3O2WH

Crystal structure of the 1e9 phel89ser/leuh47trp/meth100bphe fab in complex with a 39a11 transition state analog
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
214
Chain Sequence
QVQLVQSGPELKKPGETVKISCKASGYMFTNYGMNWVKQAPGKALKWMGWINPYTGESTFADDFKGRFAFFLETSATTAYLQINNLKNEDTATYFCARGTTIVRAFDYWGQGTSVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Chimeric antibody Fab 1E9, light chain
publication title Crystal structure of the 1E9 PheL89Ser/LeuH47Trp/MetH100bPhe Fab in complex with a 39A11 transition state analog
rcsb
source organism Mus musculus, homo sapiens
total genus 38
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2010-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o2wH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o2wH02
1F6AA 3OKLB 3EJZC 5F7FA 1JHKL 4GO6B 4S2SA 3EFDH 5DUBA 3OXSB 4JFYB 3ARXA 1DZBA 4QXWA 1AD0A 3VMPA 4Q7DA 4LQFL 4OT1L 1RK1A 2PNDA 1RUKL 2X4TB 4JY6B 4G3YL 4LLYA 3QI9D 4JVWA 2G60L 2AJSH 5IW1B 4TUOA 3V6OE 1FCCA 4GMTH 3F58L 5KN5B 1XF3A 3AREA 3UBXB 4DVBA 1RHHA 3QUMH 3T3PF 2Q6WA 1NCDL 3ULUL 3GIZH 4OFYA 3EYUL 2WWMC 5GGRB 3EO0B 1UJTA 4XCNB 5IQ9B 4IRJB 2KDGA 4Y0GA 3BZFB 5IBTL 5TH2B 1JZ8A 5GGQL 4FQXC 3WUWA 3B2VL 2EEBA 3U7YH 5D1ZB 5E8EB 2KH2B 3WLWD 3CH8A 2VLJA 4R0LC 1JGVH 3S3PA 2JJTC 5KTEL 2QSCL 3QNXB 1A3LL 12E8L 4HS3B 2YD9A 3SKUD 4ALAH 2Y07H 1SY6H 2AXFB 3S96B 4GOSA 2VLKB 2ARJB 5J1AB 4M1GH 1VACB 4NQSA 2DBLL 1I7TB 2BRRH 1KF9B 3MRCB 4JFFA 5GRVK 5K93A 3RGVB 4PY8J 3DMMA 1DVFD 5KSBB 1YJDC 4X7SH 2DWEA 5EC1A 5IHZB 4RCAA 1INQB 5CZXC 3I85A 1BFTA 3MA9L 4WJ5A 5BVJA 4LVNC 2R0WH 1S9XB 3OKOB 5JO5B 2BRQA 1AI1L 5E2UL 1EDQA 1IFHH 2OJZL 3U30C 5J6HB 4MHHG 1Q38A 4XXCA 5JW5A 2Y23A 3S3JA 4MAYA 5ANME 1UM4L 2HN7A 1F90H 1V7MH 2OZ4L 1K5NB 5E08L 1YEJL 2XT1B 3SGEH 3OXRB 2D03H 4WHYG 5D1XD 4M7ZB 1VCAA 4PY7B 4RNRB 4ODWB 2PXYC 3B9EA 4N0UE 5CD3A 4QHKI 4XMPL 2W0FA 4O2CB 3DROB 3TJHC 3UJJH 1R3IL 3RIFF 4LOUD 4RDQG 4W4OA 1KJMB 4YBLC 2MMXA 4KQ3L 2GEEA 2HAZA 2OYPA 4WWKA 2YD3A 1S7UB 5EPMA 5C08D 1TLKA 3MYJB 3VMNA 3BH8B 4G9FA 2GJJA 3SHSA 4OZFG 3V0VB 4IEFB 2H2PD 2MHAA 4RGNE 1I7RB 3S6CA 1GH7A 5BS0E 1W0WB 1KELL 1XGTB 5LAXB 4DKAA 5A2JH 4YHLL 2G2RA 3CVIH 5JTWA 4F3FB 5IBLD 2FNBA 3P0YH 4X8XA 3AU1B 3HRZA 2XV6B 3ZDYE 3FCTA 1H3PH 3WO4B 4YXKL 4UTBL 3U0WL 1UEYA 3I50L 5I66B 2MTPA 3ZL4H 4N90D 3OGCA 1PKQA 1YJDH 3ILQD 2GKIA 4YDIH 1INDL 1KB5A 3QFJA 3FONA 3H9SA 2HYMA 2BZDA 1FVCB 2WUBH 3L7EB 3TN0D 1I7ZB 2HT2C 4HKXB 1X5XA 3NMEA 3TH2T 3RVTD 4HUKB 4OZGF 3CVHL 1LO5B 4QYOA 1OP3K 1GGCH 2NZIA 3T1WA 4XCFH 3WIHA 1ACYH 1JPFB 1OGAA 1WBYB 2P8MA 1FN4B 2MWCA 4X9HA 4U1HA 4GG6A 2ARWA 2LVEA 1T1YA 4NO3B 3PDOA 3H42L 1S5HB 4WFFE 1WIUA 1RVFH 4FQHA 2JCCB 5FKAB 4C56B 5FGCE 1A6PA 3WFEL 1H8NA 3F7VA 3MV7A 4KRMB 4LSSL 1HXMA 3EO1A 5ECJE 4F33B 1CDYA 4XGZB 1Z3GH 3QUKA 3BPNC 4QOKE 4G7VL 1SEQH 4IRSD 3F7YA 5IV2B 2ZOKA 4YHYC 2YRZA 4F58L 4JM2C 3ULSB 4AIZB 1JK8B 4YWGL 5ACLA 1IAMA 1KN4L 4GW1A 4WFED 3V79C 5H35A 4PJXF 5MEPB 4NNYB 4ZFOL 1QO3A 4RIRA 4UILH 3A0OA 2JB5H 3V6OA 1FYTD 2D0HA 3QJFB 1JRHI 1J1XH 2W59A 2YHGA 3QI9A 4C4KT 5FIEA 5IB1A 4XP4L 5CJOH 1HI6A 2VLME 3OKDB 3IRPX 3KR3H 3O2DL 2BSSA 3RUGE 4JPWH 1CIUA 4X4ZA 5C0GB 2VDOL 3B4NA 4Z7OE 1U8MA 2NY2B 4BQBA 4WV1B 2Q3ZA 4HPYL 5C0BB 5TDPB 3KGRA 5I17A 1L9MA 4JY5L 4LK4A 2QHRL 3LKOA 4KTEH 3K74B 5EO0B 5LGHH 3UTZB 2AABL 2PO6D 4WO4B 4ISVA 4RISL 3DRQA 2JK5A 4I5BB 2HFEB 4HX1A 2E7LA 1U3JA 4LCWD 3U46A 4FQQA 1DL7H 4WENB 3I02B 3MV9B 3IRZA 4U1SA 3L6FB 2EH7L 4Z5RB 3BP4B 1JYWA 1RZIB 4I8DA 5DRXB 4TULL 4D3CL 1F11B 3PV6A 5JW4Q 2D9CA 2CUHA 1DVFA 1UT9A 2ZSWB 2C5DC 3WDJA 1DTUA 3PUCA 4AMKH 5TQ0L 1T3FB 5DZOA 3LOWA 5DJ0B 5MP6H 4NHCL 2NY6C 1T21A 4S1DC 2F53B 3NCYS 1IGTA 4TPRL 2YMXH 4WI9A 5I1EL 2HJFA 2HVKA 5E94B 4JFDD 3GI8L 4M6NL 4JM4L 4ACPA 5DJZB 5DHVA 3UDWC 3BPOC 3ARDC 3WJLC 4YHOH 3E1F1 1BF2A 3EYSH 3GB7B 3FB6A 4N0UA 2EC9T 4WWID 3WFZA 4PG2C 5CINL 1T66D 4GW4A 5D1XA 5F89A 5L9DL 1NDMB 4LU5L 4NWTL 1BFVL 4JHZA 2CUMA 4YHKL 1E4KA 3OGOE 1W72A 1A6ZB 3MUZ1 4OQTA 4UT9L 3MLSH 3WNOA 3TLRA 2ATPA 3OTTA 4EEEA 4R96A 5EIVA 2I9LB 5M7QA 2AGJH 4O9HH 2IPUK 5C08A 1U95A 3TH3T 4XTRC 4KV5F 4AK1A 4JDVB 4X99B 4F7CA 5AD0A 2AJSL 4HFWA 4QRRE 4F2MA 4XVJH 4GMTL 4PPTA 3MJ7B 4HWNA 3GGWA 1NAMB 2X1XR 1MSPA 5DXWA 1F6AB 3QUML 3T4YA 3UPRA 3GIZL 4S2SB 5DUBB 2AQ3A 1S3KH 3BN9C 1AD0B 3NCMA 4NHUA 1D5ZA 1RK1B 3VFWA 2XIDA 4LLYB 1WFOA 3U7YL 3OV6A 1ZT1A 4TUOB 1MVUA 2CK0H 3QUYD 3V7AE 4JVUA 3PWPE 3TN0A 3ZE1F 1XF3B 3AREB 4QCIA 5E8DH 4DVBB 1JGVL 1RHHB 2Q6WB 4GRLA 1CLOH 1JNHA 2HVJA 1HQRA 3C6SA 5HSFA 4URTB 3QDAA 4ALAL 2Y07L 1SY6L 3QAZB 1CXFA 4J1UA 1HCFX 5FM4A 4M1GL 3RWHA 3CXDH 4TRPH 3D3VD 2BRRL 3WUWB 4CUCA 5GS0D 2KZ1B 2J1KA 1ZHBA 2RIKA 5JDJA 2VLJB 2XICA 4W4NA 3VU2A 2R0WL 1G84A 3JV5A 1XH3A 1N0LA 4OAWA 5EH1A 1YC7A 4NQDE 4IRSA 1EZVX 1IFHL 4J7RA 4X5LA 2HKFH 1WIOA 4YXHH 2BHYA 5JA8B 3QEQD 4NQSB 4JFFB 4OJFH 4XXDA 1F90L 1V7ML 3HAEG 3NPSC 3DMMB 1HOCA 3DX7A 3PHOA 5CEZE 2DWEB 1FYTA 5EC1B 2P46B 1OWWA 2D03L 4MJIE 4XNQA 5HI4D 2XTJB 4EN3D 4OFIA 4WJ5B 3D48R 5BVJB 1I9EA 5T3XD 4V2BA 2COQA 1CD0A 1DEDA 1F3DH 4LBEA 1IBGH 3SJVE 3UJJL 5FK9A 3TO4C 3UCRA 3FQNA 4JREC 1WQVT 5JW5B 4MAYB 1P7HL 4P2CG 2HN7B 3CX5J 4POZC 5IW6A 5FOBA 4WUKL 4KGLA 1EZVY 5IWLC 3EYVA 4KK6C 1MHCA 2Q20A 4XMKH 3VFTA 2PO6A 4NC1E 4MA1B 2K7QA 5CD3B 2W0FB 3HE7D 5CCKH 5JXAH 3MCKA 3CVIL 4LCWA 3P0YL 4RA3A 2HT4D 1A7PH 2GAZA 4WWKB 2WANA 5DYOA 1G6RA 5EPMB 3NIGF 1H3PL 3BI9X 1T83C 4G9FB 1N2RB 2ZKHH 2BP3A 3ZL4L 1MCHA 4M03A 4YDIL 4AQ1B 2MHAB 2YK1H 3QUZD 1S9WA 5FUOH 2WUBL 3TA3A 1RZKL 4Q0XH 1ADQA 3KPMA 3OAUH 2G2RB 2PETA 1DDHA 3HRZB 3QDHA 3ELAT 3NN8A 1MELA 5MHSE 3PF2A 4JFDA 3BP7A 2Z35A 1PKOA 3FCTB 3N1FC 4XCFL 2CD0A 2R1YA 3NIFF 1ACYL 3K80A 4U6HA 1SBSH 3OGCB 4PBVC 1PKQB 4X6DA 3QFJB 1KB5B 3FONB 2LU4A 3H9SB 4OF3A 2Z4QA 2IAMD 4YIQA 1ULVA 5T33H 4F80A 5IMLA 3ME0A 5DVOA 2W65A 5ID1A 1Z3GL 4QYOB 1J86A 4NNXA 2AK4D 8FABA 4GBXA 1AH1A 4WTZA 1MIMH 5FGBC 2P8MB 1OGAB 4GG6B 1J0JA 3KPQA 1H9VA 4U1HB 5LGKA 1T1YB 4UILL 2NY5C 4S11A 3PDOB 2X4UA 4WI7A 1NCCH 2JB5L 1QFHA 4FQHB 5M95B 2ED8A 2D3VA 1J1XL 1FZKA 3F7VB 3MV7B 1HXMB 3EO1B 3D85D 4IMKA 3MROA 5CJOL 5F7EH 1V3JA 3QUKB 2DQDH 2YR3A 1IGYA 3F7YB 2ZOKB 3CFBA 3KR3L 4JPWL 4UOW1 3O3BA 3FFDA 5F1SA 3N06B 4GW1B 5H35B 1K4DA 5E99H 3MJ9H 1QO3B 5ESAA 4RIRB 1I3GH 3H9HA 4ZNEE 3PWPA 4KTEL 5LGHL 1BJMA 1KTDA 4OV6F 2FRGP 2NY1D 2IPKA 1YEIH 3QI9B 5IB1B 5AAWA 2B5IC 1HI6B 35C8H 3BKYH 3ARQA 3QUYA 1K8DA 5I75C 1A1NA 4KI5D 2BSSB 4G6FD 5B21A 3W9DA 3NACL 5C9KA 1FG9C 1DL7L 4UUJA 1WTGT 4Q97A 2WBJD 4K23H 1OM3H 2VL4A 5SX5K 1BVZA 4JN1L 1OCWH 1A21A 2GSIA 5I17B 3LKOB 2EDDA 1HHJA 4H26A 1H3UA 1FAIH 3D3VA 4OGAD 5DC0A 4ISVB 3D6GA 5DUMH 4NQDA 4HXBL 4AMKL 2JK5B 4HX1B 5I2IA 3VDBA 3V7MA 3U46B 5MP6L 4UT7H 4FQQB 3IJSA 3TO2A 4AJ0A 1OAZH 2YMXL 2VLRE 4LLAA 4QXGH 4WI6A 4U1SB 5F88A 1KTKE 4PY8I 2DAVA 4YHOL 3BD4A 4MJIA 1D9KD 3RTQC 3QEQA 3V5DA 3PV6B 1DVFB 1J0ZA 1K3ZA 3EYSL 3ARFC 43C9A 3L3DA 1C5BH 1E28A 4LPUA 4MXVF 1T21B 1FL5A 1OPGH 2R23A 2RB8A 4JPKL 3RX5A 1MFAH 2PW2A 1IGTB 2ID5A 2QKIA 5SWZD 5DMYA 2HJFB 2HVKB 3K4ZA 4PB9H 5DHVB 2VXSH 2BSRA 5DD3L 1H3WM 3RI5K 3GFUA 1QFWM 3MLSL 4UIMA 2LAGB 5ITBH 1BQHA 2GI7A 2LFGA 4N0UB 3FB6B 2AGJL 2XWBA 4FFWD 4O9HL 4JRXD 5DMGD 5EULV 2ZCHL 4GW4B 5D1XB 3W82A 5F89B 1TENA 1BFOA 1D5BA 5GISH 3LVEA 4EXPX 3O4OB 1W72B 4XVJL 2A6KA 1KIPA 4PRHD 2OL3H 3DVGA 4LLDA 5C0CE 1QFUL 4RMWA 3VXMD 3NVQA 3VXSE 4L4TD 2ATPB 4ZOCA 4ZFFB 1S3KL 4PJ9C 4R96B 4G9DA 5CILL 5C08B 3PG2A 2HH0H 1U95B 1ZS8A 3RHWF 4F7CB 1CICD 5AD0B 1FL6A 4HFWB 5HGGS 4A2LA 3JWDH 5FV1L 2CK0L 3QUZA 4IJ3B 4R4NC 1X5LA 1HQ4A 2DN7A 3GI9H 4F2MB 3GGWB 5DO2C 5E8DL 3ULVD 4GKNA 3OAZH 2CDEA 3T4YB 3UPRB 1CLOL 2HLFD 4Z78A 1YNLH 3DO3A 4NHUB 1D5ZB 4NGHH 1L4IA 3CXDL 4P2OC 4LNVA 1L9NA 4TRPL 3VFWB 5CHNA 3VFUA 1K2DA 2H6PA 1ZT1B 1MVUB 2IAND 1H5BA 1REIA 1KACB 3TN0B 1U91A 4XPGH 3P4MA 4XVUD 1PG7W 5KVEH 4QCIB 1VADA 2VQUA 1NFDE 4GRLB 1JNHB 2HVJB 1HQRB 3C6SB 1FNEA 1BVLA 3RVWD 2AK4A 4J4PC 4FXGA 43CAA 1A6UH 2HKFL 2CGRH 4J1UB 4YXHL 4IDLA 2QLVB 3OBAA 3RWHB 1GC1H 1WZ1L 5IMKA 5GS2H 4LP5A 1CD8A 1ZHBB 3BOVA 1QLRA 4L4VE 2VN4A 1IKFH 4K2UL 2ESVD 4MDIA 3RZCC 1G9EA 1B0RA 2A0LC 1XH3B 4OAWB 5TQ2H 3TV3H 1IBGL 1NEZA 4IRSB 4ZNEA 2GJ6D 3RVUC 3MV8E 4XXDB 5F9WB 1HOCB 4Z7VE 3DX7B 3PHOB 4G8EA 1FYTB 5FYLE 3RUGB 4XNQB 4PGBA 1II4E 5J0BA 5JNYA 2OMNA 3LKQA 1TIUA 3DX6A 4Q6IA 4XMKL 4G8GD 4D94A 4J23A 1XIWA 4RGMC 4LBEB 1VFBA 5CCKL 3LDBC 2EXYC 5JXAL 5FK9B 3OJVC 4ELME 1ED3A 3FQNB 3TYGH 3NTCH 3V7AG 3GUTA 4M93B 1A7PL 1NCNA 3HN3A 1RULH 5IW6B 5FOBB 4QLRA 2ADGA 3EYVB 3KPLA 4M7ZC 2ZKHL 1CXKA 4J8RA 3GK8L 1S9KC 2YK1L 4AENA 5JHDD 3VFTB 2PO6B 3EYQD 5FUOL 3U0PA 5DRNA 3JBG7 1RIVH 2C3WA 4Q0XL 5GS1A 3RL1A 3MCKB 2DL9A 2X42A 2E6QA 4LCWB 1EEZA 1WV7T 1JZ3A 1A6WH 2GAZB 1Q9KA 3LRGA 4Y4HD 5DYOB 5HI3D 1G6RB 4HUXA 2XRAH 1YMMD 1IARB 1SBSL 1S9WB 5JIPA 5INDA 4AH2A 5T33L 2B1AH 4FMKA 1ACZA 1OOAA 3TA3B 1FSKB 1AJ7H 3KPMB 4TTDD 1CTNA 3T0BA 2H26A 1DDHB 3E3QC 4X7TA 4DK6A 4P5MA 2Y1VA 5JOPD 5E24E 3FKUS 3NN8B 4G6MH 5SWZA 4HG4K 4JFDB 3BP7B 2WNGA 2Z35B 3FB5B 1MIML 2R1YB 4TTGA 4U6HB 3ZTJH 4X6DB 4PJIF 4PLJD 1NCCL 2Z4QB 4YIQB 1ZGLP 4HGKC 2AEWA 3K0WA 4JRXA 3SO3B 5IMLB 4YLQT 4P46D 2W65B 5ID1B 1G7HA 4RWYH 3E0GA 5F7EL 3T2PA 1ZVSA 2DQDL 5A1AA 1AY1H 4NNXB 2CRYA 8FABB 5DURD 2Y5TA 4GBXB 4L9LC 5EIIB 1LP9A 5EBGA 5FYJH 5LG1A 3VXMA 3KPQB 3MJ9L 4L4TA 1MNUH 3E2HC 1I3GL 4CADA 2X4UB 5IHBA 4L8CA 1IEHA 3CSYA 2DIBA 3ZYZA 1RJZA 1FZKB 1YEIL 1GL4B 1CK0H 3MROB 2QQQA 1I3RA 5GXBB 1IGYB 2ADIA 4XP6H 3CFBB 1HZHL 3O3BB 4PRDA 3FFDB 4FNLH 1G7LA 1K4DB 4K23L 1OM3L 5ESAB 4KDTC 2OCFD 1TQCC 2LE9A 3H9HB 5IHLB 1OCWL 2YD7A 3PWPB 4HMDA 1KTDB 5JXED 1FAIL 2IPKB 2OR8A 5F71A 4HKZA 1NFDA 1EJ6A 2VDMH 1U8HA 4QXUH 2IANA 3QUYB 1K8DB 5DUML 4YGAB 1A1NB 3ALPA 1WAAE 3SDDC 3W9DB 3O81A 4UT7L 1JWSA 4KK5D 4UUJB 1RIHH 3S36H 5I71B 1AGEA 1OAZL 2QJDA 32C2A 1OAUL 4QXGL 2CO7B 2GSIB 1G7JA 3SDAC 2Z8VC 3ULUE 1GVIA 1FZMA 1LWRA 3EAKA 1HHJB 3EHBC 4H26B 4XH2A 3SDCD 1CCZA 3D3VB 3JVGC 4N8VG 3CXHK 2P49B 3D2UA 4NQDB 4XP9H 3BUYA 1C5BL 5I2IB 4P9HC 4NCC2 1AR1D 3PL6A 3SGKC 2A1WH 1OPGL 3IJSB 3TO2B 4C83A 4KK9D 3WN5C 1QFPA 3X14A 4GAYA 4MQXD 4PB9L 4JN2A 5F88B 4N8PA 2GK2A 2VXSL 1CE6A 5EORH 3C09B 3HZVA 4MJIB 2FEEI 3MRRA 5HHQA 3QEQB 4CMHC 4I3SH 3V5DB 5ITBL 2F54E 2MSPA 3TBSA 4JGJA 2PR4H 3VXRE 1S8DA 2EDEA 3L3DB 4YQXH 43C9B 1X6LA 4ELMA 1E28B 2R23B 1FL5B 5HI5C 4G8GA 3QZWG 4KKAD 1NLDH 5GISL 8CGTA 2PW2B 5C0NC 3LKPA 1WFUA 2QKIB 2WP3T 3CSGA 3LMJH 5JW3L 1HYRC 2XWTA 2BSRB 2OL3L 1J1OH 5HHOD 3GMNA 1G1YA 1KCSH 4UIMB 2C1PA 3HTLX 1VENA 1BQHB 1BQUA 1UKSA 4U7MA 2XWBB 2PKDA 2HH0L 3TZVD 1JGLH 5HYSA 4Y8DC 3UYRH 1BFOB 1D5BB 2A6IA 3JWDL 5EBLA 5JHDA 1MI5E 3GI9L 4OLEA 3PIQA 4MLIA 2A6KB 3D39D 3I2CH 1KIPB 4U6TA 3DVGB 4LLDB 1QHOA 1QTYT 2A74A 2APTA 5J89A 1Q9OA 1W0VA 1NANI 2MFNA 1NBYA 1YNLL 4G9DB 3B9KA 1KJ2A 5JZ7C 4NGHL 2VZVA 3GSNA 3G04A 1ZS8B 3RJDA 3OL2A 1E4WH 1FL6B 3WS6C 3GDBA 3Q6GH 3QUZB 1HQ4B 3ARVA 1DQTA 4PGJA 3ZKNC 4HK0A 2J5LC 4XPGL 2QL1A 3QIBA 5KVEL 5HHVH 4PJIA 1D6EA 4GKNB 4KJWD 3DURA 2CDEB 3S98A 1Q1JH 3C5SA 4UV7H 4WFHE 4WDIA 4X6BA 4EJ1C 4Z78B 1I1AA 4LLMA 1A6UL 4I0PD 2CGRL 1GC1L 2GY7B 3U48A 3U36A 5CHNB 4BQ6A 1K2DB 1T80A 3DHJA 2H6PB 4HAGA 1H5BB 3UTPE 1HKLH 1U91B 3P4MB 1IKFL 1JGUH 1LD9A 3C87A 4P46A 5D7IE 1VADB 3G9AB 3L5JA 5TQ2L 3TV3L 2NNAA 2KBGA 1FNEB 1BVLB 2AK4B 3EYFA 4FXGB 43CAB 1BZ9A 3IDXH 2X7LA 1FJ1A 5AZEH 3VXQA 5IMKB 1BQLH 4NO5A 1OB1A 2FWOA 2BHZA 3GRWA 3HG1E 3K8KA 4ORGA 2X2YA 1NKOA 1QLRB 4HEME 5E4IA 4BZ1H 5CD5D 4YAQA 4MDIB 1B0RB 4H20H 2DL2A 4QWWC 4WVRA 5F7DA 5F9JA 1NEZB 4W70A 2IBBA 3RBGA 3TYGL 1KTRL 3NTCL 1I85A 5KSAD 4ZTPH 3IKCA 4WW2C 2OQJA 1UJ3C 3IFPA 3UC0L 4WI2A 3WD5H 5ESVA 4G8EB 4PGBB 5JNYB 1N3NA 1WAAA 4OB5H 5JXEA 2NY1B 3LKQB 4Q6IB 3DX6B 5D7JD 4XB8A 4ONFL 1XIWB 1T89A 4JFXA 1NAMH 3V8OA 2QADD 1RIVL 1VFBB 1ED3B 4X83A 3EGSA 4G6FB 4PGCA 3GUTB 4PYHA 1A9BA 2VDPH 1A6WL 2HTLD 1D5IH 3VRLF 4JHWH 5TE4H 1MCKA 2ADGB 2XRAL 3KYOA 4HBQA 2DTMH 4N0FA 3KPLB 1IC1A 3C60A 1JWUA 5DGQA 2W92A 4J8RB 3SDCA 1ERNA 4W68A 4AENB 2FO1A 1RJYA 1FNGA 4HLZG 1YDPA 2B1AL 4YZFE 3U0PB 1WF5A 5DRNB 2VXTH 4Y2OA 1B0GA 1AJ7L 1VEPA 5GS1B 3RL1B 4OF6A 2H32A 5JIKA 3CH1A 1EEZB 3QG7H 1NGYA 4HUMB 5HGDA 3FRPA 1Q9KB 4G6ML 2F54A 1TPXC 5FYKH 5HDOA 4HUXB 3VXRA 3V4VH 2YPLD 2DLIA 3L1OL 5INDB 1HWHB 3E6FA 2EE2A 4AH2B 3U83A 5HYQA 1OAXH 3HMXA 4XP1H 1U8JA 2H26B 4RWYL 4X7TB 3KYMA 4P5MB 2E9JA 1ND0A 2XA3A 3NCCB 1W2KT 1AY1L 4YXLH 5SWZB 3BAEH 2HT3C 2C3VA 5HHOA 4Y5XC 5FYJL 5CGTA 1ZAGA 2VH5L 5IB5A 1MNUL 3LQMA 1XGYL 3NIDE 4YH6A 5GGTA 3UROR 2YN3A 1JF6A 4JRXB 3BO8A 2E9IA 3TZVA 1DP0A 3ETBF 1G7HB 3BD3A 4F7TA 1ZVSB 1MRCH 2Y6SD 4XP6L 2YOCA 3G9VA 4JKLA 4N1CA 4PJ7E 1WFTA 4OZ4A 3D39A 2VOTA 4OGXH 2Y5TB 2AP2A 1LP9B 3T0WA 4FNLL 3VXMB 1U93B 4W6XB 1N6QH 1H15A 4L4TB 4LLVA 2B0SH 4CADB 4P5KA 4L8CB 3CSYB 3PWVA 1LO0H 1RJZB 4KK8C 2X41A 3OJ2C 2DRUA 4ZTOH 2VDML 4QXUL 1I3RB 4GG8A 2QTEA 3MMEA 2ADIB 2WQRA 5HVFB 1VEOA 4J3OC 3O3UN 1D6VH 4PRDB 2K3TA 3KJ4B 2X4SA 1NSNH 1RIHL 1G7LB 3S36L 4L29A 1MCLA 5FF6A 3QHZH 1MFEH 4MCYA 1EO7A 1JNLH 1NC4D 1MCIA 3WJJC 3QI9C 4NQEE 5IFJA 3MOBH 4HKZB 3V6BR 3OSKA 1HCVA 1NFDB 1U8HB 2IANB 2V17H 4XP9L 3WCYA 3EO9H 2FD6H 1JWSB 2A1WL 1AGEB 2Q7NA 4YC2C 32C2B 4NFDA 1CS6A 3P3YA 5BRZD 3LHPH 3HG1A 1G7JB 4GH7B 5EORL 3QDJD 1KB5H 1FZMB 1ONQA 4XH2B 4KKBD 4I3SL 5KSVA 3WNNA 4C4KO 3DETD 3MLWH 2V2XA 4HHAA 3D2UB 2PR4L 3HR6A 1DUZA 3WLWC 5TDOA 2E7LC 4OI7A 4YQXL 3BUYB 2EKJA 2R8SH 5JORB 3PL6B 1XCQA 1NLDL 2Y9RT 3QCUH 4C83B 4S0SD 3LMJL 3WIHH 3I6KA 3X14B 1OAYH 4GAYB 4RA0C 1UWXH 4JN2B 4UINH 5EUOF 4ZS7H 4MB4A 1CE6B 1J1OL 4MJ4A 3HZVB 4GRWF 1O0VA 4Z6AT 4Z95H 1FYHB 4AM0A 3MRRB 4ZFOA 1KJ3H 5CLWA 3TBSB 2F74A 1WISA 1S8DB 2W1NA 1TVDA 4ELMB 2R2HA 5ALBH 2DB8A 4Q6YA 4MB3A 4B7IA 3UYRL 1KIQA 2M1KA 4G8GB 1A7OH 1ZMYA 1KGCD 1PAMA 2DM2A 3LKPB 3IJHA 3U2SA 1NDGA 2XWTB 3I2CL 5JR1H 1A0QH 4NDMA 1NGXA 2WWMD 3LB6C 3GMNB 3G5YA 3KPSE 1ZLUH 1XFPA 4X98A 2DQTH 4FQIH 5EC2A 2OM5A 2IBZX 4FQXD 3O4LD 2Y7QA 3HPJA 3WFCH 1WWAX 4U2ZA 4RMUA 3EOAA 3M8OH 5HYSB 1E4WL 5EBLB 2A6IB 3Q6GL 5F93C 5JHDB 4IOFD 4K7PH 5GRZA 1IJ9A 2JLLA 2IQAA 5ICZA 3PIQB 1CDCA 4Y1AE 5HHVL 5A2FA 4JFED 4LVHB 3SE4A 1Q1JL 2A74B 4UV7L 5A2LH 1Q9OB 1W0VB 5D5ME 2FIRT 3VXTA 1HEZA 1NBYB 2AK1H 3KG5A 2WW8A 1UEMA 3B9KB 1KJ2B 4LSPH 5I1AA 5DMIH 3GSNB 5LQBH 2YPLA 3G04B 4IJ3C 1VFMA 4NQCD 1MWAH 3AC0A 2Q76A 2IBZY 1HKLL 2XN9D 3MRLA 4HK0B 1Q9WA 5F7MC 2XXMB 1JGUL 4L4JA 3QIBB 3QISA 1UENA 5FB8A 5L0QC 5IBLC 4PJIB 1D6EB 5M94B 1CGVA 2XZAH 4S1SH 3GMRA 3DURB 4FQCH 3C5SB 4Q9RH 3KS0J 1DBKL 4WDIB 4X6BB 4EUPA 2G9HA 4UT6H 1I1AB 2NCMA 5IJKC 3MRFA 5B3JE 1CXEA 4GUPA 1EV2E 4LLMB 3KLDA 5AZEL 2J4WH 4JAMA 3HR5A 1BQLL 2P5ED 2W0KA 3BGAA 3U36B 1INEH 2JJSA 3DWTA 2O26U 4Y5YC 3JV6A 3ARSA 4M6OH 5SWSD 4BZ1L 4JJ5A 4FA8A 4O2FA 1LD9B 4P46B 4PLKD 4H20L 2KZWA 4YBQD 5DQJA 1MUJA 2VZ1A 4J3VA 3B43A 2NNAB 3RVXD 4DEPB 3EYFB 2F9BT 5DURB 2QQKH 5FGSA 2NX5D 1BZ9B 2GT9A 2X7LB 1FJ1B 3BX7C 3KPRD 1CR9H 4ZTPL 3VXQB 2GITA 2NLJA 4M02A 4NO5B 2ZG2A 1EHXA 1OB1B 2FWOB 3NA9H 4E41D 5D8JL 3WD5L 4ORGB 2NX5E 4CBPA 1I1RA 5IMOA 1MAJA 3ALXA 4OB5L 4YAQB 1NAML 5F7DB 1U3HA 5F9JB 4OQTH 5B38B 2B39A 1J05A 1E4XH 3K2UH 5B4MD 3UO1H 2O5ZH 1CLZH 4WIQA 2VDPL 3IKCB 4KKCC 5FM5O 2OQJB 1D5IL 2W60A 3WHXA 3IFPB 4JHWL 3FO9A 5BW7C 5TE4L 4OF0A 5ESVB 2NTFA 2DTML 1N3NB 5D2LF 1VGKA 4JFXB 1CZ8H 1XGQA 3MOAH 5D7LD 3TM6A 2VXTL 1GPOH 3QQ9C 3ZTNH 3WE6A 3EGSB 4PGCB 4BQCA 3QG7L 5ESQA 1A9BB 3ET9F 3SE8H 5EU5A 5CJ5A 5FYKL 1YPZE 1QBBA 2XY1A 2GQHA 4M00A 3KYOB 5BRZA 3V4VL 3PV7A 4N0FB 4NN5B 3DO7A 4U1LA 3QDJA 3C60B 1JWUB 3IVKA 4U1GB 5F7UA 1BJ1J 3SDCB 2Y36H 2PO6C 5EUOA 1KB9J 1RJYB 1FNGB 5FM8A 4LPVA 1OW0A 1YDPB 2VDNH 1UXSA 4D9QD 2WINA 1B0GB 4XP1L 4WFGE 2H32B 3CH1B 2V9QA 4U2YA 1NGYB 4JM2D 5GIRA 5HGDB 3QPQD 3QG6A 4YXLL 4MCZA 2F54B 3BESR 2CKNA 2R1WA 4D0CA 3BAEL 4EXKA 4K8RH 3VXRB 3P40A 4M3KB 5IUSA 1UM5H 3FHQA 1FFRA 3I6GA 5DJ8A 3VH8G 1HE7A 4KROC 3E6FB 1LK2A 3TBVA 4JM2F 5HYQB 3BE1H 3MRJA 1U8JB 4U7SA 3KYMB 1U92B 5LVEA 1ND0B 1MRCL 3KPSA 1ZVYA 4Z7UE 1GAFH 3SE3A 1UWXK 4OGXL 4LFHG 2C3VB 5HHOB 5F8RC 4O02H 1U58A 3DSFH 1MJ7H 5IB5B 1N6QL 3G5VA 2B0SL 3CIQA 5GSRA 4FQXA 5HD8D 3O4LA 5HVGB 4HGMA 1DN2A 3BO8B 1LO0L 3TZVB 1S5IH 1A7NH 3KPTA 3FOLA 4ZTOL 3ILPA 1NUGA 4F7TB 1QSED 5D5MA 3ESVF 4QRPE 4R0LA 4XNZB 4OZ4B 2I07A 1A7QH 2ZJSH 3D39B 2JJTA 3B9AA 1D6VL 2NY4D 4RFNB 1NSNL 4JFEA 2NMSA 4OCSH 2A38A 4EQ3A 5J8OA 1H15B 5AEAA 3QHZL 4LLVB 1ZLUK 1MFEL 4M7JH 4P5KB 5TF0A 1JNLL 2P44B 1U8LA 3PWVB 2IGFL 3MOBL 3EYOA 2FHBA 3Q2CA 4GG8B 3MMEB 2V17L 3UP1A 3V0WH 4S1DD 2XN9A 2GHWB 4AEFA 3H3KA 3EO9L 4JZNA 2FD6L 2MCG1 2IFFH 1G6RH 2X4SB 4L29B 5FF6B 3ARDD 3ARBB 1T0NA 4MCYB 2HG5A 4NIKB 1KB5L 2GYSA 1M7DA 5IFJB 2P5EA 1ADQH 5J12B 4NFCA 2VDKH 3MLWL 4BH8A 2OTPA 3WKNA 1LK3L 1U8IA 3ARZA 2R15A 5SWSA 3S5LG 2R8SL 1OSPH 1Y6KR 1U3YA 3CVHB 3QCUL 2KPNA 3O2VH 3WIHL 1OAYL 2GUOA 4UINL 1WBXA 4G6KH 4ZS7L 4G5ZH 5IVZA 3HG1B 3MNVA 4K9EC 1TNNA 4G7YH 1MRFH 2NX5A 1ONQB 4Z95L 4HIJA 1KJ3L 4OFDA 2X4PA 5KSVB 1KLUA 4ZO6A 3L3IA 4E41A 5K9QI 4LP4A 4HHAB 2W9DH 3S4SG 4L3AA 5H8DA 5ICYA 4MD5A 4JKMA 4NC2B 1DUZB 5TDOB 4PJFE 3QBTB 3KXFD 4Z76A 5ALBL 2NQCA 1XCQB 2Z8SA 1A7OL 4K7FA 4FP8H 4PJ8C 4RBPH 2N7AA 3I6KB 3EDDA 3C09C 3MLXH 4XHJC 1A0QL 1MHHA 4KTYA 2LU3A 5FHAH 4AM0B 4ZFOB 1ZOXA 3VXNA 2DQTL 2QHLA 2EO9A 4FQIL 2ZSVA 2F74B 5HI4C 3AROA 3WFCL 4EN3C 4J3SA 2JE8A 4YFDB 3M8OL 2R2HB 4LGSB 4X6CE 1KIQB 3ORJA 5F6HI 5IB3A 1JIBA 3BZ4A 4K7PL 4HJGA 2QADB 2P43B 3IJHB 3PXJA 3ZE2E 3U2SB 2GK0A 1NDGB 3DARA 2GCYA 3GMOA 1YPZA 4AL8H 4NDMB 1NGXB 4L8BA 5FKPA 3G5YB 3UTTE 4GW5A 5GGUA 3PWLA 4X98B 5EC2B 3TC9A 3PQYD 2AK1L 4F15C 1QNZH 5I6XB 4J6RL 2Y7QB 4LSPL 3HPJB 5LQBL 3EOAB 2P48B 4NO2A 1I9JL 3RVVD 3IS0X 3HE7C 3U4BH 2IQAB 5ICZB 1F97A 4MNHA 2WLZA 1MCCA 2DQEH 5DJXA 2XZAL 4FQCL 2HT4C 4Q9RL 4JM2A 4JRYD 4UT6L 3VXTB 3NCFB 1HEZB 4K9EH 4KUZH 3BJLA 5I1AB 4LRNH 2VABA 2J4WL 5J1TC 4RWHA 2J2ZA 4GAGH 5GS0H 2YPLB 1INEL 1ZGLM 5BO1H 1D5XA 1X5AA 4X6EA 2R4SH 2Q76B 4NJAH 3MYZA 2BOBA 4I13B 4PJDE 4M6OL 3MRLB 1Q9WB 1ZWIA 2EDNA 5FB8B 4NQVA 4PG9A 5FXCH 1BVKA 3GMRB 3TO4D 4F7MA 3BYTA 3N85L 4EUPB 2G9HB 5D96C 1ODAA 3MRFB 1M6OA 3REVA 2CQVA 4GUPB 1R0AH 2IPUG 4AIXA 3AGVA 4JAMB 1CR9L 5SX4I 4OZIF 1H5BC 4KK6D 2B4CH 2IAMC 1B6UA 3BP5A 5T3XH 3JV6B 1DBML 4PJBE 3IFLH 2EIBA 4JJ5B 3QDMD 4O2FB 4YPGA 3MLVH 5IHUH 1DBAH 4CDGC 4Y19E 4HG4J 1KCKA 4OQTL 5DQJB 1MUJB 2DI7A 4K94H 1E4XL 3K2UL 1XGRA 2EECA 4NN7B 4P0DA 3UO1L 2GT9B 2Z93A 2O5ZL 5T1KD 1CLZL 4AZ8A 2GITB 1KXVC 3I3DA 2NLJB 2L7JA 4Z7VF 1GHFH 1UZ6F 2H2SC 4ZUTA 1VGEH 4OCLC 3SCMD 3RY5A 4PRPE 5D7KD 2NY0B 4PRIE 2VISA 3J8F7 5IMOB 4MS8D 2D7TH 2ICEA 1X5HA 2NY3D 5GRJH 2EDKA 5D2NE 1L0QA 2PTVA 4JDZA 5DWUH 1CZ8L 1U3HB 5GGRY 4TUJA 3MOAL 1J05B 5IR1A 1GPOL 3M07A 3VD7A 1T1WA 4KJQC 1UC6A 2K7PA 5K59F 4L1DA 4RAVA 3SE8L 3UDWA 3ARDA 3WJLA 3WHXB 2W60B 1SVCP 4MGXA 4MNGA 3FO9B 3LEXA 5FUZH 2NTFB 5B8CA 1OGTA 2J7LA 2R1XA 3WNPA 2Y36L 4PV9A 2HFGH 4FFZH 4QTHA 1VGKB 2DJ4A 1XGQB 2VDNL 4PG2A 3U1SH 4ZUSA 5IOPA 2YZ8A 3BRGC 3WE6B 5DFTA 5MEND 2WBJC 3WXWH 5ESQB 1FRGH 4B50A 4FHBD 3FRUA 5EU5B 1RZFH 2UUDH 4Q9BA 4K8RL 5BRZB 3CFKA 4NJ9H 3DO7B 4PJFA 4U1LB 3QDJB 3KNBA 1UM5L 3IVKB 5EUOB 1GRWA 2I5YL 1OF2A 1NBZA 3LS5H 1PZ5A 1S9VA 1WWWX 4NM8H 1FHGA 1UXSB 2WINB 3BE1L 3KXFA 3EDKA 1BIIA 3DUUA 4OGYH 4DKDC 2AXGA 5GIRB 1X9QA 1JCKA 3QG6B 4CGTA 1GAFL 4MCZB 5EUKA 2R1WB 4D0CB 4LKCA 1D9KC 4PJAE 3FOMA 4O02L 1U36A 3SDXE 5C0JA 4KQ4H 1MJ7L 3WL9A 3KLSA 5DJ8B 3I6GB 1DANU 1GOGA 1RIUH 1EBAA 4P23C 5E6ID 3S36X 2CXKA 4KKNA 3WFDH 1NJ9A 1LK2B 3TBVB 4RRPG 3MRJB 1ORQA 5TE7H 4APQD 1S5IL 1ZT7A 5AG8A 1A7NL 1X5IA 2N56A 2PCPA 2ZUSA 3KPSB 2UVFA 3RWJA 3QFDA 1A7QL 2ZJSL 4Z77A 4MYWB 2JB6A 4OCSL 4QEGA 1U58B 1RZJH 3G5VB 5GSRB 4M7JL 1GIGH 4FFWC 2C9AA 3PQYA 4KUCF 2ZUQC 4F9LC 4FQXB 3K46A 3UZVB 3O4LB 4PLNC 5FDWA 4WU7A 3VGBA 3VGFA 3GJEA 1KEMH 4W81A 1I1YA 3FHAA 3FOLB 3ILPB 5D5MB 3SGDI 3V0WL 4R0LB 1P69B 2I07B 4LPYA 1OAKH 5D72H 3JWOC 4IOSD 3IDMA 2IFFL 1G6RL 4JFEB 3MO1A 4ZPTA 1X6NA 4HPOH 4H1LA 2IMMA 1T2QH 3RTQD 5KW9H 1KBGH 1EVTC 3K4AA 1U8LB 1CICC 1F4WH 1RPQA 3EYOB 2BSTA 1ADQL 4LSVH 4PJCF 2VDKL 1J11A 5HYJE 4LVNB 4N0RA 1J18A 2XN9B 4ODTL 3KJ4C 2A9MH 4OZIA 3T0DA 1PVHA 2XPGB 1OSPL 3N1PC 3RWEA 4JZNB 4X9FA 5CGYD 2HLFC 3QYCA 1B88A 3TO4A 2AQ1A 4XNXL 3O2VL 3U30B 1X5ZA 3VI4F 4G6KL 1T0NB 4HFUH 4G5ZL 5HDLA 2HG5B 1JJUA 3HZKA 1T1XA 1MCWW 4ZQKA 1MRFL 3GM0A 2NZ9C 3VMOA 1M7DB 2P5EB 5IWLA 1S7SA 3IDJA 4O2EA 2W9DL 4BH8B 3T0EE 4XVUC 4O5LH 1U8IB 1IL1A 1AO7E 2VAJA 2IH1A 5SWSB 4A6YA 3QDMA 2XI9A 3NFNA 3G6JE 1S9YA 3IKKA 4FP8L 4TVPD 3RVWC 4D0BA 1DR9A 2GUOB 1H0DA 5CJ8A 4YBLB 1WBXB 5C09E 3MLXL 1T22A 5IVZB 4PRPA 3MNVB 1VSCA 2NX5B 4QF1A 5FHAL 3MJ9A 2DLGA 4HIJB 5T1KA 2X4PB 1KLUB 2GJZA 3L3IB 3BWUC 5ICYB 4MD5B 3SCMA 1KCUL 2VDRH 1S7TA 5D6CA 1SBBA 2MKWA 4Z76B 3B5GA 2DQHH 2N4IA 4K7FB 5DO2D 5EOTA 4I9WE 4K3DH 3ZDXE 2ZUXA 4AL8L 3CCHA 2Y06H 3OR7A 1MHHB 2ZUWA 2NY7H 4OCNC 4WI5A 5DQ9A 5HPOA 3VXNB 5ILTH 1VKXA 3DXAD 4MMZC 4P2OD 1EHNA 1QNZL 2ZSVB 1QBAA 2FHFA 5IBUG 3R8QA 1WGOA 1OQXA 5CZKA 4PP1D 1UG9A 2PTUA 5IB3B 3BZ4B 3U4BL 2K9UA 4HJGB 3LV3A 3ULVH 2GK0B 3NCJH 2GCYB 1YPZB 2DQEL 5C3TA 3SDYL 5L7XH 3EKCA 4L8BB 1F4YH 5FKPB 5MENA 4J4PD 4GW5B 5GGUB 2BCKA 4Y16C 3PWLB 5TPWH 4OZFH 3VA6A 1RI8A 4HH8A 4K9EL 5FGBA 4KUZL 4C58B 1GYAA 5IM7A 2V2WA 4GAGL 5TFSH 1BOYA 1BMGA 5GS0L 4NO2B 2KL6A 2OSLA 3VCLA 5BO1L 3EYQC 1T6WA 3FMGH 2EDFA 5T3ZD 2R4SL 3B5HA 4NJAL 3RZCD 4MNHB 4LEXH 2WP3O 1EHLH 1SM3H 5DJXB 1CWVA 1A4KA 3BJ91 3BPNB 1ZT4A 3TYFA 2QR0A 4YHYB 4JFHD 4Y4HC 1ITBB 4JM2B 2EIDA 3H3BC 3OAYH 4KPHH 5HI3C 4HKBA 4OFKA 1R0AL 1C8PA 2R2EA 2VABB 2WUCH 1JRHH 4HDIA 4OCMC 3QEGH 2VLKE 1BM3H 5B39G 5J06A 2B4CL 1D5XB 3ZSTA 4X6EB 5E6IA 4DCQA 5T3XL 2BOBB 5D7IF 4UB0H 15C8H 1ZWIB 3IFLL 2EXWD 4NQVB 4PG9B 3H6JA 7FABH 1KYOK 4APQA 5IVXF 1BVKB 2EXYD 3MLVL 1DBAL 3IAPA 3MUY1 4F7MB 2VE6A 4GXUM 4K94L 2HP4A 3A6OA 2OL3A 1M6OB 3REVB 3RDTD 4R97C 1GHFL 5CS7A 1S7WA 3VG9B 3LQZA 4LAJH 3SOBH 1VGEL 3BP5B 5FYJE 3LEVH 4EI6A 1PEZA 2D7TL 1TJHH 3TNNA 3JZ7A 4YPGB 5GRJL 5GS3A 1N64H 2BHUA 5DWUL 1WBZA 4MQSB 5CSBA 4QHKJ 2CH8A 5HPMA 2CDGA 1XGRB 3B9DA 1V8HA 2Z93B 2NY4B 4LHUA 4RQQA 3FAXA 5JUEL 3R4DA 3ZHKA 4DTGH 2EDHA 4NPYA 5CJBA 3GMLA 4OD1H 3UTSE 4ZUTB 2DLTA 4GSDH 3RTQA 3MRGA 1I75A 2FECI 2XACC 4TYUA 2VISB 2ICEB 2DQIH 2HFGL 4FFZL 3ARFA 4NCDA 3OPZH 4JDZB 5ENWA 4LLWA 4TUJB 3U1SL 1M71A 1T1ZA 3I6LD 5IR1B 4P3DA 2NY6B 4HC1H 3WHE1 2ZNWA 1T1WB 3WXWL 2DKSA 1FRGL 1EK3A 4QT5A 4RAVB 1KJ2H 2BK8A 2NXZC 1KCRH 2VRAA 4KZDH 2ZCLH 3BPOB 3ARDB 1RZFL 4LARH 3GSNH 1OVZA 4MNGB 3GBNL 4P2RD 3CLFH 3LEXB 4CVZA 2F15A 5B8CB 1OGTB 2R1XB 2X70A 4UBDC 1MCQA 4PV9B 4QTHB 2EE3A 1SJHA 5H2BA 3LS5L 4ZUSB 4NM8L 4C55A 5E00A 5IOPB 2JELH 4PJEE 3G5XA 3K81A 4KK5C 1G9MH 4OGYL 2EDQA 3ZDZF 3OKYA 5ALCH 4D9RD 3FRUB 1IZJA 3QQNA 1FDLL 2OTUA 3S7GA 3PHQA 4U1GC 3CFKB 4YO0A 3SDCC 4PJFB 4JZOA 4KU1A 4OLZH 3KNBB 4PJ9A 4KQ4L 1IEAA 4D9RE 3SQBA 1RIUL 4CNIA 2YPKA 1OF2B 1NBZB 5IEHA 1PZ5B 1S9VB 3WFDL 5KJRH 2BVQA 1MFDH 2JCCE 1AR1C 1HHKA 4O00A 4N5ED 4C56E 1AQKH 3KXFB 4HZLA 5TE7L 1BIIB 4LVEA 1N7MH 3DUUB 4KK9C 2AXGB 5CSGA 1JF1A 1KENL 2MKLC 4MQXC 5DFVD 4L8DA 5EB9A 5EUKB 3C2AH 3L7FA 4LKCB 3OJDA 3FOMB 4QGTA 5C6WH 3LQAH 3GRWH 3NIDF 5C0JB 3FQWA 1RZJL 3WL9B 2VUYA 2WQ8A 5HVWA 2FX9H 1GIGL 2NPLX 4UAOC 2HJLA 4P2OA 1T7WA 1NJ9B 4JJHA 4BQ8A 2I26N 3OR6A 2X4QA 5LGJA 1ORQB 2WLYA 4ERSH 1KEML 1T2JA 1ZT7B 4KKAC 2KQMA 2PCPB 4PJ7F 4K07A 1R5WA 1WC7B 4PS4H 3SDDD 4ZSOA 5F6IC 2JJUA 2Z8RA 3RWJB 2DQGL 2AJVH 3QFDB 1OAKL 4Z77B 1F4HA 5D72L 5GJSH 1Z6JT 2JB6B 1AR2A 4YJZL 3F6LA 4J4PA 1FIGH 2VQTA 2I60H 3EHBD 1T2QL 5KW9L 3PQYB 1BHGA 4HJ0C 4ZDHA 3MQIA 3TZVC 1J87A 5FDWB 4WU7B 3GJEB 1F4WL 4TNVK 1I1YB 4LSVL 4J3WA 4XNZC 2MOVA 1U6AH 3D9AH 1QSFD 3RZCA 2A9ML 4RFNC 4GKZA 4HBCH 3IDMB 4DUVA 3BRFA 3F7PC 3MO1B 4C59B 1JTOA 1EFQA 4ZPTB 2APFA 3MV9E 4H1LB 1OP5H 1AHWA 4M4RA 5DK3A 4NBXB 4DVRH 1BWWA 1WZLA 3NPSB 5ITFA 4JKPH 4WGVB 2BSTB 3T3ME 3V5KA 5TF1H 2H32H 4O5LL 4XVTH 5KS9F 1DUYA 3G6AA 4X4ME 3RWEB 1QSVA 1MREH 3TO4B 3QNZA 1SMAA 4JREB 1TMCB 4I0PC 2LU7A 3HZKB 2DOCA 4MAUH 1VB9A 1T1XB 4ZQKB 1Q72H 2R2CA 1YY9C 2MQ3A 1MLCB 4XWOD 5L8JB 1H3XA 5DK0A 3HMXH 1S7SB 2VO5A 3IDJB 4O2EB 5EU7E 4POYA 2L7UA 2VDRL 1IL1B 3ZT6A 2IH1B 4HV8A 4A6YB 3QDMB 2DQHL 5I19H 3NFNB 3V5HA 1S9YB 4UNVA 2G5RA 4D0BB 2AQ2A 2LQRA 4K3DL 1H0DB 5DFWH 3UTSA 3HAEH 4MNQE 1T22B 4U33A 4PRPB 4QF1B 1HHIA 1MJ8H 5GGTH 5ILTL 5T1KB 3EFFA 1JZ5A 5JZ7D 2GJZB 3H8NA 1HDMA 5CD5C 3SCMB 1S7TB 4K7PY 5D6CB 3BGFB 3F8UB 1W8NA 2NY3B 3BPCA 2CLVA 3HNVH 1G0YR 5EOTB 3ULVL 4E0RA 3ZT5A 1NQBA 3SKOA 3CCHB 1A2YA 4JFPA 3OR7B 4LSDA 5KSAC 1F4YL 5DQ9B 4PJHF 5TPWL 5ADPH 1VKXB 1TCMA 4UMGA 1OY3B 5JPMA 2H45A 2EC9U 5FAAA 2P7TA 3T65A 4PJEA 4MX7A 5D7JC 5TFSL 4YGVA 5IVNA 3FMGL 3MV11 2YXFA 4RGNC 5K9JH 4HF5H 3LV3B 2RQ8A 2FJHA 1FZOA 4LEXL 4G80A 1EHLL 5E5RB 1SM3L 5GHWH 5MENB 4Z7QE 2H8PA 2HTLC 5EZLA 4KPHL 4L9LA 1FNSH 2XQYG 2WUCL 2V2WB 5IM7B 1T7XA 4OCWL 3QEGL 3WNLA 1TCRA 1BM3L 2OSLB 3VCLB 5FYKE 5E9DE 2R0ZH 5CAYB 3HUJA 2Q87A 15C8L 2OX5A 1IM3A 2YD5A 4ZPVA 1A4KB 3C6LC 7FABL 1ZT4B 3MJ8A 3NPZB 4GKSA 4JY4A 3TYFB 1I4FA 2QR0B 1LNUA 5I30H 5FHBH 5B3JF 2QQNH 4ZXBD 4HKBB 3IFNH 3BXNA 3W5MA 4K3EL 1LHZA 1PG7H 2R2EB 4Z7WF 1X4ZA 4HDIB 4KDTA 3BIBX 3VFOA 2YD1A 2BNRE 4UV4H 4JFFE 3EZ8A 5IF0A 3HB3D 3SOBL 5E6IB 4DCQB 1X4YA 3LEVL 2B5IB 1TJHL 4NKMA 2DDQH 1N64L 2LVCA 4APQB 2R39A 4MA3A 3SDDA 2VE6B 5I1KH 2OL3B 4HIEA 4HUWA 2JJSC 1FORH 2HWZH 3FQTA 4IHOA 1UWGH 2VXUH 3H0TA 1T0PB 1S7WB 3SDAA 1UWEH 4OD1L 3LQZB 3UBXG 4GSDL 5HVHC 4NBYB 4KDVA 3JVGA 4EI6B 2GTZA 2DQIL 3TNNB 5MEOA 2DLHA 3OPZL 1WBZB 2O5YH 4NN7C 5HPMB 2QV2A 1QSFA 3SGKA 2CDGB 3IAGC 3HNSH 3SEPA 1MCBA 3WN5A 3PGCA 1FNLA 4LHUB 3SKMA 4RQQB 2D7OA 1KJ2L 1TTFA 1JN6A 1KCRL 4KZDL 3U7WH 3CLEH 1CD1A 4NPYB 1DLFH 2EIZA 3GMLB 3GSNL 4KKLD 3PP4H 2Z8WC 3RTQB 2VZUA 3MRGB 2J3SA 3ARFB 1PLGH 2PYEE 5ENWB 4LLWB 1M71B 1T1ZB 2JELL 4P3DB 4PRNA 3BDXA 2IPTH 1G9ML 4JPIA 4Y5VC 4QT5B 2DIJA 1G9NH 2UVEA 5ALCL 3ZTJG 3TCLA 2DMKA 4NKIH 1A5FH 3UBXI 3V4UH 2GIYA 4CVZB 2FZ3A 3PWNA 2X70B 4OLZL 5DD6A 2P8PA 4WI3A 2VXQH 1SJHB 1PKQE 3MV01 5H2BB 1T04A 5KJRL 1L0YA 3QFJE 1MHEA 5E00B 5EU6D 5GRWA 1MFDL 1MOEA 4MNQA 3G5XB 1AQKL 4EUPH 5JW4M 1N7ML 5FA4A 3HFMH 1U8KA 5C0AD 4ZODA 3P2TA 3THMH 5D6DC 2OTUB 3C2AL 3PHQB 1SVZA 4YO0B 4KKBC 4JZOB 4DZBA 3LQAL 1JGDA 4PJ9B 1NGWB 3GRWL 1T03H 2VWEE 1IEAB 1OGAE 2F8OA 3DETC 2FX9L 4CNIB 2YPKB 4KK8D 5IEHB 2BVQB 1HHKB 2XKNA 3VFRA 3BUTA 4HZLB 4ERSL 3C8KA 1OLLA 1TVHA 2QQLH 3MV7E 2Y4SA 1ZLVK 4EI5D 3KVQA 1LMKA 4OIIH 4PS4L 1JF1B 1BGXH 4L8DB 4CN6A 4KJPC 4BJLA 3GKZA 5C0FA 2AJVL 4DUXA 3HI1A 3LD8C 4ZUUA 4N8CH 4PGEA 3L7FB 5GJSL 5FA3A 5KSUA 3OJDB 1NGPH 1FIGL 3FQWB 5JOFA 3S88H 1U0QA 4MA8H 3ALWA 2I60L 5E5MA 3GMMB 3S37H 2HJLB 4P2OB 2DIAA 3OR6B 2X4QB 5LGJB 3T3PE 1R5WB 3SE3C 1J8HD 3TVMC 4B0MM 1U6AL 4PJGA 3D9AL 4ZSOB 3HCVA 4POUB 4EIZC 4HBCL 3NAAL 3AMKA 4BM7A 4ZMAT 4OZHF 4HAFA 5E9DA 5HBBA 1BJ8A 4ZDHB 3W81A 4DVRL 3RFZC 3VD9A 2CSPA 1NFIA 3OG4B 3QO0A 4JKPL 2FGWH 4R90H 4DN4H 4KZEH 3MRBA 4IOFC 5TF1L 3U4EA 3NBNA 3IDUA 1MHPH 2UWEF 4XVTL 4BYHA 3RZCB 3V6FA 1GGUA 3QH3A 4GKZB 5T1LD 1T20A 2IFGA 2O5XH 1NFKA 5I1DA 2BNRA 4ZXBA 1AHWB 4QXTA 4MAUL 4KWUA 1Q72L 4WW2A 1PFCA 1UJ3A 3GSOB 5ITFB 3R0MA 4KVNH 5F44A 1SJVA 4NQTA 5T5FL 2GTWA 3V5KB 3RU8H 3HMXL 3LH2H 1FGNH 3CSBA 4ODVH 1F4XH 3KDMA 5F1KC 4W6WB 4WGWB 2EKSA 4RGMB 1DUYB 3G6AB 5I19L 1DEEA 1PX3A 3ECBA 4FMFA 3LDBB 1YEEH 2FH8A 3QNZB 3DPBA 3LB6D 1IAKA 1HNGA 1YEFH 3PNWA 3Q5OA 2AW2A 5GGTL 4OLUH 3RI5F 3WDHA 3WMSA 1NCTA 5DK0B 1MF2H 2W9EH 5E6ZA 4HV8B 4PLKC 1GCFA 4YBQC 3VXUD 2HTKD 1HSBA 3V5HB 3HNVL 4XZUA 2BMKA 5F7YC 3RVXC 2BVOA 1EX0A 1P7QD 3UTSB 5AWNH 5J13C 4P2QD 1HHIB 1A47A 3EFFB 5ADPL 2PYEA 3BVNA 1IM9D 1HDMB 3PGDA 4X6CF 3HS0A 3TP4A 5C08E 1WZMA 3BPCB 2ORBL 2CLVB 3QA3A 1NMAH 5K9JL 1IMHC 5B4MC 4MHHI 4CU7A 4E0RB 3SKOB 1A2YB 4JFPB 5GHWL 4HS6A 5IVOA 3BSZL 3VGAC 4JQVA 3ZE0F 1FNSL 1K8IA 4Y5XA 5JPMB 4XCCH 2P7TB 2D9QB 1IQWH 3T65B 4PJEB 4MX7B 4OZGE 4YGVB 1D3CA 4XAWH 2R0ZL 4N90E 1QRND 5DJDA 1FFQA 2FJHB 1MJJA 1FZOB 5EU6A 4G80B 4WHTA 3LPFA 3MLRH 4JFZH 2H8PB 3T77A 3Q5TA 5FHBL 2QQNL 2QBWA 5DJ6A 5EZLB 4L9LB 5J11C 4NSKA 3IFNL 3RX8A 3GBMH 1PG7L 3QSKB 1JWMA 1MCOH 1EAJA 3E2HB 4YK4B 1TCRB 3QHFH 2ERJC 4PJDF 4UV4L 5I74B 3ARTA 1F6LL 1XCTA 3HUJB 4M8QA 3P9WB 4YDLB 1IM3B 3GBLA 1X5JA 4PJXE 2DDQL 4ZPVB 1EXUA 4WEMB 2MNUA 3MJ8B 4GKSB 4JY4B 5I15H 1I4FB 3QPQC 1LNUB 1FVEA 1TZIB 1Z5LA 5F7LB 3T0VA 3BXNB 5I1KL 4KKCD 1TVBA 1UB5A 3DBXA 2HWZL 2VNCA 1UWGL 2VXUL 3VFOB 1TQCB 2W0PA 4WFEE 3UJTH 1CFBA 4NZRL 3WJJA 1UWEL 4PJBF 5IF0B 3OWEA 4U7KA 3SPVA 2ENYA 4KXZI 1FYTE 2EDOA 4NKMB 2HLAA 5A40E 4Q2ZA 1MQKH 4OLYH 5J56B 1K4CA 3IF1A 3QQ9D 5T5NG 2O5YL 4HXAH 1J8HA 3O6MH 4MA3B 3SDDB 1LDPH 4N0YH 1NAKH 1EEUA 5C0RH 2X1QA 4HIEB 3HNSL 2RFXA 4NZJA 4HUWB 3FQTB 3VG9C 4IHOB 3H0TB 1CDUA 3W11C 3U7WL 3CLEL 3MJ6A 3SDAB 1DLFL 2L0DA 5LCVH 5HD8C 3PP4L 4D9LH 4HIXH 2GTZB 4HQQH 2G75A 5MEOB 1MWAA 1PLGL 4ZG1A 4AG4H 1A1OA 5DVNA 3A67H 1QSFB 2GSGA 2ZNXA 3MPCA 2IPTL 2NY4C 1MY5A 1QBLH 4M43H 3WUWG 1MFBH 3WN5B 4MZ2A 3PGCB 4XNUL 1CDHA 2R0LH 3SKMB 4JHAH 5L2KD 3WKMH 4FTVD 4LCWE 1RD6A 1G9NL 1JN6B 4R7NA 2HRPH 5CEXA 1CD1B 2EIZB 3DUHA 4NKIL 1A5FL 2CUIA 3CFIC 3V4UL 2PUQT 4CMHB 1GXEA 4KROD 1R5IA 1N26A 2VXQL 3TPUA 5F3BA 4QNPF 4FOMA 2WMPA 3MCLH 3HE6D 4PRNB 5CMAA 4NN6C 3EDFA 1B3JA 3FN9A 4JPIB 5MEQA 5DUPH 4BK4A 3HFML 1NCBH 3WUZA 4RAUA 2VDQL 3TCLB 3RAJH 3THML 4YHIA 5B8CC 3IAQA 5A2IH 4JFDE 4UOW0 2FZ3B 3PWNB 4R9HA 1T03L 2QEJA 2IMNA 5DD6B 1EEQA 2P8PB 3KYKH 4LLQA 1EGJA 3HKFA 2CKBH 4X6DE 1T04B 3DGCR 3HC0A 1MHEB 1OTUC 1UA6H 5C92A 4MNQB 5CJXC 1QACA 1ZA6A 2QQLL 5FA4B 3FB8A 4LCIH 3OB0H 5FECA 1U8KB 4OIIL 4NKOA 1BGXL 1I1CA 1NANH 3EFDL 1M1SA 4XCEA 1E4JA 3SDXF 2ZUUA 1ETZA 4N8CL 4ZAKC 1G7MA 1GZQA 2Q1EA 1NMCC 4DZBB 1IC4H 1JGDB 3S88L 2X09A 4MA8L 1P9MC 1A6VH 3S37L 3NH7H 1MRDH 1DLHA 4UNUA 1BBJA 2XKNB 3VFRB 4PFEA 3C8KB 3V95A 1TVHB 1L0XA 1WWBX 1W0YT 2J5LB 1JYNA 4L5FH 4DUWA 3RA7H 3RWCA 4MQTB 5C0FB 4R4FH 1Z9LA 3HI1B 5EO9A 4ZUUB 4M9PA 4PGEB 3FT3A 5SV4A 5FA3B 5AUMA 5KSUB 2CO6B 4OQ1A 4OZGA 5EU3A 5IW3A 5IJKA 1A9EA 4U31A 3MRNA 4FXLA 3FQUA 4M7LH 5JOFB 1UYWH 4XAKD 4IS6A 5E5MB 3ZE1E 3TPKA 4QRTA 5EFIA 2VQ1A 2EDXA 2FGWL 4HZAA 4R90L 4Y5YA 4DN4L 3NGBC 5E2TH 4KZEL 4Y4FD 1RUMH 4NUGH 4PJGB 2AJZA 1MHPL 1QRNA 1JNJA 3F65A 1YQ2A 3HCVB 2WBWB 3GNMH 4JB9H 1Q0YH 1RQ5A 2O5XL 5I8CA 3IU4H 2J8UF 5F70A 1BD2D 5E9DB 5DZLA 4MJ2A 1JE6A 4LMQI 1B90A 3FFCD 3OG6B 4X7SL 1C5CH 1NFIB 3QO0B 4PJXA 3RVVC 4KVNL 1EERB 3RU8L 3F6IA 3MRBB 4F7PA 1QPPA 3U4EB 5AZ2H 3LH2L 1FGNL 3D3VE 4ODVL 1HXYA 1F4XL 4RFOH 5KAQG 2C3HA 3V6FB 5FM5M 1A6TA 2P5WD 4JG0H 3QH3B 4PJ8D 5I8EA 1F02I 1T20B 1WIPA 4PYGA 4XHJD 1GGIH 1YEEL 5I1DB 2BNRB 4ZXBB 1KIUA 3V8CA 3OKNA 1YEFL 4QXTB 1IAII 4IOIA 4WW2B 1UJ3B 5BW7A 2GTWB 2H1PH 4I0KA 3EOTH 3QEQE 1ZK9A 3KDMB 3LPWA 4JO2H 2W9EL 1J0IA 3WXVH 4YHNA 1PSKH 2EKSB 3MRMA 4OTXH 1DEEB 3ECBB 3RPKA 4H0IA 1J12A 4P5TC 5T3XE 2B7DT 4LASH 1IAKB 4I0CC 5AWNL 3O8XD 3PNWB 3TIEA 5EZIH 1CD9B 5DA0B 5L6YH 1BF8A 1CFTA 4LRIC 5DK2A 3CU1A 3CDYA 3W0WD 3MZGB 5HDQH 1KYOJ 1J1PH 3HMWH 5F96H 2PTTA 3BDYH 4KFZC 1KULA 4X4XA 3ZDXF 4XX1E 1HSBB 1NMAL 4XZUB 2BMKB 2BVOB 1SMOA 4GKOA 3D0VA 4FZ8H 3P73A 1X3DA 1E6JH 1TPXB 1X7QA 5L2KA 1NBVH 3M1BA 2PYEB 3BVNB 1CDBA 3SCMC 1YJDL 3BGFC 3PGDB 2N7BA 3H9ZA 4MS8C 4XCCL 1JHTA 3Q48A 1IQWL 1YC8A 3MFFA 2NY3C 1RU9H 3HS0B 4ONOA 4IRJD 3AB0C 3L95A 4J3UA 3O6KH 3QA3B 4XAWL 5D7SH 3LCYA 3IDGA 2Y72A 1FC1A 3MJGX 5KZCD 1C7TA 1OQOA 3HE6A 1PQZA 3NIFE 4LDLB 1TJGH 1NCUA 4H1LH 4HS6B 3TT1H 2E9BA 3MLRL 1GGCL 5DA4A 4JFZL 2HMIC 5HDBF 4ELKA 3ARPA 1K8IB 3GBML 4Y5XB 4RGOH 4H8WC 1MCOL 1RVFL 3IFOA 1UM6H 3RNQA 3QHFL 1TXKA 5DVLA 5CP7A 1N8ZA 1S7RA 1J7VR 4PBXA 5DJDB 5J1SC 4S0TD 1MJJB 4XHQA 1SEQL 5EU6B 4WHTB 2MCPH 1H3VA 2VLLA 5L88H 5I15L 3QNYA 3T77B 1RZ8A 5DJ6B 5JIHA 4NSKB 1JWMB 2AK4E 4R3SA 2AKRA 4UOJA 2H2SD 4M8VA 5H37G 1YEKH 1V7NH 4GMSH 3UJTL 3BHBA 5KSBF 3AVEA 4A6YH 4ONHA 1XCTB 3QXUA 4M8QB 2BXYA 2VKXA 4KMLB 3U79A 1MQKL 4FABH 1EXUB 1UCTA 3ZHLA 1YEGH 3C2SA 4HXAL 4LVOC 1FVEB 3B2UD 3O6ML 4P2YA 3C8HA 4N0YL 1NAKL 1Z5LB 4KJQD 5C0RL 3O2WH 1TVBB 1RAMA 2R2BA 1UB5B 3RY6C 2K1MA 3DBXB 4XC3H 5TE6H 5JQ6H 1X44A 2P45B 1V5JA 5E6IC 5LCVL 4D9LL 4BUGA 1V3KA 3SPVB 4HIXL 4APQC 4HQQL 5I18H 2HLAB 2ADFH 4Q2ZB 4X6FA 1I9IH 4XI5D 4AG4L 1K4CB 3IF1B 4Y4FA 1N6VA 3A67L 1J8HB 2FGZA 3R06A 2AXJA 3BEVA 1U8MB 1QBLL 4M43L 3LAFA 1MFBL 2IWGA 1KNOA 2AJYH 4U1MA 2RFXB 4KI5E 4YC2B 4JHAL 4U4BA 3WKML 2FEEL 3QDGD 1U2CA 2HRPL 2OJEA 5C6PB 1BD2A 4H8WH 4LSUH 3PWJA 3SN6N 3GEWB 4O58H 3FFCA 3T0XA 3DRQB 2ENSA 2DMCA 2G75B 3WDIA 1MWAB 1A1OB 1YNTA 4CU6A 3DVFA 3MCLL 2GSGB 3BDBA 2P5WA 1XR9A 4Q58C 3I9GH 4PJ8A 5DUPL 3AM8C 3CNKA 1JBJA 1N0XH 1AKJD 1TFHA 2DD8H 1VESA 3N1QC 4HWBA 4R7NB 3VJ6A 5CEXB 3RAJL 1G0DA 2NY5H 2D7PA 4MXVE 5DGRA 2W07A 1NMBH 2EE6A 4P23D 1ZEAH 5HHXH 1R5IB 3N0PB 3MR9A 5E2JA 4EN3A 1RFDH 4LCYA 3TPUB 2CKBL 5F3BB 2F58H 2F5AH 4CDHA 1AIFA 2IJ0C 4Z7NE 5CMAB 2FO4A 4YEFA 3C5JA 5BJTA 5CGYC 3RJQB 1LGVA 5MEQB 4LCIL 2UZIH 4RAUB 4YHIB 3T2OA 2JF1A 3KYAA 5SWZE 4AQOA 2BFVH 4L1HA 3TBYA 2BNQD 4LLQB 1A6VL 2JCCF 3NH7L 3HC0B 3W0WA 1MRDL 2W0LA 3WV0A 3LSOA 5I1HH 1I8KA 3MRQA 3HE7A 4JRXE 4ODXA 5DHYA 1ZA6B 1U8PA 4U49A 3FB8B 5FECB 1KV3A 4L5FL 4NKOB 3MRHA 3RA7L 4TUKH 4UU9A 4XCEB 4R4FL 3U82B 1EHAA 1ETZB 3TGXA 1G7MB 4X5WA 1RUPH 5DMKA 1GZQB 3CFJA 4PRHE 2VMFA 2VAAA 1LP9E 5ISZD 4M7LL 3VXME 1UYWL 2DKUA 4CRPA 2SEBA 4L4TE 2NY2D 4BUHA 5C0BD 1DLHB 1BREA 1BBJB 1HIMH 1FNHA 5E2TL 5HYFA 1MFCH 3JSSA 4Y8AA 1RUML 4NUGL 3CDCA 3GSRA 2OI9C 4OBRA 4JO1H 3O3DA 5L0QB 3RWCB 5EO9B 3FQXA 4WO4D 5TGBA 4L3ED 1YY8A 3GNML 3FT3B 4JB9L 3P9LA 5AUMB 1Q0YL 1QBMH 1CDIA 5EU3B 4OZGB 1R3HA 3ULVE 1A9EB 5J7CC 3MRNB 5HHMD 1MAMH 2EICA 3FQUB 3IU4L 4RDQF 5C2BH 4IS6B 2NZ9D 1NPUA 4QRTB 5EFIB 2VQ1B 1C5CL 2IAMA 4PP1C 4Y5YB 5L2JA 1DBJH 2EDWA 5AZ2L 4RFOL 4PRBA 2AJZB 3V0AC 3BGMA 1QRNB 2IANE 1N59A 2CJUH 4WUUD 3BWAA 1FE8H 1G7QA 4GXVH 1MCJA 1XF5A 5I8CB 1FP5A 1LO3H 4OJFL 4CL7A 2F53D 3CMOH 4I3GA 2D4DA 3T3MF 2NTSP 1A7BA 2YWYA 3EUUA 4PJXB 4FQ1H 2Q7YA 4F7PB 1HXYB 2DMBA 4OF7A 3D85A 4JO2L 5CBEA 4WTZG 3VD3A 1QFOA 3WXVL 1PSKL 1A6TB 4TVPH 5I8EB 5IROC 4OTXL 1F4AA 3PDDA 2ESVE 1CXIA 1AHWC 2HFTA 1UH3A 4LASL 3OKNB 1K85A 4U0QB 5EZIL 3L9RA 4IOIB 1F42A 4D0DA 3SBWC 4PD4J 5L6YL 1PEWA 1S7XA 2GJ6E 5E2VH 4XNYH 4HCRA 4NP4H 2F5BH 2EXWC 5HDQL 1J1PL 3RKPA 4YHNB 3HMWL 3MRMB 1KG0A 3BDYL 3D25A 1A1MA 3BH8A 4G8GE 1CQYA 2WBJA 3RDTC 4FZ8L 4Y16D 3TIEB 2Y5EA 1Z2KA 1P4LA 5F7HA 5IT2H 1E6JL 4LSQH 5HGBA 2Q8BH 1NBVL 3QDGA 4KTDH 1MHCB 3L3JA 1CFTB 1P4IH 5DK2B 2V9TA 4NKQB 1RU9L 2YN5A 1PG7X 2PTTB 3O6KL 4HMEA 4X4XB 3OAUL 3VWKD 5D7SL 3VA2C 1B2WH 3BRDA 3U9PH 5JHDE 4DFHA 3T4AA 3D0VB 4XBEH 3P73B 1TJGL 3TT1L 2ZOLA 3BIAX 3ARED 1BOGA 1X7QB 2XOTA 5L2KB 1AKJA 1D9KA 5T5NF 3M1BB 3T09A 4TNWK 4P59H 4OFYD 4RGOL 4UDUA 3DTXA 1JHTB 5T3ZH 3MFFB 3QXAA 4P99A 4P23A 1UM6L 3CZJA 3L95B 4KROB 1KSRA 1YMME 1FL3A 3IDGB 3HE6B 1PQZB 3GMPA 4W6YB 2ICCA 5L88L 2EO1A 1F8TH 4PJIE 4ELKB 2VLJD 5F9AC 2PYFA 4IIQC 3EW3B 3L5IA 4BSVA 3FO0H 5JOPE 1U8QA 3TBTA 4OI8A 3IFOB 2KKQA 3DVIA 3RNQB 1YEKL 4GMSL 4F9LA 3BT2H 1D5MA 2BNQA 5CP7B 3K1DA 4A6YL 1N8ZB 1S7RB 2EDJA 4YDJA 4DOHE 4LHJB 3KLHD 1PD6A 1RJLA 3UPCA 3DMMD 1FAKT 1U41A 2DM7A 4FABL 1BQHG 3D69A 3DSNA 5F1NA 2VLLB 5INCA 1YEGL 4PRHA 5C07D 1CFSA 1LDSA 3QNYB 1CGUA 2I9TA 1RZ8B 2DJUA 5E99L 4Z0BH 3O2WL 4YK4C 4R3SB 2AKRB 4XC3L 5TE6L 5JQ6L 5I74C 4KY1H 2BC4A 1DQJA 5ISZA 2ED9A 3BHBB 6CGTA 4M9OA 4YDLC 4ONHB 1CICA 1AGDA 3IS1X 4MAYD 35C8L 2UZYB 3BKYL 4N5EC 4WEUD 2HKHH 1PW3A 4YHMH 2ADFL 2EIEA 1I9IL 1A3QA 3X3GH 5DFVC 5FUCC 3MSPA 1B6DA 1OLZA 4XP4H 3AY4C 2NXZD 2OR7A 4L3EA 2R2BB 1UCBH 2AJYL 3MLYH 3EDEA 4ESKA 4OZFA 2AJ3A 2AEQH 4MDJA 1NCWH 4UBDD 4HD9A 4H8WL 3B6SA 4LSUL 4O58L 4WWKD 4N5UA 4X6FB 4G9FD 2YZ1A 4Y4FB 3R06B 3OAZK 1DCLA 1QUNA 3BEVB 2RBLA 4WUUA 1BX2A 4A2MA 1KNOB 4PJ5D 4U1MB 1N0XL 2DD8L 2DM4A 3Q3GA 2OJEB 4N0CC 2NY5L 4N1HB 5F8QC 3VWJD 1BD2B 1BIHA 3QULA 1XZ0A 3PWJB 1I7UA 1NMBL 2C3GA 1ZEAL 3FFCB 2F8XC 1YNTB 1RFDL 3ZKXB 2ESVA 4MWFA 2F5AL 1MFAL 1IGMH 5JLZA 3H9SD 3S37X 2P5WB 3FB7A 1XR9B 4PJ8B 3SO5A 2UZIL 3QEUA 2GJ6A 3VJ6B 1P1ZA 3ARUA 1LO2H 2BFVL 4L9DA 2XQYK 4BH7A 3WFHA 4JM4H 3PJSA 3MR9B 1BBDH 4RFEA 4WY7H 4M5ZH 1NEZG 3C5ZD 4EN3B 4LCYB 1B0WA 4I77H 3R8BB 3CPLA 3MGOA 5IG7A 3CSPA 1AIFB 1N4XH 1VPOH 3EJYD 3LZFH 4OD3H 2FO4B 3C5JB 1U42A 5BJTB 5BXFA 3UAJD 3O6LH 2YPVH 4TUKL 4JZJC 5KAQF 4JO3H 1RUPL 4Y16A 4R26H 4GG6F 3HNTH 4DGYH 4XWOC 4EZMA 5HHOE 4HJ0D 4F15B 4KC3B 3TBYB 4UT9H 1XF2A 2LTQB 5D71H 4U1JA 2DQJH 3BKCH 3W0WB 4HIIA 5E1HB 3LSOB 1HIML 1I8KB 3MRQB 4MZ3A 3HE7B 5DHYB 4ODXB 5E0QA 5EA0H 1U8PB 1MFCL 4P4KC 5KANG 3L3HA 3VWKA 3MRHB 2EYSA 3K4DA 4JO1L 1GZPA 4HC1A 4UU9B 4Q74A 4Y4HA 4X5WB 3VFVA 1IILE 2EYRA 3D39E 5DMKB 3UYOD 3CFJB 1QBML 1OAQH 2VAAB 1MAML 4JG1H 1P6FA 5C2BL 1IC5H 5I0ZA 1YMMA 2SEBB 3CDGA 5SV3A 3HHRB 4P9HH 5D1QC 1T5WA 4ODSH 1DBJL 3JTTA 3RKDD 3GSRB 3O3DB 4JHBA 5DJCA 2CJUL 3FQXB 5TGBB 2ITCA 5KZCB 1YY8B 2C4FT 1G7IA 1FE8L 5DF0A 3P9LB 4GXVL 5D96B 1R3HB 1CXLA 1O7VA 5SX4H 3WO3B 1ZANH 1YY9D 1LO3L 3VFUB 3CMOL 3LIZH 4H25A 3ROOA 1ZHNA 2IAMB 4ETQA 3GSXA 5IFHH 4FQ1L 5L2JB 5KANI 4PRBB 1CGXA 3BGMB 3K8MA 1N59B 2ZUYA 3BWAB 4TVPL 1G7QB 4JLRA 2D7MA 1XF5B 3JXAA 5B22A 5C07A 3RWFA 1Q9LA 3A6CH 1RZKC 2DI9A 1MJUH 1L7IH 2IALA 1H8OA 4L8SC 3L5HA 4KRPC 5E2VL 2Q7YB 4XNYL 2E5EA 1NGZA 3RWIA 4NP4L 3D85B 5CBEB 3B83A 2F5BL 5GQBA 1J5OH 3MGTA 4E42A 4U6XA 3BZDA 3QIUD 4ZXBC 1P7KA 1QEWA 1I8IA 1M05A 2JJWA 3O9WC 3BIKA 3MLUH 1RULL 3L9RB 3HLAA 5IT2L 4LSQL 4D0DB 2Q8BL 1S7XB 3HB3C 4KTDL 3AMLA 1P4IL 1IE5A 5GGSA 4RGND 4OFPA 1KG0B 5BS0D 3D25B 1A1MB 4WUKH 5F6HJ 2XFXA 1B2WL 1N2RA 3NCYP 3VRLE 3U9PL 2VL5A 2WBJB 1QZ1A 4XBEL 3GM8A 2X1PA 1P4LB 4PJ5A 5IIEA 5HGBB 3B8YA 3N1MC 3QDGB 1CL7I 1FVDA 2DQCH 3L3JB 3IU3A 4NZTH 4UI2A 4P59L 3VWJA 3IJYA 5T3ZL 5DDHA 3CDFA 5I9QC 1WTLA 3C6LD 4FFVC 5GRVL 3ZDYF 3QQ3A 3T4AB 3ZT7A 4DAGH 4G43A 4XBGA 3HRPA 2ZOLB 3CZFA 1F8TL 1RZKH 3Q1SH 1BOGB 1AP2A 2APWA 1AKJB 4KKLC 1D9KB 4ZS6D 4GRLD 3PDGA 3FO0L 4UDUB 3DTXB 3OB8A 3KJ6H 1CI5A 4JCMA 3QXAB 4P23B 4WFFD 2CIKA 2XNAA 5K9OA 3BT2L 2J88H 4JKKA 2YPLE 3UZEA 1FL3B 3C5ZA 1AGCA 1Y6NR 4KHTH 4K8RD 1JVKA 5ICXA 1BAFH 5I1JH 3ZYOA 1JZ6A 4QOKD 4X7DC 3GMPB 2AS5M 1YEHH 3VGEA 2X9WA 4FN0A 4JQVC 3G08A 4K71B 2PYFB 5A16A 3HAEA 4Z0BL 4BSVB 1U8QB 1G6VK 3TBTB 4X5XA 4M62H 1HHGA 4KY1L 4DGIH 1NUDA 2ZUQB 3MRDA 1D5MB 3PHSA 2BNQB 1CK0L 4NUJA 4YDJB 5C0EA 4NFBA 3SGDH 1RJLB 4YHZH 2HKHL 4YHML 4ODBD 2VLMD 4L3CA 3P0VH 3D69B 5IP4A 3X3GL 5F1NB 5INCB 4PRHB 2BSED 5TDNA 1CFSB 3UTOA 2I9TB 3VD5A 1VFUA 2JJVA 3BKMH 5HYSG 1P84K 1UFUA 2IC2A 1UCBL 3MLYL 5ETUA 4WCYH 5F97E 4FFYH 4QRUA 2AEQL 5MERA 1A8JH 1DQJB 2BC4B 5ISZB 3FO2A 1NCWL 3QWRD 1CICB 1AGDB 5ACZA 3RUGF 5SWQA 3KS0H 2R9HC 1MPAH 4EI5C 4Z7OF 1ORSA 1M7IA 4YDVA 1UADC 4NKDA 5A43C 4L3EB 3GSQA 2AJXH 2WWKO 3P11H 2FHCA 1MCFA 1FNAA 3W2DH 3KYNA 2W38A 4I0PA 4OZFB 2AJ3B 3BQUC 4MDJB 5HHMB 4XPFH 3NACH 3B6SB 1R5VA 1HHHA 2X89D 4X0KA 1N5AA 2XKSA 4JN1H 2ICWJ 3H3PH 4JQXA 1IGML 3GHEH 4GQPH 1DQMH 3P4OA 1BZ7A 4WUUB 1BX2B 3TA3D 1KCVH 2EDBA 4HXBH 1NBQA 3Q3GB 4IDJH 5EZJA 3H9YA 4JFQA 1LO2L 3QULB 1XZ0B 1I8LA 1JF5A 1I7UB 5ANMA 5BRZE 1P53A 1ZXQA 1W8OA 3SQOH 1BBDL 1Z0MA 3QO1A 3QDJE 4M5ZL 4WY7L 1T2XA 3RIAF 4I1NB 4S10A 3VGHA 1RMFH 5EUOE 2ESVB 4GLRI 4MWFB 4I77L 5GZOD 1N4XL 4EOWH 1VPOL 2E27H 3LZFL 4OD3L 1QG3A 3D0LA 4GRWE 5JLZB 5CLTA 4LDOB 1KEGH 1ES0A 3FB7B 3OKKA 3P0GB 4KJPD 3TFKD 3GJFA 3O6LL 4FQPA 2YPVL 3MACH 3QEUB 2D0FA 1EAPA 2J6EA 1KCSL 3QIUA 1I8MA 2GJ6B 5HHQB 1P1ZB 5KSAA 4N68A 3RGHA 1T6VN 3DRTA 4JO3L 4JPKH 4R26L 2A83A 4BH7B 3WFHB 3MXVH 3HNTL 4DGYL 1QFWI 3PJSB 1RK0A 4GBXD 4RFEB 4X6DF 5B38G 1JGLL 4MD0A 5DD3H 2AV1A 5D71L 5D7JA 1IAOA 5IG7B 3CPLB 3MGOB 3BH9A 2DQJL 3BKCL 2X1OA 1PZUB 4QRRD 4ZFFA 4C57C 3TVMD 5EA0L 4HSQA 5DVMA 4OF5A 1F13A 5BS0A 5BXFB 1BEYH 2X4OA 4FG6D 2ZCHH 5DJAA 2C1PB 3GIVA 4EVNA 1BJ1H 1KGCE 3CGTA 3MREA 4Y16B 4OLWH 2VUOA 1EIBA 1ZA3A 1OAQL 2YUWA 4OIAA 5F7NC 5C9JA 4JG1L 1IC5L 3V4PH 1QFUH 1XF2B 5FO7A 2YUXA 4U1JB 5SX5H 4HIIB 3O4LE 4P9HL 2HTKC 5CILH 4ODSL 3PWPD 3DX9A 1OTTC 5T1MA 1BWMA 3L3HB 3VWKB 2EYSB 3C6LA 1GZPB 4M7LT 3MBEC 1CFNA 3OF6D 1OD7A 1GGBH 4Y4HB 3VFVB 1NC2D 2EYRB 4OD2A 5JIIA 1XGPA 4JFEE 1MVFA 2WV3A 5DD1H 3TH4T 3U7AA 2BY2A 1ZANL 1K6QH 1YMMB 3CDGB 1J0KA 1JP5A 2FH6A 2OBGA 2DYPD 3LIZL 4KJYA 5KVDH 1HILA 3U4AA 1TQBC 3FRPG 1T5WB 5IFHL 3JTTB 2VC2H 5FYJU 3R0NA 1ROWA 1OWRM 4NQCE 2HRLA 5DJCB 4R6UA 1UKQA 2ITCB 4K3JH 2CRMA 1G7IB 1P5VA 2XN9E 4I2XE 4QOKA 4NQDD 4NRYA 3LKNA 3MNWA 5F72S 3IDXL 1OL0A 3A6CL 4HW6A 1MJUL 4DOHB 3MUHL 2NR6C 1L7IL 2FCBA 2XZCH 5KOVC 3E6HA 4R97B 4H25B 3ROOB 1YA5A 1ZHNB 4AIOA 5AG9A 3AS2A 4ETQB 5CEZD 3GSXB 3I3EA 4MJID 2P5EE 5LJYH 5ABDE 1WZ1H 3TCXA 2A9NH 2XTLA 1KXQE 1J5OL 4DGVH 4JLRB 1PY4A 5SWSE 3SJVD 5C07B 3RUGA 3PGFH 3RWFB 1Q9LB 4K2UH 3D87B 1DE4A 3DVNA 2EE9A 2IALB 2OP4H 3MLZH 3MLUL 1EGJH 1R3LA 5GPRA 2W9LA 3NFSH 1ITCA 3QP3A 3KPRE 1NGZB 3QWRA 4LPTA 3S3SA 3RWIB 3V9FA 2L4OA 4E41E 3MRIA 5I1GH 5EOCH 4Y4KC 3UJIH 3MGTB 4E42B 4I48A 4U6XB 1XMWA 1P7KB 1QEWB 1I8IB 1M05B 1TZGH 4Y5VA 4P3WA 5EO1A 1MCEA 5GJTH 3CAFA 3BIKB 4MSWA 2NXZB 5D2LE 3HLAB 3U6RA 3CK0H 5IFAH 3G5ZA 4WI4A 1NC4A 3OHXA 3ES6A 2DQCL 4NZTL 2XWJA 1XEDA 2X40A 2APXA 4UQ3A 5GGSB 2X89A 2BVUA 4B41A 1LE9A 3QQ4A 2UYLA 5E4EC 5D2NC 4JQIH 1YEDA 4HLJA 2XFXB 2FLBT 3GK8H 2VL5B 4X7CC 5D7LE 4DAGL 3ZKQD 4PJ5B 5MHSD 5DRZA 5IIEB 5D6DA