4B9FA

High resolution structure for family 3a carbohydrate binding module from the cipa scaffolding of clostridium thermocellum
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
b'NLKVEFYNSNPSDTTNSINPQFKVTNTGSSAIDLSKLTLRYYYTVDGQKDQTFWCDHAAIIGSNGSYNGITSNVKGTFVKMSSSTNNADTYLEISFTGGTLEPGAHVQIQGRFAKNDWSNYTQSNDYSFKSASQFVEWDQVTAYLNGVLVWG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULOSOMAL-SCAFFOLDING PROTEIN A
publication title High Resolution Structure of the Family 3A Carbohydrate-Binding Module from the Mafor Scaffoldin Subunit Cipa of Clostridium Thermocellum
rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Sugar binding protein
total genus 35
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 4b9fA00
3ZQXA 4B96A 1TF4A 4TF4A 4B9FA 4B9PA 1GA2A 1G87A 4JO5A 3ZUCA 1NBCA 2WNXA 1G43A 1KFGA 4B9CA 3TF4A 2XBTA 3ZU8A 4B97A 2YLKA 3ZQWA 2L8AA 1K72A 2WOBA 2XFGB 2WO4A 1JS4A 4C8XA
chains in the Genus database with same CATH superfamily
2WQSA 4Z7AA 1ZLSH 5A2JH 3PXJA 5FKPB 4XMLL 3KDMA 5IMOB 4X99B 3C5ZC 3D85D 2AF2A 1EPFA 1GVIA 2DEWX 4FNLH 1FZKB 4QUOA 3S34H 2ZUVA 1QR1B 2CJUH 3QFJD 2XV0A 5HYQB 1MREH 1X5KA 4JZNB 5BMFL 4OTXH 4AYGA 1ET7A 2ZUQC 3UFIA 5KW9H 5J11B 4HZ1A 2LLLA 1NC2D 2YQGA 4C83A 3S48A 5F1IB 3CBRA 4X42A 3UAJA 4ODWA 3PV6A 1X4YA 4HKJB 4TSAL 3CZUB 5IZ7A 2MNWA 1XGTA 4PW3A 2RA1A 1UH2A 4LBEB 2X4UA 4APXA 1U93A 2ZSVA 3AQZA 4DKFH 3VTTA 2EDQA 5DEGA 3ALPA 2NNAB 3C60B 4OZHA 3WG7B 3C5ZD 1Z9OA 5D7IB 4HEPA 4Z7OB 4HKBB 2IQAA 5EO9B 2LVCA 1DSWA 3CVHL 4W9EC 3MV8E 2JIXD 1S9XB 3CFIC 3CPUA 3V0FA 4R26L 4PG2C 1MHHB 2ENPA 5HYSB 4H8VA 1KCBA 1D5BA 1ORQB 3B2VH 3ZQXA 4ZFOA 3UGXA 1OV8A 4ZW7A 2PW1B 1YUKB 3NIGF 1NCJA 5A7BA 5IEKB 3GEFA 2EYRB 3EHBB 3MMEA 4KHXL 4HPOL 1UA3A 5J13C 2CUAA 4LASL 5FKPA 4A2DA 3I9GL 4FNRA 4JFPA 5IMOA 3WJMA 4X99A 1GYCA 4LQ1A 4LLDB 2AAVA 1FNEA 1FZKA 4FQXB 2BP0B 4M1CC 1MLBA 3OMAB 1JGVL 3PHOB 3GLEA 5CBAB 4K5PA 4KZDH 4JZNA 5C0GB 4N26A 3DX7B 4FADA 3RILA 3POCA 2V9QA 2YOCA 1V55B 1NDTA 3K2KA 4JFVA 5C0CB 5GJTH 4X8XA 1KCSH 2X4TA 4OD1L 3WEAA 4MDIB 4HKJA 3VXSA 5MP6L 5F1SA 1U95B 5D9SB 5IHWA 1NWOA 2V4LA 4LBEA 3FU8A 5DCCA 1PL3A 4LGRB 1UGKA 4AKQA 2APSA 3O3BB 4FQCL 4F57H 2HKFH 4QJ5B 5J4MA 5D7IA 4Z23A 2FGWL 1UKQA 1SFHA 4UNVA 4HEME 5J89A 4M1CD 3IK2A 5EO9A 1QFUH 3N50A 3RU8L 3UBHA 1X44A 2GJJA 4PJ9D 5CZVL 1S9XA 1J0HA 2MPAH 3WNKA 3DYMA 4OZ4B 4B96A 4TSBL 1KLGB 1MHHA 2PF6A 1DBKL 3TO4B 4EUPG 4QRQB 2ZUYA 3WNIA 1ORQA 3BVNA 4DN3H 5HYFA 3KXFD 3O3DB 3Q8BA 3VYPA 1A8ZA 2RB8A 4JDEB 3FUMA 1Z9PA 3P4MB 2WLHA 5IEKA 3VRJB 2EYRA 1P4IL 2KBGA 1RIHL 3ISRA 5D2LF 5D1ZC 4R5XA 3DC0A 4GQQA 5TDPB 2YD3A 1SXNA 4IKNA 4C56E 3SE9H 4UMSA 5T1LD 1B3IA 4LLDA 5C0BB 4FQXA 5HHNB 2YRPA 5AW5B 1J8SA 3PHOA 4G8FB 1PZBA 5CBAA 3C5XA 2HG5B 5C0GA 5FGBA 2V7NB 3DX7A 5IOKA 1IM3A 4DETA 1N5YH 3OMIB 1SY6H 3BOVA 4N2AA 2H8PA 2NY1B 2QTEA 1A1NB 5IOPA 3AGVA 1BD2A 2LT9A 4MDIA 1SHMA 2Q20A 4OF6A 4GSRA 4P4RB 3OC5A 1SJHA 3K2UH 4FJ6A 2XIBA 1LDSA 1WBYA 3ABLB 3MRGB 4HIJB 1U8MA 1TZGH 4XNXL 5CP3A 5E6ZA 4J28A 3Q8EA 3SJVD 1V3LA 2J8UA 4DFHA 4LVEA 5I1KL 3KL0A 5D1ZD 4AVKA 4YL4A 4ONGH 2ZYIA 4ZMQA 4FYSA 2XBZA 2PN5A 2L7EA 5FUZH 2Q6WA 2JWYA 4KUCD 3K5RA 1CICC 3BE1H 1FGVH 1G4MA 3GLDA 4OZ4A 5BZWA 4H44C 5AKSA 1KLGA 2FSEA 1E5AA 3TJPA 3TO4A 1Q8MA 1CDJA 5CJQH 5DC0A 6FABL 2N56A 1LO0L 1NM4A 1JDDA 4J3OH 3S5LB 1WRFA 4K7PL 4MNQB 4LFHD 2YN5A 4E9YA 1N5AB 1IAIH 1A4AA 2Z64C 4JVWA 2MNJB 3O3DA 4M6MH 2Q87A 1NCCL 4FGMA 1QUNB 4JDEA 2D3NA 1KJ3H 4XN4A 3U0WL 4JO1L 2P80A 2QADC 5GRJL 4PJDF 4NZRH 4QHMA 5TDPA 3BW9B 1QSFA 3L5HA 3WHXB 5C0BA 2VM4A 1MKFA 1CICD 4PN6A 5HHNA 4G8FA 1OCWH 3CQPA 3ARDA 2HG5A 1CFVL 4B9CA 2ZX7A 2V7NA 1YPZB 2ENQA 1D5ZB 4KQ3L 3EXJA 1CLVA 3PDOB 4G72B 3SGEI 2VZTA 2YXFA 4XP1H 1D5XB 2XQYG 2CDEA 1NFDA 2QSCH 3T65A 1A1NA 4BCYA 1DBJH 1DBAL 1DSFL 2V3DA 4XAWH 4N3UA 4JO2H 1DCEA 1HL9A 3N1MC 3SQOH 3SKOB 2QADD 3QUYA 3QWRA 3ARGA 3FT4B 1A7QL 1OQOA 5AYTA 4NUJB 1G7MB 3AY4C 5CJ8A 1P6WA 3U48A 2R83A 3DX2A 1G9MC 1UB6B 2MJWA 1AHMA 3VQ2C 2R0ZL 5KVGH 2V7HB 3RWHA 5HGBA 3GRBA 4RFNC 2DYRB 2XTJC 4Y9CA 5HJGA 4NM4L 1WFJA 2VDKH 1G5AA 5JQ6H 2B4CH 4V2CB 4UIMB 5ESVB 2CLZB 4J4PC 3KW7A 2VLJE 3BQUB 3WAKA 1YZZA 4LSQL 4JPKH 4MNQA 3REVB 2EXYC 3B6SA 1XF5B 1N5AA 3WEXB 2RHEA 1EMTH 1A3LH 3A5VA 3QIBC 2WVVB 2E9JA 3O2WH 1CJYA 3ZYOA 2WXMA 4I9WE 1QUNA 1U3YA 1W0YT 1QBMH 1T1WA 3A67H 4PCYA 4F7PB 5HVWA 3GBNL 4FFZL 4RX4D 4AIZB 3US1A 3NDYE 3BW9A 2IEPA 4LSPL 5D70H 2H3NA 2IBZY 2XTJD 4B97A 5DRXB 3WHXA 1KGWA 3O9WA 5AEAA 3VM7A 4HCRH 4I2XB 3O0LA 2PP8A 3I50L 3FXIC 4QKXB 4ZOAA 1YPZA 1CE1L 4J4PD 1CD1B 4WENB 2Y1AA 4FI8A 1K2DB 1P7BA 3N1FC 3ILPB 5DD1L 2WXNA 2EXYD 4IU3B 2HP4A 3QIBD 1SM3H 5DHYB 3FH5A 2H41A 3MRNB 4UQDA 3T0WA 3NSYA 4DEPC 1THAA 4P4KC 1BFVH 3SKOA 4NKDB 4MQTB 2C9PA 2G9KA 3FT4A 5IB5B 4MXQC 4NUJA 1G7MA 2JKIS 1R17A 4PRPA 1JVLA 4PREB 1UB6A 3PJNA 3QEGL 2EEFA 2ADIB 3QW9A 2WAHA 1QFWM 4S1RL 1HL8A 3L1OH 1NC4B 5D7LB 3SSGA 1YG9A 3QEHB 2AJXH 4JQIH 3T6XA 5ERWB 3N85L 5C0JB 4UIMA 2N3JA 5ESVA 5C0DB 2CLZA 1NEZG 3BQUA 5GZOC 1JTTA 4XPFL 3IXAB 4G9DB 2LTQB 3REVA 5DS2A 1XF5A 3FRUB 3TPUB 4P4KD 3WEXA 2I24N 4MDJB 4ZW3A 4KROB 4OR1A 5FW6A 4CJ1A 1Y6MR 4EI5A 5ALBH 1CMOA 2X3BA 2WBJC 1OY3B 3F6IA 2ZXEB 4MXQD 3PJSA 2XY2A 5C0RH 5JPNC 4FABH 3MAWA 4AIZA 4OJDH 4PJCA 4BFBD 5DRXA 3RP1A 1M53A 1DSYA 1U8NB 4I2XA 1H9DA 3KBEA 4WCYL 1T89A 4LCWB 4MTMA 5D7JC 1CD1A 3VWJB 4WNQB 5GZOD 1K2DA 3ILPA 3HMWL 3O4OC 1J5OL 4G6JH 3DSFL 4IU3A 2AV1B 1YYLL 4GKSB 2WBJD 3JVGC 2BO0A 2O5YL 4MHHG 3KPTA 3WSQH 3K81A 1BXVA 4HV8B 3Q8AA 5CEXA 1BBJB 3GIZL 2BIHA 3IFPA 3H4FA 3ATEA 1ES0B 3FFDB 4RMQA 2DY2A 4PREA 2EJ1A 2FSDA 3OKOB 1ZDQA 5ICXB 1WWBX 4NKIH 4UTAL 2ADIA 5DYOB 5E7BA 4OD2B 5D7JD 2WWNA 2EKJA 1S6NA 4HJ0C 3BPLC 1NC4A 5D7LA 1E4HA 4EXKA 2ZE0A 5IFHH 5J8OA 2G9HB 3QEHA 5L8KB 4OFVA 4QAMB 1XGYH 5ERWA 5C0DA 2Y72A 4J3OC 3SGKC 4OZHE 2X2HA 5C6TH 3PWPB 4G9DA 3T4YB 4YSPA 1E50A 2BWIA 1I8KB 3TPUA 2EDYA 4MDJA 4NSKB 2OL3B 3QI9C 4O2CB 5TE4H 1V5JA 2AAAA 1JRHI 4JFFD 1ZT1B 3BZ5A 5B4MC 3QAZC 3DX0A 2ATPB 3LD8C 3FRPA 2DQ6A 1BWWA 4L8BB 1NGXB 4M93C 5DVLA 5DEJA 2NDGA 3SBRA 3WS6C 5L2JB 1DO6A 2EDDA 4FLHA 1O6SB 4HJ0D 4U33A 3JTTB 4H13C 1U8NA 1AYOA 2OMWB 4GMTH 4CVZB 3OPUA 4PJHB 3HR5A 5IVXB 1JGEA 2O6FA 4OT1L 5I71C 4LCWA 3BEVB 4J3OD 2B3IA 4WNQA 2H1LM 3LRLA 2G60H 3VI4B 2O30A 1S3KL 2BWQA 2ZP0T 4WFFD 3MRMB 2DWXA 4YHKL 2Z31A 3CGTA 1FIGH 2NXZC 5DK2B 3QI9D 2XTSA 2WBXA 2QFPA 2VERA 5T1DL 3BHBA 4HV8A 4FKHA 5B4MD 3GMPB 1WPCA 3C8KA 1BBJA 1HXYB 3LKPB 2OMVB 4M8RA 2Q8AL 3FQUA 4G1MA 5K9KB 3INUH 3RTQC 4OCYL 3TV8A 3VAEA 3U6XS 5DSCA 4YZFE 5C9KA 3KPRB 5ICXA 1O6TA 1JZHA 3MRQB 1F8TH 3VXSE 5JO5B 4XPAH 3D39D 3CUPB 4YLQT 2DH2A 3VA2C 1LXMA 4HSAC 5BVPL 5F1OB 1C5BL 5IVOA 3CK0H 2NXZD 5JUEH 3WKMH 1PY0A 1FGNL 3PWPA 5D7IE 4Z7OE 1J0KA 4PIBA 4QRTA 4NSKA 4R7XA 1J0JA 1KFAL 2YA2A 4TOYL 1L0YA 2OL3A 2VLRA 2XY1A 4O2CA 4FCHA 4ENEC 2LV4A 1MY5A 4P2QD 4UV7H 4W9FC 3RA7L 1ZT1A 5GSVB 3BP7B 2R4RL 4L8BA 1HKFA 1NGXA 4FFYA 4ZAKB 3U36B 3DRQB 5L2JA 1OSYA 4P48A 4NC0B 1KCLA 1QW9A 1O6SA 4QLRA 4KAQL 1VEPA 3JTTA 2OMWA 2MQGA 4YR6A 4PJHA 4N87A 2VMJA 2X4RB 3BLKA 3BEVA 1J1XH 1YSOA 4XOBA 2Z7YA 2YRZA 1FO0B 2D0GA 5I74C 3VI4A 4DZ8B 1E3XA 3DDFA 3MRMA 4JPIA 4MVBD 1PAMA 1KACB 2XYCA 1EDHA 3JYBA 5DK2A 3QUXB 3MNZB 4ENED 2BHUA 4RRPA 4GO6B 3OLEA 1CBVH 1JMXA 1A2YB 4JFUA 1T5WB 1HXYA 3PHAA 4MD0B 3LKPA 2OMVA 5E1HB 3M86A 5LKNA 3RIFF 4H20H 4WK2B 3AG4B 4TMPA 3KDPB 1X5ZA 1SXCA 2AJVL 2OZ4H 1BD2E 1XF1A 3DKHA 3UG5A 4UM9B 3MRQA 2KS0A 2B14A 4KDVA 1GZQB 2H1PH 3HG4A 5E08L 2A1WH 1BBDL 2J8UE 3MVSA 2VDLH 2HRLA 3MOAL 4JFED 1OT1A 2N1KA 4WTQA 4YDJA 1H9VA 1D2PA 4FXKB 2YPVA 2RFXA 2GSIB 2VKWA 3FN0H 5CAYB 3VXNA 2H6OA 4JHWL 3TNMA 2AK1H 4BCXA 2F1BA 5I8KH 2P9RA 3TF4A 5CN1A 5J12B 3FSZA 2OMUB 1XAUA 3HS9A 2NLJB 4IGBA 3SKJH 5JHDD 3MOBH 4S1SL 5GSVA 4ZFQA 3O3AB 5H2BA 1ITCA 3BIKA 1CYWA 1KUMA 1EQWA 4ZAKA 3U36A 4ANUA 5I16B 5KSVB 4QGYA 5IKCB 4NCC1 5EHFA 4GSUA 3DV4A 4Y9GA 5ADPH 3P77A 1RI8A 3BN3B 3GMMB 3FB7A 4IS6A 3F85A 1FH5H 3KMDA 4KVNL 5CCHE 2J6EA 3U1SH 2GJPA 5H37A 3HMXL 1OP5H 1HHKB 5B39B 1MCJA 3UTZB 3M17B 1PCSA 3QUXA 3HG3A 3MNZA 4H26B 1LK3L 4LOEA 2H4EA 3L1GA 2VL4A 4PY8J 1QSFE 3RWJB 3EOAB 4CL7A 2AKRB 5C0BE 3SQBA 4MXVE 4Y4HB 5KVMC 4ZFZA 4GAJH 2F8OA 1UWFA 5KVEE 1A2YA 1RVFL 4N85A 3NEXA 3TESA 3D2TA 1F1DA 4NBXB 3H2PA 4A6YB 4M56A 4PRID 1OW0A 1NIEA 5I6XC 2CGRL 2WJ5A 3LQAL 3Q5TA 5FC9A 5HI5C 1NFDE 1RJLB 3VFUA 4W9HC 1SRDA 1E30A 4UM9A 1F6FB 3KGRA 2J12B 5JOEA 1GZQA 4NO0D 4RGNB 4R7LA 1F4WH 3ECBB 2J7LA 1BQ5A 1F3DJ 4OQ1A 1UASA 3FUDA 1WWWX 3K71B 3MBXL 1R5WB 3ESUF 1RK0B 4AYMC 4L48A 4ETYA 4NKQB 3ZYIA 2OMUA 4RBPH 3UMTA 2NLJA 2YAPA 2A9ML 3OKKB 3K72B 2PTUA 3O3AA 5HI5D 1V27A 4PSPA 5IW1B 2FVNA 3RZWA 5I16A 2K7PA 5IKCA 5KSVA 2WJ7A 4Z9KB 2YJLA 1A14L 4X6BB 4QRUB 1N6UA 4MNQE 2BP3A 3GMMA 1DVQA 3QJTB 1NOLA 4DUXA 5E99H 3SHSA 5F97E 1QBLL 2IJ0C 2CA3A 1FG2B 4IM8A 4XCEA 3T8XB 4L4VA 1HHKA 2XQ0A 3R8QA 3UTZA 3M17A 4HU2A 4GSXA 2OULB 4H26A 4YC2B 4FEIA 1PIGA 3EOAA 2AKRA 4L4TA 1I8IA 1WHOA 4RDQG 3GJFH 2FO1A 1KZYA 4MAYB 3C2AH 1YPZE 1F4YL 4A6YA 2EILB 1XBRA 1E67A 2ZOTA 1J5IA 1YJDC 3W11C 1FFRA 3W37A 2WP3O 3LTVA 4DP9X 4B41A 1WAEA 4HETA 4JG0L 3E2HB 3UG4A 5FGSA 5AOJA 3RYMA 1CU4H 3ECBA 1MCOH 2IF7A 1JI2A 2D3LA 5D1XC 3K71A 1R5WA 5SV4A 4UT6A 4Z3JA 2OM5A 5M94B 1E9OB 4PRPE 1YC8A 1RK0A 3QSKB 1UJ3B 3BRFA 2BOBB 3GBMH 5E5RB 2J1KA 4G3YH 2XHNA 4L1DA 2VDML 4HS8H 3R1GH 1OKEA 1RULL 3BAYA 3K72A 2EEXA 2VDNH 4OZHF 4H8PA 4OSUH 5DTFB 3TLRA 5IW1A 3W11D 1EZVY 1IIIA 5AD0A 3LRHA 4KI1A 1OWRM 1WWAX 1QSED 1PFOA 4RESB 1NEUA 3UEZA 3D87B 1JXJA 5I19L 1MF2L 3N40F 1QYGL 1SHWA 4K9EH 5DVKA 3G9AB 3AS0A 4B53A 5D1XD 1I9RL 3BPOB 3WUZA 1FG2A 1R3LB 5EDSA 3W2DL 1KTRL 3T8XA 3NPZB 2HFTA 4M4RB 3NCWA 2ZF9A 1INEL 4HIPA 3K91A 2HFFB 4PMEA 1TR7A 1HHIA 2D4DA 2YN3A 1NBVL 1TVBB 4HISA 4PJCE 1YNLL 5L8JB 2PNDA 1I75A 2VAAB 3CDGB 2BVEA 3Q0HA 4LOFA 4MCZB 4FI7A 4I2XE 1PSKH 2AZUA 3WEBA 3ZTJH 1AKJB 4LSUH 4JR9L 3WOVA 4MAYA 2CIIA 5LWYL 2J25A 3QDJD 4JW3A 3L4VA 3EYQC 1P1VA 3I3BA 1A7PL 3U9UB 3MLSL 1MIEH 4XVUC 3PNRB 1KWKA 2DI7A 4P9ML 3FO1B 1JF6A 2Z0BA 2YUWA 3TGXA 2HA1A 1SMAA 1RZ7L 2F5BH 4Q7DA 3EYUL 4FNTA 4U1HB 3MJ9H 3LZPA 4YZFF 4PYGA 3E1F1 1E9OA 4AV5A 4F2FA 4HPYH 1WYJA 1A1OB 5AW8B 5EEYA 3RZCB 2BOBA 3GDCA 2HRGA 3TC9A 4LFHG 3O11B 3MZGB 1YVLA 4XNZC 4POYA 5LBSH 3EYQD 5D7LE 5FA3A 4OCMC 5D7IF 3FU6A 4XVUD 1L9NA 4Z7OF 2O6CA 5ICUA 3WO3B 4LO9A 4P46C 3ZLQC 5E2VL 1SZNA 8FABB 4PJEB 3PCYA 4XMKL 1J5HA 2Z9TA 3DLQR 4DEUA 3CDCA 4A7GA 1KXTB 3G5WA 3BSHA 2FO8A 2JV6A 4AYID 3IRZA 1R3LA 2O5XH 1NCNA 4XCFL 1WFNA 4OZFH 1RZ8B 4M4RA 1RH8A 2HFFA 2R2EB 1FAKT 1JJUA 4WI0A 3HC0A 1TVBA 3F00A 2HFGL 1W16A 1I53A 2GTWA 1T7VA 2VAAA 4JFOB 3CDGA 2HX9A 3DSNA 5I76B 1AKJA 4KKBC 4LCWE 2DLIA 4L0ZA 4MMZB 4WWPA 4TQIA 4ZXBB 4P46D 4C4BA 1PGRB 1SEQL 1ERNA 5E7FA 1LQSR 2D7TL 1OAXL 3G08B 4PRNB 2ATKB 3SDDB 1MG2C 4OLEA 2W0FB 4DWHA 2H2SC 1QPXA 3WTTA 3IDYB 4U1HA 5JQIB 4Y2LA 2HX8A 3HPJB 4JHAL 1P2CB 2NY2C 4JY5H 4RISH 3RWCB 2EADA 2YK1H 2Z65C 1IFRA 2R2HB 2CCVA 1TPXC 5EN3A 1MPAL 1ESOA 2NQDA 3RZCA 2X28A 3A21A 4KKBD 4BE5A 3EFFA 1JPGB 1NCWL 3O11A 4L2LA 4MHHI 5K1NA 1XR9B 3ASOB 3SGDH 1NCBL 1XX9C 3SB3A 3GB7B 3GXFA 3ZQWA 2X89A 1TCMA 3PWPE 3V5DB 3LKOB 4PJEA 2IFFL 8FABA 2H2SD 1AGFA 1KXTA 3GSOA 1RU9L 3DIFB 1U0QA 4GKLA 2VLRE 2NY2D 3O6ML 2DQTH 4YHNB 3LPGA 3N44B 4V2BA 5FUOH 1CZ8L 1SYVB 2WKLA 4AGNA 4JKPH 2R2EA 4LRNH 4XPTH 4RIRA 2ARJB 3MLYH 1F18A 5BO1H 1HYRC 2Y23A 1F90H 5IB1B 3L9BA 4JFOA 4D94A 1A9EB 1JCVA 4Q9BA 1OM3L 2NY5L 4PJHE 1JZFA 3BAEH 1AQDB 5EA0L 4XO8A 1GTFA 3VI4E 4IMKC 3BO8A 5FK9B 4WGKA 1Y18B 3VX0A 4MXVF 3S37X 4PV1C 3G08A 4PLKC 4PRNA 1VGEL 2ATKA 4GI8A 2Y36H 3QXVA 1DJIA 4G6KL 4X9FA 4ELKA 5HBBA 1LEIB 3BLBA 1MHPL 1I3GL 3HPJA 1NDGB 4PWFA 2J57A 2BIPA 1P2CA 2V5TA 3UC0H 1ZJBA 3RWCA 3S8GB 4D7BA 4UILH 4FA8A 1IGYB 4U31A 2R2HA 3OX8B 3EJQA 3IM1A 4IJ3C 4GLRH 4JANB 5CKAA 4H2AA 2CR0A 2E8ZA 2Y7LA 3RURA 4IBWA 4JJOA 1NUNB 1X6LA 1KELL 5IIEB 3DX3A 3SYAA 1FSKB 2VXQL 4JO4L 3P30H 1HQ4B 1XR9A 3TT3L 3UADA 1VF5C 3TT1H 1QACA 4PLKD 4APQC 2UXFA 3GMRB 5BUPA 1SOXA 4H4NA 3TBWB 4H7VA 3CJJA 3CLWA 1CBJA 3DIFA 2IG2L 2PTTB 4O02B 2RQ8A 2E7CA 2HYMA 4YHNA 2KZ1B 1BYOA 1PIFA 4XZ4A 4EUPB 3WFZA 4WKZB 5JOPD 3OMZA 1J0IA 1U6AH 2CRMA 1JP5A 2NNRA 2RCSH 4EMZA 3CCHB 5C08B 2OCCB 3VWKA 2UZPA 5KJRH 2KZBA 4AY0A 2HTKC 3HNVH 5F93C 1E8WA 1XH2A 2ICEC 5LDUA 1E2VA 2XDHA 2Y07H 2EKSB 1AQDA 4NOBA 4APQD 1W2KT 1SOSA 3D3VB 5F7EH 2ITFA 3IN0A 1MRCH 4XPHL 2CUHA 5FK9A 1Y18A 2QKIB 3Q1EA 4R0LC 5SX5H 2Y2WA 4I77H 1U8CA 4XX1G 1DLFH 3VM5A 2W1NA 2XUWA 1YPZF 1LEIA 4N0YL 4YBHA 1JI1A 4XCYA 3V6OA 4L3CB 4JM2B 5E2TL 4AQEB 2VDRB 3K6FA 3VB9A 1VACA 2GY5A 5CINH 1M2VB 3GHPA 5G4NA 1IGYA 4Y5XA 4JGMA 2VDQH 1KTBA 2HTKD 3DK0A 2F08A 1QZ1A 4JANA 3IJHB 5J06A 3LN5B 4U1MB 2Q3ZA 5EBGA 1FYHB 3K80A 1ZLWH 3TYFB 1GW0A 1TG8A 3UZQB 1HQ4A 3DETC 2H32B 2PCYA 3JWOL 4OFQA 5AZEL 3HE7B 4TQHA 5EOQH 3VFGH 2J21A 4BH8A 1HJCA 1G43A 3T2LA 1MNUH 2EDFA 3ZGHA 3TBWA 3OAZK 2D7PA 1VPOH 3CZNA 4YHIB 1DQML 5IJDC 3RY5A 1WJ3A 3HLAB 4YXHH 5E00B 4HDIA 4O02A 3EF4A 4TVUA 4XNYH 2KC0A 1U8KB 2NY4C 3RDTB 1G6RB 4EUPA 5GZNA 4AMXA 4WKZA 1CDBA 3FTGA 3G5ZB 4J3OG 5EU6B 3SDYL 4BXVA 1NSNL 2ICES 4DKDC 2B0SL 4K94H 3CCHA 5JHLH 1OVZA 5C08A 2GJ6B 3VFNB 2CM5A 4HJSA 3DETD 2FHCA 1KGYE 4MAZA 5CR8A 5MEND 3HI5H 4NO5B 3UAEA 4AVHA 5I15H 2DTML 2DLTA 1SUHA 4JHBA 4L4VE 3D3VA 5JW4M 3P4OB 4PS8A 3GBDA 4NC1C 1B4RA 2VM9A 3L5IA 5A3ID 5AW1B 2NY4D 5GGVH 2XXMB 2WSPA 3CZGA 3QK0A 4JKMA 4L3CA 3BAIA 4AQEA 3BMVA 1IGIH 3C6LC 4S0HA 2YZ8A 3MCLH 4PCSA 3SGJA 4LVNC 3QJVB 3TWCL 4TQPA 5KYUB 3IJHA 3LN5A 4U1MA 4PCKA 1V8HA 3TYFA 3U7AA 4RGNE 2DWDB 3UZQA 2QVIA 4BFKA 4PB9L 4L1BA 3CDFA 3HE7A 1MLCB 5JW4Q 1ZXQA 1ZS8B 4ZMVA 2R9HC 5EU5B 3HZMA 5EOCL 5G4OA 2WTRB 3KAAA 3MV9D 3QNFA 1NCAH 2X1WL 3APCA 3L3JB 5K39B 3HLAA 4N68A 3C6LD 5EU3A 5FO8B 1U8KA 3RDTA 4KPHH 3S36X 4DIXA 4B9ZA 1ZANL 5CWSB 4H1LH 5EU6A 3V0JA 1MXGA 4PJAB 1I85C 3W82A 1PZUB 1M57B 2WN2A 1QEXA 2GJ6A 1J8HB 5AVSB 3EW3B 4DTGL 3VXMD 2K7QA 3V10A 4LPUA 3PWVB 5BOZG 4NJ9H 1WG3A 1WT5C 4ZMYA 4MNHA 3UTQA 5D71L 5IJKA 2R9HD 5DXWA 2N7AA 1XFPA 4XPBL 2GUYA 3HEIB 1BP3B 1KJVA 2ZKMX 4NHCL 4QWWC 5KOVC 1EJOL 3DI3B 5GS2H 3LEVH 4WY7L 2Q8BL 5F7FA 2QBWA 1KFGA 5EO1A 2XQYA 1SNRA 1KDJA 1YDPA 2YWZA 1B4LA 3EYVB 1OF2A 3G5YB 3QORC 1QSVA 3ZDXE 2CKBA 3Q6FB 5KYUA 5TE7H 3VXPA 5C3TA 3T2NL 4GEJA 3P0GB 4JPVL 5MEOB 4BH7B 3IN2A 1MLCA 4PGBA 2JQZA 1MH5B 2I26N 3GHBL 3IE4A 3X3FL 4BZ1H 4QWWD 3I9AA 1ZS8A 1NGQL 3QRBA 4MCYB 5CJXC 3ZMNA 4AYFB 3S35H 2WTRA 2Y69B 5A2LH 4YOKA 4FMFA 4L0YA 3L3JA 3MREB 5K39A 3HAEH 4EBQL 5FPIA 5I1DB 4LVOB 1QRKA 2YKLL 2A9NL 5T1MB 1NEZB 3NACH 4FNUA 5KVDH 3QORD 5CWSA 2YPKB 4E9SA 3MRPB 1WHPA 3HI1B 1BF2A 2PMZA 4PJAA 4PIRF 2X9YA 3H56A 2H0FA 3KYKL 4LP4A 3ZE1B 4AE1A 12E8L 1J8HA 3MNDA 5K9QG 2AV7B 1KIUB 2R4SH 4G6FB 1FORH 5HJ3B 2HCZX 2ICWI 5CFHA 5J6HB 2DD8L 2GHWB 3FTUA 1MAML 4HWEH 3MBWA 3RKDC 3W57A 4F91B 5JTWA 4OGXH 1DQJB 2FTAA 3LRGA 1AHWC 4N25A 2K6YA 2YXVA 5F44A 5GHWL 3D0VB 3OBAA 3U30C 2EVFA 4PJHF 4U6VH 5IVXF 4UAHA 1HFUA 3RUGA 2HRPH 4N0CC 3WAJA 3VI4F 1D6EB 2BSSB 3EYVA 1S3RA 3IMSA 4S1QH 3G5YA 1BYPA 3R18A 1JOIA 4XN5A 4AQZA 3TBVB 4LEXL 1FQ9C 3V4PH 3PGFL 3BUIA 3TH4T 3Q6FA 3KEHA 1N8ZB 4J27A 4H8WL 5KSUB 3ZDYB 4WDIB 3HOGA 5CCJA 1P1ZB 2WB7A 3RKDD 4NP9A 5MEOA 5DEZA 4BH7A 4I4WB 1O6VA 4NKOA 4AIXA 4DO6A 2Z1KA 1CGSH 2EO7A 3PWLB 4JDTL 2VXSH 2WTOA 2EIEA 2R7EB 5K59E 3TFKC 3SZ6A 3CU1A 5D1ZI 4GRLC 2WLIA 3MREA 4N0CD 5I1DA 2B59A 4IEFB 2C7FA 4OAWB 5AW9B 4J23A 4JGJA 5IMMB 3HRZA 4XBEL 5T1MA 2EP6A 1NEZA 4AL8C 4OD3H 2IPTL 3LYRA 4G7SB 4HULB 2YPKA 1HT6A 5E9AA 2EAEA 3MRPA 3HI1A 2IQ9H 1S8DB 4P5TA 2XV3A 2WO3B 2VDOH 4P3CL 3BUPA 3AB0C 2AV7A 3UYRL 1FA4A 4PJEE 3FB5B 1FHNA 4Y89A 2NY6C 2Y2YA 2ZAHA 4M43L 5J6HA 2VH5L 3QIWB 1A5FH 3KPMB 5L2KB 1JWMA 5IMLA 4CC0A 1I9EA 1NUFA 4JB9L 2YFOA 4I0KA 3U0TB 5IBUG 3TFKD 1GGTA 2YQBA 3JTBA 2JNZA 4GRLD 1PDKA 4P2OB 3D0VA 4Q9QH 2M26A 2WZPD 1ZJAA 1LMKA 2XVKA 4PI2A 3Q1SL 3FTVA 4F3FB 2DDQL 3OD3A 1OCZB 4JJHA 4F7EB 5C2BL 1GGIH 4QLWA 2ADJB 2YUXA 2Y5EA 5C71A 4IBTA 4XNUL 4YE4L 2BNQD 1TZIA 2JKTM 4QXGL 5F6IB 5BV7B 3INOA 2NY6D 1CF1A 5FM4A 2DB8A 2IBBA 1N8ZA 3QG7H 4I3GA 5KSUA 2YD1A 5DFAA 1P1ZA 2YBRB 2UUDK 3LCYA 2DIBA 4POZC 2BVOA 1KBWA 1OWWA 2YUVA 1PFCA 5FA4B 4BFIB 4NNPH 2QHLA 4A04A 1IL1A 1IGFH 2VQ1B 5I75C 5DFVC 4JM4L 2R1YB 3RB5A 1L0XA 3UEQA 5JZ7C 2R7EA 4F15B 3C12A 2Y3AA 3LPOA 4FLOA 2G0LA 3J27A 3OLIA 4WV1B 3LXAA 4WWNA 4IEFA 1R3KB 2OPCA 4R8WL 5IMMA 2O1AA 4AG4H 1DQTA 4NPKA 3D2UD 4Y5YB 4J2XA 1EFXB 2OR9H 1S8DA 2YLKA 3AM8A 1KBKA 3QYNA 4KKRA 3CAFA 1A6UH 2VQ4A 3FB5A 5DZOA 3NFNB 4POZD 4J5VA 2CWRA 3WUWG 3QIWA 2A9BA 5L2KA 1SLVA 2IDSA 3HA0A 1UD6A 5DFVD 4QTIL 5JZ7D 3DTXB 4NQXB 2E7LC 3U0TA 3ZHNA 2QSQA 1L0QA 3BIAX 3QQNA 1BQLL 1YUHA 2HT2C 4YBQD 3CFJA 3SO3C 4GKNA 4HG4K 3T3MB 2O61B 4I18C 4AYEC 1DZBA 4F3FA 4F7EA 3QDGB 5GGQL 4FYRA 4Y4FC 1W72H 3FPYA 4S10A 3QYMA 3G6DL 3SPVA 2DWYA 5GGUA 1H5BC 2X4QA 1PNDA 1T0PB 2V8MA 4JY6B 1CFNB 4P5RA 4YSOA 4LMQI 4CMMA 5DT1H 4ZFOL 4K2UH 4LGPB 4YO0B 3ROLB 4B9KC 2XV6B 3PAVA 3NCFB 4OBRA 2YBRA 4LU5H 4GAFB 5DLMH 3EOYG 5FA4A 3V6OE 4BFIA 4K07A 1J9CT 5I5JA 2VQ1A 2HT2D 2R1YA 5INDA 2KQMA 1N4XL 1XIWB 2DEYX 3I6LD 4O2EB 3GK8L 4Y19B 3TOPA 1R3KA 4QDGA 4Y4FD 4OJCA 1OGAA 1RUMH 1NIAA 1CYGA 4AJ0A 4DNLA 1EXHA 2NY7H 1CF8L 4G8EA 3GSVB 4Y5YA 1ID5I 3RQ3A 1EFXA 4WSKA 4YBLB 1AD0B 1G7QA 2OBGA 2YJQA 4AC4A 4JCLA 2I7SA 5KBNC 1D3CA 4KY2A 2HVJB 2WLNA 4OCRL 1NL0L 1YMHB 4HIHB 1B4JH 3NFNA 4GY4A 4MCMA 2WYIA 5AKVA 1J88A 4JO8A 1YMMD 1E5YA 3DTXA 1DBML 4FL4B 4DGIL 3BGFB 3FYIB 2ZXQA 2IAAC 5FF6B 3QZMA 3RDJA 5I1LA 2BLFA 1KBBA 2JI3A 1E4XI 3LV3B 2VZVA 4K3DL 5C08E 1OPGL 4QTFA 3D85B 2DYPA 4O9HL 3QDGA 3QFJB 1EUUA 4PS7A 1PD0A 1IAKB 3P4NB 4ODSH 1CL7I 1M7DB 1NC2B 3D3VE 4U4IA 3J2PA 4Y9FA 5IROC 3PDGA 1CFNA 3WE6B 4FI6A 3EYOB 3S97C 4YO0A 1G9NC 3ROLA 3IDGB 1DBBL 3GPEA 4PV9B 4OGAC 4QY8A 3T8VA 5DMJB 1UA6H 3QRGL 3NIFB 1L7IL 1JMZA 5IB3B 3D34A 1O75A 1XIWA 2FWUA 3D9AL 3C5ZB 2GJZB 4NAMA 4K3EH 4G7YH 4O2EA 1KB9J 3OAYH 2QPFA 1BJ1H 3LEXB 4HGMA 2ZUQB 4B0MM 1X5HA 3EUUA 2JIXB 4WEBH 1P5UA 2NUTA 2X6VA 5IROD 2WBWB 4A2LA 1AD0A 4Y1TA 1CE6B 1HXMB 3VGGA 2HVJA 1VA9A 1YMHA 1TQBC 1O0VA 4B3EA 4HFUL 4OGAD 4XMLH 4P3WA 4N2FA 4XZUB 5KYNA 1CVRA 4Q8BA 4HAFA 1C5CL 1A6PA 2R23A 3WTSA 5BMFH 5EU6E 2OCJA 5FF6A 3PL6C 4FTVA 1TCRB 2FQEA 4YAQB 4LDOB 3LV3A 2GJ6E 3KCWA 1O7SA 1Z0NA 3CZLA 4TSAH 4G42B 1F6LL 1A0QL 2W88A 4U6TA 2XA8L 3UDWC 3QFJA 1JF1B 2X9XA 3CFCL 3CH1A 2NZ9C 1HINL 4WFEE 3JV6A 4HWNA 1NC2A 3H53A 1LYQA 4IOSD 4BFNA 1U8LA 3HN5A 5DUPL 3TO2B 5D4HA 1QI5A 3WE6A 4N2NA 5GISL 3EYOA 3HS0C 5EUOB 1CWVA 2ZG1A 5B7MA 3GSUB 1IVLA 3F12B 3BI9X 4PV9A 4MASA 4AI7A 1WTGT 5J13B 3PL6D 2BPBA 1TJGL 1I3VA 3HHMA 4M7KL 3C5ZA 4R26H 1NMAL 2F53A 4M29A 5LN8A 1OANA 5KVEL 1KPVB 2EDLA 2NZ9D 4MWFA 2WWKT 2JIXA 2DV6A 3WS3B 1WVZA 1XGQB 2IPUG 2L8AA 4LAQL 1SOKA 1G7IA 4K8RL 4RWYL 5K59F 1LE5B 3LKNA 1CE6A 2ICWB 1KXQA 3W9DB 1HXMA 4KHXH 4HPOH 1KIRA 1JV5B 4LASH 5FO7A 1XMWA 3TXAA 4YIQB 3I9GH 3EJSA 2C9AA 3KXFB 4OM0L 2Z35A 4ZT1A 1K6QL 2VSKB 3HE6C 3BX7C 4IDJL 4YXKL 4BXSV 1JGVH 1TTUA 1NTDA 2I27N 4NX0A 4Q2ZA 4PJEF 4PJAE 1TCRA 1GY1A 2SODB 1J8HE 4OD1H 4F20A 1ORSB 5T1LB 1TQCC 4G42A 5MERB 5MP6H 2BY1A 4LT7A 5BW7C 5JDJA 3T8MA 1SXZA 4PG2A 1GS7A 3MRLB 2VO5A 1PX8A 2EACA 4X0KB 3WFHB 1RK1A 3BP6B 4K73A 3TO2A 3M45A 4FQCH 1ET8A 4W9IC 4BSJA 2FGWH 2EIMB 3JWDC 3GSUA 3HE6D 3F12A 3GZKA 2IDCA 3RU8H 2VAJA 5D7HA 3SJVB 3RUGE 1MZYA 3CHQA 5CZVH 5D1ZB 1XCQB 3DMMC 2C3WA 4AENA 4TSBH 2X09A 3X1GA 1DBKH 5E1QA 1KPVA 3T0VA 4PJ9A 3F7KA 4M7JL 2D7OA 3C5JB 4TNFA 2W65B 2XCMC 3WS3A 1N9PA 1XGQA 3DROB 2OSXA 1N0XL 1FE8L 3K3QA 4NN6C 1LE5A 2LVEA 2OZNA 2ICWA 3M7OA 3W9DA 2V9RA 1RZJL 5TF0A 1P7KB 1P4IH 4PJ5D 1RIHH 5I26A 1JV5A 2R8SL 1I1AC 2VXUH 3QUGA 4MJ2A 1IQWL 1A6AB 3KXFA 3S37L 1N6QL 3MCKA 3DMMD 4HA1A 1MY7A 3F84A 1S7RA 3KPNA 1PEZA 5CSGA 4A2GA 1PLAA 4HK3J 2ZOOA 1AS6A 1N68A 2XWZA 3NTCL 5GGRY 3RWDB 5E4IA 1ZVYA 1A64A 1ORSA 5T1LA 2Z4QB 3ILDA 4PRAA 5BXFA 2X2YA 2EUZA 5MERA 1CICB 3MNMA 1RPUA 3N44F 4OZFG 4Y8DC 4XNXH 4KK8C 4OCLC 4AMKL 1ZIAA 3MRLA 1QEWA 3OGOE 5EZJB 4X0KA 5I1KH 3QXDB 2AEPL 1U8HB 2GTZB 3BP6A 4AQAB 1I1AD 4P2YA 2X7LA 3LS5L 1BQUA 5DZAA 1PS3A 3AZUA 3ETBF 4U6YB 1CO1A 3MBEA 5K9QI 2HLEB 3OLGA 5DFTA 2MCG1 2CO2A 4JZJC 2ARWA 3KPOB 3SJVA 4ZMAT 2JVUA 4L3AA 1BEXA 3BKCL 5ICYB 4LHJB 2QADB 2XN9A 5D1ZA 1C9SA 1XCQA 4YHYC 1G7PB 5FYKD 1JSYA 4YXKH 2V0AA 4BKSC 5E6SB 2DKSA 1CR9L 5CN3A 6FABH 1C08B 1LO0H 3H55A 4K7PH 1Q4NX 3DUSA 3VFPA 4KK8D 3ZDYE 3C5JA 4PVBA 4NHUB 2CLRB 3DROA 3ABZA 3O4LD 2BXZA 4OFPA 4D0CB 1NCCH 5T3ZD 1N19A 1VESA 1BJ8A 4BV1A 4X9HA 3VRLE 1P7KA 4UU9A 4E9WA 4JO1H 3U0WH 4ZQKA 4D9LL 4XHQA 5GRJH 1BFTA 4PBWD 1A6AA 5JLZA 1LNUB 1NGWB 5F7WC 2WINB 1KGIA 1CFVH 2VZSA 4KQ3H 4XNMB 4GUQA 3GGWA 2J1WA 4RFNB 5HHXL 2XTJB 1WQVT 2XXGA 2Z4QA 3IKCB 4MGXA 1DBAH 1DSFH 1MSPA 2K3TA 3MJGX 5L2KE 5EZJA 2BVQB 3GFUA 1NPJA 4NQQA 5DVNA 2GTZA 4H25B 4AQAA 5EIIA 4U6YA 1A7QH 2RD0A 3QIBB 3NAAL 4JPSA 3KPQB 4JFDA 5E51A 4U1JB 3MO1B 3VO0A 4U1IB 2J8OA 3SOBL 1CD0A 2R0ZH 3C09C 2VN5A 3AXLB 4GXUN 5ICYA 2ZKYA 1M3JA 4KKAC 5E23A 4NM4H 1G7PA 5DK0B 4PP1C 4UT9A 3S2AA 5ETUB 1ZHNB 3B9AA 1BX2A 4DP4X 1IZKA 5C86A 4LSQH 2WVSA 4AZUA 4L1HA 4NHUA 4JM2F 1M56B 2CLRA 4ZX5A 3U0PA 4D0CA 4FZEL 1CDIA 4R97C 3ZT6A 3SPHA 1MRDL 4B5EA 4MJJA 3WY3A 4DEPB 3FTYA 2X4NB 3GBNH 4FFZH 4P4KB 5HGDA 3L6FB 1R3HB 3BH4A 4LSPH 1NGWA 1A4JB 3R0NA 2WINA 4KKAD 1ACXA 1EDYA 3UO8B 1OGAE 3ELQA 5DS8B 4E41A 4PP1D 1NANH 1DJXA 3FCTB 3I50H 1IEHA 1CE1H 4AZ8B 4XNMA 3VB8A 3DVIA 1ZXKA 4RX4A 1DQIA 3W56A 2H0JA 3NCXA 3IKCA 2RBLA 4G82A 1ID2A 3G3LA 3VD4A 3NEOA 1UOKA 3ABGA 1P53A 4FXLA 4NEHB 2UY6B 3KYMB 3C8HA 2BVQA 2OXGB 2WKOA 4H25A 4H40A 1NM9A 2DRUA 2L7UA 4WI2A 3TEUA 1PKQB 4AGMA 1HHGB 3QIBA 2BFGA 3KPQA 3V0WL 3WYRA 4U1JA 3MO1A 2OL3L 1PZ5B 2WBJB 4U1IA 5FO2A 4XO3A 3QEGH 1XCTB 3T3ME 5ID1B 1MCDA 1EHAA 2A6JB 3QDGE 4S1RH 5JPNB 1BWMA 1K72A 2KDYA 1KCUL 4FFYL 4FHKA 2BXYA 3IAPA 2W9EL 1FYTA 3D4CA 3S36L 1SF5A 4LESA 5ETUA 1KGCD 1QHOA 5DRZB 5IW6B 1MELA 4TUJB 1OAQL 4AT6B 4XPFH 2ARJQ 5B8CC 5DURD 5D7JB 3SDCC 3VGHA 4IBVA 1NIDA 1JDCA 2XETA 3GEWB 2DQFB 3OSKA 3O4OB 1W91A 3D25A 1HOEA 4BCZA 3QUZC 3FPXA 3WNOA 3RY4A 3CVCA 4PTUB 2F1AA 2X4NA 3T0EC 3U6RB 5J5EA 1R3HA 4JJ5B 1A4JA 4JY4A 1W0WB 3ZN6A 5I23A 1CDUA 1A7NL 3Q6GL 3FQWB 3FCTA 3KYOA 4WCYH 4JFFB 4YGAB 1NMCC 3T0AA 2VMCA 4L18A 1YEGL 3GSXB 4GBXC 4AQ8A 4D8PA 1JNHA 1TTRA 4WHCA 4XP5L 3HMWH 1J5OH 3DSFH 2YARA 3CD4A 3CIQA 5HDLA 3SDCD 3UH8A 1QA9B 3BPLB 1YYLH 1G7JB 2ZX6A 1S7UB 1EBAA 2O5YH 5EU7C 3QUZD 2UY6A 3KYMA 5ADOL 5GZOA 4PJAF 1UD5A 2LLGA 2NSMA 2OXGA 4HMCA 2YPVL 3T0ED 3GIZH 4LKXB 4HAKA 2GK0B 4OU3A 2YEVB 1HHGA 4FTVE 3KPSA 3QI9B 4MKMA 2XQYK 1ZLUK 1ZGLM 1ZLVH 3N9GL 4UTAH 1OT4A 1XCTA 3MRKB 2QPSA 4JCMA 1S7SB 2K6ZA 2A6JA 3QAZB 3LD8B 4BGLA 4M93B 4JUSA 3QFJE 4GBXD 5ID1A 5JPNA 3V0HA 5EEZA 4M3HA 3WN5C 5DRZA 3PGDB 4TUJA 4HQQL 3ULUC 4AT6A 5I71B 4FNPA 4GRWH 3BRGC 3D39B 4JMNA 2J6EL 2ZSWB 4ZNEA 2HVKB 2YWYA 2EIDA 3AACA 2H5UA 1F56A 3KHQA 1Q9LB 1YYCA 3S4SG 1SN2A 2IDQA 4MJID 3SE4C 3QYCA 2NXZB 1DO5A 2EVJA 1ZDSA 2NX5A 4BFGA 2D3JA 3JVGA 4N2KA 2X4SB 4PTUA 3U6RA 2F53E 1IC5L 5CIPH 4CVXB 4W4OA 1IRAY 4JJ5A 4XMZA 1ONQA 3BEWA 4IBLT 3CC5A 5FFLA 1FWXA 1HILA 5GIRB 3FQWA 4JRYD 1U8QB 4P2QB 3RTQB 4NZUL 5AOIA 3A6OA 3LOWA 1HQRB 3ULUD 4IRZA 4N90D 3FQRB 1INDL 3IU3B 2VMEA 2GABA 3MUHL 3NCCB 3OHMB 1KXQE 1S3KH 4XH2A 4YHKH 3ULAB 1DEEA 1OGSA 2VDKB 1C5DB 4ESKA 2ENYA 4I1NB 4QOKA 1AXSA 2BMKB 5T1DH 3SGKA 4H1LG 4FXGC 3AREA 1JN6A 5IK3B 3R7QA 2FX7L 3ZE1F 2ZTBA 2Q8AH 5I73C 1E3FA 5IESL 3K6SB 2GK0A 4OV5B 3PDDA 2E7MA 4OCYH 4PAZA 4ACPA 5HD8C 5L88L 4OB5L 1YNTB 2J5LC 1FNFA 1E5UI 1UCBL 1BJ1J 1HDMB 3I6KA 3VQLA 3WS6A 3ZRFC 5BVPH 1C5BH 3CXDL 3GIVB 1GR7A 1VFMA 3DPDA 1FGNH 1HHJB 4ZTPL 1WZLA 4UQ2B 2FT8A 2ZSWA 2HVKA 1YHPA 1KBPA 1KFAH 5I74B 4TOYH 4LCYB 2XU9A 3B9KA 4JFEB 3NGBC 3RA7H 5HD8D 2FBJL 5EZLB 2R4RH 2X4SA 4MMYB 3ZDYF 5E6YA 1KIQB 4CVXA 2KHAA 3I9PA 4FS0A 3CSFA 4KAQH 4HSCX 2AQ1A 4M48L 2E46A 5GIRA 1E4WL 1U8QA 4A6YL 4B60A 1HQRA 4LVHC 4EI6A 1NCUA 4OKDA 2JB5L 2G2PA 4J3TA 1XF4B 3ZYJA 2JCCA 3ARWA 1C5DA 3HAEG 5HHPB 5EF2A 2PYFA 3LPFA 3KLSA 2BMKA 3KXFE 3OVUB 4JFTA 3FKUS 3N0PB 4M02A 5GS0C 1RAMA 1TYJA 2WQVA 2E9WA 5IK3A 4UT6L 4P2RD 1IAOA 3K6SA 4OV5A 2WMPB 1CIUA 1ASOA 3FHEA 3ULVF 4M6AA 2AJVH 4R5VA 1T1ZA 4MZRA 3V6FB 2AXGB 2D73A 1HDMA 2MOQA 4PJ7B 4WHYH 4I3RL 3TA3C 5E08H 2BZDA 5AVWB 5IR1A 5JQHC 4PGZA 1BBDH 5T1KA 1C12A 2BP8B 4PRIB 3QWOA 3MOAH 3TU6A 3GIVA 2DQDL 4HJJL 2VQUA 4Q6KA 4KBPA 4QRAA 4UQ2A 3JBG7 3QC5X 3V6ZB 5GS0D 4NO0B 1VAHA 3FONB 4JHWH 5IQNA 2YD5A 4LCYA 1UACL 3SJVE 1M6UA 4J8RB 3LZOA 5C6PB 5D7SL 1ETA1 4JFEA 2CQVA 4U7KA 4S1SH 5EZLA 1HNGA 2YAEA 2ID5A 3KWVA 4MMYA 3GYRA 5TH2B 3K1DA 4Q9RL 5IVZB 1T1XA 2VKXA 2Y6SC 2ZUXA 3H7BB 3TA3D 4X4YB 5CR1A 1RV6X 3P0YL 4B9YA 1A9BA 2PYEB 2V8LA 5JHDA 4P06A 4KVNH 5I6XB 4PR5B 5J1AB 3HMXH 4EZLA 4HWBA 4HJEA 5F1NB 3QH3B 4AYSA 1XF4A 2VN4A 3GBLA 3AABA 5HHPA 1U8JB 2CCLA 1HH6B 1LK3H 5SWSD 2JK5A 1TJIL 1FAIL 4OIBA 1VB9A 1C7TA 3RL1B 3M07A 3NH7L 4FZ8L 2DL2A 4Y1AD 1EH9A 1RVFH 2FCBA 1UD3A 2VN3A 4K5OA 2WMPA 3T3PB 2Y6SD 1AI1L 1IO4C 4TL4A 3LQAH 3U4EB 4N1EA 1FZOB 3FUNA 4PJ7A 3X11B 5IBUB 1IGJB 2BP8A 4PRIA 4C4KT 1UT2A 5I1CL 1WV7T 1GMIA 3MBXH 4J39A 3T3MF 4JFDE 4L4JA 5FM8A 1SFDA 3V6ZA 3KL5A 3LH9A 3UPRB 5GS3A 2W91A 3DJZA 2GB2A 2F18A 2P8MB 4J8RA 5AL0A 2A9MH 1TF4A 4W4NA 3B9EA 3CVDA 2NNCA 5I30L 3I02B 2H26A 3NFSL 5D7KD 4F33B 5J1TC 5TH2A 3PGCB 3B1TA 4N0UB 5CGBA 4CC1A 2NXYC 1AIZA 5IVZA 4WK0B 5BVJB 1A14H 2ISDA 1MCSA 3HCVB 1U3HC 3FTWA 4G8GA 2MCAA 3ZSTA 3KW8A 2EYSB 4D0BB 4M61B 1TQSA 1BG1A 3DIVA 1LILA 3WDHA 2KERA 1QBLH 4PR5A 5J1AA 3QARA 3B34A 2RH0A 3APDA 5F1NA 1A7BA 3DA0A 1RUAL 3TBTB 1QSEB 3D08A 4RNRB 3V4VA 3DJSA 2UVFA 4GAYB 4P57B 1HH6A 4UM8B 5E1AB 4GAGL 1MDAA 3A4FA 4EZJA 3FB6A 5D1XB 1G7HB 3RL1A 3P3SA 4E41E 3BH8B 3MODL 3WHE1 1F4YH 2NXYD 1JRHL 1J9QA 3EH5B 1U3HD 1MJ7L 3WUWB 2XTJE 2GVYA 4Z7QE 1FZOA 2XZCL 3BT2L 4KI5C 5LDSA 5HGHB 3X11A 4JG0H 1GJWA 5KS9A 1IGJA 4LMQE 1EEUA 3DX6B 4UQ9A 3QDJB 2WXGA 1U3NA 4D0DB 3OAWA 4ZTEA 4WI4A 4Z3TA 3FO2B 1HOCB 5ISZD 2K9FB 3CZJA 5D55A 4XB7A 5IY5B 5F9JA 1NA8A 4AM0A 5BUAA 5AVYB 4PPTA 4PMFA 1T2JA 1J87A 2VDMH 4L8DB 1WP6A 3RB7A 1RULH 1WWCA 1FYTE 1TIUA 3I02A 4F33A 4N0UA 4KI5D 3GLAA 4QHNB 3NP4A 1I7UB 5BVJA 1E6OL 1P9MC 2Q76B 2XWTB 3PWNB 2ZX8A 3B7SA 4OM1L 4A1RA 5I19H 2EYSA 2F9BT 4D0BA 1MF2H 2A4ZA 1QYGH 2UY7B 2AQQA 4M61A 3W39B 5CF3A 5AB2A 1MAKA 3NIFF 1F86A 4FX5A 3W2DH 4X9YA 3ZRSA 4F8QA 4KJQC 2WXPA 1INEH 4WEMB 1MFMA 3TBTA 2VDLB 1D5RA 1NBVH 2WLZA 4GAYA 4UT7L 4P57A 3BCDA 4UM8A 1YNLH 3FQNB 4LLVB 5E03A 3T9WA 4UF7C 4XMVA 2DF3A 1G7HA 2FB4L 4KKNA 4BSWB 4M6NL 3BH8A 2F7QA 5LGJB 4JR9H 4ZPVB 3WNMA 1AR1C 5LWYH 4LL4A 3GRWA 3CH8A 3KWWB 3EF7A 1A7PH 3WUWA 3MLSH 2J8HA 3LH8A 4XNZB 4P9MH 4X4XB 1BZDA 1MCLA 4EN3A 1IKNC 1DQLL 4KJQD 1RZ7H 4NI3A 4WJG3 3QDJA 1SQMA 4P46B 3EYUH 4WW1B 4D0DA 1UM4L 4F9PC 1X9UA 3LKQB 4GKZB 4PBVC 2A74C 4LEOB 3FO2A 5DRNB 5ESAB 2FATL 2W9LA 3KPSE 4U3XA 5FFGA 1HOCA 2C3XA 3IWUA 4Z7UB 2JELL 5J7CC 3ETSA 5T5FA 3BH9B 2P42B 5C92A 1AR1D 2X2IA 1PX4A 2FQDA 1BQSA 4L8DA 2FHFA 4MYPA 2EUVA 1X7TA 2HJFA 3QBTB 5CSBA 4F93B 4MB1A 4RDQF 3QQ9C 5EUOF 1Q9OB 3QJRB 1RUQL 1I7UA 4QHNA 4XX1E 3PWNA 2XWTA 2Q76A 4Y7OC 4YDKL 2Z8RA 3EO1B 5E2VH 3P3RA 1GW6A 5LBGA 1JD7A 4XMKH 4N28A 1KB5B 4PU2A 4EZMA 4ZNEE 5CCGE 2GBTA 4AITA 3DHMA 3O41B 4HJ1A 4OFKA 4CBZA 5HYIA 1WGOA 4XCFH 3ROOB 2WQAA 4PGJA 4KFZC 1LLAA 2NX5E 1L9MA 3DVGB 4ONHB 1DN2A 5C09D 3OPZL 3B2PA 1TMQA 2HFGH 2KDGA 3FQNA 4H5SB 4IK6A 3CN2A 4X83A 1QTYT 2EO1A 2NY2B 3FCSB 3TS8A 1HEZB 1KEGH 3DBXB 5LGJA 3QQ9D 4KXZH 5CLTA 4ZPVA 2WK2A 1IMHC 1TPXB 2PWDA 3KWWA 5ALCH 4Z18A 1SEQH 3IDMB 1Z9NA 1F3JB 1AS8A 2D7TH 1OAXH 5ESQB 1X3DA 4X4XA 3UYPB 5E8DL 1XSOA 4QOKE 4GFTB 2C3HA 2Y7QB 1DLHB 1RERA 2APVA 3B7UX 5D2NC 3V6BR 4G9FA 4WW1A 4JHAH 5E1GA 1BFOB 1TQWA 4WFFE 3LKQA 1QFWI 4Y9BA 1ZGLP 5ESAA 4GUOA 3X14B 3EJPA 4HK0A 4J7RA 1ZHBB 3ZYZA 4O02L 1MPAH 3DDGA 2N01B 3V0IA 3ISWA 1AQKL 3QXUA 1NCWH 2JJSC 1JYXA 3MV7A 4DJMA 1TLKA 4LNRB 3L16A 1NCBH 1U4FA 1XD1A 1Q9OA 1HESA 3VJ6A 3GJFB 3MSPA 5MHSD 2W5PA 3HNTL 1TTCA 2IFFH 1BHGA 3FSWA 3QPKA 1KB5A 4GT7A 2QGEA 1JWUB 2N1TE 2FJFB 4PUBL 1RU9H 2YGPA 1AR2A 1E2ZA 3LIZA 3O41A 4LLQA 4LPVA 5KSBB 3O6MH 1Z3GL 2L3BA 3ROOA 4DKEL 4KX9A 3RKPA 1WS8A 1CZ8H 1WH0A 3DVGA 1LK2B 4ONHA 1CYXA 1JPSL 2VLLB 1E28B 4KUCF 4RCAA 1P4UA 4H5SA 3O3EB 5INCB 4MBRA 1OM3H 3FCSA 4UNTA 2VDRL 2V2XB 1MCBA 2NY5H 4H0IA 4ODUB 1GSKA 3DBXA 5EA0H 1EHNA 4IJ3B 5FYLH 3CVIL 1BVZA 4K5MA 3IDMA 1G9EA 1H3GA 3R4DA 2ZYHA 1FZJB 2XTLA 3IS1X 2ZXBA 2B3RA 4N1HB 1RSFA 4PW9A 2JCCE 2VDNB 3E9TA 4J3UA 3O6FC 5ESQA 4ORGA 5LG6A 1HS6A 1VGEH 3UYPA 2OW7A 2DLEA 3HUJF 1HHHB 3L2NA 4G6KH 4KO6A 1DLHA 3WELA 2DS4A 3JWNH 1MHPH 1JPFB 2HT3C 1I3GH 4APQB 3L7EB 5EWIL 1BFOA 3CFDB 3P2TA 1NEPA 5AKTA 5IP4A 3MJ8A 2DLFL 1T0NB 2IH3A 3BMWA 3O2DA 5C7XL 1DR9A 2B2XL 2P8PA 5DZ9A 5LCVA 1M4KA 4OLUL 5DO2C 2GI7A 3RFZC 3B2MA 1KELH 4PCTA 4YWGL 4JFYB 3V7AE 4GIAA 2VXQH 4JO4H 3HR6A 2DQCL 3WMQA 4LNRA 3TT3H 4Z3FA 2X9ZA 4ONOA 3BDYL 2CHXA 1LVEA 4DH2A 1I4FB 3O6FD 1U91B 4PS4L 2C3VB 3RX7A 2ICEB 1XGUB 2WGNB 1BECA 4OLVL 2ZXDA 2R0KL 1FFQA 3NJIA 1JWUA 2HT3D 3MCYA 1DTUA 4FD0A 5KSBA 2R2CA 2IG2H 3MR9B 3RWEB 1JK8A 3SKNB 4JFEE 1CXKA 1TLMA 4R0LB 1L3NA 4TQ8A 4CVUA 1JYWA 1LK2A 5AAMC 2Z93A 2VLLA 3MTRA 4IBQA 5DO2D 1E28A 1GGYA 4L3FA 5HDRA 4H88L 5INCA 2AQRA 5KSAA 3FHQA 2H47C 2V37A 1GSMA 1RURL 2P45B 5I0XA 2V2XA 2NUPB 3II1A 4J3SA 4ODUA 4PW4A 5JHDE 1PVHA 2C3GA 2YRBA 3ZTNL 4W9JC 2CKBL 3Q2LA 4ZO6A 1DQDL 4JRXD 4MJHA 4XPHH 1X9RA 3L08A 2CD0A 4NPJA 2ZAGA 1Q0XL 1FNAA 5MENB 3WENA 1HHHA 3HFML 5IBTL 3UTTD 3VXRD 4CILA 3HN3A 4N0YH 1IT9L 2WWKO 1IJ9A 1JPFA 4APQA 5A6IA 3CN4A 1B0IA 3CFDA 3EJTA 5E2TH 4JG1L 3MQIA 1HEJC 5J3HC 3DTDA 4HIXL 2DIEA 1T0NA 4UZGA 4D9QD 3EOTL 1G84A 4OZFB 5MEPB 1NJ9B 2E86A 2EE3A 2NY4B 4OLWL 1JFHA 4W9KC 4ODBD 5F72S 1XHHA 3UCQA 1Z5YD 4R4FL 4PJ7E 2G75B 2WKOF 5EORL 5GGTH 4IRSC 3DXAA 4AX3A 1CFMA 3JWOH 4PRIE 5AZEH 4A7TA 1I4FA 2GI0A 3N0AA 4ZSOA 1U91A 2OQJB 4YDMA 2ICEA 1XGUA 1HNFA 2CDFB 2QT6A 2LU7A 1DVUA 5EBLB 3LKSB 3IU4L 4NZ8A 4FQ2L 1DQMH 4JO5A 1L9QA 1UKSA 3MR9A 3RWEA 2EIBA 5J3HD 3FQYA 3SKNA 3S8WA 2VDPB 3BP5B 4WNJA 3SDYH 1NSNH 2JKRM 2B0SH 9CGTA 3MV9B 2CUIA 1ZPLA 1NCTA 2P46B 1AMXA 3MJ6A 5F7MC 1KYAA 4G8GE 4IRSD 3C6LB 4YDLC 3OR6B 4FQIL 2NUPA 3T2QA 1IBFA 3DGGB 4XN2A 2X2UA 1ETJA 1BGXL 2E59A 3NCBB 2NYKA 3NJGA 3GMNB 4LVNB 4OF7A 2DTMH 3WIHA 4BFJA 1Z9MA 2OCFD 1RUPL 2WKGA 3KBHE 3N1QC 1WFOA 2QSTA 2YGOA 3VXMB 3VRIB 1BXXA 2Z92A 1F0LA 4IMLB 5HXMA 3W9EA 2X3AA 1COBA 3SY0B 1F6AB 3F83A 4KY1L 3GXUB 3VXUD 2C9XA 1GYAA 4R2GC 1JZ2A 3C5SB 2W92A 3E8UL 5T8IA 3T3PE 5I17B 1ACYL 2GK2A 4ZDHB 5TE6L 3H8NA 5MEPA 1NJ9A 3TWCH 2YXMA 4JG9A 2CK0L 4XODA 4QYOA 2ZXGA 1BYNA 1KTLB 4WSJA 5KS9E 2XG4B 1Z5HA 4PB9H 3BLPX 4NFDA 2X0VA 4MD4B 3KLDA 3ZE2B 5F88B 4G1EA 3ZX1A 4DGWC 4X7SL 4XMPL 5EOCH 1GOFA 3KR3L 2LGNA 4R2GD 1N64L 1R4XA 4XN8A 1ZANH 4KVCL 3IJ7A 3ZTDC 4UZUA 2DI8A 2IMNA 2QPUA 1QSZA 2UYLB 4Q0XL 4XHJC 4N0UE 2Q5BA 2Z7ZA 3MV9A 3WIIL 1RK7A 4U1KB 2RMNA 2NY5C 3C6LA 2IO5A 4OIIL 4DTGH 4PY7B 2GC4C 2CNYA 3QZPA 3WNLA 3QORB 3T0XA 4JFQB 2CE6A 4IYKA 5HP5A 5D71H 3S7GA 1TU2B 4KXAA 4QIRA 3K6OA 2AXFB 4RZKA 4XPBH 4DFIA 3WTVA 4KO9A 4NHCH 3VXMA 1YEFL 4IMLA 1Q72L 3IBOA 3JWNC 1VHPA 3JZYA 2FD6L 1F6AA 4GO8A 4WY7H 4JLRB 2Q8BH 4HFWB 1UURA 3KCPB 1E8YA 4XHJD 2BHYA 5E1IA 3FQ1A 3WY4A 5I17A 2BJML 1MQKL 5F6HI 2LHAA 2P26A 2G2NA 4ZDHA 5DWPA 3ZT5A 4TLTA 4JHVA 3D07A 4PTTB 2JTDA 2ZWLT 1LEGB 1G6VK 4J3OF 1TEFA 1EO8L 1U2HA 5FYLD 4ODXB 3TM6A 1G5GA 2ZJSL 4HHGA 4N5EC 1U4EA 3T2NH 5BRZD 3LN4B 1I85A 2CXGA 3SCMC 2L4OA 5CEZL 3QDJE 4JPVH 4ZTOL 4N24A 4MD4A 5CEYB 5DI8B 3MRCB 3GHBH 3CQQA 3LS4L 2TRYA 3UZEC 3X3FH 1NGQH 5F88A 3BWAB 1KTCA 4Z7NB 1R75A 1WT5A 4WWKC 4ZO8A 1J1OL 2BIOA 5DGRA 3S3JA 3DO7B 1ZT4B 4EBQH 4JQVC 2YKLH 2A9NH 1AHWB 2F54B 4QRBA 4FQJL 1LP9B 4M4PA 4IQHA 3U30B 4XX5A 2QVFB 3QJFB 2UYLA 2Y1ZA 3ECWA 4QD2E 5I9QC 2GKIA 3KYKH 12E8H 4N5ED 5LXGH 3SCMD 4KKZA 3MC0A 1KBGL 2PWEA 3AFLA 3UBGA 5AVQB 4HSQA 2VDQB 4HS3A 3QORA 1KSRA 3B2DC 2DD8H 1MCEA 1IBHA 1MAMH 4JFQA 4PLOB 4XR8C 5BV7L 1M2OA 1WIUA 3RIKA 4KUZL 1QAWA 1S9WB 2A83A 4MJ5B 4UOW0 2OMXB 2X4PB 3E80A 4WWKD 1XXDC 1EAJA 5TFSL 1DP0A 2AXFA 2WXJA 2H3KA 3L3OC 5GHWH 5FGCB 2RAMA 2EDTA 2FT6A 4TNEA 3P54A 1YCSA 3FSOA 1IBGL 5JIMA 4JLRA 3EGDA 2FJHB 4HFWA 5HDQL 4RAUA 2WQUA 3S88L 4NRZB 4GRLB 3MV8D 4MRBA 3BKYL 4LEXH 3PGFH 2C9VA 3WJLC 2WVUA 4H8WH 3RVVC 5T3XE 1ULVA 2A9AA 4QHUB 4KKLC 3RRQA 4RMUA 1KULA 1Z5LB 1OK0A 3PABB 1YEKL 3FS9A 3V52L 2BRRL 1WA2X 1KENL 3AB0B 2BNQB 4G9FE 4OF3A 5CEYA 3WO4C 1YNTF 2NY6B 3MFGB 3B8YA 4JDTH 3NA9L 2VUYA 3WXWL 3MLXL 2B1OA 3L54A 4QHKJ 3VQMA 3NOIA 2AW2A 1ZT4A 1GPOL 2CDGB 3IT8D 3HN8A 1KEML 4XBEH 5AVRB 1AHWA 4D3CL 3Q2CA 2IPTH 2WIIA 3MV7E 3QJFA 4KFMA 4P3CH 4NZTL 2Y24A 3RVVD 1UWXH 4KKLD 2OW6A 3UYRH 4U1LB 4NQUA 4B9JA 1F1GA 1RZKC 4WFHD 2NR6C 3S4SB 5DHVH 3UACA 1JGUL 3FSVA 3X1EA 1XSIA 4M43H 3UJJL 2VH5H 2E47A 1JHTB 2X12A 2JKNA 3D2UB 2ADFL 3BUYB 4JB9H 1L6ZA 4GI9A 3SPGA 4MJ5A 2OMXA 2X4PA 3MGOB 4IKJA 4OJAA 2GPZA 3V9CA 2QTVA 4XVSL 2Z91A 2ZKXA 5AYUL 2XWRA 2W07B 1NGZB 1P5VA 5AW4B 3Q1SH 1CFSB 5I75B 2FJHA 3TH3T 2DDQH 5C2BH 2P3YA 4NRZA 1IAIM 2OMTA 3JV5A 4GRLA 1F58L 4XNUH 4ZMTA 4QXGH 2WZPA 1CFBA 2DZEA 2NR6D 4WAFA 5EBWB 4GB9A 2GYSA 1SJEA 2ORBL 5SWZE 4H1LB 4NRYA 1FNGB 2XBDA 4QHUA 1U8IB 1QMUA 3GXMA 1FCCA 1MW1A 4PJDA 3PABA 1K4DB 4JREC 3LJ3A 3TVMC 2P5ED 3GTNA 2Z8VC 1Q9WB 3HHSB 4JM4H 1JXKA 4R6UA 1CUOA 2G2RB 3DO3A 4ANWA 4PJ7F 2ZNWA 5DLLA 2CDGA 3TCXA 3BRDA 1VERA 4NQCD 4R8WH 2KZKA 4P23C 1WZ1L 3IPFA 1P84K 5HHOD 4LQFL 3SYQA 1UM6L 3ZHFA 3SO3B 3TONA 4I18B 2AJSL 1QO3B 4U1SA 4U1LA 1B4TA 2WCGA 4Y4FB 3ZXAC 4LSVL 3PAYA 1WA0X 3L4YA 3HW7A 5KSBE 3RY6C 5A2FA 1H5BB 1JHTA 2VIRB 1CLOL 3BUYA 3AU0A 4JAMB 4QTIH 3ZDWA 5C0IB 1RP9A 1HL4A 4OW6A 2W07A 1BQLH 4WW2C 1EHXA 5KOMC 1NGZA 5AZ2L 4P23D 3H4HA 5JYLA 5DJ2B 4PH8A 1YMMB 2ODHA 3MRFB 2JJTC 5GGQH 2IOIA 4DGVL 1XH0A 3OJ2C 3KGUA 4NQTA 3BWZA 3HAEB 3G6DH 1QLEB 5EBWA 1IGCL 3M1BB 3ZO9A 1AGEB 2X3CA 4H1LA 3QQ4B 4CU7A 1U8IA 3GPSA 1JNNL 3X2QB 1VLXA 2YKKA 1K4DA 4N8VA 2RQEA 4JN1L 2VZ3A 3T3PF 2FL5A 2A9CA 3FL7A 1Q9WA 2AABL 3HHSA 1UWYA 1MHEB 2E4FA 3C9NB 4XC3L 1N4XH 3RIAK 4YDIL 3MLTA 3GK8H 5JORA 2E7LA 2ZUWA 1BAWA 4AJYV 2C9RA 4HJTA 2ADYA 3ZDZB 4X80L 1S46A 1EEZA 1CF8H 3DXAE 2HG0A 4F92B 4ZMOA 3PLYA 1N2RA 4ZSOE 5B38G 4IIQC 1IQDA 5DJXB 1QO3A 4I5BB 3ES6B 4OCRH 5FOJA 1NL0H 4CADB 2VLKA 1PJWA 4L1LA 3GBEA 3V4PB 5G55A 1H5BA 2VIRA 1SHSA 4JAMA 3O6LL 1F2XK 3VGEA 1DBMH 4DGIH 4DP0X 5C0IA 1DVXA 4I3SL 5IJBC 2D7NA 2F19L 3QZLA 3MLUL 2I69A 4YSRA 1ROCA 3QVAA 5F1KC 4K3DH 2NNFA 5DHMC 1OPGH 5HY9A 2VSDA 2BNRD 5DJ2A 1YMMA 4K23L 4PWEA 1KPUB 3ZMRA 4O9HH 2VOTA 3ABMB 1Y07A 4LCCC 4UYQA 3Q3GA 1A47A 3M1BA 4GUPA 2AVGA 3QQ4A 5FYJE 3H9ZA 3P4LA 3WKYA 1UKTA 1DBBH 5EH1A 3MA7B 4MNGB 5HHVL 2I7OA 2QGDA 1E27B 4OVUA 4WSGA 2APFA 2A6KB 2GCYB 1TQBB 2B16A 1MHEA 1DVFC 3C9NA 3QRGH 1URZA 1L7IH 4I9WD 4GQZA 3D9AH 4UOW1 1OL0A 3P11L 4H0LC 2P48B 1KG0B 5DD3L 4JK0D 4GO9A 4AXWA 1ZSDB 2N0KA 3DX8B 3SE6A 4LF3A 4QKTA 3WKQA 4KJYB 3PL6B 4HHWA 5JW4N 1YEWA 2O93L 1P7QD 2XKSA 3OWRA 1I7RB 2PPFA 3IJSB 4WI8A 4S1DC 5DJXA 3EDDA 4JUTA 3GWJA 4I5BA 3ES6A 2E9GA 2IDUA 1MFAL 5CP3H 4HFUH 3IDNA 2PTVA 1P6FA 1CT8B 3BZEB 3V4PA 1YY8B 1JGLL 3CFEB 3HKZA 1MCPL 1LTXA 3IXTA 3MCG1 3PIQB 1DVFD 3JVFC 1GYUA 5IROA 1PQZA 1QVOA 1C5CH 1UWEL 4NC1E 3HS0B 3OTTA 2EVIA 4HHAB 1EVUA 4PYHA 5AW6B 1MCWW 5DHDA 4A38A 5HDOA 1PF3A 4BK5A 2BS8A 3CBKB 4P9HC 3MV9E 5DHEA 5GSRB 3RGVA 4PGEB 2QEJA 1DL7L 2JKXA 3BWSA 3EFDL 1KPUA 1NCIA 1A0QH 4OQTL 4CN4A 1KJ2B 2XA8H 3CFCH 1W0VB 4S1DD 2BNUB 1HINH 5F7YC 3HC2A 4OI7A 1ZE3H 3LRMA 4MQ7A 4ZRGA 5DUPH 1ZT7B 4O00A 5GISH 5F3BB 2ZAIA 1CTOA 3LAFA 4R4BB 4EEEA 1F13A 3VXME 4AYBA 5EU4B 1EO5A 2EDHA 2PKDA 4NYLB 3RBSA 3MA7A 4MNGA 2G30A 1E27A 5I0VA 3GKWL 1DJYA 4DKAA 1TJGH 4M7KH 4QEGA 3RWGB 4O4YL 1NMAH 3NCEB 5JR1L 3HE6B 4MYWB 1KG0A 5DC4B 5KVEH 4QCIA 5B39G 2L7JA 4KJYA 3PL6A 3K8MA 4HC1A 5EF3A 4XNQB 1PZCA 5C8JA 4LAQH 5IF0B 4K8RH 4MLSA 3AMKA 4RWYH 3IJSA 1UHVA 1TQCB 1D7FA 1G0YR 4Z7UF 5D4JA 3UDWA 3WCYA 1W72B 3QUMB 2VWEE 1NDMB 3WGVB 4BZ2A 5K33A 5I0WA 1CT8A 1YY8A 3CHXA 2XX1A 4FQ1L 3LNGA 3PIQA 1K6QH 1JZIA 2WZ5A 4HWZA 1OO2A 4IDJH 4OM0H 4QNPE 4G8IB 3GJEB 1GYVA 2HJKA 4HHAA 4W68A 4PJ5B 2XKNB 1YECL 1A3ZA 3RJDA 5JIDA 1OT2A 2PABA 4PRDB 5JIPA 1OE1A 3H9SD 3DMMB 3T2PA 1KJ2A 3TEYA 1M1XB 1W0VA 4UT9L 2RACA 1XZWA 1CGYA 2BNUA 1I8AA 3OQ3B 3TL5A 1G0DA 2WWMC 2P44B 4U2ZA 2H3XC 5EOCJ 1NBZB 2V5RA 4BQ8A 5FKAB 4ALAL 4XBPB 4NN6B 1AD9B 5EU4A 3DGCR 4NYLA 3WXVL 3Q7JA 4W1TA 2XYBA 4P04A 2DOCA 1OP5K 3HI6H 1I1AB 2CM6A 4XN1A 4AUUA 5I1GL 2ZXWB 3IJ8A 2CRIA 2ZT9C 3HE6A 2PETA 43CAA 4NBZB 2ZCHL 4AE0A 3U2JA 2CZNA 4M7JH 4TN9A 3CFNA 4X8JA 3LDBC 2WWMD 5AAPA 1G9ML 4XNQA 3D05A 5IF0A 4NXSA 1N0XH 4GXUM 2Y5TA 4D2NA 1RZJH 3BKML 5BW7A 3QUMA 4R90L 2R8SH 1NDMA 4Z7NE 1IQWH 2OKMA 2IVFC 3KLAB 2AEOA 2KLTA 3S37H 1N6QH 3O4LB 1OP3H 3RNKB 3NEEA 4Z3EA 1Q0YL 1KGXA 5I8EB 1VGKB 3ML9A 2I9TB 4FQQB 2W80C 4CU6A 3GJEA 1DDHB 5DJAB 2WXHA 4PJ5A 3VD5A 1M42A 1N0LB 2XKNA 2VJXA 4JZJB 1FZMB 2DQUL 3NTCH 3QFDB 3HFFA 3FU7B 3ALWA 1UVQB 3IAQA 4PRDA 2R56L 5KSBF 5LGYA 3QUKA 5M95B 2EC9U 4RBPK 4YHYB 4XVJL 1M1XA 4LKCB 2HLFC 2FJSA 3VXSD 4AMKH 4CA4A 3LXBA 2F68X 3LN9A 3STLB 2D03L 5JW5A 1PEWA 2AEPH 3VNZA 1QHQA 1E8XA 1NBZA 4L29B 4XXCA 4ZFFB 5FGCE 2WZ6A 4NKMB 4XBPA 5E8PB 1YQVL 1DFBL 3PF2A 1AD9A 5I6NA 1OB1B 1YAIA 2CJ3A 1FJ1B 2BC4B 2IGFL 3KYNB 5GS1C 4AEHL 2XBTA 4XCCL 1I1AA 2PR4L 4JX0A 4BDVA 2VISB 1CR9H 5E4AA 1QLFA 5LNDA 3Q5OA 1KN4L 1E4XL 2HLFD 3L3IB 3E3QE 5GRUL 1OSZB 3GJFK 3VVWA 4PJDE 2VC2B 2CHZA 2XPYA 4YMPA 5J6GB 1OZTG 1UXSB 4BIKA 1CL7L 5IFJB 4D9LH 2XZQL 3GSNB 2ILLA 1OZUA 2OLDA 3FT3B 1AFVL 1J1PL 3O4LA 3RNKA 1EHLL 2NW2B 5E6RB 5I8EA 3WL9B 2AC0A 2I9TA 1LO5B 2IPUK 2IDFA 2QQNL 5DJAA 2NTFA 3QJXA 5C0EB 3Q44A 1FZMA 3QFDA 3V5HB 2A0LC 2XWBA 3FU7A 3C09B 1UVQA 5HHXH 3UIYA 1IM3D 4QI3A 4L0PB 4BFRA 1S7QB 1BD2D 1MVYA 5EEUA 4DN4L 3STLA 4Z7WB 4NO2B 4YN3A 5LNGA 5B1AB 4Y88A 3EAKA 1NQBA 2F74A 4BFEA 4L29A 1WIPA 4ZFFA 3NAAH 2YEQA 4NKMA 3WJJC 3MGTB 5IHHA 4R97B 3M1OA 3GHEL 1OB1A 4KQ4L 3SOBH 3ZSSA 3B8SA 2BC4A 1YEHL 3DX9B 3K2UL 3QRLA 3KYNA 2YAFA 3L7FB 4G5AA 5EV7A 2A0LD 1BVNP 4ZW8A 3BIBX 4B9FA 2UZYB 4TTDC 2VISA 6TAAA 3ARDC 4OIFA 5CSZB 3L3IA 4MQXC 4CNIB 4AMWA 1OSZA 3ZVVA 3BT0A 2P52A 3L9YA 3PE9A 4IRZL 5GGSY 4E68A 2VTFA 4FZEH 5MI0C 5J6GA 2JCWA 1MRDH 3ELAT 2W81C 3ZZSA 4HKZB 3ZJAA 1WUZA 5DURB 5HGAB 3FW6A 3GSNA 1YN7B 4O2FB 4NPYA 3KS0J 3I6SA 5KVFE 3MV01 5AG8A 4GG6B 1OAJA 1ZVHA 3G6AB 4LOVA 1XH3B 3QUYC 1MAJA 3ARGC 3MXWL 3D48R 3MYZA 3WL9A 1E4KC 1QSFD 4HLJA 1FBIL 3BVXA 4MZ2A 4YHML 3QS2A 2MQ0A 4TTDD 2QSVA 4S0TD 1NMBL 4KMLB 1H0DB 5C0EA 2BCKB 3I6LE 4AQ1A 2QDVA 2P8LB 2YD4A 3ARDD 1DCLA 4MQXD 3DVNB 2GC7C 4NFBA 3BWUC 3V7MA 1W9XA 1X9QA 4DUWA 1HSAB 2VLKE 3O45B 4ZMPA 5HVFB 1S7QA 4EDWL 3GXTA 3HBGA 2AQPA 4U3HA 4Z7WA 2XACC 4NO2A 1GS6X 1SDDB 1KT2B 3CV5A 1ZS2A 5B8CB 3SDCB 3CX5J 5BCAA 3GDBA 1XF2B 1MFBL 3HVNA 4HUCA 1T80A 3V0WH 3QUYD 3GUTB 3QWRD 3ARGD 2OL3H 4IKLA 3L95B 1CG9A 3QUZB 1JZ3A 1YMME 1ACCA 4LHQB 4GW5B 1ODUA 2BDNL 3ZPDA 3T0EB 4ES8A 1KCUH 4FFYH 3KM2A 2OX5B 2W9EH 3S36H 1U3ZA 2UZYA 3MRRA 3O9WC 2Z8SA 4OGYL 1OAQH 4UQEA 1D5MA 4YHOL 4JN2B 3EO9L 5D6DC 4CNIA 1NMCB 5KEZA 4GBXB 3KEDA 4OCXL 5LB1A 2A5UA 4LAJH 1OAUL 2Z3FA 4L37B 4Q97A 4DHLA 2PPCA 3MGAA 1RZJC 4F7CB 2LR4A 3HZKB 4J6RL 4HKZA 4JMXA 2WCPA 5HGAA 1YN7A 4O2FA 1L0PA 1YO4A 3PRZA 2BVPB 4J3XA 4QHLB 3CQFA 4GG6A 1F11B 1XH3A 4B7LA 4JL2A 1A7NH 3Q6GH 4FG4A 3ZDZE 4MJIB 1QR1A 3O9WD 3VD0A 4KTDL 3ZE2F 4F7KA 1YEGH 5DR5L 1H0DA 5HYQA 2P8LA 1Z3RA 1T3FB 3FF8A 3DVNA 3FO9B 4PQXA 1DQKA 2EDKA 2PPDA 3QO0B 4W9LC 4X4MA 1ASQA 3OAUL 5F1IA 1EANA 3MACL 4QNPF 3H9YA 4JRYB 3REWB 2QVMA 4MAUL 3WN5B 3LEYL 5ADOH 3GZQA 1SDDA 1KT2A 2YPVH 3UOAB 2UUDH 4ZO9A 5B8CA 3SDCA 3RG1C 1TFHA 4EI5C 2NNAA 3C60A 3GQFA 1XF2A 1XTLA 3AG1B 4Y2DC 3APNA 1P4LB 2EXSA 3DIDA 4HKBA 4DPBX 3CN1A 5IUSA 1XB6A 4WTZG 3N9GH 1SM3L 3QUZA 5BZDB 2BH0A 3FCUB 4PRPD 4Q52A 4GW5A 3J8F7 4Y5VC 4XAKD 5TQ2L 4L9DA 1KBVA 1OM9A 1BXUA 1X5XA 1WA1X 4NS0A 3CDYA 2OX5A 3QJHB 4A2MA 4NBYB 5F9DC 4JPQA 4HQQH 4L2YA 3ARXA 4JN2A 3TJHC 3BUBA 5HYSA 2AQSA 2GW5A 4GBXA 4QAWA 2J6EH 5EO0B 1TITA 4XPGL 5AW2B 3FCGA 1FDLL 3GS4A 3IDXL 2PW1A 4HWBL 2ALWA 4MNGE 4L37A 5H37H 4CSZA 3BDXA 4EI5D 2V3EA 2VZUA 4F7CA 4Y2DD 1OTTC 2X9WA 5K1JA 1M7IB 3HZKA 2FRGP 3DK2A 1F3DH 2OMYB 4F5CA 1NCGA 4FLQA 1IC5H 4QHLA 4FXGB 1F11A 2XN2A 4LHUD 3ZTCC 5I73B 3SZKC 2G5BB 3ARZA 1E5BA 4X8CA 2BP0A 4F8PA 4MJIA 4NZUH 2WO2B 5HYEA 1CQYA 2J5LB 3OZ9L 1INDH 4Z7NF 1T3FA 3P2BA 5C0CA 3IGKA 3TJHD 3QO0A 3T0DA 1U2CA 3S5YA 4PG9B 5ILTL 3F3HA 3EDKA 4JZOB 1IFHL 2J71A 1HU8A 2V5SA 1X5MA 1U95A 3REWA 1LP9F 5D9SA 3WN5A 3I75B 3ZMEA 1OTTD 5KWYC 4UAOC 4DK6A 1UOLA 5IQLA 1ZRUA 2FX7H 1GGCL 1CTNA 1J86A 1T5XB 4Z6AT 5IESH 1H6EA 2WOBA 3O3BA 4HUXB 2OMZB 2MWCA 5L88H 2X6AA 1P4LA 4W6XB 3ULSB 4OB5H 4XC1L 1UCBH 4PWJA 3NGBB 5BZDA 1BQKA 1V7ML 3P40A 4P2RB 4PWKA 25C8L 5F89B 2CIKB 4RFEB 3QCUL 2MTPA 3MXVL 3QJHA 5SV3A 4QRQA 4UDTB 5CP7B 4ZTPH 3JYCA 3A0OA 4LVHB 4HUUB 5AOZA 4JQXA 2Y25A 5EO0A 2OYPA 4XVOA 1U33A 2VJ0A 1NFAA 2Z31C 1ZV5A 3BFOA 3P4MA 1M7IA 2FBJH 3V4VL 5SX5K 3VRJA 2ZXAA 1HEHC 1QQDB 3APMA 2TAAA 3L13A 3U83A 3COOA 1JTOA 1RP8A 4FXGA 1WFMA 1L9SA 3EDJA 3PXHA 3SD5A 2BVYA 4M48H 2BVUA 3K5SA 3W0WD 1E9QB 1HAUA 3NQKA 5DZPA 1E4WH 2A2QT 4A6YH 4KZ0A 3FOMB 3NSFA