 2BSTA 3NCJL 2D0FA 3DX6A 5KSBB 3OR6A 2V9TA 5E8NA 1RK1B 2YPVH 1INQB 1L4IA 4MJ5A 4WFHD 3ZTNL 1NCAL 4LASH 5D71L 5JW4N 1TJHH 1N6VA 3TBVA 3V4VH 4PJ8D 1QYGH 1UC6A 4LNRB 2R0KH 4IMLB 4Y19D 4PGDA 5L88H 2W92A 5CIPA 5HYFA 4NZTH 1JCKA 5GGTH 4GXUM 3QUML 1RVFL 3KPMB 5IOPA 4FQLH 2AJVH 3E3QE 3MJGX 3DVIA 4YXHL 4YHYC 3VW3H 4LNVA 3DLQR 7CGTA 5F1IA 5JW4R 3HPLB 3KLSA 3X3GH 1CGXA 2XXMB 2XWTA 3DETD 2VQ1B 1NEZB 1Y18A 4Y4FC 1E27B 4KMLB 4OF3A 4NQDD 4HPYL 5EBLA 5I30L 3CVHA 2OTUB 3ZE1F 5D1ZA 2YD8A 4BQBA 2O61B 5F7UA 1B6DA 3KLDA 3BOVA 5E2WL 4AIOA 1DN2A 4UILL 1Q1JL 4KK9D 4G3YH 4M5YH 3ULVL 3CDGA 5E94B 4K55A 3WS3A 4FZ8H 1D9KD 2JF1A 2FJHA 5EZLA 2GUOB 5HI5C 5I1GH 3BDXA 4OQTL 4NKOA 5ANME 4MJ4A 1IE5A 3T0WA 3WYRA 2OSLA 1YEEL 3SDDC 2HT2C 3KJ6L 2OP4L 4BZYA 5D6DC 1XGPA 4GRLC 4G42B 5GIRB 1JWMA 3PWPD 2HJKB 2XZQH 5CP7B 2X4QB 3LDBB 4HS6B 4XX1G 2DTMH 2MCPL 5JLZB 2V7NA 3HI5L 1JNHB 3CSPA 3GSXA 3VXPB 3GSRA 2BNQD 1ZVHA 5DHVB 4PJIA 2BSSB 5DQJA 4EOWL 3VCLB 5I1EL 4OCLC 4H20H 2CDEA 3QNXA 5ILTL 1RJLB 5GRVK 2NXZD 1X4YA 1P9MA 1CXKA 2VDMH 2PF6A 2QQQA 3SE3A 3AREA 4W6XB 4GRWB 2BCKB 3LPWA 4JGUA 4TTDC 1OP5H 4I5BB 5TE7L 4L8DA 5E70A 1QSEE 3TFKC 1ZA3A 1VADA 2AJ3B 2ZG2A 3JV4A 1ZLVK 4Y5YC 1FO0H 2CSPA 4MNGB 4LPWA 1A5FH 1X7QA 2JKXA 3CGTA 1QFUL 1FVEB 1JK8B 1ACYH 4HWBH 3ZT7A 5A3IC 5AWNH 1DBJL 1I7ZA 3KPTA 1OAYH 3QDJA 1MIMH 1J0JA 1Y0LB 1GVIA 5F1IB 4JRXB 4YX2H 3DUSA 1JZ7A 1JBJA 1SBBA 1MHEB 1DVFA 5EOCL 5FIEA 4G8GE 2A6KA 1JUFB 2LTQB 3NZ8B 1BP3B 5IJKA 1EX0A 2OP4H 1CE1L 4PV9B 3DROA 3TNNA 1ED3A 5GSVB 5JIIA 5JPMA 4RDQF 2DQJH 5CEXA 3P2TA 4NKIH 4NNXB 4KRPD 3OV6A 2EE9A 2R1YB 2H6PB 3FT2B 1T21A 5CEYA 2BVPB 5GGVL 2PW2A 5SX5K 4ZPTB 1FRGH 2HTLC 1YMME 4U0RB 5JIKA 3AGVA 2DDQH 3NFSL 4J4PC 1O0VA 3QEQE 5IMKB 4U1SA 1NBZA 4BELD 2DBLL 5BS0E 2GSGB 3B8SA 1CVRA 3K1DA 4XNUL 1XGYL 1T20B 2ZCKL 5KS9E 1QFPA 2OYPA 3RWJB 1CF8L 3NABH 4G8GA 2CIIA 3MRQA 4NO2B 1VACB 4JPKL 1WAAF 3DX9B 5D1XB 5K9JL 1MCSA 1FN4A 3EGSB 4YPGA 3OGCB 5E5RB 4NYLA 5EU5A 1GAFL 2D7TL 4OUOA 4EUPB 5DJZA 4EBQH 4DGVL 4I0PA 1WLHA 2IANE 4Y1AB 3FRPA 3O2DA 1KCUL 1SVCP 5E95B 3HNTH 3TV3H 3SDCD 3DOSA 1MQKL 4KKBD 1AGBB 5EBMA 5D1XD 4LEOA 3RWGB 4GFTB 3SDDD 1W72A 2NY0C 4G6JL 1HWGB 2D2OA 4MX7B 3S98A 2B1AH 1T89A 4LLVA 3TYGH 1EEZA 1I1RA 4JZJC 1A2YB 4D3CH 3C6LC 1I3RA 1KB5A 3K1KC 4BH8B 4MCZA 1MUJB 4ELMF 4JFDD 4LK4A 4M7JL 1LP9E 4OKVA 3TZVD 1GOFA 3DV6B 4JRYB 1XR9B 4XP1H 3IAPA 3QHTC 1UVQB 1CWVA 3QPXH 1Z5LA 1DJSA 2JJSC 1AR1D 3LAFA 2R4RH 2VLKE 2OTUA 1RURL 4IOFD 1T2XA 2Q6WB 3KPQB 4AT6B 2N56A 2Z8VC 3O2VH 1Y6MR 3MLZH 2HMIC 4Y19A 3QQ3B 1A6ZA 2DBLH 3NBNA 2ZCLH 3HZMB 3DROB 3BKYH 4OF5A 2ZKHH 3D69A 4JHBA 1CVSC 4HMDA 3MLXH 4PJ5E 1NFDE 2D7QA 5IESH 1UQSA 3MRDB 3OKNB 1U95A 2YD3A 2Z31C 5IHLB 1EH9A 5KN5B 4NJ9H 1MJJA 4PJFB 1VFMA 4PB0L 2C7UA 3DPBA 2FL5A 1CK0H 3AM8A 1QLEH 2BMKB 3Q0HA 3QI9C 1T7YA 1V05A 5I71C 2DJ4A 4HPOL 5DK3A 5JUEL 3HR6A 3MUZ1 3TLRA 4M7KH 4D9RE 3RTQA 3P73A 3VFUA 4JE4B 3ZKND 1T1YB 3ARWA 1JHTB 1E6JL 5C8JA 1R5VA 1QVOA 5D7IB 1LILA 2D9QB 1LP9F 5MEQB 2NZ9D 2NY2D 3REWB 5SWQB 5FA4B 4KZEH 3VE0A 1PG7H 1FL3A 1VPOL 4XP6H 5F89B 2GCYA 5HPMB 4ERSL 4XTRC 3SGDI 4PG9B 5BV7C 1CXHA 1FZKA 4HG4J 3MNWA 4P4RB 3AY4A 3DSNA 4ODWB 4POZC 4AG4L 1IGTB 3J8F7 4Z76A 3BIBX 1IGFH 1UZ8B 4U6TA 3DGCR 1UCBH 2DQEL 4N8CH 2FRGP 3GMRB 3MLRH 5JR1L 3TA3C 3INUL 3BP7B 3ZDZF 1DBJH 3U9PL 5GIRA 3CMOL 4JM2F 1NLDL 1P4BL 1NDMB 2F5BL 2IQAB 3KXFD 2XNAA 3N1GC 1IAIH 4JFPA 5D1ZD 3WE6A 1OWRM 4YDIH 3HC0A 2CKBL 3D25A 3IS1X 3ARGB 4N9GA 3BI9X 5CCKL 2XFXA 4UMGA 4KHXL 2DQDH 4W6YB 5EZOH 3KYOA 3QCTL 4RAHA 2PO6A 2L7UA 3SO3B 2UVEA 3MNVA 2VDNH 2VDRH 4CMMA 1UCBL 1MREL 4NQDB 4ZPTA 1AO7E 1A7RH 3VGAC 4Y4KA 5I76A 1DBKL 1T66C 2DQGL 1BMGA 2WBJD 4LCYA 5HBBA 3D69B 2XA3A 1G7QA 3Q3GB 4DUVA 4Z5RA 4PJGF 4JQIL 4XCEA 5I6XB 2YN3A 3FOMA 4U2ZA 2BFVH 3T4YB 3U82B 3BUTA 5L2KB 4UT6H 2N1KA 1F58H 2KPNA 4M6NH 4XXDA 3I3BA 4R4FH 3C5ZB 4XVSL 3LKPB 3CLFL 1OP3H 4EN3D 1FBIL 2F8XC 4PYHA 3HFMH 1RZGB 1RZ8B 2R4SH 3KS0H 2W0FA 1H5BB 1BQLH 1DQLL 1QACA 5T3XE 1MH5A 4MHHI 1I1YB 4LARH 4P4KC 3PWJA 5T5FH 4ETQB 2YS4A 4FFYH 4AIZA 3VD9A 3V95A 3PE9A 5D96B 2VSCA 1MLCB 2JK5A 2N4IA 5I74C 1EIBA 1OQOA 2GJZB 2EZ0C 4WDIA 4LHJB 2VZ1A 1S7SA 2B4CL 4ISVA 4UINH 4JRWA 5E6IB 2CRYA 4HS8L 3V6FA 4CADA 5CZKA 4IRSD 3IYLW 1E28B 1TVHA 4G6ML 5IT2H 3X14A 5DVOA 1NC2D 5GS3A 1Q0XH 1LE9B 2B1HL 4E41B 2GT9B 5CGYC 4KQ3L 4ZMAT 4FQXB 1TQBC 4S1DC 5B39G 1F13A 5E6ID 3MV7D 2YWYA 5IBLC 2NW2B 1OGAE 3VD5A 3ROLB 4OBRA 3TN0B 4YHNA 3IDGA 2H2PD 5E9DB 2EEAA 3VI4E 4JG1L 5FK9A 4I5BA 2F54D 1IEAB 3RJQB 4HCRH 1MAKA 1OOAA 5IUSA 2EDLA 3F5WB 1E4WL 1KIQB 5CZVL 3HG1D 5C1MB 1T0MA 3EJZD 3VXSE 4G8IB 3VD7A 4WFGE 1U8LA 1CLOH 5KSBA 4NJAL 1MNUL 2W9EL 3DO7A 2UZYB 1SY6L 5CD3A 4MAYB 2DBJA 4HV8B 4KFZC 5SX4H 1S7QA 1LO5B 3L95B 3OJMB 4GS7B 4UV7L 4PRAA 4ZSOA 4HIIB 3LS4L 2E7LA 5GS2H 3UTOA 5F9JA 3MGTA 4MVBC 3A0OA 4JKPH 1UKSA 5TF1H 3QIUA 5D8JL 5E99H 5TGBA 1UB5B 4AL8L 4JO1H 1HXYB 1BWWA 2Z35B 3SE9H 2X1OA 4APQD 1NGZB 4HUKB 1RUPL 5ANMB 4PJ9B 1ULVA 2QQNH 2APFA 5DVMA 4LVHC 5A43C 1U3ZA 3R8QA 1A6AB 2B1HH 4IDJL 3EYFA 4OJFL 1AQKH 1DL7L 5DDHB 5HHPA 1JWUA 5IF0A 2VAAA 1DUYB 1ORQB 5C08B 5E1AB 3SDXE 4LLDA 3ARDC 3LPFA 3NTCL 1A14H 1EO8L 1KEGH 4KAQH 1BD2A 4IOSD 3F7YB 3MSPA 1ZHKA 2VXQL 3QDGA 4NO0D 3MOAL 2QKIB 1R5WB 4OZGF 5FV2A 2QADD 2NTFB 1FFNA 5D2LE 4JHAH 3RWCA 2C1PA 3ZYOA 4EZMA 3KPLA 2IH1B 5FHBH 5CILH 3NA9L 4OZIB 3RVWD 3MNZB 5L88L 4KY1L 4U1JA 1AXTL 3E6HA 5GGRB 5GGQL 2K7PA 2VR9A 3WS6A 2OXGA 3MNVB 4ODXA 2VQUA 3LN9A 2NZIA 2Q8AH 4PRBB 3WN5B 1E4JA 4L9DA 4UB0L 1VB9A 2E7LC 4LQ1A 1RI8A 3WNLA 1MHPH 2UYLB 4MS8C 1TQBB 4BQCA 4PJAB 1KIQA 3T4AA 3K46A 3DGGB 3SDCA 3S9DB 4ONFL 4JB9L 5GZNC 2DLFL 1XR9A 4UBDC 3WLBB 1JGLH 1HH6A 4UQ3A 3RIFF 3TVMD 1BECA 2C1OB 4WU7A 4DVBB 1D6EA 3TH4T 3HAEH 4R4FL 3O4LA 1IGMH 4YUEL 1EUUA 2O5ZH 3WFHB 5M7QA 3UXFA 1OAYL 5HHQB 4J3UA 3W11D 2ARWA 3NZHL 4KVNL 1CD9B 1X5LA 2BY2A 1A1MA 4ZOCA 5FDYA 3MZTA 4N8VB 3C5JB 4PJCE 5BO1H 3MMEA 2VDKL 4XVUD 5DJZB 5T1DH 3CLEL 1U92A 3BE1H 2YD9A 2IC2A 5GS1C 2RJMA 4JKKA 4GBXC 4U05A 3LQMA 4F33A 5E4IA 5FM8A 3PGFL 5C09A 1NEZG 4X8XA 2FBOJ 1OTUD 5EU3A 5TDPA 1Q9LB 4NCDA 1EFXA 3DI3B 5DJXB 1FVCA 4U6VH 1UM4H 1MWAA 3NFSH 1YN7B 5DXWA 1WBXB 4OI9A 1FSKC 1YDPA 3ET9F 4ODTL 2W1NA 3SKJL 1PFCA 3QUXC 1MJ8L 5M94B 3KYNB 1B2WL 4HLJA 4YXKL 5C09E 5E00B 1VERA 2OJEB 2DQTL 5HGBB 1DBBH 3U36A 3ES6A 3ROOA 4FP8H 3CFJB 1DLHA 2ADGA 4XCNA 4PJCA 4TPRH 1S9VA 4UT7L 1QTYT 3STLA 5L2JB 1U36A 2NY4C 3TESA 1C5CH 3IDXH 4OKDA 1U8PB 2P43B 1LQSR 5JQ6H 5LXGL 5CS7A 2P5WA 5KSAD 1KENH 3W9DA 3TGXA 1U3HD 4BFIB 4Z76B 5KVMC 4LSVH 1BJ8A 1T3FB 4NGHH 2K7QA 4OGAC 3BKML 5GSRB 3GMMB 3X3FH 4PJFE 1D5ZA 4X83A 1ONQB 2GUOA 1FP5A 4JKMA 1L9MA 2FL5B 1OGTA 4NNPL 2A0LD 1UJ3A 1FC2D 1K8IA 2PTVA 1OPGL 1MCPL 5EULV 2EH8H 5DA0B 3VGEA 1PVHA 1P4LB 4E9LA 1OB1A 3RX8A 3VGFA 5J1SC 2HKFH 3K8LA 3RTQB 3OB0H 1X5JA 3QUXB 4NO0A 5IB3B 3VDBA 3L9RB 5FM4A 1PKOA 4LSSH 4MD5B 4L4TB 2ATPB 4P46B 4HZLB 4PJGE 3KR3L 3IFOA 5B8CA 1FYTB 4HFWB 4O58H 4PJ9D 1MY5A 3QO0B 1A1NA 1TDQA 3V2AR 3TO2B 3ZKMC 3U30B 2A2QT 2NY5L 3H3KA 4JRYE 4YXHH 3VW3L 1B90A 3TVMC 3Q2CA 5HI4C 3CFCH 3GMNB 3U36B 2MCG1 3M17A 5I18H 3QI9D 4YFLI 4G9FD 3RNQB 3TV3L 2HKFL 3UTQA 1TJIL 3QWRD 3QDGE 4DWHA 3MV9E 4MAYD 3ULUC 2GTZA 2DWEB 4WFFE 3L6FA 3GJFH 4MJIA 3VWKA 4PTUA 4L5FH 4TTDD 5EB9A 3Q48A 3RGVB 3WS3B 3B2VL 4NC2B 1NCWL 4HD9A 1MCLA 4ZPVA 1KYOJ 3TFKD 4XVUC 4XNUH 3C9NB 3IDUA 5CD5C 1CD1B 1KEMH 4EDXB 1AXSA 1HHJA 3G6AB 4XB8A 2YKLL 2BXZA 3K2MC 3O2WL 1OTUC 4LSQH 1VFBB 3PABB 5I8CA 5JW4M 2GJJA 4I9WD 1B0RB 1FVDB 4GKZB 3S96A 3VRJA 5KBNC 4PRHD 3SDAA 5JTWA 4G6AC 3D5OF 1P4IH 1CE6B 4M93C 3OG4B 5CGMA 2IH3B 1BM3L 3QUXA 2OZ4L 3FAXA 4YO0A 4ETYA 3RQ3A 1OTTC 2HN7B 3LKPA 2ICEB 3JTSB 1K9TA 5EOQL 5DO2C 4XHJD 1NLBH 2GJZA 3V4UL 5EU7C 1U8KA 4JDZA 5E56A 3LH2H 2HA1A 4XBEH 2VITA 2FNBA 4NC1C 4U6HA 5CEYB 3VXNB 2DI8A 4LMQE 3ZKQD 4JGJA 5CSZA 4MXQC 2OBGA 3RKDD 1TENA 4JQXC 2VERN 1TETL 1XF3B 4Z7OF 2NXZB 1GJIA 5IR1A 1MI5E 3B5GA 1GZPA 2J88H 5FHAH 3ZYJA 2CUIA 1C5DA 2DLHA 3B9KC 3ARZA 2W9DL 1A7QH 4HX1B 2R9HD 4LCWB 3BKYL 1F4WL 2XZAH 2OJZL 3LEXB 4L8SA 4LHQB 1INDL 3QUZA 1FNEA 5IB5A 3C6LA 5C0RL 2YWZA 1T2JA 1X5HA 1MEXH 3Q3GA 4G8FB 5TJWK 3F8UB 4U6YA 2A83A 2I9TA 4JREC 1NCNA 5FA3A 3RDTB 5HSFA 5DYOB 5L0QB 5EZIL 2VJXA 3FTGA 4TULH 1DUZA 5JO5B 5F71A 2WBJB 3BEVA 4WWKC 3WBDA 5BV7L 2CRIA 3QIUD 3S8WA 4TUJA 1FV1A 4P2QA 1I7RB 1N6UA 5DRNA 5E2WH 5IF0B 3B43A 4WW1A 5ITFA 2W0LA 4M7KL 2HG5A 3J7HA 2D7OA 3OHXB 4BZ1H 2PTTB 2X4OB 4U1MB 1OAKH 2HRLA 3O3BB 5I1GL 4MNQA 3IDMA 1IQDB 1K4DB 2XWTB 4ZD3H 2A9ML 1FGVL 5ITBL 1BFOA 5F1NB 5IG7B 3QG6B 2HWZH 4K94H 2BSRA 5EZIH 3ARFD 2EDDA 5CP3A 5IVXA 4W68A 1IRAY 3TCLA 1I3GH 4YDKH 4ZTPH 1ADQA 4FQXC 5SWZA 1GAFH 2G2RA 1T5WA 4NUJA 1AP2B 3WKNA 4QY8B 5GXBB 3JTTA 5ADPL 4QXGH 4MSWB 5TH2A 4URTB 3QUKB 3BH9A 3JXAA 4JY4B 4LCIH 3IXTA 1WWWX 1NGPH 4NHCL 2W9DH 4X4XB 2B5IC 5BXFA 3ZO0A 3H7LA 4N8PA 1F4WH 2KL6A 1C5DB 3B5HA 2R0ZL 2HFEB 1CLZH 3D18A 2X4QA 4XI5C 1R5VB 4Z78A 1JHLH 3BMWA 3AB0B 3QCTH 4ZG1A 4RWYH 1K8IB 1CTNA 3VXRA 3VXMD 1HWHB 1NUFA 3FFCE 4WNQA 4LU5L 3GK8H 3NCJH 3P4MA 3HE7D 1UJ3C 1RJLA 3KPQA 4HUXA 1BD2B 1T0MB 3LB6D 1EGJA 3V5DB 1RURH 2YRZA 5I71B 1YEKH 4JM2D 4PRBA 3WLWC 3G08B 4ZAKB 3PQYB 5HY9A 4QXUL 1UB6A 3CCHB 5GS0H 3REVB 3WNPA 4APQC 3L95A 3WKML 2AXFA 4ZS6D 2QL1A 4MXQD 1OSZB 5IFAH 3CU7A 3ZYIA 2V7HB 4OD1H 5JZ7C 1VFBA 4RMRA 2VOTA 4O2EA 4L4TA 3OKDB 4ZXBC 1R6VA 5JDJA 1HXMA 2A73B 5DD1L 3FONA 4OFYA 1C08B 4Y4FD 3PGCB 3VFUB 1EEUA 2J8UB 3BT2L 3EYFB 4CRPA 3G08A 4ZAKA 4C56B 3IDNA 4XC3L 4I8DA 1QBLL 2KBGA 3IDGB 3VWKC 4XCCH 4JDVA 4K94C 3GKZA 3IT8D 3PWLB 1FG2A 3H3PH 4QRRE 5IVXF 4CN6A 3QG6A 1GZQB 1LNUB 4ZAKC 5KTEL 1QSFD 5DT1L 1OLLA 2QHRL 3QUYC 1A21A 4OAWA 3BPNC 4TTGA 4WWKD 1P6FA 3HAEB 4NWTL 2KDGA 3CVHH 4L8CA 4O5LH 2Y5EA 1IKNA 1DQMH 1NGWA 2X9YA 3HNTL 2DTML 3GSQA 1MPAL 4UOW1 4NKDB 4GRWH 5FFLA 3WNOA 5IIEA 2VLKB 3KPSA 3SGJA 4GKOA 4PR5B 4QRTA 2WK2A 4NZRH 4JFZL 5L0QC 2YPKB 5EUKB 4GW5B 4TNVF 4YNYB 4M03A 3MRPA 4F7PB 4PJEF 1OTSD 4LF3B 4J23A 4R2GC 1AFVH 4P9MH 3JV4B 5TDOB 4ISVB 3NIFE 4LVOB 2W0FB 4LVHB 3DMMA 3QPXL 1YEGH 1FL6B 1I8LC 4P46C 5C3LD 3DURB 4GG6E 1EHLH 4R7DA 1PZ5A 5MEND 1A3QA 2IQ9H 1IGML 4L9LC 3WD5L 3FO0H 5CGTA 3L3JB 2A6JB 2D0GA 1P84J 1UWGH 1YNLL 3QUMA 3EO1A 2J6EH 3GMMA 4HKXA 1JGVL 1RUQL 4WO4B 1CN4A 3DYMA 4NOFA 3QFDB 5EOCJ 4AZ8A 3UAJD 1OARH 4HWNA 2VDLL 4TRPL 5GRYA 2FGWH 4QRQB 4LKCA 3CDFA 4Q74A 2CR6A 1NMBH 1P53A 4YBQC 4Z7UB 3Q6GH 5C0CA 3GSNB 4LLQA 3NIGF 3QEQA 4OCSH 1HILB 5FDWA 3OL2A 5EIVA 4U1IB 3PQYE 4APQA 3DVNA 5T1MB 3LEYL 4M5ZH 4JFED 5FXCH 1FPTH 4JFZH 5D93B 1EERB 3L3IB 2QR0A 4I2XA 2W38A 4KROB 1ZLUH 1WFTA 2R39A 2DDQL 1BGXH 2RFXB 5CUSH 4KI5E 4Y0GA 2XY2A 1NGPL 5FUCC 3S3SA 3QNZB 1HCFX 3JUZA 3NA9H 1IC4L 1AFVL 4P9ML 5TFSH 1VFAB 1XF4B 4X98B 4Q9CA 3F6LA 1TNMA 4G7YL 5GPRA 3FQTB 1U58B 4J3XA 4C57C 3CU1A 1A1NB 4JFDA 4K9EL 5IIEB 3GUTA 2AJUH 4U1GC 3B5TA 2KZ1B 4D94A 1MHEA 4DUXA 4FXLA 3BHBA 4ZTOH 3NA4A 4H25B 3EO9L 4YR6B 2AABH 2F74A 1YYLH 2NY3C 1LD9A 5KS9F 2XN9D 4MD0A 4PP1D 5D7LD 4IDLA 3M17B 4DZ8A 1KFAL 4LLMB 1Q9OB 3WHXB 3W9EB 3TJHD 2ESVD 3GB7A 3OZ9L 4I4WA 1K6QL 1MJ7H 1LK2A 4LEXL 5C9JB 3GM8A 2Z92B 4D9LL 4PGDB 4PJ9C 2DKMA 5DTFA 1ETZA 3S36L 1DUYA 1ORQA 5IW3A 3FQRA 4AQOA 1W8OA 1CTOA 1KG0A 2A9NH 1VEOA 4JO2H 4LVEA 3VI3E 4ZTOL 1H3PH 5H2BB 5HHOD 1MNUH 1DDHB 2H8PB 4OFKA 3EYOA 3EHBD 1R3HA 2B1AL 5J7CC 5HHNA 4F37F 5E4EC 1NEZA 3SKMB 5SWSE 3T0BA 1M7DB 3VFMB 5DRWB 4JO4H 4M7JH 1AQDB 4NQCD 3P0VH 4XMPH 4K7FB 1E4KA 5CWSA 4WI7A 3I85A 2GIYA 5DEGB 4LLMA 1IC7L 3PP3H 5DD5L 3FT3B 1BD2D 2R4RL 2I60L 4M02A 1JHKH 3QULA 5FGSA 3TBTB 1NCAH 1QFHA 1OSPH 1J10A 3DYPA 1YUHB 4MDJA 4C59B 5LBSL 1U93B 4BYHA 2P5EB 3SN6N 1U3JA 2PKDA 4OLUH 1IT9L 3RX5A 2ADJA 1QKZL 4OZ4A 3VWKB 5I8OL 1JF5A 4EQ3A 3VH8B 3P0VL 3UZEA 5ICYA 1YPZF 3G5VA 4QRUB 3V0VA 2X42A 3GIVA 2VH5L 4MD0B 5GHWH 1F4HA 4JANA 4CVWA 2BNRB 2FYYB 1RZ8A 5GGVH 1K8DA 4TVPH 3MMEB 4XNQA 3TN0D 3RWEB 3U4EB 4L3CB 4TSAL 2YN5A 4JDTH 4HPYH 3P3YA 5LXGH 4NZDA 4X6CF 5D7JB 5C9JA 2APXA 3DBXA 1H8OA 3TZVB 1EEYA 4ZOBA 2EKSA 1MIEH 4HZLA 3BIKB 2EO1A 5DC9B 3NAAL 5IV2B 5I8KH 3MLYL 4IIQA 1CXEA 5IW6B 4ZUVB 3BWAB 1KPVA 4ZFFA 4LGRB 4LHUB 1M6OA 4EVNB 2GHWB 2A6KB 4NM8H 3RA7L 3RVUD 4PJFF 1RZFL 4O00A 4PG2C 3QJHB 3VXME 5GISH 1OP5K 2FHBA 1U2CA 5EUOA 3WO4C 3O81A 4KHTH 4R8WL 5E8NB 2GAZB 3WFCH 5I1KH 2X5PA 2ZG1A 3LSOB 1IAIL 5H94A 3VFRB 3GJEA 5F9OL 3WFDL 2ZOLB 2EDNA 3H9YA 2R29L 3AM8C 4HC1A 4CJ0A 5GS0C 2HJLB 2YEZA 1WZ1H 1TZGH 1XCTA 4I0KA 5KSUB 4MD4A 5I1LA 2VDML 1ZLWH 2EYSB 3G04A 2QR0B 1T4KB 1LO0H 2AV7A 4ODHH 2AKRA 3G9VA 5IGXH 2QBWA 1A3LL 4DZBA 4JN2A 5DRZB 3D39D 5EU4B 4QRPD 3CFEB 3CLEH 3CPLB 3BYTA 5CUSL 2XPGA 1NKRA 5HYJD 1MF2L 3GMLB 2XG4A 2VDRL 5E7FA 3V0WL 5T33H 4M48L 2R1WA 4OZFG 4YHKL 4DQOL 4XNZB 3NPSC 1B3JA 1WBXA 1KCKA 4ONHA 4WO4A 1IEHA 3E6FA 3FO1A 2HRPL 3BO8A 3RWHB 4RFEA 3QAZC 4NRXA 1MCNA 3PDOA 4ENED 4OZFA 4EIZC 1JN6B 3S37X 2OR8A 1NFIB 3P77A 4LGPB 1LO2H 5E1AA 2O5YL 3LKSA 5D7SL 1YNTA 2P47B 2KH2B 2WUBH 4PJDA 1BM3H 5JHDE 2PO6D 2VDQH 4UB0H 2BRQA 1ZAGA 4DKDC 4OIBA 1OM3H 2QV2A 4OQTH 4WHCA 5EC2B 5C08E 5TE4H 1LEIA 1T0NB 1S9WB 3IB4A 1FORL 1MFBH 3U46A 1PQZB 5E5MB 3ARBD 5C0CE 2MKWA 4DCQA 3CK0L 3DX6B 3BPCA 4X5LA 2CLVB 3VE0B 2VQTA 5ICXB 4HJGA 3MRNA 5C09D 3DTXB 3VFOA 4YDLB 3VGBA 5KVEL 1JGDB 4HKBB 3L7FB 1T03L 2ZOKA 1G6RH 4P5KA 3GBML 5HDQL 4G8EA 3PP3K 3STZB 1D5XB 1S5HA 1HEZB 4QNPF 3ARBB 1WC7B 1OM3L 2JB5H 1M05B 3C8KA 2O93L 4NOBA 1TPXC 1T5XB 1INEL 2FLRT 4EI5D 4K9EC 4TNVK 4LSSL 4K7PY 3HC4H 3ZDXE 4KUCD 2NW3B 3E8UL 3KR3H 3EYUL 3FQNA 4G8GD 3HMXH 2DWDB 5F1OB 3UJJL 4PRPD 2OL3H 4XP5L 4POYA 2HH0H 2HFTA 1MFEH 3MROA 1DQTA 3VFPB 1IZJA 4L4VD 3VG9C 3O6LL 2BRRH 4G80B 4YZFF 4F9PA 4RQQB 3RFZC 1QHPA 3RTQD 4Q6IB 5GRJL 4OLXH 5F1KC 4GBXA 1I1AC 1A4KB 1OAZL 3C5SA 2O5YH 1R3HB 3EYQD 1DEDA 1CG9A 3WUWG 1XIWD 1A02N 3DXAE 4MSWA 3U2SA 4P5TA 3KPSE 5I16B 1QYGL 3UYRL 4TSBL 5BS0D 4BSWB 1JYXA 1A4JB 4LRIC 1HQ4A 5C0DA 3IXAB 4YFEA 2GK2A 1BBDL 5F7HA 1F8TL 2WLZA 2EIBA 5C0FA 3MLYH 2JCCB 4WI4A 5T3ZD 5J06A 3W39B 1QA9A 3MQIA 2OZ4A 4QF1A 4HIXL 5HVWA 2JELL 4WV1B 4RIRA 1MCHA 4QYOB 4PJDF 5JW3L 4LHUD 3S5LB 1YUHA 1T03H 5IMOA 4G80A 3MA9H 1CICD 1ZT1B 4WNQB 4AEFA 4NJ9L 3GBMH 5HDQH 3VFSB 4QRRA 4BK5A 1AGDA 3MLTB 2GSIB 1NMCC 2PYED 3WJJC 2Q7YA 3WV0A 3QIWA 2VLRE 3MXWH 2FATL 4UDUB 1FV1B 1OAQH 2BY0A 2X4RB 5F93C 4RNRB 1RUML 1EHAA 5ISZB 2R29H 5BRZB 1FNLA 4QHLB 3NH7H 3KLAB 1A6TB 3I75B 4NN5B 3IS0X 5GRXG 5DHVH 1LE5A 4FHBD 1DLHB 2ADGB 2HFFA 3VMPA 4CU8A 5IT2L 3QIUC 3CNKA 5AUMB 3ZYZA 1J1PH 4DZBB 2FBJL 4RAUB 1HHKB 3ISWA 2VDOL 4AQ1B 4Z7VB 3LKNB 4OQTA 3AMKA 4P2QB 2H2SD 3WL9A 1XGUB 3QPQC 4LCUA 3BP6B 4N0YH 4N90D 4QRSA 3T3ME 1JGEB 2YEZB 4IS6B 1S8DA 5AEAA 3RWDA 4M1GH 4RMWA 5TH2B 3SE3C 3TYGL 2QHRH 1HYSD 5IB5B 4QXTA 5HJ3A 4NQSA 4PV9A 1LHZA 3QXAA 1UWEH 1J8HA 4HWZB 5D7LB 4HAFA 3WSQL 1HHHB 2PXYD 5I2IB 3VH8G 5SWSB 4F7EB 3EJZC 5DUMH 3PDOB 4P4KA 5T1DL 3MGOB 5DD1H 3MJ8B 4L9LB 1OAXH 2JIXB 4WEBL 2EEDA 3AU1A 5F8RC 4WV1C 3O6KH 4ODSH 3MA7A 2J12B 4WO4D 2UZIH 2VIRA 1UFUA 4ONGL 4YGVA 4GAGL 1S8DB 5GJTH 4KKBC 1ND0B 1CS6A 4P57B 2R2EA 2FX9H 5D1XC 4DTGL 3SCMB 4OGXL 5IB1B 4JM4H 1FDLL 4PS4H 4KXZI 3MBEC 3BPCB 4N90E 5T5NF 1UWXK 1FYTD 5K9KA 4WUUD 1FORH 2QQNL 2XFXB 3KJ4B 1XF5B 1NANI 3LD8B 5DMGC 5TDOA 4RSVA 1MCEA 1DE4A 2D7NA 2ZPKH 5L2KA 5K93A 1EO7A 1A9EA 4PREB 5BJTA 2YK1L 2EDRA 4JFEB 4NKIL 4QY8A 4ZXBA 3U4AA 1UM6H 3CSBA 3VCLA 1QD0A 2DMKA 2H45A 4FQQA 4N9OB 5C0BD 1G7HB 4RGNE 2AK4E 1JVKA 4OLZH 1UA6L 5T1KA 3OX8B 2YA0A 1GZPB 4M00A 2XTJE 4JM4L 1HHJB 3W5NA 4X6DA 1NMAL 4G42A 3DETC 4GRLA 1MAML 3V6BR 3A67H 3BESR 3QR2A 4H8WH 4QXWA 4PP2B 1P7QA 3LH2L 3DV4A 4I18C 4RGMC 1KUMA 3S4SB 3IF1B 3BZDA 4HAGA 1TQCB 3IU3B 4HF5H 4OAWB 5HVHB 4K3DL 1KN4L 1H5BA 4CBPA 3ARSA 1GC1L 3QO1B 3U7YH 1ZLVH 3LMJL 3KJ4C 5DDHA 5HHPB 3NMEA 1QFWH 4N8CL 2HMID 4GG6F 3LKOA 4X6CE 3AREB 1CGWA 4EDWL 3TH3T 3DX8A 4D9RD 4HMCA 2VABB 5ADOH 1S7WB 4QXUH 1PW3A 3OKLA 4IHOA 1KCRL 2X4UB 5JOFA 4NKMA 1JV5B 3PWNB 3OKNA 5D2LB 2R0LH 1GSMA 1TZIB 2LFGA 3RNQA 2GY7B 1NFDF 4Q2ZA 5F1SA 4ESKA 4U7MA 5J56B 2HT4D 1P2CB 1T7XA 4L3EA 5LCVH 1OSPL 4JLRB 1BF2A 3TBVB 4JFHE 3UBXA 2GK0B 2YPVL 3BHBB 1BIIB 4G43B 4LSRH 5CEZL 3O0RL 4HJJL 3ZTNH 3O3DA 3O6FA 2FJGB 1QKZH 1EJ6A 4WW2C 4MAYC 1N2RA 1KCRH 5ESVA 5EUOB 1TTUA 2IPUG 4FNLL 3I84A 3L3DB 4XC3H 1FIEA 3W2DL 2BVTA 2HLAB 4PRHB 3FRPG 3GNMH 2R69L 4GBXD 1TJIH 4UOW0 2F19L 2VLJE 3GMNA 4K2UH 5FYLE 1SJEB 5L8JB 4AY0A 3UTSB 2EIDA 3A6OA 4A6YH 4HKJA 4ODTH 1B0RA 5JXEC 3VFWA 1DP0A 3TO2A 3MRBB 1CFBA 5HYSA 1RVFH 4ORZC 1YPZB 3IFNL 1KFAH 5KAQF 1WF5A 3L3HA 4N0YL 3REWA 3ALXA 1Q1JH 4M5YL 3GNML 1KXQE 2YA1A 4P2OB 2FO1A 2X4NA 3CJJA 1F3DJ 2FB4H 4P23B 3CFKA 4JEGB 1CICB 1ZS8B 5LQBL 1EFXD 3MLVL 2HT2D 1DTUA 3GI9L 3KNBA 1T83C 4X8JA 3FB6B 5TDNA 5I2IA 2MNUA 2F5AH 4K3EH 1NAML 2P4AB 2OX5A 4OLUL 4UU9A 4XP9H 1HILA 2J3SA 3DHJA 4S1RH 5C0JA 5EDXA 4X4YA 5F3HA 5DMIL 1KJ2A 3E2HB 3T1FB 4PGJA 1NSNL 5DUPL 1P1ZB 3OJDB 4EQ2A 4O2CA 1NCCL 1L7TH 3FO0L 2OL3B 3OXRA 5T3XH 4CVXA 1IVLA 4XWGL 2HFEA 5EZJB 4Z95H 1FFOA 3KYNA 4EI6A 1QO3A 3TO4B 4JFEE 5K33A 5CKGA 1JGVH 3TWCH 4KVCH 5BVPH 2A0LC 3MGAA 2I5YL 1ZWIB 2R2CA 3FRUB 4OLVL 3D3VB 3ZKSD 4CUCA 3HI6L 3GMQA 4QHKJ 5FO8B 1NMBL 3HE6A 2DQCH 3U7AA 4JFOA 3DX7A 4O9HL 3WEXB 1MLBB 3Q6FB 3MJ8A 3QQ4B 4Z77B 2BOCA 3PL6B 1EZVX 1JI1A 5C9KA 2J4WL 2VDNL 4S10A 2WLYA 1BVZA 3PWPB 4AH2B 1UKQA 3O11B 1U8IB 5JORB 5DGQA 3TT1H 1J8HB 1OAUL 2FH6A 1I3RB 1KB5B 5HD8C 5KVFH 1IQWH 2D7MA 2EDOA 4PTTB 4X6EA 3I02A 5IEKB 4GW5A 4YNYA 1MJUL 4LSUL 3BPOC 5BRZD 2DIBA 4XPTL 4QYOA 4L9LA 1ED3B 5L2KE 4X0KA 3VG0L 4JVWA 3U48A 4LPCA 1RZKL 4IDJH 5IWLA 2Z4QB 1FBIH 3V6ZB 5GGRA 5FUCE 1FL6A 2PYFB 4PJXA 4JO3H 1J0HA 2FEDC 1QSED 5TQ0L 2HTLD 3JV6B 1N0XL 4FXGB 4B7IA 4N0FA 4OCWH 2ZG3A 4UTBH 5HHMB 4PGEB 5D7JD 3PUCA 2NY6C 4MA8L 4EI6B 2FJFA 4KH2A 1CK0L 3GFUA 1VPOH 3SCMC 3T0ED 3HMWH 5KVEH 3QH3B 4JG0H 4M48H 1Q94B 2DM7A 4XCYB 4NT6B 2VZ3A 5DQ9B 5F6HJ 1J8HE 5TF0A 3MLTA 1T21B 4L4TE 3OKOA 2B0SL 4HC1L 3GHBL 3QEQB 4C58B 1AO7A 3G6DH 5SV4A 4D0CA 5E7BA 1EZVY 3DHMA 2NNAB 2AVGA 4X6CB 3BP4A 1I1FA 1G9MH 1QSFE 2QQLL 3BSZL 3OKEA 3QIWC 2AEPL 2CDGA 1EVTC 1A7OL 2MFNA 3IDYB 3MRFB 2ED7A 3TPUA 1R3IH 3JVGA 1I1AD 2UZXB 1BZ9A 1B88A 1WTLA 2HJKA 5CP7A 4LAQH 2WIIB 3TZVC 1I1CA 2ZUUA 3QULB 4U4BA 1E4XL 3QDAA 2JJTC 4FZEH 4NQED 3ME0A 4O2EB 1N26A 3G6JF 5J13C 1DQDH 4GKSB 2NY1B 4Z8FH 1EHXA 4LMQI 4N0UE 5IOPB 4LCUB 2YD7A 2GJ6A 5IQ7H 4PY8J 4BFEA 4PBWD 3D39A 4TSBH 3MR9A 4O58L 1N0XH 4OFYD 3JV6A 2HVJB 4ELME 2XOTA 5I16A 5ACZA 5IHUH 2AQ1A 5E03A 4PJIF 4CN4A 1CFVH 1NFDB 3MREA 2AK1H 4BH8A 2BZDA 1A0QH 2H1PH 1HXYA 1ZXQA 4FZEL 1Z2KA 1DSFH 1QA9B 1FNFA 2FR4A 4X80H 4ORGB 4ODXB 5H37H 5J6GA 1WWAX 5CZXC 3NCBB 2X7LB 1BD2E 1YY9D 4L5FL 4LL9A 4ZOAA 4JFDE 1KN2L 2QADB 2E9WA 4KXZH 4O5LL 3MOBH 1RMFH 1IAKA 1MJ8H 4HH9B 3U0TB 4IRSA 2LU3A 2HH0L 4EEEA 1N0LA 2W60A 5D1QB 4E5XB 3DXAA 4HPOH 5JUEH 1R3IL 5EO0B 2WINA 1CR9H 4PJ5A 4NQEA 3UMTA 4HIHA 3UPRA 3PHQB 1ZHLA 3R1GL 2VLJD 4RQQA 2I9LB 4E41A 1BAFH 4MQSB 4PBVC 3OKOB 3C08L 1HYRC 3S97C 4L8BA 1J1XH 5JA9A 1S3KH 3IFPA 4YK4B 3MOBL 1CT8A 1A6WL 1I75A 1A6VH 1MFDH 1J9CT 5DJYA 5IB1A 1KT2B 3HC4L 5ESQA 2NY6D 4JN1H 2NY0B 3CX5J 2CRMA 2JLLA 4G8FA 5C70A 2HVKA 1MHHB 3O8XD 4MNQB 5CJXA 3L3OA 3SQOL 2MMXA 1QG3A 1NJ9A 1NGQH 3LS5H 5EOTA 1Q0XL 2WIIA 4YHIB 1KIRB 3QUYA 5IVNA 1G6RB 1UXWB 5CEZD 2VZTA 1BFVL 4FN0A 1W72L 3C2AH 3C6SB 3VFOB 2DLFH 1G7HA 5FKAA 4KRPC 4FA8A 1N3NA 1OARL 3M1BB 5IQ9A 4IEFB 2IAMC 3MV11 4DGYL 15C8H 1UWGL 1OGAA 3HCVA 5FO8A 4OV5A 4F15B 1JPSL 2F54B 3ULUL 3SBWA 3BKCL 1HEZA 4ZO6A 5C0AA 2A38A 3RIAK 1A7QL 2EDTA 3GM0A 3P9LA 4H26B 3LPGA 2JJVA 2F5BH 4CW1B 3O41A 3R06B 4R3SA 4R90H 4TYUA 2VH5H 2WANA 4HX1A 1FPTL 2H9GA 3RVXD 3PQYD 2VRAA 4OZFB 5C71A 4DKAA 4TVPL 4Y5YB 4MAUH 4EJ1C 4EN3C 3ARGA 5IFJA 1F58L 5DHXB 1NGXB 2W9LA 3UX9B 5LVEA 2FSEA 2P24A 1SBSL 3ECBA 5HI3D 4YAQB 2DQGH 2HLFC 5D7SH 4Q9QH 4DOHB 1QZ1A 2OTWA 2X41A 3UDWA 4H88L 4N0CD 4M6AA 4LCWA 4F3FA 3GDBA 2YPLD 3QHFH 4HT1H 1RIUH 4P99A 3DXAB 5ETUA 4GRMA 3FN0H 3FT4A 5D70L 4F8QA 2NY0D 2DQFB 3ORJA 4X0KB 4MNGE 4KI5C 1OVZA 3ZKMD 1MWAL 3EOYG 3S6CA 4HWZA 5D7LA 2Y36L 4XZUB 4QTHA 4X7SH 5ERWA 3MRKB 1BWMA 3X12A 5IB4A 1SYSB 1CFTB 4LFHG 5BCAA 1KIPB 1I8KB 1AR1C 4S2SA 5I1JH 4HW6A 4MQTB 1LEGA 2YC1A 1QR4A 5E6YA 1X5XA 15C8L 4HKJB 5DQDH 2Y5TB 2NPLX 5CBEB 1E6JH 3LCYA 3QCUH 1MAJA 5F7YC 5C6TL 1UM5H 1AI1L 3MBXL 4KJWD 3T4AB 3VJ6B 5IBLD 5F9DC 3V6OE 1YJDC 1H8SA 4FQIH 4OF7A 3M07A 2HT4C 3DIFA 2NCMA 3KLAA 1FYHB 4JPKH 3OKDA 2O26U 3BGAA 2NYYD 1NUGA 2HFFB 2Z93B 3C60D 3HZKB 5GS2D 3LVEA 3ARFA 3RUGF 2DWEA 5EUOE 1RD6A 3V5HB 3BN3B 3H2WA 1E4WH 3AUVA 4FOMA 4YHPA 4KWUA 4IMLA 1S7TA 4PRDB 3ZMRA 4NN5C 4W70A 2NY7H 2YOCA 2X09A 1DBMH 4X80L 3WIFB 3UJIH 4GAGH 3FFCA 3P4NA 3U6RA 3ZDYE 4G6AD 4KTYA 1Q0YH 1M7IB 4OZ4B 4OM0H 2ZSWB 1A7BA 3TBWA 4M7LL 4XMPL 3WO4B 3RWFB 5J1TC 4QF1B 4LPTA 1MJJB 4PJFA 5DJCA 5D2NE 5KVGL 1A3RH 1HINL 2YA2A 3JTSA 4PJAE 3BEWB 1JHKL 5DO2D 3NCFB 4LCWD 2AEQH 1K8DB 4XP1L 4YE4L 1TVBA 3IKKA 5DJ8B 5GGSB 3P0YL 3BGMB 1D5BB 3VWJC 3O4OB 4EDWH 3RVVC 3ZT6A 1CDGA 5LWYL 3EOTL 1NCDL 4JO1L 1YDPB 5DQDL 1DVFC 1MIML 2VTFA 3ROLA 2CXKA 4IJ3C 2NY2C 1UM4L 1M7DA 1GCFA 1FE8H 3SKUD 5EU6E 4V2CB 4HIEB 4N5ED 3WNNA 4H8WC 3DMMC 5I1IH 3HRZA 1FL5B 4FQHB 3DSFH 2CDFB 3FQNB 3NIDE 5JA8B 2HFGL 4GAJL 4JY6B 1WEJL 2GITB 3G5XA 4MNQE 4JDTL 3PNWA 3E0GA 1IAMA 3B6SB 4I0CC 4J2XA 3W9DB 4PJBF 1UJ3B 2WM0A 3AFLA 2XKNB 3V4PL 5DJAA 3RVWC 3HPJB 2CMRL 2ITDB 3H7BA 2IFFL 4HUVB 1I1YA 1XT5A 2NNAA 2QSTA 1DBML 2P7TA 1ZVSB 5EBMB 2X70B 1A7NL 5ADOL 1KYOK 1Z3GH 1HHIA 4KI5D 5I1HH 4KJYB 3S88H 4OM0L 5F8QC 2ZCKH 1BBJA 1DZBA 3S35L 4GMTH 2F19H 3EOBA 4X6DB 2DQHL 1ZEAH 4R26H 1JPTL 2D9CA 2I5YH 2K9UA 1KCLA 1BHGA 4PJHB 2EC9U 3MRHB 6CGTA 3P9MA 4JFEA 4ZXBB 2XN9B 3DV4B 1S7UB 1SYVA 1CBVL 4PV8A 4HDIA 3N85L 5H2BA 4D0BA 4MNHB 2QQKL 4Z5RB 2XN9E 2BJMH 3S88L 2NTSP 4H20L 4P2RE 4PJHE 3RNKB 3QA3A 4ODHL 2E9JA 4NZUL 5JR1H 3TO4C 2BHUA 2AK4D 2YXMA 3TIEA 1RUQH 1CDHA 3F7PC 1QHOA 1CDYA 2H41A 3BO8B 5FCUL 2NQCA 4I3SH 3WHE1 5EH1A 4OCYH 2UUDH 5IVXE 4NNXA 5T1KD 1VHPA 2IALA 3H42H 3I2CL 1X7QB 4OB5L 5D7IE 4F33B 4YDVB 1EJOH 2BY3A 1QRKA 1SEBA 5DLMH 5T33L 2ZUTA 3UTZA 1JPFB 1K4CB 2BVQA 3BW9B 4MQ7A 5CBEA 3MRMA 2IF7A 3VI4F 4NZUH 5DS8B 3GSNL 4CVZA 1YJDL 4KVNH 1G7MA 3WJLC 1YMMA 4HUWA 4J3TA 2F58H 4P2OC 4P2QE 4TOYL 3ULUF 3RWJA 5FYJH 1IGYB 3NN8B 2F53B 4NN7C 5HJ3B 4PJ5B 3C09B 3KHQA 3HI6H 5GGUA 1RULL 3SJVD 1F2XK 5GGSY 2NX5A 3B8YA 3MFFA 1B4JL 5HVFB 1X9QA 3EUUA 3QUMH 2V7NB 1GGCL 4ZS7L 5MENE 4U6XA 5ELIA 2ZNWA 3N85H 4Z7WE 4MJ6B 1EFXB 4N5EC 4QHMA 1IEBA 1KJ2L 3RJDA 4U1NB 5C0GA 1SQ2N 1DEEA 5DVLA 4Y5XA 1MI5A 3RY4A 4TN9A 4M1GL 4NDMB 3GSVA 4JHAL 1V7NL 4PGZA 1A6UL 2JB5L 1RK0A 1U3HA 4FP8L 1U41A 2NY1D 5EO0A 4HHAB 3QJHA 4LCCB 4OZHA 4KY1H 4NCC1 1H3XA 4NT6A 2MCPH 4ZAKD 3UYPA 3IDJB 2JJTA 4FXKA 2IG2H 2J5LC 2X4TA 4C83B 3FN3A 1P69B 2AGJH 4NQDE 5BOPA 4IS6A 4GRLD 4UIMA 5KSAB 1EXUB 1S5IH 4UTBL 1N5YH 1N6QH 1YEIH 4TVPD 3DRTB 2FGZA 1OAZH 3B9VA 1DANU 1LK3H 4YK4C 1D5MA 1VKXA 2RR3A 3QQNA 4BUGA 3SDYL 5JDSA 3P11H 1KTDB 1S7XA 3P9WB 3I6GB 4GXUN 3C6LD 3EYOB 5IROC 2DWDA 3DXAD 3QBTB 5IVOA 4FNLH 2DI7A 4FMKA 5HGHB 4PJ9A 2NXZC 3V8CA 1WISA 4J4PA 1MOEA 3W2DH 4XBGB 4XVJL 4OLXL 1MCDA 1YA5A 3BEWA 3BDYH 3UTZB 2CLRB 5IG7A 2WUCH 1P7KA 5EORH 3T0EB 3O6ML 3FB5A 1M05A 3C8KB 1RIVL 1INDH 4GBXB 3VXTB 4UOJA 1C5BH 3MV8E 1M7IA 1OP9A 5DD3L 2P8MB 4C56A 3ETBF 2EEBA 4OZGB 4BSVB 3BN9C 4OLZL 1PBYA 1MVUB 4WJ5A 4WUUA 1H3VA 4F57L 1UH4A 3PDGA 3QEHB 5FK9B 1GGBL 2DQFA 2VL4A 4ODVH 1IM3B 5JQHC 1OY3B 4R4ND 4PJBE 3PWVA 5E9DE 5TFSL 4F58H 2ZKHL 4Q6YA 4ELMB 4NKMB 1DQDL 1NH6A 2F8VA 2G60H 1QPXA 1BREA 2IG2L 1RU9H 1DQLH 4U7SA 1JPTH 3C2SA 1IEBB 1KG0B 3G6DL 3U7YL 4LPYA 1NC4B 3GHEH 1T4KA 3T3PE 5E4EB 5JHDB 4IMKC 5IHUL 4ZQKA 5E6IA 5EZJA 1G7IA 2NW2A 4LVNC 2H9GB 1LDPH 1VFOA 1UADC 3U46B 2XTLA 3TIDB 1HHIB 1L7TL 5T3XL 3HE6D 1PEWA 4L29B 3BZ4B 4RFEB 4WI8A 3LY6A 3MREB 2IAMD 4O4YH 4EI5A 5BQ7B 3HN3A 2MSPA 3C8DA 4C56D 3FB8A 5DJAB 4GRWE 3GSNA 4MA1B 4BFBD 4X4MA 2HT3C 2V5TA 1OD7A 3S36H 3BRGC 4LQFH 2XWJB 4JO2L 2B4CC 2X44D 1P4IL 4IIQC 4FABH 3PL6A 1WGOA 2IPKB 1NBYA 5E9DD 5IW1A 3EYUH 2EYTA 4ZUVA 2Q8BH 4K71B 4PGEA 3T0EC 4AG4H 1GPOL 5D6DA 2ZUYA 1WIUA 4F7TB 1T20A 3PWJB 4L1HA 1CDCA 1T6WA 3TCXA 4G6JH 4JR9L 5BV7B 3KPRA 1FH5L 2OJEA 5HGBA 3QEQD 3FZUD 3QUZB 1WAAA 1IGJB 4HBCL 2YSSA 3QIBB 5SWZE 1S7RA 3MO1B 5K9KB 2OJZH 3UTTB 4WIQA 4WFEE 1LO4L 5JOEA 4DTGH 3RAJL 3K8KA 1A6VL 4K07A 3RWIA 1MEXL 1CZ8H 1RU9L 3VWJB 1ZSDA 1P9MC 4GLRH 2DIAA 5C2BH 2W0KA 2RB8A 5KSAC 2FCBA 4MA7L 4NSKA 4XNXH 1I8IA 3ZHDA 5JPNB 5IBUG 3UYOD 2ICCA 1CFNB 5EFIB 1ROWA 3IETA 1RJCA 3MRCB 4HUWB 3CFCL 4Z7VE 2C4FU 4XGZA 2EDEA 5CHNB 3LIZH 5E2TH 4Z7VF 1W72H 3GGWA 1SEBB 1MI5D 4LPUA 4PJEB 5C0BE 3RAJH 2I25N 2BHYA 1RUPH 1I85A 2EE6A 5JNYB 2I9TB 4FQCL 5IFHH 4Z7WF 4UTAH 4FQ2H 3L1OL 2ICWI 3FFDA 2ZOLA 4MA7H 1BOYA 1YMMB 4PRPA 1LEKB 2X1QA 4NHUB 4P4KD 3S37L 2VLMD 1C12A 2VLRB 2XA8L 4G9FB 4EUPG 1HQRB 2ATPA 4P46A 3BRFA 3KGRA 3T65B 1UZ8A 4J8RB 4D2NA 4OTXH 5DZNA 3VU2A 1RZFH 1NC4D 4R3SB 2VR5A 1ODAA 2D31B 4UDTB 2R1XA 4FQHA 2D03L 4Y19E 1G9NL 2VQ1A 4NN7B 3I02B 5GZOC 4LBEA 2Z91A 1D9KA 4TPRL 4ZSOE 1KN4H 4HIHB 4BKLB 4LAQL 1BEYL 1TNNA 2AV1A 1A9BB 4J6RH 2AI0H 3U4EA 1G6VK 3JWOL 3LKQA 2VLKA 3KPSB 3QRGH 3U0PA 3OXRB 5INDA 3D87B 4RX4D 1FJ1B 1R3JA 4HIIA 3QWRA 3ZTJG 3BKMH 2CK2A 2ADIA 4P0DA 5IJVA 5MI0B 4KJYA 3V7AE 3QRFM 2GQHA 3NVQA 3UZQA 3P0GB 1CGSH 4POZD 3TT3L 2XKNA 5HTSA 3D85A 1I3UA 3WJLA 3UTTE 5L2JA 1GGBH 1U9KA 3HPJA 5TPWH 4HCRL 1T04B 1ZT4A 4KRLB 5I1EH 4AEEA 2SEBB 5IHBA 3QXWA 3JWOH 4XNYH 4CAGA 5FHAL 3X11A 3NOIA 1IGTA 4QOKA 3U9PH 1WIPA 1NDGA 1H15B 5JDSB 5HYEA 3ARTA 1JL8A 5DK2A 1V3JA 3GEWB 4BSJA 1U8OB 1KN2H 4AENB 3U9UA 5B21A 4JM2A 2ZUXA 1VACA 1KIUA 5F9JB 1DBAH 4BQ9A 4KKAD 5HPOA 3RL2A 1U6AH 4WHYH 4OUUB 1MSPA 4X7SL 3JBG7 1A5FL 2FYYA 5HHME 3CFKB 3FQWA 1V8HA 4DUWA 4P3CL 3SKOB 3IU4H 4K7PH 4K8RC 5GJSL 1GH7A 3CH1A 4GXVH 2XACC 5GS0D 5HVHC 2AI0L 5CEZE 1Y6KR 3QDMD 4YX2L 4NRZA 5HYSG 4NQSB 3U0WL 3O2VL 3SE4A 2P24B 4QNPE 3U6RB 4Y5XB 1WWBX 2IGFL 4HGWA 3WFHA 2ZSWA 4KMTH 2VISB 4PJGA 5I66B 3WHXA 4LRNL 3CXHJ 2AJVL 2C3VA 4FQLL 5DR5L 5MEOB 2C3WA 2YRPA 1B0GA 3P30L 1JTOA 5TE6H 5CLWA 5ICZB 3WS6C 2KZWA 3SY0A 3CDYA 4LGSB 1KLFA 5C7XH 4JCLA 3UTPE 4FQXA 3AS0A 1JTTA 2PR4L 3JWNC 2XT1B 2BVPA 3DVFA 4AT6A 2ZCHH 4P2RA 3O3AA 5E2VH 3TBSA 5C09B 3L9RA 4MQXC 2XN9A 2ADIB 1AXTH 1OF2B 2P49B 1DFBH 3B3IA 3ULVH 5FYLH 3X3FL 2M8XA 5C0GB 4ODUB 1J5OL 5IMKA 2OS7A 1Q9WB 1KGCE 1KJVB 4PJAF 5DEZA 1MRCL 4YZFE 5J6HA 1YNKL 5GZOD 1WUNT 4M6MH 3QUZC 5ENWA 4I0PC 1LGVA 2LVEA 3QAZB 2VNCA 3T2NH 1C1EL 1IC5L 3BD4A 4WI6A 5GGTA 5L8KB 3D0VA 1JV5A 2DYPD 2FECL 5J1AA 4FTVA 3K7UA 5CINL 1I8KA 1G7LB 5IMOB 3ARFC 5F97E 3KXFB 1WJ3A 4F7CB 4RGNB 1AGFA 1R5IA 1KJMA 3CSYA 4E42B 2BNUB 4QHNA 5E5UB 5BZWB 4JFQB 3EDEA 3CDGB 2VZSA 2VUYA 3MGOA 3ZE2E 3QA3B 1YJDH 3EFFA 4WU5B 2YSSB 1OW0C 3QIBA 1GIGL 5GJTL 5I1IL 5B38B 3HS0B 2JJSA 4IOIA 4LF3A 4DN4H 1S7VA 5AG8A 3MLWH 4XPAL 1L0QA 1UG9A 2XQYK 1R3KA 3VFTB 3ULUE