4B9FA

High resolution structure for family 3a carbohydrate binding module from the cipa scaffolding of clostridium thermocellum
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
NLKVEFYNSNPSDTTNSINPQFKVTNTGSSAIDLSKLTLRYYYTVDGQKDQTFWCDHAAIIGSNGSYNGITSNVKGTFVKMSSSTNNADTYLEISFTGGTLEPGAHVQIQGRFAKNDWSNYTQSNDYSFKSASQFVEWDQVTAYLNGVLVWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULOSOMAL-SCAFFOLDING PROTEIN A
publication title High Resolution Structure of the Family 3A Carbohydrate-Binding Module from the Mafor Scaffoldin Subunit Cipa of Clostridium Thermocellum
rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Sugar binding protein
total genus 35
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 4b9fA00
1JS4A 1NBCA 3ZQWA 4B9CA 2WNXA 2WO4A 3ZUCA 1KFGA 3ZU8A 4B97A 2L8AA 1GA2A 4B96A 1G43A 2WOBA 4TF4A 4JO5A 1TF4A 2XBTA 1K72A 1G87A 4C8XA 4B9PA 2YLKA 4B9FA 3TF4A 3ZQXA 2XFGB
chains in the Genus database with same CATH superfamily
3ARTA 4YFLI 3IGUA 4Y7MA 4KZDH 1R3JB 4RSYA 2VGLM 4HIHB 2Z65C 2P45B 1LO4H 1X7QA 3MNWB 4ZODA 4ZTEA 3FTUA 3VXOA 4AYFA 5JHMA 1TQVA 1AAJA 3FHQA 5IJBC 2VLKB 2YKLL 1UEYA 3M7OA 4G3YH 4XHJD 3TEXA 2NY6D 3MC0A 1MFUA 2OR9L 3F7VA 4FZ8H 4R6UA 3FSAA 4U3SB 3OXSA 4FZEL 2ZE0A 5IK3A 1JGLL 4BK5A 3HS0A 5IQ7L 4XP1H 2JJTC 1EGJL 3DRQA 4BCXA 4TVPD 2AW2A 2HH0L 3TBWB 4DCQB 4ZDHA 2ITCB 4XWGL 5HD8C 4PJHE 2LOEA 1Q94A 2OMVB 3QFGA 5SWZD 4ZQKA 2G75B 3FCTA 3NZUA 4RDQG 2BS71 1L9OA 2OXGA 2GTWA 3NIGE 3Q01A 2VW7A 4BSWA 1UA6H 2BSED 3GXMA 2VMEA 3U79A 3NCMA 2CSPA 5GXBB 1JBJA 4Q52A 1A7NL 1W0VB 1ORSA 1ERNA 3FUJA 4GBXB 3MV9A 4L4TB 2DL2A 4FEMA 4FQLH 4RMTA 3NEEA 4HGKC 2WINA 4YS4A 5KBLA 2AGJH 2UVEA 4B9PA 3AC0A 5FHBL 2RA1A 5AVQB 3BEVA 1R3KB 1FBIL 4HCRA 2YLHA 3QHZH 4M7LH 4OJFL 4KK5D 4PRID 1NGQH 2XKNB 3GFUA 1QLFB 3ULVE 3LPFA 1EIBA 3EGSB 2DEWX 3CDFA 5B1AB 1PY0A 2NNAB 3ZOAA 4TSBL 2CXKA 1AZRA 2MKLC 3EJTA 3UPRB 2D2CC 3T8XA 3P3YA 3IJEB 2VSKB 4DKFL 3MRRA 1OANA 5BUPA 3DO7A 1UZ8B 3CMOH 1MHCB 1IGJB 4GRWE 1SN5A 4ORGA 2NXZB 1I9JL 4B9FA 1MJUL 3FRUB 3SKJH 1DJIA 1Q0YH 3KH3A 4JFYB 4ATTA 4AKQA 4WCYH 3SPVA 5C3LD 2HMIC 1K4CB 3QEUB 1DLFL 2XV0A 2Q1EA 2R0WH 1PG7L 3FT4A 3U4EA 1C8QA 4C56A 5ENWA 1LEKA 4GIAA 3REWA 5CILH 1JP5A 5IMLB 2XWJB 3OC8A 3RZCC 3N3EA 3E1F1 1G7IA 3AREB 1MCWM 1TPXB 5I74C 4BD4A 1ZT7A 1AMYA 3CQPA 3V6OE 4KV5E 2DS4A 5CEZD 2ZUWA 3I6KA 3MGTA 3K74B 5JMOC 2YGPA 2UYLB 2BXZA 4S1SH 2HT3C 5FXCH 5C0AB 1EBAA 1RLWA 1SHMA 2GYSA 3BHBA 5DK3A 5EIQA 4IOIB 3NQIA 3SDCA 2PR4L 4D0DB 1F4YH 1DFBL 2DJUA 3ZL2A 2WZ5A 3K2KA 4KK9D 4ICWA 3IK2A 4KQ3L 2QTEA 3MRFA 4IS6A 3RTLA 3LOWA 4U05A 3L3OC 3TBSB 5BVJA 3L1FA 1ZTXE 2JI3A 5C09D 5ABAA 1D6VH 5E6ZA 5ERWA 4TKWA 5HDOA 1TVHA 1NCCH 1J1XL 1WAEA 3QEHA 2UWEA 3QWRD 4UU9B 4B50A 2C3VA 3VRLE 4F80A 4MCNA 2ICES 3EJSA 1M56B 4GSDH 5MEOA 4RGNC 2XG5B 3VI4F 4MWFA 4L8CB 2E86A 1A9BA 2G9HB 4N3TA 2W60A 4HMCA 3P2DA 1UM6H 1KTJA 3JV6A 3ML9A 3PWUA 4WW2B 4FQ2L 3VFUB 1M7DA 2AEIT 1VZIA 3NIFE 1A8ZA 1EJ6A 3DPBA 3QJTB 4XN1A 1RJLA 2O5ZH 3BCFA 3W3BA 3HNSH 4UQAA 2HG5A 3MVSA 4N9GA 3WFCL 4AIZB 5E5MA 3LDBC 1CDHA 1CFQB 2P5ED 2EDDA 4X2UA 3VGAC 5D8JH 2CHZA 5E6IA 2NW3B 4Z3FA 1M71B 1PKOA 1T0OA 3DX9B 5KVEL 1LE9A 5LG6A 5EBLA 4D9QE 5F7FA 3G3LA 3MA9L 4HETA 1U21A 1FZKA 2CO7B 2WKOF 4N0RA 1U95A 3ZHNA 1MRFH 4X6DB 4XCCL 4ZUUA 4HSAC 3DUSB 1A7RL 4QTHA 2EVGA 4ZXBA 1XHHA 3HZMA 5GS2H 2D3JA 3TZVA 3SHSA 3HUJA 4W9DC 2UV3A 1T0PB 3B6SA 4O2EA 2YOCA 5DZ9A 1THAA 5ISZB 2V9RA 1GGBL 3PLYA 5F96L 5GHWL 3RTQB 5E24E 4ZJ9A 4NCDA 3OR7B 4PS8A 1MCQA 1PS3A 1BAWA 2WCGA 3CZFB 4LP4A 2OMUB 3BKMH 4XPAH 5ID1B 3VFPA 4X5PA 2HN7B 4J4PD 5DLML 5BVPL 3W5NA 1RZ7H 4ZOAA 2JB6A 3D69B 1NLDL 2B0SL 3FN0H 3W39B 5F44A 2JIXB 3LV3A 5EZOL 4AYGA 2X53A 1QSZA 4OJDH 4QHMA 1FO0B 4JY5H 4F7KA 2A6KA 4UQBA 1GGTA 1A7OL 2ZKHH 3ARQA 5PAZA 4MMXB 3BVUA 1Q9OB 1FC2D 1D5MB 4K7PH 3RIFK 2VC2H 35C8H 2V8LA 4JY6B 1JPFA 2AXWA 4LSPL 4UYQA 5HGDA 3UTPE 1QA9B 2BVEA 5IGXL 1DUZB 1UACH 4K7FB 4Q0XL 5I15H 1Z0NA 1GKEA 2F54D 1CPUA 3ZRSA 5AKVA 1NC2B 3RY6C 2R0LH 1HXMB 2Y7QA 2FUQA 2GAZB 5C0EB 2ZTBA 2K3TA 5I17A 4GBXC 1A7PL 4FTVB 1NAKL 4MB3A 4Z7VA 5LKNA 4RISH 4MNHB 3VXSB 2Q3XA 4AGQA 4GKLA 4NNYB 1J9SA 4I3RL 2XG4A 3CN3A 4URKA 3MRPB 4CMMB 1VADB 4WI7A 4LLQB 4KK6C 4TV3A 4R4NC 3WIIL 5I2IB 4YHIB 4E9XA 3B2VL 4XZUA 1DQJB 3UBGA 4UQCA 2IDQA 4K5LA 4I77H 1G6RB 4KRPD 5DC2A 2K9UA 4H0GA 4U6YA 5JIDA 1JVLA 2XHNA 2CLZB 3LQAL 3FT3B 4HEPG 4OD1L 5JW3L 1OTTC 3OAUH 2YAEA 1ED3A 1D7DA 5EOTB 5EB9A 4HUWB 4N22A 4QXWA 4HCRL 5G55A 2ICWB 5K9OB 4ZO6A 3ZLQC 4NNPH 2NXZC 5GZOD 3MRLB 1RLBA 2VDPL 4OLVL 2AEQH 1H9DA 1S78C 4F7MA 4EJ1C 5IY5B 1J8KA 4UTBA 2R7EB 4JPVL 4HUXB 3S6CA 4YDIL 4P23A 4HF5L 2O26U 3DOIA 3QDJB 3THML 4QXTB 4Q9RL 1J8RA 3AREC 1E65A 1TPXC 1FFQA 2Q76A 2G3NA 5GSRB 2FIRT 3HE6D 4TNVK 3RWHB 5T8IA 2CA4A 4UTCA 3BSGA 2EDRA 5F7LB 4G80A 5BRZA 1X4ZA 3L5HA 4FQXD 2LR4A 1X5KA 4JPKL 4KKBD 5GGSY 5A2LH 1BF2A 3RLSA 2C9UA 4CJ0A 4GAFB 4L1LA 1UYWH 4YUEL 3RGBA 4BFKA 5EF1A 4A68A 1KPRB 1KBKA 1P4BH 3KJ6L 5D7LA 3H9YA 3MUGA 1XCQA 2CBMA 2FQFA 2FHCA 1HTYA 2EZ0C 2ADGA 4GIOA 3TT1L 3N55A 3II3A 5LN8A 1EWHA 1N19A 3IJSB 4QRPA 5EOQH 2AITA 2X4UA 2BY1A 3LHPL 3QO0B 3UMTA 4CSSA 1CFTB 3W0WB 2QZ5A 3ECUA 4BDVB 3E0GA 2PTUA 4E9LA 1RFDH 2GCYA 4Y2DB 4YHMH 5AVRB 3VTAA 2YD2A 2VQTA 1LILA 4U6HB 4DN4H 1XCTB 4XODA 3PXHA 4NPJA 3WNLA 4L0PB 3D9AL 3IS0X 3FFDA 5KANG 4OZHB 4WW2C 3IDXL 1MI5A 4XNXL 4OF0A 1MCJA 5BPPA 1XGTB 5IIEB 2EDKA 1E7VA 4JQIL 3PWVB 1C5BH 1W80A 4PJ9A 5B7EA 4TNWF 4ERSH 2XFXB 4JO8A 3T04D 1Q9WA 3BVNB 3U46A 2IGFL 3MZTA 3QPQC 4JO2L 1E42A 1H3PL 2LGNA 4XP4L 3R7QA 3SZ6A 4LQFH 4OD3H 1H19A 3VI3B 3FTYA 4UIKH 4FXKC 4K7PY 2UZIH 2CPCA 3BKYL 4MXWH 5GRUL 3BSZH 4L3EA 1YEIL 2EDFA 3POHA 1PKQE 5D5MB 4R2GD 2OSLB 1LEGB 2OTWA 4V11A 1I1YA 2QDVA 5TFSH 1YJDH 2ZPKH 4B5EA 4EE2A 2AAVA 4S0TD 1WE5A 3MV8E 3L4XA 1YPZE 1TCMA 2AZUA 1JFQH 2W88A 4FLRA 3W11D 1A4KA 5I8OH 3RTQC 2MOVA 4QXUH 4Z76A 2HUEA 3ARVA 5KVEE 5D2LE 2BNQD 4LCIL 3ZIYA 5FW8A 5I71B 1HILB 4AC2A 3FSOA 4GKZA 3MYJA 4P5TA 1YY9D 1LDPH 3JT0A 4NHUA 1LP9B 5AOIA 4LCWA 3ZX1A 4LXFA 4XP5H 4E41D 4YVNA 1I8MB 4JHAH 2A7BA 4MCMA 4H4NA 3L7EA 4YDKL 3BP6B 4G59C 2D7PA 2X3BA 5JUEL 3PQYB 4U1SA 1MJJB 3TWCH 3VACA 3GSOB 1TJGL 1AI1H 5H4YA 1R19A 4MMXC 1FFPB 3NJMA 3HI1B 4LASL 4ZI8A 4AVHA 4ZMNA 4J3WA 4R0LA 3T0VA 5C0DA 3H6AA 4NRZB 2Z8VC 4G6AC 5JOPE 1IAIH 5HYSB 3S0PA 3SD5A 1N12A 3CFCL 25C8L 2GB2A 3MX0B 2NZ1A 2RMNA 1FFOA 3TONA 1U91B 2K6WA 4IRJA 3VXMA 2FX7H 5HVGB 1M2OA 3E6FA 4Y19D 2E27H 2VMJA 4N25A 3UAAA 3ZHFA 4ICXA 1A6UH 1DDHB 3V5KB 2Y5EA 3PABA 1HCYA 3QZPA 2FJHA 2ESVB 3EZ8A 5C7ZA 3RU8H 5D93B 1OP9A 2J57A 5G5DB 4WI9A 3UBFA 4IIQA 2JKIS 2LU5A 1DSFH 1H9VA 1NGZA 3EO1B 4HBCL 4AV0A 2OMZA 2P8LA 4E9RA 2CLRB 1MRDH 4MCYA 4UUJA 3W2DH 1P53A 2JJUA 3T3MF 4V1DB 1U33A 2TSBA 7FABL 1G0YR 5C8JB 2FJSA 3FU7A 4O5LH 2EIDA 1QG3A 1TMQA 4XCNB 1KNOA 1WG3A 1YNLL 3GSNL 4WFFE 5CJQL 5KN5B 1JN6B 4FQIH 1G0XA 3T6ZA 5L4JA 1MIEL 4M1GH 4H0LC 1UXMA 1MFVA 2GK0B 1XZ0B 3VXRA 1NCOA 2DH3A 5FW7A 4MBOA 4GFXA 3W9DB 1S9XB 1CFBA 3CNKA 3TNNA 3QG7L 3FB7B 1M2VA 5F9WB 3L3DB 4PRPD 4UOZA 4AK1A 3S34H 2VE6B 3G7TA 2G2PA 3SQBB 5MP6L 3HE7B 2EXWC 2P80A 4NUMA 4Z7OE 1I3GL 1UFUA 1WEJL 3CFIC 1LK3L 3FQNA 3MV9E 4PV8A 4WTZG 3OB0H 1R5IB 5F1NA 4XPBH 1CF1A 1WBZB 3FO9B 4GMSL 3V55A 4LPXA 4AEEA 3ARBD 2EH8L 1WISA 5IB5B 4L23A 2FSEB 3EYVA 3IDIB 4ISVA 2WB7A 4X4XA 1AGFA 4PYHA 4APXB 3GBLA 1F58L 3S3SA 5E94B 2Q10A 1A4BA 4UTBL 1ECZA 4DT2A 2J56A 3EJZC 4IKIA 4JFTA 2QSQA 3SE3A 3ARGA 2IC2A 3JUZA 4YOKA 2HJLB 1CGUA 3JTTA 4UQIM 3IKKA 4J5VA 1GH7A 4AQEA 3SBRA 1YEFL 2G2NA 4HPYL 4WF7A 1E4KA 1J10A 1UWXH 3FB8B 4BELD 4ELDA 5M7QA 4I85A 4XBEH 1DQLH 1ZLVK 3OF6D 2GJ6D 4QHNA 3CFMA 3K5RA 3PWPB 4JY4A 5TQ0L 3JTSB 3RY4A 4ZW8A 3SO3B 3MOQA 1JCKA 2EIEA 4QHUA 1J05B 4R4BA 4C56E 8FABA 3O3DB 1QFWL 3MNVA 3MOAH 5FA3A 1S7RA 3L3HA 3QNZA 4HWEL 43C9A 5FV1L 3WDHA 3FTXA 4WFGD 5IBTH 1D5ZA 1UENA 5DMKB 3ORJA 3PFUA 1BJ8A 3GD1C 2IMMA 5EO9B 1ZVSA 4PJIB 3P4MB 2WNKA 3NJHA 5G4MA 1I4FA 4GAJL 2BVTA 2W9DH 2WLYA 4WKZB 3ZKNC 1L3NA 2HT2C 1QRNA 5EIVA 2WSKA 2GI0A 4AKPA 2VXTH 3EYUL 1NOAA 3WFDL 3BE1H 3TJEL 3WEAA 3O2VH 1CU4H 4ADIA 2OL3B 1F18A 3NJGA 1KYOK 4PJ8B 1F6AB 1C9SA 43CAA 3TA3D 1BZQK 5KS9F 4DK6A 5FLUA 3K2IA 2UWEE 3L3IA 3T0EB 3VFSB 3VFWB 5GGTL 4J3UA 3GI8L 2YQBA 1ADQL 1ZK9A 1XFPA 2AQ1A 3BAEH 5LBVA 3RWGA 5C9JB 1AHWA 2Y5QA 4NAMA 4RWYL 3AW5A 3TCLA 2CGRH 2VUYA 4JQXC 3EJJX 1D3CA 2PCFB 1ZXKA 4TSAL 5ACZA 2WAHA 2D2OA 3H9HA 4KKLD 5GISL 2RALA 5KZCD 4JFPA 1BZ7B 1I1AB 3PDOA 5GRJH 4GFTB 4XO4A 2IAND 4KUCF 1IEAA 1V10A 4HDIA 4Z0BH 3DBXA 1GAFL 3SPGA 3WE1A 1S7VB 4JKKA 5I5JA 1I8KA 4TPRH 5LO7A 1CXFA 3KPQA 5CEYA 3HLKA 5E2VH 1SMDA 2L4OA 3O6LL 1UWGH 5F7EH 2ADIA 2P4AB 4W9ZA 3LS5H 1JWSA 2IPKA 1MJ7L 1VKXB 1SMOA 2VZ1A 3HUJE 2DI7A 5JOFB 1N26A 2AV7A 3L9EA 4G1EA 1TUPA 1SLUA 3VXNB 4PTUB 2GFBA 1TJXA 3I6GB 3N43F 4M03A 4LFHD 1CGSH 5EUKB 1F1DA 2BRRL 5D93C 1ITBB 4N5UA 5E9DB 3T4YA 1JPTL 1CS6A 4BBWA 5F21B 5IOPB 3WU1A 2AK4D 2D7QA 1HCFX 2D3NA 4Z7UA 3PAYA 4FFVC 2N1TE 4C59B 4TUJB 4NI3A 1LNUA 1OAYH 2DLHA 3RZCA 2V2XA 3WY2A 1OCOB 3LKQB 5DJ2B 2RHEA 1CE6B 5GGSB 4PRHB 3UYRH 3IFNH 4JKPL 3JQOB 5E8PA 2EICA 2PYFB 5AAWA 2F18A 2X4NA 1BAGA 4Y4FD 5IQ9B 3QH3A 2ZIDA 2YAMA 3B7SA 1XH3B 2CH8A 3WEXB 4PVBA 5C2UB 5F9WC 3EFFA 4MD4A 2BVOB 2DQGL 4RX4D 4HUUA 4NIKB 4GEIA 5DRNB 4NFCA 4N24A 3V4PA 3HE7C 2RCSH 1QFOA 3GLZA 1RULL 5FYJH 4U1KA 4Z7VE 5GS0L 5JHDA 4JCLA 4OKVB 3L3OA 4WEEA 1E40A 4YL9A 3CPUA 1BYOA 1L7IL 5KVMC 1JPST 3ZXAC 1A21A 4OM0L 3FQRA 1S2EA 4YHPA 1WVZA 5C70A 3ATFA 5HGAA 4ANKA 4P99A 4RMWA 5C6WH 1KCBA 1PY9A 3NPZB 3MUZ1 3BDYH 1UOWA 4DKEL 1WT5C 2A6DA 2JKWA 3AG1B 2KPNA 3JT2A 3H6JA 3SJVA 2NY5H 4TQEL 3PV7A 2QVMA 4JMNA 1PZ3A 4JFUA 3QQNA 1B2WH 4KI1A 2PXYC 2EDNA 3HG2A 4OLUH 1KY7A 1CE1H 1JPGB 4ZUWB 4LP8A 4OZFH 1A4CA 1IGFH 3OJDA 4UDUA 1DSYA 3SO3C 5MENA 4LCCB 3NN8B 1Z3GH 1U8OB 1VPOH 1TYJA 2HVJB 3HA0A 4NAQA 1A1OA 1OCWH 1YN6A 1P5VA 3CVIH 4PI0A 3UC2A 4UINL 3OPUA 4G9FA 3U6XS 3ULUH 2M2DA 3F05A 3AAZB 2ZYHA 3U4KA 5CLWA 4MXVE 1OB1A 4NRYB 1ID2A 1GS8A 5BRZE 2R39A 3QDAA 1I85A 5DJXA 5F0MB 3V9FA 2VR3A 3BDXA 4G8GD 3FFCB 4BSVA 4CVWA 1EX0A 5FGBC 3HNVH 2HJKB 1R3JA 2F7RA 4LSRL 1FNEB 2YMXH 3LIZH 3MNWA 5D7LE 3BWAA 3HI5H 4OT1L 1UATA 3EYOB 4QDGA 2VLKA 1AIFB 2X1WL 1KJ3L 4HJGA 5IQNA 2Y2WA 4PJ8C 3O8XB 1KEMH 4QRPE 4H40A 2WXGA 2A9ML 3TEZA 5ITBL 4K0OA 5IROC 3QCVL 3APFA 3QDMD 3T0EC 3T65A 3CHSA 3V4UL 3L08A 4I3GA 3GK8H 3Q8BA 1VB9A 4G11A 3LNIA 1BZ9B 4YSSA 2ITCA 4BYHA 5T3ZH 3BGAA 2XXMB 1PZAA 3ZKMD 4AKOA 5EEVA 4RDQF 3OWRA 3CCHB 2XNAA 1MI5E 3ME0A 2YK1H 1I1AC 3LMJH 4UT9A 1A6ZB 5IKCB 5B7FA 1I1FB 3D0LB 3GBEA 4QOKD 5CKGA 1L9PA 1P0SE 2EEBA 4NGHH 4ZBJA 2WWKO 2OYPA 4DUWA 4A2DA 1E5CA 5DD1H 1MHHA 3K6DA 4OGAC 3KYMA 4L3EE 3K72B 4WK4B 2Y07L 5FKPA 3AG4B 1SXSA 3AMKA 1KF9B 3BAJA 3L9RB 3EGSA 4P9ML 2BZ7A 2RQEA 2NNAA 3MBWB 3H3PH 2PP7A 4K94H 3Q2NA 4AEHH 1THCA 5EOCJ 5JZ7C 2A77L 1NUFA 1WIOA 5JW5B 1F4WH 2GY5A 1AYRA 3WE6B 5AENA 3D0AA 2G30A 1MHCA 2K7QA 3D39D 3RVWD 5CKAA 2NSMA 3FRUA 4JFYA 4ZNEA 4LCWE 2NOYA 1PL3A 2EC9T 4OFYD 3IU4H 4OLYH 4KAQH 2EDMA 5AKRA 3FN9A 4NAJA 4C47A 1EDYA 2VL5B 3L4CA 2V2TA 3BZEB 3QUYA 1SZNA 2B9AA 4WNQA 2CO6B 2FYVA 3RJDA 1NFDB 3WNPA 4D9LH 3AREA 2Z92B 3FU8A 4G1MA 3L1OH 5SWSB 1ZA3A 3DTDA 3S36X 1I8AA 4HHWA 1A14L 3P9LB 3N91A 1JUFB 2UYLA 4PS7A 2IDCA 4FG2A 4WHTB 5BO0D 3VI4A 1HHIB 4P48A 5C0AA 4OGYH 4IOIA 1WFJA 1O6SB 1FVEB 3VXME 3F7YB 1ZGLM 3OBAA 1BOGA 5BV7H 4Z3JA 1SFHA 1NL0L 2GKIA 2AABL 4WO4B 5INCA 1FL6A 4HMDA 1ECYA 4S2SA 4U1MB 2HG0A 1GL4B 4RWHA 5CBAA 3PV6A 5DHYB 3VSQA 2PNDA 3D0VA 4LNRA 5LVEA 5DLLA 1AQHA 4NENB 3MMEB 4AOFA 5HDBF 2BVPA 3NFPB 5D71L 3EG9B 2WBJB 1FCGA 1CI5A 3FH8A 3S5YA 5F93C 1GA2A 3AU1A 4DGWC 2R4SL 1AS6A 1UB5B 3GMRA 1FYTD 4L8CA 2WKOA 3VFGL 1RZPA 2E6QA 3PL6B 1ANUA 2WZPA 3S3DB 4FMVA 5FWQA 1OZUA 2LVEA 3HBPA 4A2LA 3VD9A 2H47C 1CIUA 3DGGB 3WIFB 4M5YL 1P5UA 5L2KB 4DPBX 1A6WL 3P0VL 2FEJA 3ESNA 4KGJA 1GSKA 5EU6D 3OLEA 3VXRE 1U8QB 4OFIA 1TJMA 1TJIH 2WP3T 2Y25A 3OKMA 3G04B 3CU1A 4AIZA 1CFQA 2ZT9C 3MOBL 2A9NL 5C07B 2WLIB 1AXTH 1I7RA 4DW2H 3QZWG 4OQ1A 3GRWA 2IJ0C 3MBEB 4LCCC 4JFXB 4B97A 2VN4A 2VXQH 1B9KA 3INUL 2F0CA 2F8IA 4XMKL 1MNUL 1F13A 1HK6A 3CDCA 3KPTA 3PG2A 4GW4B 4W93A 3T0WA 4X6DA 5E2UL 1ZIAA 3AG3B 1QFUL 2JB5L 5BW7A 3RFRA 4OF8A 1QLRA 3LVTA 1U8NB 4X5XB 4I48B 4FHJA 2C9SA 4XPTL 4NZTL 1RURH 4H25B 4K23L 3RTQA 4FCAA 2R29A 5H35A 3H9SB 3MRBA 3GRWH 4I0PD 5AZEL 2FWUA 2Z7ZA 3CZFA 3EH1A 3F58H 2IOIA 4PRDB 5KG9B 1EAJA 2HN7A 3DXAB 4AM0Q 2XICA 3O8XC 5T1LD 4TRPL 4BZ1L 4MDJA 1T66C 3I74A 4BXSV 2KL6A 1H3XA 3VW3L 3DX6B 3NSXA 4N2FA 1KCKA 3W39A 2A83B 3K4ZA 2IG2L 1LHZA 3F01A 5BQDA 4KX9A 2ZG2A 2WK2A 5E9NA 5KVDL 3X3GL 2VMFA 3WJLC 5L2JB 2IFFH 1D5MA 2VZSA 4HEMA 4NO0D 4UNIA 4J8RB 4JY6A 5DXWA 3GSRB 3V0VA 4QJ5B 4K7FA 1AMXA 3ELQA 4ABWA 4Q2ZB 5DCCA 4Q9QH 1NGWA 5IMOB 4HWZA 1DJHA 2GAZA 2DTMH 1O7SA 5I0WA 5TDNB 1DVXA 4X80H 2YRZA 3OHXA 3O3UN 3FJTA 4FTVA 2OBGA 5T3XH 4HWBA 2P44B 4PW9A 2DQFA 3HB3B 4TTDC 5J89A 1QRNE 4L3CA 4PRBB 4WWKA 3VA6A 1VADA 4LLQA 2J1ZA 3TF7C 4KXCA 5EBWB 4S1RL 2AQQA 1LO3H 5T1MA 1RXLA 4W9EC 1WGOA 2IXQB 2ZYIA 4LOUC 1G9MH 2CLZA 3Q8FA 3FT3A 2VM3A 2Y06L 1D5BB 2VLJB 5IESH 2FWOB 2XOTA 1XF2B 4HUWA 4HS8H 4G8FB 4AGNA 2A5UA 1JGEB 4FNLL 3MRLA 3LXBA 2D4FA 4HPHA 1SHXA 4KKPA 4NFDA 3C60A 1IGIH 5T5FA 2FYYA 2MHAA 3LQZB 5IVNA 3TFKD 1PAZA 2O5NA 2R7EA 5I6PA 3SPIA 2I85A 4QXVA 4PJXB 2EUXA 4XNQB 4LRIA 1MXDA 3M7FB 1SLVA 3X12B 3RWHA 3QNXB 4WJG3 3LS4L 4KVPA 2HRPH 1M7UA 1KUMA 3IYLW 5ECGA 2DLIA 3SE9H 2GQHA 2GEEA 2HJFA 3SDAA 1KTBA 2BP3A 5AW6B 3T4AB 3ZT6A 5T5FH 2ARJQ 3MO1B 4JFED 3PJSA 2H1PH 2WQXA 1M42A 4WO4C 1YJDC 3ZDXF 1FGVH 2ZKXA 5HY9B 2I5YH 2CCWA 2GSMB 2ICCA 5HGGS 4AYMC 4LSQL 1Y18B 3IJSA 5HPMB 1FUNA 4KC3B 3ULVD 4O51A 4JM2B 4D0BB 3ARXA 4KJWC 1OTSD 2UZPA 1XVSA 2Z4QB 4X5RA 2WBJC 2FUTA 1E6JL 1KBPA 3B7YA 3EIFA 3K5SA 4Y2DA 5IFJB 1JPEA 1YMMA 3GI9H 4ALAC 1U8MB 1BWWA 5JIIA 4Z7UE 3EDFA 4NC0B 2B2XH 1IC5H 1ZRUA 3QUMH 3PL6C 4YDJA 1QFHA 2IAMB 3EFDH 3AGWA 4OZHA 4MJ2A 5I8EB 5B39A 4PGDB 1RZ8B 1AY1L 5AAMA 1RU9L 4ZYKB 3UROR 5CP7A 2Q6WB 1H6FA 4PJ5A 1EHKB 2E7CA 3BGMA 4M8VA 4DGYL 5JHLA 4CBZA 4JO4H 2I7OA 5LAXA 3PP3H 5IM7A 4HPOL 2WV3A 3MBEC 4MCZA 3EYFA 2ZG3A 2KI6A 3TCTA 3TIDB 1HU8A 1MHPH 3W9EA 1BGXH 1AIZA 1E3ZA 2PO6C 4ODTH 2XU9A 4XMPL 4P07A 4W4OC 1AD9A 4YDVB 5JHDE 5EG6C 3VSTA 2V7HB 1MNNA 1D7BA 1JYVA 5FM5M 3E9TA 1NBVH 1S7WB 1ACYH 2XN9B 2KERA 3KW7A 5AW4B 1Q0XH 3VQMA 1ROWA 1YEGL 3N40P 1N59A 3BH9A 4XNUL 1MXGA 3QAZB 3QUZA 4K9JA 5EIIG 4OZ4A 5JHLH 4U7SA 3FULA 3CUPA 5B3NA 4DVBA 3C6LC 2ALWA 2K70A 3K6NA 4FHBD 4HP5A 4QRTB 2M83A 2Z35B 4W6YB 3ZHKA 5I1DB 4QCIA 5AOZA 1LP9A 2ZUSA 2R15A 3SJVE 3TH2T 5DJ0B 3QULB 2X9ZA 4JHUA 4HOZA 3GJEB 1IC4H 1QPKA 1X4XA 3Q1SH 4Z3TA 2B4CH 5GGRY 3BP6A 3NA9L 2EEDA 1OE2A 1CD9B 4A04A 3KBEA 5IFHH 2NZIA 1MJJA 3D18B 4WHDA 3Q3GA 3NGBB 4IW4C 4POYA 1A66A 4KDVA 4E2OA 5MENE 1FFPA 1NEZG 5HI5D 3CHQA 1UD6A 4GMTL 4JQVA 4GP5B 3WFEH 5J57B 5HYSA 2R59A 1MSPA 1ZLWH 1GS6X 5CGYD 1Z3RA 1AO7B 3FQUB 4G9FE 4PLJC 1IAIM 1MFEH 1N2RB 3FOMB 1U91A 4YJZL 4G6KH 3ETBJ 4BKSC 4OUUA 5SV4A 3FT2B 4HISA 4RQQA 4D9QD 1UM4H 3BVXA 2HVKB 1FO0L 3D1MC 2OZ4A 4LAQL 5FPIA 2W95A 1D5IH 1CD8A 1DDHA 2A9CA 3QIUD 2F5BL 4XNMB 3GHBH 4L2YA 3HB3C 4MHHI 5T3ZE 2PPCA 4IMKA 3QB7C 5KVDE 4PSRA 3O6ML 3QCUH 1D5XB 3EO0B 1A1NB 3EO1A 2GT9B 2N0MA 5E95B 2VLKE 2CR6A 1BVKB 3OKNB 3QJZA 1TNNA 4V1DA 1BXUA 3R8QA 2F5AL 4XPFL 3U7AA 5KAQG 3DI2B 4U0QB 4N4YB 3IWVA 5TGBB 4A7GF 1I8UA 3EGXB 3L13A 1JN6A 5IWLC 3OGOE 3OMZA 4KHTL 3CSYB 2BJMH 3HG5A 5GRVL 2GK0A 4AVIA 5LXGH 3L7FB 1X9LA 2D7MA 4CNIB 1DL7H 2G9KA 1NPNA 3SQRA 3U2SB 4J3TA 4DAGH 3W9DA 1S9XA 4CAGA 4GW1B 3LXCA 4ONFL 2YGOA 4XVJH 3FUIA 1D9KD 1G7HB 3FB7A 5ALBL 1G6RL 1KXQA 4P2CG 2MCG1 4IRZH 2P47B 4NT6B 1KCUL 4JEGB 3DECA 1P4LA 1YEEL 4NZ8A 3UTPD 1HOEA 4Y5VC 3BP7B 3ALPA 1PYWB 4HJUA 4EOWH 3OKDA 4KK8C 1WBZA 5B3SB 4YXKL 3R19A 1CICB 3N1GC 1J5HA 3UPAA 4M8QA 1OXYA 4TLUA 5IB5A 2L7QA 4P46D 1IM9B 1BVZA 2FSEA 3IDIA 2VCOA 1FV1A 3I75B 5F89B 3BWSA 4APXA 3P11H 2VO8A 2GBTA 1N68A 4M48H 4U1NB 2DQDH 3T4AC 4DN3L 4YGVB 2VLLB 1EPFA 2HJLA 1WT5A 1NIDA 3AUVA 4U1HA 3HMWL 1MCNA 4MSWB 4G6FB 3CQQA 4JM2C 5F1IB 7PCYA 1MG2C 3FB8A 4F15B 4QTIL 4XO9A 3UOAB 1JPSL 4Y89A 4X5QA 1DQQB 4ZNEE 3QEQB 3RWCB 1WFUA 2PTTB 2DYPA 2WQVA 4HHAB 3QHFL 2G3XA 2IF7A 4RDBA 1J05A 2IAMC 3TYGL 3OB8A 4HIIB 1U2YA 1V3LA 1OT4A 3WN5B 3N1FC 2E7LA 3Q0HA 4M93B 1IBYA 3DC0A 3FTZA 1R5WA 3MLSH 3MXVL 3NH7H 4I3SH 4K7PX 4Q6IB 5EO9A 5EU5B 3DVNB 2FT8A 1H8SA 3P4MA 5I5RA 1SEBA 3VI4E 4M6OH 1A3ZA 5L9DL 5C0AE 4AMXA 2BW4A 3GQFA 3U4BH 2PETA 2FATL 2WIIB 5AB2A 4AMKH 1TITA 4FE9A 5HHPB 5B3JF 2Z3FA 3GNMH 2BFVH 3NCYP 3K80A 5H2BA 3QS3A 2OL3A 2IWEA 1AHMA 2HKFL 4DERA 3G9AB 2B7DT 2JKTM 3ZO9A 4DP5X 4XTRD 3MCG1 5C3TA 4ZS6C 5FYLH 3MRHA 3MR9A 1MF2L 3VFWA 5AZUA 4P2RB 3QAZC 1IIKA 5I82A 2IDUA 4M5ZL 3B5GA 3U9PL 2PYED 1A8JH 3AS1A 4KKCD 2VB5A 2LV4A 4GSXA 4ZFOA 4HOXA 1DP0A 4LDEB 3QHTC 3T6QC 1M9WA 3WNMA 3STZB 4YWGL 2PCFA 2HTKC 1LQSR 1HXKA 3H53A 5G4NA 3FC8A 1A7QH 1PEWA 4S10A 3QJHB 1OP4A 1BZ7A 1I1AA 2EP6A 3KEHA 1ORQB 2YRPA 1JZEA 1Y0LB 4BHUI 1NC4D 5C0RL 1S7QB 3VSUA 4MJ4A 2IH8A 2GUOB 2AAAA 2AJXH 3NGBC 2FWLB 5L6YL 1JZ3A 4NKOB 2ZCKL 2G3ZA 3W82A 1RZFH 2SODB 3RDTD 3ARDB 4ES9A 1YUHB 4N2AA 1A6AB 3QK0A 2JLPA 5BV7B 1SHWA 4FC3E 3U36A 3FO2B 2DKUA 4X6DE 4UANA 4GXFA 3ZL4L 4DP0X 3T08A 3P40A 1EHXA 3WXWL 1MFBH 3KR3L 4ZMZA 3NFSL 3X1NA 4NQXA 1NGXB 3H7BA 1JE6A 2WMPA 1SJMA 4MDRA 2XWDA 4PTUA 2WJ5A 2XQYK 4OCRH 4DWHA 4EPSA 5I30L 2W94A 3GT6A 4J3OD 5F7BA 3RFZA 3Q8AA 4ODSL 5GGUB 4MRBA 3VNYA 2F53B 3OAYK 3OJVC 1PIFA 3BVVA 2HKAA 2ZWZA 3EZJB 3KLKA 6FABH 4F9PA 1HHKB 2MIZA 1DANT 2NY5C 3QIBB 4HK0A 4I2XA 4DO6A 1G7JA 2J8OA 2OZ4L 4NZUH 4MYWB 4TUJA 1ZEAH 3DOSB 4XBPB 4IHBA 5MERB 1JI1A 4XP9L 1SRDA 4L3FA 2CMRL 2E8YA 2LLLA 4YO0A 4M56A 4RFOL 1CE6A 5GGSA 4HEME 4XB8A 3UEQA 4BZ2H 5LCVH 1UHVA 5KSBB 2PYFA 4YBQC 5ID0A 2BIMA 2VDOH 2CNYA 4L1TA 3CZSA 4LHQB 2LFEA 1N7ML 4N90E 3FU3A 2WQSA 1ZK5A 5LWYL 1OWWA 3GSQA 4NM4H 3ULUC 5CWSB 3RVUC 1DQDL 5JOPD 1EEQA 3WMQA 1EJOH 4O58H 4TUOB 2ZOKB 1RK0B 2WWOA 3AJ7A 4FTVE 2FGWH 3WBDA 1U58B 3RI5F 4GAGL 3VCLA 4G7VL 4L1DA 1E6OL 5J1TC 3G5YB 4KROB 1CICC 3JVGA 4QRUB 4O9HH 1MHEB 2ALAA 3K4AA 4U49A 2WZ6A 1XTLA 2Y22A 4L8SB 3F6JA 1CQYA 1IFHH 3CG8A 4PJAF 5L4FA 2GSGB 2YJLA 1ZHNA 2NZ9D 4KVCH 2DYSB 2BC4B 1HSAB 1JERA 4OJEH 4FQCL 5DUPL 5IJKA 2D03L 2WXHA 3EGDA 3A6CH 4PUBL 3O6KL 3TL5A 3WJMB 3P0GB 2WLJA 4AMWA 2H32H 1IILE 3NP3A 4F15C 4ODXB 1T0NA 4RRPM 1MOEA 4WFFD 5D6CA 4WAFA 4F2MB 4XMLL 1IU1A 1P1ZB 4KNQA 1U3HB 3FMGL 4NUGL 2NNXA 4X7CC 4P2OA 2HVJA 4G3YL 4FZ8L 4PMFA 1NFIB 5JXEC 2YXFA 3M8OL 1A3RH 3KYNB 3WN5C 2YO3A 2R4RH 4M93C 3E6HB 1OAQL 2W0PA 4Q6IC 3ZZ1A 3P0YL 3UZQB 1R0AH 5MEPB 4FA7B 4Y16D 1EVUA 1HHJB 3H1ZA 3FFCA 3MV9D 2JKXA 5IT2H 1NFKA 3P02A 5IHWA 4ONOA 2C3XA 1QPPA 1WFMA 2YZ8A 4APQB 3I2CL 4Q6YA 4N1CA 2EIZA 1AKPA 2DMBA 3EYOA 3QUXB 5GGRB 3HG3A 1QUNB 1XL4A 1AIFA 3ILPA 4K94C 4QGYA 4KTYA 4QAMB 4F1ZA 5DRZB 2HLFD 1UM5H 3O8XA 3IB4A 4R7DB 3ARUA 4A55A 4FNUA 1QPXA 5FGSA 2QV4A 3SYQA 3VM5A 4X42A 3DOHA 1ACXA 1WLHA 3QHZL 4PJFF 5FCUH 1DE4A 4K5NA 5KYUB 1NGQL 4OY9A 1YMME 2XXCB 2YQGA 2MPAH 1BZ9A 3WJLA 3KDMB 1T04A 1RAMA 4JG0L 1MW0A 2E7DA 4DK5A 4ACTA 2OL3L 3CN1A 4OZHE 1T1YB 2UY6B 2VKWA 3CCHA 2A4CA 5DHVB 5GS1C 2HWZH 2MCPL 3GBDA 4GO6B 2PMZA 1A6ZA 4PJ5E 3O9WB 2J7LA 3UJJL 3WO4B 3WUWG 4C56D 1AR1B 3PREA 4I0KA 2LW3A 2HZHA 3GJFB 1NCIA 4HGWB 4G42B 5IF0B 3SKJL 3U6RB 3VD1A 2EH7L 3ARDC 3B2MA 5DVOA 1HL5A 1UWFA 4NQSA 1P9MC 1VRSA 3T2LA 5BV7C 2YD8A 3F7KA 4TF4A 4IRSB 1U3ZA 3BEWA 3SDCD 3L9RA 2FRGP 5TE4H 3UCQA 3MLXH 2ZKWA 4FA8A 2H6UA 4Y1AB 3BZFB 1I9EA 2ZAGA 4NWUL 3WE6A 4PAZA 4DGUA 2H9GB 3V5HB 4ZD3L 3CLEH 3UIYA 2IWGA 2ZG1A 1CGYA 4K9EC 1LP9E 1MLCA 3QUMB 2XXFA 3RUGF 4QYOA 4B96A 5I1AB 5FUZH 2WCSA 3HG0A 4PCTA 4YVUA 3RVTC 3IU3B 2XVBA 2YRLA 2VL5A 3OLDA 1EFXB 1D6VL 4R4FL 1Z9SB 5FAAA 1JWMB 2W0KA 2H1XA 1N9PA 2DH2A 1NFDA 4KXAA 1LVEA 1O6TA 3N1PC 4GSDL 5EOCH 5SWSA 3EJPA 3TN0A 1JXJA 2UZYA 1MLBA 1EO8H 3T3ME 2EDTA 1XR8A 3BH8A 5CHNA 2MFNA 2QPFA 1K8DA 1DQVA 2AJZB 4FQJL 2EYTB 2C34A 2RB8A 4ODHH 15C8L 4WK2B 2O5ZL 3VYPA 2PPAA 4KI5F 4YSAA 1FSKB 1H8OA 4PWHA 3WY4A 4AGPA 1VFBB 2EIKB 4D0CB 3ZDZB 4KROC 3UDWA 5I19H 5I28A 3TZVD 3MUUA 4X7SL 3EG9A 3TVMA 4L8SC 2V9TA 3K1DA 1WZKA 5E00B 4CVZB 1T0MA 4X98A 3V4VH 4V1DE 4DTGH 4B7LA 1B0WA 3PWLA 1BFTA 2PF6A 3UFIA 3N41B 4F8LA 1F3DJ 1GOFA 1U8QA 3O2DH 4XNYL 4UTAH 2VERA 3SGEH 3M17B 3O0RL 3ZDZF 5HHOB 3VX0A 3RNQA 1KCVH 1U0QA 3BT2L 4U6XB 2WLIA 2M26A 4MZ2A 4BQ8A 2Z64C 3MNZA 1U3HC 2VISB 2X41A 1KXQE 1MFAL 3B9KD 5GGVY 2YXMA 2BNUB 4AIOA 3GMLB 1F4XL 4WY7H 3CVHA 4A2MA 3G08B 3DVGA 1WS7A 1IIIA 5KJ7E 5JPMB 2FQEA 1XGQA 1XR9B 3LZRA 3X3FH 5F97E 4ZMTA 1TO5A 1CDIA 1GMEA 4NUJA 4OR1A 5C0BB 4K7PL 2XZQH 1USQA 1RUAL 1U8NA 2A9BA 2B1HH 4WSKA 5DUML 1GYCA 1SMAA 4X5XA 4AQ8C 3F8UB 4B9YA 4C83A 5CD3A 1QVOB 4APQC 3FCUB 5I15L 3E3QC 1KJMB 5CJOH 1GCFA 4PCSA 3BKJH 2R2HA 3C5JB 1CYGA 1G9MC 3QUXC 4PRDA 3IDGB 4MVBD 2HFGL 2R2BA 2V33A 4OB5L 1TYEB 2NR6C 4GQPH 1A6TB 1OSYA 4HFWB 2I69A 3A3YB 1T3FB 4L5FH 4NKDB 1E7UA 4JRXB 2WVSA 4J3OG 4NPKA 5C0FA 3DX6A 1QHPA 1KZYA 3PGCA 5KANI 3P3UA 4K3JH 1JXDA 1ZWIA 4G8EA 5B4MD 1JYXA 5DK2A 2KYIA 3C2SA 1DVFD 1QW9A 3BN9D 3KWWB 2PR9A 2R2CA 4PHXA 1KTRL 5ADPH 1R3LA 5C0NC 1GCYA 2ZX7A 3GB7B 3F04A 2I27N 4FNPA 1NAMA 4PPTA 3OAUL 1O7VA 3C8KB 1LM8V 3B4NA 1SDDB 2Y7SA 3GTTA 5ETUB 4R90L 2BNRB 3CQFA 4OZGF 1N8ZA 4PWEA 1AR1C 3WO4C 4LSTH 4AT6B 1XH2A 3RG1C 4AQ1B 1YRKA 3PNWB 4RIRB 3SIKA 1X5ZA 5D1ZD 5FK9A 3TO4C 2AEQL 5B38B 4HJSA 2BXYA 3AS0A 1BVLA 5C6TL 2C26A 2MWCA 3SGJC 3VWKB 1IB5A 2X87A 3B43A 5EBWA 1G1YA 2WM0A 3FAWA 3RWFB 2B77A 4IRSC 3T8VA 4Y9CA 3WKML 3S4SA 3IBOA 4LZKA 5FO7A 4AYBA 5CFHA 1Z1WA 3L3JB 2IXQA 3EJQA 2JWYA 2QPSA 4M4RA 1VFAA 2R8SH 5CIPB 1A5FL 4Y2OA 5HSFA 4LLDB 3TOPA 2YUVA 2FWOA 2GBVA 4G82A 4QRPD 4RFNB 1XF2A 3KPNB 5KTEL 2AI0H 4G8FA 3AQDA 3MPCA 3PGFH 4LEXH 4JUSA 3G6JF 1P4BL 2OMXB 1JGEA 3LZFH 5FYKH 1JL8A 3A4AA 3UBXI 3MGAA 3KYOA 2DPKA 5IFAH 3FHAA 2X88A 4Z18A 4E9QA 4HZ1A 1MFDH 1F4AA 3BPNB 1KYFA 4PYGA 4AUUA 1TFHA 2W07A 4PJXA 4XNQA 5I1IH 1I9IH 2V3FA 4AM0B 4YHML 3AFLA 3VAEA 4XXWA 3QNXA 1S8DB 3IXTB 3EH5B 4IHOB 2DQMA 1D2OA 4N0CD 4PJ9D 4Y5XB 3VMOA 1T5XA 1LTXA 4LAJH 2H4EA 1XSJA 3BC9A 3FU5A 4YHNB 4KRMB 1OM3H 4LSVH 3EHBD 3P2BA 1QATA 1MCIA 2OW7A 3NZHL 2EQDA 5AAPA 5HJ3B 1DQMH 3EJCA 1FSKC 1X5YA 3CSFA 5J56B 4L3ED 4XBGB 2MCAA 5HY9A 5AVYB 2IALA 4IQHA 3A6BL 5HPMA 5DJYB 1S7TA 4JM2A 1NUGA 3BGFC 5J0BA 5LHDA 1LO2H 1M6OB 1J1OH 2YBRB 2Z4QA 1BM3L 5TPWL 1RP9A 5IFJA 1OARH 2CRMA 5D1QD 1U8MA 3RWDB 2JTYA 2EDLA 4I2XE 1ZY9A 3BAIA 3FCGA 3EOTH 4YSOA 5TFSL 3Q9PA 2ZPKL 5J8OA 4P5TD 3U0PA 4TVPH 2VDNB 4AW4A 2BSBA 4LCWD 4PGDA 5J9PA 4PRIA 3AVEA 3EDKA 5CINH 4QXUL 5F0JB 5BZZA 1JHTB 1ZT1B 3EJYC 4Z3IA 5D55A 4XCEA 3QAQA 1OSZA 5F7DA 4ALAL 3WD5H 3WG7B 2K78A 4PWFA 3WJJC 2J8UF 4WJKB 3RIFF 1K8IB 1UG9A 5K69A 4Z0XB 1UD4A 2JKRM 5LBSH 4JN2B 4FS0A 3F65A 5T5NF 1G84A 5JPMC 4YDVA 3FQ4A 3KGSA 3SGDI 1DVYA 2V7HA 3TWCL 3BIAX 1WAAF 1BD2B 3VXMD 1BM7A 3RNKB 4M3JA 3PHQB 5KYXB 4OV5B 1RZIA 2AQ2A 2V9UA 3UTQB 2D3LA 4F7CA 3UJIL 1BZOA 5ADOL 4UMGA 1IUZA 4FFWD 5A7EA 1B3IA 1NJ9B 2YAFA 1VGEL 3QJFA 3CVHL 2UUDK 1TT6A 3TT3H 3QYCA 4PREA 4OJAA 1WSST 3CZUB 5I1GH 5TK4A 1V3KA 2OXHA 3CAFA 1M7IB 3QULA 3GJEA 4KMTL 3BIKB 2I7SA 2NLJA 4K15A 1HKFA 3RU8L 3H2QA 2BIHA 2VDLH 3GO1H 2ARJB 2NNFA 1G7MB 5DD6A 3D18A 3N0AA 4H20H 1SPDA 3PAVA 3EH3B 1HQRA 2TRHA 1MRDL 3QRGH 5GS0D 1E8XA 2DQ6A 3VXRD 1Z0MA 3VG0L 2VJ0A 1Q8MA 3MTXA 3MLTB 3PCYA 3UAEA 5FDWB 3L4ZA 3NP4A 4H2CA 2QR0B 4PSPA 2EC8A 4BQBA 1AO7A 4C4UA 5A6LA 1N2RA 3OX8A 3QWRA 2K1MA 4A7GA 3S37L 3FT2A 3ZE0B 2QQQA 4AQ1C 4JFFA 5ALCH 1NMBH 4WDIB 5DC0A 3SKUD 2X40A 5LNGA 4WEBH 3U7YH 2KZ1B 3FFCE 4IBYA 2YA2A 3BP4B 4UOW1 5HVWA 3G6DL 2Y36L 2WXKA 4EDXB 3RQ3A 5FFOA 2ITDB 3VWKC 4PS4L 3ZW3A 1AZNA 1KDIA 2D0HA 5JW4M 3A67H 3OKNA 3C5XA 3FYEB 4JKWA 4QHLB 4KKRA 1EHLH 2YD5A 4PIBA 3OWEA 3CJJA 5TGBA 4JFQB 3DI3B 2B08A 1OD9A 3CSYA 5EDSA 3L7FA 4CNIA 4RFNC 3FQWB 3U2SA 1QTSA 4LF3B 4J1UB 2HFEA 4GW1A 2QVIA 1UADC 4I13B 1R24B 2CKNA 3DRTA 2NYKA 3UACA 1IGMH 3DIDA 1N8OE 4G6JL 4OD2B 4F57H 2DAVA 2PTVA 1ILSA 3HFFA 4DF9A 3BPNC 2QVKA 2KDGA 4P04A 4JJ5B 2CBTA 2H3NB 3HPJB 3RA7H 1OAUH 3BP7A 3QG6A 3UCRA 1PYWA 4A2HA 4HJ0D 3O4LB 2YLKA 4JW3A 3N5AA 1EXUB 4EXKA 2XFGB 4Y5XC 1HOCA 5CN2A 4YXHH 1O7DE 4UOQA 4JPIA 3VFVB 4YHKH 5DQ9B 1SYVB 2ENJA 1F11B 1OALA 4OI9A 4JFZL 3VUAA 2YD9A 4QY8B 2WUBH 2WO3B 5IBTL 4LKXB 3M1CA 4UM9B 2VLLA 1QSFB 4WI3A 3GIZH 2E76C 4E0RA 2C1PA 2NY1B 2ZYSA 4HCIA 3T2NL 4A66A 3SE4A 3WSQH 5FR3A 3CXDH 1H5BB 4ZW5A 4NQED 1YA5A 3IMSA 1KEGL 1EA9C 4FFYA 3VFTA 3MRMB 1DQQA 2WB1A 3ASNB 1XSOA 1PZBA 4JPQA 4HHAA 3ZQWA 5ABZA 1ZV2A 2VW4A 3IN0A 1EAPA 2CJTA 1MWAH 5IMKB 4HWNA 4J27A 5HD8D 5JXEA 4H88H 5J1AB 3IPFA 1NFDE 2VIRB 3WN5A 5HDBE 4W9GC 3M6DA 2LHAA 1RMFH 3EFOB 5GRWA 4KRLB 1UT2A 1G43A 2DWXA 5SWSE 2KZWA 3ISWA 2FJUB 4MA8L 5E6UB 3NCWA 1NCBH 5EU5A 3BAEL 1W0YT 4I4WA 4Q14A 3UO1H 3EUDA 4NKIH 5TK2A 3GGWB 4B3EA 5I6KA 4KTEH 2P43B 3GZPA 3UC0H 4Y9BA 3VH8A 4Y4HB 5TJWK 2Y7MA 4YHYB 3V7AE 3ZMEA 5GQBA 3K0WA 4PJGF 1WK0A 3NZ8B 3BMWA 4Z0BL 4QKXB 5HHME 2C3WA 2DWSA 3S7GA 1SYSB 4URTB 5GZOA 4UQEA 4ODWB 1YAIA 4NBZB 5CLTA 4BK4A 5J7CC 1CFVH 1TNMA 4W9KC 2FH6A 3ROLA 5F7EL 2CXGA 3ARFB 2HLAA 4N6QA 1UB6A 3QWQB 5DHMC 3GUTA 1SLWA 3HG1B 1UD5A 3RVVC 2KQMA 2NY4C 2H2SC 4X6CB 4POUB 1MIMH 3OAZH 3HE6A 4RMUA 2DIAA 3HMXA 3UTSB 3PJLA 4LLYB 2FBOJ 1Z66A 1YN7B 3IGAB 4YE4H 3QJHA 2HMID 1HI6A 2AANA 3NCJL 2Q8AL 2PABA 4HC1A 2OK0H 3RZCD 2BY3A 3BVTA 2YSSB 1WO2A 2WUCH 3H2WA 3HBZA 1BMZA 4OCLC 4I88A 3RGVB 4C8XA 4LCUA 4WK0B 1BQLL 3HG4A 4LGPB 4X7EC 5INDA 4FNRA 2HT3D 2IV9A 1IQDB 4EZMA 5EU7E 3PDDA 4A6YH 4NQVA 2QGCA 3LPPA 2VZVA 2P42B 1AACA 1UD3A 1NGXA 2CO3A 3QEGH 1X5HA 4WI8A 4EZKA 3FONB 1HWGB 3GMQB 4H5SB 4KVNL 5F9JA 3V10A 3WS6C 2OQJB 1CLOL 3BYYA 2FO4B 2E7MA 2WQ8A 3FS9A 5DO2C 1ZDSA 3VFRA 1UZGA 2AJVH 3V4VB 2DWEA 2WN2A 3QZNA 4OIIH 2J6EH 2RCSL 1FVCA 2CDGB 1Y1UA 3LQMA 3X1GA 4YGAB 2BOBA 1HHKA 4LDCA 3QIBA 2A1WL 2IVFC 4XMZA 4YFEA 4XBPA 5EFIB 1EANA 5MERA 3CDGA 1PBYA 2QHLA 4AG4L 4OJYA 2H41A 2MNJB 3RKPA 3HZYA 4D3CH 1DBJH 1KLGA 1PFOA 4HD9A 1SXZA 4IMLB 3KLSA 2IAAC 3T1FA 3HRPA 4OFQA 5IJVB 5KSBA 3VFNB 5IG7B 2VLRB 1WPCA 4YIQA 2J1YA 1NICA 4PM1A 5HPOA 5D1XB 5LQBL 5MEND 2NY5L 2PWHA 4KRNA 1ETA1 1GHFL 1D7FA 2NDGA 1R3HA 3LKSA 2FR4A 2ZOKA 1RK0A 5DRXA 3S5ZA 3QS2A 2OMTA 1IAKB 2BNQA 4L4JA 2Q9OA 4P3WA 5DMJB 2WLZA 3D2UB 3HC2A 3WIAA 5KBDA 2XSKA 2R83A 1OGAB 4QRUA 2H0EA 4K5OA 3T3PF 2F1EA 2IADB 2VXVL 1CZ8H 1OCWL 5FUOH 3K6SB 1BYPA 4O02A 2DYRB 2XWZA 1ZVHA 4GO8A 2GSGA 5A1AA 1JXFA 5I6XB 3MLYH 1WZ1H 1Z2KA 2BC4A 4J3BA 1PW3A 1HAWA 2VLKD 2X0WA 2NY1C 4F27A 4JO3L 3LAFA 3UXFA 1S5IL 3DWTA 2EVIA 5DK0B 1C16B 2DBLH 3C5ZA 5T1KB 4LARL 1XGUB 2H5UA 2R9HD 2YOAA 2VN7A 5IEKA 2WQRA 1P1ZA 2E0PA 1U3HA 3ZDXE 4O02H 1KEML 5EA0H 5HJGA 3QZOA 5C0CB 1JGIA 4WI5A 3VRJA 2FHBA 4BWUA 1T80A 4PJXE 3KYNA 4EDWH 2IFGA 1XT5A 3KS0J 3GK8L 2IDTA 3NIFF 1NM4A 4M7JH 2JCCB 3FCBA 2Z8SA 2VZ3A 3QUGA 5BQ7B 3UZQA 3UTTA 4AGMA 4GBXD 5TD4A 1HHJA 4OFKA 5ITFB 1ZLUH 2DQCH 2YWZA 5F3FA 1U2CA 2O6FA 4XVTH 3V52L 4APQA 1RSFA 5HDQL 4YHYC 1IKFH 4UZSA 3ESVF 3LMJL 1MCPL 3L81A 4MXQD 4KK6D 3BH4A 4R4ND 5DFAA 2X5PA 4R84A 2Y9RT 4JL1A 3FF8A 2NR6A 1JZGA 4X9FA 4IGBB 3KBPA 1T4KA 4QIRA 3Q5OA 5F6HJ 4U1JB 5ICUA 4OQTH 2CO2A 1OTTD 2YUZA 3MU3A 5E8DH 3EYSL 3ARFC 5KYUA 4KXDA 5I0XA 2Z4TA 1JNNH 4M1DL 3U7WH 3ES6B 2NXZD 3IRPX 1HKLH 4WV1C 5IQMA 4K94L 2UY6A 1N6VA 1OWRM 4AEHL 1UZ6E 5C0JB 5DHVA 1COBA 1V05A 1OT1A 1S78D 4JRYB 4PRIE 5IMMB 3CFQA 2XTSA 3O9WA 3WDJA 4KDTC 2VABA 4UM8A 4HUVA 3LB6C 2Z31B 3GJFA 2XN0A 4HGWA 1FLRH 3ARED 3I84A 3U6RA 1A4JB 1QEXA 3KPLA 4PJ7F 3IU4L 1TXKA 3RGVC 4F91B 4L2LA 3D4GA 3H54A 3FRPA 1SUHA 4Y9GA 3APDA 3D2TA 3HMXL 1NCDL 3VD2A 4IRSA 3F12B 5C0AD 4IKKA 3WIHA 4D8PB 3GSUB 2QKIA 4N6RB 2CD0A 1MH5B 3WHE0 3OF6A 1FE8H 4J6IA 4HC1L 1QWHA 3VWJB 2HKHL 1K72A 4EZLA 2EZ0D 4Y1AA 3TP4A 2IDFA 5B22A 1BV8A 1J9RA 2B3RA 3D09A 2H9GA 1HXYB 2Y1VA 1QBAA 5BZWB 1UQSB 5DA0B 3BJLA 2E3VA 3FO0H 1OQXA 1HWWA 1WFIA 2QQKL 4QO1B 4AX3A 2HT4C 4NQTA 5CEZE 1E5UI 4JM0A 3U2IA 1IKNC 3R0MA 3VE0A 5FC9A 1M1XB 3IU3A 1B9ZA 2WZPD 1TZOA 3WNOA 5LDUA 1TVBB 1OZTG 2BWDA 3E7JA 3PY9A 2ODIA 2ZKYA 1KTKE 3LKRB 2C4FT 1UGKA 1O6VA 1CR9H 2X7LB 1FGNH 1IBFA 1HCZA 3QYNA 1KTCA 3JV0A 4HUKB 4FNQA 5GRYA 4K9EL 5B1CA 3TEWA 1EEUA 1HFUA 1C5DA 2APTA 1FG2A 1HEJC 3IMUA 3PP4L 1AO7E 4BFOA 5D1XC 2AJZA 3QPQD 2EYTA 5J3HC 2EE0A 3OR6B 3C9NA 3NABL 3ILQD 4JFFE 4NZRH 2CDFB 5IHHA 1LWJA 2MRYA 2BCKB 2FE0A 3C2AH 3O3EB 1B3JA 4DW2L 2OMYA 1YEJH 1J0KA 1QQDA 2IO5A 2ENSA 2YSTA 1P7QB 5E00A 3JWDH 3UTZB 4CVZA 3R1GH 1KGUA 5ISZD 4PG9B 3RTQD 4YR6B 2ZXCA 3EBGA 5I6XC 1ZPLA 3GHPA 5BCAA 3KGRA 2W1NA 1QNIA 4PB9H 4GUCA 1BFSA 4XC1H 3UBXB 2QJDA 2ZJSL 2XTJB 3ECBB 4PWKA 3M17A 1M05B 2WIMA 4N87A 2Y23A 4JO1H 3F58L 2X6BA 1SY6A 4U6XA 3RAJH 4FN0A 4LLUB 1Z7JA 3PHOA 1IGCH 1EMTL 1QR4A 5GGQH 5C08A 1ZHBB 1JZFA 4H26A 4HJJH 2XI9A 4L8DB 1GPOH 4G6AD 5TE6H 2FECI 1XMWA 3OZ9L 3LEXA 4OCSL 1XR9A 4JHBA 2DQEH 5B1BB 3SZKC 5E8NB 1NC2D 3MROB 2IFFL 1S9WB 2HTLD 2Z1KA 4M7ZB 4TSCH 4FTVD 1TLMA 2V9QA 3UEZA 2FB4H 1NM9A 3VXSD 2AFNA 1QVOA 4JZOB 2C9PA 2VAAA 4Z5RB 1MPAL 5E2JA 5C09B 3C5JA 4BA8A 4N85A 2AMUA 3ESPA 2DTML 5DURB 4BJLA 4HZLA 5I1EH 3BKCL 1L9SA 5T3XL 4IGBC 4HFWA 4W70A 4J3OF 1T3FA 5EWIL 3RL2A 1SJEB 2EXYC 3IFOA 4WU5B 3HN8A 3WNIA 1NQBA 5ESVB 3GPEA 3PAZA 3PHSA 1B0RA 1I7ZA 3CC5A 4N86A 4FQQB 5B3JE 5FIEA 1FZJB 1UXLA 2C4XA 3H56A 3TA4D 5D2LF 3KWWA 1G9ML 2VDKH 2GJPA 4GT7A 4RETB 2BP0B 3IFLL 4EI5B 4AQAB 4IK6A 3T0XA 1RUPH 2EDWA 4HJ1A 5CCGE 1GRWA 1NCAH 3SDYH 4CSPA 1FG9C 1OF0A 1SDDA 2WNXA 1GIGH 2CG9X 1UCBH 3CK0L 4UQDA 4G8AC 3WHXB 4AQ1A 4AI7A 5KSUB 4D9RD 2Q86A 2EXWD 2WYTA 3WS3B 2WANA 2YUWA 3D33A 4OBRA 1IGIL 2NUPB 4OZIF 3LHAA 3N40F 5CP3H 4PY7B 4XMXA 1H0DA 2R1WB 4K8RL 5KBKA 5EPMB 3DK0A 5F3HA 3M45A 1WTGT 3RWFA 3HC3L 4X6BA 4M6MH 1CFSB 5BS0B 3FCSB 3L3JA 3MLZH 4L05A 1KTDA 2FBJL 4C4BA 2VH5H 4M43H 3EJZD 3VWJC 1AYOA 4YPJA 3WFHB 2AJUL 3P9MA 4HIEB 5CIPA 5D4QA 2P24B 3C08H 4GLRI 1HVXA 3SE9L 3BUIA 3HRZB 2KT6A 4XHJC 3BOVA 1W72H 4OSUH 1MWAB 4KBPA 2H1PL 2XN1A 4Y2DD 4YNYB 2I60H 4KZEH 2V7NB 3WTSA 3D4YA 1AXIB 4ZAKB 2C9RA 3LRGA 3JBG7 1BPVA 3BFOA 4IU2A 4PVMA 3TO2A 2QMKA 3US9A 4XXCC 5IB1B 4DVRH 1MEXL 1I53A 2EDYA 4JKNA 4MAZA 4AM0A 4W6WB 4FNTA 2F54B 3IXTA 4PJCB 1LLAA 4YZFF 4PJ5D 2WWMD 5CZRA 4Y5XA 1QLEH 4AH2B 2MH4A 1AJ7H 3EDDA 4P3DA 4NSKB 5FM5O 2VDQB 1OAKL 3ZKND 4HAGA 4H44C 1JD7A 1CLCA 2OA9A 4OCXH 4G2AA 4AYDC 1GS7A 4Z7OF 1IKOP 4B0MB 1A65A 1ILUA 2WXQA 3MQIA 5I16B 5DJYA 4HGMA 3PF2A 4TQHA 3AWEA 4KH2A 1MCFA 4KRPB 3ZZSA 2LTQC 1YNKL 3CDZA 2YBRA 3GF8A 1TQCB 1GC1H 5I0ZA 3FSZA 3GBNH 3KPPA 3QUZD 1WCBB 1SOQA 2J8UA 4GT0A 1N18A 4X9IA 4ZPVB 3UABA 5IVXB 2BO0A 1RUKL 2Y6SC 4X8CA 3S35X 4R7NB 1WAAA 2EYSB 1Y6MR 3P77A 1MQKH 1WHPA 1DBAL 3ZTNH 3BLKA 1CFNB 3SGKA 1FORL 1ND0B 2XTJC 2P8PB 1S7SB 5I1JH 4C54A 1FPTH 1ZT1A 5KSBE 2XWCA 1FIGH 3REVB 4WNJA 2B15A 5F88B 2AQSA 3GXTA 4HALA 1G7LB 5KVGH 2J43A 2JXMB 6PCYA 1M3IA 1IC4L 1A7BA 4RA0C 1L9QA 4NP4L 1K8IA 1BZ8A 1KIRB 5EZJA 4A6YB 2A74B 1AE6H 5B1KA 3CSGA 1FH5L 2FL5B 2BNQE 4NPYB 3ZDYB 1HS6A 3CXHK 2NSQA 1BD2A 3DTUB 4Z7QF 1PX3A 2OSYA 3K8KA 4ZG1A 3US0A 2DLTA 3CBKB 1SXCA 4XRCB 3U0WL 1T6VN 4B41A 1SY6L 2RGSA 4KK9C 3UTQA 2GJJA 4JG1H 1DJYA 1O5PA 2ESVD 3B2XA 1NJ9A 3KXFB 3AQZA 1HDMB 4JZJB 4WWPA 1QEWB 1Q1JH 2JKSA 1HNYA 1UWXK 4JCWA 3QDGA 1PJ9A 2ZOTA 4UIMB 1SNRA 1D5IL 3BUYB 2PW1B 4UWQB 4V1DD 2I07B 3RWEA 5IVZB 4XXDA 5IEHA 2ARJA 1ET8A 1G7MA 1J12A 1GW0A 2UWEF 4HAKA 4JJHA 5BO1H 2X6VA 1EZVY 3CLFH 1GR7A 4X4YA 1S7UB 1UH3A 5JORB 5I8KH 5IBUG 2QLYA 1VACA 1EJFA 3ZN6A 4DUXA 2Q7YB 3MLUL 4EI5C 1I3RA 3ZRFC 3B37A 1J8HB 3GBMH 2IWFA 1G9NC 2X2IA 4MYPA 3OG4B 4W81A 2BOCB 4A7QA 2H0JA 1AZUA 1I3UA 1CC3A 3OMNB 1DL7L 4MJHA 3UZEA 1F3JB 2ZWKA 4H1LB 4DAGL 3UTTE 2XQBL 3HE7D 5CAYB 1U8CA 2VJ8A 4CSTA 3DX7B 4XVJL 3WS6A 3ZT7A 4BH8B 4PN6A 4BM7A 3B9DA 4IOFC 2CKBH 3MRCB 1I8IA 3QORB 1Q9KB 4EDXA 5DS2A 2W9EH 5EU6A 1DO5A 3M07A 2NSXA 4TM9A 5E4IA 3SKMB 1BHGA 1OK8A 3MJ9A 4HZAA 1ZSDB 3EADA 4LLVB 1RK7A 5J11C 3MUY1 4ZPTB 1BZDA 3ZE2F 2HRLA 4G5ZL 4OFPA 1J5IA 1F41A 4J4PC 2C9VA 3LKOB 4N0UB 2R0ZL 3HRZC 4E41B 4UMSA 4Z8FL 3AQXA 2NT1A 4PJDB 4NN5B 1K5NA 2FSDA 5AW8B 3DPDA 4BHUA 4PB0H 2A99A 1R24A 1TTAA 4JZNB 5HHVH 3PWPD 4Q56A 1N4XH 5KYNA 1EZUA 2WWKT 4ZAKC 4Y8DC 1MDTA 1FJ1B 2FWSA 4LNVA 4V2BA 4MNGB 4WI2A 2PCXA 4JJ5A 4J7RA 4LKCB 4OTXH 2VQ1A 3BWUF 3N1QC 3O4LA 1H3WM 1WGVA 2D8KA 5SWQB 2J5WA 1U8JB 4JFDB 3KM2A 4N2EA 5JXAH 2BS9A 2PCPB 4LBEB 5T1LA 1IQWL 3QQ4B 2WD0A 3KAAA 4M1CC 5H8DA 4Y19B 2X42A 2LT9A 4FLOA 3VFVA 1SYVA 3I02B 1F11A 4PGZA 5J6SA 1NMCB 3BSHA 3B3IB 4QRQA 4NBYB 4LKXA 1NGPH 3NH7L 4UM9A 4CN1A 3D52A 1QSFA 4Y1AE 4NO0A 4KUCD 1G0DA 5K9QG 4M6OL 4XVSH 4PJ8D 1KN4L 3RWJA 3SDXF 4KRPC 1WQVT 4KKQA 3U4BL 1H5BA 1WRFA 4HFUH 1NMAH 3LRSB 4JAMA 5FO2A 3S3CB 3T0ED 1TQCC 3MRMA 3VO0A 1PF3A 4WFGE 4JL2A 1DANU 3ZGIA 4KI5E 4F7TB 4UZGA 4PJGA 4MRCA 2P7TA 3KBFA 5L7XH 5E9AA 2WZAA 3DSNB 2W9LA 1QTPA 4GQ9L 2WNGA 1NDGB 4LCYA 3WEOA 3O11B 4HBQA 1KTLB 5J1AA 1J0HA 3HLAA 3QZBA 1WWCA 2VIRA 4CU7A 5EZIL 4GW5B 1XF3A 3EFOA 1M6UA 4PV9B 1N0XH 5DZPA 2YD3A 1G1OA 1I1AD 5LGHH 2XRAL 2X4OB 3L5JA 4G5AA 2WQWA 4DKTA 1MY7A 3QJQB 3MCLH 1L9MA 1UOLA 2OJEB 3SKNB 3KLAB 3K6FA 5DEFB 5D7HA 1RJZB 1MAJA 3KG5A 4Y4HA 3QXVA 5F8RC 4WU7B 2E9GA 2A74C 3AITA 3ARBB 3D08A 1A6VH 1WA1X 2VDNL 4FQXC 3F5WB 3PXLA 2WJ7A 3JWOH 5IR1B 3VTMA 2HX7A 1RUMH 4R3SB 3ZDZE 1SYSA 2X9YA 4F3FB 5E1QA 4MXVF 2R2EA 3HZKA 4KGLA 3GSWB 5DF0A 2ICEB 5I1HH 1JRHH 4UB0H 5I73B 1CDUA 2GVYA 1DQTA 5JZ7D 4B0MM 2W92A 4JZJC 1BFVL 2XA8L 3QVAA 4LHUA 4MAUL 4QT5A 3BDBA 3TV3L 1FF5A 2CDEB 1A2YA 3P4OB 1RY7B 4X6CA 3DJSA 3BW9B 4AZUA 1R9FA 3NTCH 3D06A 2BMKA 2WQAA 1KB5B 3UTSA 4G71B 1R1CA 4BUGA 4O2CB 2CBPA 4NLHA 1AKJB 3NAAH 1RIVH 1I7UA 2JK5A 4MMZA 1P7BA 4YLQT 4F2EA 2IPUG 5IB2B 4KDTA 4BFIB 3D50A 1S7XA 5J6GA 1UWEL 4AC4A 1CDGA 4P9HL 2RFXB 4JFEA 5F1KC 3EBAA 5C08E 3HC4L 3G5ZB 3MKGA 3ZMRA 4GKNB 1BYNA 2Y24A 5E56A 2Y5TA 5DS8B 3CIAA 3FTSA 3IJYB 5ESQB 5MEQB 3V95A 3ECQA 4M9PA 4XO3A 5B39G 1KJVA 4KPHH 5JR1L 4ZOEA 3U2JA 1NZRA 3P30L 3W1ZA 4BZ2L 4UT6H 3L54A 1FL5A 3GMQA 4H5SA 3TS8A 2DBJA 2ITEA 4QUOA 4BUQA 4YSEA 1ASQA 3QORC 1YYMH 4NM4L 5DD5L 4PWIA 4RA3A 4TVSa 1PCSA 2J5LB 3K7UA 5LN4A 2G5BA 1N67A 4XMTA 1EJOL 1ML0A 1TTUA 1QFPA 4HMEA 2CDGA 3ULVH 2AP2A 1RK1B 3AXLA 4GB9A 1UEMA 1KJ2H 3MRIA 5DJZA 3UYPB 3RGHA 3QJXA 1PLGH 5EFIA 3LX9A 2QELA 1UUNA 1YY9C 2E47A 3DARA 4HX1B 1U3JA 2N01B 3QZWB 3OVUB 5KOMC 1TZGL 2IDSA 3CZKA 1FWXA 4PCYA 2DQIH 4NN5C 4G8IB 1CL7I 3VD3A 1DYZA 1UKTA 2VRAA 2VR5A 5IJVA 2IANB 2UZXB 3VFNA 1WHOA 2VLRA 5IG7A 1JHKH 1KYDA 1VFOA 3MA7B 1VJSA 1XB8A 5EEYA 3IDMB 5F6HI 3CVCA 3SCMA 1JZ4A 1TZIB 3P3TA 1HYSD 1CYXA 2ATAA 1OLZA 1JNJA 1J5OH 4HIXH 4R8WH 5DVMA 4PY8J 4XCFH 5SX5H 1IAKA 4U6VH 3F7QA 2VW6A 5EORH 2F8OA 5DR5L 4DIXA 3DIFB 4XWOD 4FI7A 2NX5B 4AVKA 5LUMA 2FNWA 1TTCA 2P9RA 4MA3B 3MKKA 4U1GB 4Y5YB 4HLEA 5HYSG 1A3LH 3K6SA 3FFCD 3GRGA 1SLXA 4XN7A 5E0FA 1NMCC 4OLWH 4P2QB 3MN8A 3O2WL 3MREA 3WUZA 2I9TA 1IBBA 4JGJA 3EOAB 3QWOB 2OCJA 1L0QA 3CXHJ 1R0AL 2QQNH 1INEH 4ONGL 4WLCA 5LGYA 1ZTXH 2F8VA 3O8XD 1AQKL 1BAFH 5M94B 1P4IL 1T66D 1IL1B 1LO0L 4ZOBA 4GXVH 1JS4A 5CCKL 3L2LA 4LCVA 1UJ3B 2VDKB 1G4RA 4BH7B 4NWTH 1J5CA 1E67A 1CBJA 1IBGH 5DEGA 1LJMA 4NJAH 5DT1L 2QSVA 1UM5L 3B3BA 3BVDB 1JTPA 3GSVA 4LEOB 3QIUA 4P3CH 4YDLB 1UCTA 5FW6A 3S35L 5F7HA 2AC0A 3CFKB 4QI3A 4KMQA 4YAQB 3L3GB 4LVHB 4Y4FB 1E4WL 1KENL 1KFAH 1YECL 4GKSB 5FCUL 1T2QL 3S8FB 1TYRA 5GGVL 3V9CA 2IOMA 3DVFA 4ZTOL 3QNYB 1DN0B 2YJQA 5BQ7A 3AM8A 1E28B 4Z7WF 5JHBA 5IQLA 1EHAA 1GGCH 5TF1H 3ZZLA 2W81C 1NANI 3KCPA 2HWZL 3K8LA 3CPLB 1GVIA 5TE7L 4BA0A 3ARBC 4NQCA 1CLZL 1Z6JT 3OKKA 3IGLA 4MAYB 3ZUNC 2IH1B 3N42B 4K3EL 3NJNA 4RZCB 2WLHA 1T20B 1WITA 1AH1A 4QRAA 2CUAA 1OOWA 3KS0H 3NSCA 2ICEC 5JQHC 1ZVYA 2UY7B 1JXKA 5AOLA 5I73C 4TOYL 2VWEC 3V0GA 3VDBA 4PJ7A 2G3MA 3B5TA 2J8UE 4FYTA 2IWKA 2ZOUA 1KCLA 1I1CA 1Z5LB 4ZUSA 5AL8A 5FHAH 1A0QH 4LU5L 3ES6A 3QJUB 1WAAE 4YSTA 3HR5B 1RVFH 3OPZL 3MLXL 3ZTEA 4NQDB 5C0JA 4DQOL 1UXWB 1CVRA 3AABA 1JGVL 1QWUA 1WBYA 2PP8A 3AROA 3UJTH 2JSFA 3B83A 4OM1H 2Z34A 1INQB 1XGRB 1ZHKB 1EGJA 4P57A 5F1SA 1CGVA 1FNFA 1CN4A 2Z31A 2F08A 1A4JA 4CW1A 2UXFA 5FUCC 5SWSD 2DJSA 1KDJA 4U7KA 2APFA 2A6JA 3G5WA 2CRYA 2YEZB 3FB6A 5CZKA 2YKLH 3IJ8A 4X8XA 5DJ6B 1BD2E 1SOXA 1NEPA 3GSUA 4N6RA 5FEBA 5JIHA 4P2YA 1OSEA 1DUYB 5DTFA 3JSSA 1WIPA 4FZEH 4PV1C 1JGLH 5IQ7H 5HHMD 3BWZA 3V0WH 1EGJH 1S3KL 2HH0H 3JWDC 5K9JL 4XWGH 4KJWD 2WC7A 2J5LC 3QDGE 5EULV 1MZZA 4NCC2 2WBJD 4QO1A 4AJYV 1X5IA 3K2UL 5AB1A 1GJUA 2P5WA 2ZF8A 1KGIA 3FHEA 2K45A 4DP6X 5D7JB 3PL6D 3QQ3B 2EDQA 2J3SA 4MNQB 4N8VA 3IF1A 4KZCA 2GSIB 3B9VA 1K6QH 5AG9A 1E5ZA 4JRFA 4X7DC 1I8LC 5D70H 5FHBH 1OTUD 5JQ6L 1TF4A 1FBIH 1UWYA 2OW6A 4NO2B 4XVOA 1H15A 5CSZB 1RJYA 4QOKB 5DYOB 2MPVA 1FN4B 5K1NA 5KSVA 1FVDB 2ZX8A 3MRGA 3O2DL 3QPXL 4EN3A 1TU2B 4PGCB 1T1ZA 1WICA 4TSBH 5ILTL 3UYOD 4NN6B 4QYAA 3ULSB 2BCKA 2PYEA 3QJRB 4QRRB 1CD0A 1TETL 4DKFH 1KG0B 3W56A 1KXTA 3FUHA 5KSAA 3CMGA 1AXSB 3WFBL 5JYMA 1BQRA 4WY7L 4OF5A 1OY3B 4NO5B 5EU6E 1E2WA 1FZOB 4U1GC 1MJUH 1P7QA 3NPSB 4Y5YC 2AJYL 3UTZA 3MRJB 2XYBA 4PH8A 4U1LA 2NQ3A 4JBSA 1NC4A 3QZMA 4YR6A 1KSRA 1PG7H 2BPBA 3ZDWA 1E2ZA 3ABMB 3W81A 2WXNA 1C7TA 4JX0A 5H94A 1GKOA 2XZQL 5DZLA 3GMPB 1JF1B 3LH8A 5EUOF 4CSZA 4BKLA 3ZE1F 2GITB 1NEZB 3ECBA 2EACA 1ZE3H 3GTNA 4IBUA 1UJ3C 1AGEA 3D5OF 1XEDA 3DO3A 1ZS2A 3F85A 4LLUA 4XOCA 2VL4A 2ZCZA 3OKLA 3PE9A 5D6DC 5EU3A 2PR4H 4Z7UF 2H0PA 1KV7A 3HHSA 4PGBB 2ETWA 4KQ3H 4TULL 1VFMA 4MX7A 3QFDA 3IXAA 4LVHC 5EO1B 3PFQA 4Y4FC 2ATPA 2WWNA 4CVUA 4WFEE 3O4LE 4PLJD 3CFJB 4B9IA 1OPGH 1RIHL 2WVUA 1J1XH 1NDMB 1QABA 3FT0A 4RGNB 3T2PA 1BIIA 1OOAA 3UZVB 2FDBP 3HB3D 4JZOA 1XMEB 2NMSA 5D7IB 2VMDA 1V3MA 3US1A 4L9LA 4X6FB 1D5RA 1QSFE 1T5WB 4MAYC 1ZTMA 4HCGA 3W5MA 2OR7A 5EMYA 3VXUA 4FF9A 4J3OH 4HT1H 5FOBA 3O6FB 1EEZB 3IDYB 2GTZB 3FQTA 2VOTA 3CFEB 3HCVB 3WFCH 1BFOA 5ESVA 1OV8A 3BO8A 5DMGC 4OZIA 4FQQA 4CBPA 4B27A 5KVEH 4PJGE 3KPOB 2Z7UA 2OSWA 3V79C 3ZJAA 1AGDB 1MVUA 3EXJA 5MHSD 1L7TL 4EI5A 3NJJA 1S9YA 3MA9H 4AQAA 1P7HL 4TNWK 2R8SL 2DM2A 3BPCB 2IPUK 3BYTA 3PP3K 5IHUL 2F58L 1WFNA 2E6PA 2NCMA 1IV8A 5JDSA 3PGFL 3CN4A 4JVUA 2P48B 5KSUA 1Q1PA 3WS3A 4X8GA 5E2TH 4JHWL 1KN2H 3Q9QA 5K59E 1CYWA 4KK8D 3JXAA 1QD0A 4Z7NF 2O6CA 2WTRB 2XPGB 1JTOA 2YEQA 4WWOA 1CO1A 2NW2A 2ODHA 1ZD6A 5EPMA 1GYVA 4KHXL 5HI4D 4AENB 1GYUA 4JDZB 4PLNC 4OU3A 5BVPH 1BJMA 1CFSA 3LZQA 5BS0A 2NRDA 5I1IL 2NUTB 4I18B 1S9VB 4JANA 2R56L 3ZTDC 9PCYA 4HH9A 1BMWA 5FA4B 2B0SH 3WLWC 2G0KA 5EZOH 5JPNB 4G43B 5LGJA 1Z5YD 4UCFA 1A7OH 1GC1C 3FUNA 4EUPB 1VIWA 1VDGA 4E42B 1OM3L 4JM2D 4WENB 5EC1B 2Y72A 4QJ3B 2V0AA 4X6CE 4P5KB 3L95A 3UL4A 4YNYA 3UTSE 3MZGB 4HOWA 3QXAB 4XP6L 4ZAKA 1JF6A 1OW0C 4Y16A 5D7JC 3D25B 2D9QB 2IAMD 1RERA 1C8PA 1BX2A 1LO2L 1A7PH 1T7YA 3S3JA 2NTFB 4XX5A 2VM9A 4JFEE 2O30A 5AZ2L 1ZLWK 4W9LC 5HYJA 5JO5B 1QASA 2QADB 1OAXL 1GYWA 2NY3B 4EMZA 3WIIH 3B2VH 4AH2A 1TEFA 1W2KT 1BECA 1BF8A 3EDEA 3HC0A 4FLSA 1JNHB 2YD0A 3DV4B 4NERA 3LQAH 5GJTL 2EADA 4OD1H 2V5RA 3Q48A 4NN6C 4Z3HA 3D6GA 1N64L 4FA6A 1CBVL 1E27B 5EZPA 1BDYA 1FQ9C 2IEPA 1WP6A 5I16A 3CSPA 2IQAB 1LE5B 2XN9D 4HCRH 2ZCHL 4ZS6D 1NINA 2VDPH 3NPSC 4BFJA 4WW1B 5BUGA 4OLVH 2I32A 1WCBA 1W15A 5C7XL 4BQ9A 4Y4KB 4B60A 4P4RB 3VJ6A 4KO9A 1CG9B 1E5AA 3BN3B 4JPVH 4R7NA 4YDIH 4HF5H 4WZ9A 2VSCA 3HAEA 1GOHA 1BW8A 4Q9RH 2HTKD 4G6MH 2AVFA 2J25A 3QW9A 4IDJH 1GZHC 5A40E 3FXIC 4N8CL 3T3PE 2OYMA 2QV2A 4P5RA 3SDDB 2VLRE 4PJHB 3REVA 4JPKH 5F88A 1QBML 1TCRB 1KXVA 1G7LA 2X4SB 3ZKSD 2JXMA 3FO1B 3GYRA 4D8OA 3MJ7A 4U33A 1L9TA 1YEDA 3RX8A 2JNZA 3NIGB 1IE5A 2D9CA 3KJ6H 2E74C 5E5RB 2A74A 1NKRA 4M8UA 1FFNA 3GO1L 3IDJB 2L7EA 2OTUA 4L0ZA 2IBGA 5ICXB 3TT1H 1AO7D 2VN6A 5FECA 4JQIA 2YWYA 4GG6B 3QRGL 3LHPH 2BSSA 1FRGH 4IJTA 4XRCA 1OF2B 4GI6A 4JFFD 3IS1X 1IEHA 3UP1A 4OAWA 1DLHB 3KXFA 1D7CA 1HDMA 4EI6B 3NSYA 3U4AA 3GC3A 3KWVA 3V7AG 1KJ2B 3VQ1C 1NMBL 4UIMA 5KYYB 3IDXH 4N9OB 4OLZL 4XNXH 2PW1A 2WHVA 1IRAY 2I07A 4GKOA 5DFVC 3O6FC 3IDYC 1E9QB 1QR1B 5IW1A 5I6MA 5DYFA 4MD5A 4X6EA 4GRWB 2YPKB 4HKBA 3BAKA 3G5VB 4FXKB 4PR5B 4JRLA 3L5WA 4RLDA 3A67L 2IGFH 3GKWH 3OKOA 4AK2A 1H3PH 1TENA 2X6MA 3IKCB 2Q7YA 5D2NA 1W6WA 3S97C 1ZA6A 3LN4A 2GABA 5K39A 2WQUA 3HPLA 4LLWA 1J8HA 5GRUH 1YEIH 4WW2F 2ZWLT 2H2PD 1KLFA 3IT8D 2FBRA 4FG6C 1DHKA 3V0FA 4JR9L 4H1LA 4AXWB 2Z91A 2L8AA 4YSPA 2B59A 2HA1A 3DX7A 3TYFB 4BH8A 3L4YA 1IGML 1QACA 3I9PA 1CICD 1JK8B 1CTMA 3QORA 4F57L 3APCA 4LCIH 3S5LA 4NQCE 4AYEC 1U92B 3C6SB 1CI3M 3N9GL 4FHKA 1JVKA 3NJVA 2MQ3A 1G9NL 1BA9A 4X6DF 1GGIH 2EEFA 2P8MB 4I18C 3UGEA 3U48A 1FNAA 1ZSDA 4LLVA 1PTZA 2Q2EB 5I1KH 5CU9A 3GMOB 1P2CB 4NQQA 5C3IA 2XV3A 2ROYA 3B9KA 3SQOL 5IUCA 2EXSA 5JPNC 4PJ7E 5A16A 5JUEH 1BBDL 1TJGH 3A22A 4G6FD 2MJWA 2I9LB 1WFOA 3O45A 3KPMB 4LASH 4LGRB 3QRFM 3Q6FB 3GWJA 25C8H 4JZNA 4QHKJ 3QEQD 5CMAB 5C0IA 3PGDB 3JV4B 2ADFH 4KITB 3JWNC 2WYIA 3GSNA 3WSQL 4IBWA 3CXDL 1AGBB 5JXED 3K2MC 4H8HA 2CJUL 3SDXA 4XI5D 5JLZA 4XNDA 1DEEA 2W5PA 5AOJA 4PVNA 1E2VA 4RAUA 3BLPX 4GRLB 1AHKA 4NS0A 1KCRL 2QADC 4JFDA 2NY3C 1MWAL 1YEKL 5LG1A 4HBCH 1P6WA 4MS8C 7FABH 3I02A 3VFMA 1ZANL 4LK4A 5A2CA 2YMOA 3VDAA 5CR1A 1T7ZA 2J2ZB 5DI8B 2VR4A 5F72S 1YNLH 2DF3A 1DVFA 3TPUA 1KIPA 1IX2A 4K55A 4KTEL 4NNXB 2R23B 1JD9A 2BHFA 4ZUTA 4HIJB 4RSVA 3SBQA 1HT6A 3BCDA 3UC0L 3X11A 2YPVA 5F9AC 5HHNA