4B9FA

High resolution structure for family 3a carbohydrate binding module from the cipa scaffolding of clostridium thermocellum
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
NLKVEFYNSNPSDTTNSINPQFKVTNTGSSAIDLSKLTLRYYYTVDGQKDQTFWCDHAAIIGSNGSYNGITSNVKGTFVKMSSSTNNADTYLEISFTGGTLEPGAHVQIQGRFAKNDWSNYTQSNDYSFKSASQFVEWDQVTAYLNGVLVWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structure of the Family 3A Carbohydrate-Binding Module from the Mafor Scaffoldin Subunit Cipa of Clostridium Thermocellum
rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Sugar binding protein
molecule keywords CELLULOSOMAL-SCAFFOLDING PROTEIN A
total genus 35
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 4b9fA00
4C8XA 2L8AA 4B9PA 4B9FA 1JS4A 4B96A 1TF4A 1K72A 2YLKA 1G87A 3ZQXA 1NBCA 3TF4A 1KFGA 4B97A 3ZU8A 4TF4A 2WOBA 2XFGB 3ZUCA 2WO4A 4B9CA 1GA2A 2XBTA 3ZQWA 2WNXA 1G43A 4JO5A
chains in the Genus database with same CATH superfamily
1CGSH 1QOKA 3BEWB 3RDTD 4NO2A 5BO1H 4PJIA 5FECB 2F53A 5DQDL 5TDPA 2B4CL 2PTTA 1A14L 3FTUA 1B6DA 1S4IA 1OT2A 1OP4A 4F8QA 2FX9L 3NCYS 4WV1C 5F88B 4UZUA 1VZHA 4ZFOL 1PZDA 2OR9H 3LN9A 3PNWA 5CBAB 5FUOH 1NC2D 4UDTB 2YZ8A 3TWCH 5EN2A 3H9HA 1HJBC 1WWCA 3LVEA 5TFSH 1LO5A 4FQJL 2B9BA 4BM7A 4R7NA 2XTSA 4O2EA 3FT4A 4QXUL 1JNJA 4RDBA 9PCYA 1HHJA 3BUYB 4ANXA 1INDL 3U83A 4OZ4A 2YSTA 4MNHA 3TTSA 1MCHA 4ZUSA 2VE6A 4IU2A 4IEFB 3VFNA 2YPVA 3K6IA 4WWID 1Z5LB 3MPCA 5HVWA 1WBYA 1ZTXH 3KLHC 4P5MB 2GSIA 2BWDA 2WQVA 3HS0A 4AGNA 3GTVA 1X5LA 5AVVB 2R0LL 1FZJB 3IDIB 2DYRB 1KPVA 2C5DC 2ZOTA 1HJCA 4KOBA 4EEEA 4Z7IA 3JQOB 3DX9A 4UINL 4NQEB 5K1JA 2DQ6A 4QHKI 5LAPA 1NOAA 2BH0A 2WQWA 4XO3A 3UIYA 4P46D 3P4OA 3VTMA 4YLCA 2GPZA 4LCYB 3TA4D 1ZJBA 3LQAC 5KVFE 3QUKA 4OJAA 2AEWA 2VKXA 1B9ZA 1J8HA 2NMSA 3VG9C 1K6QH 1FDLL 4ADGA 1S6NA 4ORGB 5H37A 3QXDA 1QQDB 4NQCA 3H7BB 2OCJA 5HSFA 4MZIA 2HT2D 1DVXA 3HE7D 4HCGA 4UTAA 5I6LA 4TUJB 2IAMD 1B3IA 3NTCH 4IK6A 3IMSA 1JMZA 4B9IA 1R3JB 4JFPB 1OT4A 2FH6A 1Z9SA 2JJUA 5EZLA 4TOYH 4DO5A 4NQSA 3P73A 3SQOH 5F1IB 3D85D 4C57C 1R34A 4ENED 1N8OE 1D2PA 5IHZB 4WLCA 4UQAA 5DJ6A 1TU2A 3UDWC 2WZ6A 3IS1X 3DO7A 5B3JE 5I0YA 3DIVA 4XX5A 4GEJA 5IFHL 4QRAA 1YMHB 3K5SA 4JHWL 1Q0YH 2B9AA 2KUTA 2AZUA 3NPZB 4U3HA 3UTQA 5ANHA 1FO0B 3B7SA 1JI1A 1KBBA 2K9FB 2JELL 1P6FA 4GAJH 5GRYA 5CJ5A 1P4IH 1SVCP 2J8OA 2F1BA 1WHOA 4LCCC 1UOVA 4OV6F 3TBVB 1NGQH 4CDHA 4H20H 2Q5BA 2OTUA 5GZND 2L8AA 3JTTB 1P5VA 4JQXA 3QDMB 1G9MH 3B5HA 4XI5C 1B2YA 3VFWA 3GSQB 3WHXB 5D72L 1R0AH 4C4KO 3FB8A 1PNDA 1EPFA 1KJVA 1QSEA 2VDKL 1W8OA 2OMXA 2Y5TB 5FYJU 1YQVL 3V7MA 3MV7E 1N2RA 3HC3H 5F9JA 5KVDL 1NAKL 3WD5L 3T0EC 4X6FB 1HHJB 3OZKA 2VL4A 5D2NC 3I6LE 5MI0C 4OT1L 4LB8A 4UZGA 5DVLA 5DQ9B 4NIKB 4RWHA 4LSUH 3S8WA 1W2KT 3R1GH 4Z3TA 3GS4A 5BPPA 2EZ0D 2NW3B 4HYTB 3HZMB 4BZ1H 3RWJA 5CSBA 4XPHL 3KLAA 5FA4B 5CMAA 3N91A 3L2MA 1JS4A 2BIOA 1J05B 1UXWB 3H9SB 2MKWA 3RNKB 5B39B 4N2MA 3F6LA 3HB3B 1QP1A 1J11A 5CP3A 1EEYB 3IDMB 5DMYA 2OQJA 4N1CA 1KDIA 4Y1TA 1PG7H 1HCYA 3T08A 3BP5B 2ID5A 3WFBL 4ONGH 3MZGB 1MLBB 4FJ6A 3CX5K 1KGIA 3FT1A 3UAEA 2NNFA 4R3SB 3SKJH 4OF6A 3TJHD 4G7VL 4I18A 4IGBA 4ACTA 1Z3GH 1CDHA 3Q3GA 4QXGH 3OG6B 4L3FA 2ORBH 4N8CH 2DOCA 1H8OA 3MRIA 1M71B 2XG5A 3ZVVA 1IBBA 3KPLB 3FRUA 2X0WA 4K7PH 4ZX4A 2FL5A 1S7UB 2FBJL 1KG0A 3KE0A 2TRYA 2OK0L 1GXEA 2VM3A 1RURL 3KYKL 5IJVB 2ZXDA 4XPGL 3UAJC 5D7KE 4CSZA 3MOAH 4FE9A 4GMSL 4J3SA 4FQQB 1B2WL 2GTWA 2F5AL 1KN2L 2YBGA 3CXFA 3AREB 1LM8V 4I0PA 5GS1A 4N85A 3TEWA 3LN4A 2VMDA 2X0VA 3LVTA 3EOBB 2IOIA 2KZBA 2DQHH 3T8VA 3VXUD 2W9DH 4UV4L 5IW6A 1U8JB 4S11A 4S1RL 4P06A 2IPTL 4JL2A 2EDEA 5E5MA 3K7UA 3BKJL 4TV3A 2VLKD 5KG9A 3FN9A 2YD9A 4J2XA 1O7VA 3CC5B 4YUEL 5EPMB 5GGVH 2FNBA 3JT0A 1O9WA 3LD8B 5T3ZL 4AQEB 5ITFB 1KTBA 1AD9B 2WN2A 3GXUB 3MRDB 1BVNP 4PRHE 4NENA 4FXGB 3VD7A 3MRJB 2OMTA 2EDHA 3TO4B 4QHPA 4PP2B 2W59A 2VJ8A 4XT1C 3IAQA 2DBLH 2GTWB 4YZWA 2E27H 3L3IA 5TE4H 1IL1B 3ARGA 4OCRL 5C0FA 1AS8A 3LH2L 4WSKA 4JN2B 2CA4A 4IKNA 4PJBA 3S6CA 3HHMA 3BVXA 2VWEC 2C4FT 1WP6A 1JK9B 1Q9KA 5D8JH 3VE0B 3REWB 4GY4A 3MNDA 1DEDA 3VRJA 1U8OA 3RL2B 1MNNA 1A5FH 1EFXA 3SDXF 3HRZB 4XVSL 1HK6A 1YEDB 2P7TB 4EZLA 4WJG3 5IFJA 1S9YB 4NKDA 4ZDHA 3DV4A 3VMPA 1OOWA 3GKZA 3PWLB 5DQJA 5A2AA 5HI4D 1LDPL 3QUYB 3DETD 5DEFA 1MIEH 1BVLA 5JHLL 2Z31A 1XSJA 4IBLT 3QQ3B 4N87A 1B88A 5FYKE 1ETZB 3TURA 3T77B 3QUHA 2X4NA 2WSPA 3LRGA 5I26A 3HE6C 3L3OA 5T1DL 3EJPA 4GRWE 3AJ7A 1RZ8A 1I8IB 5ERWA 3LPGA 3P9LA 3UZVB 1ZT4A 1QATA 1HAWA 3GMPA 2MNWA 4F9PA 1RULH 1WGVA 4C56A 1CVSC 4FG2A 4M02A 3SKOA 1R9FA 4MJ6A 3INUL 2XTJB 4X4YB 4PVNA 3VGAB 3CN0A 3QW9A 4ORGA 3ZZQA 1QLEB 5E9AA 2A0LD 2ESVB 5J13C 2NCEA 1MFNA 2Q3AA 5C0IB 3B9AA 4FFYA 4DK3A 5DU7A 2BSED 3LV3B 2ATKB 3BUPA 3M8OH 2GK2A 5B7MA 1XB8A 2JWYA 4PJ8C 4F58H 1JERA 2JK5B 4OIFA 4DT2A 1CL7H 2VABB 3ARTA 3MFFA 5DEJA 4OIBA 4EZJA 3OKOA 3TVMA 4E9VA 2BWQA 2B5IB 3HFML 5IMKB 5KSAC 3HG1A 2PMZA 3F7YB 3IXAB 5FYLH 3WE6A 3X14A 1KXTA 1YC7A 3UTSA 1AI1H 4RA0C 4BRVA 5JA9A 2WBJB 2DJ4A 1PVHA 1ZMYA 1CGXA 5FM5O 1QFUH 3WLBA 3KW8A 4MA8H 4NUPA 4IOIB 4YXHH 4UQ2B 4AKQA 4UI2A 1A65A 4IRJD 4HCRH 5H94B 4GXVH 5AG9A 2AXJA 1KTLB 1BJ1J 2BRQA 5JPNA 1HQRA 3M1OA 1C1EH 3PWUB 2GSGA 3IMTA 2M1KA 2DQCL 1I7UA 3S37L 3EFFB 5HHVL 4L1BA 4BSVA 3PE9A 4AYFB 1JPSL 3FFOA 5C0EB 1IRAY 5I71B 1NANI 3BD5A 4NO0D 3MLYH 4PJAF 4G80B 5LWYL 4ZFOA 4UOW1 1R17A 4D9QD 2WK2A 3FOLB 4OZHF 3AS1A 3IJHA 3CMOH 4WFGE 2GUOA 3LOWA 3P9MB 4Y1AA 3X3GH 3NIDF 1NDGB 2GBUA 2O6CA 3D6GA 4ODHH 5BOJA 3HA0A 3DURB 1CF8H 3O45A 3VJ6A 1RJCA 3A24A 1RZFL 4FTVE 3IF1A 5DQJB 4RWYL 2IPKB 1I8UA 4H5SA 1UM5H 1ZHLB 5GRJH 4E36A 2MPVA 2JJSC 2H8PA 3EH2A 4MA7H 5I1LA 2DL2A 2YXVA 1P2CB 4UT6L 4RX4A 3VWKC 1Q94A 5GZOC 1R75A 5TDOA 4EUPA 3ESUF 3KS0J 3UTTB 1JV2A 1SJVA 5GIRA 2HG0A 4P2CG 4NPKA 1QSFE 1D6EA 3L4UA 4HQQH 5EU6A 2E9BA 2MQ3A 4XRCB 4H25B 4A66A 1FNGA 3TEXA 4PJ9D 3OKLA 4AMKL 1JF1B 3MREB 2FQFA 1BVKB 5BRZA 3RVTD 5L0QC 2Y6SD 4JZNA 2PXYD 4LAJH 4G80A 4ZUTA 1MVYA 1GOFA 1F1DA 2GCYA 4DK5A 5IFAH 4XHJD 2P48B 5JHDA 1ACZA 2P4AB 3S96A 4WEEA 1I8KA 3BT0A 4FTVA 4WJ5B 5DVMA 3WBDA 3SE8H 4F7MB 2HT3C 3AAZA 4G6MH 5EO0A 4ONHA 4H0GA 4C58B 2AK1L 5I8KL 5ID1B 4LKXA 4GAFB 4CL7A 4HIIA 4IGBD 2O1AA 2D73A 2F74B 2R39A 4PJIB 3BX7C 5FECA 1IIKA 3FQRA 4IOIA 2HJLA 1U8QB 3HW7A 4XX1E 5AB0A 3EOBA 2PTVA 5GGVY 1IBZA 4R4BA 1CVRA 3H55A 2EYRB 5EZIL 1FCGA 1G5AA 3HUJA 4HMDA 3X17A 1CLZL 1JZ5A 2IV9A 4OCXL 1MFMA 2GFBA 1M3JA 2PPDA 4W9JC 4JGJA 4B9PA 2G60H 1WBXB 2QT6A 2ALAA 3JV6A 4GXUM 2OZ4L 3RNQB 5IHUL 3N50A 3ARFD 5IQOA 3HB3C 4N8CL 1JXGA 1NCGA 1V7NH 3KR3L 3L16A 4G72B 4LASH 4M7LH 5I0ZA 3PREA 4AQAA 3KS0H 4OLXH 2KMWA 3CFUA 3GSNH 4MAYA 3I6LD 1SYVB 1PLCA 2F68X 2NDFA 3T4YA 5TQ0H 5B7FA 2DY2A 4DP7X 2PR4H 4MD4B 4P2OD 3WXVL 1NPJA 3KYOB 1S9XA 4B5ZA 4R8WL 1XR8B 1TTBA 3B1TA 3DVGB 1D7CA 1P7KA 4WFFD 3RTLA 5HYJD 4NKIL 3O3DB 5KJRH 2H3NB 2IDUA 4BZ2H 1TENA 5FGCE 3NDZE 4IM8A 2CHZA 3QJQB 4XBEL 5MP6H 1WTLA 4NZ8A 1OGTB 1U58B 1XR9B 2FUTA 4MSWB 1RIUH 1OB1A 4M8QA 1MNUL 1AACA 4NC0B 4PS3A 4JFQB 2HVJA 5C09A 4YDJA 3CD4A 1RI8A 3HKZA 1Y6KR 1Y7VA 2IVFC 4KUZH 5HVHC 3T3ME 4ABWA 3R1GL 3HZYB 4IBUA 5LXGL 1BEYH 4QHMA 2OKMA 3GJFB 4IBYA 3CSGA 3DARA 3FHAA 5CSZA 1RZPA 2WLIB 4KKNA 1UZ8A 4OM0L 3HG3A 4HWBH 1TXKA 1B4LA 4OCYH 5DWUH 1P7QB 5KYXA 4K3EH 3DSFH 1Y1UA 3DGGA 4OZFA 4F33B 1JHKH 2EH7L 5F3BB 3QB7C 3RILA 1KXTB 4NZTL 3TLRA 3IDNA 1KCRL 5AOIA 1ZGLM 1NBVL 5CBEB 5CEYB 1GRWA 4FLSA 3L3HA 4EDWL 2VLJD 2ZYHA 5I1EH 1ZPLA 1X5FA 4ZW7A 3TA3A 2WUBH 1DBMH 1WF5A 2I25N 3FOMB 5CZVH 1R4XA 1ID5I 4YSRA 4H40A 1QKZL 5F3HA 1K8IB 2NYKA 4LP5A 1I7RB 4CDGC 2F7PA 3VCLB 5I1DA 3QCVL 5AVTB 1YO4A 5K59E 4DKFL 4NUJB 3EF4A 2APVA 1HSBA 3NIGB 1KIPA 3VX1A 2KERA 2W5PA 1BM7A 1G1CA 1N4XH 3EUUA 1S9VB 1PX4A 4J3OG 5BZWB 4MMXB 4BZ1A 1AZZC 2WIMA 4JFDB 1JYNA 2LU4A 2WXOA 2Z31C 3IE9A 4TOYL 3EZ8A 2X6UA 3MRKA 5ITBL 2BCMA 4WTZG 3PWVA 5IOKA 4XVJL 4BQBA 3PHOA 4Z9KB 3AQDA 4JUSA 1O7SA 1OAUL 4XN8A 1RJYA 1T66D 4S1DC 2FWUA 3BHBB 4DGIH 3C08L 3SJVE 3DETC 2R7EA 2YA2A 3MBWA 3NPSB 4RIRA 5C09D 2FEDC 2J1ZA 4X7SL 2AGJL 4HVBA 1R5VA 4K3EL 4KO7A 4D8PB 1FLRH 5H4YA 3ZN6A 3OX8A 3ZMRA 4MXQC 4I0PB 4WI5A 4KKZA 1BX2A 2D7TL 3Q9QA 2IH9A 2F9BT 4G6AC 3MBED 4MNGB 2EO1A 3V0HA 3IBOA 1S7RB 2O61A 3UTSD 1L9TA 2X2IA 1E42A 1KT2B 2WO2B 3NFPA 5J7CC 3TIEA 4PRDB 1G1YA 1HXKA 2VC2B 4UTBL 1HCVA 1RJLB 5A2JH 3JTSB 2ICEB 2NR6C 4XCCL 4KMQA 3NAAH 3DK2A 1FIEA 2ATPB 1XD0A 4X6DB 2VGLM 4HEMA 4EJ1C 4A38A 1KB5H 5C0BB 4WGVB 5EU3A 3S2AA 2A77H 4BXVA 3R0NA 3T2OA 2I9LB 5KBLA 1R24B 2ENQA 5F7WC 3UO1H 2PR4L 3D34A 1DJXA 2VE6B 1N3NA 3MRQB 1LWRA 2I9TA 1WPCA 1YMHA 2CBPA 5CJBA 4AYGA 3O3AA 4HGMA 1E5AA 2J6EH 1T21A 4KKAC 2PWFA 2IGTA 3IGAA 4LASL 1ACYL 1TYJA 5HGBB 2I60H 2FX9H 3SE9L 5FCUH 1WWAX 1UYWH 3PAYA 5SX4I 2XXMB 2DLGA 3WJJC 4PWKA 4EUPG 5JDSB 1FPTL 1YY8B 2V8LA 4R84A 4AJVA 4ELMB 3DX3A 5L8KB 2B1OA 1NEUA 5EZIH 5F44A 1FSKB 4CW1B 1T20B 4CRPA 2G4GA 2Y7NA 2HFFB 4E42A 1DUYA 4OZIE 1PD0A 2X09A 1FE8H 4PBDA 2JI2A 3ECWA 2VZ1A 3VXSA 4ESKA 3VXPA 4J3OH 4P2YA 1XL6A 3ZKXC 1FYTB 2OSLA 4X5XA 2HYMA 1LE5A 2OMBA 5HHQB 4YFDB 2FB4H 4PWEA 1P1VA 2BY1A 4X50A 4ZZFA 5D1XA 1T6WA 4LPTA 4BHUI 2DWEB 5C0GA 4HMEA 1B0GA 3LDBC 4F3FB 4Y9BA 2PLTA 3RIFF 4F8NA 5GZOA 2I9LA 4EIGB 1T2QH 3MRFB 1QA9B 1KELL 4D8OA 4IRSA 2ROYA 3TBVA 3FQTB 5E51A 1X9LA 3LHPH 4HKBA 1P5UC 2RR3A 2P8PB 2CHDA 3NRPA 1XH3B 5K33A 3VXMB 5AAPA 4ZS7H 2Q10A 2XNAA 4RZKA 3UTQB 1GSMA 1AY1H 3NA9L 2CLRB 4F7TA 1SY6A 4NERA 1FORH 2XKUA 3V4PL 5DK2A 2E5EA 1DDHB 1XGUB 1A25A 4J28A 5E2TL 5LGHH 3JWNH 4ZMLA 1UOKA 2DMBA 1SGKA 4QRBA 1UM5L 5GRJL 3EW3B 2R0KL 3WHE0 5ANMB 4ZTPH 3IDJA 1W8NA 3ZZLA 1CK0H 2ERJC 3OPZH 3BZFA 3E80A 4IQHA 1FFNA 2WVSA 1AZVA 5TK4A 1WT5C 1T7ZA 4HZLB 2IH1A 1O9VA 2KDGA 9CGTA 1SBSL 1DCLA 1JGIA 3PHOB 5B3JF 3O2VH 3NQKA 4M1CD 4OZHE 1KB3A 1MVFA 3MLTB 3EJYD 5T5NG 4A6YH 3FMGL 5HJ3A 1JZ6A 2P1YA 3HMWL 1F3JB 5EEWA 3A6OA 4JDTH 4NQQA 3FF8A 1BGXL 1TJMA 4LNRB 3LB6D 4AEIH 1HE7A 1NCNA 5DK2B 2EC8A 2F5BL 1VIWA 4TRPH 1A4BA 3GK8L 2H6UA 5EBWA 2FWSA 3PP3K 5F6HI 3ZE0E 1W0YT 2I60L 4PRBB 5BV7C 5I5RA 3VXMA 1XGTB 5EBMA 2HRPH 5D1ZC 2FWLB 5AB1A 2FLBT 4PG9B 3S0PA 5AZEL 2QKIC 3F83A 4XBPB 4CGTA 1I9JH 1FZOA 5ESAB 1M7UA 5JTWA 1BZ9A 1TETH 3TN0C 2XZCH 3FSZA 3K74B 4OLVL 1K8IA 4WNJA 1RUKH 4F33A 1KJMB 3X3FL 2VXVL 4NXSA 4HDIA 3IFOA 1YJDL 3MX0B 2H26A 3JV5A 5DA4A 2AXFB 3L3HB 1BQHA 1UGNA 2EE0A 2MSPA 4KXZI 4O02H 5D2NA 4R7NB 4N8VG 2WKOA 4N8VB 1O5DT 2R23B 4XCCH 3SDXB 5IW1A 4TXVB 3GXTA 3AT8A 1O7DE 5D7JA 4WWOA 3S4SA 5AG8A 1IGIL 2APBA 2K8MA 1J12A 4HS6A 5DI8A 1V10A 4HZLA 3S5LB 3HMWH 3CZKA 2I24N 3ARZA 1DHKA 4DEPB 5IMMB 5FGSA 4FXTA 3HZVA 2NXYB 2WNGA 2Q2LA 4J4PD 3SDCA 2Z7YA 2LAAA 3K6FA 3VGHA 4NQXB 4N8VA 2Z6FA 3OWEA 3ETBF 2VO5A 2LTQB 1SHMA 3NSFA 4MDIA 4R96B 3ZR6A 1VFAB 3CWGA 4GMTL 3WE1A 1ZXQA 3DHUA 4XN5A 2VMCA 2ZAGA 3ETTA 4ODUA 4G42B 3QIBC 2BY2A 1XDTT 1CE6B 5AVRB 3E6FA 1LNUA 4ABUA 3WYRA 1HH9A 4OD3H 4XO5A 4AEFA 4MZ2A 1SBBA 4H8HA 3UXFA 3C8DA 1H8NA 4JPKH 4B7IA 1M6UA 2GAZB 1UWXH 4HHAB 3TA3C 3T4AA 4B9YA 3GSXB 5HI4C 4ZMPA 5E99H 5KW9H 5T1LD 5DLMH 3DBSA 3AU0A 4J3TA 2DDQH 3B8SA 4X8CA 3BD4A 3T0DA 2XPGA 3P3YA 1CTNA 1ZLVH 3N9GL 3GBNL 1FNSL 2Y6TE 3EDKA 3JTBA 1D3CA 2PYEA 4PS4L 2CZNA 4G5AA 1L6PA 1TO5A 4JPWH 5D7SL 1WZ1L 3VXPB 1A6WL 1ZV2A 4U7SA 1N5AB 3CFCH 5C6PB 2C3VA 5DD5H 4JQVC 2OFQA 3FUJA 5CZVL 5T1MA 3TONA 2JB5L 4AIXA 1G7HA 4PY7B 4HUWB 3U1QA 1OPGH 2DIEA 2BP3A 2XWTB 5J3HD 1X5ZA 4IU3A 2BM3A 3OB0H 1X9RA 5E9DE 1QBMH 2F7OA 5I75C 1ZTMA 5E1AA 3ATEA 2CCWA 4J23A 2Y7MA 4B50A 5JYMA 4YLQT 4YC2B 3O0RL 4ISVA 3BKJH 3SDYL 4F37F 3B2MA 1CFNA 2ZKXA 3S35X 2E9WA 1GIGL 2P3YA 8FABA 1GW0A 1SJEA 4S1RH 2BFGA 2X9WA 4NQDE 1W15A 4K94H 2ZYSA 2VLJB 5HD8C 1NGYA 4HC1H 4N0RA 4PLKD 1ZHLA 1P4BL 1Q0EA 1D9KB 4X0KA 4F27A 4MYPA 2F5AH 2W07B 5F7UA 2HVKA 3WJLA 1U91B 1E2ZA 3DC0A 3NFPB 5TQ0L 1XF2B 4FQLL 3M86A 4N9GB 3FH7A 2GABA 5GGQH 3DURA 4NJAH 3UGUA 2XQYG 3OXRB 4M1GL 2NNAB 3MI6A 2NYYD 1KGUA 2BHYA 1N64L 4GW4B 1V5JA 4IDJH 4KXZH 3KG5A 5FHAL 2XG4B 2R27A 2XN9D 3VYPA 3EHBB 3C60D 1HC1A 2N01B 4TNVK 2ZAIA 4NDMA 3QHZL 3MU3A 1FBIL 4ZT1A 2B1AH 5T1MB 1K4DB 3TO4D 2ZOKB 3WJJA 1OV8A 5E8DL 3QO0B 2R2CA 1JIBA 4BELD 2BDNH 2H45A 3EO9L 1SHWA 2IPUG 4G6ML 1NCCH 5HHMB 4ALAL 2CRYA 1FNGB 3S48A 4M00A 4AE0A 3IU3B 4NSKA 5C86A 2IGFH 4AC4A 1X4ZA 3ZMNA 2OTWB 5I16A 1I8MB 4OTXL 4OZGA 4XPHH 3D3VD 4ATWA 4WU7B 2XIDA 4OF3A 5D5MB 1HOCB 4PJCA 4FFYL 5GGSB 2FHCA 4M5YL 1A6ZA 4KZDL 4KNQA 1I3GL 5T5FA 1OOAA 1UM6L 4B60A 1VACA 1D5BB 3QDME 2NY6D 4GLRH 1XB3A 4DKDC 1WBZB 4KTDL 2H7WA 3AROA 3D2UA 3L4WA 5KVDH 3FSAA 3WNOA 3QXTA 3IBEA 2ZD0A 2PW1A 2XYCA 4KXCA 4GSDH 3KH3A 2R2EB 2EYRA 3AABA 2VLKB 2A6KB 3BH8B 4KVPA 5D7JC 4G8GA 1FRGH 2J2ZA 1KOAA 1KNOB 4UT9H 3BH9A 3QJRB 1WYJA 3WG7B 4NZTH 4GAJL 4DW2L 5EZOL 3TNNB 3RVVD 3QQXA 4P9HC 1ZK9A 3ZTCC 2LAGB 4Q0XL 4WRLA 2YRPA 5FX3A 4LPYA 1QZ1A 5J11B 2XETA 3L3OB 2R69A 3CFQA 2WBJC 4OM0H 3QDJD 3TCTA 3MRKB 5EV7A 3WDHA 2VDML 4A6YA 5EO1A 3V4PB 2WJ7A 4YSSA 2EP6A 1BVKA 4FQ1H 3WEOA 4G9DA 2FJHB 3BKML 3P1VA 2Z4TA 1Q0XL 3HB3D 4JL1A 5ADPL 4NEHB 4A7GF 2WLLB 4XNUH 1VB9A 3E6HB 1IZKA 3F01A 4FMFA 5JIIA 5AOMA 4AUJA 1CGTA 5MENA 4EN2A 4Z3IA 1Q9KB 2E7CA 1KLUB 3B34A 2AEPL 4K8RH 3F85A 4ZPVA 4TLKA 5KJRL 4JN1H 3EYUL 5DJ2B 5TE6H 2Y5EA 1JZIA 5H4ZA 2WM0A 1YECL 5F3HB 2O6FA 1F4XL 3E38A 4RLDA 2X40A 2EACA 4ECNA 2PPEA 4FD0A 2YBRA 4FQXD 4NHCH 2UXVA 2H3KA 1SY6H 3BRDA 2ZUSA 1ZA3A 4LVEA 5E9DB 3UJIH 4ZXBB 5C0FB 3QUMB 3UO8B 1R3LA 4XC3L 2ZOWA 3BIAX 4NNXA 4BKSC 3VMNA 1IKFH 2FJHA 5AKSA 2QSVA 3P9WB 5B1JA 5C6TL 2DEXX 4OIIL 4HXAH 2G30A 3CK0L 4W93A 4LCWB 5F0MB 2WXJA 3UBXB 3ZOAA 3FF7A 3A3YB 3L95A 1IFGA 3EYQD 4YDKL 5KJ4A 2VWEE 3H9YA 3HNSL 1EAPA 3QRLA 1AXIB 4H7VA 4NN6C 2D8KA 2I7SA 4Q6KA 4TF4A 4ELDA 1NMBH 1G9HA 2DQIL 4RGNC 5JPNB 2C9UA 2PCYA 1AYOA 3DNKA 1DQJA 4JK0D 3H7LA 4TLTA 1E90A 2B20A 4U1GB 1PKQE 1TEGA 5EIIG 2Z8VC 1KXHA 2G9KA 3VWJA 2RQEA 2AV1B 2UZPA 1IV8A 4TKWA 4FQ2H 4XCEA 3FQWB 5ICUA 1HNGA 1XGYH 5MEQB 4GAYA 1P69B 5I5MA 3QH3A 4GQZA 1PS3A 1SUJA 3DX8A 2WWMD 1W0VB 3NUKA 4L1HA 3NFNB 4Q58C 3OHMB 4AQ1C 3BN9C 2N0KA 5JHLH 3DI2B 1QFWI 4RZCA 4JRWA 1UWGL 5EU4B 4XWOD 4Y16B 4TQEL 3ULVD 1L7IH 1P2CA 4HPYL 3DTXB 1JNLH 3H56A 2Z31D 3JV0A 4Z7WA 1G94A 4YSDA 1JNNL 3RY4A 4KVCL 1NCWL 3PWNA 1IL1A 4R2GD 1A5FL 4ZRGA 1ZE3H 1F90L 3CSTA 4MA7L 3DYPA 2CMRH 4LVNB 2IPUK 3IMBA 1CURA 3S3DB 4WUKL 1F1GA 2IV8A 4K0OA 3FN0L 2R2HB 5C08E 1T5KA 2YEZB 2ZOOA 1EBAA 3BN3B 4Y2DD 1DQTA 3SPVA 2ZXGA 5HI5C 4PJ7B 5EUKB 1Z0NA 4PJCF 2YK1H 3KLAB 5FM8A 5GGRA 1HYSD 4LPVA 4N1HB 3IDJB 4OQTH 5LN4A 1A4JB 1F6LL 4Y4KA 1A66A 3KLSA 2PF6A 2O5ZL 3ARDD 3SDXA 2VB5A 5DK0B 4TVPE 4ANVA 5IM7B 1TFPA 4G7YH 3K3QA 3MLYL 4PD4J 4IBVA 3OG4B 2OCCB 3MX0A 2DLFL 4OGAC 5T1LB 2X4UB 4RRPA 4WO4C 5EF0A 2A38A 3ALPA 4YXLH 1EZSA 2D0HA 1R3KB 3CHOA 2P5WA 5AW8B 2FDBP 5IVNA 3AQZA 2C1OA 4HCRL 4NWTL 1SQMA 2YO3A 4ZFZB 1A6UL 3RKPA 3AQYA 4HWEH 4X9IA 4EUPB 1H0DB 1UD5A 3V55A 5C0RH 4B0MM 1BP3B 4XGZA 3KWXA 3T2LA 3K4AA 1NUNB 5FKAA 1OP5H 3DO4A 2V7NB 3BZ4B 4Y2DA 1DZBA 3IVKB 4Y16D 1GOHA 4P3DB 3GZPA 4ZUVB 5EH1A 3MOAL 5FFGA 1E2VA 3W11D 2VDOH 2E8YA 4S0SD 3PQYB 4QXTB 3WY2A 4PRAB 1WTGT 2BVPA 4WWNA 4ELKA 1WIOA 2WLKA 3NSXA 4LE8A 4PJHB 4HALA 4X6CB 5D70L 1EV2E 5F7AA 1HHGB 5H8DA 3UH8A 2B59B 5DHDA 2KKQA 3EBGA 1OXYA 3NIGF 3A4FA 3V4VL 4N6QA 2UXFA 2DKSA 4QXGL 3STLB 2ODIA 4F93B 4L5FE 4QI3A 4YHMH 1QNIA 1XH2A 5D1XE 1OSEA 3N0AA 1ORSA 3SKJL 1C8PA 4OV5B 1R5WA 1MIML 3QWRD 3KYAA 2ZX8A 8PAZA 1IFHH 1D5IH 1NGPH 4JY4A 4AJYV 2GTZB 2NX5A 4TM9A 4NP4H 4FKKA 5J1AA 3KXFB 1IGFL 2PR9A 4Y4KD 1A4KB 4X6EA 2O5NA 3GMLA 3LZFL 5IQ7H 4HWBA 3OTTA 1RP8A 3IGKA 3CHRA 5JW3L 1QSVA 1CG9A 1BVZA 1XIWB 1TTAA 2CR0A 3RE0A 3NZSA 4JO4L 3L3DB 5CR1A 1RK0B 2OP4L 3W56A 1RFDL 4OUOA 1MWAB 3OHXB 1T22B 1B0WA 3MJ6A 5AW3B 2FIKB 3NPSC 1BFOA 1CICA 3DRTB 1R3IH 1LK2A 2DWEA 4NFDA 3CFIC 3ZDYE 3REWA 4AT6A 1P5VB 2DL9A 3IDIA 1MCBA 1PU0A 4OZ4B 4P3CL 4L8BA 4L37A 4ZFZA 1HL9A 2V7HA 1C5DB 3GSVA 1AQMA 4BZ2A 3KPLA 3DUUB 4GRLB 1QFWH 3LIZH 2DS4A 1F2XK 3Q5OA 3RVXD 4PJHF 4DUVA 2X44D 1YQ2A 1QSFB 1XIWA 4WGKA 1CD1A 1J5HA 2DI9A 5AYQA 2YSSB 2QLYA 1IAMA 4YHML 2HMIC 3IFNL 4QD2E 1NGQL 2X1PA 4MNQD 2VSMB 4PW4A 5F9WB 1KZYA 1CFSA 3R06B 2I69A 5BV7L 4BD4A 3KM1A 1GYAA 4Z3GA 3ISYA 4O4YH 5IB4A 4ZK8A 2BVTA 3WGUB 2AEIT 1U8MA 4L8DA 5IR1A 1ZGLP 4KJYB 3GI9H 3FO1A 3SPGA 1RKRA 4HW6A 1PMYA 3WO4C 4JFEB 4FL4C 3VFRB 3EJYC 5B39A 1ZLUK 5GS1C 2GK0B 1EVTC 2N7SA 3GBEA 3GJFK 4N0YH 4Y4HB 1EUTA 1YZZA 5GGVL 4EI5D 1H9DA 3GFUA 1VFBB 4NHUA 1X5YA 1HSAB 4PJ5D 4AQ8C 4LSTH 4AEEA 4PRAA 5E4EC 2OXGA 1X5IA 2J4WH 2R69H 1RH8A 5BZWA 2DWDB 4PBVC 4P2OC 1QSFA 1VLXA 2XZQH 5HI3D 4ZUVA 4UQBA 3H9SE 5C3IA 2A1WH 2OI9C 2X5PA 1KFAL 3AMLA 3MBXL 4J3WA 4MJ5A 1IEBB 4L8BB 4L37B 4AQ1A 2CO3A 2V5SA 5DRNB 1AYRA 3S5LG 5J13B 4O00A 1VENA 4WHTA 1A7NH 1B2WH 2GC4C 2XFXB 4XMLH 3CNKA 4H4NA 3MHZA 2BRRL 1RZIB 2VM9A 3BKCH 2FL5B 2EE3A 3GSQA 4KRPD 3MCKB 4LPXA 4X7DC 4BWTA 5BOPA 2ZF8A 5C3LD 1N59B 1RZGA 2RBLA 3PGFL 4K8RD 5I2IA 3V5KA 4WFHD 3MRNA 2NCMA 1UCBH 1U2HA 4OJFH 4ZAKB 2B0SL 2YMXH 1JGVH 4P9MH 3MJ7B 3C8KA 3O4LE 4M7KL 4R0LB 1DVSA 1TIUA 1EX0A 2X4UA 3CFMA 3AVEA 5T3XL 1Z3GL 1I4FB 1WRFA 2C7UA 1OIOA 3BHBA 1KBGH 1OARL 1PTZA 4R90L 3KNBB 5KVGL 3P54A 4YDVB 3KM2A 4O2CA 4FDWA 3WY4A 5EORH 1P5UB 3CH8A 1F58L 3BIKA 1R3HA 3NK4A 4HKZA 4K2UH 1UXWA 3H9SA 3UJTL 2YJQA 4XZUB 3LPPA 3PWVB 4XVUD 1ND0B 4HF5H 5EZLB 1A6VL 1FFOB 2CNYA 5I28A 4HK3N 4RMRA 5GGSY 3HZMA 2B15A 2F53B 5E4IA 5T1KA 1VEPA 4JREB 1DE4A 3CZNA 2DJMA 1KCSL 4AL8H 3OKLB 1J0KA 1TZGH 2VLKA 1KLFB 3GQFA 2KL6A 1Q9WB 5DJDA 3APFA 1T1WB 3VGDA 4YAQA 2IBZY 3US9A 4C55A 1UKQA 5DMGD 5DJCA 5BRPA 1K72A 5LHDA 3DX9B 1KYUA 2HLFD 4AYID 5KUKA 1NAKH 2BVUA 1CXEA 1YEEL 1JWSB 4HHGA 3UBFA 4KDTC 3WNNA 1GPOH 3IXTA 5AD0B 4GG6A 5KBKA 3NRQA 4ZNEE 4GAYB 3T8MA 3KPSE 4U49A 1YRKA 1CD0A 2HTKD 3E9UA 5HBBA 3FCUB 5LGYA 4K5PA 1O9ZA 4RAVA 1INEH 1I9IL 3DVIA 1UZ6F 3O6MH 1ADWA 4OFQA 4TMPA 2MCAA 3MNVA 2JB6A 4HJTA 4MCZB 4DFIA 4D9RD 3ARGC 1AP2A 5A2FA 5C0AB 2VCOA 2A9DA 3B6SA 4DUXA 4X0NA 2PYFA 4JE4B 2HLAA 4U3XA 2ZX7A 3G6JF 3UOAB 1R5IB 2NSMA 5C07B 3DTUB 3P0VH 3OXSB 5TF0A 5CMAB 2VQ1B 2VAAA 3DBXB 4UAOC 4WW1A 3RGVB 1G7JB 3U7YH 4OJFL 1GZPA 1WAPA 3WN5A 2GY5A 3V4VA 1AR1D 1EMTL 3NIDE 4K3DL 3PGFH 3QIBA 3TBWB 2WANA 5GSVA 3K0YA 2DICA 4LOEA 5TDNB 5HHXL 2YXFA 1J10A 1J1PH 4PRPB 1KCUL 4NNXB 5SWSA 3DUUA 5K9OA 5I0WA 4LVHC 4JZJB 1ZANH 4XN9A 1ET7A 3PWPD 2ZUVA 4E9WA 1PFOA 1T0MA 2ICWA 4K94C 4M3HA 1CFQB 1PLBA 5FR3A 2XQBL 1NIAA 4WEUD 2AKRA 4QRUB 2YWYA 4DVRL 1MPAL 4J8RB 5DR5H 3GS7A 4TUOA 1CYWA 1Q9OA 2IQ9H 3C5ZC 4BK5A 3UABA 3LJ3A 4X6DE 1YN7A 4HJGB 4MQSB 3CZUB 4UDUB 4KKQA 1WV7T 3QQNA 1A4KA 5I19L 1CFNB 1ULVA 2ITFA 3LZLA 3DPDA 3M7FB 5E1QA 2H47C 2QPFA 4UNIA 5BQ7A 3UG5A 3QIBB 1SUHA 3TBWA 1JWMB 1QFWM 1ZWIA 4QWWC 3BIBX 2NNXA 4PJDB 3AB0C 5CIPB 1RZJL 5SV4A 1KBVA 3BGMA 4JGMA 2DYPB 5IB1A 4N22A 3K1DA 3T6VA 4QXUH 5ICXB 4UQIM 2AJUH 3FU0A 2QKIA 2OULB 3AQXA 4V11A 2R1WA 1XH1A 2TAAA 1V3JA 4Y88A 4DN4H 1AP2B 2RQ8A 3MSPA 4P59H 5D9SA 3TNNA 1KEML 2YEZA 4PJCE 1YMME 2K7QA 2OMUA 2ZSWA 3ECVA 3OMIB 4W9ZA 4TLUA 5BZDB 4Q97A 2VH5H 2WQAA 2DWSA 2YOCA 3PL6D 1ZKAA 4OFYA 5HGDA 2ZUQC 2QZQA 2R2EA 1DFXA 3U2JA 3TV3H 2A73B 5T8IA 4K23H 4N2OA 4H8WL 2Q7AA 3K6OA 3A21A 4PBWD 4NCC1 4JO4H 1NUFA 1A7QL 1QRND 3LRHA 5D2LF 4DGYL 3GTTA 3VH8B 4F7PA 4AL8L 1BCIA 5I1LB 2JK5A 3UL4A 3NFNA 2E75C 1DVZA 4L29B 4NUJA 4XXWA 2NNCA 1NCCL 2XIIA 4URTB 4FERA 1C08A 5I75B 1X5KA 5AZ2H 2BDNL 4YEFA 1UZ6E 1CICC 4L4TA 2J8UE 4K71B 5F1OB 4XWGL 2QPSA 3STBA 1ZPUA 2H0PA 2H2SD 4KQ3H 4GKZB 4XX1G 1QLFB 1E8ZA 4ES9A 3JYCA 3Q1EA 3B4NA 3MJ8B 2JQAA 4NQEE 3BQUB 1JXJA 2WC7A 5FHAH 4QCIA 3A67H 5EUOE 1FG2B 4GKSB 4R4FH 5KSVA 3PYCA 1RUQL 2ZICA 3BPNB 3MRGB 2L7UA 4HLZG 2OXHA 2X89D 3MV8B 1IC5H 3DHJA 3O9WC 4GW4A 4RAUB 5H94A 3SCMD 1WLHA 5D4HA 4KTYA 1UWEH 1XX9C 3S5LA 1J48A 5BRZD 4POZC 2O93L 1PIFA 4PWFA 4OB5H 3LD8C 3T6ZA 4D9LL 5AD0A 4U1LB 5CWSA 3TN0D 5HHNA 3TZVD 4N9GA 4MQ7A 5CP3H 4JQVA 4GKZA 4KO9A 2X12A 2ITDA 3SOBH 5JORA 1A6UH 5DDHA 3EJZC 2XOTA 4KI5F 4MB3A 4QRPE 1DVYA 1CXHA 5IJVA 4KI5E 2V17H 3HN5A 4YE4L 5T5FL 1H19A 5IROD 2WBWB 4N2LA 5GISH 1VA9A 1T1WA 2BIMA 4LGPB 4NNPH 1MLCA 2WZAA 4RISH 3KDMA 1P84K 3D52A 2GG1A 2APWA 1GGIL 1N6QL 1J8KA 5I23A 1JZEA 4N20A 4G7YL 1WD8A 2QPDB 3Q3GB 4NN7C 4OF8A 4KK9D 2O5ZH 3CZFA 1CR9H 1BXXA 3HRPA 1PFCA 5L4IA 1XCTB 2C26A 3OAZH 4K7PY 4M43H 4G71B 2V17L 2YRLA 3W1ZA 2HH0H 4RFEB 3EH5B 1AG6A 1FUNA 3IDYB 2DH2A 1D5MB 4YBHA 3S98A 1KENH 2IG2L 1AHMA 4UYPA 2F58H 3IWVA 3B9KA 5K9QG 2XI9A 1IC1A 2XU9A 5DHVB 3FT9A 3J8F7 3JV4A 4KDVA 4JCWA 3SDDB 2CHXA 3BH9B 2FZ3A 1T80A 1H3UA 3QARA 4GBXD 3W0WD 5J9PA 1DL7H 2J5LC 4UIKH 5IEHA 2QJDA 3MUGA 4ABVA 3CZLA 2R59A 4YE0A 2DPKA 1FH5H 3RL1B 3SGEI 1ETB1 3T6XA 4TQPA 3LKNB 3UADA 5DVKA 4EQ2A 5JIDA 3VMOA 1SLVA 1UWGH 4P99A 3D3VB 3IPFA 4OZFG 5IVZB 5LGJA 1C5DA 2V7HB 1ETJA 5K69A 3VD3A 1WC7A 1G7PA 4Y8DC 1J9RA 3FB8B 3PJNA 2HJFA 1LK3L 1PJWA 1KC5H 2YD7A 1T22A 2PCFA 3QUXA 3B3IB 2J6EA 4W4OA 3PIQA 1UEYA 1SOSA 1JFHA 2YAOA 2GIYA 1NMBL 3D4ZA 4LSRH 1RIVL 4FKEA 1GGUA 1PZAA 4HFUL 2YMOA 4HAGA 3SDXE 1MRFL 3V4VH 1E43A 1QR4A 4FNRA 1IUZA 4JO5A 4X7FC 3S5ZA 4HULB 4LEXH 1BA9A 3Q7JA 3GSUA 3U7AA 3GJFH 4FC3E 3U9WA 1YA5A 4HISA 4APQA 4WTZA 1A6AB 2ZG2A 3CMGA 3LEVH 5FO9A 4JO2H 1MW3A 5HI5D 1IQWH 1KNOA 4PJGA 3RWJB 5AVYB 1SOXA 2VH5L 5AUMB 5FCSH 1P4LB 1NCBH 4TUJA 3O6KL 5D5ME 1WICA 4WO4D 1DJWA 2DYPA 4B9CA 5IB1B 3VWJC 4MJ4A 4Y4HD 2XZCL 5EIQA 5C0AA 4BQ6A 4AUYA 3OGOE 4KMTH 4JM2F 1I9JL 1O6TA 1FC1A 3L5HA 1QFHA 2F7RA 4XNQB 12E8L 4XB3A 2AJUL 2ETWA 3BFOA 5TE6L 4JN1L 4OLUL 1UTDA 2NY7L 2RJMA 4XB8A 2YLKA 3GSNB 4M43L 4PG2A 1NGWA 4WWKC 3TESA 4KO5A 1WFTA 2E56A 3QZPA 4I48A 1HQ4A 4H2CA 4X9BA 1IM9B 1VRSA 4AEIL 4DP9X 1LMKA 2XWBB 3GM8A 1QNZH 3QZWG 3SGJC 3AWFA 3KPSD 3MRIB 15C8L 1OTUC 1MCDA 3KYNB 5JYLA 1GGIH 1N6QH 2ATPA 3GO1H 4L9LB 4X4MA 2BNUA 3OKDA 4Q6IA 5FYKD 4JM4H 1SBSH 1U8IB 4DO4A 2JF1A 2XVLA 2Y2YA 1OAQL 1BD2B 2QVTA 1M1SA 2Y1ZA 1MHPH 4U0QB 3U82B 4GG8A 1A2YB 3B2XA 3BP7A 5INCB 2WINA 3QQ4B 3HJEA 1L9OA 2MNUA 3LKNA 2FHBA 2NR6D 3C5ZB 1P4LA 1FRGL 4M6NH 2F53E 4OFIA 3TX4A 4PY7A 1IAIM 1ZANL 1LE9B 2FK9A 1CIDA 4LLMA 4K5MA 1M6OA 2YWZA 1JNNH 3AW5A 3SPVB 2H1PL 3LKOA 1VZGA 3RKDC 1X6NA 1PIGA 3ARVA 2BXYA 1EMTH 2IMMA 2J44A 3TBTA 4B96A 2AJSH 5DZAA 4P4KD 2P24B 1ZE3C 2X2HA 4G2AA 5EWIH 5EEVA 1QTYT 3OR6A 1MHCA 1UM6H 5DZLA 3LHPL 4PGEB 1GYWA 5GJTL 3DLQR 4HJEA 1EO7A 5I24A 4WKZB 2KPNA 4GI6A 1T2QL 2QQKH 1L3WA 4WO4A 2N4IA 5D7LE 4RVBA 5AOZA 3F7PC 1MQ8A 4KHXH 3OKEA 2ZWSA 3NCYP 4PTUB 3SN6N 1S7WA 3BZEB 4DWHA 3SD2A 4BUHA 4KY1H 4OZIB 4LSQL 4I88A 5GHWH 1YEKH 2K6WA 3HRZA 4QF1B 3K81A 1MFEL 4PGCA 2V9UA 3QH3B 2J56A 1AC6A 3MRFA 3VSUA 4IU2B 3VFNB 4BQ8A 1IZJA 3WKQA 5EBWB 3FTVA 1BD2E 4PRDA 2SEBB 2HCZX 3UP6A 5L8JB 1DYZA 3OAYH 1NGZB 4LO9A 2B7DT 4WO4B 3TA3B 3D2TA 5HGAA 4MA1C 4Z7OE 2WYIA 2CHNA 4J1UA 5M7QA 2YEQA 2DWDA 2BOLA 1ODUA 2EYTA 3E3QC 3NCCB 2VERA 3IDGB 2E3VA 3IN2A 4OGXL 2BW5A 1ZLUH 4DPRA 5E8EA 1R47A 2X42A 4N9OB 1YVLA 5JPMB 3ARED 4KKBC 1DSYA 3PAVA 3L81A 1IGML 1ZIAA 2D7NA 4J3VA 3TYGH 4LL1A 1HAUA 1GKOA 1RJYB 4JFEE 3QXDB 4W9EC 4KJYA 1KEMH 4Z95L 1HI6B 4X6BB 5DYOB 3OLEA 4QHLB 5E5MB 2K4AA 3UO1L 4D0DA 5FW6A 3LS5L 3TOPA 2A77L 5IHBA 3R4DA 5INCA 5KSBA 3MRQA 6CGTA 2YFOA 5CLZA 4UOJA 2NY5L 1NGZA 1F58H 4K2UL 4M9OA 3V8CA 4JFYA 3NAAL 3U0WL 5IIEB 5CP7A 3B9EA 4BKLA 3WEMA 2ZWLT 3EYFA 5HYSB 3ORJA 3ATDA 3DECA 5B21A 2J1XA 3RVUD 2AF2A 2XXCB 2NZ9D 2KLRA 3CFTA 4NS0A 1OAQH 4RA3A 4XO9A 4LARH 3RUGB 5EEUA 4DNLA 1WCBA 3FUIA 4G42A 3OKEB 1MHHB 4BYHA 1EH9A 5I8CA 3GO1L 1WVZA 2I5YH 3BWZA 1YCSA 3BPCB 3ARFC 4I77H 3T9WA 4F15C 4Z7OB 1KYOJ 2ZUWA 4PCTA 2FNWA 2I7OA 5CIPH 5B7EA 2P5EA 4U1KB 3BYTA 2BRRH 3GRGA 4NO3B 4WCYH 4F1SA 1T03H 1T1YA 3OKKA 2GVYA 3JWDC 3TH4T 4YL4A 2ZOUA 4EO5A 4NKOA 1Z5YD 4Q52A 5FO8A 2JIXA 2XWCA 1OAUH 4DOHE 2YQGA 3MBXH 2OYKA 2FGWH 2X9YA 4OZFH 1L9NA 3B9KC 1NFAA 4XVJH 2R7EB 3CFCL 4GSDL 4L3AA 1XZ0B 3QNZB 2XBTA 3ZZSA 2VDRB 3F7VA 2HT4D 5A16A 3AAZB 2FWOA 3WS3B 3GBDA 5C0ND 4YSOA 3T2NH 2R69L 1Z1WA 4KY2A 4OLZH 4ZUWA 1I3RB 3MUUA 1NCBL 1NFDB 3LQZB 1FG9C 5EULV 4MCMA 3DHPA 4WENB 4NN5C 5FA4A 3ZL4L 5EDSA 1ZVNA 5CEZD 2Q7YB 1IGYA 3BVTA 1G7QB 3ULVE 5E0QA 4J3OC 4JZOB 2OBGA 2NY2D 2JMRA 2RGSA 1OAKL 4YO0B 3C9NB 3GZOA 4MAYC 4ZSOE 5IWLA 1N6UA 4XBGB 4G8EB 4PJIE 3SDCD 5C7XL 1HHIB 1KIPB 2Y2WA 2ZG1A 1JZ2A 5F9JB 1Z3RA 2R51A 4FL4B 3KBFA 1JV2B 4F5CA 5HVFB 5I6KA 2YD8A 4NOBA 4MXVF 1Q4NX 4NAMA 4AY0A 1OP3K 4F3FA 5J8OA 3HC0A 4LAQL 3AT0A 3GSNA 4Q6IC 2B1AL 3UACA 4NKQB 5CSGA 1JPEA 4WAFA 2VLRE 3QHZH 1JZ8A 1A8ZA 5FYJH 5CN1A 4WVRA 3MLTA 4PN6A 4G8FB 4JRXE 1SJXA 4GUPB 3MRPB 3TBTB 3DX4A 1LGVA 4MX7B 5HGDB 5ESVA 4IOFC 1HIML 3PFQA 4AZ8B 1H6UA 4FABH 3KXFA 5CR8A 2EYSB 3V0IA 3G5XB 2WQ8A 3U0PB 4PJBF 3MMEB 3VXTA 4N5EC 3MBEB 3W0WE 3WTXA 4ACPA 5ILTL 3GJFA 4OZIF 4HU2A 1R5WB 4X7EC 5A3ID 3LRLA 4PJ7E 1U4FA 1EZVY 3MRGA 4E2OA 3N42B 3QZLA 1E27B 2MQCA 2GCYB 1NWOA 3NSCA 3ALWA 2A6JB 4W9FC 5I73C 1I75A 3QBTB 4OI9A 5CN3A 2DW5A 3KBPA 1S78D 1IFHL 2JJTA 3L3GB 4HC1L 4RRPG 1Q38A 1E30A 3QIUC 5BQ7B 3U2SB 1SNRA 4JRXA 5ETUA 5G2NA 3BSZH 1TR7A 1TJGH 3BW9A 4QT5B 4OLXL 1XEUA 4Y4FB 3WL9A 2FEDD 4AENA 3AGWA 4XCNA 2UZIH 2IOMA 2P45B 2UUDK 2Z9TA 4GRMB 4ZOCA 2V2TB 1UT9A 2EKSB 1Z32X 3AMKA 2WZPD 1QA9A 3RBSA 3BAWA 4YXKL 1BF2A 4OD2A 1HOCA 3BI9X 2KI6A 5F7DA 4LDEB 2HKHH 5HXMA 2VDNL 1M56B 2VL5A 4FJZA 3ZMEA 4Y8AA 3W9DA 4LNVA 4C59B 4Z3FA 4PJEB 1JFQH 3KZ8A 3FMGH 4RCAA 4POUB 2HWZL 2WYTA 3FUEA 4IKJA 1OAXH 5FWQA 4TULH 4MQ7B 4BDVA 1G43A 4JRXB 1MUJA 3DX8B 3SYAA 4NFCA 3HUJB 3MNMA 2AK1H 3GHPA 5I8KH 1YNTF 2KQNA 4PB9L 3E7JA 3SE8L 4ICWA 2Z1PA 3G5ZB 1EK3A 3D5OF 4L2LA 1A6PA 3HE6B 4HIIB 2ZE0A 4DP4X 2IIJA 1S5IL 3OF6D 5DHMC 5TE7H 2F7IA 4D9LH 2D0FA 1Q90A 4QYOA 3VFOA 2YS4A 2H0EA 3F3HA 4YSCA 4HIEA 4OCNC 4LSTL 5HYSG 4DGVL 4L4JA 4YLBA 5H2BB 1E9QB 1ZGLB 5CBAA 5I76A 3GBMH 3LAFA 3NMEA 5E0FA 2FR4A 4RESB 1I7UB 4YDVA 5DLML 2VLMD 5I6PA 3T0BA 3ARUA 2BERA 4W9LC 5SWZD 3V9EA 1YY9D 1XR9A 5E5LA 3M7OA 5HDWA 4N2AA 4LHJB 1QLFA 3C60A 2YQ3A 1PZ2A 5I0XA 3RDJA 4A2GA 1DQQA 5BV7H 2AJYL 3PNRB 4P23A 4E41D 1BLNA 4LGRB 5EC2B 1I8LA 1S3RA 3S7GA 3GJEA 4AV0A 4YOKA 2V3EA 4XTRC 1S9YA 4KKPA 2R0ZL 2CIIB 3MV9A 1J8SA 3C6LD 3RGVC 3UTPD 1X6LA 1GOGA 1HH9B 4WZ9A 1TCRA 1QFWL 5GZOD 2UWEB 4ISVB 1CLYH 3OLIA 4UU9B 3NZ8A 4XNXH 5BS0A 3ETBJ 3X3GL 4P3CH 5IVZA 4AQ1B 3I9PA 4Q14A 1LP9B 3CMOL 4Q9QL 2UYLA 3UDWA 2IFFH 2R29H 1MFAH 2R56H 4FQCL 2C3HA 5HHVH 3U46B 1GKEA 3F04A 5E1HB 3ZKQD 2BZDA 4Y4FD 2BHZA 3LZRA 4D94A 4U6VL 4LVNC 5SWQB 1XSKA 2YIHA 1QSFD 4GXVL 3VD4A 4QHMB 3QJHB 2P46B 2W0KA 2WWKO 1KGYE 1UD6A 2XZAL 3CC5A 3BGMB 1UD3A 3BAJA 3EBIA 2JIXB 1CT8A 3D0VA 4YDJB 1SOKA 3H4HA 4QRRB 5IW1B 4LIQL 4Y9EA 3QNYA 2GSGB 2EKJA 3MJ8A 5AZEH 1DQLH 2X70B 1RHHA 5D4JA 3DXAB 3SE3C 4ZOBA 1BQSA 3IRCA 4JM0A 3SDDD 4QJ4B 2WQXA 4Y2OA 1OP5K 2ADGB 4XN4A 2NDGA 4HBCH 4S2SB 3LY6A 1D6EB 4JHAL 4M29A 5DZJA 5ADOL 3VO0A 4UU9A 5I1DB 3RUGF 5FLVA 1NOFA 4OAWB 3VGBA 4AXWA 3TCLB 4Z7QE 4CNIA 1M4KA 1HXYB 4KKCD 1JF6A 3UMTA 2VW7A 4AV5A 2AJZB 1E4XI 2QKSA 4C47A 1P0SE 2N7AA 5K9OB 1KXQE 4NUGH 2MCG1 3RB5A 3GM0A 4PM1A 4Y2OB 1TZOA 3WTYA 2VLLA 4C83A 2X89A 3MRMB 2CK0L 1DQQB 2UXTA 1UXMA 3HMXA 2R0KH 3C08H 5F1SA 4H88H 1RHHB 4KRPB 4JFVA 1OTSC 4M3JA 4GRWF 5GSVB 3SY0B 3ARFA 4K8RL 5DC2A 2VDOB 1FL6B 1QUNA 1TJHH 3GSWB 2R1XB 2DMGA 4P5TD 3BZFB 4YN3A 2X9ZA 4FA8A 4ONFH 1UZGA 1ZLEA 1DQDH 1GGCH 3S8GB 3HR6A 5D55A 4ZS7L 2WNXA 5BRQA 3NSYA 4HEPG 1DSWA 4BRJA 2YAPA 3PWUA 3VD9A 3HC4H 5EFIA 2A4CA 3NZHL 4MCYB 1ETZA 5ANME 3C8KB 1NKGA 2HFEB 3H2QA 4XPAH 4GBXC 3BEVB 4IBSA 3N55A 4ZFFA 2X1QA 5L2JA 1T5XA 3LYRA 3DIFA 1JNHA 5LNGA 3CG8A 1ZV9A 4J6RL 1QO3A 1EHKB 5EZOH 5ICYB 4U7MA 2D7OA 3ATAA 1Q72L 2ZP9A 1J9CT 2H9GA 3AU1B 3OLDA 2LGNA 4LSPL 4JKMA 4IRSB 5BW7C 2XFXA 4M62H 5DHVH 1VESA 4L0PB 1SN0A 2BP0A 2W07A 5E6IA 5HHPA 1NLDL 3MFFB 4KVCH 1V3LA 4PJDE 1OF2A 1X5GA 1KPRA 2Y1AA 3DSFL 3OHXC 3R18A 2J43A 4Y5XB 3UGEA 3K2IA 4PJ5B 5C0IA 4OCYL 5DWUL 1VEMA 3INOA 1OSYA 1A1NB 3B7TA 3AG2B 1U30A 2AQNA 2FYYB 5D7HA 4QT5A 2JJTC 5SWSE 4AGMA 2IAMB 1UYWL 2EIZB 1I3VA 3ZKMC 4JFXA 1MLBA 1XGQB 1B3JA 3R4RA 3DO7B 1OL0A 4FCHA 4DCQB 3ME0B 1DR9A 4WUUA 3GMPB 3QA3A 1EEUA 4JPIB 1RIUL 1KCSH 3MOQA 4N2NA 3V6OE 4AYEC 3MUJA 4ALAH 5J6SA 5BRZB 2DQDL 4B6ZA 1DBKH 3H2WA 2EDNA 5KTEL 3QEQD 4BH8A 2NY1C 3QG7H 2C7FA 5IQMA 3O8XD 1KPUA 2NXYD 5B38G 4R7VA 3CSFA 4J3UA 2OSWA 1AHWB 3QORD 2C3VB 3EKCA 4BJLA 5LUMA 1T4WA 2E9GA 2BVPB 3HLAA 4RBPK 4Y4HC 3T2QA 2FYYA 2HX7A 2BSRB 4LLWA 2A2QT 2CBQA 1MUJB 4J2QA 3UTTA 4UOQA 1CD9B 4M7KH 1OTUD 2Z4QB 43C9A 3DSNB 4I3RH 5HDBF 1NKOA 3BZDA 3TVMB 2AS5M 4P9ML 1H8SA 1KPRB 5GS2H 2XUWA 3BVWA 4NAQA 4M1GH 4WQOA 1OKEA 5AW4B 1BFOB 3DRTA 3HI1B 4HA1A 5KANG 3QZBA 4G7VH 5FIEA 1SRDA 4WHTB 4GQ9H 3FRUB 3FQ2A 4RZCB 5D1XB 3F5WA 5JR1H 5FUZH 5LXVA 2AGJH 3L3DA 1PD1A 4HIHA 4X7SH 4M3KB 5CCKH 5SWSB 3GMMB 3L7FA 4AC2A 2I26N 3WIHL 1K3IA 5HYSA 1KBWA 4HWZB 4X6EB 4S0TD 5KVFH 1E4XH 4Y5VC 1QRNB 1P4BH 4FXLA 1AHWA 1MJUL 2EECA 4IHBA 1KFAH 1CC3A 1DN2A 2COVD 2FX7H 3GSRA 1NBZB 3MRJA 4LCVA 5FYKH 2HFEA 5IFAL 1UOLA 1XSOA 2OS7A 1U92B 1NC4B 1YN6A 1SM3H 4LEEA 1N70A 5E9DD 5TH2B 3RDTA 1VSCA 3SDYH 3EJQA 3ULUD 4J8QA 4LSUL 2Y25A 1KFGA 2O26U 4N2EA 1P7QD 1X9QA 3QPQD 2CJSA 1LWHA 2NY4C 3QNZA 2BOBA 4Z7QB 2XV2A 3C2SA 3VWKD 1DN0A 2VDPH 4UNVA 5BNXD 4U1IA 3TEZA 2W91A 3WD5H 5JMRA 3W11C 1TG8A 4HQQL 3A6CL 4UM8B 2PABA 2LU3A 5HYQA 1D5ZA 5KSUA 3DA0A 1NLDH 2M26A 4YR6A 2B14A 2BJML 2VLLB 4P2QB 5EU3B 5SX5K 3VXOA 2CDFB 3MNWA 3OKOB 3EOYG 2J71A 1U3YA 3L5WB 3VFMA 1P4IL 4ZYKB 3VRJB 4RWYH 3FUDA 4CN6A 1EWHA 1WZ1H 3AWGA 5L2KD 3C5SA 1MWAA 2Q9OA 4PY8J 4XBPA 2PW2B 4U6YA 3WXWH 2D31A 4N8UA 2W9LA 2Z93A 3HI6L 4NNYB 3FOMA 2F8XC 1QHQA 2OTUB 2C1OB 5D1XD 3D3VA 5GGTA 5CO1A 2ICWI 3DWTA 4DKEL 3B2DC 2EEXA 4XCEB 5MENB 4AYSA 2ZX6A 4PV9A 3AXLA 4F91B 5KW9L 4FLOA 5LWYH 4QOKB 2XDHA 3QVAA 2VO8A 1NJ9A 1RMFH 3FC8A 3PV6B 1KPUB 3ABGA 3ULSB 4DP2X 1LP9F 3QT2A 3PLYA 1F4AA 1MNUH 3ROOB 1UZ8B 5JW3H 3NTCL 4QRPA 1ZIBA 2FX7L 1QLEL 5B39G 1EVUA 1HCFX 4ES8A 5L4MA 1OSZB 1ZHKA 3TS8A 2IH3B 1BQRA 1PY9A 3VU2A 4QRQA 2AEQL 2XWJB 4MTMA 1MI5E 5F0PB 1FDLH 5IQ9B 2GI7A 3EO9H 5IB4B 4I4WA 1YMMB 5EUKA 4BZYA 4NC1C 2WP3T 3GKWL 2DB8A 4HOXA 2RA1A 4HS6B 5DI8B 3ZIYA 1I7ZA 2CU9A 8CGTA 1OP9A 3WNLA 1FFQA 1FL5A 4NUMA 3IDGA 1RIHH 5E56A 2J2ZB 3IGLA 1J87A 4B3VA 3ROOA 4AJWA 5AVUB 4AGPA 3CFNA 3PQYA 1HKLL 2IDTA 2P7TA 4I3RL 1BYOA 3SDAD 3E3QE 4F58L 3SGKC 3ENEA 3ZE2B 4Z7QF 5IEKB 4KK9C 4RGNB 4U6YB 4EIUA 3JVFC 5EOCH 3D51A 3SGDI 3BAYA 4ZMOA 2VM4A 2Y7OA 2BOCB 4K5NA 4X80H 3SO3B 4Q74A 4U1GC 1JI2A 4Y2LA 4H1LA 4NKMB 3SKNB 4AMXA 1IEBA 1VCAA 2KZWA 1VACB 3MRCA 3VXQB 4X4KA 1PZUB 1H0DA 3QWOB 4FI6A 3X3FH 4M7LT 5K9KA 1Y6MR 3DOIA 4U6HA 5EA0H 4JFYB 3SD5A 4JO1L 1OTTC 3FBQA 3TWCL 5KVGE 3GLDA 5JQHC 2IAAC 3VRIA 1IKOP 4GIPD 4L23A 2XZAH 3TGXA 1AD9A 3MRDA 4PB0L 1GS7A 3ATFA 3GRWH 4ZMXA 4D2NA 3ARSA 5T3XE 2FYVA 1KN4H 1ZD6A 5GRXG 2XJLA 5EO0B 1A14H 1LO5B 1F6FB 3WUWB 1DBJL 2BIQA 2M8XA 4XH2B 3WUWG 2P44B 3SOTA 2V6HA 3LNFA 4I0PD 4L3EE 2DLFH 3LZOA 3TYFB 2JQZA 2VUKA 1AR1B 4FZEH 3QUZD 4P46B 5AW0B 1ZVSB 1L9QA 1XXDC 4A6YL 1WUZA 3FUKA 3JUZA 4QY8A 3UBXG 1IGJB 2VZVA 4QDGA 3CFKA 4KUCD 5JMOC 4XCYA 2ZXEB 1U92A 2B1HH 1W16A 2N0MA 3APNA 2IANB 4AVHA 1U2CA 3L5XL 1TVHB 4UT6H 4X7TB 4B7LA 3GT6A 4K9EC 4KC3B 1OQXA 1MCEA 4PJ5A 1MRCH 3FN0H 5KN5A 3HNVH 4H8WC 1FYTE 4QIRA 5I17A 1PY4A 4J6RH 4AT6B 4WU5B 3UFIA 1PCXA 3NABH 2P8PA 2WQUA 2ZUQB 1XGRA 3WFDH 2Z7WA 3ARDA 3V5HB 4ERSL 5EZJB 1FZJA 4OH2A 5E2TH 3N9GH 5LGHL 3P3SA 1QEWA 3MC0A 4KDTA 4NZRH 5ALBL 1SLUA 5D5MA 5DGQA 5B8CB 1ZHNA 3TA3D 2J12B 5ICYA 3CBKB 4Y1SA 2OYPA 4EI5B 3VVVA 4UBDD 2MQ0A 5D1ZI 2X6VA 1JPSH 1BBJB 1JV5A 4NQCD 1GC1L 3QPKA 4PRHA 5T3ZH 3GBML 3RPIA 3G5VA 4FFVC 3U2SA 35C8H 1ICTA 4AM0A 3N5AA 3NCJH 4DPCX 1KN4L 3O3UN 4OQTA 1OCWH 2PWDA 3F7QA 5HDBB 1RZJC 1FA4A 3SQBB 4PW9A 3WGVB 1N5YL 3RNKA 2WQRA 3H3KA 3TFKC 4YXHL 3VSQA 1QBBA 2MFNA 3RWGA 4D8PA 5JOPD 1G7MA 1ECZA 5IJCC 4OFYD 3F7LA 4Q4IA 4WW2C 4ZUTB 1XV8A 2EXWC 5IV2A 4LRIC 2NX5D 1ZWIB 5FYLL 2X6MA 3A22A 2X38A 3FN3A 2XZZA 1ZVYA 2NX5E 3IJSB 5F7LB 2DIJA 5BVPH 3BMWA 3KPNA 3KWWB 4FFZL 3R8QA 3ME0A 1VDGA 2GW5A 2EAEA 2BVQA 4CVZB 1HYSC 3EFDH 3NJVA 4WUUE 1JPFB 5KANI 3D0AA 4G8FA 2HKHL 1AMXA 3N41F 1VPOL 4N86A 4LOVA 1C7SA 1JPTL 1QRKA 4LGSB 3DOSB 5MI0B 3RWEB 2MMXA 3BUTA 3N04A 2Y22A 4MZ3A 5FGRA 4MKTA 3FO2B 3HCVA 3LXCA 1J8HD 1BMZA 1HILA 1O6SA 3B3IA 3G3LA 2ADJB 3K8KA 2WLZA 3INUH 1JTPA 1XAKA 2V2XB 2ATKA 4NHCL 3D39E 2B8OT 1EEZA 1RULL 3HI5L 4NX0A 4JBSA 2QMJA 4Y4FA 3WL9B 3GXIA 1HHKA 5FKPB 4Z3JA 1UJ3A 3BJ91 4QTHA 2VSDA 1BECA 1CXLA 3ZE2E 3K6SA 3M1BB 5JNYA 1NLBH 3TTYA 4TVUA 3ZHKA 3D12B 2VW6A 3OV6A 1IGYB 4HIXH 5D7LA 4TRPL 3QXAB 4PJ8D 5L7XL 5AAMA 2HN7B 5CU9A 4ODTL 3BAKA 4HT1H 3ZYZA 1VKXB 4BZ1L 2KPWA 2VIRB 4FXKB 2F1AA 3GGWB 3B2UD 1BZOA 5FUCC 5JIMA 2MOGA 5BVJB 1Z9SB 4JDTL 1B0IA 1NBQA 2PYFB 2W95A 2XVKA 3G6JA 1HQRB 2VDMH 5B38A 2HT2C 2JB6B 4IOSD 1FO0H 4G1EA 4X8GA 3P30H 2GJPA 3ZKND 1NANH 1YQVH 1AIZA 1TPXB 2CK2A 1EQWA 4WI8A 3RYMA 4GSRA 3I02A 2X3CA 4XTRD 4DGIL 2C9PA 4IK7A 1BQUA 1MCRA 1HNYA 4GFTB 2ZUTA 3MACL 3C87A 5DF0A 4MXVE 3STZA 2ARJB 2BJMH 4CAGA 1D9KC 1JWUB 4LHUA 4TSBL 4HUXB 4YHOH 3O41B 1EXGA 2VSCA 2GSIB 3HS0B 2PO6A 4NRZA 1NGYB 3MJGX 4YHLH 3NG5A 3LV3A 1IMHC 1LD9A 3ZX1A 3MV9E 2NXZD 2EKSA 1HHIA 4HUCA 2WXLA 2Q8BL 3QDHA 4AXWB 1KLFA 3ELAT 5GQBA 4X99B 4B53A 4DHLA 1UADC 1N4XL 3PL6C 1NIDA 2GKIA 4Q9RH 4NC1E 4RBPH 4XI5D 3DXAA 1Y18A 4FFYH 3MV7D 4JFUA 4F2MB 2W9EH 5CWSB 3T2NL 3MUHL 5CINH 1AO7E 2ZSVA 3L3JA 4LFHG 5TE7L 2ZIDA 4Y1AD 3WO3B 4O2FB 4UV4H 4ZD3H 4KO6A 4ZQTA 4FEMA 5C2BH 4GXFA 3SODB 5BUGA 1E5YA 1ROWA 1P5UA 2LLGA 3HE7B 4OCWL 1NSNH 4M8RA 1U33A 1OGAA 3BP4B 3T3MB 2G75A 3P3TA 5ACZB 3WS3A 1I1AD 4UT9A 1KN2H 1NBVH 2CO6A 2R4SH 4P05A 5D7KD 1KCRH 1K6QL 4RMBA 3SPIA 3VXTB 3TCXA 3WIFB 4B9ZA 2X4OA 4NAJA 2DEYX 2X28A 2ADFL 4D7BA 3UCQA 2NTFA 1RJZB 4BFIB 5DK3A 1RURH 3OMZA 4I2XB 1BYPA 2I5YL 2ZOLB 3B2VL 2EYTB 1U8PB 4C54A 1NCUA 5D7LB 3K72A 1F8TL 3EGSA 4PIBA 4KAQL 3LCYA 1CDYA 1HL4A 5L2KE 2H41A 1EFXB 4OF0A 4QTHB 1ZTXL 4K5OA 4JRYD 2Q2EB 2JJWA 1UFGA 1INQB 4GKNB 4PMEA 3TM6A 4BEIA 3WU1A 3NZUA 1JK9A 3KPRA 1A6ZB 2ESVD 3BCDA 4HLEA 1TTCA 3SCMC 4G6JH 5IF0A 4OFDA 3WHE1 1HZHL 2ESVE 5EC2A 3KL5A 4YO0A 3T5WA 4JR9H 2G2NA 1LYQA 1Q94B 2QSCH 5HYIA 2NUTB 2BP8B 4MD5B 2DQDH 1YYMH 5INDB 3BUIA 2XCMC 1N12A 2HT4C 2EE9A 2PKDA 5IG7A 3K71A 4Z95H 4P5KB 2WLYA 5HPMB 4NBXB 2QQLL 4DETA 4I2XA 2OJEB 1B4TA 3QJTB 2OR9L 5IROA 5T1KD 1P1ZA 2BK8A 2DBJA 3O0RH 2F74A 5IHUH 4Y1AB 1L9RA 2X4OB 3VRLF 1A1MA 2A7BA 2ZKHL 1U8MB 4A68A 2Y7QB 1MY5A 4HS8L 1BBDH 3FONA 2D7TH 1G7HB 4ORZC 2HFFA 4E42B 4U1SB 1G7JA 1Y0LA 3B2VH 4XE0A 3CUPB 3CX5J 4TTGA 5DD6B 3RY6C 1ZT1B 3F65A 4R5XA 4ELMA 1UACL 4JRYA 4HIEB 3ABMB 4LAQH 2F8IA 2NY0C 3P69A 4PJDA 4MX7A 3L7EB 4UMSA 3UC0H 4J1UB 4HV8B 3KVPA 4FQQA 4OKDA 2DM7A 3T8XA 2BSTA 3O2DH 4H0IA 1UJ3B 5C09E 4F7TB 4PSRA 4M93B 3NRFA 3W0WA 5ESAA 1BPVA 3ML9A 5DS8A 1LK2B 4JPWL 3OAYK 4KHXL 3CFJA 4XAWH 1KBKA 5CU5A 32C2B 2YA0A 1E8XA 2VXQH 5MENE 3NFSH 4AMKH 1XGTA 4B97A 5F93C 4HZ1A 1UCTA 3UAAA 4HFWB 3V4LA 3WY1A 3NZHH 3R0MA 2NQDA 1WAEA 4HOWA 1AGCA 2AQ3A 2Y06L 2BIIA 4DF9A 1AXSA 3GUTB 5E9NA 3GMLB 1U93A 3CLFL 4OLZL 1CFQA 3R7QA 4Y2NA 1G9NL 2V9QA 4JPKL 5KSBB 3KL0A 4JFFB 2VJ0A 4UM9B 5JIPA 1KGXA 2WXPA 1UD2A 1KIQA 4XNQA 5B1AB 4Q2ZA 3QEUB 3PWPE 4TSBH 4ODWB 5D93C 2HKAA 2YD5A 3GINA 2Q87A 4KMLB 1UD8A 3GD1C 5I1EL 3BRGC 1G7IA 2NW2A 3MFGB 1FGNL 4FHKA 1RPUA 3NDYE 3G08A 5CAYB 3E8UH 4IBZA 3RGVA 4NQDA 3F7VB 1DJIA 1RZFH 5JPMA 3CSPA 5B8CC 5DO2D 1ZY9A 3WEXA 4QXWA 5HDRA 4NUGL 3ARRA 5FV1L 5JW4M 5GRVK 4YDNA 4HWBL 5CNHA 4XNZB 5LBSA 3VAEA 4P49A 1G4RA 2VNCA 2ZWYA 1EJOL 2H32B 1YPZA 5HDOA 1A3LL 1WAAE 3RI5K 2OMWA 5C08D 5KBDA 4QRPB 1I4FA 5FA3A 1J9QA 1IT9H 1E4WH 4IRZL 1JXFA 4KUZL 4WHYH 3S36X 4JHAH 4AGLA 2HTLD 3P4OB 4HUKB 1MXGA 4HT1L 2XNAB 3EH1A 3TFBA 4U6HB 3WY3A 1SOQA 2VAJA 3BJLA 1INDH 1ZLVK 3SE6A 1U8CA 2NY5H 5IB5B 2ZKYA 5A40E 2IBGA 4BZ2L 1DQMH 4OZIA 4FZ8L 2WXRA 3DX6A 2WXFA 1KUMA 5FUCE 4L0YA 3EJRA 2D7PA 2ICEA 1DVQA 4FNTA 2VLRA 2ZONA 4KMTL 5D71L 2OR7A 3FQXB 5FUOL 3OZ9H 5L88H 4YAQB 3WNIA 1MCOL 4NB7A 3OR6B 2QEJA 3T8XB 3QULA 4HAFA 5J0BA 1GTFA 1PJ9A 1TU2B 4YK4B 1IQWL 1NL0H 1IQDA 4WWKD 2SODB 3THML 3LEVL 4NM8H 1CGSL 1UQSB 4A63A 1F56A 1TZIB 3C6SB 5J9PB 3BDXA 3MR9B 3RBGA 1K4CA 3O2VL 4B9JA 4DEUA 3LQAL 5FO9B 5F88A 3WKML 2YD6A 4GW1A 3B9KB 3V9CA 3K2MC 2IH3A 3KNBA 2K6YA 1OSPH 5K39B 1IARB 1KSRA 3DMMB 2DKMA 4PJ8A 3FO9B 4HC1A 1TQBB 2P5EB 1HEZA 4U1KA 4FF9A 3TPUB 2EDFA 3ZHFA 5GHWL 4YSQA 4JDVB 4V33A 5GGUA 1CQYA 1NJ9B 4F20A 4HU8A 3MRBB 2DZEA 4K07A 4WNQA 1GCYA 1LK3H 4MDRA 2CLRA 2MQGA 1A3RH 3BZ5A 2FJUB 2AJYH 4CMMB 3NEXA 3NCJL 3KYOA 1BQLH 1I9RH 2DF3A 5CUSL 1UXSB 4UTCA 1FORL 1M9WA 1TJIL 4DK6A 3NIFE 2GBAA 1WBYB 2QGDA 2QGEA 3CQQA 4P2RB 4P57A 2NSXA 1FH2A 4MAYB 2K0RA 3MXWL 1LQSR 2BOCA 5EF2A 2X87A 4JFHD 4UTBA 2VZTA 4ZTOL 4U33A 1AHWC 4GQQA 3VXSE 4XR8C 3MRLA 1L6ZA 5DS1A 5KYUB 3L3KB 1JUFB 1DL7L 2HB0A 4UIKL 1T7XA 3T3PB 4DO6A 2EC9T 1NQBA 5F3BA 3CU7A 4PU2A 4B9GA 5E6RB 4PP2A 1T7WA 1I1RA 1MJ8L 1DUYB 1OAYL 1QBLL 4FTDA 5F7YC 3DHMA 2BNRA 4PJGB 2DIBA 3CJJA 5DC0A 3CQPA 3LNIA 3V0VB 4IYKA 4MJHA 3MLUL 2JTDA 2VYRE 5E6IC 1YEFH 1O6VA 2HJKB 3SDDA 3KCPB 5CEXA 2J6WA 4ODVH 1LE9A 1PW3A 4XP4H 1JCKA 1II4E 2BSSA 1CMOA 4M1DL 4OSUH 4I1PA 2K6ZA 5HI3C 2RD0A 2RMNA 5HGGS 2Q8AL 2LR4A 4FZEL 4RNRB 1RVFH 1QSED 3AS2A 4MNQE 3BQUA 3SGKA 3DMMD 3IJYB 5IUCA 1AZRA 4FAAB 1G6RA 1QI4A 4NNPL 4RISL 1I1AC 1HHHB 3DROA 3OSVA 4A2DA 4Y5YB 2EDMA 3CXDL 3PWPB 2N56A 3FRPG 2J6EL 4HCFA 2X4PB 3V7AE 1NBYB 4ZFQA 2XT1B 3ZR5A 5FPIA 5DFAA 4ZTEA 3U25A 4X5PA 3QWNA 4Y0GA 5C0CA 2DRUA 5EA0L 4DZBB 1KCBA 2Z64C 5CLXA 3SHSA 4RGMB 3L5JA 5GGTL 3STZB 3NACL 2ZCKL 1KZQA 3EJZD 1YPZF 2P42B 1G7LA 4YQXL 1EZUA 1LMIA 4JRFA 5FYKU 1TVBB 4RFNC 5ILTH 1H15A 4A7QA 5I5IA 4X80L 2H32A 4CN1A 3Q8AA 4MB5A 4UTBH 4WKZA 1ZHBB 3S3JA 2IH1B 2CJUH 1PQZB 3TPUA 2C4XA 5IJKA 4LEXL 4O02A 1URIA 5CZXD 5ID1A 2E4FA 3DX0A 3MV8A 1MFUA 4KTGA 3SE4A 1JZ3A 1AS6A 4IBTA 4WFHE 1RIHL 4LPUA 3S96B 4L3EA 3WMPA 4YH6A 1NC4A 1YN6B 2IC2A 4KQ3L 2XYBA 3FK3A 5ALCL 3V5DA 4F2FA 2Z0UA 3MUY1 2A6KA 4LLMB 1CFSB 2E6JA 1G87A 4KJPD 3QXAA 5GPRA 4FADA 2QV2A 5BOZG 1A9BA 4P2OB 2YUZA 5C0CE 4DSYA 1Y18B 2OMNA 3N1MC 2WGNB 1GZHA 2OI9B 2ZZUT 3QXWA 4G7RB 4HS3B 3M1BA 2Q1EA 4YSPA 5JNYB 3T0EA 1KJ2A 4WHCA 1AGCB 1QLEH 1EO8L 2TSBA 1NKRA 3W39A 2DLTA 2YD2A 3T4YB 1MF2H 2YN5A 5IQNA 5KYWB 2NT1A 3BISA 2HZHA 3OWRA 3WE6B 3MOBH 4UIMB 4GFXA 2VLJE 1HSBB 1SXBA 4ALAC 1Q9OB 3NJHA 1AE6L 2YD1A 1D6VH 4WU7A 2AMUA 3TT1H 3UX9B 2E46A 1YEWA 3QI9C 4DKEH 3L9RB 5C71A 1XF5A 3GMOB 1VF5C 4AJ0A 1CCZA 2V0AA 2KC0A 4F9LA 1T1XA 4TQIA 3WS6A 3GF8A 5LGJB 3ARBC 3ARQA 4NQUA 3CSYA 3VFUB 5DS8B 1AD0A 1OVZA 1QO3B 2VDKH 4GQPH 3MGTB 2X6AA 3ZRFC 1CO1A 1R0AL 3T0VA 3BFWA 2FGWL 1YSOA 3PUCA 5GS2D 3VDCA 1WIPA 1C7TA 4WI7A 5DJ0A 3SO3C 2E27L 4Z78A 2AW2A 1SMOA 3QYMA 4TNVF 1E9OB 5DK0A 5CFAA 2JELH 1CR9L 1YY8A 3QS2A 4RDQG 3CFBA 4UTAL 1PZBA 4F8TA 4FQHA 4BSVB 4PV8A 1X44A 4UQ3B 3L95B 4HJ0C 4JREC 4FKHA 3UROR 2IWGA 3GUFA 2CDGA 3EYOB 5D7IE 4DPAX 5GS0C 4DZ8A 5D7IF 2F15A 1G7IB 2NW2B 2R83A 3O8XB 4KXDA 3UYOD 3CXHK 5HPMA 3L4XA 3ALXA 4PJGE 2YZ1A 4HG4K 3QJOA 3MO1B 4CVXA 4W9HC 3U46A 3ZO0A 1NC4D 2PCPB 3QNFA 2BSCA 1IC7H 2BX5A 1P1ZB 5IVXA 2JNZA 2NTSP 2VRQA 1TT6A 5A2BA 1C08B 1AGDB 4LCYA 5KSAD 4DVRH 5FYKL 4ZG1A 4Z3HA 1ANUA 2WP3O 2DTML 1IKNC 5GIRB 1Q1JL 3DV6A 5FKAB 4NPYA 3US0A 1C16B 1EGJL 2UZXB 2YUVA 5HYJB 1GMIA 3KXFD 1TQTA 4NI3A 8FABB 1TCRB 3PJSB 3V0DA 4JVPA 4BHUA 1B0RB 5FUZL 5JR1L 1U3HC 3KAAA 4GO6B 3D4CA 4GQ9L 2OK0H 5GXBB 4Z7UE 2AK4E 3I9IA 4GKNA 1XB6A 1AGFB 1MW1A 4S10A 3ARGB 3CZSA 3VA6A 1V7NL 2J57A 2BSTB 3KR3H 4UILH 1T3FA 4ZS6D 5EOTA 1PZ3A 4FCAA 4PJXE 3UERA 2EIKB 4WW2A 3HG1D 1DSFL 1OHQA 2WVVA 2ORBL 2CGRL 1WZKA 4JG0L 5T5NF 3ZHDA 2OMTB 4J6IA 3TO4A 5TGBA 3ZPDA 3A4AA 4OW6A 5DHVA 4UAOB 3VDAA 1NCHA 5DJAB 1BYNA 4UDTA 4DFHA 2I32A 1OLLA 1J18A 5JQ6H 4XWGH 1THAA 5IBUG 4IJ3C 2WTPA 4U1SA 4X98B 3O2DA 3FUFA 3I9GL 4U1JA 3VGEA 1MELA 4N3TA 3UG4A 4R2GB 4NZJA 1Q8MA 4NGHH 1T83A 2XV3A 3FBKA 1QABA 5F8QC 1MFEH 1SFDA 1N18A 1WJ3A 4RFEA 2MOQA 1A7QH 1S9VA 3OKNB 1X7QA 3QS3A 5EU6B 2WBJA 1EHNA 1F42A 4ANKA 1SDYA 1W72A 3DV4B 2CCLA 4FNLH 2OZ4A 4W70A 4LDCA 5AKRA 1N19A 3G5WA 5DT1L 1FJ1B 1HX0A 4LMQE 4NM4H 3MRCB 4GJTB 5DJZA 4R97C 2QTEA 4I18C 3TCLA 3D08A 1W0VA 3MV9B 3SGEH 4KGLA 1T0MB 2ICWB 4IRSC 3KPRB 5F0LB 4S2SA 4NPYB 4BCZA 1V55B 2EDDA 2JI3A 1FAKT 2NT0A 1ZSHA 4OJCA 4P59L 5G5DB 3W5MA 1N67A 5CILL 1V3KA 1FP5A 1YC8A 4PJFE 4K3GA 2I27N 2FJGB 3AB0B 1IILE 4HF5L 4CC4A 2VR7A 1R33A 1FNFA 4WV1B 5DEZA 5BJTB 5C8JA 3VI3F 1NDGA 2DQGL 1IBYA 3HZKB 3TNMB 2H2PC 5IOPA 4W9CC 1CF8L 4FQIL 4EI0A 4NXKA 3UZVA 2GK0A 2EUZA 5AW6B 1U3HA 2Z34A 3ESNA 3NCXA 3Q2VA 4KVNH 2VQ4A 2X41A 4QHNB 5I19H 4QCIB 3A5VA 1KGCD 1TQCB 1C5BH 2YPLB 5TGBB 3OL2A 4IIQB 4LLUB 4HSQA 4H8QA 1S7QA 3JVGA 5HPOA 4HPOL 2R8SL 3ZW3A 2F2HA 1KYFA 4FQXB 1W0WA 3HG5A 4B9FA 5AVSB 4ONFL 1HKFA 2GIXA 1W91A 4P4RB 2NY1B 3KPMB 3NIDB 1TNNA 3HPLB 3F7YA 3NJXA 4PLJC 4PWHA 5FOBA 3X14B 4F2MA 4UMGA 1VGKB 2IDCA 4W81A 5DHEA 4PJFA 3SDAB 3EJTA 3Q1SH 3ZSTA 5IGXL 3UBHA 2NY5C 3ZHLA 3FULA 2HLEB 3Q6FA 4L1DA 4YFEA 3CBJB 1PDKB 2VERN 2XZQL 2WBJD 2K45A 1CE1L 1CICB 1MEXL 1E65A 1KLUA 4TYUA 1RZ7H 2A73A 4P48A 2XBDA 5DJDB 5AOLA 3VG9B 5A6MA 4OF7A 3U1SH 4YHIB 4EKJA 3BD3A 4EKXA 5E2VL 3FCGA 4GRMA 4XBGA 2R0LH 3P0VL 4Z0BL 3TZVA 3WIIH 3KPNB 3I9AA 1UVQB 3NJKA 3HHSA 5DTFA 3GMNB 4UQ9A 2JQMA 5E03A 3WLWD 5AYUL 4DIXA 1A9BB 4P2OA 1GGBL 2VMEA 5K1VA 3EBHA