1JHLH

Three-dimensional structure of a heteroclitic antigen-antibody cross-reaction complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
QVQLQQSGAELVRPGASVKLSCKASGYTFISYWINWVKQRPGQGLEWIGNIYPSDSYTNYNQKFKDKATLTVDKSSSTAYMQLSSPTSEDSAVYYCTRDDNYGAMDYWGQGTTVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex(antibody-antigen)
molecule keywords IGG1-KAPPA D11.15 FV (LIGHT CHAIN)
publication title Three-dimensional structure of a heteroclitic antigen-antibody cross-reaction complex.
pubmed doi rcsb
source organism Mus musculus
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 1993-05-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jhlH00
5JA8B 2HJLA 4OTXL 4IRJC 4K71B 4PJ5A 3H9HB 1KEGL 2R0LH 4PJ9D 1JPGA 4P9MH 1FFPB 2Y07L 3CFCH 1F00I 3LVEA 3RL2A 5I1LA 3EYOA 3L3OB 1S78C 2BOBB 4G6AC 1HNFA 2DLFH 2FB4H 4WV1C 1UENA 1F8TH 3U30C 3P9MA 1NCDH 1NEUA 1IMHC 3FB6B 1AJ7H 3ARDC 4HKXA 4OLVH 4N0UA 2H9GB 2HJFA 2J8UA 4XNXH 3GKWH 5CCKH 3O8XB 3U9PH 4AIZA 4CAGA 5HYJB 2XTLA 3T4YB 5JDSB 5KVDL 1J10A 4JZJB 1U42A 4X7FC 5E2VH 1S5HA 2LU7A 3VCLA 3VXNA 2DRUA 1FFNB 1YC7A 1T1ZB 1XGYL 4J8RA 4Y4KA 1I7RA 4KROC 4PB0L 5CEYA 2YSSB 3LRSB 2WZPD 1M7IA 1S7SA 4RMVA 5HI4D 3QJFA 1U8LA 3GBML 4MNQA 1YEEH 5C0AB 3P9LA 4YPJA 2GJ6D 4WRLA 1I4FA 2AK4B 1J1XH 4F3FB 3CXHK 5FA3A 1JGLL 3SE9L 4PJ8D 2BVEA 2OZ4L 5BVPL 2EIDA 2PTUA 2PO6B 4N9OB 3CXHJ 4XI5D 2HH0H 4Z8FH 4NT6B 4FQCL 2VN7A 4K9EC 2FHBA 3OMZA 4XVSL 3O6LL 3U0PB 4K7PY 2PF6A 4JREB 1Q1JL 4WU5B 1N5YH 3GSVB 5EU5B 4X7TA 4FABL 4PJAF 1X44A 3SPVA 1JHKL 1BX2A 2CXGA 4WW2C 4LASL 2OK0H 1ZT7B 1YY9C 5BV7C 3O9WB 3RGHA 1EVTC 4UUJB 4RWHA 3EO9H 3N85L 1MLCA 4DKAA 1I3VA 1UCBH 2B0SH 5FO7A 5AWNL 1P9MA 5KSBF 2GK0B 4N5ED 2JLLA 3D0LB 5GRVL 3SDAD 4JFQA 3IGAB 4N8CH 3S34L 3KPSD 5F89A 3L1OH 5TJWK 5IQ9A 5LXGL 1N0LA 4HIEA 3VFNB 5I8OL 1WZKA 1AO7E 4F15C 3BP5A 1K3IA 5TE6H 4YHYB 3CLFL 3RL2B 5I1LB 1RUAL 3H9SE 3BD3A 1KIRA 4ZTOH 3E3QC 3P9MB 4JFDD 2WP3T 4MA8H 4NQDB 4J3OC 4N0UB 4EVNA 2J8UB 3GSOA 3IAPA 1FCGA 4O58H 4AIZB 3QHFH 1XZ0A 5GRUH 3SOBL 1MF2H 4QRQA 1NFIB 3T1WA 4G7VL 4EDWL 4R2GD 5IEKA 3BP7A 1ZHNA 2ZUXA 4Y4KB 3RZWA 5C0EA 3EAKA 1QEWB 4YDIL 3GHEL 4L4TB 4ONGH 2WUBL 1CD0A 2YD3A 1U8IB 5GGTL 5LJYH 3C87A 2W9DH 1M7IB 1S7SB 3DMMA 3L5HA 4OFKA 3FFDA 2DQCL 3QJFB 2A1WL 1J0JA 4MNQB 2W0LA 3RUGE 4DVBB 1BPVA 4FTVA 5B38G 5LCVL 3F5WA 1DVFB 1I4FB 1MFCL 3FTGA 3U7WL 1GGCH 5K9OA 1YEGL 4Z7UE 1QFOA 5I73B 3IFLL 3CZFA 1XF3A 4H20H 3NAAL 1C12B 5ACZA 2CMRL 4W81A 1UGNA 2HYMA 3VWKA 2BVOA 3UTPD 5I1GL 3KGRA 2P5ED 1XF1A 5DRZA 5BV7H 3VI3F 1G7QA 1LWRA 3IJSA 3W0WA 5JXED 2EXWD 1IGYB 4XXDA 2ICEB 1IGJB 3OKLA 4L1DA 3SPVB 2IF7A 1FNAA 5FV2A 2P5WD 1RZJL 1CGSL 4JG0H 4FZEL 1G1CA 1TVHA 4MAYC 1MHEB 1OB1A 3RX7A 2YMXH 3SJVE 3VFVA 1S7XA 4KKNA 4EOWH 5JW4N 2UZYB 4HD9A 4M5YH 1EMTH 5C07B 3S37L 5FHAL 5ID0B 1HHKA 5DGRA 1CU4L 4JPIA 4LSDA 3NGBB 5E00A 2V2TA 4LNVA 3B4NA 3RGVC 4JFXA 1HZHL 2NQCA 1T80A 4JFQB 4LPUA 1MWAH 5F8RC 4LLQA 4LK4A 5DJXA 2H26A 2I9TA 1KFAH 5F89B 1VPOL 3ESVF 3D0VA 5IQ9B 5DT1H 5C8JB 4H8WH 1KIUA 2ILLA 3IFNH 2XPGB 4I0KA 2QTEA 3NFSL 4B41A 5KVEH 3C6SA 3ARFA 5SV4A 2IBZY 2EIZA 3U48A 2AEWA 4KMTH 5DA0B 4HIHA 4XZUB 4NWUH 4EVNB 2OL3H 1INEH 3VGAB 2CRZA 1XZ0B 1LO5A 2LVEA 4N1EA 4QRQB 3BP7B 1ZHNB 4RMSA 1JNNH 5I1HH 3SGDI 5C0EB 1UA6H 5FOJA 1PQZA 5SX4H 3BWAB 2XZQL 3AGVA 5SWSE 5C1MB 3FFDB 5AEAA 4CKVX 3SDDA 4XNZB 2EH8L 1DANU 3MLTB 4K94L 2O5XL 4FTVB 1V3KA 4WI2A 1H9VA 3F5WB 2G9HA 4BQCA 5FF6B 3FTGB 4MDJA 1T1YA 5FYLL 5K9OB 1FZJA 2BX5A 2AKRA 2EDXA 1XF3B 4M1GL 5ACZB 2Z93A 4WFEE 2WUCH 2YBRB 4KRNA 3QXVA 3RWJA 1IKFH 4WI6A 5DD1L 1QNZL 2DQJL 4J6RH 3LHPH 3T77A 1WWCA 3UTSB 1INDL 3P4NA 2RR3A 1LGVA 3IJSB 2Y5TA 2XWBB 2GCYA 3BH8A 4XXDB 1FAIL 1X5FA 4JN1L 5F7KC 3T0EA 2GSIA 1WSST 4XNUL 4NGHH 4OIIL 1HIMH 2PTTA 3V6ZA 5FYJH 1FYTA 5I15L 1QD0A 1TVHB 1OB1B 3O6ML 1YJDC 4IOIA 4ZD3L 1ZGLB 4X9IA 5I1IH 3AS0A 3VFVB 4ZUUB 4BZYA 1S7XB 3U36B 1KSRA 4C57C 2VL5A 1HHKB 3S96A 5EWIL 1KTKE 2OYPA 3OJDA 5E00B 2V2TB 4L3EA 3KHOA 3HPJA 4OI8A 1G7LA 3HPLB 3L6FA 1T5XB 3WL9A 5DJXB 3MSPA 4NRXA 4ONOA 1I1RA 4YXKH 5KZCD 4X4ZA 2VSDA 4AJ0A 2H2PD 3OF6D 2X70B 4B5EA 3LN9A 1RK1A 3LRHA 4PFEA 3C6SB 4GAFB 3VI4E 1E27B 1MRCH 2Y6SC 4G8GA 2E7BA 3S35L 4HS3A 4JKPL 1YQVL 4QHNB 4HIHB 2NY6C 4HFWA 4KAQH 1ZLUK 1H3XA 4XC3L 1LO5B 3U2SB 5IB2A 2EYSB 5JPNA 4JHZA 3DIFA 4E41D 1CBVL 1CG9B 4HBCL 4TVPD 5EN2A 4U6XA 1SYVA 3QCVL 1DE4A 3H3KA 4MA3A 3D39E 3WIIL 3OKOA 4JHWH 1JYNA 3QUXD 1FL6A 1JRHL 4R7DB 2VIRB 1JPTH 2G9HB 1K4DA 4FFWD 5KSAA 4MDJB 4JQXA 5C71A 5E7FA 1FZJB 2F15A 3UAJD 3RZCD 1EFQA 3BVNA 5GGUA 3KPNB 4ZNEE 2DWDA 3LDBB 2BDNL 2H1PL 3L3HB 5F88A 4PRPA 3RWJB 2XN9E 1JHLL 4FFVD 5ISZE 3C2AL 3P4NB 4ODXA 3SGJC 5HHOD 2Y5TB 3BH8B 4DFHA 3DYOA 2D7MA 3ARBA 4M7LT 5TH2A 4JFPA 3F58L 4JGJA 3RY6A 2PTTB 1FYTB 1W72L 1UQSB 4Y5XA 3QUMA 5IMLB 1G0XA 4I2XE 3BPNB 4IOIB 3O0RL 2H45A 4U6TA 3EO1A 4KU1A 3KYMB 4AH2B 4HJJL 3UBXI 3AY4C 3FL7A 1S78D 5E5RB 2MTPA 2HKFL 1WUNT 2NPLX 3S96B 1TTUA 3FB8A 4O2CB 4L3EB 3KJ4C 3ARDD 3HPJB 4X4ME 4QY8B 4Z0XA 4WWKA 4NRXB 1HI6A 4FQ2H 5HDBF 4PD4K 1TZGH 3PHSA 4HXAL 3S4SA 2FX8H 4Y8AA 1T7WA 1CK0H 5DTFA 5FCUL 4PD4J 1J5OH 4KROD 4XPBL 4J3VA 4EI5A 4G8GB 5JQ6L 1C1EL 5D71L 4F57L 3KPTA 3QPQC 2ADIA 3CMGA 3QEUA 2V2XB 3S9DB 1LK3L 5L0QB 4I3SH 4K3GA 3R1GH 5E2WL 1LO4H 1FNEA 5HY9A 1NLDL 1NANH 1UH4A 4D0DA 5EU6A 1T7XA 2MNUA 4G9DA 3BISA 3W9DA 5IB2B 3HAEH 1ONQA 3DXAD 2V5MA 4I3RH 1FE8H 3X14A 4GRLB 4QHKI 5BMFH 5EN2B 1QBMH 1QVOA 5D6DA 1SYVB 1X6NA 1N64L 1EAPA 1U36A 2Z4QA 4MA3B 1LK2A 2NY0B 3SKOB 5JUEH 1IT9H 3OKOB 3HG1E 1NGWA 4U0QB 4XHQA 1UEMA 1K4DB 4EI6B 5KSAB 1YY9D 2L7JA 3VFTB 2BNRE 1M7DA 3IFPA 3EYQC 2I26N 4PRNB 2HT2C 5F88B 1UKQA 3N50A 3D87B 1GIGH 5IM7B 2P46B 3RBGA 3B6SB 1YNKH 3LIZL 4ZUWA 3FO2A 3QCTL 1RVFH 3QCUL 3S36X 3ARBB 3GUTA 4JFPB 5IMKA 1AY1H 1PG7L 1DDHB 3K74B 2VLRD 1MI5A 3BZFA 1AIFB 2Z91A 4Y5XB 3QUMB 4MNGE 5FYKH 4HWZA 5CLWA 4JJHA 3W2DH 1OAQH 3KLAB 3D85A 4TUOA 3IKCA 5I1AA 3GMQB 3FO0H 3N1GC 4G6JL 4HAGA 2PKDA 4QLRA 3K8LA 3IFOA 2Q3ZA 1DQDL 2JCCF 3BN3B 1NGZB 4MD4A 1JPST 1U8MA 3O4OC 4Z0XB 4WWKB 1A1MB 4YBLC 3SE8L 1G6RH 1HI6B 2CKNA 4GKNA 1F3JB 2OTUA 5DJAA 2AV1A 1HILA 4KKCC 5J9PA 1IEBB 4QHKJ 2JTDA 5E7BA 3HLAB 3IDGA 4NQED 4QT5A 5F44A 1KJ2L 1A6VL 4M7JL 4EI5B 2F5BL 1I1AC 3OZ9H 2B2XL 5J0BA 1EJOH 3QEUB 3BX7C 4JB9L 1U58A 4PJEA 3FQTA 4ZXBC 4QNPF 1A0QH 3WDIA 5F6HI 3DNKA 2W0KA 1FNEB 5HY9B 5EU6B 3BEVB 2X4SB 3W9DB 1JTTA 4RA3A 1FORL 1ONQB 1LNUA 1YEHL 2R39A 1A7BA 2HG5A 5CUSL 5D93C 3I3EA 4O5LL 1FZMA 2FECL 1LEIA 5FKAA 3F7PC 4ZTPH 5C0NC 2EZ0D 1GPOH 3ET9F 4YUEH 5E0QA 1NGWB 4BJLA 4ZAKA 5MEOA 5ANME 3SO3B 1J0HA 3RKPA 1JHTA 5ITBL 2RGSA 4I18C 3ZE1F 4R4FL 1U3HC 5ACMA 3QNYA 4MAYD 5GHWH 1MNUL 2D2OA 3PP3H 1RFDL 1M7DB 4YDVB 3HC0A 3WHE1 5JXAL 1YEJL 1AKJA 1QSFB 4HXBL 1YEIL 4ZS6C 1V8HA 3U0WL 5SWQB 3RGVD 3FO2B 1DBAL 5FO9B 5D2NE 3OAUH 2FX9H 3AAZA 4X9BA 3GUTB 3C6LC 2VDNH 3QEQD 4OLUH 3HC4H 1MI5B 25C8H 3BZFB 2Z91B 1YEKH 3ECBA 5IFJA 4KVCH 5CIPA 5DQJB 4QEGA 1OWRM 1CR9L 3D85B 3IKCB 2OJZL 1JGDA 5I1AB 2N1KA 5IV2A 1EFXB 1CDGA 2OSLB 3BN9C 1Y6MR 1KLUB 4JO4H 1CL7L 2E3VA 1JTOA 2YD7A 1R24A 1QKZH 4GKNB 3W39A 1Q0YH 2B1HL 2OTUB 1HILB 1XR9A 2X89A 4U7SA 3GZKA 3QDJD 3IDGB 4RMUA 5FM8A 2XXCB 2XTJB 1JWUA 4YDKL 3OKDB 2YD1A 3FQNA 5INDA 2NY2C 3K80A 3ZKXB 4XBEH 1KCVH 3J7HA 1U58B 3KJ6H 4PJEB 2BOCA 3FQTB 4UDUA 2V2WB 2FWOB 4OCSL 1BVKB 2GJ6E 4LSSH 4ENEC 1JF5A 3HR6A 4YO0A 4Y2DC 5C08A 4LLWB 3IDXH 1QR1B 1LNUB 3VD9A 3X17A 5IHUL 4PJ7E 4NBZB 4PJGE 3ZE0F 4HUVA 4M62L 1NAMA 4OM0L 5TPWL 2HG5B 4L8SB 5C6WH 4X7CC 3HNSL 4C54A 3P4MA 5FKAB 3V7AE 4MA7H 4JM2F 3CDCA 3MPCA 4FHBD 1X7QA 4DUXA 3CFKA 1JHTB 4K2UL 4ZO9A 3QNYB 5F8QC 3D3VD 3MCG1 3U4EA 4OBRA 2VQ1A 4JFYB 4FQJH 3TCXA 4NKOA 2H6PB 1DBKH 2FX7H 4UQ3B 3L3DB 3VFOA 3CK0L 1T1WA 2XZZA 3I9GL 1Q72H 4FQIH 3VXRD 4XMPH 4QNPE 1PW3A 3O6KH 3P4LA 4YXLL 5FUCE 3Q5TA 4JKKA 3BKML 1FG2A 4LCIH 2LTQC 3U7YL 4JFED 1KYOK 3UJJH 4AL8L 4R3SB 2W59A 3ECBB 2VWEC 1LD9A 3KPSE 3PV7A 2BZDA 4OF5A 5CIPB 1KYOJ 3TZVD 4P2OA 5DJ6A 2Y6SD 2A0LC 4WTZA 3MV8B 3S3SA 4IRSB 2VQUA 1JGDB 4GSDH 3ULUF 1NC2D 1MQ8A 1S7WB 3T3PF 5ETUA 5IV2B 4D0BB 5C0BA 2E7LC 2IH1A 3INUH 1JWMA 5ESAB 4ODVH 2NY6D 4KQ4L 1A3LH 3D25A 3TIEA 4JFDE 1R24B 4LAQH 1MJUL 4LSUH 4PJHB 1JF1B 5JIKA 3W39B 3NA9L 3FQRB 4P5TC 4YIQB 1DR9A 4F7TB 4O4YH 4L9DA 4HK0A 3U4AA 3QHZL 3FT4B 3KR3L 4P3CH 3FQNB 4WY7L 1ZANH 1N3NA 4HZAA 1FO0H 2NY1C 4FXGB 4QRUA 5I1DA 2OJEA 4KK9C 1P5VA 4L8CA 4PJXE 1GGYA 5KTEL 1F90H 1IM3A 1H5BA 2YPVL 2CH8A 2YRZA 4YO0B 3UDWC 3ES6A 4FP8H 1AO7A 3BHBB 4XB8A 1W8NA 1XEDA 3BPLB 4HUVB 5KAQF 4M6OH 1RUQL 4UT9H 3O4LD 5J1TC 4NZRL 5J6GB 3T08A 2FRGP 5IW3A 3H9SA 5J3HD 3S88L 1MRDL 4V1DD 3N0PB 1XFPA 1X7QB 1KB5A 3UTPE 5D7LD 1KC5H 2P5EE 4XVJL 4HS8L 3MRCB 2XYCA 3VXUB 3A67H 3EYFA 4YHOL 3MLSL 3U4EB 2P5WE 3AMKA 1D5XA 4NWTH 5I76A 1F4HA 3U6RB 3VFOB 5TFSL 4JZJC 5DUPL 4XPGH 3PP4L 5L88H 4ZFFB 5DRXA 5LGHH 1XR8B 3SE3A 1E4XL 3RUGA 2FB4L 3Q5OA 1RURH 1F8TL 3FT3B 4DZBA 1FG2B 2VZOA 3T2NH 1HN1A 5EZOH 4JPVH 5FDYA 3UP1A 4ODUA 5HVHB 15C8L 4Z7UA 3TBVA 5FAAA 4XT1C 5ICYB 3V6OE 3EDDA 3HMXA 5J06A 4U1LA 2PO6C 2BNUA 1VGKA 3QPQD 4Z7VF 2OZ4A 1F45A 5C0BB 2IH1B 1ZAGA 2R4SL 3T0DA 1JWMB 1DLHA 3HRPA 4ODTH 9CGTA 5EOCJ 4KDTA 4JREC 4LKCA 5E6IB 5TE7H 3D25B 2EYTA 3TIEB 1ZHBA 5D9SB 4BYHA 5AYUH 2D7TL 3VGHA 4PLKC 1NEZB 1JZ3A 1J8HD 4HK0B 3H7BB 3O41B 3SJVA 3R06A 5ERWB 3O9WC 2R8SH 2WM0A 4LAJH 1M4KA 4QRUB 2FJGB 1CFQA 4GMTH 3T65B 2XKNB 3R4DA 4QWWC 4L8CB 3OXSB 2WBJA 3KLDA 5MERA 3S35X 1IM3B 1N7MH 4GAJH 3ZYIA 1H5BB 1VSCA 2MMXA 4DN4H 3ES6B 1AO7B 3EYQD 2J1KA 2HT2D 5ILTH 3H2WA 4ONHA 4Z77B 1T21B 5HSFA 2BHYA 2WMPA 3VGDA 2CIIB 3CU7A 3H9SB 2F58L 3MRFB 5JHLL 4YK4B 3TT1L 3O2WL 4YHYC 2VDOL 2XG5A 1SEBB 5DURB 3RWEA 5E1HB 5CZXC 4DZ8A 1KB5B 4K3DH 1YECH 3G6DH 1OAUL 2PR4H 1A7RL 3BE1H 2F8XC 3HRZA 3TVMA 3HI5L 3EYFB 3R0NA 4S10A 3L1OL 5DVKA 1QRKA 3PXHA 1D5XB 3GSUA 2J6EA 1DLFH 4FG6C 1IKNA 3NFNB 4LLVA 3ARPA 3QFJB 5ESVB 5I66A 6FABH 43C9A 3DVIA 4L4JA 5SWSA 3SKJL 2BY0A 5DRXB 3WLWC 3CDFA 3RUGB 1A7PL 5GGTA 1YEFH 2R56H 2HJKA 1R3JB 1U6AH 4N8VG 4AEHL 4DZBB 3KPRD 2R15A 2F8VA 5DD3L 3ARZA 4KKCD 2ZCHH 1ODAA 5CFHA 2OTWA 5BXFB 2EC9T 4I0PA 1DVFC 1XGUB 4Z7UB 3MGAA 4DJMA 4O58L 1RZKC 3MV7D 2BRQA 5KSUB 1KPRA 5GRUL 5IBUB 1XIWB 5I73C 1DFBH 4U1LB 2MHAA 2BNUB 1VGKB 3THMH 3V6BR 1GGBH 5L2KD 1OT2A 3D69A 5I1CL 2W9DL 4K8RC 4KRPB 4ZXBD 3CVIH 4MJ5B 4TUKL 1ZHBB 1CGYA 5AUMA 4HW6A 5HD8D 2JELH 5J13B 3M8OH 1BAFL 1PKOA 5DD0L 4K9EL 2CUMA 3VGEA 3BZ4B 4RFEA 3TO4A 1LHZA 3MGTA 5I18L 1XGTA 2Y72A 4E41E 1YMME 2CLRA 4AMKL 1MCPH 4XWOC 3KXFB 3QA3A 4TVPE 3QHTC 5EU3A 4AEIH 4LHUG 5ABDE 3H42H 5I8EA 1NFDF 1KF9B 2P24A 1P9MC 3HKFA 4HJGA 1CFQB 2VXVL 3SDYH 3VH8B 3NGBC 5BV7L 1U3HD 5K9KA 5MERB 2AQ3A 4FQLH 3A6BH 4PTUA 4IMKA 3X13B 2CLZA 4LLUA 5IFAH 4NOFA 4ZS6D 4ODHL 4JZOA 1G9NC 3MROB 4KMLB 2AXHA 4WIQA 4PJAB 1I1FA 1UVQB 1MCOH 4M5YL 4EUPA 1IAOA 4WFGD 3RVVD 4D3CL 4PS4H 3I50H 3QDMB 3RWEB 1EO7A 3C6LD 1OTSC 3BWUC 4DOHE 1F3RB 4Q6IB 4MCZA 2J7LA 3TWCH 5HHOE 1MWAL 4Y5YA 1HSAA 4KK8C 3HRZB 3NZ8A 3TVMB 1DZBA 5JQHC 3VFGL 4EQ3A 3KYNA 1RQ5A 2VABA 4JFOA 3MLRL 3GSUB 3E8UL 5GS1C 5KSBB 3VGAC 3DSFL 4FMFA 3PWUA 4LLVB 5I66B 43C9B 4CADA 3BN9D 3HR5A 4XNYL 2EDYA 2X4QB 3D39A 3CFIC 3MRLA 3OTTA 5TGBA 2UY6A 1RZKH 1QPXA 3JUYA 3CSYB 4MXWH 2C5DC 1IC4H 4XNZC 4L29A 5E8EA 5GGRY 3U79A 4M7LL 4CW1B 3LB6D 2AABL 1LO2H 2OTWB 1CDCA 4I0PB 5D6CA 5INCB 4X6EB 1H8NA 3WUZA 4M6MH 4ZNEA 4K8RH 1INEL 3MJGX 3BP4A 5E2TH 5C7XH 2XN9A 2NY2D 5I1HL 5ISZA 3D69B 4HAFA 1INQA 1CE1H 1NGPL 5IB1B 1T2XA 4LPXA 3MRKA 1BJ8A 3VXOA 4OGXH 3WSQH 1UACH 1BQSA 1EHAA 5KJRH 3N1PC 5DHVA 4ENED 5I1KH 4PV8B 4YNYA 5AUMB 1DQJA 2YC1B 3EYVB 2QADD 4Y2DD 1UXSA 3SBWA 3T09A 2A77H 3MACH 4I2XA 1FNFA 3TO4B 1NSNL 1QG3A 1XGTB 5EIIA 2EDEA 3DXAE 4X8XA 5DK0A 1NC4D 4RX4D 4UT7L 5EU3B 5LQBL 1L7IL 5I8EB 2UWEF 4NNPH 1BREA 2P24B 4X4MA 5I75B 2E27L 1D5ZA 3ULSB 1NGYB 3TC9A 4CBPA 3GMRA 5K9KB 1WTGT 1G9NH 2RQ8A 2OI9B 4RZCB 3RVTC 1A6ZB 1KACB 3L3KA 4NGHL 4PTUB 3WFDH 5GGRA 4MJ6A 3MXWH 1B4JL 2CLZB 4LLUB 2ZNXA 1U8OA 5IB3B 4LHUD 4JZOB 5KS9F 2FATL 1I1FB 2IMMA 4EUPB 1IAOB 4F80A 2Q6WA 5D8JH 3CSGA 3VFRA 4DKFH 2Q86B 3MCLL 2R69H 5CJOH 4JVPA 3NZ8B 3DHJA 1I3UA 3LPGA 5EO9B 1BZQK 1QHOA 2JB5L 2VABB 2VLRE 4U0RB 5DQ9A 1BOYA 2V7HA 4YAQB 2J4WL 1A1NA 2A2QT 3ZDYF 1MCSA 3PWUB 5DHYA 5IROA 1A5FL 4YHNA 1NCBL 4JFZL 4WTXA 3MRIB 3QZWA 1FN4A 3D39B 1CLYH 3PHOA 3MRLB 5TGBB 1KN4H 3HG1A 3E3QE 1I8LC 1T1XB 5C0CD 4L29B 3TN0A 3QWRA 4PG9A 3OSKA 3S97C 2EDLA 5FIEA 1BVLA 1DSFH 2G60H 4FMKA 5D6CB 1N26A 2BNRA 5F96H 1NMBH 3MLZH 1FDLL 2EO9A 3MOAH 4KWUA 1IBGL 1F4WL 1WITA 2ARJQ 3BP4B 4Z7WF 2AEQH 1FGVH 5IFHH 3LDBC 3GFUA 3QQ9D 3AM8A 5E9DD 2IFGA 3WE6A 4NUJB 1INQB 1BBDL 2NY1D 3MRKB 4J2XA 1K3ZA 3VXOB 2VR4A 2YUVA 1G84A 3QPXH 2DMKA 4S1DC 3RA7H 5DHVB 5D72H 3IS1X 2D0FA 4YNYB 1FBIL 1DQJB 1MY7A 1U93A 5I2IB 2NNAA 4MNGA 3DPBA 4H25A 1GC1C 2HMIC 5ADOH 1EO8H 3FRUA 4WCYH 1UM6H 1UWXH 5EIIB 4WW1B 1EA9C 4JO3L 5F72S 4KZEH 3TBTA 2BY2A 4CMHC 1QFPA 5J11B 3NACH 5F9JB 2LE9A 4NZJA 3GSWB 1JV5A 5DO2D 3CFDA 4D94A 4ZUSA 3MLYH 1YJDL 2VO5A 2IPUG 4Z7QE 1SBSH 4S1SH 4ISVA 4OI7A 3LQAC 4Y1AB 2P1YA 5EBGA 1WFTA 3VA6A 5GGRB 3V5DA 1G1YA 4MJ6B 3CU1A 3RY4A 3OJVC 1U8OB 2P42B 2BRRH 3LQZB 4LLMB 2PW2A 3A0OA 2IPKB 4FQ1H 1S9XA 4PUBL 3ZYOA 5I71B 2MKLC 4LEXH 2Q6WB 4FS0A 5D1QB 3E2HB 1FNHA 3VD4A 3VFRB 4DVRL 1WIUA 1ZLSL 1CLOH 3VW3H 2AK4D 4IMLB 3O3EA 5KG9A 3CLEL 3QEQE 4UOJA 5L0QC 2DDQH 5DQ9B 1F4XL 2NY5C 2VE6A 3CDYA 2FX8L 4KI5F 2WIMA 2PO6D 1HYSD 2G75B 4YHNB 4GRLC 2Q8BH 1VFBB 2O5YL 2CKBL 4LNRA 3UYOD 5TQ2L 2A9NH 3D48R 3HG1B 5J6HA 5ANMA 3MGOB 1GGIH 2NY0C 2NCMA 1G9EA 1A9EA 4PG9B 3WHXA 1UM4H 4P2RE 2EEAA 5F7DB 4C56B 4PLKD 1BZ9A 3RWCA 3RVWC 1CT8A 3O9WD 2XACC 5EUOF 1MIEL 4G3YH 4AZ8A 4LRNL 3QDJE 1VDGA 1AHWB 3WE6B 4NRYA 3UZQA 1T2JA 5D2NA 4OB5L 4QWWD 4U1SA 5DYOA 2UUDK 3BUTA 1UWGL 5HVWA 3W82A 2IH3B 3F7RA 3OPZL 2DKMA 1NLBH 3ARBC 4P0DA 2MQCA 5HGDA 4DGVH 4DGYL 3ULVC 2X41A 4GAGH 2DLTA 3RY6C 4UINH 1T66C 4LLYB 4Y5XC 3FRUB 1I9IH 4KZDL 3SGEI 4PJ9A 3SQOH 3TBTB 4MQSB 1GIGL 3VFMB 3WEXB 5CZXD 5B8CA 3ZHLA 1YNKL 1UYWH 2ICCA 4MS8C 2B4CH 2Y9RT 1OWWA 3CFDB 1UCTA 4IDJL 1TZIA 4BFIA 4ZUSB 1BOGA 1ZEAH 4NQDD 1F97A 1GGTA 1HWGB 1P4BL 4ISVB 4M7KL 4WWKC 3CUPA 4OCWL 4GFTB 1YNTA 3MR9A 4FG6D 3V5DB 3D3VE 4C59B 3LAFA 1LILA 4AEEA 2V9QA 2QSCH 2NTSP 2GJJA 2PW2B 4JPWH 2XZAH 4L4TD 1KEMH 4HLZH 5IBTL 3WXWH 1FNLA 1EUTA 1NBVH 3C5JB 1KJ2A 2CDEA 4IOFC 3VXRE 5LKNA 5ALBH 1AC0A 3D5OF 1HWHB 8FABA 3NCCB 2GJ6A 1U3JA 3MRNA 1DVFD 3O3EB 2MOVA 4JFEE 1RUPL 4PY8I 3ZKMC 3UTOA 2BP3A 2VE6B 1C16B 3K81A 3MC0A 2OR9H 4PJ8A 4PJ7A 4PJGA 5EULV 2P7TA 4N90D 4HWBL 3ARSA 4UT6L 4NQUA 3O3AA 1J8KA 2EDJA 1I9RL 1R3IH 5EOQL 2DLEA 3CDGB 3WUWB 1A9EB 3W5NA 4J12A 3JBG7 3SO3C 5I8KH 1TQBB 2ZUSA 5EBMA 4XCEA 4U2ZA 5E2UH 3SDXE 2A74A 5T5NF 2R29L 4I9WE 3TPKA 4BFGA 3RNKB 1U3ZA 4XWOD 2X1WL 3V4UH 5C07D 1U8HA 4MLSA 4MMZC 5GPRA 4OIBA 1CGUA 5D2NB 4X4YA 4U1SB 3OB0K 3I6GA 5FGSA 3QUMH 1ZE3C 3LPWA 3OKEA 1WF5A 2GAZB 3SDAA 3LEYL 3GRWL 1MCRA 4U4BA 2X4TB 5HGDB 3D9AL 3P30H 4OZHE 4H0IA 1OAZH 3KPSA 3VGFA 3C08H 4GKZA 5M94B 1JWSB 2LQRA 3LV3B 3NPZB 1A6WH 1MCKA 1JRHI 4OAWA 3MBXL 4LRIC 2K3TA 3TCLB 1YUHA 1TITA 2VMFA 2HRPH 1CLZL 4XP5L 3O4LE 5MI0B 3F7QA 4A6YL 1OTSD 3U82B 1OF2A 4XCNA 1KENL 2F5AL 4V1DE 3H7LA 1TZIB 4KK8D 4JFDA 3QNZA 2DQIH 5D7LE 4PR5A 4X7SL 2R1WB 4S0TD 4JY4A 5IVZB 25C8L 1YNTB 3MR9B 1NBQA 1LO0L 3WMSA 5CJXA 2Y23A 3HI6H 5JOEA 3FFCB 5EIQA 1RIHH 2DL9A 1GHFL 2VXUL 3GNMH 1VGEH 5LGJB 3MLWH 2CDEB 4BZ1H 3ZKXC 3ZSTA 1HOCA 3EOYG 5FKPB 3NVQA 4LSPH 4P3WA 1FSKB 3GI9L 4FTVD 2WWKT 8FABB 1EHLL 2GJZA 2IPTL 1SYSA 2AEPH 4PJXA 3IXTA 5F3BB 4LVHB 1KCUL 4LMQI 1A6PA 3V8CA 1RU9H 4NJ9H 1BJMA 4PY7A 1Q0YL 1MVUA 2WSKA 2X4RA 4PJ7B 3VGGA 1NGXB 1FIGL 1MFNA 2JCCB 3A6CL 1IGML 2PCPA 3HNTH 4JCMA 3O3AB 1SQ2N 2P44B 4Z7NE 1HINL 1H0DA 4L8SC 5FUZH 3UTSD 1NCCH 3G6JF 4G7YL 1KCVL 3C09B 5DD5H 3TO2B 4X5XB 2P5EA 1ED3A 1S7UA 5JXEA 1E4WH 2P5WA 1OLLA 3U9UA 1WVZA 3RX8A 4GG6F 2A74B 2X5PA 2VLLA 2W9EH 1MELA 5CSBA 4WNQB 2VDPH 4P4KD 1J8HE 4NYLB 3MFFA 1TIUA 2XZCH 4NZUL 4CU6A 5E1AA 2DM2A 4AK1A 4ALAH 4KQ3L 2I25N 4PRIB 5E4IA 4X4YB 2O5ZL 5DJ2B 3VXMB 1KULA 5LAXA 3SDAB 5D70L 4LSTL 4BH8A 4URTB 3TLRA 3KPSB 4BQ6A 3L3GA 4HLZG 5GJSH 2VDQH 3HS0A 3Q5YA 1MEXL 3V6OA 4OAWB 5GJTL 1YUHB 4IRSC 1Z5LA 4PIRF 1J05A 1U8PA 4FQIL 1QR4A 1B88A 4XP1L 3QNZB 1K8DA 4NKDB 4K3JL 2JB6A 1UH2A 4PR5B 1DL7L 1I85A 2DTML 3DUHA 5DDHA 3FCTA 3EZ8A 5C0FA 1SVZA 4MLIA 4I48A 1URLA 4WEBH 4C4KT 4DN3H 4OZ4A 1ZOXA 3TYGH 2XKSA 2AQ1A 2EDFA 4X7DC 2C3XA 4MB5A 4JQIH 2IAND 3TGXA 3V0WH 5JHDB 3L5JA 1EV2E 3EJZC 4PRDA 4Y4HA 1YPZF 1HOCB 3C9NA 2AXJA 3FB5A 1VENA 1X5XA 1FV1A 4PJCF 3SE4A 3IXTB 3QG6A 3KPRE 1OM3L 2CO6B 4H5SB 4Q0XH 4PY7B 3B9KC 5KBNC 1MVUB 2X4RB 3AS2A 4TN9A 5GRJH 2XQYG 4WU7A 1QLFB 2D4FA 4NUGH 3MV7E 4N0FA 1QA9A 2PCPB 5I30H 1QLRA 5F1NA 3KYKL 1J11A 5GGVH 4XCFL 5IQ7H 1K5NA 4FXLA 5L2KE 4S1DD 5B38A 4C83A 2QL1A 5FGBC 4U3CA 3BGMA 4LP4A 3MUJA 3VXSD 1FO0L 4TSBL 1X5KA 1ED3B 4X8JB 3STZB 4JO1L 4RBPK 5DFWH 4Q74A 2HMID 3BO8B 2X4UB 1Q9LA 3MUY1 3U9UB 4ODWB 4TNVF 3BW9A 3JV5A 4HS6B 1TDQA 2RBLA 5E99H 4ETQA 4OUUB 1DQTA 4JDVB 3QXAA 3IDNB 4F7CA 3V52H 2DQFA 5LAXB 1AD0A 2N7BA 3TJHD 2DQDH 2VQTA 4MD5A 2O61A 2PW1A 3L7EA 2EDTA 4AT6A 1HDMB 1BIIA 5HGAA 5BJTA 1MVFA 4NQCD 3U4BH 5HVHC 3OF6A 3H0TA 2VAAA 5E94A 4R6UA 4JM2B 3RWIA 1TJHH 1K8IA 2FZ3A 2Q20A 4P57A 4X80L 1CF8L 4RDQF 3BDXA 4FZ8H 5IB4A 4WFGE 5T1LD 3SKMB 5LGHL 1IJ9A 1MREH 2IALA 1BFOA 1RURL 1WWBX 1CZ8H 5E6IC 2OTPA 4OZGE 4JPVL 5DDHB 1EXUA 3FCTB 5C0FB 4LFHD 2VH5L 3K2UH 1OQOA 3LMJL 2OR7A 2V9RA 4GRLD 4E41A 1YMMA 4HJ0C 2E6JA 3UX9B 5CKGA 3V5KA 4MB4A 5F7NC 3EYUH 1J0IA 4IRZH 1SMOA 4Y4HB 5T3ZD 2DD8L 2CDGA 2NY0D 5J12B 1KJVA 1UJTA 3C9NB 3JWOH 5TE7L 5MEQA 1J1OH 3CX2A 3QG6B 1X5GA 3RVWD 4A2LA 1T0PB 2CIKA 1NAMH 4P2QE 5AYUL 1U41A 3LSOB 2X05A 1LE5B 3RZCA 2VDLH 2SEBB 4G6KH 4N0FB 1QA9B 1QLRB 5F1NB 4O9HH 1TQCB 2E6PA 1CFBA 1S7RA 1K5NB 5JIHA 2ORBH 4X6DF 4RAVA 4YK4C 1XCTA 3BGMB 2X44D 5HHOA 4H26A 4GMTL 3ULVD 1MOEA 2BNQB 5DMIL 3HUJE 2EH7L 4JRYE 1T66D 1Q9LB 5KVGH 3OG4B 1UWEL 4GAJL 3RX5A 2E8YA 3WJJC 3PXJA 1RZGA 2DLIA 2ADJA 5DC9B 4XXCC 3S8WA 2X9WA 4ETQB 1IAKA 3QQ4B 3QXAB 4JHBA 4MS8D 4KXZI 4JY5H 1J18A 4BSJA 2DQFB 1J9CT 4NC1C 1JCKA 4MD5B 4WWKD 2O61B 3ARDA 4K3DL 4PB9L 2BJML 3BIAX 3GGWB 4OZIE 3L7EB 5IESH 2PR4L 4QRRB 4AT6B 1BIIB 3MFGB 3RRQA 3G04A 1IC5H 3CPLA 4O00A 4L5FL 2DM3A 4NM8L 4S1RL 2C3GA 4KUCF 3LKOA 1XIWC 4IOFD 2DQGH 3TYFA 3KPQA 3BRGC 2NLJA 3MRJB 1RMFH 1ZSDA 4HFUH 4KRPC 2IALB 4QGYA 1BFOB 4E42B 2DBJA 1F6LL 1U6AL 4KDTC 1G9MH 3B2UC 4CUCA 5EU6D 2IQAA 5J13C 1EXUB 3L3IA 3QEGL 2J12B 3L5XL 4X6CE 1CFVH 4GW4A 12E8L 4JRXD 4Y2OA 3DXAA 1YMMB 3CXDH 1CFTA 3N06B 5BOPA 4Z6AT 4U1NB 2XA8L 4IBLT 3V5KB 4UILL 1R0AH 5T3XD 3MA9H 4J3UA 4BM7A 1GGBL 2CDGB 1QOKA 4JJ5A 4HPOL 1ORQA 3N1MC 5C3LD 5MEQB 4WW2A 5CLTA 3W9EA 5C0CE 4KMQA 1RY7B 2CIKB 4Z7VB 3LKRA 1X4YA 3IDYB 3QNXB 1IC1A 1GZPA 3WLBA 1KEGH 2Z9TA 2QLVB 3RWFA 1QSFD 2Y07H 1R3LA 1WISA 3QQ3A 2OQJA 1KB5H 2CGRL 1KCKA 1Z9OA 4GRWF 4AM0A 5E9DE 3LY6A 4U6HA 4DOHB 4FA8A 4MWFB 1XCTB 2ZOKB 2FSEA 1TENA 4H26B 3RL1A 3SDYL 4M00A 1BF2A 1I9JL 4Q6IC 1A6TA 1TZHB 4M03A 2VLRA 4UV4L 5DMKB 5D7SL 1OARL 1RZGB 5KVDH 1FL3A 5HXMA 3BOVA 3D85D 1XGYH 1IAKB 1IKNC 5DHXB 3C5ZA 1DUYB 2V9TA 5FGRA 1EFXD 3SKUD 1CQKA 2VLKB 3GBMH 3IU3A 3BRFA 4PS4L 3EDFA 3I50L 4WHYH 2GFBA 1U91A 3EUUA 5AAWA 4NO3A 1E6JL 1KJMA 3TWCL 2DMCA 1BVZA 2K9UA 3HMXH 1C5CH 1JGLH 3GIZL 3G04B 3SE9H 3WFHA 3CPLB 4I0PC 2OZ4H 3TBYB 3DSNA 5BVPH 1EO5A 1GCFA 2XWJB 1QPPA 1VEPA 4FQCH 2YUZA 4KROB 4XVSH 2CR3A 3O6LH 1MJ7L 3KPQB 3TYFB 3VFWB 2NLJB 1Q1JH 1ZSDB 4N5UA 3FJTA 4FABH 1RZKL 3QRGL 4QCIB 1JHKH 3EO0A 3B5TA 4ZOAA 2VNCA 2IQAB 2CO7B 1MPAH 3L3IB 4WUUB 4QXTB 1FPTL 4TPRL 2F9BT 5I17A 3K1KC 4KGLA 4GW4B 1ZT4A 1IEHA 4M6ML 4K8RL 1QHPA 1T4KA 3N85H 2VRAA 4F8TA 4XNMB 3TO4C 5E2TL 5C7XL 3S3PA 1J1PL 3G9AB 5AWNH 4XVUC 4KDVA 1HH9B 2VZUA 4JJ5B 4MHHG 2E9WA 3UPRB 3FN9A 3GMMA 3FQUB 3MZTA 3S34H 5I75C 5AG9A 3W9EB 5LXGH 4M1CC 4L3CA 4RGNE 4APQB 2OI9C 2R2HB 3C60B 2A77L 1P6AB 5TDOA 1GZPB 3G9VA 3WLBB 5DC0A 4IMKC 3RWFB 5L6YL 1FRGH 2OQJB 3CLFH 1IC7L 1RUAH 4JZNB 3ZHKA 4WTZG 5LVEA 4ACPA 3C8KB 4OLZL 3RGVA 4U6HB 4BSWA 3QG7L 4NNPL 2FSEB 3RL1B 1L4IA 2NW2A 2J6EH 3QEQA 4GQ9H 4R26L 1G9NL 3O45B 4XMLL 1A7NL 5A16A 3DI3B 3SOBH 1FL3B 4Y16D 4G7VH 4EDWH 3MOBL 2DS4A 2WIIB 2X9XA 1NFDB 4U0RC 3MV8D 4HEME 4IRSD 4HT1H 4YDIH 3GHEH 1NEZG 5HJ3A 5GGTH 2BSED 3C5ZB 2A6IB 3L5IA 4K7PL 5JDJA 2A1WH 5I9QB 2DL2A 1BFSA 1H8OA 2GFBB 2VKWA 4LEOA 1NCWH 5D8JL 5LCVH 2X4PA 4NO3B 4P2RA 1KJMB 3PQYD 1AP2A 1ITCA 2VITA 4YQXH 4OCMC 1MFCH 4DKFL 3NCFB 4NQDE 3U7WH 4KTDL 3KNBA 3WFHB 3D1MC 4ORGA 1YEGH 1FGNL 3DI2B 3IFLH 5D1XD 1BBJA 4I4WA 3NAAH 1H15A 3QDJA 2CMRH 4NHCL 3JWDC 4HKJA 3TP4A 1ZA3B 1J87A 3MNVA 1CIDA 3EJZD 4L4TE 3JUZA 2QKIA 3VXPA 3U0TA 3DTXB 2DWEA 3OHXA 1QQDB 1Z2KA 3MCKA 4D0CB 4I77L 2BVQA 3UCRA 3B9KD 1RZJH 3OKMB 3VD5A 1CGSH 3DRQA 4FZEH 5I17B 3SBWC 5FB8A 1ZT4B 3QUYD 1WQVT 4LPYA 4KGJA 3MOAL 1AQDB 1FGVL 3S37H 5FHAH 5GS2H 1CU4H 3LN4B 4PJBF 5J11C 2P8MA 4XRCA 1HZHH 1ZA6A 1PEZA 5JOFA 4KVNH 2X4NA 4BFBD 1HYRC 1VPOH 3FT2B 3VXUD 5AD0A 3AXLB 1OCWL 1SM3L 4QHLA 2FNBA 3MUHL 4N9GA 1OL0A 3D3VA 5TDOB 3NFSH 4FQPA 5K59F 1OP3H 5L9DL 1AQKL 4CN1A 4X6BA 1Q9WA 2FGWL 3TH4T 1T04A 2FL5B 5IBUG 3LEVL 3WV0A 5C07E 3VXRA 3NACL 2EDHA 4BELD 5I71C 4LARL 2NW2B 3QISA 4B0MM 5D1QC 4KJPC 3E2HC 5I16B 3MRGB 3MRQB 4JFEA 3TPUA 5EOTA 5A16B 1H3WM 1MCQA 2EICA 3PGDA 3ZTJG 4U1HB 3VXTA 5DJ8A 3WNNA 2V17L 4HF5H 1AGFA 2UWEB 5DEFA 3TZVA 5HJ3B 1EJ6A 4CGTA 5IROC 1NC2A 5C0BD 2EH8H 4CRPA 1ZHLA 1SY6L 3TM6A 1BJ1J 2GTWA 1Q38A 4K94H 2O5XH 4LEOB 4MJIE 5E6ID 1BM3L 2CKBA 4P2RB 1AP2B 2VITB 4NKMA 4YBQC 3VRJA 3WFEL 3NN8A 5HHXL 5KS9B 3KNBB 3E6HB 1ZLWH 4ORGB 3SDXA 1VFAA 4HJ0D 4HMCA 4NFBA 4M1GH 1T20A 3QIBD 2E9IA 4WI8A 3T3ME 4NOBA 5BO1L 4G6FD 3LEXA 3MNVB 2A6DA 1I3GL 5DHVH 5DD1H 1OSPH 1QNZH 1C5DB 1HSBA 1AHWC 4YHIA 1INDH 4QTHB 2DQTL 2A9NL 2Z35B 2OS7A 1FAIH 4JN1H 3MCKB 5T33L 4XNUH 4OIIH 5TF0A 5SWZD 2O26U 2EKSB 3T2OA 5I15H 3MLPA 5FO8B 5HBBA 3DRQB 1GSMA 5LGKA 5GIRA 3O6MH 1TFHA 4ZD3H 2Z0BA 5F1KC 7CGTA 2ATKB 1R3KA 5CSZA 3O4LA 3H9SD 4RNRB 5SX5K 3N1QC 2VDRL 4NKQB 5EWIH 4U6VH 5E8NB 3SGJA 1PBYA 5CBEA 2P8MB 4XRCB 5DURD 4V1DA 4X9FA 1GC1L 1CIUA 1ZA6B 3UTSE 1JMXA 1IL1A 1MCDA 2X4NB 4JE4B 5D7LA 4LCYA 4Z7WB 4RAUA 5SX4I 4JKWA 1A47A 1KLGA 1I7TA 3RNQB 43CAB 1S8DA 4GAGL 4EEEA 1MQKL 3MJ9A 3PWVB 4UINL 4QHUB 3GB7A 4JCLA 5F7WC 3RP1A 3LZFL 4X6BB 4U7MA 4ESKA 5M95B 3QFJD 3VRIB 3S35H 1T04B 2QSQA 2BHZA 2PYFA 5BRZB 4JKPH 4OD2B 3VXRB 1YQVH 3LQAL 1IAIL 1PLGH 1SJEA 4N68A 3BXNA 2R1XA 5EA0L 2F54B 2BC4B 1WBXA 1OP5K 4UTBL 1JUFA 1T2QL 2BFVL 4JFEB 3TPUB 4XC3H 5EOTB 5AYQA 4ZO8A 3VXTB 4TOYL 5DJ8B 1HXYA 3P0VL 4F8QA 1AGFB 4NN7C 1CBVH 1XIWD 3TZVB 4JHAL 2Q3AA 4HBCH 2VZVA 3IF1B 1FJ1A 2QSCL 3PDOB 5GS0C 2D4DA 5DS8A 3QCVH 3H9ZA 3KS0H 1CWVA 1MCCA 2LVCA 1NH6A 4KRPD 3FQWB 3OX8A 5C0DA 3WIIH 3B3IA 3MA7A 1NAKL 2CKBB 2NY5L 5F9OL 4NKMB 3VRJB 4UV7L 3DGGA 5B3JF 4EBQL 2V5SA 1FYHB 4EN3B 1S7VA 4HUNB 1BFTA 1TQBC 2BDNH 5A2JH 1TETH 1J8HA 2H1PH 3QUKA 1JNJA 4DQOL 4PPTA 2WINA 5T3ZL 2A6DB 3KXFD 4WI7A 3C2AH 4XVTL 1HSBB 2VXSL 4YHIB 4OFIA 4FFYL 2A73A 3WN5A 4TNWF 2IANE 4IHOA 4ZQKA 3S5LA 2VZTA 4EUPG 5D2NC 3F58H 1W72H 2XOTA 4KJYA 5I8KL 4Z0BH 5GIRB 1BQUA 3GMNA 1MCBA 4EJ1C 4HJJH 5D2LF 1R3KB 5CSZB 3L3JA 3M17A 2HKFH 1X5HA 2FBOJ 3HE6A 1CICA 3QDMD 1NKOA 5CBEB 1BZ7A 5MI0C 3MYJA 3ULVL 2Z92A 2ZJSH 4QRTB 5FUOL 1OY3B 4G5ZL 4A6YA 3VXSE 3OJ2C 3BKCL 4U1MA 1MAML 4RAUB 1XGPB 1S8DB 3KPMB 4ZO6A 1P1ZA 5FCUH 1PYWA 3NMEA 1RD6A 4XPBH 5ESQA 1DEEB 5DUBA 5ICXB 5JQ6H 1C1EH 2YOCA 4F57H 5J1SC 3NIFE 2PYFB 2J8OA 1CXFA 4CNIB 3KJ4B 4IS6B 4LF3A 1XT5A 4YBHA 3OJMB 1SJEB 3BXNB 2R1XB 1KCLA 1LK3H 5E2WH 5GRXG 3SGKA 1NLDH 1FSKC 3DV6B 3KPRA 5C0IB 4LVHC 4XX1E 4PGJA 3EDKA 1HXYB 4NQCE 1OVZA 3MV7A 1RZIA 3PG2A 3IRZA 3HI6L 1FJ1B 2OX5A 4LCUA 4RRPA 4NSKB 1X5IA 3AC0A 1UT9A 3M07A 1N64H 4B7LA 5L2KA 2AJZA 3Q48A 5T5FL 5C0DB 3MX0A 3OX8B 1QO3A 3MA7B 1UZ8A 4ZXBA 3R0MA 3C09C 3ARTA 1D6EA 3V4VL 3DGGB 4G8EA 3DX8A 3F62A 2NY3B 4JVWA 5JMOC 1OT1A 4NJ9L 3DO7A 1J8HB 1PKQE 4NQVB 5T3XL 4RWYL 4OT1L 2AERT 1BEYH 4XVUD 1E28B 3LIZH 1T7VA 3U1SL 3QCTH 2AJXL 5FUZL 2A73B 3PV6A 3WN5B 2UYLA 3QCUH 3S5LB 5T3ZE 1T89A 4KDWA 3DBXB 4M1CD 1PG7H 4I18A 1U3HA 1OLZA 3QDGD 4N0YH 4XPFL 1LO3L 4HSQA 3GMNB 1FVEB 5IJVA 5CKAA 4LSRL 4TNWK 1IM9A 4JGUA 3OKYA 4JANB 2GK2A 4LQFL 3TNMA 5I19H 2YZ1A 3Q3GA 4G6JH 1EERB 4TTGA 1NANI 2XZCL 3HE6B 1CICB 1EEYA 1BZ7B 4FRWA 3MYJB 2Z92B 1OGTB 2AVGA 4N0RA 3QZWG 5HHMD 1BQLH 3SE8H 4A6YB 2DI9A 5DJYB 4OZGA 2ZG2A 3LKNA 2H32H 4TTDC 1FH5L 2P8LB 3NIGE 1KJ2H 1A6VH 4M7JH 5ESQB 5DUBB 2HLFC 1A02N 3MRDA 2B2XH 1S9KC 3QT2A 4LF3B 4JB9H 1KTLA 2H8PA 3U7AA 1NL0L 1FFRA 3BPOB 4P2QA 5C3TA 5D2LE 5HDOA 1FORH 2WNGA 5IWLC 1YEHH 1NKRA 3MV7B 1RZIB 5D5ME 5F71A 4EDXA 4LCUB 4PJIF 4YDLB 1VA9A 3G5XB 4O5LH 5L2KB 2AJZB 1U8NA 2L4OA 4OCXL 3STBA 1UZ8B 3ZKNC 1Q8MA 3MLUL 3H3BC 5BVJA 1KELL 1OAYL 1D6EB 5ITBH 2BERA 4G8EB 3DX8B 1Z9MA 4JRYA 2VISA 4R4FH 4Y2DA 5E5UB 2QQLL 1MNUH 3IDJB 1RFDH 3DO7B 2XG4A 4YHZL 2AAVA 3DROA 2Q76A 1E0OB 3GJEA 2IADA 2DB8A 3BEWA 3V8OA 1RK0B 1Y6KR 4HCRL 1YEJH 3C5SB 2X10A 4JRXE 4H1LA 1YEIH 4YJZL 3DUUA 5D1ZC 3UROR 3U0WH 2FJFA 1B2WL 1NC4A 4F7MA 4RX4A 3PV6B 5A43C 5T3XE 4HZLB 5IIEA 1UXWA 4OZIA 3B8SA 4AQ1B 2KBGA 4Y1AD 3W5MA 5IJVB 1IM9B 1CR9H 4PLJC 3KYOA 2OJZH 3TNMB 3V6OC 1HEZA 2OBGA 1CLCA 4NO5B 2JIXA 4JM2C 4YXHL 1QSFE 3UPAA 1H3PL 3GSNB 4QHMA 5IVXF 5D1QD 5GGSY 4KJPD 1CL7H 3HZKA 4ORZC 4FQHA 2DQDL 4F2MA 5IOPB 2WAHA 4OQTL 2B1HH 3K7UA 3LKNB 4PRAB 4X6CA 2YD2A 5F1OB 1Z9SA 3U4BL 2G5BB 2AJVL 1IQWL 4YDKH 1FP5A 3MRDB 2E7LA 3HC3L 1CN4A 5BW7C 1CFNB 2FH8A 5DK3A 2APFA 4YDJA 2AQ2A 4NZTL 4Y4HC 4YBQD 3BKJL 1KTLB 2Z31C 4OCSH 5J12C 3VG0L 4MAUL 4ZDHB 5C0CA 3MLVH 1S9YA 4C56D 2VDKH 4P2QB 1RAMA 1A3RL 1Z3GL 3PDDA 5IHUH 3ULUC 3K2UL 4M62H 5GXBB 4EDXB 5TPWH 4OM0H 4KRLB 4O2EA 1RSFA 1LEKA 3HNSH 4HUKB 2FBJL 3JVGA 5E9DA 1RZ7L 2FEEI 1TVDA 4N8PA 1TQCC 3OGOE 1B0RB 5DR5L 4P23B 1YC8A 3J8F7 1D5IL 5ADPH 5ALCL 4Y7MA 3MNWA 4R96B 1T0NB 1RULL 1DUZA 3RWHB 4JRYB 2QADB 1ACYL 2VISB 4Y2DB 3UDWA 2CK0H 1M71A 4MNHA 3DROB 2IADB 1YPZB 3H9HA 1G0DA 32C2A 3CK0H 4H1LB 1MHHA 5H37G 2HA1A 3DUUB 4PJCB 3I9GH 2VLJD 2RFXA 3TFKC 1DP0A 4F7MB 1U92B 4K07A 2ORBL 3B2VL 3BKMH 5IIEB 5EPMA 3FO9A 1UXWB 4M1DL 2J88L 4IDLA 2Q87A 4AL8H 2AJSL 3N1FC 5F7HA 3PP3K 5JDSA 4Y4FA 1PX3A 4JZJA 2GTZA 2UZIH 3FZUD 2B39A 1FFNA 2JIXB 2ZPKL 2EC9U 2YEZB 4XH2A 4AG4L 3NCMA 5C0GA 1VFUA 2YSSA 4XP9L 3LRSA 4QHMB 4KQ4H 2XWTA 3HZKB 1KNOA 5ECJE 4S2SB 5B39B 3NOIA 1MJUH 2DIAA 1QBBA 3ILPB 3NA9H 4NQSA 3TJEH 4X6CB 5DVMA 3VRLE 1NMCB 3IAGC 3QHZH 4KY1L 5GS0D 4QOKE 3KR3H 2PO6A 2K7QA 3MV8E 2VLMD 4WY7H 3OBAA 4OKVA 1J86A 3U0PA 4YDJB 4WU5A 4M4RA 3GSVA 5KTEH 2GT9A 1S9YB 2DOCA 3OAZK 3PQYE 1IARB 1OW0C 1JJUA 1AE6L 3CFBB 1BLNB 4PJHE 3RIAK 3HB3C 4P2YA 1E6OL 3O9WA 4RIRB 1RUQH 3IDYC 4UUJA 4NZRH 1LEKB 3CXDL 1M05B 3OAYH 5E9DB 1BWWA 1MRDH 2J3SA 2GK0A 4XVJH 3D0LA 1ZTXL 1WBYB 3MNWB 4HS8H 3CVHL 4KUZL 5E8DH 1D5MB 4YHOH 3MLSH 5KVFL 4MNHB 4POUB 1IAMA 1QRNB 4MQXC 3FN3A 1NCUA 1I1YA 2X4OB 5TFSH 2FLBT 32C2B 5DUPH 3V0AC 1MHHB 5F7YC 1KN2L 2P8PA 3PP4H 2RFXB 4M8QA 1KB5L 4E0RA 5DGQA 4I5BB 1GH7A 2FD6H 5CHNB 1E4XH 3I2CL 2YA2A 4F58L 5EPMB 3FO9B 1AC6A 4HWNA 1F3DJ 2D0GA 2KUTA 2ICWI 2ZCLL 1TJGL 4NQDA 1G7MA 15C8H 1WBZA 2VB5A 1DQML 4UBDC 3VXUE 5AZEL 4UU9B 4Y4FB 2GTZB 1NFIA 3FFCD 2MQ3A 3RU8L 1YEDB 1QEWA 1A21A 4L4TA 2R4SH 4XH2B 1U8IA 5C0GB 1CDUA 2XWTB 3EOTL 2JKXA 4LSVL 2ZG1A 1KNOB 5C6TL 4DVBA 1MFBL 2XT1B 1JPFA 1DVFA 4NQSB 5L8LB 2D7TH 3HMXL 1C5CL 4TVPH 5HHVH 2QEJA 1HKLH 4E5XB 4UNVA 3JV4A 1SEQL 3QBTB 1C12A 4TULH 4U33A 5C2UB 1NDMB 3DX6A 3NFPB 4OKVB 3X11A 2OMNA 4LVEA 5C0BE 3Q1SL 4MXVE 2MPAL 3BZDA 1IGYA 2ICEA 1IGJA 1AXTL 2GT9B 4HUUB 1I1CA 3REWB 4RGNB 4M3KB 1C7SA 1MPAL 4APQC 1UZ6E 1MHEA 3C60C 2HN7A 2XI9A 3TIDA 2F58H 5JHLH 5DJCA 3TT1H 4OZFB 3O2WH 5C07A 2VDOH 5ID0A 4PRID 1WIPA 2ICWJ 5DC4B 3B9DA 3HTLX 3VMPA 4WHTA 3VXMD 3CSPA 1OAUH 4BQBA 5F7EL 4OCLC 4WJ5A 1A7RH 1YY8A 2EDBA 3HI5H 1RV6X 3QJHA 4ZODA 3G5YB 5SWZE 3QWOA 1JFQL 5C8JA 4LL9A 5EFIB 1I1YB 2XPGA 1FL5B 4NN5B 1L6ZA 2P8PB 5EU7C 1M6OB 4M8QB 1FRGL 5GSRB 3SKJH 1CE6A 4E0RB 5EBWA 2NY4B 2C3WA 3PGFL 3C5ZC 4O51A 1A7PH 4MJIA 1ZK9A 2AJUL 4AEHH 5I9QC 4NC2B 1G0YR 5C92A 5DD3H 3HFML 4XZUA 4R0LC 5HTSA 2YR3A 4KHXL 2J6EL 4TTDD 5F70A 1G7MB 4LCCC 1WBZB 4GQ9L 3CGTA 5GS1A 1IGTA 2HLFD 2ZUYA 4HT1L 5IGXL 3BWAA 5I1CH 3QFJE 5JHDD 4OD3L 4NC1E 4TUKH 1UJ3A 3MLTA 3IU4L 4LLDB 1MCWM 3MJ7A 1JPFB 4TQEL 1NCWL 3EOAA 3I3DA 1BAFH 5FF6A 4YQXL 5DD0H 4LVOB 4OCNC 4K9EH 2XY1A 1NUFA 5I18H 4KFZC 2QSTA 3JV4B 3D6GA 4AMKH 2YBRA 3NA4A 3PL6B 3LQMA 4XPHL 3DX6B 3LRGA 3T0AA 2C1OB 3X11B 3ZKND 1KBGL 4RISL 3I6KA 3UTSA 2VXVH 1XH3B 3IJHB 4XMKL 5DJ0A 3C8HA 1RUKL 2EZ0C 2XWBA 4OF3A 3ARXA 5I1JL 1VADA 3MBEA 3TBWB 5DJZA 5KAQG 4HPYL 2HN7B 1DCLA 1ZGLA 5D1ZD 4JQVC 4ODHH 4P4KA 1FVCB 4ZUUA 3TIDB 5D7JB 5DJCB 1G7HA 3U36A 3WNMA 1W2KT 1Y18B 4X4XA 4D3CH 3KXFE 5T1MA 2DQHL 1B90A 4WHTB 5F9DC 1RIVL 2JK5B 4ONFL 3HPLA 4WJ5B 1YY8B 1T5XA 1EHXA 4KVNL 5L7XL 5CP3A 1I7ZA 3VFGH 4XP4H 4ZFGL 3QJHB 5BS0B 3VMOA 4G80A 2ZUWA 3KPLB 3QWOB 3MLRH 4PLJD 3E8UH 3EHBC 2X70A 2XFXA 3DSFH 4JM2D 1EGJL 1E27A 2E8ZA 1KTDA 1CE6B 3MRPB 4XNYH 4PTTA 1LP9F 4OLXL 5EBWB 4PJAE 2NY7L 3UTTB 4O51B 1ND0B 4MQ7A 4MJIB 3QDME 4GW5B 3FN0L 4QHNA 3SDCA 3DJ9A 4M7LH 3FONA 3BYYA 2AABH 1QZ1A 2DLGA 1SY6A 3SQBA 3DO3A 5GS1B 4U7KA 1IGTB 1U8KB 3U2SA 3DVNB 4GBXD 2DJSA 2EYSA 3LH2L 2X9YA 2DTSA 4XNQB 1RZ8A 2XY2A 4HF5L 5KSBE 4KPHL 1CG9A 3UO1L 3G08A 4J23A 1NGPH 2YA0A 4Y4HD 1I8LA 2IANA 2Z31D 5IB5A 1KLFA 2IJ0C 3RDTB 3T0XA 2R0WL 1UJ3B 3MJ7B 4R7DA 3EOAB 2VIRA 3JWDL 4G43A 3ULUD 1DN0A 4UZGA 2VDML 1ACZA 5DFVC 1NSNH 3MRMA 5DEGA 3KPNA 4KC3B 5TQ0L 3L3HA 3WKMH 1QBLL 1DBBL 4M9OA 4UT7H 5LQBH 1L7IH 1ADQL 1OSPL 1CVRA 3RFZC 3I6KB 4GO6B 2E27H 1GRWA 2X1XR 5DJ0B 4F9PC 3VXSA 2BNQD 1VADB 3MBEB 1NUDA 5DJZB 3RI5F 3P77A 1UQSA 1B4JH 3MJ6A 5IMLA 5I1EL 4GKOA 1HHIA 4JFHE 4P4KB 3TFKD 2FATH 3KYMA 2QR0B 4AH2A 1G7HB 2FIKB 3SCMB 3T8XA 4X4XB 5T1MB 5MENE 4HKZB 4U6VL 1DQLL 4O2CA 3GI8L 4QY8A 3MCLH 3WBDA 2R2BA 5F6IC 3DGCR 4QRRD 1I7ZB 1AGBB 2VXTL 3WFBL 1D7FA 2JB5H 4G80B 4JY6A 2HWZL 3QDGE 1FNGA 2CRIA 4NQCA 1IEAA 2XFXB 1KUMA 3VD7A 2J4WH 1MUJB 2R23B 2Y1VA 4OJFL 1A5FH 3TZVC 1NCBH 4JFZH 1KTDB 3P4OA 4UIMA 3VI3E 4PTTB 1IE5A 1OAKL 1CTOA 3HE7B 4MQ7B 4OKDA 3T0BA 4WWID 3R8BB 5T1LA 3SDCB 5C2BL 1PLGL 4WI3A 5HGHA 2V2XA 3FONB 5HHME 1R5VA 4YWGL 1UB6B 5I0DA 1ZVSA 4KJQD 1QBAA 5IHZA 5KANI 2MWCA 1T3FA 4EN3C 1FDLH 1PKQA 1F4WH 1IBGH 4GW1B 2Q8AH 1VFOA 1FC2D 1YMMD 2ZSVA 1RZ8B 4FQXD 4GRLA 2KL6A 2BVPA 2W92A 3G08B 1BBDH 1KPUA 1MFEH 1OHQA 5DRWB 4E9LA 3EFFA 2IANB 4ZUTA 5IB5B 4RSVA 1K85A 3FAXA 3V4PL 3SKOA 4L4VD 1EHNA 3EW3B 1FBIH 1J12A 1YYLL 3EZJB 5B22A 3RTQB 3HB3D 4YGVA 4G43B 4KI5C 4EI6A 4U1JA 3QSKB 1DN0B 2OL3B 3VFTA 3MRMB 5DEGB 4RGMB 4JO3H 1TETL 5DZOA 4PRNA 1ZXQA 1CI5A 4Z18A 3N9GL 3PF2A 4IOSD 5IM7A 3BZEA 4R9HA 3PWPA 4HV8A 3B6SA 4U3XA 4Z5RA 1P53A 3G5VB 5J3HC 4XAWL 2VYRE 1BP3B 3CH8A 1YJDH 3VXSB 4LKXA 4MQXD 1DDHA 4MB3A 3GHBL 3P77B 1AIFA 3AU1B 4Z0BL 2ADFL 4F7PA 4XPAL 1HHIB 1TJIL 2FIRT 3KLAA 4CMHB 2FHCA 5CJ5A 3GMQA 4PUBH 3T8XB 3RI5K 2VLKD 4G8FA 1UB5A 4O2FA 1WCBA 3GMLA 3GEWB 4JO2L 4OD1L 1NGZA 2GW5A 4DVRH 1ZLSH 2ZJSL 2R2BB 1A1MA 3TBSA 2Q7YB 1WJ3A 4UBDD 3B5GA 3CLEH 1JGUL 3ESUF 5D2LA 3UTQA 4JY6B 5EUKA 3WS6A 4CU8A 1FNGB 1F3JA 4Y1AE 1F4XH 1MFAL 5ICZA 3MQIA 4NQCB 1IEAB 1IEBA 5D5MA 2Y25A 3OXRA 3OQ3B 4LDOB 3HLAA 2Y7QB 1CXIA 4G6ML 4HDIB 3P4OB 4UIMB 2O5YH 2CKBH 5TQ2H 3RPKA 1EEZB 3MLXL 3HCVB 1KPVB 5T1LB 1OPGL 5HGHB 4OV5B 1JVKA 1R5VB 4WI9A 1TCRB 1ZVSB 4WUUD 5IHZB 5GS0L 2BY3A 3BEVA 1T3FB 2NY3C 2X4SA 1PKQB 1MIEH 1PX4A 5B4MC 5FECB 1N4XL 4LRNH 2ZSVB 4Q9RL 4JRXA 5FA4A 4YEFA 5FYJU 5BZWB 2BVPB 1YDPA 2AXFA 1KPUB 3EFFB 3BIBX 4ZUTB 4OB5H 1ES0A 4HULB 1P7QA 1UWGH 3OPZH 3WN5C 2V5TA 3FB7A 4YGVB 4S11A 4DGYH 3G5ZB 4GMSL 4GRMA 4TSCL 4U1JB 5CWSA 4APQD 3OWEA 4C56E 1W8OA 3C60D 1PZ5B 2YKLH 3K8MA 1RUML 4YDVA 4KZDH 4L8DB 3HAEA 1QSFA 1A4JB 3OB0H 2PXYB 1BEYL 3V0VA 3BZEB 5EC2B 2APXA 4BZ2L 3PWPB 4HV8B 2CPCA 4Z5RB 3GSXA 5SWQA 4IDJH 3HE6C 1CICC 1NFKA 5FO9A 4Z95L 4AYFA 4LKXB 1P4BH 4M7KH 2P47B 2IGFL 4OCWH 3ZDZF 4N0YL 2HVKB 3HN3A 4F7PB 1CTNA 1RIUL 5DQJA 4LRIA 2ED8A 3T04D 5I19L 3C5ZD 5ELIA 1DBJH 2Q7NA 3MOQA 5DLML 5IBTH 4ZFOA 2VLJE 2P4AB 1EFXA 1SJXA 4G8FB 1UB5B 2OSLA 4O2FB 1WCBB 3GMLB 3NIDF 1KLUA 1GVIA 1BQLL 3QIUB 3TBSB 3V5HA 4KHTL 5D2LB 3UTQB 1ULVA 5EUKB 3SGKC 2HVJB 1RUPH 2VC2L 4M3JA 3QXDA 4L8BB 3BPOC 5ICZB 4GG8B 5D5MB 3OXRB 1WV7T 3F8UB 1C7TA 4ZUVA 1N0XL 5C0JA 4HWBH 4UT6H 3OKDA 5FEBA 1NUNB 2BSRA 4YDLC 1CD1A 4Z7OF 1I9RH 1C5BH 4M6AA 5EOQH 2KDGA 4Q7DA 1V3MA 2A83A 3NPSB 4LPCA 4BQ9A 2V2WA 2VTFA 2FWOA 1BVKA 3KYAA 1G6RA 4HKBB 2ID5A 5HD8C 3ARYA 4LLWA 2R29H 5JW3L 4KJWC 4R8WL 1QR1A 4PV9B 4JRXB 5FA4B 1BD2B 1YDPB 1WAAF 2QQKL 2ZZUT 4PYHA 2AXFB 4L8SA 3AS1A 2LABA 4KTEL 1JP5A 4HCRA 2VLME 1ES0B 3OV6A 4ZYKA 1P7QB 3VGBA 5HDBE 2EIEA 4M4PA 3KPPA 2JF1A 4GUPB 3LEYH 3GRWH 2DLHA 1T89C 3IS0X 1D6VL 3D9AH 3FB7B 3BJLA 1AGCB 4GRMB 5CWSB 4H0GA 4QXUL 3ZE2F 1EDQA 1XF5A 3L9RA 2KQMA 4P2CG 3NZHL 4JFYA 5H94A 4NKIL 2H6PA 3ZL4L 3MBXH 2DI8A 3HAEB 1JI1A 1CLZH 4UQ3A 3L3DA 4XP5H 3V0VB 1TVBB 4A6YH 3GSXB 5D7KD 1KENH 2F5AH 2ARJA 1FHGA 4RGOH 3RVVC 3ROOA 4B53A 4X7SH 4DAGH 5F7UA 1JMZA 5HHQB 2VR5A 5JPMB 1KT2B 3EHBD 4R3SA 1LO0H 1QUNA 1JIBA 1K2DB 3DETC 4YZFF 1KCRL 4QOKA 4OQTA 4Y16A 3RJQB 3MV8A 4IRSA 1GHFH 2VXUH 5IF0B 4ZFOB 1S7WA 4D0BA 3QRFM 4R7NA 4RMWA 5ESAA 4N1CA 5F6HJ 3WCYA 3GI9H 4N1HB 1G7PB 3HZVA 1EHLH 3NCJL 2IPTH 4P2RD 1F2XK 5IVOA 1KCUH 2DQEL 3V5HB 2FO1A 3PQYA 1DEDA 2AXGA 4OF0A 3OR6B 4PJHA 3QXDB 1JF1A 1KXQE 3LB6C 3FQRA 4YIQA 4F7TA 1BF8A 3B43A 1FIGH 5D1XA 3O2DL 4X5WA 3A6CH 1IGMH 4ZUVB 4PGCB 5TDNA 5C0JB 3FT4A 1U9KA 3UPCA 5DMYA 4X9HA 3FFCE 2W60A 1JI2A 1HINH 2BSRB 2EEBA 2DQUL 1CD1B 4PP2A 4X6FA 4G7YH 3BPCA 2BVUA 2B20A 2A83B 4FXGA 1NDGB 1V7NL 2F53D 4P23C 2ATPA 1WEJL 2BXZA 4M43H 1G6RB 3B9KA 3MLVL 5DFVD 2QADC 2AK1L 2VDKL 3TT3H 3BHBA 4M93B 3QUYA 3WXVL 1T83C 4D9QD 2W65B 4U1GB 3RWGA 3BD4A 4NZUH 2JCCE 5J6GA 5FYKU 4KQ3H 3MV11 5FGBA 2O5ZH 4ZYKB 4RBPH 2UV3A 3E0GA 3KPPB 2FYYB 5D70H 4LSTH 3KDMB 5ADPL 3I02B 1WFUA 1QFWL 3MRCA 2FO4A 5I8CB 5MHSD 3VXUA 3KPOA 2CK0L 1Q0XL 1XF5B 3CCHA 1S7TB 3L9RB 3QI9B 1MEXH 5H94B 5GJTH 3U6RA 2Z8VC 2PYEB 5F93C 5BRZD 2R0KL 1D9KD 3GMPB 4ZFFA 5D96B 2ARJB 1ORSA 1XR8A 4PRIE 2F54D 4XP1H 3T1FA 4HK3N 3ROOB 2IQ9L 4K3JH 2VUOA 1A6AA 3VXME 3FT3A 4LDEB 3NTCL 1DL7H 3TNNA 3P9WB 2DTMH 1WAAE 3P0GB 4QOKB 4Y16B 4D9LH 2WP3O 5JW4M 3QIWB 2C7UA 5ICYA 1NMCC 2CJUL 4UOW0 2OR8A 2UZIL 4CU7A 4CN6A 2C4FT 1R3HB 2FGZA 1VESA 4R7NB 2DBLL 1NCAL 3EFDH 3ZE1E 5CEZD 3HZVB 1ZVHA 5E6IA 1MHPL 1T5WA 1ZLVH 5D9SA 3PQYB 2AXGB 4PJEF 1OM3H 4KV5F 3S37X 3S5LG 4EN3D 4MZ2A 3TJEL 4I9WD 4NCC1 3NCYP 1NEZA 4Y88A 3H7BA 3D18A 4X5WB 2GHWB 3O41A 3H9YA 5D1XB 3JV6A 2JJSA 3OB8A 5EOCL 5ERWA 5TDNB 3QIBA 1A4KB 5IVXB 3B8YA 3KYKH 1CVSC 2KZ1B 2W60B 3GK8H 4XCFH 4UIKL 2YWYA 4LIQE 4PP2B 1W0VA 3PWNA 4X6FB 2G2RB 3QQ9C 3JVGC 5DRNA 3BPCB 5JW4Q 3KHQA 3RQ3A 1YZZA 5JHDE 4TSBH 2FJGA 3T65A 2XKNA 4JO1H 4KI5D 4D2NA 2XRAL 5C9KA 2ATPB 3OXSA 2NX5B 3B9KB 5SWZA 4H1LH 3JWNC 5FYLD 2C1PA 3CVHA 3ROLA 2NXZC 1AGDB 3QUYB 5ITFA 4Z77A 1T21A 3RWGB 3GJFH 2CIIA 2ICWA 3MRFA 3CSBA 3WJLC 5LWYL 1NPUA 2YHGA 3ISWA 1SEBA 1WFOA 5DO2C 2W38A 2X09A 2FO4B 1QSED 3WJJA 4KH2A 3KPOB 5E8DL 3CCHB 1TTGA 1J0KA 4XXCA 4RFOH 3WD5L 3U83A 4NJAL 4K3EL 3QDHA 2PTVA 4NO2B 4Y4FC 4X80H 3BT2L 3MO1A 3NFNA 3QFJA 5ESVA 3ARED 1CF8H 4QRPB 4RRPG 5JIIA 1ORSB 2FD6L 4P99A 3T1FB 3K8KA 3ZSSA 1A6AB 1R3JA 5HHPA 1IGCH 5IMMB 4NP4L 3JV0A 3TNNB 3ZE0E 3JXAA 5BXFA 1GZQB 1XGUA 2VH5H 1NJ9B 3LMJH 5KSUA 2C7UB 3ZO0A 1NUGA 3BDYL 4XCCL 1XIWA 4UTAL 1M1SA 3RAJL 3LKSA 5JW5A 1EPFA 4HH8A 1HYSC 4PBVC 2DD8H 1V5JA 2EC8A 7FABH 2LU4A 3JSSA 4MJ5A 1LMKA 4DGIL 1DJSA 1T5WB 4ELKB 1R5WA 2NY3D 3SHSA 5B4MD 4TYUA 4RGNC 5LBSH 3D18B 4RMTA 4TVPL 3BZ4A 4Q97A 3JV6B 4W4OC 5HHVL 3QIBB 1HKLL 1WIOA 4G6FB 4TULL 4WTWA 1W0VB 3KXFA 3PWNB 5DRNB 4HHAA 4TVSa 5TE4H 2HKHL 4PLNC 2WWMC 1L9MA 5J57B 3FHAA 3VH8A 2W91A 5DMIH 2EH7H 3UJIL 1UWEH 5SWZB 2IG2H 2C1PB 3CVHB 2A6KB 3ROLB 3ULUE 3T3PE 3X13A 4Y0GA 1UM5L 5ITFB 3EBAA 4PRHD 1EVUA 4P46B 4NO0D 4NN5C 4U31A 3MROA 2ICWB 4PJAA 3HE6D 1CICD 1UVQA 1YMHA 2RAMA 3QDMA 1LEGA 2NY4C 2K7PA 3EKCA 2NZ9C 4DKEL 4PB9H 4Q6IA 2BJMH 4OGYL 1KIPB 2BNQE 4YHLL 4RQQA 3PDGA 4L5FH 2ESVE 3FOLA 4NM8H 4S1RH 2WK2A 1TNNA 3BKYL 3V6FB 5KSBA 2D3VA 3I6LD 3MO1B 1HKFA 5C9JA 2BMKA 1U2HA 1WLHA 2X4QA 1EZVX 5DZNA 3CSYA 3QYCA 2KH2B 5HHPB 5E4EB 1V3JA 4CW1A 2I07A 3QEGH 4QRRE 3L5XH 5INCA 1SJHA 5DUML 4X6EA 12E8H 4OI9A 4LVOC 4QF1B 2QSVA 4HWEH 1P84K 4U1IB 5DMJB 2XA8H 2AI0L 4UILH 3LKSB 5JW5B 1V05A 2BCKA 1P84J 3PL6C 4CVUA 4H1LG 5IB1A 4HPOH 5A2FA 4PV8A 5CMAA 3PABB 3O2VL 1R5WB 2YC1A 3EYVA 5CAYB 3IVKB 3E6FA 4KJWD 4QGTA 3JTTB 5K9JL 3QXUA 3S36L 2FDBP 3BIKB 3QR2A 4P5KA 5L2JB 2CGRH 1L7TL 1GAFL 1PSKL 1VERA 2EE9A 3ABZA 2NMSA 5D7JC 2E9JA 4HHAB 5MENA 1X9QA 1CXLA 3GMOA 4KKLD 2VOTA 4PRBA 4L4VE 1I9JH 3ULSA 1NGYA 1P6FA 3K0WA 5JLZA 4JKLA 3QDGA 4UV4H 4RZCA 5D7SH 1A6ZA 1OARH 2CSPA 5A3IC 5CILL 5B39G 3STLB 2B1AL 4Z7VE 5K9QI 1IM9D 1NMAH 1AR2A 2RJMA 1PFCA 5KSVA 5IB3A 3VWJB 5JOPD 1LDPL 1YMHB 3RJDA 1EGJA 4LLAA 2DM7A 2MKWA 3O81A 1LEGB 2JJTA 1E6JH 3L7FB 2Q86A 3RUGF 4XHJD 3DETD 5ID1A 1BHGA 3GIZH 4RQQB 4XP4L 4M48L 5EO9A 1I7UB 1MSPA 3FOLB 5CS7A 1YYML 4YAQA 3QXTA 4Z7UF 4CVZB 4LU5L 2W1NA 3HNVL 3QH3B 3AMLA 4RDQG 2X1OA 1MJ7H 5C9JB 2BMKB 3HZMA 3MRIA 4NRZA 5DI8A 4XC1L 2VLKE 5E5MA 3MUZ1 3RDTC 3QRGH 1PEWA 3FQXA 1T1XA 1UJ3C 2I60L 2I07B 4P2QD 4JFFB 5CINH 1FPTH 1R6VA 2EE2A 4TPRH 1SJHB 4ZPVA 3LD8B 3VDAA 1LP9A 5F9WB 4W68A 4CMMB 5EIVA 1ZGLP 3WS3A 1PG7X 1PVHA 1P4LA 1J1PH 2BCKB 4NUJA 1UC6A 1KJ3L 4P23D 4LVNB 4WFHD 1ADQA 4HIIA 4DK3A 2HAZA 5CMAB 4JRYD 5HPMB 5CGMA 3E6FB 5I2IA 3BQUA 5E95B 4AQOA 3LS4L 1VKXB 5E08L 3MBEC 4WUUE 1XGRA 4P49A 1FVDA 5L6YH 4P5KB 3LS5L 5AZ2H 4PP1C 4H88L 4CDGC 4WW1A 1IC7H 4HIJB 4P4KC 3PWLA 4MVBD 3WKML 4LP5A 4FNLL 5MENB 4OLZH 1KOAA 5F9JA 1X5ZA 3SCMC 3BH9A 3QG7H 3GSWA 4JG1L 2XV6B 5EO1B 3GMOB 4EKXA 4PRBB 1RJZA 1FZKA 2ERJB 4JVUA 5JLZB 4R26H 1V7ML 3QDGB 4XMLH 4P5MA 1A7NH 4Y1AA 4MX7A 3PHQA 4OLWL 3MOBH 3AB0C 1YN7A 4HLJA 3WNLA 5KSVB 4LSQL 2JE8A 4KK6D 3QEHB 2JIXD 3LQZA 4LLMA 2HP4A 2IPKA 3WDHA 4K7PH 4NNYA 4PG2C 1J0ZA 3S7GA 1DQQB 1WICA 2Y06L 4TSAL 5D1QA 1MCIA 3HE7C 2X42A 5EG6C 2FR4A 5HHMB 3SDCC 2BSTA 3REVB 2I27N 4KTDH 5ID1B 4IMLA 2HJLB 2ZCKL 1CD8A 4PJ5B 1FGNH 3ZZ1A 2P49B 4QRSA 1JPGB 3EJYC 4GOSA 5FHBL 1BJ1H 1N2RA 4NHCH 4LBEA 1A2YA 2M8XA 2D03L 3EYOB 2ZNWA 1NFDE 3Q2CA 4H8WC 5EU7E 2G75A 3HZMB 1VFBA 2VKXA 4NRZB 5DI8B 2YD4A 5HDLA 4HKXB 4OZFG 4DTGL 5E5MB 3R8QA 3NBNA 2HJFB 3MGOA 3FQXB 4I77H 1L0QA 5F7DA 4C56A 1QLEL 3CMOL 3RTQC 1S5HB 3VCLB 4ZPVB 3RWDA 3VXNB 1LP9B 4W4NA 2YRLA 4J8RB 1I7RB 4HIXL 3WS3B 2Q8AL 5CEYB 2VXQL 1DBML 4RGMC 3ZT5A 1P4LB 2IMNA 1AHWA 2HFGL 1U8LB 5K93A 1A7QH 3UXFA 1MFEL 3P9LB 3TA3C 4HIIB 2IH3A 1JPSL 2RCSH 5FA3B 1OCWH 1SM3H 3BQUB 2NXZD 1QRND 3UBXA 1XGRB 4K55A 5EZIH 5MP6L 4LLYA 1FVDB 5SX5H 5L9DH 1HHGA 1AQKH 2OXGA 2FGWH 3PWLB 4WO4A 3VI4F 3LEVH 3CD4A 2VLJA 4GH7B 3VFMA 3WEXA 5CP3H 3BH9B 4C55A 4X7TB 3ZDXF 5I74B 4LARH 1BX2B 5GRVK 1RJZB 1FZKB 3VU2A 3TJHC 1BFVL 5J8OA 4P5MB 4MX7B 4F9LC 1P4IH 1MRFL 3U46A 3PHQB 3RHWF 1WFNA 1A8JH 2V17H 1MLCB 4Y4FD 1YN7B 5AAMA 3GO1H 4V2BA 1WZ1H 5FO7B 3MXVH 5EZJA 1JYWA 1A7OL 5FM5M 3LOWA 3SEPA 4NNYB 1OP5H 1B4RA 1SY6H 2VERN 3O6FD 3C5JA 4MSWA 1BM3H 2ADGA 5D7KE 2FR4B 3DLQR 4HIEB 2BSTB 3WFEH 5HHXH 2E5EA 3ZYJA 3BP5B 1IVLA 4QRSB 2HTLC 5FGCE 1C16A 1N2RB 4LBEB 4XTRC 1A2YB 5BO1H 3FHQA 4LPWA 1I3GH 2UWEE 4L3AA 2CRMA 1KIRB 4U1KA 5CEZL 1GOGA 2DQTH 1FLRL 1FZOA 4ETYA 3GSOB 3CDGA 2IBGA 5T33H 3WUWA 4RGND 2X40A 4KUCD 3F7YA 3RWDB 5KS9E 5IEKB 3TF7C 5GGQH 1GXEA 1ZT1A 4R97B 4JR9L 5C6PB 2L7UA 3RNKA 3DMMB 2VDRH 5DQDL 2WWMD 2GY7B 2PXYC 3BMVA 1IGIL 1A6UL 1GC1H 4DUWA 2JJWA 2GAZA 4BUHA 2QHRL 2F53E 2X4TA 3ZDYE 4J4PA 3UBXB 5HDQL 3CZFB 1MQKH 1A22B 4GS7B 1SMAA 1JWSA 1HHGB 2YKLL 2M2DA 3LV3A 3LZFH 3X3GL 4UNUA 4YHMH 3VWKB 3GBLA 3TCLA 4WO4B 2BVOB 2ARWA 4D9QE 2VLJB 2NY4D 5DRZB 3LQAH 2NZ9D 1IAIH 1G7QB 3W0WB 3ZTNL 5EA0H 3OKLB 4UTBH 1SJVA 1T2QH 2BFVH 4NNXA 3MJ9L 1JBJA 2R1WA 2XA3A 3QIUC 4Z7WE 3U46B 5IVZA 3WS6C 4TOYH 2EKJA 4XWGH 5MHSE 3P0VH 1C8PA 3QUZC 4JHAH 5HVFB 1MCLA 5CJQH 3FFCA 1OP3K 2NW3A 5EZJB 4JPIB 1JGEA 3VDBA 1DBJL 3UC0H 4JFXB 1YNLL 5LGJA 4LLQB 4MSWB 3X3FL 3RHWK 5BRZE 1NAKH 1GYAA 2H26B 2ADGB 2I9TB 2NY5H 5FKPA 5F9OH 2J8HA 3D0VB 2F54E 1AI1L 4UV7H 4EBQH 3NPSC 4YHKL 5F3BA 4R4NC 5GS3A 5T1DL 3BAEH 4NN7B 3ARFB 4JRWA 4WHDA 1NGXA 4DQOH 5T3ZH 2JCCA 3ZDXE 3PL6D 4LOUC 4U1KB 2EIZB 4XVTH 3QQNA 3WFCH 2VXSH 4FFYH 4J3WA 4S0SD 1C5BL 1FZOB 3SO5A 2CUHA 3TO2A 4X5XA 1UADC 5F7FA 5CEZE 4HX1A 4OSUL 3F7YB 4BUGA 1ZLWK 1ZT1B 1PQZB 4GJTB 4Q58C 4WNQA 3UYRL 5DVOA 4NYLA 4J3SA 1ETZA 5D7JD 1N5AA 3SDDB 4S1QL 3BSZH 3ULVH 2Z8SA 1HCFX 3MUGA 4PRIA 4Q9QL 4HGWA 5DJ2A 5FUOH 4G5ZH 3VXMA 3WKNA 3DARA 1T1YB 2CK2A 3BKCH 1MAMH 4OCYL 5A3ID 2D9CA 2MJWA 4UQ2A 5BS0D 4KI5E 2AKRB 1WAAA 3NCYS 3DV4A 2Z93B 4RFNB 5FYLE 2YD5A 4OF7A 5JR1L 4G9FE 2X1PA 3T77B 4ERSL 4J3XA 3UTTD 2GCYB 2EEDA 3GM0A 4MJID 3T0EB 5F1SA 2GSIB 5FFLA 4Y5VA 5C09D 4RGOL 2R2EA 4NNXB 3V6ZB 5IJKC 4NKDA 4PY8J 4L9LC 4IRJD 5EUOE 4DAGL