4B9FA

High resolution structure for family 3a carbohydrate binding module from the cipa scaffolding of clostridium thermocellum
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
NLKVEFYNSNPSDTTNSINPQFKVTNTGSSAIDLSKLTLRYYYTVDGQKDQTFWCDHAAIIGSNGSYNGITSNVKGTFVKMSSSTNNADTYLEISFTGGTLEPGAHVQIQGRFAKNDWSNYTQSNDYSFKSASQFVEWDQVTAYLNGVLVWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structure of the Family 3A Carbohydrate-Binding Module from the Mafor Scaffoldin Subunit Cipa of Clostridium Thermocellum
rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Sugar binding protein
molecule keywords CELLULOSOMAL-SCAFFOLDING PROTEIN A
total genus 35
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 4b9fA00
4B9CA 1NBCA 1G43A 4JO5A 3ZU8A 2YLKA 4TF4A 2L8AA 1TF4A 1JS4A 4B97A 4B96A 1KFGA 3ZQWA 4B9PA 3ZUCA 2WO4A 2XBTA 1K72A 3TF4A 1G87A 4B9FA 2XFGB 2WNXA 3ZQXA 1GA2A 4C8XA 2WOBA
chains in the Genus database with same CATH superfamily
4NGHL 1C16A 1AGEA 5E1AA 5T1DL 1B90A 1DLHA 2XWTB 4I2XA 2WINB 4F7PA 1IJNA 3Q9PA 4M61A 3X14A 2ZSVB 4Y4FB 2OBGA 1T5WA 2V33A 4DVRH 4Z3IA 2WXOA 2XWDA 1BEXA 2P5WA 3TFKD 2H1LM 4I48A 4V1DE 2IPKA 3ULSB 4XO3A 1LO0L 4LFHG 5DMIH 1SJHB 4FHJA 4BRJA 2C7UB 1ET5A 4OKDA 1ZKAA 4WHYG 4YDJB 1HZHH 1NH6A 3IM1A 2A4CA 3FQUB 3X3GH 3MRIB 3N43F 4JKPH 3RY6A 5F7WC 3AUVA 5D1QB 3FO1B 3TNMB 1CK0L 1TO4A 2PPDA 3GIZL 5D7LA 1DL7H 1URIA 4A6YA 2HKHH 5B21A 2LAGB 4B53A 3ZYJA 3V4UL 2PWEA 2HT4C 4PV1C 1PKQE 2QR0A 1IT9L 2WCSA 4YDLC 4PB0H 1B0RB 2WV3A 2BJML 3G5YB 3OHXB 5ANMA 1EMTH 1U8HA 3MRIA 3N85H 4ORZC 3TO4C 3OKDA 3LH2H 5BO1L 2AJZA 2EIDA 4QRQA 3QCUL 4S0TD 4ZXBB 1FL5A 3D4GA 3U0WL 4CVZB 5CJ5A 1QA9A 1TKWB 2X4UB 3BFWA 3C8KA 1DANT 1SMOA 4JRLA 1U3ZA 2VCOA 3ZDXF 1T1XA 1JZIA 4IRZH 5CWSA 3WAJA 5AQ0A 5HGDA 3GI8H 3O8XC 1BVNT 1U2CA 2DYPA 2F8VA 2HVJA 3II1A 2DTML 3PDDA 3H3PL 4L4TB 2YD8A 4I18C 1KN4L 1KXTB 3QFJE 5SWSE 1JSYA 3ZYOA 1I1RA 3CFUA 4IRJA 1ID5I 1SBSL 5CR1A 1N70A 1NM9A 4G80B 4ES8A 2YBGA 3VH8B 3MRGB 4F15B 3NIFF 3ILEA 1UKSA 4JHWH 1T1XB 1ZTMA 3PL6D 4XOCA 4ZSOE 4HWZB 3FH7A 4J6RH 4JFFB 1OZTG 4PJ9D 1QLFA 2CIIA 4WUUE 3M6DA 1IAIL 3RTLA 5CBEA 3WIFA 2ZSVA 4NBZB 3ROOB 5C97A 1OAJA 4HH9B 4HUUB 1YPZF 4Z95L 5DO8A 3SDXF 4KUZH 2B16A 3ZL4H 3NRPA 5JPMC 2Y06L 2G0KA 2OX5B 5TQ2H 3X1FA 5ACMA 1OF0A 4GFXA 2QELA 2O6CA 5I1GH 1H9DA 2WQUA 4HV8A 1CYWA 4U1NA 5DEGA 1U3JA 1YEHH 3HZ3A 2DI7A 2GIYA 1SY6A 1LEKB 4AZ8A 1XD1A 1BYOA 1MJUL 1NCCL 1PS3A 5C0BA 4GSDH 1WQVT 4U3XA 3VXNA 5B3SB 1CFQA 5KVDH 3TEUA 1KXQA 4LCVA 5HHPA 2VDKH 2XBTA 1ERNA 4XPTH 3DBSA 3F62A 3HG2A 4KJPC 2LT9A 4WO4D 1MNUL 3DO7A 5FO9B 1UVQA 3KGSA 4KROD 2FJFB 3HKZA 1IBYA 5J11C 2MNWA 1VEOA 2I07B 5F88A 1PAZA 2IAND 2PR9A 2YSSB 3QIBB 3VFTA 3OKOA 1N8ZA 4IM8A 5F7DB 4L8CA 2PYEE 1KDJA 5EZOL 4ERSL 2IAAC 4UDTA 4YHMH 4FOMA 2KHAA 4QXTA 1OAUL 3T0BA 3DOHA 3DPDA 3UBXB 1U8QB 2MPAH 4D9QE 4X4YA 3WL9B 4K23L 1E8YA 1UZGA 3DTDA 4AEEA 3OZ9H 5EZJB 4NQTA 1EAOA 1H3TA 4F7TA 4TQEH 4UQCA 3JYCA 4PLJC 5EN2A 3M1BB 3OKYA 1KIUB 4UDUB 3EW3B 4I77H 2YPVL 2BRRH 6CGTA 4KJPD 3V7MA 5GS1A 3U25A 3GK8H 1CFNB 2K9UA 1D5XA 5GS1C 4XPTL 1DQQA 1NEUA 4ZFZA 2NCEA 4XO4A 4MD4A 1AC6A 3H2WA 5IW6B 4PTUB 2O72A 3ETSA 1P7QD 2BSED 3WUWG 1DDHB 5MI0C 2X3BA 4YDIH 2ADFH 4HZLB 4XPAH 1D7FA 4GG6B 4L4JA 4QHKJ 1MVUA 1O6SB 3L54A 3DECA 1XGPB 2VDMH 4TQIA 3SPHA 4F7MA 2Z35A 2NX5A 4U1NB 5DEGB 4L9LA 3IJHB 4W4OA 3DLQR 5EUKA 1L3WA 4Y4KB 1AOHA 1LEKA 3MOBL 2ZWSA 3MLTA 4LDOB 4WY7L 1S3RA 4S11A 1AD9A 5CIPA 4EIGB 4IKLA 3CLEH 3TEXA 4GUPB 4X4KA 3FB5A 4EQ2A 4JRWA 4O5LL 1NOLA 1FNAA 2GJ6E 3KGRA 1Y6NR 4P0DA 4XC1L 3H9ZA 5HHVL 4JUTA 1BQUA 4JZJB 1NJ9A 1QTYT 3KPRD 4JM2A 5LNEA 4GG8B 4F3FA 3JV6B 2HRPH 3HN5A 2JVUA 4N90E 5E00A 3LNEA 3NEOA 3X13B 1WZAA 3Q05A 5DRWA 2Y1ZA 3VD0A 1KN4H 5D6DC 5DVLA 1GY2A 4P3DA 3EYFB 1DVFC 1M9SA 3FB5B 3KJ6H 3GRWH 4NNPH 1K72A 5ICZA 3VXUD 1HL4A 3KR3H 4EUPH 5I66A 2VUYA 4WGWB 3D3VA 2CKBB 1GH7A 3QWOA 4JE4B 3T2QA 2YQGA 5T3XL 4IDJH 5E94A 3NK4A 4OTXH 1KGJA 2GAZB 2YD1A 4XODA 5JXAH 4I9XA 3OXRB 3G3LA 2OZ4A 1JIBA 1JTPA 3G6JE 3KDMA 1DLFH 2PCXA 3JXAA 5FYLD 3T0XA 4FQ1H 3T77A 4CW1B 1HK6A 5D8JH 2JB5H 1MJJA 1CFTA 4DGYL 3E0GA 2R23A 4QF1B 3DUUB 2AW2A 4FFYL 3OR7B 2CKBA 4XAKD 4CKVX 1BZQK 2IWKA 4UT6H 4LHUA 3C2AL 2R69A 3DUSB 5C08B 1PLGH 2Z1PA 4RMVA 4DUVA 3HG1E 2I5YL 3BPOB 4JHBA 5ISZE 1TXKA 3FO1A 3LIZL 3Q2LA 2GJ6D 3RWGA 4DFHA 1OTTD 4NO3B 4ZMXA 1E27A 3A24A 3O8XA 1L7IH 2XG4A 3DI3B 2D03L 3GEWB 4XPFL 4Z23A 3QNXB 3U1QA 25C8L 1E4WH 1XMWA 3T1FA 5AKRA 2C8NA 1SRDA 2AQTA 5E6IB 1J05B 2PXYC 3QXUA 5L0QC 2R2HB 3GI9H 3IRPX 3LIZA 3IMSA 5KVGL 2FO8A 1KPUB 4U1JB 3G6AA 1AR2A 1I1AA 3DHMA 5GHWL 3V6ZA 4HC1L 1QEWA 4NQUA 2KLRA 3DSNA 4PJAE 1PBYA 4IKIA 3LPFA 5FYJL 2VDLB 1LE9B 1KULA 4Z7UB 1VFBA 2J5WA 1CU4L 2R0WH 5ABZA 4LMQI 4MNHA 5ITFA 4R4FH 2VXTH 2B15A 4L1BA 4U6YA 4XVUC 5I1AA 4FL4B 4AUYA 1I82A 1ZPUA 2KKQA 3PRZA 4GOSA 2FJUB 3EH5B 1ZT1A 3NFNA 4KKLD 4LVEA 1JYXA 3P4MA 2R27A 4BFBD 5KYWB 2JB6B 3UO1L 1P5UA 3A4DA 3C5ZD 5E6YA 4YDNA 1U8LB 4NOBA 1Y6KR 1H3GA 3MXWH 1NIDA 3WFBH 5AB0A 4ZI8A 1UWYA 4NQVA 1XH1A 4OU3A 2AEQL 4HJSA 3FFCB 4NQQA 1QWUA 3L9BA 5EFIA 5KBLA 1OGAE 4F2EA 5IHZA 4G6AC 4Z1PA 5CGMA 1HJCA 1YSOA 2SEBA 3LDBC 1DUZA 1T0OA 4AM0B 3C5JA 3CVBA 5CP7B 4R7XA 3PWPA 5HHQA 2A6JB 1PL3A 1GZPA 2MHAB 1P6FA 3T0EB 2HPOA 1KF9B 1NMAH 2E75C 4L3CB 4DQOH 1QYGL 4P59H 3D9AH 4QO1B 3IFNL 4FNTA 3GS0A 4WW2A 4HQQH 3LKPA 3QUYA 2W0PA 4JHWL 4WW1B 1HL5A 2DB8A 1PG7X 3DVGA 4UAHA 3WFCL 3H3KA 3J07A 1N0XL 1WFIA 2ZQKA 1IEHA 2HG5B 1YNLH 4M7ZB 4OAWB 3BUQA 1F4XH 4LNRB 3IFOB 4M02A 2Z64C 1NCBH 5BW7C 3LKRA 4JFEE 4KK5D 3TNNA 3MDJA 5INDA 3MXVH 1WFTA 4K9EH 1ZGLA 1EIBA 1Q1JH 3MOAL 5FXCH 4M8VA 4POZC 5IJCC 3P3YA 1IAIM 2AV1B 1WAAF 2OR8A 1DQJB 5L4MA 4WW2B 1ZK5A 1FHNA 3O6FC 4JPWL 1CZ8H 2C3HA 1ZWIB 3L1OH 2Y4SA 3DVGB 4HJ1A 4P2RE 2YR3A 4X80H 3L3KB 3LTVA 4K71B 2CKBH 5D70L 3OGCA 1F18A 1SLWA 1TQWA 1OGAA 3G6DH 3SYQA 4YHZH 3G5XA 2CRZA 3KYMA 1BVOA 5AB2A 1UKQA 2QVMA 1N4XL 3UYRH 4IEFB 3EG9A 3WHE0 3N40P 4S0SD 1T4KB 3CCHA 2KS0A 4K3DL 5IV2A 3ESPA 3PNWB 3IMBA 1NCDL 3MJGX 4S2SA 3CZUB 4X99B 4KK8C 1D5IL 3U4BL 5IWLA 5D4JA 2GIMA 3RWEB 5HI5D 4C8XA 3MU3A 1BQKA 1RD6A 3BEWB 3TV8A 3F7RA 2X4PA 4XO8A 4MTMA 3T0ED 5FDWA 3CZLA 4XI5D 4HMDA 5GPRA 3RL1B 2WXHA 3QQ9C 1RY7B 3BZ4B 5T3XH 4A63A 1WWCA 4YVUA 1FFPA 2BWIA 2F6AA 3OJDA 5B3JE 3STBA 3T2OA 5SX5H 2F54D 4ODVL 1INQA 1TMCB 4G6JL 2NUPA 5IUSA 3IDGA 1MQKL 4NN7B 5EC1B 2OA9A 2E46A 5DI8A 1OAZH 2FX9L 2Z8RA 3ECWA 4OD3H 3FULA 5T3ZH 1A14L 2L04A 4A2FA 2H0FA 3WN6A 4R2GD 3QUYB 4WW1A 3DYMA 2R0WL 5F3BA 4LSQL 4XP9H 3JTSA 4KTEH 2W80C 3C6LD 2HPTA 4F1ZA 1YYMH 4LLDA 4FQXC 3D39B 4JRXE 1J18A 1FE8H 1WUNT 1CC3A 1MFMA 3S3BB 4E68A 1KIPA 1P5VB 3CIAA 4ZFOB 3QDJB 5ALBH 3V8CA 1MI5D 3V5KB 1RZGA 2P26A 1D5BA 4TQHA 4LVOB 1F56A 4EPSA 1E4WL 3HG1A 2LVEA 2YA1A 1BHGA 1WV7T 1S5HA 4J8RA 1ONQB 1L7IL 4PRHB 1E3FA 1TNNA 3O9WD 3QZBA 3RBSA 4ZQKA 4GLRI 2VDOH 2GTWB 2OK0H 4KZDL 3CFCL 3CN1A 1T2QL 4H1LH 3HIZA 2APFA 1D6VH 2Y9RT 5D96B 4WFGE 1NGZB 1XL4A 1Q90A 1FNGA 3QNYB 4PB9L 1HAUA 3HCVA 3IGAB 4NYLB 2OJEB 4P4KA 4QY8A 2OMUA 1PFOA 2G5UA 2MQ0A 4R2GC 3B7YA 4NPYB 3LS5L 4APXB 1I4FA 4ZODA 3ZE0E 2V7HA 1UB5A 1H5BA 1TENA 1HU8A 3EFFA 5BVPL 1TLKA 1QA9B 1TKWA 2X4UA 3K2UL 1JP5A 3X12A 2P80D 5IG7B 5K69A 4UZSA 2IH8A 5A7BA 2PPAA 2TSAA 2Q10A 5FHAH 1WAEA 3KW8A 1E4XH 3NQIA 3EGSB 3FF7A 3BGAA 1AIFB 3CSBA 4OFVA 4CSSA 2FR4B 2ZWLT 3R1GH 1AAJA 5SWZD 4L48A 2WVTA 1FFTB 4M7LL 4AJWA 5GGRA 4M43H 1I4FB 5SWSD 1ZDSA 3L2LA 4FABH 2FO4B 4D8OA 4HAGA 4Z8FH 1WFUA 4XX5A 3L7EB 3QDGD 1MFEL 3BZ5A 5E9DE 3IDGB 2R15A 3LPPA 5IJBC 1IX2A 4XVJH 2XN2A 4JVWA 2UZYB 4G7SB 3FS9A 1SEQH 4MMXC 4WWKC 3S5LA 4PM1A 5KSAA 1QFWM 2L3BA 1FYTA 1H3PH 1BIHA 2ZX9A 5HBBA 2I32A 4FLHA 5T1KD 3UBXA 1CBVH 3PWNB 3VFNB 5I75B 3FO0H 1HKLH 1R5IB 4OJFL 1CT8B 4BD4A 1HQ4B 3GDBA 1IC4L 3NGBC 4XNQB 3UROR 3PE9A 1CQKA 3TYFA 3BRGC 4GW5B 1KIPB 1P5VA 1U8JA 3B9KC 5KSBB 3FT9A 3NAAL 2UZXA 1D5BB 4UT6L 5MI0B 2R0KL 5LGYA 5ESQB 1FYTB 2QMKA 4D0CB 4X98B 3GXDA 3L2MA 1QSFE 2H26B 1NBQA 2BSRA 4Y8AA 2FBRA 2ZXGA 2ZCZA 3SGDI 1Q0EA 4LP8A 5IBUB 1DJGA 4RGNB 4TPRH 3D85D 5C0CE 3U9PL 1S7WA 1T5XA 4N2FA 1JNNL 3G08B 4U1LB 4JGNA 4OZIE 1UXMA 3HAEA 5F7KC 1H0DB 4NZRL 2VISB 3CLFH 5FYKL 2IBZY 4IRSC 5IB3B 1NFDB 5LBSH 4BGDA 3MUUA 4K8RH 1A4JA 1ES0B 4PJEB 5EC2B 4YFLF 3OKOB 5T5FH 4FYSA 4QNPF 5KOMC 4OCXH 3RAJL 2QQNH 5I9QB 4AQ1C 1Q94B 3HBQA 1M56B 4PG9B 2V5YA 1VF5C 4D9LL 3MLZH 4QXTB 3OXSA 3C8DA 3PAUA 4XNMA 3O3EA 3BD3A 4ZNCD 1CUOA 2AXHA 3HE7B 3PGDB 5LG6A 2H5UA 3A4FA 2XYCA 2G9HB 5BMFH 3BE1L 2XBDA 3T8MA 3VX1A 3DURA 4K3JL 3UTSD 4I2XB 3MBEB 1SHXA 1TQVA 2DTSA 1NMCB 2DBLH 1XH3B 1MJ7H 4X7TB 5HYJE 1X4ZA 1XGRB 3LXAA 4HF5H 2ZXQA 2D7TL 3ZOAA 2GK2A 1M2OA 1BIIB 1MFAH 3PDOA 3HR5B 1DJWA 1VPOH 2UZYA 1QO3A 1JGUL 4GLRH 3EYFA 4HU2A 3G5WA 1PNCA 3FQRA 4RWHA 1SHWA 1OAKH 1YA5A 4PJIF 3ARXA 3KYMB 2EAEA 5JO5A 3MNDA 5C09A 4Y2OA 5FYLE 4CMMA 2FTAA 1OARH 5DWUH 3S3CB 4LLQB 5EOCJ 3HPLB 4WWOA 3O11A 4KXAA 2ZOWA 3ROLB 3SGJC 1LLAA 3CXFA 1RZ8B 5JW3L 1TZ8A 2M83A 1A6ZB 3LOWA 5IQ7L 2MNUA 2YJQA 4P9HL 5I19H 4HUWB 5CUSL 1TVBA 5D5MF 2I25N 3CHPA 3FU5A 5I6PA 4HKZA 2AMUA 2ED6A 2FH8A 1I8LC 5C0IB 4GT7A 5CIPH 5HGDB 3ZSSA 1NBVL 5D7LD 5GSRA 1J9SA 3BFQG 5SWZE 4HK0B 3RWDB 3OZLA 5I1KH 3KL0A 4UTBA 3BPNB 3EZ8A 2D7TH 1A6ZA 1O0VA 2O5ZH 3IU3B 1WITA 3KPRE 3ULSA 3ECBB 5E8DL 3T65B 1WZ1H 3BAEH 4G9DA 1IBGL 3FYEB 1OAUH 2BSEA 3RGBA 1JHKH 2OI9B 3FK3A 3AT0A 5AW6B 5T5FA 4EN2A 3MYJA 4XCFH 1JVKA 1UC6A 1TF4A 2JLLA 3IGLA 1YEIL 4MQXD 3UO8B 4N22A 4RLDA 5DC4B 5F3BB 4ANKA 2DD8L 4QHNA 4R5VA 4H2AA 4DT2A 3F7PC 3Q13A 2ISDA 1QSEB 5T3XD 2WN2A 5BRZB 2ZXBA 1IFRA 5JHBA 1MHHA 3DRQA 3ZIYA 2DLIA 1OTUC 1WT5C 1JN6B 3A47A 3RHWF 3PJNA 4QHLB 5TGBB 1OAZL 1XGRA 2JJTC 3GLDA 3T09A 1A0QH 4KI5F 4G6JH 1EGJA 3DUUA 4E42B 1E50A 2L7JA 2WNGA 3HS0C 2V17L 5AOZA 2GJZB 4AQAA 5FO7B 1DBJH 1Z5YD 1J0IA 2LU4A 5KEZA 1WIOA 4NWUL 1NCJA 4WSGA 1P1ZB 2CCLA 3PUUA 1NPJA 2J1WA 1PMYA 5E9DA 1PEZA 2UZPA 4ZRGA 3D34A 5E5LA 1QOKA 1BVKB 4KKCC 1JZ6A 1SN5A 4OZIF 4J3OH 2CJSA 1I9RH 2VZVA 5BO0D 4XP1L 1N64H 3WEAA 4KHXL 1BZ8A 3W39B 4QHUA 3N9GL 3SPJA 1RPKA 3UYPB 2YQ2A 5HHXH 3BUIA 4TVPE 2Q7YA 4Q7DA 2N59A 2C26A 3WTXA 3NEEA 1GYVA 3J7HA 1DJYA 4KV5E 3T6ZA 1RZPA 5DRXA 3R8BB 3GMRB 3MTXA 3T0WA 3GBDA 2H32B 4FTVA 4J6IA 4G43B 4HKJB 4N1HB 5T3ZL 4DUWA 3JV0A 3K8LA 5SX4H 4HIHB 1PQZA 3PAVA 4YBQD 5TE4H 5J06A 2FEDC 2Y5TA 4Y1TA 2ZOLA 4WI6A 4RX4A 4FERA 4OIIH 4BQCA 3TZVA 5JPNC 4OZIB 2APSA 5C0FA 2WB7A 2OFQA 2WUBH 3VNYA 5E03A 4PJXA 4ANXA 1T6WA 5D5MA 1KTLA 3IXTA 4FP8H 1U93B 4U3SB 3X11A 5MENA 1OANA 5I1IL 3L4ZA 4AYFA 4ADGA 2ALAA 1A7QL 3RDTB 5LXGL 1OCCB 1X5HA 3H85A 4AIZA 1YNTA 5B1JA 1YUHB 1KIQB 4HEMA 3SDCA 2P48B 4DPAX 1JXKA 1V10A 1S5IH 3F3HA 4K3DH 1L9PA 1AHKA 2ZUVA 1FZJB 3SDDC 3W11C 4JQVC 4PTUA 5L88H 5EF1A 1PDKA 2EUVA 1E5BA 3V6FA 3CFJA 3HZMB 1EANA 4PREA 4PJXB 3NJGA 4N5EC 5JDSA 4EI6B 1CIUA 3C6SB 2E7BA 3BN3B 2EE6A 3NA9L 2MCG1 1RJLA 4NZUH 2WOYA 5DJZB 4C56D 3GC3A 4ZBJA 4PBWD 1CGWA 4F24A 4XGZB 3ZE0F 3S34L 3VWJA 2YBRA 1TT6A 2NY0C 3QSKB 4PCKA 5EIQA 2BNRE 4ZS7H 5FF6A 2X87A 1OO2A 2ZWKA 3HNTL 4CC4A 4QXUH 4A2EA 3DMMA 4U1HB 5IB3A 1Y1UA 3QJTB 3JV4B 2WCPA 1HIML 2HJKB 2ZP8A 3QUKB 1T6VN 3IJSB 4TQPA 1S9WB 1KYOK 3FCSA 4KXZH 3SHSA 5IKCB 3EFOA 4MAYD 3V0WH 4LSPL 1E8ZA 4ZOEA 3EOTH 1I3RB 5ICXA 1U58A 3O2VL 5IFHL 4HGKC 4LLWB 3T04D 2DQDH 2CRIA 1CIDA 4J3OG 1U2YA 1AYRA 2HXAA 3IN0A 2GYSA 4NUQA 2ICES 4G8GE 4RGMC 2R29H 3W37A 5EEXA 5FV1L 2Y6TE 3FRPG 2YD4A 1SYVA 3PUCA 3NPSB 3QPQD 1SHMA 1GIGL 3N0AA 2VDLH 3LQAL 4Y16B 3D3VB 2WMPB 1S7VB 4Y2DC 3GSOB 1B0RA 4HJUA 4XPBL 4PRHE 4WFGD 4KKNA 5AW8B 1BXVA 2FX8L 1NDTA 2O5YL 4PJBF 4IBYA 1FO0H 1G4RA 2IADB 2J72A 3C08L 2DQGH 3WNMA 4B9FA 3EJUA 3RWHB 3N40F 3W9EB 1DZBA 4L37A 4E9QA 1XCWA 2V5TA 5AYQA 3CFCH 1IGTB 3FRPB 4F9PA 2D4FA 4WFEE 3RE0A 3O4LA 5EBMA 1KTJA 1DVYA 1RUKL 2BNQB 2WQVA 3MCLL 3FOLB 1BREA 5EO9A 2A9NL 3HZMA 1DUYA 4PREB 4HU8A 5KVEE 4F2ME 4G8EB 5ICYA 1XB3A 2ZCKL 1VPOL 1C7SA 2GQHA 3D2UD 4R7NA 4XE5B 1GA2A 3DJRA 4G5ZL 4HF5L 4IS6A 4OCWH 1V55B 4U7KA 5F21B 1BGXL 5FR3A 4JCMA 3MPCA 2QPDB 4U1HA 3STZA 1P9MA 1T89C 4AMKL 3EDFA 5GGRB 3M7FB 4M4RA 4NPJA 1L3NA 1AZNA 1OTUD 2UX7A 2VAJA 4P57A 4UT9H 4MBRA 5CEZH 2BSDA 4KI5D 1JJUA 4UTBL 1AKJA 2Z91B 3NGBB 1DZ0A 3S8GB 1B4TA 2IV8A 4JO2L 5FWRA 3FSVA 4EEEA 4QRRD 1PEWA 3EDEA 2GC7C 3V0IA 3F12B 1UJTA 1MXGA 3N9GH 5HHXL 5IHZB 4ZMAT 2HT4D 3DDFA 1VZIA 1MCBA 2YPKB 3ZX1A 3GMNA 4JO5A 1T03H 2ZSWA 2JCCE 3TA3A 3W2DL 4L8SA 4M29A 2V7HB 4YPGB 5FUCC 5EFIB 2BNQD 1JGDA 1XX9C 2FX8H 1UWGH 1WSST 5E5UB 2DMGA 3VU1A 3QFJA 5I0VA 2ZYRA 5B39A 4RRPG 4XNUL 1QHOA 2XXMB 3OLGA 3MLYL 4DIXA 3KLHC 3JQOB 3GIVA 1MUJB 3EFDH 3M88A 3D08A 4L8SB 5E9DB 1FDLH 2P46B 3VWKD 3IEAA 3FTZA 4MA7H 3VI3B 4XN9A 3D2UB 4NN6C 4ZO7A 2IPKB 2VQTA 4JRYE 4WFFD 4PG2C 3ATFA 1R3LA 3CX2A 4G1MB 4ETYA 5FPIA 3CC5A 4TNEA 5DS1A 1G9NC 1XDTT 2CD0A 1ETJA 3K4AA 3MFFB 4JZNB 2D3VA 5IM7B 4P46B 1K8IA 2IANE 3MLXL 4NQVB 1GPOH 1UXWA 2V5MA 3KJ4B 2A7BA 3BD5A 3U6RB 4KOBA 3D2UA 1JF1B 1HEZA 3KPLA 2A9BA 1U21A 4IEFA 4NBYB 4X4ZA 4XN2A 3BSZL 4RZKA 3ZE0B 4LSTL 2ED8A 2NXZC 1OGAB 1TQSA 5EH1A 3OV6A 3OB0H 4K7PY 3Q5OA 1CFSB 4QIRA 1EO8H 4GG6A 3GB7A 4YHLL 1E9PB 4YIQA 3SPCA 2HA1A 2XN9A 3MNZA 3FUEA 5DRZA 1QVOB 2EEFA 4ZW6A 4GQRA 4WGKA 1WAAE 2KMWA 5K9JH 5FDWB 1TPXC 2Z8VC 3BVNB 3WXVL 1K3ZA 1U3YA 2CHDA 5CP3H 4H1LB 2JELH 5AWNL 2BSBA 4AL8H 3O6KH 1AP2A 1QHQA 3V7AG 4H26B 5AZ2H 2ZSWB 2CZNA 2K6YA 1ODAA 2DYPB 4JHVA 3TA3B 5J9PA 3FT0A 4OFKA 5TPWH 2OSWA 1OARL 1AGBB 4NQDD 2Q20A 5E6IC 5DVPA 1HZLA 2H2PD 4KJWC 4BSWA 4DN3H 1FSKB 4Y9FA 3ARBC 5C0AB 3WEOA 4BFKA 5JQHC 2YGQA 2Y24A 1B4RA 2YC1A 2WXMA 2Y2WA 4PJGA 4JRYB 2A1WH 1JGUH 2EE9A 1BOGB 3C6LB 1FJ1A 2YAHA 4LP4A 5KVEH 4LKCA 4JFFA 4R26L 2R4RL 2ZUQC 3MNWA 1E8XA 3GZPA 3E3QE 1HNYA 1UWEH 2DDQH 4IIQC 4JB9L 1E90A 5IVNA 4P5MA 5DHYA 2HRPL 3K0YA 4HUUA 4OCNC 5DJ2B 1Q9LB 1IBBA 2ZAHA 5E70A 1BBJA 2WNWA 2XX0A 1T1WB 2Z7ZA 4NQEE 2D7QA 2AJVL 2BIMA 3MBXL 2HFGL 2XN0A 3B7SA 4LHJB 5C07D 4CAGA 5ANME 5J7CC 3QC6X 4Z77A 3W56A 4S10A 4WKZB 3V4PB 3KLAB 4PJIA 4JM4H 1CDUA 2NY2D 3MRRB 2EIZB 2HTLC 4N0CD 5DQJA 5C0BB 3UPAA 3IGAA 1BLIA 2Y22A 2XWEA 4OLZH 1JZ4A 3HPLA 4ATWA 4EN3A 3RL1A 2F1AA 1X5FA 3MA9H 4JFQA 3TTSA 4B5EA 4XPGL 4WSKA 3EJPA 3BH4A 4C4BA 2OJ1A 2HJLA 3QORB 4FNLH 3EYQD 2JB5L 4UOW1 5I17A 1I1YA 4Z7VF 5DD3L 3SKOA 4MSWA 1E9PA 4D3CL 1HFUA 2AXWA 2OSXA 4G8FB 4IRJD 5A7EA 4WFED 2MQCA 3QNXA 1EFXD 3AS3A 2WY3B 4PLOB 4E42A 1CPUA 5AWNH 3G04B 4P2AA 1AQHA 1XH2A 3ATAA 4L2YA 1N6UA 5ANHA 3DX7A 4JDVB 1NFDF 3PIQA 2ZD0A 5BUGA 1P4LA 2BRRL 2WLJA 3QI9A 4PJDB 3P3TA 4EBQL 3ZJAA 4H26A 3CFQA 3MUY1 3SD5A 4FMKA 1OSPL 3I9GL 4XMKL 1SMDA 3LS4L 3QDME 4YSQA 3IDMB 4XBPA 5BS0B 4LLMB 4MQTB 3JWDC 4JFED 1CBVL 1HDMB 1X9LA 2W0FB 2WWOA 4WK0B 12E8L 1EXUA 4TVPH 4X6FB 3EXJA 2ZIDA 1FA4A 1D2PA 1IM3A 1KCRL 4WNQA 4JY4B 3T4AB 4CN6A 1NANH 2UVFA 3OF6D 4NO5A 2AABL 2AQNA 1MJ8L 5IIEA 2FT6A 5HVWA 2J55A 2JJWA 4HKJA 2APBA 3CZGA 1BA9A 4R5TA 4S1SL 3GJEB 3BKYH 1MCOL 1N6VA 4YOKA 1THCA 4ZS6D 3RU8L 1P9MC 2A3TA 4MNGE 1S2EA 1I3VA 1A14H 3PQYA 3GXPA 5I5RA 1ZVNA 2N4IA 4WVRA 1DL7L 1DEDA 1IBZA 2HWZH 1ILSA 2UY7A 1CL7I 4ORGB 3SO3B 4ALAC 4DKEL 4NZFA 5I28A 3CFEB 5HI4D 4OZFH 1AZRA 1BFOB 3DTXA 1AZVA 4GKLA 3DXAD 4KNSA 4X98A 5E23A 3VUAA 3U0PA 1UKTA 5F9JA 4Z6AT 2DM7A 4MLSA 5BJTB 1E4HA 3M1CA 5FYKU 2WBJD 5MEOA 1F1GA 1NBYA 1RQ5A 1XQ4A 2NY5C 4ODUB 3HI6H 1XHHA 3QDMA 3FQXA 4OD1L 2FWLB 3B3IB 4H2CA 1XBDA 1TSRA 3JVFC 1SM3H 4ZFFB 4OCRH 4AMXA 3I75A 2OL3B 1S78C 2ZAIA 2O6PA 5H94A 1DQJA 5ETUB 7FABH 1FNEB 1OOWA 5IQOA 3UC0L 1KTDB 4GO8A 4E9YA 2OK0L 3IMRA 1HYSC 4Q6IA 5C7XH 1IFHH 1KJ3L 3BP5B 4I0KA 4P3DB 3TC9A 1NSNL 1YY8B 5F0MB 5F1KC 5F1NB 3BO8A 2C9SA 2E74C 1F3DH 1NCIA 2ZWZA 1WDAA 4EZMA 4P2QB 2BNRD 2QKIB 3BVUA 3KCPB 1R47A 4JKWA 2F2HA 4ODXA 4PJ7F 3BE1H 1FZKA 1U8MB 1NEPA 2FB4H 2LU3A 2OL3A 3MUHL 4KDVA 4Y2DA 1ZPLA 3KZ8A 5DWPA 4OCLC 3EOTL 2X4SA 3G6DL 4ZPTB 4HJEA 3BUYA 3OG4B 4V33A 5LB1A 5KYUA 1F1AA 3SPGA 3ZT7A 3U2SB 4XP6L 4FFTA 1HINL 3OKMA 2X5PA 3VW3H 2VDNL 1HIMH 3BI9X 5BUAA 4OGXH 4NQXA 4TKWA 2WIIB 1XF5B 2E9WA 1DP0A 4JO1L 1CGSH 3VXOA 4P2QA 5A2JH 1UWXK 5DHDA 1J0JA 4NKIL 4A7QA 4KUCD 1IM9A 1ZSHA 3AQZA 4AVHA 1PD6A 4ZO6A 5IIEB 4ACPA 3IJ8A 2MOQA 4GRWH 1JI2A 4PWGA 3WO4B 2ATPB 2ERJB 2J8UA 3RFZB 5AAWC 2K9FB 4JFPB 1SXNA 1QEXA 1F8TL 3LB6D 3V95A 5DUPL 2FZ3A 1MIEL 2KDGA 5DZNA 4O51B 3FUDA 3GSOA 4F58H 1AY1L 1GW6A 5IESH 2HB0A 2DQCL 1U30A 1MFNA 3P40A 5LXVA 5CZVH 4KKAD 2BM3A 4JKNA 5I16A 4RMWA 2FECI 3O3EB 1L9RA 4MD4B 4HUNB 4UAOC 3RWDA 3X3GL 2P8PA 5ADPL 2D2CC 1BFOA 2XV6B 1NGXB 1NCUA 2E7DA 2A6IB 5A2FA 2EZ0D 1T66C 1FCCA 2C3VA 5IGXH 5C0IA 5C09E 5GS2H 3UYOD 4MQ7A 3VXUA 4O51A 1MHEB 2VXQH 1M7IA 3MRFB 1TEYA 4UM9D 4Z7IA 4Z7NF 4KTEL 3RZCA 1H3PL 4FG6D 3ZL2A 4D0BB 2G5BB 5IB5B 3IK2A 2Q9OA 1KPRB 5HJDA 1HSBB 3O3UN 3WYRA 4WWKB 4ATTA 1X5ZA 4PYGA 1KN2H 3HR5A 4NJ9L 4O58L 1VFOA 1YMMD 1R5VB 1AXSA 1CFVL 2FLMA 2HJFB 1NAMB 3PP4H 4NB7A 5D2LB 2WLKA 3PL6A 1Z32X 3S4SB 1BOGA 1RZJH 4PRID 1R3KB 1NICA 2VR7A 4F8PA 3SOTA 2P5PA 1MPAL 1YRKA 5BCAA 2E9IA 4KITB 1YEEH 2YPLB 4Z7OE 2LLNA 3AG3B 3R06B 3CX5K 1OM9A 1U8MA 3JWNH 3K72B 3O0RL 4N20A 3PL6C 2BDNL 1JPFA 1QBLH 4M7KH 4ZUUA 4XNYL 1BFTA 1KB3A 4DGIL 2HT2D 4YWGL 1NAKL 3OBAA 4D9RD 3L3IB 4Z77B 5HP5A 5ICZB 3M17A 4PJIB 4G83A 4N24A 2EYTA 2FECL 4QRRE 3BOVA 4LCCB 4G3YH 4AEHH 3U46A 3NJVA 4JN1H 5CCKH 1QWHA 4MCYB 4ELMA 4X5XA 3Q8EA 1NPNA 5F89A 1DUYB 4J12A 2APXA 3JTBA 3P3UA 5ESAB 5EV7A 3F5WB 4MJ5B 3S5YA 3FPYA 5BV7B 5DGQA 4GS7B 1T1ZA 1UJ3C 3AAZB 2AS5M 3ARZA 4NKDB 3G5YA 3OHXA 2CMRL 5FYJE 3RTQD 4WHTB 5ITBL 3OR7A 3BQUC 2GC4C 4NQDE 1G6VK 3KPQB 2ADIB 2VMDA 3P54A 5HHMB 3VD2A 2NMSA 3DX3A 4FTVB 5IHUL 2DWDB 1QLRA 4OBSA 2PABA 4NN5C 5E6ID 2ZYSA 2FD6H 4UCFA 5DTFB 2BVPB 3P1VA 1GJWA 2NDFA 2NXYC 2B5IC 1MZZA 4OT1H 5FHBH 3VXUB 1J9RA 1OW0A 4KHTL 5CCGE 5D9SA 5JORB 1JWUB 3KJ4C 3CU1A 3OMAB 5AG8A 1XTLA 2WKLA 1I8KB 1JBJA 1E28B 4QRPE 3RWCB 3OAWA 5TE4L 3MA7A 2MCPL 2R2BB 3FSOA 3MJ7A 1B0GA 2K8MA 3SGKC 1KCKA 3JTTB 4N9GB 1BD2E 2QKSA 2J1ZA 3MCYA 7FABL 1UXSA 3UZQA 3GMNB 5G4OA 2XKUA 1Z2KA 4KZCA 1BZ7A 1ZLWK 1YN7A 2YGOA 3CPLA 1IAOA 4HFWB 3Q6FB 3SZ6A 3ZTDC 4BQ8A 5F7AA 3PWUB 2G3XA 1R17A 2DS4A 2A83B 4PJ5B 5HYEA 3FOMB 5GGQH 5HJ3A 2NY2C 4URTB 3L3OA 2BVQB 4I1NB 4ZW8A 2AXJA 2IJ0C 3NP4A 2JIXA 4JQIL 1ADQH 2J5LC 1FF5A 4NP4H 3UYPA 3MV01 5BRQA 3J27A 3UTQB 2OV0A 3CPLB 2CCWA 4WUKH 1A4AA 4EF3A 2H3XC 3PLYA 4GI6A 2JCWA 2W65B 5LWYH 5E5RB 4KQ4L 3D51A 5FDYA 4H1LA 4CMHB 4XVSL 5I1HL 3ZW3A 1C8QA 1LP9B 3TCXA 1A4KA 2FBJH 4QWWC 4K9JA 4B9CA 4H40A 3IDYC 3WG7B 4OTXL 4MCZB 2IAMB 4NQSB 1N0LB 4AI7A 2MMXA 4NT6A 2H1PH 2CKBL 1H19A 3SDAD 5LUMA 3MLSH 1NEZB 1WFJA 2C3GA 1HXYA 4YHOL 4JE0A 4OFDA 3V6OE 2I07A 2FVNA 1ZANH 3T8VA 3NIDB 4G7YH 2PYED 1S9XA 4EI5C 4E36A 2UWEF 2XKSA 3G5ZB 4LNRA 4P48A 4ZO8A 1WCQA 4IKJA 1U58B 2XU9A 2AK4B 3TNNB 1KELL 1FO0B 4KKRA 1BZEA 1HWWA 1PY9A 4LCWB 5FFLA 1KJMB 3PP3H 2XV0A 4QTIH 1PKQB 4Z0BL 4RGNE 1G7QB 1T1WA 1BD2D 2HVKB 3N1PC 1RZ8A 1RIVL 1JGEA 4I3RL 4WTWA 1U8NA 1NEZG 1XEUA 5D1XD 5JDSB 4CVUA 4XP1H 1Y07A 5BO1H 3LKNB 1SVZA 3BQVA 3IDNB 2WMPA 1YEJL 3UC0H 4DP5X 3MLRL 3QNFA 1K2DB 2H0PA 3EBIA 4L37B 1CTNA 3NCMA 3QORC 5DYOB 4DP9X 3DUHA 5B1CA 3AABA 1OF2A 4XVSH 1F90L 3ESMA 2EIZA 3GZOA 3NFSH 4F37F 4O4YH 1L0PA 4OR1A 4QOKE 3O8XD 2I26N 3L5IA 1UOVA 4KMQA 3ESOA 4IBQA 3QI9C 5IQ7H 2AEQH 1VACA 5AOMA 2EDFA 3WIHH 1TQCB 1UFUA 3TPUA 5DJXA 1L5GB 1CB4A 2XQBH 3ASWA 1KBWA 1JZ8A 2EUXA 1HOCB 4UQ9A 4MJIB 4UTAH 5CR8A 1XGPA 2WLMA 3VA2C 2PF6A 5EO9B 2V3EA 4KRPB 1IEBA 2NY3B 1CGSL 4OZFG 4W9IC 5CJ8A 3ZKND 1J8SA 1UH3A 4P5MB 5DHYB 1LO0H 5FC9A 4EN3C 1G1CA 4FQLL 5FGCE 2HP4A 1I7UB 5GGUA 3QWRD 2F53A 2Q8AL 1GVIA 1NDGB 2EH7L 2Q76B 1I85A 4J3VA 4DZBB 5HHOB 1AKJB 2G5BA 1I1CA 5EBLA 1Q72H 5IB5A 3AJ7A 4NKMA 2J12B 3SOBH 4DAGL 3VM5A 4Z7WB 4PH8A 3FYIB 4F8LA 1FZMA 5MHSD 5IMOB 3MRGA 2IGFH 3LZFL 4JQXA 4F9LA 2YA2A 1DO5A 1ULVA 1YLBB 3IRZA 1I7UA 4EQ3A 3TBTA 1OWWA 3HHSA 3LIZH 3QXWA 4K07A 4ZUSA 1NAML 5JR1H 1C5CH 2J6EH 4X6CE 3RDTD 3MV9D 4U49A 1MFCL 5TE7L 2Q86B 1J11A 1JWMA 4KOCA 1RUPH 3J8F7 3N85L 5CMAA 5C7ZA 1HH6B 2HMID 1UOWA 1HI6A 4GKZA 1FL5B 2YPVH 3MRNA 4HX1B 3APCA 3QDJE 4PI0A 1KBBA 3CXHK 4KRPD 4FFVC 2R4SH 3MZGB 5GS0L 3REWA 1YJDH 2BRQA 3S37H 3QJZA 5C6TH 2KL6A 3GMRA 5D7IB 4K5PA 4NHCH 1BQ5A 1EEYA 1XXFC 4KKAC 3GSXA 3CBRA 5J6GA 2QPUA 1SQMA 1U36A 2CK2A 2P5EE 4PMEA 3RIKA 4P2OC 3S3SA 2C5DC 3WJLC 1BFSA 2XKNA 1GZHA 3D33A 1E27B 3O2WL 4L4TD 3HW7A 4PBVC 3IS1X 2EDTA 1NOAA 2GB2A 1X7TA 4UV7L 1DVQA 1HKLL 1T3FB 1FYHB 4N8VB 3LN4A 2NLJA 3VGAC 1B3JA 1BCIA 1HVXA 2YMTA 2O5XH 4NM8H 1F4HA 5D1XB 1JPSH 1KB5B 4NN6B 5T1MA 2QKIA 4LSUL 3HN8A 2Z93A 3SCMB 3QARA 1CFVH 3IE9A 3PP4L 2J56A 1FZKB 4Y2DB 1SOKA 4PJFB 3VJ6B 1JUFA 2Y36H 1A7RL 2H3NB 1H6UA 4PHXA 1D2OA 1MFUA 2HX9A 3U4EA 4KHTH 1EHXA 2H2SC 1VGEL 3GQFA 1HILA 5IVXA 2WTRA 1KEGL 1J86A 4Y16D 4OLEA 4JK0D 4YE0A 5T1MB 1QVOA 2JQMA 1AQ8A 2IH1A 5AL0A 4BWWA 3RWIB 5I75C 1DQQB 4O02B 1F90H 4UT6A 3FFCD 4U1MB 5IHHA 3LXCA 2Q2LA 4N6RB 4D3CH 3I2CL 4HEPA 5HGAB 1Z7JA 4TSCL 5EZIH 3UTTD 2DYSB 3BIKA 3H9HB 5DCCA 3WXVH 4JMNA 3N43B 1RIVH 4I3RH 3C5JB 2Y7MA 3DJSA 5HPMA 4PGEB 4EDWH 3B7UX 4HPOH 2IH1B 2NX5B 5KJ7E 2ZCHH 3K5SA 1S7WB 3E3QC 1WZLA 5I18L 1UM4L 4C4UA 1H8LA 2QDVA 3KPSA 1DVFD 2HFEA 3EUUA 4P06A 3TA3C 3V4PH 1XTMA 4QHPA 1O5DT 2F1EA 4NO0B 2YD6A 3ML9A 1SYVB 4XBEL 1DDTA 1F4AA 3GINA 5EEZA 1IAKA 3BRDA 5D2NB 1OT1A 4J3TA 4Q0XH 2FRGP 5E95B 2YS4A 3MX0B 1FBIL 3JVGA 3W5MA 2Y0SA 2XT1B 1SJHA 3OKNA 2VC2L 2PN5A 4RDBA 5EUOE 1TZOA 5IW6A 4DKTA 4CNIA 3W11D 2QFPA 3JUZA 4JM2F 4HLJA 1R3KA 2UVEA 3RFZA 3AFLA 3VGGA 3O6FA 3QCTH 2IDTA 4W9KC 5LCVA 2YPLA 5FUOH 1EA9C 1FDLL 2XYBA 4OGAC 1BFVH 3T2NL 3A21A 4FXTA 4P07A 2D3JA 1ZT4A 5C07A 1G6RL 4ODVH 2VSCA 2MIZA 2ZXEB 4DO6A 3NIFB 4GBXA 4U1IA 5TK4A 1D7BA 2G2RA 3GMLB 3PDOB 5D1QA 4BDVA 2K6ZA 1XCQB 4HPOL 2PP7A 3WDIA 4NSKB 1Q8MA 2HAZA 2DQGL 3UJTL 3IDUA 3T3PE 2CBQA 1YEKL 4X0NA 4CA4A 4U6HA 2YD7A 5SWQB 4QLWA 4RGOL 3SKOB 2ETWA 4CW1A 1CLZL 3KLLA 2P1YA 2VR3A 1OE3A 2B7DT 3IKCB 2V8LA 1BEYH 2WXIA 4NDMB 4GS7C 4MNQD 1D5IH 2OMTB 2X4PB 3S2CA 4KDTA 3WFBL 4ONGH 1EXHA 4WI0B 4M1CD 4XBGA 5DZVA 4WO4A 3BP4A 4J27A 3KNBA 4JO4L 3OLIA 5SWSA 2OYPA 4D0DA 4ZFGL 5ACLA 4FMFA 2OTUA 5LLIC 1ETZA 2BWQA 1O7DE 2COQA 2GIXA 2QZ5A 1TVBB 1HAWA 4W6XB 3PF2A 3CX5J 2YEQA 4XHJC 1UM5L 4J3WA 5LN4A 3BPLC 1IGCH 2J88L 5EO1A 4AOFA 5DVOA 4PP1D 1QRNE 2YAEA 3MLUH 2P8LB 2HTKC 4QHMB 2MNJB 2EZ0C 1BW8A 5INCB 5JHDD 3MACL 3TASA 2IGTA 3C5XA 4QJ5B 4OZFB 1K5NB 4JPWH 4NM8L 3TPKA 4GAJL 1S7RB 3D85A 1IL1B 2HTLD 4N0CC 1NGPL 1F3JB 4K7PL 2CIIB 5D7IF 3KPNB 4JKMA 2XNAB 1Q1JL 4BEIA 4WO4C 3CFJB 3WNOA 3C60B 4HH9A 3CUPB 5GRVK 1JZFA 2VDMB 2WHVA 4K5LA 3TVMD 5TDOA 1CXEA 3FUFA 3MLYH 3EJJX 4U6XA 3W0WB 1G7LA 3TEZA 1NUGA 1GHFL 3NH7L 2X6MA 3ZO0A 2NW3A 3RVWC 5GJSL 5F89B 1BPVA 4HK3J 1R3JB 1P7KB 2B08A 4IRSD 2ZCLH 1JFQL 1WA2X 5D1QC 4Q4IA 5A16A 4IMLA 1J12A 2NCMA 3CE1A 2HLAA 4GMTH 1IQWL 3B8SA 3RA7L 1CFQB 4V2BA 3L1EA 4Q9RL 4J7RA 1ZLSH 3I84A 4GQ9H 3ZDZE 3ABKB 4EUPG 5I8CA 1HHJB 1EH9A 2Z7UA 1G7LB 3PWPB 4GXFA 2CBMA 4PR5A 1HSAB 4XMUA 5DGRA 4HUXB 2FGWH 1ASPA 4GAYB 1NKGA 4U1JA 1KEGH 1BF2A 4R5XA 1F4WH 1U3HC 3LD8C 4RNRB 1SJVA 1OP3K 3ZE1E 4EIZC 5L7XH 3TJHD 2VSKB 2ZUYA 3PAZA 1AIFA 5B1JC 1T80A 4LMQE 5AENA 3VXME 2EEBA 3TVMC 4G11A 1KLFB 4HD5A 4CDGC 4OM1H 4NJ9H 4AJVA 4ZMLA 3DX6A 3K91A 2Z4TA 3SY0B 2XKNB 2WIIA 1JMZA 4G6KH 3U7WH 2WBXA 4XCNB 4QTHB 3MODH 3TESA 4KAQL 1AGFB 4MAUH 1HEJC 1ICTA 3ZT5A 4NRXA 3WD5H 3LPWA 4F2FA 5MEPA 1N3NB 2LVCA 3QZLA 4DO5A 4H0GA 2BIIA 1S9VB 1TTGA 3PWUA 3BZFB 1DBAL 1IE5A 4ODWB 2BHFA 4DPRA 1MKFA 4LCWD 2YUZA 2MEJB 2BXZA 5D1ZI 4Q9CA 3AGWA 3BH9A 2QSCH 4Q2ZA 2DPKA 2WOBA 5IUCA 1QYGH 4P59L 3TYFB 2K4WA 4ZUTB 1OSPH 3I9GH 2QFRA 3QHZL 4HHAB 1UZ6E 3NSCA 3EJYD 4GIAA 4JAMB 3VYOA 4XZUB 4EBQH 4WAFA 2NNCA 5CCKL 5MP6L 5LBGA 4L3EB 3DOSB 3RDTC 1JNLH 3WLWC 1K4DA 5FW7A 1QP1A 4MRCA 1HYRC 2HKFL 2VLMD 2NNRA 1PFCA 4H44C 1W8NA 1HL9A 3PV7A 2E86A 3GSNH 2B8OT 2X1OA 1AJ7L 1XGUA 4RFEB 3P3SA 2CXKA 3BHBB 5E00B 3AUWB 2AGJL 2QL1A 4FQQB 5AVZB 3TWYA 4BZ1H 5FEBA 4UYQA 4CVXB 5I6OA 1HHJA 2VQ4A 4PR5B 5BZWB 2IBZX 2Y1AA 4AH2B 2K4AA 2H4EA 1K4DB 3FU7A 5E5MA 4NM4H 2YGPA 5AB9A 4WI5A 3NZUA 4L4VE 3QEQB 4X7SL 1QBMH 4XN5A 3ZRSA 4NCC1 2WSKA 4Z0XB 2YFNA 2WBWB 3OMNB 5GS0C 2G60H 3PGCB 1UEYA 3HFFA 2GITA 3RJQB 1ZHBB 3TFKC 3MBEA 3EYUL 2QHRL 2UZIH 3WNNA 1SLXA 4X9BA 4MQXC 3CVIL 4JFWA 1E6OH 4X7TA 4Y2LA 3PNWA 3QBTB 2O6EA 1BJMA 4P5KA 1WD8A 4FNRA 5DYOA 3WNKA 4RAVB 3DRTA 4I0PC 3SKMB 4OCMC 4ZMPA 5JOFA 2RCSL 2VN3A 4TLUA 3V0EA 3BEWA 3HI6L 3OMZA 4LRIC 4ZQKB 3VQMA 2UUDH 1KGIA 4FKKA 1J8RA 2DKMA 4DEUA 4G9FB 5FO2A 3VCLB 1XF2A 3O2DH 1MJUH 1DQTA 3HUJB 4PEEA 1RURH 4UBDC 4JKLA 1G9EA 4M48L 2OZ4L 4UQDA 3FJTA 1IRAY 4JFFE 3FFOA 4WIQA 2ZOKA 1G7PA 1X9RA 1PZ2A 2D0FA 4X5XB 4YXHH 4LOUC 2R4SL 5FGRA 4NHUA 1IEBB 3U83A 1J0KA 2QBWA 2G3NA 3ZL4L 3SGEH 4C58B 4HWEH 2VLKA 1H3WM 5KYNA 2VKWA 2JMRA 1IQDB 5ECJE 1GGCH 4JQXC 3TN0D 4R4ND 1UQSB 1MAKA 4WNQB 1OAXH 4EOWL 4R90H 3IMUA 3QNZA 1MLCA 3VVVA 4HLEA 2F15A 5IF0B 2HFFB 1BYNA 2NY1D 1U92B 2I9TA 3GTVA 4TNVK 2VAAA 2XHNA 1RZGB 4LHUG 3KNBB 5CINH 2IQ9L 2XPGB 4WI3A 4R4BB 2IG2L 3GB7B 3QAZB 2VM4A 5JIMA 2XN9B 3MNZB 4XMKH 5I1CH 1RCYA 3UERA 4NWTH 5EOQL 1GYUA 2LTQC 4OLUL 3ABZA 4MAYA 4Y5YB 2NYZA 3CN3A 1FH2A 4IRZL 1ML0A 1JGVL 4IGBD 1U8OB 2B5IB 1SJEA 3BPCB 2DM3A 4UB0L 3WTVA 2R1YA 5IOKA 4CADB 1W72A 5KYXA 1QSED 3LEVL 2O6DA 1ZVHA 5BRZA 1RULL 1PZUB 5C0GB 4EZLA 4XPHL 2WVVA 3BIBX 1JZHA 1ASQA 5B38A 4K2UL 3CXDH 2WO3B 4QRPA 5HJ3B 2UZXB 5AW2B 1GSMA 2X0WA 5IBLC 2O26U 2VIRA 2XBZA 3HRZB 3A22A 2X38A 4MB1A 1JZ2A 1L9QA 2WTOA 3VQ1C 2A74A 2PW1B 3CZKA 3QC5X 1KSRA 1WCBA 4ODTL 3QE5A 5GIRA 2FT7A 3CFDA 2OCJA 3GSNB 3TO4A 3C09B 4TSBH 4UQAA 1WH0A 5ID1B 3HR6A 5IEHB 1DE4B 4JDTL 1ZLVH 3H9YA 3N1QC 4XH2A 1T5WB 2QSVA 4RDQF 3L7EA 2EADA 1LO2H 3L3GB 4MAYC 3R7RA 1SFDA 3RGVC 4F7CA 5KW9L 1FRGH 5GRZA 3IT8D 4FS0A 4I77L 2ALWA 1IFGA 1J5HA 2JJUA 1WCBB 1OTSC 4FA7B 4HDIB 4W9CC 2AV7B 3US9A 3QH3A 2ARJB 3KGUA 5D7LE 4F33B 4NJAL 5CLZA 3HJ0A 1FL6B 3H1ZA 1OEZW 3FN3A 4ZS6C 5E8OA 4FYQA 3L3KA 1QBML 4HKXA 3UAJC 3UP1A 3ISYA 2YN5A 3OAYH 2NXYD 2WUCL 3QIUD 5DMJB 1OAQH 2CO7B 5B4MC 1PQZB 5KVMC 2A6DB 5KSAC 4D8PB 5IVXB 5EF0A 2B1HL 1NDMB 3O3BB 2AVGA 3ASOB 4W68A 5IVXF 4F33A 5F9WB 5IHUH 4MD5A 1B0IA 3ARFB 3GMPA 4BINA 4LE8A 1T7VA 4QUOA 5IR1B 3UL4A 5B1AB 3LKOB 4KO6A 2JXMA 4TLKA 3TBSB 4OCWL 4WO0A 2A38A 1EHAA 3IAPA 4LQ1A 4UQ2B 2H8PB 5DRNA 1NGXA 2HYMA 1ID2A 1SBBA 4FQIH 2Y7NA 5FYKH 4NZTH 5JW4R 3Q2NA 1OF2B 1A4KB 3A6CH 4HWEL 4IU2A 2J8OA 2AXFA 5ADPH 2AQ3A 3ATBA 4Y4FC 4MAZA 4PRPD 5C8JA 4Z7AA 3MOQA 1AGCB 1GL4B 2AMGA 4G8IA 2JKWA 5BZZA 4MS8D 2F0CA 2Q6WA 2PUQT 4X5RA 3MFGB 1TTRA 3NSFA 5A43C 3VFPA 3GBMH 5FYKE 3D52A 3IKCA 1S7SA 3D05A 1A6UL 1KC5L 5EZLA 3L81A 4OB5L 1FO0A 3IGUA 5E0QA 5GGQL 4L0YA 5IBTH 1FAIL 4PVBA 3VRIB 2GKIA 4ZDHB 3S5ZA 3P4NB 2IF7A 4YDZA 3U7AA 4K94C 4EXPX 5JHLH 1KYOJ 4OV6F 4TTDC 3D18A 3P9MA 4HS6B 1U8KA 4R8WL 3J2PA 3NIDF 4G9DB 2Z7YA 7PCYA 4XX1G 1KT2A 3BAJA 4OM1L 4IGBB 2AV7A 2AP2A 3LPOA 2CO3A 3S36L 5DD6A 3WHXB 1NC4A 3BQUA 2K8QA 1EAPB 4M3JA 1PY0A 3PABA 3MV7E 4M1DL 1B0WA 4PJHE 1ZHBA 2DWEB 3QRGL 3L4VA 4L29B 1OALA 2F53E 3NPZB 3HHSB 4L23A 3TPUB 4AG4H 5K9QI 5EU5A 1NGZA 1NINA 1ZLVK 4U6HB 4NO3A 5SWQA 5K5YA 2WWKT 4AY0A 1RZIA 1TITA 1F3DJ 4S0HA 5KJRL 2DMHA 5EBWA 3E9TA 2G2PA 3CHQA 3UTSA 5IR1A 2BXYA 4HSAC 1AS7A 1LO5A 3V52H 1E9QA 4E9VA 4XP4L 4DW2H 3WY2A 2FR4A 1EEYB 3TN0C 3MV8D 1VGKA 5EMYA 1TVDA 3N06B 3HMWH 4RIRA 3T0AA 3NA9H 2R59A 2XTJD 1CDJA 1NDGA 3OGOE 4G8FA 2ESVA 2WANA 4HAKA 2VUOA 2B39A 3QO0B 5EZJA 4GRLA 1YNKH 5C8JB 1VENA 3H3BC 3SD2A 3UTSB 4F93B 4AX3A 5HDBE 3RWCA 1S5IL 1KY7A 2DV6A 3VSVA 4ZZFA 1EJOL 3QJFB 3GT6A 1IV8A 3MGOB 2NTFA 1A1OA 3SKNA 4L3EE 4GSXA 1C5BL 4XCEB 2QQKH 3LZNA 2OTWB 4ZTOL 4BV1A 5F0LB 2FATH 1DHKA 5CD5D 3TVMA 4HULB 1I8IB 2DMBA 4X8CA 1GKOA 4K15A 4BZ2A 3MLVL 4LSDA 4F91B 1OQOA 3M8OL 3TT3L 1F4YH 4O02H 1UHVA 5C0BD 2I9TB 4H25B 1OGSA 1U3HA 4UQIM 4IOSD 4BJLA 2Y5TB 3W82A 2ZYIA 1MF2H 3WJJA 5ILTH 3ARUA 1JTOA 2VZSA 5TDOB 2YMOA 5CHNB 3MI6A 4BFFA 2CA3A 1PG7L 2A6JA 2C3XA 3S88L 3IFNH 5ICUA 3V0VB 2CR0A 2NZ1A 1GAFL 2XTJC 2DEWX 3QEHB 3QUZD 3MUJA 4ZAKA 4JFYA 5CIPB 2WLIB 4NQDA 2F18A 3BKJL 3CDZB 2CWRA 2ZF9A 3GJFH 3GSXB 4HPYL 2CU9A 1FCGA 4MQ7B 4OLWL 1NLBL 2XSKA 1PX3A 3Q2VA 3BCFA 4A04A 4X6DB 3PQYB 1EUTA 1NCNA 4YHYB 2CO6A 3CSPA 3QEHA 4NUGH 1JPTL 4TUUA 1CL7L 2R7EA 3Q43A 2H6UA 1RLWA 3CWGA 4PY8I 5CU9A 4B9KC 4EI6A 5IJVB 2I60L 2A9MH 3PGDA 3R0NA 1QWNA 5IB2A 2F7OA 2Y2YA 4L3ED 2IWEA 2R29L 5C0EA 5KVGE 3MYZA 3TO4B 4Y1SA 5D7JB 4WCYH 5ELIA 3APMA 1KB5A 2CXGA 2VXTL 3CFKA 1UT9A 1FVCA 1R4XA 1KZYA 2F74A 4H4NA 5DJ0B 5F96H 1DN0A 1S7UA 1A3RL 1J5DA 3TZVB 5EN3A 5AW5B 2BOBB 2GT9B 3ULUH 2X3CA 2QGEA 3KEHA 4MS8C 4RBPH 4TUKH 4OZHE 4R4NC 4NO0A 3HEIB 4XB3A 5EIIB 4KRNA 5IJKA 2AABH 1UCTA 4FFZA 5GHWH 4ABQA 5I24A 1YMMB 1KGWA 3CVHH 4UB0H 2VDQL 1N3NA 3U4AA 1CGXA 1WRFA 5HVHB 3JV5A 3WFDH 5J1AB 5JXEA 5EU6A 3B2UC 1U8QA 1XT5A 3S6CA 4Q6IC 3HNTH 5I73C 4C54A 3DGDA 4Y4KC 4MXVE 3RPBA 4RZCA 2NY6B 4ELKA 3BWSA 5IHBA 1UWEL 3DV4B 3G5VA 1I1AC 5HGAA 1KC5H 3EYQC 4OLXL 1ITCA 3BJLA 2N0MA 4WKXA 3F8UB 1RZQA 2VXUH 1ET7A 4HQQL 2L4OA 2P80A 4XMPH 1QFWI 1ZTXL 3FQTA 3UJJL 3DOSA 3EKCA 4JREC 1XGTB 4PP2B 1FVEA 2EYRB 4W9ZA 1VEMA 2FL5A 2XV3A 4ONGL 2F19L 4U3HA 3SDXB 2WXLA 4NZRH 4J23A 2MOGA 1LWJA 3KPSB 5L2JA 2MCMA 4XCYB 3D06A 5AOIA 4KRLB 4AGNA 2XTJE 1Y6MR 4HKZB 2BNRA 3IWVA 4RGOH 4Z5RA 1G7IB 3RFZC 4P2OB 2ERJC 2XZCH 3GPEA 5IHLB 1PYWB 2PYFA 4XPGH 5L6YH 3O4OC 3FUJA 1IKFH 3ULVH 2OZ4H 2XIBA 1MW2A 2NYKA 4FHBD 4P2RA 4GINA 4HOWA 3FT3A 1X4XA 2D8KA 3JVGC 2FL5B 3QDJA 3HRPA 4DTGH 4K5OA 3SODB 2NZ9D 1LK2B 4KXZI 1MY7A 2JKXA 3ERXA 2HZHA 3WDHA 3GHEL 2OMYA 3NJFA 2BCKA 1PCXA 3OX8B 4X6DE 2C1OB 4X6DF 5D6CB 2V2TB 1BWWA 1MF2L 2EDJA 4DFIA 1WIUA 5L8LB 2PR4L 3BDYL 4UI2A 2VO5A 1SJXA 2WP3O 3NG5A 3PHQA 5BQ7B 3L9RB 1ACZA 5HHNA 4N0UB 4YSTA 1SEQL 3DXAA 4NZDA 3M8OH 4HC1H 1TU2A 2V0AA 5DEFB 5FCUL 5A2BA 2IEPA 4RSVA 2D3LA 3GM8A 2B1AH 1I9RL 2PTTB 3SPVB 1A6UH 3SJVA 3C5ZB 5JYMA 3MRNB 3Q9QA 1MN4A 1P1ZA 1EBPA 4HX1A 2TRHA 4CSPA 2WQRA 1R3JA 2DQUH 1ZEAH 5LQBL 3QUHA 1NCTA 4GT0A 4PLKD 3NIGB 3LCYA 3FN0H 4X42A 3W0WA 3WU1A 3O4LB 3PABB 2P3YA 3DBXB 5I76B 2OSLB 4L4VA 3DV4A 3G5VB 4WO4B 1LP9A 1LTXA 3CSYA 4ZUUB 1IM9D 4Q74A 4DTGL 1AQDB 2EXYC 1N2RA 4H0LC 3GBNH 2O61B 4M6NL 4GKNA 1S78D 4GSRA 4HT1L 1NIBA 5JYLA 1CGYA 3QXTA 5CEXA 5ABDE 3I50L 5HDBB 4HIJB 5LCVL 2E7HA 4FL4C 4M5ZH 1OK8A 3K6FA 1UG9A 3W81A 1YHPA 1Q9OB 4HFUL 5K9JL 3F7YA 4B96A 4Z3TA 5SX4I 4TPRL 4QHUB 1MCPH 3GMOA 3MBED 2QSTA 3VE0A 1L0YA 1QUNB 4IDJL 4M1CC 2VZTA 2BVUA 3SDAB 1IL1A 5AVQB 2GUOA 3MRJA 3Q7JA 3NAAH 3TIEA 1DQKA 4APQD 2HUEA 1LK3H 5ISZA 4R83A 2EP6A 4PJCB 1U8JB 4JNXA 5M7QA 1J8HB 4RA0C 3UPCA 2UV3A 2VL4A 3EO1A 2P4AB 5EORH 1XIWD 3BCDA 3QG6A 1GZHC 2D7NA 2XVBA 3VXRE 4LCIL 5AW1B 3CQQA 1I7ZB 4DKFH 3NFPB 2ZUXA 3BVVA 4WQOA 4XO9A 1Y0LA 1YNTB 4R7LA 3T6VA 3I9IA 3TVMB 1MW0A 2C1PA 4G6KL 3VSUA 4B7IA 3CVIH 4L5FE 4LHQB 5DJYA 4HS8H 4L8DA 4ZT1A 1U93A 3X11B 2Q3ZA 5F7EH 4N0UA 3T3MB 4IMLB 1T6BX 3V5HA 1QTPA 1MCLA 3RVWD 5CUSH 2RH0A 2FNWA 4UWQB 1AFVL 2IANA 3NSXA 2A0LC 4FABL 1JXDA 2OX5A 2QPSA 1BM7A 3JWOL 3OQRA 2A5UA 2ZXWB 1A2YB 4Y1AA 3V6OA 4O2EA 2CBTA 1HHGB 1WICA 4PLNC 3P69A 1D9KD 3CQPA 4YHNA 1LEGB 1G0YR 1TMQA 3BX7C 4I7ZC 4C83A 1RHFA 1VLXA 3UAFA 4UMGA 1BVLA 3LRLA 1PZSA 4JJ5B 4A67A 1QFUH 3DSFH 5FK9A 2LOEA 4NLHA 5BVPH 3V9FA 4CVWA 4FCAA 4B41A 1TFHA 2AXFB 4OI8A 1A1NB 3H2PA 3IDXH 1T7WA 4PJBB 1NA8A 2DEXX 5I30L 2VLRA 4RWYL 5CEXB 4XMPL 3UJJH 3PGFL 1SVBA 3VFUA 4P23D 3DK0A 2CGYA 1A9VA 3UACA 3FUHA 2FX7L 4EUPB 5BXFB 2DJSA 5F1IB 1KEMH 3BP5A 4AGPA 3N55A 5JOPE 3X1GA 4AH2A 1CVRA 4Y9CA 3QHFH 3C5SB 2IALB 5JMRA 1AHWB 3HE6D 5EO0A 5FW6A 2EDQA 4M03A 1PG7H 4D8PA 3QEQA 4LSVH 2WYHA 4AMWA 4JPSA 5LGHH 5DVMA 4LLYA 5MEND 2WD0A 1PW3A 1A6TA 1YEFH 2PTUA 4I48B 4NQCA 5JPNB 2HH0H 5JHDE 5DLMH 1NGQL 3Q01A 4GKSA 3VH8G 4OD2B 3A0OA 3TT3H 4AQ8A 2YD2A 4MWFB 4IRJC 4P9MH 4WW2F 2ZUSA 5C07E 3KLQA 3PS6A 3DETD 2ZCKH 3DWTA 3CLFL 3X12B 3ILPA 2AK4A 2JI3A 5DMYA 4TYUA 2NY4B 3KAAA 5E4EC 1F4XL 1XGQB 3ISRA 3BKCL 3EO9L 1KJMA 3UJIL 4YXHL 2VR5A 3D0LA 1Z5LB 4DVBB 2VDRH 2F5AH 3KPOA 2BC4B 4ZFGH 2QVFB 3O9WC 3SE4C 1AXIB 3BP4B 4YAQA 5HYSA 1KPVB 1PSKL 1QBBA 2G5RA 3FAWA 3N42F 3QORA 4GSDL 1D7DA 3FQ2A 3WUWB 1CDBA 1MCWW 5JMOC 4AXWA 1F58H 3NABH 1ZS2A 3EJQA 2X3AA 5C2BL 5DHVB 2CO4A 1NC2D 4ZMZA 2IPTH 3BEVB 1XGTA 5AVYB 3LN5A 4LVOC 3SDYH 1UWGL 3F00A 5LQBH 5JIDA 1OL0A 2VRKA 4APQB 1RVFH 3LN4B 2IQAB 2WLZA 1ZSDB 3B83A 1L6XA 4WWNA 2VQ1A 4NKOB 2D4DA 1A9EA 3QI9B 1NC4D 2K1MA 3WUWA 4J3OD 4JMXA 4YSCA 2M8XA 1U8IB 2GTZA 2P5ED 3X1BA 1MHHB 1A1NA 3DRQB 2MTAA 1N8OE 3JUYA 5C0JB 2ZKWA 5C70A 1AMXA 2IDSA 2X4RB 5F9OL 4ZYKA 2EQDA 3HB3B 4QTIL 2EO9A 1WO2A 4JPVL 2RTTA 3F12A 4UF7C 2OMWB 4LZKA 4FA6A 4PFEA 1EV2E 5HDBF 1IBHA 2HT3C 2Z91A 1LXMA 3BLBA 2GTQA 2KQMA 2HJLB 3QWNA 2F53B 3LMJH 5F7BA 3WFDL 1KYUA 1AZZC 2Y2TA 2YD3A 3DTUB 1AXTL 1I1YB 3HHMA 4HCRH 5AZUA 4F20A 5DZLA 4JZOB 5CJBA 4YUEH 1IKFL 3S3JA 2QT6A 4F9PC 2ZG1A 3BT2H 4LCWE 4ZS7L 2QHLA 4LESA 1RUQL 4HSQA 2FJHA 1I1FA 1G1KA 1JGDB 2EIJB 4BFRA 1VKXA 1DEEB 3FB7B 4M9OA 4TXVB 1GZQB 1G0XA 4GMTL 1YEHL 1PF3A 4RMUA 3HCVB 3QUMA 4LL1A 1HX0A 1HXMA 3BAYA 2DQCH 4KX7A 3JWDL 1KJVB 1QBAA 3CDZA 3LKSA 4AGOA 4YN3A 2BIPA 2J1XA 2GUYA 3IFLL 4X7EC 1IEAA 3ARGD 4LVHB 3L6FA 4ZFFA 3HE7C 1TZHB 4JG9A 3VX0A 5C0FB 2NNAA 2CO6B 2NY1C 2GCYB 1XSKA 3I9PA 1IGFL 1T20A 4HSCX 1MAJA 1T1ZB 1QQDB 3AAZA 3QR0A 4JFOA 1A0QL 4QTHA 5E0FA 3NN8A 1CG9B 1DBKH 4L1HA 4NKIH 2W5PA 2YLHA 1IGIL 1DVSA 7TAAA 1SXSA 5AW3B 4RFOL 1U4EA 4HDIA 3MFFA 4JZNA 1Z3RA 2VQUA 3MVSA 3U9WA 5H8DA 4G9FE 2CK0H 4P46A 4U3CA 5A40E 3UTPD 4IBWA 3NJJA 3VFMA 2ZONA 3NSJA 1VFBB 1YC7A 4W81A 2W81C 3FB6B 1PAMA 1QKZH 1JPSL 1UM6L 4UUJB 4M5YL 5I1AB 3RUGA 2F53D 1UJ3A 1ZT1B 2VIRB 3R18A 3N04A 5AEAA 3QCUH 1ZA6B 3SE3A 1TTFA 4OUOA 3D25B 1AHMA 2HRHA 1JG9A 4LAQH 4IBUA 1WBXA 5IQ9B 3BUTA 1A4CA 2TSBA 2OMTA 4OIFA 3CD4A 1QABA 1FFNB 3CDGB 4XZ4A 1P84J 2FLBT 1KIRA 3FTYA 3TBYA 5GRXG 3JV4A 4FI8A 1WK0A 4JFPA 1IB5A 5AAMC 4DOHB 1PD1A 3SDCC 3RZWA 1AIZA 1S9WA 5J6HA 4E5XA 3P9WB 1FN4A 2BSRB 2JIXB 4XPAL 1JTTA 1RFDH 4DHLA 3H9SD 5DZAA 2J8UF 4X4YB 1R3IL 5TH2B 5J0BA 2WAHA 3VVWA 5CBAB 3RBGA 1K3IA 1JGLL 2BP8B 2IDFA 5F6IB 5TQ0L 1FP5A 2JFCA 2DKSA 5EOCH 1KCLA 1ECZA 4OKVB 2DI8A 2YO3A 3DX0A 4J8QA 4PVMA 3ZKNC 2VC2H 3GHBH 1N68A 1CXLA 3FT3B 1CGTA 3KLAA 1JZDC 2AJ3A 3LHPH 5D1ZC 4MDJB 5DQJB 4A66A 3INUL 4XXWC 5I1DB 5IB1B 3QCVH 2HX8A 5AD0B 1RK7A 1YAIA 2KZKA 3T4YB 1DQLH 1W80A 4AV5A 3MREB 3C5ZC 3K46A 4Z76A 4Y8DC 4E0RA 4CU6A 3GXTA 5HHNB 4TRPL 5EPMB 5I6NA 1BLNB 1H6TA 5DEFA 3V0AC 2AK1L 5AVSB 5T3ZE 4X9GA 3BVXA 3CZJA 2VLJA 4YR6A 4I88A 3RTQC 2HVKA 2Y7SA 2LLGA 5I23A 1SEBB 5FM5M 1TJHH 1F6FB 3RPKA 1RV6X 5HYJA 1X5IA 2ID5A 5E4OA 1AD9B 3LRSB 4AV0A 3C09C 5FB8B 2ARJQ 1R0AL 3RB5A 1Z5HA 1MJJB 3L4YA 2V5RA 2A0LD 1G7IA 1DSFL 2GBTA 5KSBF 2EYTB 4CU7A 5EZLB 3L2NA 5EU6E 3NCBB 3GMMB 2CHNA 4PJHA 3RGVB 3STZB 4KO5A 1LDPH 2KUTA 1NUNB 4X5QA 5I5IA 5C86A 4MNQE 1W6WA 2VE6A 2O61A 4ACTA 1AANA 3ZN6A 4Y4FD 1OD9A 1OAKL 4RAUA 2E9JA 4XCEA 3ARDA 1YEGL 4OZGF 2EDOA 3ZRFC 2QEJA 2VNCA 4DQAA 2E6PA 4F8NA 1OOAA 4KGLA 3CDCA 4JY4A 5GGSB 5DD6B 3WHXA 3BVWA 3V2AR 1MIML 1UGKA 3SJVD 4XBGB 3ARGC 4U33A 3LJ3A 5KBDA 1NGQH 5L4IA 4UTCA 3O6FD 4YHPA 5EBGA 1QEWB 2F68X 2Z31C 4XNZB 4GRWB 1SUJA 5D7SH 4RMRA 1JHLH 4ZTPL 1HHKA 1J87A 4K3GA 5DXWA 3KG5A 4MNGA 3QEGH 2H2SD 3WJMA 4AJ0A 1FYTD 3LX9A 1KELH 4EAEA 4MBOA 2CKNA 4YZWA 5GZOA 3AZUA 4KI5C 4L5FH 4OZGB 4ONOA 3VYPA 2PPFA 3QZOA 2ZCHL 3U46B 3SDDB 2X1WL 3GYRA 4PQXA 3VFGH 5IB1A 4I0PB 5E8DH 3KDPB 3TV3L 5DFVD 1FH5H 3QIWB 3H0TB 5DJYB 2VLLA 5A2IH 1YN7B 4XB8A 3ABGA 1GYWA 3SGJA 4N2GA 4YXKH 3BD4A 4BZ1L 1E5UI 3WEXA 3ZRCC 1JZ7A 1S9KC 5K1NA 4ELME 2E4FA 4G1EA 1DVTA 2W59A 3QEQE 3UG4A 3RIFF 3FT4A 3OSVA 1TR7A 4JG0L 1QRKA 4LSSL 4LOVA 3STLA 3AQYA 1NBZA 5B8CB 4GNKB 1IUZA 2G4GA 4JDTH 3FT2A 3D50A 3H0TA 4HPHA 2R7EB 2B3IA 2ESVD 5DTFA 4KZEL 1LDPL 1O7SA 3QJSB 1NZRA 3QDGB 4FHKA 1I8IA 3P2TA 3VB8A 2VLME 3T1WA 3LY6A 3Q3GB 2PPEA 4XAWH 2IAMD 2VC2B 3LZLA 1JPGB 2AEOA 3O2DA 2Y36L 5C1MB 4AKPA 2EVIA 4YMPA 1A1MB 4X6BB 3TO2A 4AW4A 4LLAA 5I9QC 2OP4L 1ESOA 2NY0D 2I69A 1JZJA 2NSXA 5KVFL 4UU9B 5GSVB 1G7MB 2X1QA 4IGBC 3BSHA 4LK4A 3EJZD 4Z95H 1WWBX 3UZQB 2Y25A 3JWNE 1L7TL 5IQLA 4ZAKB 1FE8L 4NFCA 3O4LE 4GSUA 2H32A 1OM3L 5FCUH 1G7JA 3D3VD 3NJNA 3OKLA 4EZJA 1XBRA 1GGTA 3EGDA 5CILL 2IWGA 2VMCA 2OTPA 1MG3C 2ILLA 4L3FA 2WC7A 4ODSH 5DUMH 5I6XC 4C55A 2BSSA 2JTYA 4LOFA 3L95A 5CF3A 1EBAA 4GRWF 3WNJA 3QZWG 3NIGF 4WWID 5J5EA 2CO1A 5ICYB 2FE0A 3OKLB 4OAWA 1J9QA 1KCSL 4FEIA 5CZXD 4BSVA 2PPCA 4HIXL 1DJXA 1RK1B 4NRZB 2FGWL 4EDXA 2VLLB 3QPKA 5BS0E 1A3QA 5AYTA 4U4BA 5HSFA 1JCKA 5F6HJ 5IFJB 3KWWA 5ACZB 5GJTH 3UBHA 5CSZB 1G9NL 4XPHH 4HWNA 4A7UA 4YNYA 2BLFA 2V9UA 3T0VA 4PJXF 3RVUD 1ROCA 2H2PC 4KJWD 1NAMA 1NC2B 5D2LA 1K8DB 3IJEA 4Q4EA 4DP4X 3OZ9L 2C7FA 2ZNXA 2NNFA 5FF6B 4BCZA 4B97A 4WWKA 4MMXA 2MQ3A 1O9VA 3ZDZB 1E5AA 1OCWL 1U8OA 3L4CA 4UOZA 4NERA 5KUMA 3MR9A 2EICA 2X4QA 1HZHL 2X70A 4ERSH 5KSUB 1KJ2B 4PGJA 3DSNB 4JFQB 1PZDA 1P4IH 1ZHNB 3QJQB 1IGML 4TLSA 2YRLA 3P77B 1IAKB 3QPXH 1I3RA 2PR4H 3BDYH 4QDGA 3P73A 5ICXB 1ZS8A 3ZE1F 3FU9A 4OQTH 2WP3T 2ZX6A 3JZ7A 3RTQA 1MCEA 4A2MA 3NRFA 5I0YA 1RZKH 2E6QA 2DIBA 3I6KB 3QQ3B 5MENE 3OXRA 4U0RC 4GJTB 1FZMB 1RJYA 3UTTB 1S4IA 1OCWH 5KVEL 1WFOA 2YKKA 2X40A 4GW4A 3QB7C 3RWGB 2ROXA 1TQUA 3H42H 4QYOA 3H55A 1T7YA 3QUXB 3TBTB 5E56A 3HLAB 4X5LA 1LD9A 2EYSA 5J12B 3PDGA 3Q1EA 3WIHL 5K9QG 3JWOC 4J5VA 3FUIA 4BELD 2ZXAA 2ESVB 2J4WL 2OULB 1KXVC 2GK0A 3GEFA 3MRKA 4NUJB 3ZTNH 2QVTA 4TULL 2GPZA 3VFOB 1AQDA 4JO3L 1SEBA 3OZKA 1JDDA 2C9QA 4B9ZA 3K2KA 3WIIH 1RI8A 4PIBA 5T33L 2Q7AA 2BY2A 5FB8A 5CGTA 3HZYB 4M5ZL 1Q9KA 1E65A 3ESNA 2H32H 3QUMH 2Y07H 2V2TA 4L8BA 4DP1X 4HWZA 1UASA 2XY2A 4MJ4A 1PU0A 1FI8C 2X28A 2WQXA 5D7IE 4EDXB 4Z3FA 2EIEA 3HPJA 4TTDD 3CV5A 1LL1A 3KBFA 3CTTA 3MRPA 2D7PA 1GYAA 1J8HD 4LBAA 3P4MB 3AY4C 4FQXA 1NTDA 4KVPA 1M9WA 3FTGA 3MLWL 2BHZA 4OI9A 4FXKB 2AK4D 5L2KD 5J3HD 2VRQA 4N26A 2EXTA 1S6NA 1J5IA 1KTRL 2NXZB 3N2JA 3SSGA 2PXYB 4X5WB 2NZ9C 2LQRA 2WZ5A 3C2SA 3L3DA 3QUZB 4X7DC 1ZANL 2RFXB 1KYDA 2P9RA 4J3BA 2FCBA 2NLJB 4G72B 3VW3L 2HVBA 2XWCA 1G9MC 3QUXD 2H3KA 4KKZA 1YYML 3EJZC 4NAJA 3N44F 2XWJA 1D9KA 4N25A 5F1SA 5DFAA 5MHSE 1DJHA 3LQAC 1C1EH 4H88H 4DGVL 2PWGA 2WLLA 1AGBA 4Z7WE 4XC3L 1WFNA 4H8UA 3AB0B 2RHEA 2W92A 4Y19D 3PPEA 1TYRA 1XZ0B 5J1TC 2RFXA 2IANB 5C0AA 4U2YA 4YSUA 1DFBH 2YK1H 1USQA 5D7IA 4HBCH 3KVDD 4L9DA 1W72B 5MEQB 1EEUA 3BO8B 5HI3D 5FGCB 3IXAA 3A5VA 3EDJA 4P46C 4JKPL 2F58L 2OR9H 1FVCB 4A6YL 5E1QA 2FYYB 1P53A 3ARBB 4FNSA 4E41E 5FYKD 5E2TH 5IGXL 4KVCH 5BNXD 1U2HA 4DEPB 4PHZA 4HPYH 1OP9A 1XIWA 4DN4L 4W9LC 5FYLH 2F08A 3ZYIA 2O5NA 4P4RB 3QVAA 5E6RB 1U8KB 5EUOF 4RRPM 5LBVA 5I1LA 1DLFL 3MBWB 4XXCA 2VDQB 5JQIB 5CZVL 2ROYA 3NDZE 2XWZA 2PXYD 4LCUA 3U30B 4PGDB 1AY1H 2XWBB 1UD6A 3EOYG 4HWBH 3ILDA 4NN5B 3VXQB 1XV8A 3FO9A 3OM3B 2HFEB 3UYRL 1ZVSB 2QVIA 4MAUL 2OR9L 3H2QA 4A6YH 4FCHA 3JTSB 1ZXQA 4AUJA 1RUAH 1DJSA 4ZMQA 1JHTB 3V79C 1A65A 4OLYL 5I8KL 4LASH 1DCLA 2CGZA 5D5ME 3APNA 3SN6N 1SOQA 3SY0A 4A55A 3TBWA 5CBEB 3HTLX 1L0QA 2NZIA 1GS6X 3GHBL 1WBXB 4HJTA 3W9DA 5D93C 3P3RA 1DTUA 1E3XA 1FNLA 1FL6A 2GY5A 5KWYC 5I16B 3FBKA 5GRJH 3FO2B 4OFYD 1AR1C 4OJAA 5GS2D 1E9OB 6PAZA 5AUMB 1E6JH 4BKLA 2OJZH 2VDPB 3R4DA 3FUMA 5GGTH 3QK0A 2ZP9A 4PJAA 4AYID 1N9PA 4BFIB 1SQ2N 2P45B 4E9SA 4N87A 1FZJA 4WWPA 1OY3B 4XMLL 4XMXA 1VESA 3ARFA 4EDWL 3E6FA 1SXCA 1J1PL 1OLLA 3LEXA 1F6LL 5LGJA 4QR7A 1XZ0A 3BKMH 4ZJ9A 1EHLH 5EZIL 2J7LA 3CZFB 3JWNG 4L1TA 1O9ZA 4LO9A 3AXLA 1JF6A 3VWJB 3ZMNA 3T2PA 3BZEA 1DQDH 4NDMA 3AGVA 1HCZA 1V54B 2BDNH 3W57A 3ROOA 5A6LA 2Y07L 3WTWA 1NMBL 2IWFA 4BWTA 3L9EA 1P0SE 3GGWA 3UJTH 3HG0A 1MWAA 3ZQWA 4KVNH 4LLDB 1FNSH 4BCYA 1OP5H 3MKGA 1AMYA 4IQHA 4XOEA 3RVTD 1H15A 2AJYL 4PJ5E 3VXPB 3O9WA 2XVGA 3SE4A 5I15L 4PRDA 3F84A 4B3EA 5GZNC 4E0RB 3VXQA 4RFNC 1FAKT 4MS6A 4BQ6A 2LU5A 2WK2A 4MXWH 1C08B 3GLZA 5I0ZA 1MJ8H 4N0RA 3V0WL 4FAAB 2E8YA 1BXXA 2IOIA 4HUWA 2K7QA 4OSUL 2OMXB 2FJFA 1R24B 2FQFA 4QRPD 4QRSA 3L3JB 1M7DB 3W9DB 2YXMA 2TAAA 2Y3NA 1ZLEA 1EAPA 1V7ML 1WIPA 4FG6C 4JDZB 3UP6A 1M05B 4Z7QB 3IFLH 3SDDA 5KSAD 5DJCA 4YJZL 4QRBA 3PJSB 5E08L 1KPUA 5IW1B 2YFOA 3VE0B 5D7LB 5B1KA 3B3BA 3GXNA 3NACH 4LU5H 3SDAA 3FRPA 1H0DA 4K9EC 1QLEH 1SOSA 1NFDA 4LPWA 3BZDA 5DFTA 5FYJD 3F7QA 3EH3B 1MH5A 3QJHA 1MFCH 5TE7H 4JY5L 1PIFA 3FCBA 3O3DA 2DIAA 2RBLA 2KERA 1NBZB 2ZOUA 1KB5L 2EDLA 1LGVA 3PJSA 3TP4A 4LSSH 1Y18A 1P7HL 4KRPC 1DVFA 4HUVA 3MAWA 2Z92B 5D6DA 4K73A 3KS0J 4P3CL 3PFQA 3K8MA 1QBLL 2F1BA 3UMNA 1QNZH 2UX6A 4XNQA 3VXRA 2F54E 2DICA 1KTCA 1DDHA 1UZ8B 2IGFL 4N28A 1KXVA 2DQFB 5DC0A 1DCEA 2WWKO 1JGVH 2AQQA 3H54A 5BS0A 5F44A 4HGWA 4Z0BH 4XBEH 2X0VA 2CLRA 3IDJA 4JM4L 3HC3H 3VFMB 1MVFA 3ALXA 1AQKL 1JUFB 4TNWF 1CDGA 1AGFA 4OGYH 3MLWH 4WGVB 1T0MB 3ARPA 3B2VH 1PKOA 1H9VA 2X4TA 4RGND 1H15B 3WKML 4LOEA 4W4OC 4L9LC 3NZHH 1R19A 2QLYA 4PWEA 2R1WB 4BH8B 5H35B 2QQNL 4FKHA 1LO2L 2K45A 1ZRUA 1J5OL 4U1GC 2LFEA 3P0VL 1B88A 4JLRA 2HN7B 4BXVA 3SDYL 4NFDA 3V0JA 4FFWD 1CD1A 1AO7E 5FKAB 2P8MA 3QUML 3LVEA 1TQBB 4FXGB 3FFDA 3WN5C 4JM2B 5H4ZA 1R24A 2XWRA 4QRSB 2AV1A 1JWSB 5I1JH 4G70B 2QSQA 3V9CA 2JJTA 5DURD 1IT9H 2AJSH 2B2XL 1ADWA 1WC7A 4DN3L 5IESL 5GQBA 3Q3GA 3PXJA 4AYBA 4BSVB 2F54B 3ABMB 3MJWA 4BGLA 4JANA 5JXED 4Y5XB 1WLHA 5IROA 1XR9A 5H4YA 4ZNEE 4A2DA 3LRKA 5HGHB 5ALCL 4IJ3C 1LO4L 1HHHB