4B9FA

High resolution structure for family 3a carbohydrate binding module from the cipa scaffolding of clostridium thermocellum
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
b'NLKVEFYNSNPSDTTNSINPQFKVTNTGSSAIDLSKLTLRYYYTVDGQKDQTFWCDHAAIIGSNGSYNGITSNVKGTFVKMSSSTNNADTYLEISFTGGTLEPGAHVQIQGRFAKNDWSNYTQSNDYSFKSASQFVEWDQVTAYLNGVLVWG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULOSOMAL-SCAFFOLDING PROTEIN A
publication title High Resolution Structure of the Family 3A Carbohydrate-Binding Module from the Mafor Scaffoldin Subunit Cipa of Clostridium Thermocellum
rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Sugar binding protein
total genus 35
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 4b9fA00
2XBTA 1KFGA 1K72A 2WO4A 1NBCA 4B9FA 3ZQXA 1JS4A 4B9PA 3ZU8A 2WNXA 1TF4A 2WOBA 4TF4A 2XFGB 3ZQWA 3TF4A 2YLKA 4JO5A 4B97A 4C8XA 3ZUCA 1GA2A 1G43A 1G87A 4B96A 4B9CA 2L8AA
chains in the Genus database with same CATH superfamily
1QI4A 4D3CL 3MNZA 3OR6A 2AJZB 3QUZB 5DCCA 5KSBA 1KBKA 1YN7A 3DPBA 1VA9A 3NCBB 4IMLB 3WXWH 3IDJB 1AVAA 3V0WH 1F1AA 2OMYA 1WV7T 1T6BX 2KC0A 2N7SA 2ZQKA 4HFWA 3AABA 4MZ3A 4LHUD 4XP5L 1C5CH 5A7EA 5IHUH 5D93C 1UA6L 1WC7B 3EUUA 3B3IA 1K4CA 5L8JB 3FT2B 1JV2A 2JVUA 4XODA 5ICZA 4J2XA 3QDJD 3DVGB 4NLAA 1RIVL 4NUMA 3T0EA 3EDJA 3GM8A 1RPKA 5G4MA 4Z7WF 5J4MA 2DDQH 3BAKA 3QEQD 5DEGA 3OSKA 4AVKA 3TPUB 4AW4A 4AYEC 3BKMH 2IF7A 3DA0A 4AK2A 3NG5A 4KI1A 4A7GF 4ZS6C 3JTSA 1KYFA 4Q9CA 5D1QA 3DLQR 2WSDA 3GMLB 4EBQH 1QUNA 1F4WH 4JZJB 4AQAA 5E00A 4Y16A 2QGDA 3KXFB 4MXWL 5DS8A 5H37A 1XD1A 4P9HL 4ATTA 1KOAA 1O7SA 1YNTB 4JPWH 5GGVH 3ZDYE 5BXFB 3QUMA 3HS9A 4QHKJ 2FGZA 2AV7A 4GKOA 5AYUH 3ARFC 3DIDA 3D2UD 2VXQA 3ZMNA 2WD0A 1FAIH 4AIZA 3ELAT 4JANB 3U4EA 2JKRM 2Y07H 4Z7QB 1UXLA 2JIXB 4W9IC 4OZIB 3ZR6A 4DOHB 5SX5K 4EEEA 3OAUL 4ZOAA 2PCFB 3ZKNC 5ENWA 1TZHB 4RZKA 2IPKB 4JG0L 2WBWB 3GLAA 4JFYA 2B4CL 2H4EA 4MJID 4FLHA 4JCWA 1ZXQA 3C5SA 2BHZA 3P0GB 3SPVB 1FPTH 3F04A 2ZUQB 5CSZA 3G6JB 1IUZA 5D1ZI 4PJ5B 1EFXA 4K7FB 3VH8A 4DZ8A 2P5WD 2FK9A 2EQDA 3B2UD 3RDTC 3QULA 1PBYA 3GXTA 4K55A 4KJPC 4JN1L 4N2DA 1XH2A 4M5ZL 1J0YA 5T1KD 2E9IA 1Q8MA 2OMBA 5C0IA 2D3JA 4GMTH 5J1TC 3G6AB 1NIDA 3CFDB 1U8NB 5DHYB 2XJKA 5EOQH 4N6QA 1E4XL 1I3GL 2J2ZB 4RISH 5BO0D 5I9QC 4X4XA 2ZKWA 1AGFB 5GJTH 4PLJD 2APBA 2X41A 4HQQL 2X53A 4OZHE 3VI4B 2GSGB 4Z7UF 5I8KL 3UTZB 2EDOA 2YZ1A 5AUMA 1DSYA 1F90L 1HQRB 2XETA 3M17A 4J3OG 3E8VA 4AKPA 2VZSA 2NUPB 3FHAA 1N5AB 1NJ9A 2IADB 3P69A 1WBZA 1SN0A 4PJAB 4FLRA 3PYCA 4PGDA 1JIBA 1AAJA 2IDCA 3UH8A 5SWZB 3KYKH 4ZPTA 4ZUWB 5L9DL 2ZX8A 2ZTBA 3MREA 1DL7L 1TVHA 3BGMA 4K8RC 4YX2L 3L3KA 1AY1H 4N0UA 4EE2A 1XMWA 2YUWA 3N9GH 5E8PA 2YIHA 4F2MB 1UOWA 3VMPA 3SYQA 1X5HA 1TTUA 2X4OB 5C6WH 1Z7JA 3PL6B 3US0A 4W4OC 3ZT6A 4QOKE 3ULUL 4YIQA 3VRIB 4E9QA 5E08L 2H3NA 4V2CB 1PX8A 1G7PB 1BD2D 1MZZA 2WLLB 5DJ0B 1B0IA 3VGFA 1XGRB 1W72H 2D9QB 3D0VA 5KSVB 4W9EC 3QEUB 2JMRA 2PR4H 1AE6H 2PW2B 4WWKD 4I0KA 1DVFA 1ZS2A 3KGSA 3PDGA 1BEYH 2HWZL 2NZIA 4KJWC 3OMIB 1QEWA 2WO2B 3ZDZF 4JFTA 1YYMH 4IBLT 3CHSA 3HPJB 4QO1A 4ZX4A 3T4AB 3DDGA 3MV7E 4LKXB 1MHPH 4L4VE 4JO8A 2ITCA 4HALA 5ERWB 1PL3A 3Q5TA 3N41F 4X5XB 4ATWA 1TJIL 5JPNC 1A66A 5EEWA 2DJSA 3L13A 3CFEA 1N9PA 2SEBA 2NDFA 3BDXA 4MX7A 4HIIB 3K1DA 1U95A 3R1GH 3VD0A 4G1EA 4FYQA 2A77H 2XN9B 3KGRA 2H1PH 4YO0B 1BAFH 2I32A 2ZYIA 1YCSA 3OLEA 2VKXA 3ZZQA 4YSRA 3NJXA 5T1LB 4PGEA 5EFIA 3WFBH 2D4DA 5D7KE 2CHXA 3X1GA 4E0RB 1Q0YH 2AAAA 2Y7MA 4BDVB 5C0NC 2XWXA 3THML 1VFOA 4HPYL 4W9KC 2YEZB 2WYHA 4BSJA 1P9MC 1E43A 1G94A 3WAKA 3TS8A 1IT9H 4MCYB 3V6OA 1V3MA 4YSAA 2YMXL 2WXQA 1UWXK 4P2RB 5D7IE 4EIGB 3FUKA 2HUEA 4L8SB 2ESVB 1A1MA 1R75A 2N3JA 4JFEE 3TV3H 4AW7A 1ID2A 1K4DA 4YXHL 1XO8A 2NY2C 1DJWA 2VITA 2CBQA 4M9PA 5CJBA 5KG9B 5D2LE 1AQ8A 5IMOA 4NNPH 4DN3L 3GMQA 1DCEA 2J6EH 1LWJA 2IPTH 2D0HA 4HZLA 1UACH 1I9JH 1MXGA 4UILH 1TENA 3V52H 4L0YA 5AVSB 1BZOA 2W5PA 3IDXH 1BG1A 1MELA 3QJRB 4MMXB 1KTDA 1Q4NX 4RMVA 4LOUD 3MRDB 4M6OH 3TBCA 4YHYB 1LE5A 3RWHA 5IFHL 3BE1L 2E7MA 4ZBJA 3NRQA 3GRWL 1BFSA 1LNUB 3LKSA 4JM2F 3LXUX 4CBZA 1WWBX 2VLJB 1HHGA 4E9TA 1KBGL 4N2HA 5EU7E 3RL2A 3ME0B 3UBXI 4HFUH 1QBLH 4Y19E 3RU8H 3CWGA 2UY6B 2L7UA 3X3GH 4OD1H 1UM6L 1U3HB 4D8PA 3HAEA 2W9DH 5EU6D 2EDKA 3HR5A 5FB8B 1P7QA 5FK9A 3MGTA 3IJSB 3PGDA 1OAUH 3WO4C 4L1SA 5IVXA 4WI2A 1TNNA 2DKUA 4DWHA 3KLDA 1DLFL 2TRHA 2H6OA 4HD5A 1NGXB 3BO8A 4IRJA 5CZRA 2JJTA 3ASOB 1XXFC 3AAZB 3CQFA 3QO0A 4JS7A 1GVIA 4PJCE 1NGZA 1AZCA 2APSA 3VRLE 3VSVA 1AP2B 1EVTC 1LEGA 2FJHA 3OTTA 3QH3B 2IH3B 5D72L 5EU5A 3S3DB 3UTTA 5C71A 1ANUA 4A37A 2EDHA 2FHCA 3ABGA 3OXRB 4WSJA 2IC2A 1Z9NA 2JV6A 3NYKA 1IGJA 1MW0A 3L1GA 5EO0B 3MJGX 4N2LA 3UG4A 3KGUA 1BQHB 4PB0L 4BWUA 4LQFH 5I74C 1PKQA 3CMOL 1MIML 3C6SA 3VD4A 4GUOA 2G5RA 4FRWA 3WS3A 2ZKYA 2XFGB 2VTFA 3J8F7 3LB6C 3QAZB 4RFOL 3W57A 4M3KB 2ZOLA 1SDDB 3DOSA 3KVPA 4PAZA 3N43F 2ZUTA 5IMLA 2FD6L 4PJGE 4UIKL 3ABLB 1ZLSL 3SSGA 1D5IL 3IXTB 1IAKB 1NSNL 4IGBA 2Z35B 5FGRA 1L7TH 3OXSB 3Q3GA 4DP8X 2PABA 3K8MA 2Z31B 3QUGA 3QFJB 3AXHA 2IVFC 3IS1X 1BZ8A 3MLWH 1U92B 1WIPA 3T77A 4UTAH 1RJZB 5EEYA 4P05A 2WWKT 3PWLB 1XCQA 4FKKA 5AZEH 2ITEA 3D4ZA 3S5LG 3V5DB 2E27L 3U0PA 3KWVA 3V4UL 4JFQB 1TQVA 2NY4C 3JWOC 1UH4A 3QR0A 4P23C 1IGMH 1GGYA 1JWUB 4ONFH 2NZ9C 1CG9A 4MWFB 3HRZA 1M6OA 1XGUB 2CLZB 3C60A 1GZHA 4MJ5B 2Y36L 3B2DC 5T3ZL 2IAMB 3A3YB 4HAKA 2FE0A 3SE3A 1UZ8A 3UPRB 3BLPX 4LB8A 1YDPB 3G6DL 2AZAA 3CBRA 3CVCA 1MWAL 4GYBA 1GS6X 2VAAB 2AERT 4PRIE 4OGAC 1NICA 3KPPA 4AE1A 3GI8L 4CU7A 3B2MA 4ORGA 1U58A 1V3LA 4KBPA 3FO9A 3JWNC 2DLEA 1S7SA 4ZO6A 1XSJA 2BP8A 4JG5A 3NCXA 4OZGB 1QSFB 5CD3B 1KCVH 5F93C 5BRZA 4U6VL 2IBBA 1DUZB 5DT1L 2ICEA 4OH2A 2OSLB 2WVSA 3LRGA 4GQPH 4MB4A 5I73B 5T33L 2RACA 2WYZA 3EO0B 3W82A 3AY4A 2M26A 2R69A 3HVNA 4QHNB 3ROLA 5KEZA 1LE9B 1S9WA 5CD5C 2JQZA 3HI6L 4BH7A 1FL6B 4M1CC 2V8LA 1XBRA 2C3GA 1XZWA 4PJDF 5I0XA 3WFDH 3WELA 3GSWB 5BCAA 3ATAA 5IBUG 3GBMH 4JGMA 3S48A 2Z7ZA 3GSXB 1KN2H 1MDAA 1MFEH 2DEWX 4MA7H 3TBTB 2V2TA 2LLNA 1HHIB 4H2CA 3FTVA 3DO3A 4ZOEA 3SKMB 3KPLA 2HKFL 2Q8BL 2C9UA 4LPWA 4CU8A 3MV7D 3DX8A 1JG9A 5JOFB 1EAPA 4ABUA 2FWUA 2NTFA 4LEEA 2AQRA 3EYSH 3FT1A 1FIEA 3QP3A 2FQEA 3UPCA 3QJQB 3Q8BA 1KXVA 1QWHA 3TZVA 4U7MA 5CEZL 3BPNB 2FX7H 4QUOA 4AUUA 2HRPH 3IAPA 3L45A 4L9LA 4NKMB 4CC0A 2G75A 4KDTA 1UURA 1XFPA 3SDXE 4F7CA 3UOAB 3VFRA 5HPMA 1I1AA 1N4XH 3FUDA 2WYTA 1HC1A 3PFUA 5KYXB 3BRDA 2CO2A 3NEOA 4TLTA 1MW2A 2CK2A 1MFBL 1TETL 1K8DB 1YQVH 2EO9A 3T9WA 1T0MB 3LEXB 1I1FA 4Y4HA 4LRNH 1SXSA 3SEPA 3WUWB 4UB0L 4K71B 5F0MB 1MKFA 5GGSA 3QFDA 3EOAA 4K8RH 3ZMRA 1VACA 1BWWA 2XJLA 4JFED 4H20L 4U1HA 4HAFA 5JHLH 2NY5H 2NTSP 4IRJC 1P4UA 2JJTC 1R5IA 3LZNA 4JKPH 2IDSA 3GEWB 1G9EA 4ZMYA 3MRNB 2XVKA 4HCRL 5D1ZB 2XZCL 2A6JA 3RVTD 1CF8H 5FUZL 1MH5B 1DBJH 1GMIA 1HS6A 4BFBD 1E4WL 1BVLA 2EDDA 4K3GA 5EOTB 2E9GA 2FH6A 3A4AA 3L81A 5HHQA 1MCLA 1X7TA 4QHMB 3PHSA 2CM6A 3IYLW 5B1CA 4PV9B 4RMWA 5FPIA 4XX1G 5DSCB 3V7AG 3IKKA 1Z5LA 1SMDA 2J1ZA 5AW0B 4Y19D 3VI3F 1H8NA 1A1NB 1PDKA 2GIXA 4PTUB 4IGBC 3T8XA 2N0MA 3VM7A 2VISA 1RJYA 2ISDA 1XGYH 1QFUL 3STZA 1R19A 2LAAA 2ARJA 5I16A 3H7LA 1A6PA 2VLKB 3QC6X 2IQ9H 3EJCA 4ABQA 5I6XB 4MDRA 4M02A 1CBJA 1ZEAH 4TL5A 4F5CA 3DV6B 1TQSA 1X5MA 5ICUA 3CSYA 5A40E 4YFDB 1U93A 3ARYA 5H37H 4AJVA 1EZUA 1UM4L 1E9OB 3SE3C 4LBEB 4YOKA 4HIJB 4X42A 3QUMH 1B3IA 4X4YB 3UTSE 5BV7H 4OLUL 3GSOB 4B97A 3AU1A 1J0IA 2VXQH 3OJDB 4WF7A 1RP8A 4R2GD 2Y7NA 4F58L 5EH1A 4JG1H 4FABL 3FXIC 5FGCB 3SKJH 1DQML 1ZANH 4UT6A 2AABL 4XMZA 3ABMB 4E41A 4LLMB 3KEDA 3SKNA 3ZKSD 1D5RA 3AS2A 3IGLA 4YDNA 2XA8L 3W3BA 1NGWB 3P73A 4J28A 1IILE 1ED3A 4Z18A 4MQXD 1H8LA 5HJDA 2WWKO 3MRIA 3F7RA 1DQJA 4GW4A 3QIWB 4A2MA 2BO0A 1ZHKA 3I2CH 1OOWA 3LEYL 5E6YA 2QQNL 3SD5A 4LLYA 5I8CB 3MR9B 3FU3A 3ULVF 1DBAH 4NDMB 4FL4B 1BCIA 1TYEB 1NFDF 5T5FA 2VZUA 4KU1A 5B3NA 1YHPA 4PRID 1IC5H 1EZVY 2GUYA 4A66A 1FNGA 3F62A 1IM9D 4U0RB 5GZND 4MLIA 2JELH 3I75A 4HJUA 2HN7A 4L9LC 1YEIL 4PJBB 4R8WL 2Q6WA 5KVFH 3BXNB 4ZAKB 4NC2B 3EFDH 4YPJA 3QQDA 1TVDA 2WWOA 3ESMA 4YSPA 3SGDI 4B27A 3W5MA 2ZYSA 1KGIA 2AK4B 2MKLC 5CZXC 2ZD0A 5C0GA 2YGOA 4XMKL 3O2WH 4Z0XA 2ZUVA 4UQEA 3PP4H 1KCRH 2YKLL 3SQOH 2NY1C 1CK0H 5FGBA 3U36A 12E8H 3BCFA 3GMOB 4CBPA 2CCVA 3DHMA 1N8ZB 3DARA 5K39A 1S7QB 1G7LA 3B9KA 4QRQB 3SDYH 1HZKA 5LG1A 1S4IA 4BXVA 2XTJE 4AX3A 1JV5A 4QHPA 1OGAA 3QDMA 3WBDA 2BFVL 4TSCH 5KWYC 3DSNA 1OSZA 5EN2B 4I0PD 3C5ZD 4M43H 3OG4B 4TN9A 4QF1B 2R4SH 5ADOH 3UP1A 4XVSH 1ZLVH 1FVDA 2HB0A 1URZA 4OIAA 1RSYA 5JYMA 4C83B 3PWVA 4YSTA 3MV9E 5IB4B 2C7UA 3LHPH 4P2OB 3W11C 5T1JA 1K2DB 3N04A 3QZWG 3JXAA 2H5UA 3JWOH 4XBGB 4LSTL 2OMXA 3IXAB 1KYOJ 1H5BB 3WJJA 2BHUA 5FYLL 1NM4A 3HNTH 3DSFL 2X89D 3GSUA 3O81A 3D0LA 4DW2L 5EZOH 2V5MA 3LRSA 3QG6A 1DQVA 2A6IA 3O4LA 4PG9B 1UD5A 4AV4A 4G72B 3PV6A 1IL1A 4YZWA 2XWBA 4Y8AA 2VDKH 3GHEL 4LSSL 1XF3B 3EADA 5JW5A 3LN5B 2ITDB 1CTNA 3EOTH 4P2QB 1EK3A 2J6WA 2WLYA 3GXMA 4YK4C 3JWNH 4YXLH 2EADA 1QW9A 3CBKB 2ZOUA 4P4KD 1OGSA 4HJJL 3RPBA 3MLZL 2R15A 3QHZH 1TMQA 1VFAA 1ZD6A 2F68X 2YPVH 3DMMD 4U6XA 1TYJA 2DZEA 2XNAB 3JTBA 5ETUB 3L3OC 1P4IH 4JO1H 3VMOA 4H8WC 1F0LA 1QFWM 3NVQA 3NIGF 3WD5L 3U2SB 4JMXA 4NUJA 2B39A 4TSAL 5KBPA 4L18A 2YD2A 3OKLA 4PJHE 1NINA 2R0LL 3L3IB 3VXSA 5B8CC 5MEOB 1NFIA 1Q9LA 1TKWB 4XVJL 3X1EA 1P1VA 4H8HA 4N87A 1GXEA 3UJTL 4NB7A 2WO3B 5D2NB 1FO0H 1L9QA 3VTTA 4OLXH 4TYUA 1J5OL 4X8GA 3WIAA 1CGVA 5CMAA 3NTCL 4G82A 2X4SA 3S88L 1U21A 4BQ8A 5FM5O 5FHAH 1BYOA 3B43A 4FQ1L 1G7IA 4Y9EA 3QDAA 2NR6A 4U33A 1ZE3C 3R0NA 5LGHH 5DJ2B 3GJEB 1EA9C 2X4UB 2NY3B 4QMEA 1AIFA 2CLVB 5B4MD 1QI5A 3FO1B 1UJTA 4HS8H 2GTQA 3F58H 3IJHB 3OKEA 2IH8A 2IAND 4M5SA 3Q5YA 1JI2A 4ZMPA 1OAQH 5IEHA 2B59B 1CICD 4DK3A 3REWA 1V3KA 4LU5L 4Z9KB 4DT2A 4OZ4A 3RIFF 4OUOA 2WXOA 1B2YA 2XXCB 2WXJA 3X1FA 2HLAB 2K6ZA 3KW7A 3MRBA 3BSHA 3J27A 1UJ3A 3O8XD 4U3XA 3BSGA 3P0YL 4P4RB 3EJPA 3UTSD 3IU3A 1NIAA 3GSQA 3SGEI 5EZPA 5CUSL 3HAEH 2LFEA 2YMOA 3O6FB 2HRLA 4AGNA 3LQZB 3NFNA 4K23H 4LSQL 3QG7H 2IDUA 1CZ8L 2APWA 1KCLA 2CRIA 4L3AA 3VFNA 4Y5YC 1ND0B 2BWDA 2FH8A 4L4TD 1AG0A 3AB0B 4GO6B 3RVVD 4AYBA 3QJZA 2NUTB 4S1QL 4JY6A 3VXTA 4FQLL 1HWGB 2OCJA 2F5AL 3R19A 5LUMA 2YSSA 4EXKA 2J1KA 3DOIA 3QJTB 5CBAA 5HGHA 2IBGA 2J7LA 2JKXA 4JN2A 4OQTH 4Y7OC 5F1NB 2DYPA 1K3ZA 2A6KB 5FGBC 4N1EA 1KGCE 1UH3A 5I76B 2X28A 1B2WL 4WJ5A 4DZBA 1CUOA 5ALBH 2X42A 1AJ7L 2W88A 1U3ZA 3RVXC 2CGYA 1UQSA 2VQTA 4JJHA 4LSRH 2FO1A 3BKYL 4ZD3H 2JI2A 2Z0UA 4AXWA 3ATEA 3DWTA 3OZ9L 4YPGA 3KDMA 3ALXA 2XIIA 3O6LH 3D69A 4RGOH 1SEBA 4LIQE 5C0AE 1FFOB 1KJVB 1HXMB 3SOBL 2XFXB 3W39A 3TA3B 1ZJBA 1YUKB 3ZL1A 4NQTA 4N3UA 3RX9A 1YPZB 3NIDE 3PABA 5G5DB 4XP9H 1SJXA 3VB8A 2VLRB 3NFSL 4EJ1C 1QSEE 4QAMB 2XIBA 3KLLA 5DO2C 1C12A 1Q38A 2PYFB 4MMZA 2PNDA 2XN0A 4GH7B 5LXGH 5EIIG 4MDJA 3V6BR 1R47A 2JI3A 4Q97A 4EZLA 4A04A 4X7CC 4KK9C 2IDQA 4M9OA 1U8HB 3EKCA 1KDIA 3N44B 2ZKXA 1S3KH 4EAEA 4Q9RL 1T7ZA 3K7UA 3QEGH 3CZFA 5HP5A 2XWJA 3DRQB 2QZQA 1JRHI 5KVGL 3C8HA 4OFKA 4WI3A 3D09A 1UVQA 3HUJB 3NPZB 1FYTE 3LIZA 2B20A 1JMXA 5EMYA 4E9WA 5A6IA 1MHHA 4HKXA 5LGYA 4DGVH 4A67A 3A6CH 4OCRL 1BGXH 4WENB 2XN1A 4HJIA 3LKQA 1LL1A 2A9BA 5JHMA 2IWEA 2AQ2A 4BFFA 4TNVK 2A83B 5KS9F 4N24A 2EKSB 2DI8A 3RHWF 1A6WL 3CIQA 2W81C 3BVNA 4AVHA 3MRKA 1KTLB 4NFBA 3MV9D 3OLIA 4XO4A 1I8KA 2W92A 2BJML 1P53A 2R2EA 1J8HB 1KV3A 3F7KA 4KKBC 1ZT7A 1R0AL 4UTBL 3DUUA 3BUBA 2DKSA 4QXGH 5EA0L 3UABA 1HILB 1SUHA 5DJZA 3NJJA 2ROXA 3NZSA 4ZXBC 2YRLA 3ZTJH 4YZFE 3RKDD 2WINB 4B5ZA 5E6IB 3H6JA 1NPUA 5FOBA 4Z7WB 2RAMA 1YEWA 2ENQA 3ROOB 3A67H 2NR6C 2KERA 3K4AA 3OC8A 3CFMA 2F8VA 4MXVF 2DWEB 4LCWB 1Z66A 4KI5E 3VXUE 1NANI 4RMSA 3V4PL 5I1JH 1IFHH 4ANUA 4FQQB 1B0GB 3MLVH 1CS6A 4H8PA 3HFMH 4WU5A 4POYA 5IR1A 4KK5D 3W0WB 1REIA 4HEPA 2NQDA 4ELMF 3L4CA 2BNQB 3CFBA 2VN3A 5JZ7D 1WPCA 2ZX6A 4PJEF 3FH8A 1QBBA 1HCYA 2J8UB 4YC2B 2YUXA 1N68A 2VJXA 4OF5A 3UTQA 4HJTA 2ZWNA 2GJ6A 4FTVB 1R3IL 4HF5H 2A73B 1AD0A 4KHTL 3EDDA 1JAEA 4DGIH 3P30H 4D9RD 2W1NA 3D39B 2EEAA 3CFKB 3KBFA 4NFDA 5A7BA 1L0XA 4F8LA 1PQZA 1S3RA 3L5WA 1GZPA 3QRLA 5ESVA 4DVRL 4BD4A 4BSVA 4D0CA 4PWHA 1NCBL 4Y4KD 3SJVA 4PLKC 5C0CE 3LNFA 4RX4D 5L2KB 3K2MC 3H0TB 4IKKA 1XR9A 5IQ9B 3LZLA 3FOLA 4IU3B 1KJ2B 3H9HA 2QQKL 3GRBA 4KX8A 1A25A 3QRGL 1HOCB 4G9FB 1G1YA 2CBTA 3T8VA 4XCNA 2XBDA 2HT4C 2X9WA 3FQNA 5I1KL 4HUUA 1OE2A 4O2FB 1OP5K 1YMMB 2J88H 2YD8A 4L29A 2OMWA 2YA1A 2FEJA 4OD2B 4XNUH 2X88A 1MCSA 1QLEB 2AJUL 5JORB 5AYQA 4S10A 1NAML 2KQNA 2PXYA 4XCEB 5D1XE 4X6CA 5E2VL 3KLHC 1CBVH 1TJHL 2H6PB 1FSKB 1WLHA 2BSRB 3ZGIA 5A16B 2JQAA 2IH9A 3WFHA 2O5XH 4JCMA 2FR4A 2DQIH 2Z91B 4P46D 2OK0L 2WIIA 5LGJA 4X80L 1I53A 1GPOH 1R1CA 2HFEB 5T5NG 2UZXA 5DD0L 5DJCA 1GKOA 3P9LA 1EJFA 4F33B 1MNNA 2P26A 5DQJA 3X3FL 1WK0A 1E2WA 1J05A 4Y88A 1JPFB 5IW6A 5D8JH 3B2VH 3MFGB 4BA0A 1KEGH 3L7EA 1MFCL 2F7RA 3EH2A 4OB5L 4GAJH 2NXYD 5GISL 1UTDA 3JZ7A 4JDZA 4AI7A 2PTTB 2VRKA 5JHDB 4Z3FA 2EZ0D 1UZ6F 4U1LA 3ZYZA 5E8DH 4YXKH 2HG5B 3DKHA 2Y06L 3B6SB 3HG1E 2YGQA 3EJQA 4QLRA 4Y4FD 2F58L 3R0MA 5GGQL 3WDHA 4Y5VB 4H8WH 4OCSL 4XNYH 2IALB 3H2WA 4XPTL 3VFUA 1S7TB 2BNRB 5ALCL 1C16A 2HLEB 2OJ1A 3CC1A 2LVCA 4ZMQA 2DMGA 2GTZA 3BESR 4HV8B 3T3ME 1TQUA 1N3NB 1W16A 3NDZE 4AQEA 3VQLA 3BZFA 1OARL 1X9QA 2FEEI 2ADFH 1T1ZA 3VDBA 2GY5A 2NXZB 4IOFD 4L8CA 1MEXL 3U46A 4OF7A 3K2UL 4FLSA 2KZBA 5AOZA 1NFAA 3ULUE 1KBVA 3OVUB 5H94B 5KYWB 1ZE3H 3WE6A 1ZJAA 5J12C 3ES6B 4ENED 3X14A 3CQPA 1CFQB 2LLLA 2D4FA 4PD4K 3RNQA 2B9BA 3QO1A 3VW3H 3BP6B 4C59B 4AMWA 3EYOB 4HJEA 4JHVA 1TPXC 1IQWL 2ZUXA 3V10A 2VRAA 2ZG1A 1BZ9A 3HN5A 2ZPKH 1FAKT 3S3BB 5L2JB 3K71A 1JVKA 3IJ9A 1JZDC 5K69A 3RZCD 2WIMA 2Q7AA 4Z5RA 6TAAA 4JJOA 3RWEA 4JDVA 6FABL 2C3HA 4XMVA 2WQ8A 3N41B 4LAQL 2NW2A 2VJ8A 3RX5A 2FBOJ 5T5FH 1FYTD 1I8AA 1UZGA 3FQ1A 4PB9L 5B3JE 2Y7QB 2H9GB 3LKPB 4HW6A 5E9DA 2ED9A 3LDBB 3S97C 1V8HA 5FDWA 5JW4Q 4CJ1A 3NSYA 1B6DA 4DETA 3BP5B 1BM3L 1YLBB 2ARWA 4HX1A 2FB4L 1YNKL 1A6ZB 3P77A 1OO2A 4IEFB 3IB4A 2UZYA 3GUFA 3VXMB 3ASNB 3FT3B 2H45A 3BP7A 1IBYA 1JTOA 1J0HA 1S46A 4Q6IB 3EIFA 1FFNB 1X44A 1XR8B 5JLZA 4TVPH 4WW2F 1ETZB 3TC9A 5HHMD 3T2PA 3U0TA 3FF7A 5JNYA 5CGMA 4FNSA 4CMMA 4L48A 1KELH 1K6QH 3JQOB 3I9GH 4ZG1A 4J8RA 2P3YA 4HIXH 4OFPA 5LBSL 4PWIA 1Q9WA 4CVZB 2C4XA 2FJGB 1PZBA 3QUXA 4UV4L 4PRBB 4LLUB 2NW3A 2WQWA 5SWSA 2DW5A 4DIXA 4KI5D 1JXDA 4I4WB 4LHUG 3VXUD 4KKQA 5J13C 1YUHA 3F84A 2HJFA 2WXMA 3HE6B 4PW9A 4X7SL 2H2SD 4PJ7B 4Z7QE 1QBAA 2YN5A 4DO4A 1GS7A 4I77L 2XCMC 4MJ6A 4ONGH 5CU5A 4OZIE 3CDZB 5I1GL 1ZGLM 8FABA 5D5MA 5KSBF 4HLZG 4AENA 2X4QA 1BQKA 4H0LC 1LILA 2UWEA 3K0YA 3JWDC 1KJ2L 1YEEH 2VDOH 4G6AD 4WEBL 4Y7MA 1V54B 4GT7A 3CDGB 1C08B 5C0FA 3G6JE 1Z9MA 2FATH 4PJ5E 1Y0LA 5EO1A 5HHPB 3SCMB 1AYRA 3B9DA 1EEUA 2ZJSL 4DKFH 1XXDC 1QLEL 4FQXA 2X4TA 2X3BA 1A64A 4NFCA 3UJJL 3FU5A 4U1IB 1J48A 3L1OL 3H7BA 4GFXA 5I1AB 5K59E 5C0CD 1RZFL 3IDIA 1JERA 4YSUA 2P80A 4S1RL 2HAZA 3SY0B 3L17A 3QUYD 3VXQA 2EH7L 5FHBL 4TOYL 4YUEH 4HOMA 1F3DH 2BP3A 4TNEA 2AGJL 1S7VA 2OZNA 4Z0BH 3OR7B 1NC2A 4KUCF 4D0BB 4FOMA 4CA4A 4GRLD 2ZCZA 3RILA 2H6UA 4LRIA 3IDMB 3QDGA 1ZLWK 2EDWA 4Q4IA 5D1XD 4AQ1B 3BRFA 3KJ4C 2OZ4L 3WENA 5IMKA 4LPCA 4NHCH 1RZKH 1B9ZA 3PLYA 3CZUB 4Q14A 2BOBB 1HDMB 3ETTA 1DTUA 1ZLUH 3H1ZA 4MNQA 5B1JA 4JPQA 3CN1A 2WNGA 1HSAB 4PJAE 4X5RA 2RHEA 1OAZH 3MBXL 4N1CA 2JKNA 3U6XA 2PPDA 3BYYA 2A5UA 4MQ7A 1C1EL 3IF1B 5I1IL 1ODUA 3T0AA 1E9PA 4KHXL 3CLWA 1E8XA 3EHBD 3DJRA 4NWUL 2B5IB 3AG4B 4Y5XB 3S5LB 5IKCA 2Z8SA 3L9BA 3UTPD 1CLYL 2EXTA 1XGPA 2OJEA 3DVIA 5CSGA 1RZ7L 4FERA 5JO5A 2PWHA 1VEPA 2R2CA 4F2ME 5HHOB 1WRFA 2WWNA 3TWCH 2WQUA 1FHNA 1IGCL 4MAZA 3PFQA 1QTPA 5EO9B 4UQ3A 3AJ7A 1ZY9A 1WAAE 5D7LA 5T3ZE 3JTTA 3RA7L 1EEYB 4GQ9H 4JKMA 4JM4L 4JO5A 1HH6A 2IG2L 4GIOA 3PXJA 1JPGA 4TRPH 3AREC 5A2CA 5CHNB 4PRHE 32C2B 4OV5A 5I17A 4HT1L 1A7PH 4K9JA 4KVPA 1D5ZB 4HCGA 4NIYE 4OFYD 4EIZC 3QQ3A 2P5ED 2AJSH 1TCRA 2Y9RT 1G6VK 4XTRD 1Y1UA 1NGQH 4R4NC 4GKSB 4M5TA 3TO2B 2VERN 1MRFL 5FKAA 1QLRB 1HZHL 3KPTA 1I7RA 5E8EA 35C8H 1THCA 1FDLH 3VVVA 1UD2A 2P47B 4LOEA 2JTDA 3LZFL 3TL5A 5JIIA 1KDJA 1GGBH 4QRSA 1M4KA 3MX0A 1HKFA 2H32A 2YPLB 4FX5A 2XN9E 4NAQA 1YC7A 5IBTH 1AOHA 3FF8A 1F3JB 4JHUA 4E42A 4WUUB 3AS1A 1H6UA 4KRMB 3SOTA 5ECJE 3QUXC 3S36L 4H88H 5B39A 1ORQA 1LO0L 3QUZD 4FFZL 5A2FA 3AADB 3QDJA 3MV8D 5JA9A 4JK0D 2DRUA 3U7AA 1IQDA 1NBYA 4KRPB 3CIAA 2VM4A 3N1MC 1QBMH 4ZTEA 4ZFFA 5FA3B 4IBVA 5E94A 2WP3O 2XI9A 3QEQA 3HC3L 4JFXB 4JHAH 1LDSA 4FNRA 2XV2A 4U3CA 5D96B 1CL7H 4ZPVA 5CEZE 3NK4A 4P2RE 3AWEA 2BCKA 2ESVE 3TN0B 2BS71 4AK1A 1QTSA 4M6NH 4KKCC 3IKCA 4IRSC 4MGXA 4M7ZB 1FN4A 2F0CA 4Q52A 4HCFA 1L6ZA 2B4CC 2EACA 4UT7L 4FG6D 4FFYH 3X1BA 3MYJB 4EZJA 1VERA 5HDRA 3DX9A 1BIIB 1H0DB 3GIVB 4ABWA 3LHAA 1S7RB 2JCWA 3LIZH 4U6YB 3LZOA 5EWIL 5IHZB 2IPUG 5LN4A 3QE5A 3DIVA 4IOIB 3MO1B 3L54A 4GBXB 5DZJA 3WLBB 2L0DA 3C09B 4HZAA 4ISVB 4OJYA 2VLJE 3BQUC 3KXFD 1XF5A 4ODTL 1MVFA 2CO7B 3HBZA 4RAUA 2F74B 1WHPA 4MJIA 1NCCL 3IMBA 2MH4A 4QTHB 3G5VB 2EXYC 4KH2A 3KWTA 4LCCB 2XG4B 5CP7A 3S98A 2I5YH 4GSXA 2O1AA 2P5WA 2JSFA 4P3DB 4RFNC 2MCPH 3GUTB 3FB8A 1CMOA 5E03A 1AKJB 5F9OH 2JIXD 5C09B 2VDRB 1Z6JT 3FHEA 1OF2A 5C0JB 3UP6A 3W9EB 3QVAA 1X7SA 5DYFA 3DRTB 5CCJA 5T1KA 5IT2H 5AVTB 5JQIB 5ITFA 4K4KA 1WE5A 2XWDA 1JFQL 3T4YB 3HZVA 5A2LH 1RK1B 3U1SH 3UYRH 1BXVA 1RIUL 4M62L 4PJ5D 3BH8B 3T04D 3LMJH 3O6KH 1MFAH 4PR5A 6PCYA 5IP4A 1KULA 4DGWC 2FJFA 4KK8C 1PNCA 4RMUA 3VFGL 3ULAB 5J6GB 5AG8A 5JMRA 5IVNA 4HJGA 3EYVA 1ZMYA 1ONQA 5J5EA 1F8TL 1KENL 4A6YA 5D9SA 1CF1A 3T2NL 2HVKA 4FG0A 2OFQA 4F8NA 2QKIA 4G83A 2CKBB 1JGUH 1MI5E 3K4DA 5AW3B 1FZKA 4J6IA 4M93B 2VT0A 4OFDA 3IFNL 3NCYS 4B0MB 4U1JA 2EDQA 3LS4H 3ULUC 1BOGB 4JPVL 3L3GA 3QFJE 2XZQH 1VGKB 1T1YB 5FFOA 3P2BA 1RU9L 1RLWA 2GKIA 4JZOB 2J21A 4FNLH 3WG7B 4U05A 2VUOA 1LEKB 4H4NA 5I2IA 3MJ9A 3S34H 1MCJA 2XV6B 2L04A 4JB9L 1A7QL 1CLOL 4OAWB 5HHVH 3VGAB 3FZUC 1AXTL 4KUZL 1JRHL 5SWZD 3LXBA 4CU6A 1IE5A 3LY6A 4U3SA 5B7EA 3CDYA 5IVXF 4CVXB 4K3EL 4XPHH 3WIHA 1UB5B 2I07A 2W60A 4K3DL 4KTEH 3ZE0B 4BZ1A 3ZKMC 4PRPB 3FKUS 2VQ1A 2GI0A 2IDFA 4X50A 3NMEA 1N59B 2YFOA 3B7TA 5TE7L 3TPKA 4ZFOA 4WWKA 4TPRH 4IQHA 2FT6A 1DVUA 3ARDC 3IT8D 3IVKB 5HHXL 4W68A 1CQYA 5ICXA 3T6XA 4TQEL 1I9RL 3PL6D 4OZGE 1KSRA 5FO8A 3VFMA 4PLNC 4N6RB 1YJDL 3JWDH 4RDQG 3JV6A 4UOW0 1MJ8H 1OM9A 1ZA6A 4EUPA 5IHWA 1L6PA 3OMNB 5F9DC 3ULSB 4QGTA 5AVXB 1QNZH 2O26U 3T2LA 2YXVA 4JNXA 2WK2A 1CXFA 2V33A 3IPEA 4XMLH 1UFGA 4OR1A 2FIKA 4AYGA 4GG6A 1KJ3H 5D7SH 2R29H 5DDHA 1YY8A 5E5LA 1Z5YD 2BZ7A 5ACZB 2Q76B 4GRWH 3KYOB 3F8UB 5DHVA 3S37L 1H15A 3EYFA 3TT3L 3PV7A 4P3CH 1T1XA 4DGYL 4X6DB 5CU9A 3BHBA 1DZBA 2J8OA 3GZQA 5SWQB 4L1BA 4OUUB 4FQJH 1FL3B 3GMMB 4N68A 1EUTA 5AW1B 4NN6C 5AB0A 4N26A 3T8MA 4OKVA 4JRXD 2FIRT 1OTTD 5JIHA 1EAJA 3GBDA 3HC0A 3UPAA 3MLXH 1W15A 4DK5A 2K8QA 3E6HA 2E4TA 3VDCA 2WPGA 4EI0A 2R0KL 2Z9TA 3I9IA 4GP4B 1H19A 5CILL 2DQDH 5E4EB 3GKWL 4H5SA 3HCVA 5T1LD 1B0RA 3HS0C 1W0WB 2MWCA 3QQ9C 1GSMA 1TYRA 3SN6N 4P57A 3PDOA 2A4ZA 2FX9L 5B1AB 2VXVL 5IW1A 2VL5B 5BNXD 5I0VA 4NZJA 1GAFL 3SHSA 1TT6A 2AEWA 4G2AA 3L9EA 4JFDB 1S7UA 1TLKA 2X4RB 5AVRB 5AKTA 3TJEH 3B2UC 2FSEB 4NUGL 4TQIA 1K8IB 4BYHA 5CEZD 1CVRA 4P2RD 3N42B 4NQVA 3CLFL 3IFPA 1W8OA 2ADIB 5DJXB 4AEIH 4XHJC 5MI0B 3O3UN 3QZWB 1UWFA 4MCZB 5FO7A 2N1TE 1Z1WA 2C9VA 4N5EC 1M6UA 2OLDA 3F6IA 3H2QA 4X8JB 4DVBA 2HH0H 1XV8A 5E1AB 5FFLA 3FO2B 1DBMH 2WBJA 3B7RL 4HS6A 2P44B 1E27A 1PD1A 1DO5A 1AZBA 4WDIB 3V0FA 5EU6A 5DVPA 2RFXB 4YHMH 1L9SA 4D3CH 4RSVA 1FWXA 1QRKA 2HKHL 4W9FC 3T3PE 3FCUB 2QHLA 4HSAC 3OBAA 4TUKH 2VLJD 3VWJB 4G43A 5CFAA 2K6WA 2XX1A 1RUPL 5TF0A 4HCIA 1T1WA 4QRRA 2QKIC 3ZTNH 1AR1D 5KAQG 4JY5L 4W9ZA 3ZQXA 1FZJB 4N8VB 2ZXDA 1U3HD 2HCZX 4O2EA 1YMHA 5C1MB 3C5JA 4CSPA 3HB3C 4PTTA 3DV4B 4KV5E 4TF4A 2O6EA 3NGBC 4WEMB 3Q1SH 1JGDA 2OX5A 5AOMA 2VLKE 1I75A 5EBWB 2BY2A 3DXAE 1KGJA 5CS7A 4WV1A 1SEQL 1CT8A 2C9RA 5HYSA 2VZOA 5DK0B 5E9NA 1G9NC 1W80A 1CPUA 4HPOL 4KDWA 4IBQA 1J12A 4P5TB 4U4IA 4G6KH 5C8JA 3A6OA 4JFVA 1KIPB 3BC9A 1R3LA 1CGTA 1RV6X 3ILEA 4AGPA 2TRYA 4LLAA 4TQPA 2EVFA 1N7ML 5DRWA 1U2HA 2FECL 4Z23A 1SF5A 2D31A 2GK2A 3F6LA 4N2KA 1I1RA 2DBJA 1WHOA 4OJDH 3ZDWA 3GNMH 2JB6B 4PHXA 3LPWA 3QZLA 4LHQB 1AI1L 2CDFA 2PO6C 2WTRA 3KNBA 5E23A 4I48A 2FX8L 1U41A 3JYCA 2F61A 3MFFB 2VR9A 4GLRH 5I8EB 3MKGA 1U8CB 2Y72A 3OAUH 2Z31D 1ZGLA 3QFJD 4XOBA 4JG0H 2B4CH 1IBGH 1XD0A 2VERA 3P4NB 4OM1L 4ZO7A 4HIHB 1QAWA 2CMRL 4U1KB 3QWNA 4HISA 3MUHL 2MCAA 2I9LB 3ULVL 1BVKB 2J20A 4XVTL 3TO4B 4NSKB 3HZ3A 3HG0A 4RWYL 5JIQA 3QBTB 4H26B 4L3CB 4OT1L 3WNPA 1WAPA 3MRMB 3LVTA 1I8LA 4M5ZH 1E28A 2FO4A 4FNPA 4R90L 1INDL 3NJLA 2CUMA 2UVEA 4OKDA 5PCYA 2Z65C 2B77A 4JY4B 3JVFC 2IAMD 5HHNA 4N1HB 4Y2LA 3EYUL 1CIUA 3WFEL 2XRAL 3WXVL 3CZNA 1E4XH 1NL0L 4RAVA 4XN1A 1A9BB 4GKNA 5ANMB 1WWAX 1PYWA 4HQQH 3L2NA 4L3FA 1QFWH 3D18B 4R97B 3D07A 1QSFD 4MKTA 4WHCA 4HKBA 4XWOD 4FNQA 4KY2A 4YFLI 5I8KH 2WQSA 3CN4A 2QVIA 3S35H 1G1KA 2OMUA 3DUHA 1LK2A 5F72S 3PUCA 1Q94B 3MRFB 3SYOA 1EFQA 4BFIA 4R4FH 4P3WA 1WFTA 2EDEA 3C6LB 3MLPA 3CPLA 1IGFH 5L88H 3MVSA 4OGXL 4WI5A 2EEDA 5L9DH 3TLRA 1W72B 2OQJA 4JO4H 3RJOA 5EIIB 1DL7H 4LCUA 1M1SA 3HTLX 4YX2H 2D03L 3FU7A 2AEPL 5ICYB 5LCVA 3T2OA 1RCYA 4AIXA 3O3BA 5FCSH 3L3HB 1D5BB 5DXWA 3LZPA 1VAHA 2NPLX 5EZIL 1KYDA 4PHZA 3TX4A 2OL3A 2X70B 2V9TA 1JN6B 2WBJC 2AK1L 5EC1A 3MLYH 3KPRD 5KVGE 1B4TA 3M7FB 1EAQA 5E08H 5HDWA 3OZLA 3V0WL 3RTLA 5DMYA 5DQDH 4WTZA 2G9HB 1J18A 2QHRH 3B2XA 1PIFA 2OS7A 2RQEA 1TU2B 1NBQA 5C70A 4JFEA 1RULH 3DBSA 4U49A 5FO2A 3MUGB 3EJZD 1E6JL 3PHOB 1V7NH 2H0PA 3BQVA 1WFUA 2C9AA 5IHUL 4XP4H 2JXMA 3HLAB 4PJ8C 3IETB 5DWUH 4HGKC 2I69A 5ABAA 3NFPA 2WYIA 3ARRA 5JXAH 1U8JB 3SDAC 5CJXA 2AP2A 4PJIA 4XC3L 3GHBH 1U8IA 2QELA 4YSOA 5L6YH 2AXWA 3UEZA 1KB5A 4WV1C 1KF9B 4WU7B 2QSVA 3BKML 4YDJB 4P2QE 5D4HA 1D9KB 3BPOB 5D1ZD 4LLDB 2VWEE 3CFQA 4PQXA 1II4E 4Y19A 1ACYH 4YDVA 4EBQL 1T20A 3CAFA 1F4WL 2AEIT 4NQXB 4C56E 3BDBA 3EFOB 3IM1A 5AFAA 2VZ3A 1H3WM 4XN5A 3KWXA 4R96A 4KO9A 2HLFD 3W9DB 4JPWL 1VJSA 5GGVL 5KOMC 3VXOB 2CBMA 1ZS8A 4IJ3C 5AYUL 4UAOB 4Z77A 2P8MA 4W6XB 2XZAL 4HPYH 3THMH 4EVNB 1FAIL 4ECNA 2GY7B 2Y07L 4UT9A 4RESB 4A39A 2B14A 2KI6A 1SHSA 1UCTA 4MMYA 4S1DD 1S7XA 1TJGL 4WCYL 4GQZA 4UOZA 4EI6B 3F05A 3W81A 1AHWB 2VC2H 3IE9A 4ZUTB 2VLKD 3R18A 3NQKA 4XN8A 3GLDA 3KD4A 1KB9K 4DN3H 1IFRA 1JPST 5E8NA 1EDHA 4PUBH 3N91A 1JOIA 1VIWA 1PS3A 4FXTA 1BLIA 1NDGB 4KZDH 1SXZA 1Y07A 3KPOA 2VJ0A 5KSUA 3OHMB 2ZXQA 5DMJB 3S4SG 3QI9C 3BE1H 5IFHH 3SZ6A 5F3BA 2X7LB 4PY7B 5CJ5A 1NCIA 4NO2A 3TONA 1JPSH 3G5WA 1ZTMA 4NNYA 3ZRCC 4RISL 3UYPA 3OKKB 3PXHA 1NGYA 2VIRB 3ZTCC 1UUSA 1MUJA 2WXNA 3JUZA 5GJTL 1UM6H 5BS0B 3ZXAC 5KVDL 4R26L 2ZSVA 5T1DH 2XTLA 5BPPA 3CK0L 3WEXB 2BVPB 1M9SA 3RVUC 3RWIB 1ILSA 4GQRA 4F15C 5DZAA 1ES0A 2V8MA 3D85B 2A74C 4JJ5A 2KHAA 2PP8A 4KKAC 3KVQA 2OJZL 1A7OL 4EQ3A 3EGSA 1DZ0A 1H6TA 1E5YA 5D93B 4P49A 4GNKB 4F8TA 3KYKL 5GGTL 4K7PY 5D72H 5GSRB 1H9DA 4JFFB 2YRPA 5DWPA 4PRIA 1MLCB 1YN6A 4FA7B 3A4DA 5F44A 3ZN6A 2Y2YA 4AT6A 1IM9A 1FVEB 3S5ZA 4U1MA 5GZNA 3QIWD 4ADIA 4A7VA 3ARGC 3GLEA 1WZ1H 3AT9A 4IHBA 4A6YH 1MIMH 2IGLA 3N9GL 3FB5B 4X0NA 1VCBC 3BAXA 1KJMB 4GKZA 4BE6A 2G5BB 5IBLC 4RFOH 5FEBA 3ALWA 2KPWA 2V9QA 3I3BA 3KLAA 4UIKH 2FTAA 3RNKA 5BRPA 1PZSA 1RK0A 1D5IH 1YPZE 4NHUB 1AOZA 1NSNH 1ITBB 1L0QA 1E5CA 1W72L 2VLRE 4F91B 2PR4L 1IAMA 1AE6L 4A2GA 2VQUA 2FBRA 4ZAKD 5H8DA 2Y6TE 3ARFB 2GSIA 1HU8A 5AVZB 1BEYL 3ZOAA 3GBLA 1K5NB 4EDWH 2AK4D 2GK0B 2KLSA 1G9NH 1LO4H 4AKQA 3S3CB 4LPYA 5C08D 2OXHB 3C5ZA 1YYML 2ZIDA 3N1QC 2JCCA 4IU2A 4JFOB 4JEGB 4JKKA 5ADPH 1CWVA 3AM8C 5F9JA 1JVLA 1MHPL 2QV4A 1FZMB 3B9EA 5FYJH 3HUJE 5GRVK 3SBRA 4CKQA 1HK6A 1D5XB 3TASA 3VFOB 5K9OA 3OAZK 1N8OE 5JHAA 2KZ1B 1EBPA 3RDTB 3SDXA 1MWAH 3R1GL 4B9CA 4BM7A 4G8EA 4A7SA 4OCXL 2A77L 1ZK5A 3RIAK 2H1PL 3RVWC 3WFZA 1BAFL 1A2YB 3MNVB 4ZMAT 5CO1A 2X4PA 3WFBL 4PGJA 2C9QA 3KWUA 4UMGA 1CD1A 1P6FA 2X89A 1MN4A 3BZEA 2PWFA 1AS6A 2NY7L 5IJKA 5T33H 5I9QB 3RTQC 3X13A 2FLRT 4CC1A 1AH1A 3Q9PA 3FOMB 2V7HB 1E5UI 1XB6A 43C9B 3VFTA 3N40P 3T1FB 5EUOB 1R3JA 3UAEA 3TV3L 5DHVH 5IQLA 4QRTA 3LH2L 1ASQA 5L4FA 2JF1A 4Z7WE 2Z6FA 1UT9A 3QW9A 3DMMA 1NBZB 4R7VA 3ZY7A 2HKFH 3EFFB 3L7FA 3V52L 2B1HL 5KANG 3RWJA 2DD8L 3IDXL 1MRCH 4LCWE 5D7JC 2W9EH 2WVTA 1RZJC 1E50A 2RR3A 1OTUD 4GW5A 1TITA 4R2GC 2J73A 4NO3B 4G80A 1P7KB 1DJIA 3EGDB 4Z7IA 4PPTA 3OJMB 3ZT7A 3SE8L 4R7DB 1I7TB 3W0WE 4FG4A 5J9PB 2Q7YA 2ORBL 2J25A 3BLKA 4FC3E 4GUPA 2BNQE 1QBLL 2VQ4A 2H2PD 5FF6B 2J8UE 3WYRA 2COQA 2IQAB 1MCOH 3TBYB 3MRLA 5DHMC 1P4LB 4FTVE 2O72A 3UL4A 3MNZB 1OAUL 2IANA 3WMSA 5E1HB 4NRZA 2BOCA 3H3KA 1CICA 2DMKA 2MIZA 4BZ2L 4KJQC 2ZOKA 3TYGH 3U2JA 3MAWA 1CO1A 1TOXA 4H20H 4K9EL 4RMBA 3A4FA 5L2KE 5E8OB 4BUHA 1PG7L 1ZGLP 5CNHA 1TTAA 2EXWC 4N9OB 3REVA 3ZMEA 3O8XA 4AL8L 1N67A 3M88A 4G9FE 4FNTA 4K5PA 3UTSA 1AACA 4S11A 3VUAA 5FWQA 2IJ0C 4H13C 4MXQD 4B9KC 1PY4A 4UU9B 5EU3A 5FUZH 4CC4A 4IIQB 1DFXA 3PJSA 4OTXL 5AB2A 1FV1A 4OCLC 1Z32X 1BFVL 2WOYA 5JPNB 1E4WH 4E9VA 4TSBL 3X17A 2Y5TB 4L4TA 3L4TA 2OXGA 2BC4B 1BX2B 3P3RA 2HT2D 1ZVNA 3R4DA 1L7TL 3AMKA 1FIGL 1QP1A 4FXGC 5I66A 4HKJB 3O6FD 2X0UA 1TMCB 5G4OA 3MRRA 4XWGH 1JZJA 2XWRA 2BIIA 3QUMB 1XB3A 4UTCA 4F1ZA 3S3PA 3GS7A 5JHDE 2HVJA 3CVDA 3RPIB 4WQOA 3L1EA 3VGDA 1I8IA 1IC4L 4LSVH 1BEXA 3D8MA 3GINA 2NY2B 3C5SB 4I5BB 4M4RB 5F71A 3WY1A 1F86A 4KRNA 3VD9A 3A6BL 1HWHB 4L0ZA 1UM4H 4F3FA 1C5DB 1JGLH 2BNRE 4N2FA 3NRPA 3RWDA 4OLUH 2GJZA 1IAOA 5FLVA 4TXVB 4OJAA 4EQ2A 4P9ML 4UIMA 4O02A 3TA3D 1KCVL 2K9UA 5BZWA 5AEAA 1NIEA 3L9YA 4FABH 4XVUC 4M7KH 1OZTG 4X6CF 2VLRD 4ZOCA 2AABH 1PEWA 2AMGA 3HHMA 4KX9A 4MD0B 3N85H 4RH4A 2XDHA 2FYYA 5IOKA 1T4KA 1V3JA 1P7HL 4FZ8H 1ETA1 1QKZL 3WTXA 3ZDZE 5AAWA 3LJ3A 3WO4B 1KN2L 4ZMLA 1QW8A 1EHKB 3V0VA 2A9ML 1WDAA 1EO7A 5AUMB 2EYTA 3HHSA 4GXFA 3EZ8A 2VWEC 2Z7WA 1JHTA 2WZPD 3TBVA 2ZUUA 2WCGA 4NEHB 2QLYA 3LEYH 4L05A 2ZKHL 1EXUB 2QQNH 1WBZB 4ZFZA 1EVUA 1FH5L 3B8SA 3DMMC 1JWSB 2ZYRA 5ESQA 1T6WA 3BH9A 3D08A 5BQ7A 4YS4A 4YBQD 2VR8A 4F7MA 2VLLA 2E8ZA 1Z3GL 2HX7A 3GB7B 4NT6B 4MNGE 2FX7L 3L3KB 4QWWC 3TNMB 5I74B 2K7QA 4AV5A 2AMUA 1G0DA 4N0UB 2WWMD 1U91B 3VXME 5F7DB 3ILPA 2Q3ZA 2J3SA 1N4XL 1S9XA 3F85A 2J56A 5E8PB 2DBLH 2BVUA 1MY5A 4J6RH 2FL5A 3QJXA 4HUVA 3D51A 3ILDA 1DE4B 4LRNL 4YIQB 5DZLA 1U6AL 1J8HD 1DCLA 2E7CA 4YL9A 5C6PB 1HH9A 4BFKA 1XGQA 3D0VB 3MJ8B 3B37A 2PYEB 2V5RA 1T22B 5JHLL 2NY5L 3WN5C 4J7RA 3T2QA 5DRXB 5LCVH 4JKPL 4L8BA 2ADYA 3DVNB 4AGOA 5DUMH 2NY4B 4Z78B 3SODB 2CHDA 4P23B 4FXKA 3NCFB 4NJAH 1JZ8A 2QVKA 2OL3H 3QS3A 4L3EE 3F12B 5E5MA 2CIIB 5I1EH 1DBJL 4Q7DA 3JV5A 1XCTA 4PJHA 4QY8A 3RY4A 4CC4C 1ZV9A 2ZCHL 1KPVA 5CWSA 1J5CA 3C08H 1GY2A 3GLZA 5AW4B 5IB5B 2DJ4A 3CFEB 2VDKB 2SEBB 4MX7B 4FP8L 2BWQA 4N0CD 3FL7A 3W0WD 5HYJE 1U95B 1GS8A 2BNQD 4G1EB 3RB7A 2OMTA 4Y4KA 4PJXF 1RD6A 4LPUA 2XKUA 3VWKA 1PGRB 3FONB 4S0SD 1I85A 1HAWA 2UXVA 2HJKA 3GXNA 3MLRH 5DS2A 1AZNA 1HT6A 3LRLA 4MB3A 5TPWL 4HHAA 5FYLH 1QWUA 1XGYL 2HUHA 2NCEA 2XKSA 5GS1A 2DYSB 2DI7A 3D39D 1QRNE 3KJ6H 1QQDA 3NIFF 4U6TA 1ULVA 5CP3H 1ZVSB 4WI0A 2IQ9L 4U1NB 5IOPB 2CCWA 1ZPLA 2XBTA 5GIRA 2R1XB 4JHZA 3QZMA 1GJIA 3L08A 5IJVB 4IS6B 5L2KD 5F1IA 1DUYB 3ZQ9A 1XL4A 1FO0B 2OMZB 5JIPA 3ZT5A 4G9FD 4P46A 3KPQB 4HJJH 4JUSA 3FSWA 3MLZH 4PRDA 4A38A 4YEFA 3IMSA 3KEHA 1V27A 2X4NB 4MVBD 3EH4B 1YMMD 3GMQB 1NDTA 2VLMD 4Z7UA 3QUML 3FNKA 2IMMA 3DUSA 2BOLA 5BV7L 3ML8A 3FU6A 4IOSD 3MBWA 2VXQL 1FLRH 3D5OF 4I13B 4GO9A 1ZRUA 4M8QA 3MOBL 5IUCA 2E7LC 5D7HA 3UDWA 2R0LH 1DVYA 4DJMA 3HZYA 4RQQA 4XVJH 5AD0B 4NUPA 1OSPH 3OGOE 1ZANL 4XMPH 3UG5A 5EU4B 1J5OH 1DQKA 1HHGB 1VZIA 3NTCH 2OBGA 4NUQA 4XCCL 4Y4FA 2VXTL 2R59A 3UGXA 2VDMH 1GGCH 4LT7A 5D5MF 4FQ1H 2I24N 2X87A 3DJSA 1NCDL 2UWEF 1FJ1A 4J3OD 2D7TH 3HAEB 1MCWM 2QBWA 2RH0A 1VPOL 5GS0D 1RZJH 5JHDD 1UGNA 3M1OA 3ZDXF 3PGDB 3TNNA 1WFJA 2O4EA 3I2CL 4OZIF 3G5YA 5HHOE 3BO8B 1T03H 4IRJB 1N12A 3DX3A 1DBAL 3MGOA 4XP6L 4L5FH 4R3SA 1A7BA 1NGZB 4QHLB 4K2UH 1INQA 3T0WA 1IMHC 4QXWA 5EEVA 1AGBA 1IC5L 4LLWB 5L4JA 2BNRD 4FZEH 4U0QB 5GGUA 3TCLA 1ZHBA 2HFGH 3FCTA 5AOLA 2JELL 4XI5D 2ATKA 1MW3A 1PKQB 1DFBH 3C6SB 4OZHB 2JKTM 2Q86A 1SGKA 2NXZD 3JV4A 2QPEB 3EFDL 4LSQH 3ZZ1A 3E9UA 3Q06A 2X0VA 3RZCA 1MVYA 3DOSB 4AMKH 5ID0A 2BWIA 4ELDA 4NQEE 4WKXA 3BVDB 1QI3A 2YQ2A 3HMXH 3VD3A 4IGBB 3O2WL 1FYTA 1KCRL 3PP4L 2HG0A 3Q3GB 12E8L 3MNWB 1BVZA 2YAQA 3VXNB 5DYOA 4UWQB 2WZ6A 3L8QA 3SDYL 3C9NB 4JE4B 1B2WH 4KKPA 3V7MA 3MUJA 2YPLE 3P4MA 1XSKA 4LSPH 3BKYH 4FNUA 5L7XL 4ZMWA 4TSCL 4KK5C 5B38G 4Y8DC 4WUUE 1Q1PA 3PWNB 4ZQKB 2H26B 4M43L 4JKNA 2FWSA 3KYAA 5ADOL 2PTVA 2WLNA 3SOBH 4UM8B 1M7IB 2A4CA 4QOKB 1BQUA 5ESAB 4HKZA 3WLWC 2EIDA 2OP4L 1TSRA 1NM9A 3KYNA 2M1KA 3QJHA 3LRKA 3VXMD 3LHPL 2QEJA 4PJ9A 1GJUA 3V0GA 2IAAC 4DN4L 4ZMZA 3D33A 4ORGB 4BFJA 1AZVA 1S7SB 5EBMA 3DETD 3VWKC 4RFEA 3STLA 4CUCA 3U6RB 3HNTL 4GG8A 3VA2C 1KMGA 3ZZSA 2ETWA 2CLRA 2P24A 5AL0A 5IVZA 2VUYA 5C0EA 1KYUA 4Q9RH 5DFVC 3RIKA 5GS1C 4Z1PA 3VXUA 4X5WA 3OB8A 1VEOA 2ZWKA 4ANWA 1UENA 1I4FB 2EDLA 1FFQA 2VCOA 3FQUB 4POZD 2VDKL 4BE5A 4MD5B 4FCHA 3EOTL 4W9CC 3V4VB 1QHQA 4YXLL 1TUPA 4NZTH 1UG9A 1KZYA 3O3EB 3CFUA 4PFEA 3QHZL 2DM4A 5IV2B 3KPLB 5E6SB 3LD8C 2XLLA 5DUBA 3P54A 1P4IL 4PRAA 1X5XA 3NJVA 3HE6D 1A6WH 2EC9U 1G7MA 2NTFB 4O00A 1SFHA 1G0XA 1Y18B 1A65A 1U8MB 4LMQE 5JR1H 2NX5E 5C9JB 2EE2A 4MCMA 5C0CA 4L9LB 5HY9B 4G5AA 1Q9OA 2G75B 4UTBH 1R0AH 4F20A 2P9RA 2Z7YA 3KDPB 3QUYA 5IQMA 1FRGL 5EA0H 2EZ0C 3VFRB 1CL7I 2DPKA 4TUUA 5FHAL 4DKAA 3PQYE 1GR7A 4NXSA 4ZUUB 3SCMD 4GRLA 5LGHL 3GGWA 4IBTA 4OCWH 2F54E 4XN9A 2MCG1 1NIFA 2BIPA 4N9GA 1F4XL 3GDCA 3GMRB 5E5UB 2EVHA 1PZCA 1OCOB 1CDBA 2QLVB 5GRYA 2NY1B 2YAPA 4NM8H 5D1XA 3V0JA 2R7EB 3LYRA 5CZVL 5KANI 4WKZB 5GGSB 4Z7VA 1VACB 1DBBL 4MDIB 2EIKB 3TN0C 2J5LC 5FYKL 5IIEA 2APFA 2IBZY 3X12A 3GJFB 5F88A 3OM3B 4F1SA 3ESUF 3FTZA 3ATBA 4Q2ZA 1G1OA 5J6SA 5IMMA 1FBIH 2E9BA 4AM0A 2A6JB 3MBEC 4YWGH 4Y1SA 1T0NB 4QRPE 5TQ0H 1OKEA 4OLYH 5EZLB 3ARTA 3M1BA 2X2HA 2HJLA 4R84A 3BZDA 4XH2B 5I6PA 1JS4A 3QG7L 2EKJA 1OE1A 3MUZ1 4MA1C 1XTLA 1SVCP 3BT0A 2G60L 3S8WA 3CUPB 2EILB 2ZF9A 4DVRH 1A6AA 5EN3A 1IEAA 5C92A 3LZRA 1DANU 1NCBH 4RMTA 1H3PH 2WLJA 3ZE0E 2C3XA 3QCTL 4PRPE 5DQ9A 2QQKH 2V6HA 1RJYB 4NBZB 3AQXA 5AENA 5ALBL 1E4JA 2ARJB 4NQUA 3QNYA 4LSRL 3HE7C 2E59A 4RNRA 2XV0A 3ULVE 2UXTA 5HHOD 3RGBA 4AUYA 3QNZA 2AJUH 3DIFA 3O6LL 2C8NA 4OFYA 5E2VH 4RGOL 5B1BB 2P5EA 4F8QA 4YK4B 2WMPA 3OV6A 3QQ4B 2K9FB 1MCKA 2ENJA 4KXZI 4FQIH 1TZOA 3MJWA 2HPOA 2EC8A 4PJDA 3CSYB 5T3XH 3U9WA 5MHSE 3VJ6A 1ZDQA 5E6ZA 4H0IA 4BIKA 4XP9L 3L3OB 5DD0H 1GGTA 2L3BA 5JQ6H 5FXCH 2FYVA 4P06A 4PJ9C 4K5OA 1XX9C 5LXGL 4R7NA 1MFCH 2H8PA 4WI8A 5B8CB 3V5KA 3LOWA 4S2SA 3MZTA 4V11A 4HG4K 3LIUA 3MRCB 4OI7A 1S3KL 3I9AA 4WGWB 3QEGL 4K5LA 1VADB 3INOA 2R9HC 4PVMA 2AJZA 2JB5L 3CH1B 3QUZA 5CJQL 1BPVA 1QUPA 4K5MA 4IMLA 1H6EA 3IDJA 3MV8A 1VFUA 5DS1A 3PREA 1X5ZA 4G5ZL 3DECA 4I3RL 2IOIA 3X11A 2UX7A 4JM2C 3P73B 4OCSH 1BQSA 4F7KA 4DGVL 3ZHDA 3NBNA 3A6CL 1BGXL 5LJYH 4YR6A 2HP4A 4LVOC 1WC7A 4GW4B 4O02H 5DA4A 2W07B 2YA0A 3FT2A 2XT1B 1OARH 2X9ZA 3B5TA 4HUXB 4MQTB 5AW2B 1P6AB 1F00I 2FCBA 1SQ2N 4FF9A 2IOMA 4MAYC 1VFBB 1MG3C 3EBAA 4JFDE 2R69L 4E5XG 4ODWB 5IROD 1UD8A 4EXPX 3Q01A 2B1OA 1OTSC 3HW7A 4HD9A 3E3QE 4MBRA 3FCSB 3T0DA 4XXWC 3I75B 4QXGL 3LQAC 5IB1B 5F96L 5HDQH 1GJWA 3KXFA 2EDBA 3RY6C 5SX5H 1MCFA 2JQMA 3ET9F 5DC0A 5DURD 4Y5YB 3CFNA 4GG6F 2B08A 3VD1A 4YDZA 1A3LH 1YNTA 2HFFA 5BXFA 1ZHNA 3QIBB 1QFOA 6FABH 1CDCA 3H2PA 4TTDD 2VSMB 2V7NB 3EF7A 4JANA 2E3VA 1IM3B 2JIXA 4GBXD 2NY0C 5IB3B 4OZIA 2Q9OA 5K39B 4HETA 2W0PA 2OTUB 3D3VA 1G7LB 1ZA3B 1IFHL 4H1LH 3RGHA 1BM3H 1XWVA 2IPKA 1KT2B 3MLVL 3F2LA 2Z0BA 4ZUSB 3O2VH 1ZSDB 2FB4H 2JNZA 2VW4A 4M48L 1OGAB 3SPVA 3QPQD 4KZ0A 3NIGE 1IC7L 1I9EA 2VABB 3EDFA 3QJUB 4HH9A 4IHOA 3P40A 1OHZA 1AKJD 1I9IH 1T3FB 5C09D 4V1DB 1QHOA 3ZGHA 1J5HA 1BVNT 2XPZA 4HF5L 3WNMA 2MTPA 3SB3A 3ZUCA 1KIRB 1NFKA 4W70A 4DGIL 3P30L 1NAKH 1JUFB 2XOTA 2J1XA 3G6AA 2JJSC 4G7VL 3CFDA 3P1VA 1U8NA 5FC9A 5HI3D 4WFFD 3G5XA 2J2ZA 5LBSH 4LNRA 2WB1A 3O4OB 4JRYD 1AGFA 3AG1B 2VDOB 1DN2A 1CE6A 3UAJD 1VZHA 4XN7A 1KEML 4N2MA 2NYYD 3VI4A 3GSUB 1FCCA 3D0LB 3LRSB 3OKMA 3UTZA 1HI6B 2J88L 2VW6A 4XNUL 4MA3B 4NQSA 3ZDYF 3D25B 2NUPA 4CDGC 3COOA 1N5AA 2IADA 5HVHC 1AIZA 1QVOA 3S4SB 1JTPA 4X7SH 3FW6A 4PJAA 5JW5B 1Q1JL 1YEFH 3TVMC 4XTRC 5D71H 2O5XL 3S96B 4MCNA 5I1GH 1FORL 2DQIL 3HN3A 5SWZA 1MPAH 1SLXA 2R0ZH 3ARXA 1GPOL 1E3XA 3P2DA 4I9WD 2IPUK 1HJCA 1YJDC 4DPCX 3QDHA 3SBWC 2HYMA 3V5HB 4WEBH 2BNUB 4KMTH 2DIEA 1NLDH 1QA9B 1UXMA 3B2VL 1T83A 5DK2B 2KZKA 4OIFA 4NUJB 4M8VA 3EJYD 4KNUA 5CINH 5JPMC 4OLZH 5KVDE 2ZJSH 4F2MA 3WTVA 1D6EA 1MQ8A 1Q9LB 3UJJH 2ZUWA 2VAJA 3IRCA 4ETQB 4PMEA 4J4PD 1OP4A 3VRIA 3ATFA 4S1RH 4ZMVA 4PRPD 4ZXBB 1G7PA 2WLLA 2EIMB 2EH7H 5DJ0A 4YXKL 4TOYH 5JHBA 2AC0A 1XGRA 5KSVA 5KUKA 2EUZA 1G7IB 3IK2A 1NPJA 2PW2A 2DLGA 2HX9A 3M8OH 5MP6L 4NNXB 4XNYL 5CKAA 1CDIA 5ANME 4Z3TA 1AIFB 3QIUC 1A7RH 2Y2WA 3KYMB 4Q74A 4Z3JA 2D2OA 4WWID 2KT6A 3CXHK 3IJEB 2Y5QA 2OZ4H 1WZAA 2J71A 3PJNA 2BXYA 2DLFL 4I18A 1FVCA 1YZZA 1WWCA 4BFRA 4UT6L 4RDQF 4XNAA 3WTSA 5CJOL 1MFUA 2QADC 2R39A 2BW5A 2H0FA 3T4AA 2IEPA 4FFWC 3MRBB 4G71B 4JQVA 4NIKB 1CR9H 4NZDA 3WKNA 1P4BL 1MCDA 1DVZA 5CIPA 2X6AA 3DX4A 4N8CL 4Z7NB 4LQ1A 4JRXA 3PHQB 3VW3L 2HXAA 4YO0A 3NFNB 1WFMA 2WLMA 4NWUH 3MACH 2FDBP 3Q8FA 5T1LA 2CJ3A 3KBEA 3MRGB 3C6EA 3ARZA 4APQD 1U0QA 1MCQA 1RZ7H 5HVFB 4E0RA 2JJVA 4JLRB 2Z4TA 4DKEH 1OSEA 5A6LA 1IGCH 1RHHA 5T5FL 2YEZA 1OIOA 5EDXA 1S78D 3V0EA 3K6SB 2V5TA 1G7HB 2DQTH 2HTKC 4LGPB 5CBAB 2BP0B 4KFZC 4MCYA 5HGHB 3IAGC 4Y1TA 4E68A 4G6JL 3BIKB 1S8DA 4UOW1 4P2RA 1I31A 3ZPDA 4JM4H 1E9QA 5KS9E 1E4XI 4M7LT 1ORSB 3ISWA 5KG9A 1X5YA 4YPGB 4UQCA 4HT1H 5DJAB 3FFDB 3I6LE 1OSYA 1EWHA 4ZFQA 1GYAA 3KMDA 3FTXA 2DWDB 3MCKA 5IFJB 5CR8A 3W39B 1SPDA 4TVPL 5EIQA 2QGCA 4MMXA 3LZQA 4GIPD 4G6FB 4UQBA 3MRDA 1OD7A 3MCG1 1MRFH 1HZHH 2FEDC 1K6QL 5FM5M 3ZTDC 3AGVA 2KL6A 3S36X 3I9GL 5CLZA 2G0LA 5TQ2H 1LNUA 1C12B 5MENB 4WGVB 3W5NA 4ODHL 4MDJB 3ME0A 3S2AA 3UFIA 1XH3A 5KVMC 2UY6A 2XTJB 5C2BH 2P45B 2Q3XA 1JNHA 5SV3A 1OAYL 4GAFB 1U3HA 1BJMA 1CDUA 1DDHB 3DTXB 1IBDA 3Q7JA 4YHZH 1U8OA 1VGEH 5FB8A 3S36H 3IJSA 3VXPB 3AXLB 4FFZH 5I1LB 5SX4H 1BECA 4PGCA 1FHGA 2EICA 3SYCA 3VX0A 3HOGA 3WUWG 1MHEB 5CEXA 2YD4A 2X2JA 3AAZA 3D30A 3V2AR 4ELME 1AP2A 3ZL4L 3F3HA 3QH3A 5I24A 1KLFA 3FQYA 4BXSV 4D9QD 5KAQF 1CDJA 2YD3A 1IAIL 1UXWB 3TYFB 3OXRA 4KQ3H 4Y2OB 2WLHA 2Y22A 1YRKA 5FOJA 1BQLL 5EO0A 1J9SA 2EINB 2LU4A 2DOCA 1BQHA 2JFCA 2C7FA 3H53A 2M2DA 5D2LF 3O11B 1QR1A 1T83C 3MRKB 4J8QA 3QCUL 5J12B 3W37A 1I8KB 2ZXBA 4AG4L 2WO4A 1SDDA 2I25N 2R2EB 4LO9A 4N2GA 3ULVC 3TEWA 1HEZB 3K8LA 2WLIA 3WS6A 5A2KH 3IXTA 4ZNEA 1IAKA 2AQ1A 4PJIF 5DTFB 3HN8A 1TPXB 2Z35A 2WTOA 1JWMB 5DJZB 4WFED 4PP1D 4OF8A 3OXSA 4M1DL 3RX7A 5IJCC 1KTCA 3DROB 5DJ6B 2Z31A 3PAVA 3QFJA 4LL9A 4POUB 1JZ4A 4FI7A 4WHTB 5FOBB 4FA8A 1NCCH 1U92A 3MROA 1RJZA 3FQTA 3IDYB 3HFFA 2B7DT 3PWLA 4YSQA 3PIQB 5BS0E 1XSIA 4N25A 3VFSB 4K15A 5DJYB 2NRDA 4JFQA 1RZKL 3VAEA 1J87A 2HMID 4ZK8A 1NBCA 2CALA 1JWUA 2WLKA 2VDNL 4MWFA 4PBWD 4EN3C 4I18C 3APNA 3LQAH 1XGUA 2R0WH 2CLZA 3UADA 2CCLA 5KSAC 2RIKA 3IU4H 1IGTB 5IR1B 3T4AC 1JFQH 2IAMA 4TTGA 4KOBA 2D7PA 3IMUA 3UPRA 1YDPA 4JFFE 3WI9A 2D7NA 2VAAA 3TO4D 3GWJA 1CTOA 4B3VA 1QFPA 1WIOA 1J86A 2LU3A 3VFGH 1KLGB 2GFBA 4JHWL 4PJ6A 3OB0K 4M56A 2HX8A 4OZGA 1QSFA 5CD3A 1E4KA 1DUZA 4KKLC 3L5WB 3WTTA 5ESVB 4D0CB 1MHCB 2NYKA 4OZFH 3EO0A 2FBJL 1OVZA 1MVUA 3KCPA 1TF4A 3OLGA 3LVEA 4QHNA 1LE9A 3UIYA 1FL6A 4OJCA 3FOLB 3WHXA 5K1JA 1L9OA 2PWDA 4OVUA 2JK5B 2EDRA 1NMAH 4XZUA 4GQ9L 4D9LH 4IK7A 3HG2A 1XMEB 5J13B 4TRPL 2J55A 3GJFK 3GSXA 3TBTA 2KDGA 4L29B 4EDXB 2YAHA 2AVFA 4LSUL 3SKMA 2YN3A 4X6CB 4AIEA 1N64H 1FYHB 2AJSL 3VFPB 1SUJA 1I7UB 2ATPA 1NGQL 1A7QH 1CLOH 1WZLA 2CO3A 1YY9D 4NN5C 1OHQA 3C6LD 4LKCB 3FJTA 3Q44A 2WIIB 5EB9A 5LGJB 1QASA 3WAJA 2UZXB 4K3EH 3KPRA 3P9LB 1NCGA 35C8L 1EH9A 1FDLL 1MCIA 2R23B 2W0LA 3TIDB 4NKMA 2DF3A 4YHKH 5EV7A 1ZT1A 3UX9B 2A6DB 1GGBL 5TE7H 2ZCKH 1AKPA 1UXSB 3G04A 1AR1C 4W9HC 4GRWB 1T66D 2V2WB 2EYSB 1K8DA 3ALPA 3CFTA 3LEXA 1I9RH 2OPCA 1IJ9A 4N85A 3E2HC 3NJMA 4UBDC 1H9VA 4U1LB 5C0AB 4KK6C 2ZG3A 5J1SC 1V5JA 2R2HB 3BUTA 3BUYB 4X9GA 3S37X 2WXFA 1QBML 3NIDB 1EHNA 3VGHA 3BRGC 2WVVB 1RZGB 5K9KA 3EYQD 4EPSA 1CL7L 1QSEB 2P7TA 3KJ4B 5EUOE 5KYNA 1C16B 1I1CA 4DUXA 5GZOD 2H1LM 2A9NL 1M2OA 3MRNA 5D1ZA 4O4YH 1A0QL 1KCWA 4MJ2A 1I8MB 1T1ZB 2BINA 4FFYL 4L8CB 3GK8H 3EW3B 3P9MB 3QEHB 2NMSA 1JGVH 5EOTA 4PVLA 1XAKA 2BIOA 4O5LH 3WE6B 3LIZL 4QHMA 5F7FA 1D9KD 1OK0A 2JCCF 3B5GA 1BQRA 5DSCA 4ZW8A 4A2FA 3KS0J 1YO4A 3BEWA 3RNQB 2QDWA 3QO1B 1A1NA 3WNJA 3DX1A 4PTUA 3R7RA 4KY1H 3IRZA 1UUNA 1U8KB 4MAUH 3SDXF 3KHQA 4KVNH 1R3KA 4PY8J 2I5YL 5FECB 3D7PA 4XB8A 3V0IA 5F9OL 5LNGA 5LBVA 1QATA 1MCWW 4KGJA 5E5RB 5IVOA 3FB7B 3VRJB 3AREB 3BLBA 5IT2L 4M00A 1U3YA 4HSQA 1LP9B 4JR9H 1HL5A 2BX5A 3SDCD 3CLFH 4XBEH 4U7SA 2UZYB 3L4XA 2AJVH 2BVQA 3QZPA 3U1SL 1VKXB 1EIBA 3BP7B 3UYRL 4XOCA 1E9OA 4MB5A 4LBEA 5KBKA 2R56L 3LMJL 3O6KL 4HIJA 4X4YA 4KROC 2QTEA 1E67A 2YK1H 3GSOA 3P0VL 3ZE2F 1F6AB 3Q05A 1J9RA 4ZS7H 3L4UA 4B9PA 5JNYB 3OJDA 5LNEA 3SGKA 1Z0NA 1T7XA 3U9UB 4J3UA 4XAWL 1JXGA 1NBVL 1YA5A 4R5VA 2EVJA 4WJKB 3OAWA 2DI9A 2CM5A 1LTXA 4PCKA 3J7HA 4PW4A 2P49B 1RUPH 4QTIH 1BVOA 1Z9SB 1N26A 2WGNB 1RY7B 4JY5H 3GRGA 3L48A 1OCWH 2E9JA 3LS4L 5EUKB 5BS0D 1NGWA 3QUXB 4NKDB 1K85A 3ARPA 1UHVA 1FH2A 3OL2A 4RDBA 2G2RB 1YUHB 4Y9GA 4FNLL 4X99B 3QIWA 3D85D 3K6FA 3S34L 3MR9A 3HPLB 5I8CA 1G5AA 2R2BA 3F01A 1HX0A 4JFPB 4MJ6B 4NDMA 5LDSA 1OAXH 1SEQH 5HHVL 1RIHH 5ISZB 2Z8RA 1A02N 1IFGA 1JXFA 1U8LB 3FQXA 4HPOH 5DFTA 2UWEB 4JFFD 4XXCA 4IRSB 4LFHG 4KTEL 5GJSH 4F9PC 5C0FB 1J1PH 4PP2B 2F18A 1TZIB 3SYPA 1KCUH 5EO1B 2GUOA 4PJBA 4HAGA 1BXUA 2FVNA 3RWGB 4CN4A 4TPRL 4ZAKA 1D2OA 4XBPB 4G7YH 3GS4A 3RUGA 4ZS6D 2VE6B 4Q8BA 1AI1H 2AK4A 1FNLA 2OSWA 2CDEB 2FX8H 1QLFB 3BQUB 3GYRA 1MJ8L 3K72B 3VXQB 4WO4A 4HXBH 5C08A 4Z8FL 2EYRB 1UADC 3GMOA 5E7BA 1N8ZA 1QNZL 1UB6B 2EDNA 3S3SA 4QRQA 1MJUH 2P8LB 3ARFD 1R5WA 4OM1H 4XMLL 3X2QB 3SBPA 2CMRH 1JMZA 2EE3A 4RFNB 2GCYB 4PG2A 5IMKB 3ULVH 2GYSA 2K0RA 4XVTH 1RZIB 5FYKU 3S7GA 3ZKND 4I8DA 2J57A 4QF1A 4P3CL 5ITBL 4M4PA 1NOLA 3D06A 2VDLL 1KIQB 5I1CH 5ECGA 4RA0C 1LJMA 4FADA 3WTWA 2X09A 4FQJL 2HLFC 2E75C 1OAKL 1RURL 3HG1B 1SM3H 3WFEH 3HR6A 4QXVA 4KJPD 2ZSWB 1ZLUK 4WK4B 3LN9A 4GSDH 1TSHA 2BS9A 3MLXL 3UBXA 2JKLA 1RXLA 4XBGA 4Z6AT 4N0UE 3IXAA 4LP4A 1H5BA 5IKCB 2DQDL 2OJEB 5JO5B 1I7ZA 3T1WA 3NABL 3ZUNC 1UEYA 4WW2A 4ONOA 3TEXA 5C6TL 3FUFA 3L5JA 3HNVH 1AGDB 1SOKA 2ED8A 3FUNA 4PG9A 2WANA 4ZRGA 1WBYB 2E56A 5AW5B 1NOFA 2JWYA 3CC5B 3TJEL 3BISA 2DQUH 1XF3A 5CIPH 1WT5C 2ITDA 3U4KA 3BVTA 4F37K 1HH6B 2PYEE 3VSUA 25C8H 4L8DB 4OGXH 1JPGB 2Z4QA 2C3VA 4LGSB 1QWNA 2E86A 4YAQA 2HH0L 2EVGA 3QQ3B 5I0ZA 4K9EC 1PJWA 1HL9A 2XKNB 4GW1B 1DBML 3DO4A 2H1XA 3TJHC 1QYGH 4K0OA 5FKAB 3L3IA 4AL8C 3ESPA 2Y5EA 5FLUA 4XGZB 2AK1H 3OMZA 4K8RD 1IBZA 1TKWA 5IG7B 3SGKC 5MEOA 1MAML 4KNQA 5D2NA 2X5PA 4XNQA 3OLDA 4TUKL 4UOJA 3HC4H 5TDPB 3TXAA 4OV6F 1WH0A 3ARDB 3BIBX 4QRSB 4X9YA 3V95A 1CU4H 3D9AL 3JWNE 1RPUA 3ZTNL 4ADJA 2DQGH 5HTSA 1A4JB 1E6JH 2XQBL 5DJ2A 2CJSA 3BKCL 3FO1A 3IGFA 3IJHA 3Q1SL 5F1SA 3QDJB 4GXUN 5HI5C 1YEJH 3H3PH 2DWYA 2B59A 1AGEB 1IQDB 4GIAA 3ESOA 1BLNB 4XC3H 2YAMA 4XNDA 4Y2NA 1L9NA 1QMUA 4KJWD 3V6OE 3SDDC 2BK8A 4OI8A 2NLJB 1HEHC 4ZPVB 2HLAA 4G9DB 3QORA 4G3YH 3PNWB 1BFTA 4G6KL 4WK0B 5MERA 4P4RA 1SN5A 3RWCB 1FN4B 3GI9H 1M71B 5HJGA 2D73A 5JXEC 2ROYA 3TURA 2VC2B 3H8NA 4JG9A 1JZ6A 4NN6B 3GNML 1NWPA 2OR8A 2QQLL 4F24A 4YVNA 1ND0A 1N5YH 2MFNA 4TUJA 2OM5A 2XZAH 5M95B 2AQSA 4PJHF 3PWJB 2RBLA 1PTZA 3RKPA 1UM5L 3QJFB 5FYKE 5DK3A 3E80A 5FM8A 5LHDA 1Q0XH 1ASOA 3QQNA 4EI5C 1X9RA 4WO4C 3HS0B 1NEZG 1TJGH 4WCYH 3PWPA 4PBXA 1IBGL 5C0ND 1CFMA 1GZQB 4C4UA 2RD0A 3A4EA 2WZ0A 3HBQA 3M46A 4UQAA 4MNHB 3FUEA 1GY1A 4TLUA 1SJEB 5F3FA 2CR0A 3IGAB 5T1MA 4ERSL 3LTVA 5IVXE 4KJYB 2DIJA 3V6FB 4YHNB 4OFIA 1FFOA 1KJVA 2YAEA 1BMWA 1HXMA 2XFXA 4UCFA 3TA3A 5KW9H 3P11H 5ITFB 2NY2D 3G5ZB 1YPZA 1O6SB 5G5DA 3UTTE 1GYVA 1OPGH 2VLRA 5TDOB 4GEIA 1YAIA 2LOEA 2XPYA 4WAFA 2PETA 1IARB 4RLDA 5DMKB 4JFUA 1JDDA 1IC1A 2PYFA 3L5HA 3L3JA 4FFTA 5DRZB 4L2YA 4HJGB 1QFWL 1PKQE 2G4GA 3GMNB 2ZNWA 4DP5X 5KVDH 1H5BC 1U8HA 2LTQC 3OKYA 4R26H 1Y6NR 1HINL 3CK0H 3O9WC 4A6YB 3S35L 4WW2C 2WZPA 2VO8A 1PG7W 2C1PB 4NRXB 3FBKA 4WVRA 2QKIB 1LYQA 1FNEB 4IK6A 1EAOA 2OJZH 1A7OH 4R4FL 4GI9A 4DKTA 2W95A 2YXFA 4MRCA 4U1JB 1IGFL 5L88L 3HB3B 2XBZA 5GGTH 3U30C 4CJ0A 3NGBB 4C47A 4JO4L 1EJOH 2YEQA 5ILTH 3IBOA 1NA8A 3ZYOA 1FNFA 1WUNT 3DPDA 1J11A 5DHXB 4G8IA 1JZGA 1PCSA 2A83A 2NY5C 4AVJA 4KAQH 1NZRA 4HK0B 3G9AB 1MDTA 3T5WA 5AALA 2WXGA 4E2OA 2DQFA 4U3SB 1SJHB 2C9SA 3MLYL 2I07B 2W60B 4N2CA 1J8HA 1PJ9A 5KZCB 3OKOB 5IF0A 1J1XL 2CD0A 2EVIA 5DQDL 1TZAA 3RGVD 2QHRL 1L3WA 2JKWA 2BVYA 3C2SA 1RULL 2CO1A 3LB6D 5BMFL 1MWAB 2WINA 4PRHB 3GF8A 3DVFA 4WI9A 1V7NL 2AJ3B 1IAIM 2PO6B 3ROOA 3U1QA 4XP4L 5A3IC 4JGNA 1PW3A 5FO8B 5DWUL 4JO2L 4I87A 4LASL 4E5XB 2DWEA 5JXAL 1TFHA 1PZ5B 3MUUA 2PYED 3T0EC 3GHBL 4LLVA 5L6YL 1HXYB 1JXJA 3FTYA 3B4NA 4FQQA 4HJSA 3H6AA 5DZNA 1GYUA 2FIKB 1THAA 3RWFA 2NY4D 4P23D 4GJTB 3U4AA 5FO9B 3GIZH 1ECZA 2BNQA 2NZ9D 3QORC 4ZZKA 4OCXH 1ACYL 1NEPA 1H15B 4B96A 1T1XB 2NSMA 5D1QC 1TZ8A 1T2QL 5ID1B 3ZZLA 4PVBA 4Y16C 2WCSA 2A73A 4XMXA 1XEDA 3FQWB 5IJBC 4K94H 2B3IA 3D52A 3VYOA 1YEHH 3D39A 3W56A 2K45A 4OGAD 4H25B 2NY7H