5EC2A

Kcsa with v76ester+g77da mutations
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec2A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec2A02
2R0LL 4HWBA 1H3XA 4ODVH 3MV8A 4OCYL 2GCYA 4H5SB 5FEBA 5CSBA 4X4ME 4JANB 1NMCB 2GTWA 4DUXA 2AEPH 2J8OA 1PAMA 2VR4A 4RBPK 2IPTL 4OLVL 4UNVA 3E3QC 4AL8L 3U1SH 1KNOB 3RU8H 2DAVA 1ZVYA 1NMBH 2B1HH 1W72H 3UTPD 2JE8A 2IPUK 4HPOH 2DQDH 5MI0C 3QUXA 1T4KB 3I50H 4HUXB 2EXWD 4I18C 4JFEE 2DQTH 1RZKH 4IIQB 3TYFB 5E8EB 5TQ2L 1PG7X 1F6FB 5I30L 4QY8B 1N64H 2DQUH 3UO1H 4OT1L 4XP1L 5DC9B 2HRPH 5HYJB 5M95B 5D71L 4TSCH 4HQQH 2VXTH 4L29A 4APQC 5C0FB 4L3EA 3BPLC 5E95B 1CU4L 2VDKH 4S2SB 2FYYB 3F7QA 3HFML 4JRWA 5LWYH 1QFWL 1HSAB 3PQYE 3L95B 2DLGA 1ZT1A 5J13C 1YEGL 5GXBB 1F2XK 5IHZB 3QDMA 4CDGC 2EE3A 1T5XB 2X4QB 1LP9B 2R1YA 3OR7A 3T0EA 4FOMA 1BF2A 4HK0A 1DFBH 5B39B 3P0YL 3N9GH 3BMVA 3ECBB 4MCYA 3PL6B 4AJ0A 5E00B 3SE8H 3KYOB 5CEYA 1AGFB 1YC7A 2P5EB 1YEIL 3VFRB 3DJ9A 3BSZH 4YE4H 3AREA 5DRXB 5FYJU 4NUGH 3DRQB 1CYGA 1HYRC 3FRPA 4BSWA 1MIEL 1P1ZA 2XRAL 1S5HB 1XGPA 1MHEA 5HXMA 3ORJA 2A74B 4MXVE 3Q3GB 1CVSC 4X9FA 4KJYB 4E41E 3VGGA 4NPYB 4MNHB 1QSEE 1YNTB 4CMMA 5IR1B 4HJJL 2RCSL 4XBGB 3HC0A 4WO4D 5JMRA 4K8RD 1RVFH 4LLUB 4KMQA 4KRLB 2OMBA 3RVWD 4CNIB 5EUKB 1QYGH 3QUKB 4CU7A 4Y89A 3BJLA 3SJVA 2OYPA 2FCBA 5T3ZE 3QUYA 3ZHDA 4OJFH 5DHYB 3RQ3A 2CGRH 3MRPB 1L7IH 2XZQL 3EYUH 2R69L 3MJ6A 3PGDA 1ZXQA 4OM0L 4XNXL 4MCZA 3WJLC 3ZE0E 1IMHC 2IGFL 1OP9A 4NWUH 4R4ND 1H3PL 1J0YA 4WUKH 4PJ7E 4LPVA 3NZHH 3GJEB 4HW6A 2WANA 3FT3B 4U1LA 4YHMH 1B0GA 2GK0B 5KSUA 3ULVE 4OF8A 1DUYA 2IADA 3VXNB 3HZMA 1JE6A 5IMLB 4Z76B 5K59E 1Q0YL 5F9DC 2DKSA 4Q6IA 1FNAA 4MDIB 5I1LA 4X6BB 1W0YT 1HEZB 4R2GC 2PXYC 1HILB 4LLQA 4LPUA 1TLKA 2VDML 4WW1A 4E42B 3I84A 3ULUL 1A7PH 1CLYL 1F8TL 3ZTNH 4WWKA 5D2NA 1YMMA 3UJIH 3B5HA 1EXUA 3CIQA 2C7UA 1A6VH 3BKYH 3CZFB 3WN5B 4UTBH 1N6QL 1NANH 4FABL 3UTTB 5CP7A 5IMKB 4G6AD 4EN3C 4XNMA 5ADPL 5D7JD 4FQJL 1QO3B 4H1LA 4JPVL 1UZ6F 4MSWB 3MNWA 2NY3D 5C3TA 3O3EA 3KPRB 5C0BB 2O5ZH 1MLBA 1YPZB 1OP5H 4FNLL 3KYNA 3I6KB 4B0MM 3MRJB 1G6RA 1Q38A 4ELKB 3HS0B 2W59A 4R4BB 4PGCB 3FFCA 1ZLUK 1TENA 4YUEL 3RUGE 3ZE1F 3QQ4A 2MPAL 3MBED 1F90H 3WLBA 1AGDA 1FLTX 3VXQB 1BFVH 5L0QC 1F6AB 2VN7A 4OF7A 1KC5H 3O4OC 4Z78A 1CICB 1ZEAH 4KK8C 2FX7H 1Y18B 4PJGE 5I1EH 2X4UA 4X5WB 1T0MA 1NKOA 1TZHA 2GT9A 5E4EB 1TJHH 1KYOJ 2AGJL 4RFOH 3MUZ1 5ISZD 3LHPH 4CVWA 5DQJB 1AKJA 1MPAL 4F57H 3MUHL 4ZSOA 2CDFA 4XMPH 1U0QA 1URLA 4M1CD 5I1JH 1BFOA 3BQUD 1MQ8A 3LY6A 3ARBC 1CFSB 4XP9L 4RGNB 4K94L 1SEQH 4P5MA 1I7ZA 1GHFH 1H0DA 2FBJH 1NCUA 3LN5B 4KHXL 5ENWA 4FFWC 1WQVT 1NDGA 1MI5A 5FYLL 3P73B 5ILTL 4MXQD 4PRNA 4QHKJ 4LMQI 3PXHA 4M7KH 1EJOL 4UV4L 3VRJA 1MRFH 4L4VD 4XNZC 5KVFH 4ZUTA 3HMWH 2DLHA 5DRWB 4O5LL 5DK0A 4QYOB 5B38A 3GI9H 1MCWW 3CUPA 4KRPC 5DUMH 1RK0B 4FMFA 2BVUA 3MNVB 1JN6A 4C56D 1FZMB 2XN9A 1T20B 4KY1H 4NNPH 2BVQA 3D18A 5ERWB 5EZLA 4DVRH 1FO0L 1OTSC 5CHNA 4S1DD 2P8PA 1V3KA 3VXUE 1J05A 4E0RA 2OL3L 2CK0H 5C0IB 3QIBA 1WBYB 4FQHA 1IEBB 2P5WE 3MR9A 2M8XA 5D7LA 4PJBF 2XTJB 3O3AA 4NN7C 2IANB 3R06A 3BIKB 3EOBA 3IF1A 5LQBH 4TNWK 5KVDH 2R0ZL 3WFDL 5KS9F 5HVHB 1I8IA 2C3WA 1IL1A 1FFQA 1NUGA 1OB1A 2GUOA 4DOHB 5GRYA 4DFHA 3VFVA 4KQ3L 5GPRA 2BX5A 3GHEL 5EZJA 4BFEA 4G43B 5IW6A 2Q86A 2DTMH 3QYCA 2YPKB 2JCCE 2GY5A 5KVMC 3HE7C 3QBTB 4G42A 3O6FA 3VRLF 4JRXA 3VFMA 5EBMA 1KEGH 3QIUC 3DGGA 3S3JA 4Z7WF 4P9ML 4D0DB 1A6AA 3PGFL 4GW1B 4IJ3B 4X9GA 4HS3A 3EYSL 3IJYA 2MHAB 4PJBA 3O2DL 1BMGA 1G7HA 4X8JB 4YO0B 2EYTB 3F58H 4KJPC 3PWJA 3CFEB 5C9JB 3ES6A 4XX1G 5KS9A 2DDQH 2C5DC 2H8PB 3GIZH 1C5CH 2DM7A 3P9LA 2NTSP 5JXAH 2NY0C 4OBSA 2QADD 1CDIA 4R0LA 2D0GA 1D5XB 2DQEH 1U8NB 4M5ZH 5ADOH 3OG6B 4F8TA 3G5XB 2QQKH 4HPYH 1EERB 3ROOA 2DLIA 5EC1A 3MXVH 4P2OD 1JZ3A 3IRZA 4OGYL 1Q9OA 4JFDE 4PP1C 1MREH 5DEFA 4Z5RB 4G8GD 3T3PE 3FZUD 4XCYA 4X4XA 5E5MA 1X5GA 4Z7WA 1CFQB 1X5ZA 4L8DA 5IJKA 4JY5L 3SDAC 3IXTB 1NGQH 2BC4B 4QGTA 1T89A 3RVUD 3WXVL 5I8OH 4OCXH 2WBWB 1UXWB 3MMEA 3O4LE 2YPVH 3CX2A 4L4TB 4LHQB 3MYJA 3IJSB 3HC3H 5ELIA 3DXAB 3MV01 4XMKL 2VDQL 3VE0B 1KXTB 4JHWH 3RGHA 1QLEL 3VD5A 2I9TB 5ICXB 3WO4B 3BDBA 4IOFC 3RX7A 4XPBL 4ZFFB 5EU5A 4JDZB 1FYTE 2DJUA 5F88A 4XPFL 1LK2B 4HUVB 3EYVB 3SGKC 4N5ED 5CZVL 1G9ML 5FUCE 4B50A 4S11A 1FFNB 3T0AA 5DT1L 2XZAL 4L8SC 1N3NA 2BNRE 3CC5A 1K8DB 3ALWA 5IKCB 4TTDD 3RTQC 3VI4F 4JZOA 1MCPH 1NC2D 3BWAB 4X7TB 5D70H 3S88L 1RURL 3BH8A 2JJVA 35C8L 3G5YA 5JHDE 2CIIA 5CGYC 2AQ3A 3V6BR 4PJ5A 5GGSB 3GUTB 1WCQA 1QOKA 2EDKA 4EUPG 5DUBB 1HQRA 3RWCB 5E2UL 1KB5A 2IG2H 3QRGH 3VFOB 4NO0A 5B3JE 4H8WC 3RDTD 1ND0B 5TF0A 1K4CA 4OSUH 3I3DA 1RZGA 2BFVH 1GZQA 2PTVA 2YD9A 25C8L 1FFOB 5C9KA 5F96L 2OXHA 3IFPB 4LSSL 2AJ3A 1RJYA 2V5TA 1NGPL 3K80A 1HINH 4XH2A 1FORH 1YA5A 2YWZA 5E6ID 4HUKB 4IOSD 2WAHA 4K9EC 2NPLX 4QXGH 1WEJL 3UJTH 4EI5D 2XKSA 4KDTC 1MIML 4NKOA 4M9OA 1KCRL 2VDOL 3O8XB 4NQEB 1F42A 3KPQA 3VMPA 1NFKA 4U6HB 1N59B 1YQVL 2EH7H 3VGDA 3ZKMC 1FJ1A 1G9NL 3K1KC 3QEQA 4G9DA 5JLZB 2DQGL 3BAEL 2IQ9H 5I1GL 3G9AB 2G9HB 3LKRB 3KYKH 2X41A 4PTUB 5D6CB 2FJGA 3TN0C 3UTSA 1JYXA 3P9WB 4LCWA 4FG6D 5EPMA 1N2RB 3JV4B 5T3XH 4WW2C 5KSAB 4UILL 2GITA 2RHEA 4PJAE 1M7DA 1PVHA 2D4DA 1RJLB 1LP9E 1UA6H 1MCFA 2MSPA 3MV8B 1AGCA 5MERA 2NY2B 1U95A 2GCYB 1T1WA 1AI1H 3RFZC 5DZOA 3MREA 2GTWB 1FVCA 2OZ4L 3SCMA 4YXKL 3OAUL 2P5EE 4RRPA 5JUEL 5E8PA 1T03H 4EXKA 3LQAC 3C60C 1YNKL 3HB3C 1E6OL 1B6UA 1A3RH 5DFWH 3QUXB 4U1MA 4Y8AA 3RZCA 2ZUXA 3T0ED 4Z7QF 1X4YA 4GQ9H 3DMMA 3AS1A 3KXFA 2ZUQC 1I7RA 4QHLA 4TUKL 5J89A 1JPSL 1FGVL 2WUCH 1WZ1H 2C1OA 3DV4A 5GRVK 4ELME 4L29B 2ED8A 1NBVL 1ZHKA 4L3EB 2YEZA 3DETC 3P77B 3K1DA 4NN6B 3S34H 5J6GB 3BXNA 3QO1A 1RZ8A 3HR5B 1MJUL 4YQXH 4JZJA 4H20L 4R7NA 1NAML 3LS5H 3QDMB 1HHKA 4EI6B 1IQDA 1SY6L 3CFJA 4PRDA 5IOPB 1ROWA 3ELAT 4BH7B 2R1YB 4CMHC 1CDBA 5K9JH 1NCBL 1T22B 3ZDZE 1HIMH 2W0LA 5KN5A 1CGUA 2FJFB 3DUHA 4HUNB 5I8KH 4MCYB 2X1WL 3T65B 4XVSL 4QHUB 5CEYB 4OIIH 5GS0L 4YDIH 3SE9H 4PJ9A 3SJVD 4LU5L 3QUYD 2OBGA 3AREB 1BQSA 1B4RA 4UINH 4OLUL 5IB4B 4GAGH 2JB5H 4LDOB 3O0RL 1CGVA 4KZEH 3KLDA 1FC1A 1I8LC 1U2CA 4BSWB 1F3DH 2EICA 1DEDA 4NBZB 1VADA 5MEND 2YA2A 1XGPB 1MHEB 1MCKA 5GSVA 2HMID 5D7SH 4WI2A 5DD6B 5EC2A 3FN9A 5EOCL 3UTTE 4CMMB 2NY4B 5F7DB 2R9HC 1OAKH 2H45A 3MROA 1LK3H 5E9DD 3FKUS 4D3CL 4WV1C 1MCNA 1ZLUH 2WBKA 3KPRE 5C0BE 5FKAB 1BVKA 4XNUH 1AR1C 4XPTL 1NDMB 3C5JB 4CAGA 1V5JA 5TDPA 4KRMB 3LVEA 4F9LA 4N8VG 4WWKD 2VC2L 3PGDB 2F5BL 1JFQL 2NY6C 1QR1B 1BGXL 3IT8D 4P2CG 4MCZB 3RVXD 3RX8A 1AY1H 4RWYH 5F7NC 5C8JA 1FN4A 1AIFB 4ZQKA 3VGEA 3FT4A 5AZ2L 2DYPD 3U0WL 3MJ7A 3UROR 3QUML 1KJ2H 5DHXB 1XGRA 3HUJF 2HYMA 5KSUB 1DUYB 1CTOA 2FL5B 2IADB 3HZMB 3L9RA 4FZ8H 1QFPA 5D1XA 2VYRE 3FHAA 2KH2B 1PY4A 4NC1E 3FFCD 5J1TC 4Y4KD 1KLFA 3OHXA 5CIPH 4WW1B 1A6WH 2VITB 4QRPD 1YMMB 3EAKA 4TNWF 4U6XA 1EXUB 5TE4L 4Z7NE 1CFTB 3WV0A 2C7UB 4LVOB 1IM3A 1QPXA 2A73A 4JLRA 4DTGH 1MHCA 5CP7B 2VMFA 1TFHA 1G7IA 4JQVA 4RGNE 4XNMB 1KPUA 2AAVA 1F4XH 4CADA 4DKAA 3EDDA 2XY2A 3WNLA 2ESVB 1KIPB 2CKBA 3MNWB 5J8OA 4ODBD 3O3EB 3HUJA 5C09A 1MLBB 1QBLH 4IMKA 1EFXD 3UCRA 4I0PA 3P0VH 4PY7A 1G6RB 2VR5A 3OKLA 4GAJL 1OTUD 1QHPA 5JW3L 5GRZA 1GCFA 4MX7A 1XGTA 1RK1B 1YECL 3QQ4B 4R96A 3TO4D 1WC7A 3HAEA 3ILQC 4YHPA 4K8RH 3RWDA 2JF1A 2R1XB 2ORBL 3MLVL 4HCRL 5DYOB 1QBBA 1IAOA 2HP4A 1TJIL 1CZ8H 4HJGA 4GXVH 5FB8A 1EAPB 1ZHNB 4GJTB 2AJVH 2VWEE 2X4UB 2H2PD 4MAUL 2DQJL 1MI5D 1T0MB 1TZHB 2ITDA 1UKSA 4X6EA 2GT9B 4P5KA 3GRWA 1MWAH 4GRLD 2ZOLA 4U4BA 4DW2L 2UZYB 2KKQA 2VRAA 1T2JA 4LASH 5DF0A 1AKJB 1I3VA 5D1QA 3GJFA 4ZSOB 2YWYA 2ZUTA 2GY7B 4L5FL 5SWSD 1BFOB 5T33H 2ILLA 3MSPA 3TPKA 2XTJE 4LKXA 3FQTA 2IANE 4RMQA 4ZAKA 2JJSC 4JKLA 4P5TD 5GSRA 1I7ZB 1H0DB 4HX1A 2VXQH 2A1WL 4Z0BH 3T0DA 4UOW0 1P2CA 1RIVH 5ENWB 3Q6GH 1JK8B 3WUZA 1NLBL 3RGVA 1MEXL 3N85H 1RAMA 3TVMB 4PRNB 1GIGL 3QIBD 1PG7L 1CFNA 1MCCA 3H6JA 2QSCL 3LKOB 1B4JH 5D7LD 3W11D 5HGDA 3VRJB 3KPNA 2OTWB 4G6JL 6FABL 3WFEL 5FHAL 4NZJA 4ZUTB 3E8UL 3NFSH 5B38B 5DK0B 4Y2DC 3WIHL 1KCSL 4GG6E 3MFFB 2GSIA 4Y5VB 3CUPB 2Y72A 4LSUL 1UADC 1MCRA 1JN6B 3GMNA 5CJQH 1EDQA 2XN9B 3WEXA 2BVQB 3LOWA 1I1CA 3D18B 3GMLB 1MNUL 5EZLB 3RPKA 2FATH 2HJKA 4C83A 1AO7D 2A0LC 3O6FD 1E4WL 1NC4A 5CHNB 1CQYA 1X5JA 1XF4B 1J05B 3RWGA 2AEQL 4R6UA 3X13A 4X7SL 4K3HA 2E6PA 3MR9B 4HKZA 4Z95L 3O3AB 4YR6A 3TBVA 4XB8A 3TBWA 4NT6A 3SDCC 3EOBB 3IF1B 3GSQA 5GS3A 3PV6A 1I8IB 4PRAA 1UACL 4P9HC 2GUOB 1IJ9A 1S7TA 3QRFM 3GSNL 5E5UB 5IFAH 3VFVB 1JCKA 4ZUSA 2XICA 4OLWH 1PYWA 4BZ2H 5IW6B 2I60H 2Q86B 5FOJA 5BOPA 4ONHA 5MP6L 3PHQA 2OLDA 4G42B 5EU6A 4JRXB 3VJ6A 4UNTA 5C2BL 1ACZA 1IFHH 3DGGB 1MHHA 2FRGP 1JHLH 1F45A 5ANME 4M5YL 4HS3B 3IJYB 4HUUA 2HVKB 2WLYA 3UZEA 5EORH 1KBGL 1G7HB 1CDCA 5C0CE 2XKUA 3KLSA 3PWJB 4UNUA 5KS9B 2DJ4A 1PJ9A 3FO2B 4G5ZH 1FPTL 1IGCL 4O58L 3P9LB 4HXBH 2LU7A 4ZFOA 4IS6B 3EDEA 3W39A 3SBWC 3HHRB 4OZHB 3BP7B 5DDHA 3ROOB 3H9HA 5EC1B 5C07A 3C6LC 1ORSA 1GOHA 3ESVF 1I75A 3M8OL 4X4XB 1JUFA 3O2WL 3BUYA 5DJCB 2F53A 1JYNA 3DO3A 4L8DB 1TNNA 1SJHB 1QSFE 1V7NL 4CBPA 1D5ZB 3MMEB 1RI8A 4R3SA 1JF5A 1JRHI 1KJ3H 3DUUA 3WUWG 1X5KA 1QACA 2RJMA 1DQDH 3GBMH 4YBLB 3OKKA 4Z18A 4KPHL 1MVUA 4Q9RL 4R97B 3U30B 2PW1A 4PB9H 3W2DL 2B4CL 1OSPH 2VAJA 4DAGH 1OLZA 5EU5B 5E8OB 4I3RL 1F58H 5E08L 1UGNA 4HF5L 4POZD 3D39D 2B0SH 4U6VL 1P7HL 4ZXBC 1N3NB 1KN4H 4NQEE 3I2CH 4IOIA 3KNBA 1UB6A 3CC5B 2XKNB 4KHTL 5JPMA 5FA3A 4JZOB 2KBGA 1S9WB 4Y16C 4G6KL 3C8KA 3BH8B 1I9IL 1BIHA 4ODSL 3G5YB 2CIIB 2X4TA 3OJDB 4M93B 1I4FA 3F7RA 4PJ5B 1GGBL 1NCDH 3DX6B 3U9UA 3QG7H 4I0KA 5EBGA 1HQRB 2QQQA 4XCFL 3H9SD 1FAIH 4KDVA 5FO7A 3R8BB 1D9KC 1LD9A 5F7UA 3TV3L 4NO0B 1D5MA 1KG0A 1F4YH 2ZUYA 3C5ZD 5D1ZA 2HRLA 1K4CB 4PJ8A 1GZQB 1RJZB 4KJWD 1NMCC 4LVNB 4A6YH 2W60A 3C08H 2R29H 4M4RA 1O0VA 4WFEE 4WI7A 2AJ3B 2JJTA 1ZAGA 1A1OA 1LO3H 4LQ1A 3MACH 2NY5H 5F6IC 5MEPA 3GK8H 1EMTH 2VDPH 4NQCA 5C7XL 2ZKHL 4LRIC 1IGIH 5CWSA 1MHPH 3V6FA 1A6PA 1MCDA 4TSAL 2NTFB 4X6CF 3NFNB 4TVPD 2BCKB 4HKXA 3TWCL 3KPQB 2HTLD 5IB3A 2R15A 4BZ1H 4L3EE 1U91A 5F7WC 1FJ1B 1PQZA 3ZL4H 3QEQB 1CFVL 2V17L 2H2SC 2W0FA 3QNXA 4Y5XA 1GL4B 3KYMA 3FTGA 3G6DL 1ZGLA 2FJGB 3UTSB 3FQUA 1KPRA 4JHAL 4LCWB 5EPMB 3QDME 3DMMD 2GITB 1HWGB 3KXFD 4N90E 1HYSD 4ZS6C 4DKFL 1EVTC 4RA0C 5TE7H 1YZZA 2HVJA 4I2XA 1F3DJ 1AGCB 5MERB 2VLLA 1U95B 2EXWC 5AAMA 1RUML 1IZJA 1T1WB 3BX7C 1H5BC 2BK8A 3D2UA 3MV9D 4D9LH 4X6CA 4Y19A 1XZ0A 3INUL 4UT9L 3SCMB 2W9DH 1JGUL 2NCMA 1QZ1A 5E8PB 5BZWA 5E99L 3HMXH 1Q9LA 3OKYA 4XMLH 5HHXL 1QLRA 3ROLA 5DMIH 1XMWA 1E4KA 2BHZA 4YHOL 4LCCC 5FGCE 2D7OA 2EDYA 4C59B 4U1MB 4DUVA 4WY7L 3RZCB 1S7SA 3STBA 4ZO6A 2XI9A 1QUNA 5B4MC 1I7RB 1MF2L 2OM5A 2DI7A 4OIAA 3DRTA 3L1OH 3QPQD 1UM4H 1L7TH 4K2UL 5CMAA 3DV4B 4U3CA 4ZO9A 4PJ9D 1OW0A 5FGBC 2ED9A 3QWRA 1I7TA 4POYA 4JN1L 4LIQE 1ZHKB 2WWMD 1DANU 1NSNH 3JTSA 4QRRA 3A6CH 3G6AA 4HS6A 4PD4K 3U46B 3BXNB 3QO1B 1DLHA 1INDL 2A6IA 3H0TA 2H3NA 2I9LA 4XPAH 4JAMA 4KZDH 5IK3A 4JZJB 4R7NB 4PGBA 2APXA 1ZT7B 2FSEB 1IQDB 4TSBL 5GGQH 3CFJB 3MX0A 2IF7A 1H3GA 3QR2A 4O02H 4JR9H 1K6QL 1UWGH 3UTOA 4M6OH 5KN5B 2LE9A 1WTLA 5LBSL 1B6DA 4TQEH 4FFVD 4KAQL 4P4KA 4FQCL 5JNYA 1KCUL 3L5JA 4YFEA 5EO1A 1CLOL 1EGJA 4NJAL 3QZWG 2YRLA 4ZPVA 1QSVA 3V0VA 5KAQF 4XVJH 2YUZA 3ZDYE 5ITBL 3RVWC 3WSQH 2PETA 2HN7A 2LVEA 3GKWL 1VADB 5DVNA 3IAPA 2EECA 4X0KA 3PV7A 5GSVB 4YHZL 4CGTA 2O5XH 3CMOH 4AEIL 4KVNL 3KR3L 5EC2B 3CDYA 5HGBA 3L5IA 2VXUH 2BRRL 1UXSA 1JVKA 2QQLL 5D1XD 2ESVE 3EKCA 3TA3D 1K4DA 4WFFD 4M9PA 2I5YL 1AD0A 4HWNA 2XWJA 1WT5A 5TDPB 3VXSA 1FHGA 1A1MA 4LKCB 4PB0L 1JTPA 2VJXA 4QTIH 5LVEA 2ZCKH 4Z7UB 5FOBA 5C8JB 1FN4B 1B90A 4ZQKB 3FT4B 4C57C 3FB6A 4RWHA 3MJ7B 3D3VD 5KVGL 5TDNA 1XGRB 3ZYIA 3QHZH 4OUUA 1JGEA 3QG6A 1IGFH 4JN2A 1X4ZA 4OB5H 1VFUA 1P4BL 3L9RB 1G0DA 2DOCA 1CICC 5SX4I 4I0PD 2XA8L 3BE1L 4G6AC 3BDYH 5C0RL 5K9KA 1N5YL 4OKDA 4WTZG 5D7JC 5KANI 1JF1A 1DLFL 5HYEA 2NY3C 4K3JH 3OHXB 5EZIH 3ZSTA 5J6HB 3RNQA 2E27L 4U6XB 1Q8MA 2X7LA 5LGHL 3LQZA 2A73B 3JV5A 4JLRB 4J7RA 3PNWA 1MHCB 4NQUA 4LSQH 3MRQA 3VU2A 3MBEC 5C0GA 5J9PA 1KPUB 1RUAL 2VDRL 2FGWH 4OLZH 1U3ZA 5IW1A 2OP4L 4CADB 3ARSA 4MNGA 2CKBB 3QHTC 1KCVL 1YY8A 3HUJB 5C09B 2ZCLL 4DVBA 1WZKA 5LGJA 2AKRA 3JVGC 2X09A 2IFFH 1R6VA 4PY7B 3OKLB 5I76A 1T7WA 3VFSB 4M7ZB 4XP5L 4ZYKA 3TNMA 1WC7B 1Z0MA 4ETQA 3RL2A 2AW2A 4ZAKD 4HUMB 1KPVA 4YHPB 2WINA 1ZT4B 3RWDB 1GH7A 5KVEL 1IAOB 1A9EA 4HJGB 4WI5A 1WV7T 1BZQK 2F54A 1I85A 3SN6N 3BQUC 1BEYH 4XNQA 5I75C 1QG3A 1U3HD 3CK0L 1TETL 3RGVD 5DZNA 4QWWD 3WS6A 2XN9E 4X6EB 4IRZH 3AM8C 2ZOLB 4OCWH 4LRNL 2AJUH 4GAYB 1MCOL 5JXED 3NPSB 5J1AA 2NLJB 5D1QB 1VFBB 2Y36H 3VWJA 4CW1B 3WFBL 5CGTA 1FDLL 1TPXC 4X80L 2R23A 4WDIA 4Y4FA 4MXQC 5IFHL 4LKXB 2NY1D 1A0QH 3SE3C 4U2YA 4ORZC 5INDA 1G7JB 3NACL 1DANT 5GSRB 1JHKH 3AVEA 5TJWK 4HX1B 1MFDL 2ZSWA 3K8KA 1P2CB 3ARDB 5FM4A 5HVHC 4PJXF 1SHMA 4LL9A 5C71A 5CP3A 5J12C 1NC4D 5CSGA 5FYKL 1KUMA 2PW2A 2H26B 4N8PA 4OD2A 4ODHH 5C6PB 4GBXD 1VEOA 5F1KC 2EDLA 2X1PA 3NCEB 1F11B 4JRXE 1CFNB 4HJ0D 4W4OA 3BYYA 1OARH 1UKTA 3KPNB 5EG6C 3VG9B 4P2RD 3CGTA 3GNML 2V5MA 3TJEH 1AFVH 4N0FB 3VA6A 1LVEA 3LKSB 4OFVA 5TF1L 4PJFB 1Z9LA 4HWUA 3GMNB 5KS9E 5GS0D 1CGYA 4QRQA 4HG4K 5JHLH 3WEXB 2F58L 3V5HB 3MPCA 2APVA 4PJXA 1OAYL 1OGAA 3ZSSA 4NRZA 4OZHE 3T4AA 1Z5LA 3X13B 1EK3A 4EUPA 5JW5A 4J3VA 3VGBA 2Q1EA 4HKZB 5EO0A 1LO5A 4YR6B 4DGVH 3TBVB 4CU8A 3RAJH 4NT6B 4WNQA 4HIJA 4AMKL 1WAAF 4BFIA 4Z6AT 2IPTH 2DMCA 3PV6B 2JIXB 2PYEA 1T7XA 2EC9T 4AL8H 3JV6A 3ARGD 4PRAB 4E9LA 3LIZL 1V3MA 2Q3AA 3L5WA 3LKNB 5CCKL 3VWKB 4MMZC 4ZUSB 1RUKL 1PYWB 1SQ2N 1NEUA 3MQIA 5BW7A 2VDNL 4FXGA 1M6OA 3PHQB 3VXMB 5EU6B 4ZOCA 2A9NL 5CILH 3SGJA 4OT1H 5HDQL 3VJ6B 3B9EA 3WDIA 2DM2A 3CFBA 3JWOC 2QADC 4X9HA 1VA9A 2ATPA 5D71H 4YFDB 1MHHB 2RAMA 1Q94B 3WO4C 1CU4H 2OCFD 1QBAA 5C0NC 4HUUB 3HFMH 4RMRA 4OZFH 2PO6D 2HWZL 2P48B 4P2OC 5E2TL 4DN4H 1SYVB 1WAAA 1HZHL 2VQUA 4AEFA 4RSVA 2CR6A 4L4JA 4DCQB 5EIIA 2EIZB 2VLME 4ZFOB 1DQTA 3RVUC 1IGJA 4AT6A 3VFPA 1JMZA 3H9HB 2DQTL 3P0YH 5C07B 4ZOAA 5CSZA 1ORSB 1DN2A 4PJ5E 5IWLA 1BOGA 3CVHA 1N64L 2DQUL 3UO1L 1JUFB 1YEIH 4MA1B 2EDXA 3BUYB 2F53B 3DI2B 4RFNB 4XTRD 3U79A 4NC2B 5I19L 4U0RB 3F7PC 4HQQL 5DGQA 3B43A 2VDKL 5D9SB 1J1XH 1XCTA 3MRNA 3SE4C 4OI7A 4PLOB 1MIEH 4R3SB 5JZ7D 5IFJA 3B9KA 4H8WL 4JGMA 4WFGD 1AD9B 1N8ZA 3VI4E 2AQ2A 1TCMA 3LDBC 3S35H 4MWFB 4HJJH 1MVUB 3RIFF 3OZ9L 4PRPA 1FNGB 4JKMA 1V3LA 1MRCL 2ZUVA 3S6CA 3SKOA 2A83A 5GHWL 4LHUA 5BMFH 2R1WA 2R8SH 1PZUB 1XF5A 5M94B 4K9EL 5T3XE 4OCSH 2AV1A 1LEKA 5CEZL 1UM6L 2XZQH 3KNBB 1UB6B 2R69H 3CSYA 4GQPH 4P23A 4NNYA 2V2WA 2WSKA 4L8CA 1EHXA 5JPMB 1R3JA 2RB8A 4OM0H 3NVQA 3ET9F 1ZK9A 2OXGA 4XNXH 2X1OA 2IGFH 3QEQE 3C8KB 3TIDA 1H3PH 2UZIL 2F15A 3RDTC 3QFDA 5EO9B 3EJZD 5FKPA 4RGMB 1NCWL 3UTSE 1I4FB 2H1PH 2QEJA 1I8KA 3MA7B 4NJ9L 1U8LA 2EEAA 3FQRB 1IC1A 4ODWA 5KBNC 3O6KL 5FO7B 1LD9B 3S37X 1OY3B 5E6IC 1KG0B 1NLDL 2EH8H 2CSPA 2VDMH 4UB0H 5D1ZB 2ADIA 4PJ8B 1F8TH 5GRXG 5FA4A 5DJ8A 4HWZA 3GSWA 2W60B 1AGEB 3EYUL 1N6QH 5IHUL 3NAAH 2BRQA 1A2YA 4GRWH 3DHMA 1F4WL 2F74A 2VLKA 5SWZA 4FABH 1FG9C 1A1OB 3LQAL 4FQJH 1QFOA 4NQCB 2DI8A 4JPVH 5E24E 1T3FA 1PX4A 3SKNA 1KENH 3QUXC 3BGMA 4D8PA 3NZHL 4FNLH 1LNUA 3O3UN 2E7BA 3MUJA 4YHML 3AY4A 2X05A 4FG6C 2LQRA 4KK9D 4HKXB 4Y19D 2O5YL 1CLZL 3OKNA 5IB3B 1ZGLM 4LSPH 4S1RL 4N8VA 2MPAH 3ZKSD 4PG9B 1PQZB 4FFZH 3QJHB 5F7EH 4HLJA 3QNXB 4Y5XB 4FQXB 1H8SA 1KB5H 3FTGB 3KYMB 4EVNA 3UJIL 1ZGLB 1B2WL 2FHBA 4BH8A 3BKYL 3FQUB 4K07A 1J1OL 1M4KA 4UTBL 3DHJA 4X7EC 2FLRT 4MJID 4MA3B 1PKQA 4FQQA 1IM9A 2HVJB 4CJ0A 3QFJD 4I2XB 2AGJH 2VLLB 1S7WB 1T1YA 4Z7QE 4JM4L 4P0DA 4RMVA 3T0EC 3D2UB 4X6CB 5BRZD 1XZ0B 3WO3B 4P48A 3QUZA 4H0IA 5BZWB 2AK4A 2ENYA 2OMNA 2VERN 2ERJB 3QDGD 2BZDA 4IRSA 3ROLB 4XP9H 1S7UA 4Y7MA 3AS2A 4DZ8A 1BFVL 5DFVD 4KHXH 1JPFB 3A67L 2YXFA 3EYOA 4HK3J 4GW5A 1A47A 1ZEAL 2CH8A 3QWOA 5ILTH 3DRTB 4JHBA 3ARZA 1BD2A 4JG0L 5I1EL 3KDMB 4V1DB 1NCNA 4IRJB 1I7TB 1EJOH 5CD5D 1TJHL 2JTDA 3WHE0 4QRRB 2CXKA 5CD3B 3TBSB 2ZG1A 2UY6A 3G6AB 4HS6B 3FN3A 4F57L 5HHOA 1CL7L 3RWFA 1DLHB 5HHPA 3H0TB 2H32H 2H3NB 2I9LB 4HGMA 2EDEA 4JAMB 5I1JL 5IK3B 1QSZA 2MCPH 3QUYC 5E56A 4Q6YA 4TVPH 4Z7UE 1G1CA 4KROB 1SEQL 1U3JA 2FBJL 3SO5A 5C2UB 3QEUA 1FO0H 4JPKH 3LEXA 4JJ5A 5ID1A 1L0QA 1FL5A 2VL5A 2HMIC 4OCRL 2OL3H 4P4KB 2BHUA 4WI8A 3AXLA 3MV7B 3VXSD 4UV7H 4UT6L 5EO1B 2J8UF 4ZPVB 2KL6A 4WTWA 2BSSA 4EIZC 4HIXL 4GSDL 1Z9SA 5TGBB 2EIEA 1VPOH 4Q6IC 5KVFL 1HNFA 1HDMA 3MRMB 4X0KB 5EOTA 4KQ3H 1U3YA 5JOFA 4U6TA 4WWKC 5D2NC 1MRDH 5DUML 3GHEH 4O2FB 3EGSB 4J4PA 2RFXB 5HGBB 3ZO0A 3HRZA 4XVTL 3RVXC 3FO1A 3FB7B 1UXSB 4NNPL 2CLZA 4TPRL 2HT3C 1WCBA 3QDHA 5DJ0A 3WXWL 2CKNA 3PWVA 1P7KA 1E27A 4BYHA 4M7LT 2W9EL 2XWJB 1Z6JT 2WZPD 3STZA 3EYSH 2WUBH 1A1MB 3BO8A 2J8UA 3QI9D 3O2DH 4JDVA 4WUUD 5IVZB 1M71A 4ISVA 4XVUC 3L3DA 5FOBB 1XFPA 4Y4KC 3K8LA 3LN9A 4PLJD 1EO5A 1J0HA 3BP4A 5TDNB 2HT4C 2NR6D 3TZVA 2UWEF 3HPLA 3NCBB 3QG6B 4UOW1 4JN2B 2J5LB 3MLSL 5DMYA 3N0PB 5K9KB 4XNYH 3CFKB 2QSTA 3CFDB 1X6LA 4UZGA 4LLMB 1KN2L 1S9XA 4RDQF 1CQKA 2DIJA 2W91A 3T4YB 1JF1B 2AEWA 4JY5H 3RNQB 3M17A 2FBOJ 2X7LB 3LQZB 5DMJB 3RBSA 3PNWB 1LO0H 2BNQA 3UBXG 3F58L 2F54D 2Q8AL 4JRYD 3EZ8A 1EEYA 1NCTA 3MRQB 1QEWA 3GKZA 3TO4C 5FO9A 5C0GB 5J9PB 1RIHL 4MGXA 1C5CL 1MFAH 4MNGB 3LRSA 5FDYA 1J8HD 3DX8B 4JPIA 1YY8B 1P7QA 2UWEA 2DQEL 4M5ZL 4YBQC 4DVBB 3RJQB 4NYLB 5LGJB 2AKRB 4APQD 4ORGA 4XPBH 2QQKL 4HPYL 4NO5B 2ADFH 2FWOA 3RX5A 3BHBA 1NBZA 3MXVL 1C12B 2XQBL 4X4MA 4JFQA 1MREL 4F15C 3OJ2C 5DT1H 4ZYKB 1Y6MR 4ETQB 1JZ7A 3RL2B 4H0HB 2WINB 1WLHA 5ALCH 3BPCA 4MZ3A 1A9EB 1R5WB 2GJ6D 2VLJB 4LAQL 3CCHB 3S88H 1MJ8L 1RURH 5H94B 5I8OL 3MRKA 3NCJH 35C8H 3H7BA 4OCXL 4PJFE 9CGTA 4JFEA 2WP3T 2YPVL 1BP3B 5HHNA 2FNBA 4P5TC 3DROA 4OD1H 3QH3A 5D93B 4JHWL 5E2JA 2LU3A 4U33A 5HHMD 3K46A 5ISZE 3FRUA 4Z7VB 5E2UH 5HYIA 3VWJB 1PZ5A 4JFPB 5IQ7H 2R23B 4Y4FB 5I1AA 3F7VB 4OLXH 2E7HA 5JO5A 3QIBC 5HHQA 3PQYA 3QIWA 3QCTL 25C8H 5F96H 1HCVA 4MAYA 4O2CA 4BUHA 2ZSWB 3UDWA 4LSSH 4MXVF 3WUWA 5F7YC 1NFDE 4NKIH 3CXHJ 4P9HL 3IGAB 4OD2B 1ZA6B 1DTUA 4WRLA 4NP4L 3U4BH 3VXME 5MHSD 3IDXL 5FYJL 3RPIB 2NQCA 1KCRH 2VDOH 3DVGA 3W5MA 2WLZA 2OJZL 1B88A 1GZPA 3O6FC 2DLFL 5DVLA 3VRIA 3UZVB 2Z8RA 4QCIA 5K93A 2IG2L 3QRGL 3GRWH 4XPHL 1G9NH 5A2LH 3ZE0F 1XGYL 1DBKH 3BAEH 1YJDC 2XY1A 4QKXB 2BFVL 4NRYA 3GJFH 2J6EL 4QRQB 4PJ7F 5ESQB 3BVNA 4WHYH 5DJZB 5EU3B 4E41A 4RFEB 3ULVF 1QSEA 4PJXB 1OGAB 1WIOA 1HINL 4NRZB 4M8VA 5DJ6A 5K59F 3IVKA 1NUDA 3T4AB 1Z5LB 2Z31A 4R0LC 4EUPB 1T2QL 5JW5B 4R2GD 5C07E 5IP4A 5EO0B 1LO5B 4GAFB 2FJHB 4WNQB 4HIJB 3V0WL 2OZ4H 4YXKH 2QBWA 2K9UA 3OAUH 4BFIB 2PR4L 2ITCA 1YUHA 5JUEH 3WNKA 2NNAA 1QFWM 3BWUC 4U1SA 5C0AD 4JHZA 2PYEB 4ZG1A 3JV6B 1YNKH 3BD4A 3OTTA 2EH7L 2J12B 3F65A 3L5WB 4ZO8A 4Y2OA 1G7MA 1YEHH 1I7UB 1TVHA 5IJKC 5HYFA 1HI6A 2VISA 5F9AC 2YHGA 1T89C 2RIKA 3VXRA 2KDGA 5C0DA 4PJ7A 3HE6A 4S0SD 1VENA 4DQOH 1HH9A 4TUKH 5F1OB 4WTXA 1ETZA 1FH5L 2AV7A 1XAUA 3CFBB 4HC1A 4PP2B 5L2KD 4PV9A 1UA6L 2P43B 2WNGA 1NBVH 3RUGF 1ADQA 4R97C 1ZHBA 3U30C 2P24A 1AI1L 1I9EA 5T1KA 3PP3K 4F33B 2VL4A 2VQ1A 3DUSA 1T03L 5EIIB 4H20H 4UI2A 1NAMH 4KK8D 2XWBA 3WHXB 5INCA 1SY6H 2Y5EA 4X7CC 1A21A 2FEEI 2DLEA 3M1BA 4PJGF 3RA7L 5ICYA 3E6HA 3CDGA 2ARJQ 4ZUVB 4AT6B 3VFPB 4YWGL 3TH3T 4F7TA 2X9WA 5CSZB 3OB0H 4XGZB 1KF9B 5SX5K 1OQXA 1BOGB 3CVHB 4XVSH 5F3HA 4G80A 3K2MC 4N0UE 5GS0H 1YEJH 4LHUD 4FFYH 5DD1H 1WBZA 4MD0A 2MQ0A 3TCLB 3RUGA 3RNKA 4P23D 3O0RH 1FBIL 1I3GL 1ITBB 1IC7L 3MRNB 5TH2A 3BRFA 3LRGA 3Q5OA 1J0ZA 4POZC 5IFJB 3B9KB 3AB0C 4X6DF 4LCIH 3WYRA 5FXCH 3I6LD 1N8ZB 2CLRA 3LS5L 3V6OC 4JGJA 5HSFA 4PJGA 4NN5B 4PRPB 4D3CH 1YNLL 5T1DH 4B7LA 3DNKA 2A83B 5E7BA 1BZ7A 1PLGH 4XPTH 2R2BB 1XF5B 3LKPA 5EBWA 1MCLA 5IEKA 5EN2A 5DHVH 4OIIL 4EBQH 3SE9L 4D9RD 4M7JH 3CSYB 2VC2H 4NNYB 2V2WB 2F5BH 1JFQH 4R7DB 1R3JB 4XBPB 4UINL 4GAGL 5D7IB 2JB5L 5DD5L 1IILE 2ZNWA 2XPGA 3TIDB 2DF3A 3B6SA 4P46B 5AZ2H 2YKLH 3QFDB 3U0WH 5CLTA 4X6DA 4YLQT 4LLYA 1OTSD 5FKPB 2OR9L 5GGTA 1KTRL 5JIHA 3LD8C 3ZT5A 1I8KB 3P0GB 3QWQB 1SBSH 3V8OA 1HHIB 4AG4L 1FC2D 4GRWB 4HHAA 3SDXB 1PFCA 5ACLA 2IBZY 1XF2A 1LK3L 2E9IA 1WISA 5KW9H 3QZWA 5LXGH 2ADIB 3S4SG 2VNCA 4XNUL 5DLML 1Q1JL 3VFNB 5DJ8B 5I71B 4HWZB 5JTWA 2F9BT 1R5VA 3GSWB 1C5BL 4KTEL 2WIIA 1A2YB 2HTLC 3MJ9L 2F74B 2VLKB 1NJ9A 5SWZB 3TFKD 3QB7C 2FX9L 1LEIA 2XG4A 1Q9WA 2JCCF 5ALBL 2ADGB 3SKNB 4CVUA 3C9NA 1KJ2L 2HH0H 3RZCC 1QR4A 1DSFL 1V05A 2AVGA 1WBXA 3Q5YA 2KUTA 4ZS7L 1CS6A 3DMMC 4GAJH 5JW3H 2P5WA 4V1DE 3OKNB 1HYSC 5E2VL 3RL1A 1AXTL 1YECH 4N8VB 2ICWI 1JP5A 3IXAA 4KTDH 3NCYP 4IRSD 3KS0H 1I1AA 3HZYA 2NY0D 3MLVH 4HCRH 5JOEA 2H9GA 2FECL 3MRCB 1FNLA 3NIFE 3SKJH 4H26A 5C92A 4MAUH 1A02N 4XAKD 1R5IB 4DEPC 1KYOK 1INEL 2JCCA 4JEGB 4FQQB 1BD2D 3LEYL 1GSMA 1KTDA 1T1YB 3T3PF 5FO8A 4WTZA 1I9RL 4GKOA 4NQDA 1QKZL 3L3GA 4M43L 4AK1A 3MV7E 3QUZB 2J7LA 4MQXD 1ZLWK 3T09A 3QPQC 2AK4B 3UJJL 4PRHD 1R3KA 1S7UB 4PJ9C 2DKMA 3EOTL 3DX9B 2WWMC 3PHOA 2Z0BA 3TPUA 3WBDA 5F9JA 2A1WH 5C6WH 4HT1L 1HN1A 1F3JA 3B5TA 1T83A 3HC4L 4P4RA 1FZOA 4N8CH 1NLBH 3EYOB 4IOFD 4NC0B 4GW5B 1HKFA 1M7XA 4RISL 3L7EA 3QWOB 1TTUA 1WWWX 1PG7H 1U8KA 4JFDA 5GGRA 3MTRA 1AC0A 1MWAL 4GKSB 1YQ2A 1EFQA 4GW4A 3G5VB 3OAYH 3PG2A 4G6JH 6FABH 4OGAD 5LJYH 1EEZA 3V6ZA 5HHOB 3WIHH 4FFVC 5HHPB 5HVWA 5T33L 1MELA 3BD3A 3CLFL 4LSUH 4F9LC 5JW4R 4J4PD 4HS8L 2VXQL 4JY4A 4Z0BL 3QEUB 3NGBB 4HDIA 3Q6GL 1E4WH 3MLWL 3LEXB 4JJ5B 5ID1B 1FL5B 2XNAA 2AEQH 4L3CA 3AXLB 4K3EL 3L3OB 1FYTA 4Z95H 5B3JF 5CBEA 4F7PA 2BSSB 1LWRA 5D1XC 2VLRB 3DX7A 2BNRA 3BZDA 3LV3A 1CD0A 1R0AL 5D6DC 1OSZB 2YRPA 2K3TA 3WNOA 3NFSL 3GSNH 1JGDA 5EOTB 1PG7W 5JOFB 1LO2L 5IV2A 3TF7C 4EDXA 5KG9A 3BN9D 4OM1H 5CEZD 3HRZB 5E9DE 4ERSH 1WCBB 4MNGE 2VN4A 5GRWA 5DJ0B 4LFHD 3PWVB 4OZIE 1P7KB 1EBPA 3TNNA 4FTVA 2C3HA 2NYYD 2YPLA 4M5YH 2L7UA 3STZB 4FP8L 2VXSH 5J7CC 12E8H 3BO8B 2J8UB 4IMKC 4JDVB 4YZFE 2Z8WC 1QFUH 4I0PC 1M71B 4ISVB 3WDJA 4MXWH 4XWOD 3L3DB 1FPTH 4O58H 5I1HH 4M7ZC 4XX1E 3V4PL 43C9A 5FFLA 3BP4B 4K71B 2VLJE 4PJAF 3TZVB 3V7AG 3WMSA 1RZFL 3JWDH 4HUXA 2CD0A 4BZ2L 1FE8L 1CVRA 5F9WC 4QY8A 2YUXA 3M8OH 2WP3O 1S9XB 3QDJA 1VSCA 1JPGA 3C60D 3R4DA 1IFHL 4Z7VE 3M17B 3OF6A 1V7NH 4ZFGH 4P57B 3RY6A 3NPSC 3OBAA 1CCZA 5EORL 3U0PB 1I9JL 2BNQB 4ESKA 1HSAA 4F7MA 1XIWD 3L95A 4EEEA 1EEYB 2JB6B 5A3ID 4BQ6A 4G5ZL 4ZAKC 5C08D 4YGAB 1OWWA 4MNQB 4JPIB 1P7QB 2DBJA 2UWEB 3E2HB 1QLFA 4PJAA 4Q9RH 2V2TB 5KSBF 2B4CH 4ORGB 1K5NA 4ELMF 2FWOB 3DETD 4I3RH 1HXYA 3RGVC 3OAZH 3BHBB 1NBZB 1WUNT 4UAOC 4YXHL 3PL6A 4JFQB 4QWWC 1K2DA 1J5OL 1BPVA 1HHHA 2P5EA 1IAII 4R8WL 4KHTH 4G8IB 4ODXA 3BPCB 4HAGA 3D85D 4G6KH 2MOVA 3MRKB 1I9IH 1O5DT 4MYWB 3H7BB 1FYHB 3PE9A 1DQJB 4JFEB 4J3XA 5HHNB 4MJ2A 2R0WL 1FSKB 5I74B 1T0NA 1A6ZA 5HI3C 3DROB 4KJYA 3GBML 3QH3B 4PJXE 1YNTA 5IR1A 5KSBA 1JZ8A 4XCFH 3FRUB 4EXPX 1U2HA 4PB9L 1JIBA 5TE6L 4EJ1C 1PZ5B 4ELMA 1OSPL 3NFPA 2BMKA 3TV3H 4CNIA 5B8CC 3IKCB 3CJJA 5JO5B 4GBXC 2OSLB 5HHQB 1NCCL 3PQYB 3QIWB 5I18H 5DHYA 5DWUL 4HJ0C 1D6VH 1OAXL 4MAYB 4O2CB 5K9OB 4OIBA 4UIKH 3WUWB 3IDUA 5I0ZA 3O9WB 4E41D 3LZFH 1JZ6A 5A40E 1QSED 5C7XH 4I8DA 4X9IA 2ZKHH 5IB5A 1UH3A 1AR1D 4V2BA 4K3DL 4OAWA 5E94B 3IKKA 1TVDA 2GK0A 2NZ9D 1M7IA 5IROA 3JSSA 1RPQA 5JW4Q 5T3ZD 2NY6D 5JA9A 4QCIB 3JWOL 4JY6A 3HKFA 1BX2A 4JFOA 3HCVA 2V17H 1SM3H 1RSFA 2Q6WB 3C8DA 4NRYB 2WBJB 5I6XB 3G6DH 3RHWF 2BVPA 5L2JA 3WKNA 4JHAH 3C87A 1NGYA 5I9QB 1G84A 1LO3L 3MRLA 5DJ6B 2VDPL 2Z31B 2OTUB 1RUMH 4MSWA 1I8MB 3P4MB 3PUCA 3DSNA 1KIQA 4DK6A 1EPFA 3INUH 4UT9H 2GQHA 5HD8D 4D0CA 1JGUH 3GDBA 3MRJA 2NNAB 4U1SB 3HS0A 5E99H 3ZE2E 4R4BA 4HFWB 4Z7NF 5KTEL 5HHXH 2YD4A 1DUZA 2EDQA 1PY9A 3VXPA 1MCHA 5HI4C 3S96A 1G7MB 1G0XA 4ZDHA 3ZL4L 1HI6B 4WY7H 2PO6C 2VISB 2ZZUT 2X4OA 3VXRB 5C0DB 4DN3L 4PJ7B 3HE6B 1U8HB 1CTNA 2X89A 1ETZB 5GJTH 4L8BA 4NGHH 3M07A 1ZV5A 4PY8I 2CLVA 4PRPE 3SY0A 1II4E 2B39A 1G6VK 4JN1H 5DFTA 1T6VN 3ILQD 5JIIA 1ZHBB 5T1KB 2X9XA 2VQ1B 3DUSB 3PWUB 1SVZA 4TSBH 4M3JA 5INCB 5D7IE 5DMIL 4QRSA 2X4NA 3M1BB 5ICYB 3CDGB 3LPGA 1ZGLP 2DJSA 3ULUE 5JZ7C 5LBSH 4HWEH 5GS1B 5F3HB 4KAQH 4FQCH 4GRWE 3SDXE 5DC0A 1KCUH 4WI9A 3L1OL 1IC4L 1L7TL 3EHBC 1CLOH 4MD0B 4NJAH 1C5DA 5CZXD 5EWIH 2FO4B 1FFPA 3RNKB 1U8JA 5GJSL 5TH2B 5IIEA 1HNGA 3V4UH 3QQNA 3RVTC 2J4WL 2FGZA 3SDDA 2H41A 4TUOA 3S7GA 4P3CL 8FABB 3IDYC 3SHSA 3X14A 2MNUA 5DRWA 1H15A 4YHZH 5AYUL 1PGRB 4PJ8C 4XPAL 3KR3H 1RK0A 5SWZE 1YEFH 5GGQL 4PJGB 4KI5E 3NMEA 3KS0J 2BRRH 1T20A 3UPRB 2JJTC 3AS3A 3OKDB 2I26N 1UWGL 3H42H 1Y6NR 4QNPE 2DI9A 2I5YH 3EJZC 3QUMB 4NQSA 4X6FA 1REIA 2XQYG 3D39E 3LKPB 5EBWB 5C0IA 5IEKB 5EN2B 4J23A 1U92A 1JGVL 1L6ZA 3O45A 4GG6F 4D9QE 2IANA 2Z92A 4ONFH 4CRPA 3L3HA 3GEWB 3LCYA 4YHYC 3PP4L 3WSQL 4X6DB 4G6FB 4LLYB 5CS7A 4P3DB 2EXYC 4QF1B 3NABL 3VXUD 5F7FA 2XA8H 3BE1H 2YPKA 3CXDL 3ARBA 3H9SE 1XF2B 4JM2D 5HYQA 1MCEA 2P45B 3B5GA 1J11A 3QA3A 2BXYA 1DVFD 1DLFH 3KPSD 3ZDXF 3QZWB 4NUJA 2NX5D 1DQLH 5FUOL 1Q0XH 3EO0A 5J4MA 5JR1L 2FH6A 3WHE1 2MQCA 5FYLE 1BVZA 5LGHH 1R5VB 4GG6A 2P8MA 2AK4E 4KK9C 2WIIB 5D8JL 3RWHA 3U0TA 2PYFA 4GMSH 1BBJA 4YO0A 1NJ9B 2EYTA 2YS4A 1F00I 1LEIB 1Q9WB 4S0TD 1KCVH 3C9NB 1H3UA 1KV3A 1U8NA 5EU7E 4ZD3H 1WWBX 1GC1C 3QHZL 4KK6C 4LSDA 3G5XA 2P1YA 2P5WB 1S7XA 3BUTA 1I1AB 3HZYB 1OW0C 3ZYZA 1CGTA 1SJXA 4JFFD 3G04A 4D94A 4X99B 4H26B 3CK0H 3MXWL 3C6LD 3OR6A 1XR8B 1UFUA 4QT5B 3IJSA 5A16A 2JCCB 4JKPL 2NXYB 5IUSA 3QPXL 3VE0A 4HBCL 4P49A 5DFVC 4JFDD 3MRGA 4LRNH 5ICXA 3S36X 2I9TA 4NQDB 3MV9E 5ANMA 1NGWA 1FDLH 4X80H 4GH7B 4ZFFA 5D96C 3BKML 4KKBD 4O2EA 5IFHH 1ZLSH 1R3KB 1U58A 2XXCB 3ALPA 4P4KC 1DN0A 5DR5H 5C0CA 3NACH 5CD5C 2VLRE 3JXAA 3PHOB 3TPUB 3HE7A 3DIFA 4Y4HA 3UBXA 3O4LD 4JO1H 4U1HA 3OL2A 4FQ2L 3MGTA 3S5LG 1WTGT 4CDHA 4P4RB 1FZOB 3JWDC 4D0BB 2HJLA 3QIUA 5IMOB 1EJ6A 4M6NH 1LDSA 2M26A 3L7EB 1BEYL 3CZJA 1U8KB 1FYTD 5HGHA 1RZ7H 4GW4B 4OFYA 4ZTPL 5SV4A 5DD0L 3TESA 1EEZB 1DJSA 3GNMH 3I3EA 4Q74A 3V6ZB 1JJUA 2A6JA 4NBYB 4LSVH 1QSFA 1T1XA 2A6KB 3FOMA 1A0QL 2Z8SA 1DBJL 2DICA 2D3VA 4OZ4A 2FB4H 2EE6A 1JHKL 2F58H 3PWNA 1FFOA 1G6RL 2BNUA 3IFPA 5JHDD 4JY4B 4PJDF 4LDLB 1DBML 4HDIB 5IBLD 1QPPA 2XACC 3MRIA 4PRIB 2IAMD 4L3CB 3LEVH 5DRNA 4N9OB 1A5FH 2J5LC 4J3WA 4AMKH 4F7PB 2C9AA 3MZGB 2XG5A 3O8XA 3DX7B 2BNRB 1OARL 1ONQA 3LV3B 1IGML 3LMJH 4LGSB 1VGEH 3LIZH 2E9WA 2QSVA 1JGDB 4Y1AD 2OJEA 1W0WB 4DGIH 2A38A 3SO3B 2L0DA 2BNQE 5JLZA 1ZHLB 3VDAA 5IV2B 3R8QA 4EDXB 5KG9B 4LCYA 5L8JB 1JGLH 2G9HA 3LKRA 1YYLL 3SGKA 2C3VA 5D6CA 2OR7A 1FIEA 4RX4D 5HDQH 4PJDA 4PLKC 5KSAA 4MNQE 2X4RA 4NHCL 5A43C 1JV5A 4R26L 1W72A 1YN6A 2Y06L 3MUY1 4FTVB 2CMRH 2QHRH 3RTQA 5HYJD 2YPLB 4Z8FL 1KLUA 4UUJA 3ARUA 2ZOKA 2X9YA 1PKOA 3GI8H 3OF6D 2HWZH 5E2TH 2H2SD 4DGVL 1HZHH 3RAJL 4MQSB 1HXMA 3QNZA 1ED3B 1RUQH 1INQA 1NFIB 3RZWA 3VGAB 4LEXL 43C9B 1IVLA 4ZS6D 4XXDA 5F6HI 1WZMA 5F1SA 1T04A 1UWXH 4KKNA 2VXVL 3HG1A 2B1AL 5J11B 1I85C 5IT2L 5CILL 1QNZL 3QDJB 2X1QA 3PL6D 1NUFA 3WS6C 3RKDD 1X5HA 1JPGB 4LBEA 4LVEA 1XR9A 2P5ED 5I19H 4KXZH 5D93C 5JPNA 1BQUA 1L9NA 1L9MA 4L1DA 1LGVA 3P77A 3VWJC 4DN4L 5I1KL 4JJHA 1SEBA 3LSOA 5J6GA 1FL3B 4Y4FC 1I3RA 2W0KA 4H8WH 3VI3E 4F7MB 1R3LB 5B4MD 4X7DC 4JO3H 3HR5A 1OAZL 2NZIA 2APBA 5FUZH 1FGNL 4EI6A 3RVVD 2XA3A 2JELH 1CIUA 2E6QA 4PJAB 5IOPA 1QLFB 5DEZA 5HBBA 3OZ9H 3W81A 4BH7A 4HZAA 3VD7A 4QTHA 1K5NB 1T22A 1JYWA 1MRCH 3RI5F 1HXYB 4LCUA 3F12B 2FJFA 3IFNL 5GHWH 2X4SB 2DM3A 1F5WA 3T65A 1K2DB 4K9EH 4QHUA 1HHHB 2PF6A 5CEZH 1UM6H 3Q5TA 5DA0B 3TN0A 4E5XA 2P7TA 4ODXB 5IB4A 1JF6A 1X5LA 1J1XL 2UZIH 3HNVL 1NKRA 1NCWH 1T0NB 1A6ZB 1YJDL 4NJ9H 5DD6A 5FHBH 2FIRT 2W07A 3S35L 3T0BA 4MJ5A 5F7DA 5KSBB 3O6KH 5BS0B 3LQMA 4ELMB 3NFPB 2BMKB 5FDWA 3G5ZA 1NLDH 5MI0B 4HKJA 5FKAA 3ZDYF 1QHOA 4XAWH 3O3DA 1L6XA 1ZKAA 5BMFL 1NDMA 3BOVA 3C5JA 2R8SL 5IJVA 4OFKA 3CPLB 4GS7B 4OCSL 3BPOC 1MCSA 1U6AH 5IHUH 1F4WH 4YC2C 1QR1A 3LQAH 4U1GC 2E7CA 4D2NA 4XHJD 3UTTD 3FAXA 1AIFA 3VXRE 3T04D 5IB5B 1UH4A 1OD9A 3IDNB 4OAWB 2H1PL 2YN3A 3SDYL 3KPRD 5C0BD 2FL5A 3FB5A 3U4EA 5J13B 5E6YA 1M7IB 5C0EB 1CGWA 1UM5L 2BJML 4LF3A 1JHTA 1CLZH 2O5YH 3SGJC 5LGKA 5HY9A 4P2RE 4S1RH 3SQBA 4ZPTB 4JY6B 3PWPB 1BX2B 4JFOB 1P9MA 3HCVB 2EH8L 4UB0L 4YNYA 2VITA 5L2JB 2BVPB 1B2WH 1CFTA 5T1LB 1J1OH 3F62A 1NGYB 3IDJA 3NAAL 1CICD 1IZKA 3J8F7 2X89D 4HIEA 1BFSA 1IBGH 3MRLB 5IVXE 4JM4H 2ESVA 1KIPA 1KENL 2M1KA 1KIQB 3DVNA 4D0CB 5LKNA 3D5OF 5CJBA 2WMPA 5IWLC 1HK6A 4Z7OE 5C86A 1DUZB 3VXPB 4G9FA 3PXJA 5JORB 4ENED 1OT1A 4LSPL 1RK1A 3S96B 5JIPA 4ZDHB 1CD8A 3MZTA 4FFZL 4NKQB 4AIZB 5F7EL 2R1XA 2GJZA 2X4OB 3A67H 4RGND 5DYOA 5IHLB 1KB5L 4JCMA 1BWWA 1MAML 3G6JE 2F8OA 1FIGH 1EAPA 1NUNB 4CVZA 1ZHNA 2HFTA 4L8BB 3PDOB 4JG0H 4WGWB 4BQBA 3WKMH 1FL6A 2A9ML 3BPNC 4CN6A 2CLVB 3SY0B 3WIIH 4F7CA 2NW3A 5DVKA 3BKJL 4NN5C 4OV6F 3RWIB 3LS4H 3O2VH 1OOAA 1CL7H 1DQMH 4BZYA 4BK4A 4KFZC 4QRSB 1WZLA 4P23C 2X4NB 5T3ZH 2VH5L 4X6DE 4WI4A 1JK8A 2PXYB 1LO4L 2XQYK 4OCRH 2UUDH 2IMNA 1TTGA 1IAIH 1TNMA 3TVMA 3R0MA 4UT6H 1Q9KA 1C5DB 1FFPB 1ORQA 1U8JB 4HIXH 3LKOA 2XTJD 4GSDH 4EN3B 2IAND 5IIEB 5JIKA 4HC1H 3TBYA 2OTWA 3FRPG 3SDDB 5BV7B 4TUOB 1CG9B 3S98A 3X14B 3AC0A 1H15B 1JRHL 4MMXC 5F7LB 3MFFA 1ADQH 4Y5VA 2MCPL 4HXAL 4AIXA 5EFIA 4TVPL 1P4LA 5F7HA 1UB5B 2GFBA 4XVTH 2EYRA 5HPMA 4F37K 4TPRH 3GMLA 1J0KA 3WXWH 4JPKL 4NQSB 4X6FB 1C8PA 5L0QB 2W9EH 1XF4A 2HA1A 3O4OB 1U92B 3O45B 4YEFA 4K23L 6CGTA 4UV7L 3FMGL 2AABH 2Z92B 3L3HB 1GGCH 3MRBA 1PEZA 5GZND 1IRAY 5HGAA 1ZANL 3ESUF 1VPOL 3W0WA 2EZ0D 1FVDB 3MLSH 4OZHF 2BSED 1OCWH 4RZCA 2GW5A 2AXGA 1MRDL 3I3BA 3TFKC 1QRNB 2BSTB 3J7HA 5HVGB 3ARBB 1BHGA 5HYQB 1EV2E 1KN2H 1MLCA 2BVOB 5DJ2B 3QA3B 1QTYT 4NQDE 4NUJB 3OMZA 3IJHA 2ZCHL 3EO0B 5DO2D 4KKCD 5DJXA 2PCPB 4UT7H 3B4NA 4GG6B 2P8MB 1HWHB 2HVKA 2WUBL 4QGYA 4RAVA 3RWHB 3U0TB 2PYFB 4NKDB 1BBJB 3QUZC 2Q8AH 4M02A 2E9JA 3FO2A 1RIHH 4IRSC 4L4TD 5I17A 2WW8A 1CE6B 2YD7A 4H1LG 4Q2ZB 3DXAD 4IS6A 4OZHA 5DGRA 3LPWA 4GG8A 5C0ND 4Y2DA 3BP7A 5DD3L 4H25A 3TC9A 1S7XB 2XQBH 4BQ8A 4KRPB 4XNYL 2A2QT 4UBDD 1T2XA 5DJCA 2IEPA 1SJHA 4LAQH 1KT2A 5KSVA 4MQXC 3KJ6L 1MJ8H 3G04B 5C6TL 5I1DA 1D5ZA 1IGTB 1LO0L 3OR6B 2CR3A 5A16B 2PTTA 3FQXA 4MJIE 4NN7B 2UV3A 4YDLC 2UYLB 3W9DB 1MFAL 5HHVL 3SKMA 3MRGB 4M6AA 1L4IA 1MOEA 3X17A 3VFGH 3QEGL 2V5YA 4PRIE 2VR9A 4OFYD 4EIGB 5ANMB 1NGWB 1C08A 2ADFL 5E8OA 4O2EB 5BVJA 1U58B 5K9QI 3QDGE 1DN0B 5C0CB 1EO7A 3MBXL 3BGFC 2ZJSH 3QCTH 3HE7B 3DIFB 4Y4HB 4XPGL 3UBXB 4AYFA 2X42A 4LQFH 2XKNA 3PIQB 4U1HB 3MGTB 4OGAC 5ALCL 4KJQD 3F8UB 2EE9A 1S9WA 2HJLB 2YD8A 3QIUB 5IBTL 4P9HH 4N1CA 5AWNH 2DKUA 2XZCH 3NCJL 4K3GA 1JNNL 4NP4H 1RV6X 3OJDA 3IDXH 5FYJH 4J4PC 5HGHB 3DX6A 1GXEA 4OD1L 4NRXA 2P46B 4CN1A 2OJZH 4J3UA 1T66D 4HH8A 3PWLA 4FTVE 2DLFH 3HN3A 4ZUWB 1J88A 2EDHA 2YPLE 2A6JB 4NQED 5BVPL 1QSFB 4XPHH 4BJLA 5IQ7L 1T1XB 1VEPA 3SBWA 5F70A 2CKBL 4OLXL 1XGYH 3FOMB 4X5XA 1ZA3A 2ICWJ 5F89B 1I1FA 2J6EH 4OZ4B 1RJZA 3NN8A 1NCAL 3PWNB 1KTKE 4LVHB 3ARFA 2BNUB 2K7PA 4OZFG 3MRIB 5KSAD 4NKIL 3U9PL 2YD1A 1C1EL 2VIRA 3SDAB 3GBNH 5DRNB 1T2QH 1H3WM 4UIMA 3BN9C 2P47B 3ARQA 3EDKA 3MV8D 3U4BL 2G75A 2NY2D 3V0WH 2N7AA 2NTFA 3NFNA 3QDJE 2PR4H 3OGCB 3UYRL 1E6JH 4RAUA 3HZVB 2BCKA 1ONQB 2IH3A 3P30L 1M1SA 2NYYC 1U42A 4R4FL 2YBRB 3FHQA 3GRWL 2OJEB 2L4OA 1SBBA 2RBLA 4M7LL 4NM8L 5J06A 4WFED 2BVTA 4ZO7A 1DBKL 3OG4B 3NBNA 3GMOA 3QUXD 4LCYB 4A2MA 5L8KB 4XWOC 1B0WA 4TTGA 1TZGL 2C3VB 2XFXA 4PJDB 1C16A 1FH5H 4L8SB 4ZXBA 2X4RB 3EIFA 1F2QA 1JV5B 1W72B 1YN6B 2VDLH 4TYUA 5CUSH 3CLEL 3RTQB 4XZUA 3QEHB 1KLUB 4UUJB 2ZOKB 5EA0L 3V4VL 2L7JA 1JZ5A 4OF6A 3VD4A 4L3ED 1O7SA 4WUUE 1TJGH 1HXMB 2VZOA 3QNZB 2Z4QB 4OZGB 3T08A 1INQB 3I02A 4KMLB 1MFEL 3OKOA 4HUWA 3TIEA 3RA7H 4XXDB 1YEHL 3QDMD 4ZOEA 1T04B 4YWGH 3CAFA 3HG1B 5DURB 5JDSA 1XIWC 2HG5A 3TEUA 5T1MB 5A3IC 2J88L 3QP3A 4DQOL 1CGSH 5KSBE 4U1IB 3E3QE 4LBEB 5BS0E 1XR9B 1DEEA 1IGYA 5JPNB 2X4PA 1FBIH 3B2UC 3ARED 1I3GH 1AJ7H 1IC7H 2CPCA 3HPJA 3OPZH 1SEBB 2LVCA 3LSOB 1I3RB 3B8YA 3U46A 2I27N 3GSXA 1IT9L 2X6MA 1ZT7A 2FSEA 1EIBA 3FL7A 1VERA 2IWGA 3OSKA 4I3SH 4MAYC 3UDWC 4NQTA 1XEDA 2NY4D 1YNLH 4QTHB 1RUPL 4LCUB 3D9AH 1WIUA 4DKEL 2I07B 3NZ8B 1AXIB 3HRPA 4IEFB 4YK4C 3V5DB 1MAKA 4U0QB 4TOYH 3I9GH 5CEXA 4X4YA 3TT1H 1J0JA 1YEJL 1A8JH 1CDHA 4FFYL 5DD1L 3TN0B 3GHBL 3T2PA 5GGSY 4E5XB 2P7TB 2EIDA 2AJSL 3PWPE 5DD5H 5E8DH 4Z7UF 5FGCB 2GJ6E 4J8RA 3Q0HA 5T5FH 2OR9H 1OF2A 4LCIL 4AG4H 1UQSB 4P99A 4LSTH 4MJ5B 5GRJH 1A1NA 5T5NG 3E1F1 5FDWB 2YUWA 3G5ZB 4LCCA 4RNRA 5T1DL 4BUGA 4I3GA 4HKJB 3WS3A 2Z31C 5DLMH 1PLGL 3O3DB 4QRTA 5IJVB 2FZ3A 1Q1JH 2CUMA 3EFFA 2VZ1A 3ETBF 2KQNA 4EBQL 2NZ9C 4NDMA 2ZUQB 4LKCA 4M7JL 1C5BH 3ABZA 5GQBA 4KTEH 1YMMD 3MJ9H 3H7LA 5B21A 2FX9H 4Z7UA 4QOKB 1U9KA 1TQCC 5ALBH 2HT3D 5FGBA 1A7OL 2YKLL 4UDTB 5CIPA 3GM8A 3AGVA 1A9BA 1X7QB 1X3DA 1YYML 3PHSA 1LQSR 1DSFH 1SBSL 3U4EB 3FB5B 3HE6C 5E70A 4ZS7H 5CKAA 5CJ5A 4LF3B 1JHTB 1KTLA 5HY9B 5E2VH 3ULVC 1P4IL 1AXTH 3TO2A 4XVUD 3U82B 5KW9L 3FN0L 4G6MH 4CMHB 5C1MB 5LXGL 3S3PA 5J6HA 4YNYB 2EE2A 1QFHA 4M3KB 1KB9J 5HD8C 2HT4D 3TJHD 4OFPA 1UWEL 4OUOA 3U83A 4N0CC 4JZNA 3OKMB 3IDJB 2VABA 3DARA 5DK2A 1MFCL 2GEEA 1INEH 1KCLA 4HIEB 1CDUA 2BDNL 4WO4A 3LEYH 3ALXA 1YY9C 1I9RH 5E8NB 1QKZH 1MCWM 2YN5A 3D48R 4M43H 5MEOA 2CRIA 4NQVA 2HH0L 3DVNB 1OVZA 3X12A 3N1FC 4RRPG 1AKJD 2IALA 3S4SB 3RBGA 5C0AE 3UJJH 3VFSA 1JL8A 4NSKB 4G9FB 4KKLC 3EOTH 1MWAA 2DTSA 4KTDL 1GOFA 1ZT4A 4HT1H 2GJZB 4WV1B 2JJWA 3HC4H 3GIVA 2R0KL 4YBQD 1RD6A 3IETA 4RISH 4JFXB 4HIIA 3SKJL 5GISL 4CVZB 2BOBA 4XRCA 4PBXA 2E7LA 5GRVL 2D7MA 5E03A 3EYFA 4JFHE 5CBAB 1FL6B 4XCNB 3FQNA 3TVMD 5CJXA 4F7CB 4PREA 2NW3B 3BN3B 3CNKA 4GAYA 4MS8D 1ZLVH 1VHPA 5KZCB 2NLJA 1VFBA 5TDOB 4UTAL 4CW1A 4WU5A 1BOYA 1KEML 5E2WL 2NW2B 5AZEH 4IBLT 2Q8BH 3CLFH 4LARL 5CZXC 4PJFF 5SWQA 5L9DL 1G7JA 4G8EA 5D2LB 2ARJA 4HS8H 1LE5B 3ILPA 3N1GC 2XN9D 3ARDA 3V9FA 3MLWH 1JMXA 4N8CL 4ODTH 4IHOA 1A7BA 1JBJA 3ZMRA 4K3EH 5J57B 1QRNE 3X3GH 2H26A 3SPVA 1A3QA 4QLRA 5IESH 1Q9KB 1RZIA 3BMWA 1BAFL 1F11A 1ORQB 2HJFA 3MCKB 1KELH 4LLDB 4XCEB 1FQ9C 3MBEA 3TBYB 1R0AH 4GXUN 5CINH 3TCXA 3ULSA 4XC3L 5D5MF 1XF3A 4TULL 2EYSA 4N0FA 1L0YA 1NFDF 3OQ3B 1LO2H 2CO7B 3LKSA 3I6LE 3P9MA 4PJFA 5EFIB 1P4LB 1N6UA 3BKCL 2GFBB 2EYRB 1OL0A 4AQOA 5HPMB 3V5HA 3JTTA 3B83A 4JRXD 3F7YB 5ISZA 2GKIA 1F4AA 2IH1B 3GSVA 4FP8H 4N0RA 3NTCH 4PY8J 1ACYH 1GC1L 1M05B 1UYWL 5HDLA 5I2IB 4GUPB 3BQUA 3WLWC 3ARPA 4JM2C 3ZDXE 3MRBB 2B5IC 4IDLA 1DVFC 1KGCD 3FT2A 4JG1L 2JIXA 2Y07L 4OQ1A 5ID0B 5HGAB 3V4PH 5D5MA 5A2IH 3W0WB 5I0DA 1NFDA 1I1AC 3LKNA 4JQXA 3QCUL 1RZFH 3VWKA 3MUGA 4RZCB 4G7YL 2AXGB 4K7PX 2QJDA 5CZKA 1FE8H 3VDBA 4OM1L 1UC6A 3VXMA 3SE3A 1MLCB 5I73B 3WFZA 1OWRM 4ERSL 3H9ZA 4Z77A 2Y7QA 4LP4A 3IJHB 3GFUA 5DMGC 5DJXB 5GIRA 1Q94A 4HV8A 5FYKE 2VXSL 3S37H 12E8L 1X5YA 1TCRA 4RAVB 1I9JH 2HKHH 4XP4L 1QFUL 1SYVA 2NXZB 3CFCL 3VH8G 2EKSB 3OJVC 3D1MC 4MXWL 4C56A 4DCQA 1GPOH 3EZJB 5I17B 5I1HL 2EIZA 3MRHB 4F9PA 1EGJL 1EZVX 4FMKA 1T1ZA 5C3LD 2F19H 1T83C 3JWDL 4GG8B 4Y2DB 4DWHA 4H25B 4YPJA 4M6MH 4YXHH 5DRZB 3RRQA 1P5UA 3CSGA 15C8H 1J5OH 3AMLA 1N5AA 3HAEG 4R8WH 2AJYL 3DYPA 5I66A 3MRRA 3K3QA 4ZFGL 1KT2B 5D9SA 5KSVB 2VLMD 4U6YA 5I1DB 4KKBC 2R2HA 3TH2T 1GGIH 1MJJA 2R0WH 4XAKE 3ZKXC 2PTTB 3FQXB 4LEOA 4PLNC 1AD9A 3SDCB 4KUCF 2BY2A 1NAKL 3NCCB 3SKMB 2EDOA 1QA9B 4MWFA 2EDNA 4PJ5D 1IC5H 4L9LA 1I1YB 5TE6H 1FNGA 4J3OC 4PJCE 1C08B 1RU9H 4KU1A 4FN0A 5BVJB 4WHYG 4XBEL 1NCCH 2VZTA 4PRHE 4NO0D 3NCFB 5DWUH 2O61A 1OAXH 5FUCC 5KJRH 3HA0A 3CXHK 5ESVA 2GK2A 4NZTL 1S3KL 1RQ5A 5E5RB 3H2WA 1DBAH 3C2AL 2VB5A 1TQBC 4I77L 5EO9A 4KMTL 2ED7A 1PSKL 3ARTA 4K3DH 5DS8A 3SO3C 4P2OA 3BEWB 4PJDE 3MA7A 4A6YA 4G8GA 4N0UA 3FQRA 3MJ8B 4NRXB 4O4YL 3CH1A 3T3ME 5IBLC 4EDWH 3PWLB 3ZTJH 3JWOH 2UVEA 2IAMC 4JCLA 3B2VH 3U2SA 4P2QB 3VDCA 5KANG 2W9LA 4X5XB 1QRKA 1ZA3B 5DZLA 3UPCA 1I1FB 3QEQD 4GRMB 5I18L 3NN8B 1WSST 4OZGE 2I24N 1D6VL 1AGEA 3ARFB 1JNLL 2J1KA 2Q76B 4UIKL 3UTSD 4LCWD 2VSDA 1FNHA 1XCQA 3LZFL 2VIRB 3MCLH 4GXUM 3HG1E 4UIMB 1T21A 1C7TA 3DYOA 3KPOB 3ZZ1A 2G75B 3ME0A 1GAFH 4IIQC 4EOWH 5J11C 4RAUB 5KTEH 2IH3B 3SCMD 5HYSG 1J18A 3T8XA 3FO9A 2VZUA 4KUZH 3WE6A 4JDTH 1JNHA 1E4XI 1H8NA 3IDIA 1IKNA 2Q3ZA 4PG9A 1NC2A 2V6HA 3QJHA 1CN4A 2I25N 1SM3L 3GMOB 3V52H 4DN3H 4JKWA 3RY6C 4WEMB 4FQXA 3RZCD 5CEZE 2XFXB 1AGBB 4X5LA 3V0AC 1C16B 3HMXA 3U4AA 4ZXBB 1NEZG 4ZMAT 5I1IH 4NCDA 3UP1A 4MA3A 3WDHA 4XZUB 2Q20A 3VXOA 4HD9A 1S7WA 1QP1A 4Y16B 5IMMA 4HIHB 1G7LB 4KV5F 2Y6SC 3AAZA 4WWID 2HFEA 1X6NA 1RIUL 3PL6C 4PYHA 3RKDC 5IF0A 3I02B 5LAXA 1U8MB 2XYCA 3NIFF 4PJHE 3OKOB 4FS0A 1R24B 5B3NA 4HUWB 2V9TA 4RIRA 3TIEB 2ATKA 3N1MC 1Q72L 1D9KB 4PGEB 1JPFA 5E6IA 3HI6L 1NPUA 5JDSB 3VG0H 2HG5B 2AI0L 4EI5A 1JZ2A 5JMOC 5GJTL 5AEAA 5D7KE 1IC4H 3RVVC 4NGHL 4PIRF 5EUOE 3KDMA 5TFSL 5IW3A 4V1DA 3F6IA 1DEEB 1IGYB 4IRJA 2X4PB 5GJSH 5CAYB 4FQ1L 4HLZH 2G5RA 5CD3A 4AEEA 5F6IB 4Y1AB 4NCC1 3N50A 3TBSA 2J4WH 3HPJB 5I15H 2DB8A 4P3CH 4HWBH 2O26U 5AYUH 3GSXB 1A14H 2RQ8A 5C08E 3MLXH 3DI3B 5H37H 4GS7C 5F1IB 2YD3A 2XWTA 3BIBX 4QOKE 2ARWA 2DLTA 1YN7B 5BO1H 2BY3A 2JKXA 2QQNH 3DBXA 4GFTB 4ODUA 3O41A 4HWEL 3SQOH 5FF6A 5CEXB 4X4YB 3MV7A 1JGVH 1ZTXH 5EWIL 1AHWA 2V7HA 4CN4A 5IROC 1G7QA 4J8RB 5TGBA 3BD5A 3PP4H 3V4UL 1A6TB 2JLLA 4OF0A 2ZPKH 3MRMA 1H5BB 1OF2B 3QCVH 2N7BA 3ZHLA 5JOPE 2Z35B 1AXSA 3NABH 1BQLH 3AU1B 3EO1A 4O2FA 3EGSA 1YEFL 5F6HJ 2RFXA 3WN5C 3CXDH 2ZP0T 1A1NB 1LDPL 4XXCA 2N56A 3KPLA 4HKBA 3FB7A 4XHJC 4RNRB 4LCCB 2AK1L 4JO2L 3WS3B 3H42L 5FUOH 2EC9U 1BM3L 3NH7H 1KJ2B 1D5IL 4QRTB 5JR1H 2FZ3B 3EFFB 2VO5A 4LLWA 4NDMB 5D8JH 4G9FE 5IVZA 3BYTA 4PV8A 4UQ2A 4ONFL 1F13A 3CVHL 3UTZA 3C6SA 2ZG2A 2MQ3A 1XH3A 5CIPB 5E1HB 4KGJA 3GMQA 1A9BB 3DO7B 4XT1C 3MOBH 4OZIF 3L3KA 3Q2CA 3DGCR 5C09D 3OGOE 1KTLB 3MLYL 3CFKA 4YZFF 3SGDI 3TO2B 4OQTA 3CFDA 2Q87A 4LLMA 1OM3L 2EDRA 3FCTA 3T4YA 2E7MA 1P53A 3K74B 1DQLL 1TVBB 3H9YA 4NC1C 4BELD 5E4EC 2C26A 1B9ZA 1Q0XL 4HBQA 4I13B 4NOFA 4GMTH 1HCFX 4MD4A 5MENA 1AC6A 2Q7YA 2FHCA 4LIQH 5BOZG 4JZNB 1BWMA 4J6RH 1OPGL 4J2XA 2VABB 4GMSL 3MXWH 4NZDA 5DK2B 4WEBH 4ENEC 1WF5A 4JKPH 1OTTC 3QPXH 4WO4B 4HBCH 5D2LE 3REWA 5E9DA 3X11A 1X4XA 3DX8A 4RGNC 3FQWA 3IAQA 4OZIA 1FZKB 4NQXA 4ZD3L 5MEOB 4NQVB 4NYLA 3JWNC 5JA8B 4Z7VF 3X12B 2QR0B 4NO5A 2IALB 3BKMH 5D1QD 1C12A 5ABDE 3KLAB 1L0XA 2GI7A 1MWAB 4C4KO 4JGUA 3MA9H 4OD3L 4FQ2H 3EO9L 1JWMA 3GIVB 2DYPA 4MJ4A 1KLGA 4PJIE 1R5WA 2VLJA 3SDDC 5BV7C 3O3BB 3CCHA 3IETB 3ARDD 4ZUUA 5H94A 4HIIB 3HTLX 2BOBB 4XRCB 2E9BA 3BEVA 3EYFB 4HGWB 3FQNB 4QXTB 4QO1A 2FEDD 2VWEC 4PREB 1ZS8A 4ZTPH 4KKAD 2YR3A 2UVFA 5DD0H 4Y4KA 2CDGA 4Z7VA 4M03A 4JFPA 4KK5D 5IVOA 5ESAA 4QRPA 4WU5B 4H1LH 3F7VA 4J12A 4OGZA 1ZLSL 1I3UA 1PBYA 1DBJH 5DR5L 5SWQB 2FEEL 2F5AH 2NY7L 4G8EB 2XTJC 5HI3D 1G6RH 5D7JB 2ARJB 3QHFL 4JO1L 4JREB 3ILPB 1DBMH 4LOUD 5L7XL 3W0WE 4HMCA 3U7YL 2NY3B 5IBUG 4OBRA 4IHOB 3TBTB 4XP6L 4M6NL 1EFXA 4WHDA 1FNFA 1A3LL 3IGAA 3SPVB 1ZA6A 5DQDL 1NMAH 1S5IH 1RZIB 1MCBA 3DVIA 2HJFB 5FGSA 3RPIA 2D7QA 2VUYA 3MBEB 1RZ7L 3TO4A 4CUCA 1FNSL 1N26A 1IGMH 1SJEB 4CVXA 4JQIL 3ULSB 2ZUSA 2CQVA 1XF3B 2EYSB 2JIXD 2W1NA 4LSVL 1OP3H 2P8LA 3S5LB 5DI8A 2Z91A 5BXFB 4IJ3C 3P9MB 4AEHH 1UCTA 4O00A 3VWKD 3GSRA 3U48A 4LPXA 1YYLH 2FB4L 3FAWA 3JTTB 5ESQA 3BRGC 5GZNC 5DJZA 4NHCH 4GRLA 5EU3A 4RFEA 3VXMD 4R26H 5EU6D 2Y06H 5ISZB 3MLZL 4RQQB 2EZ0C 2X10A 3UMTA 3GSVB 4Z8FH 3AFLA 3LEVL 1U8PA 1A5FL 5SWSA 4QHMA 5A2JH 3BQUB 3GSUB 5I75B 5KAQG 2FJHA 2R4RH 4Q9QL 4P5TA 3FT2B 3TT3L 5D5MB 3LMJL 1VGEL 4LEXH 5DO2C 1RZJH 4KKCC 1NFDB 1KJMA 3CD4A 4NWTL 1I7UA 4DGIL 3GGWA 2A77H 1WFNA 3MUGB 4OZFA 4YBHA 3HI1B 3V5KA 1TPXB 2VXVH 5L88L 4KI1A 3V7AE 1UVQA 2B1AH 4WHCA 5EIQA 4X4ZA 5IT2H 1JGLL 4XI5D 1T7VA 2IQAA 3PF2A 4HFUH 1QNZH 5C07D 2DIBA 2IC2A 4Z77B 2Y7QB 4ZNEA 4M61A 2YA0A 4PP2A 4UOJA 3KPSE 2NX5E 1IQWL 4L4VB 3ZE2F 1CE1H 3MOAL 2CMRL 2V2XB 5HI4D 2QHRL 5GIRB 2EEBA 2CRYA 5CKGA 3UYOD 2F53D 4HV8B 2P49B 3GI8L 1TCRB 3BZFA 1CXEA 2PUQT 3WL9A 5I1KH 5J12B 4F33A 1LE9B 5FYJE 4C56B 5F1NA 3KWWA 2ZNXA 5HDBE 2QHLA 4UBDC 4O51B 1OAZH 1RUQL 4M1GL 7FABL 1FGNH 1J7VR 3WHXA 4GKNB 1AO7A 4Y4HC 1J12A 1T1ZB 4MQ7A 3GJFK 4NHUA 2IBZX 4ZUVA 4YHIA 1R3IH 4UMGA 3IFNH 4JKKA 2N1KA 1LILA 5FM5M 1TTFA 4XGZA 3RKPA 3BESR 2W38A 1A7QL 4YGVA 4YDKL 1N5AB 3BP6A 5GGUB 1E0OB 5ACZB 5I66B 3MRRB 3TCLA 3CVIH 3MLTB 1OHQA 4MB5A 4P2QE 5D7IF 4JFFE 4JFZL 4U6YB 4XHQA 2R2HB 4XCCL 3HNVH 1BQHG 4MDJA 3ULUF 1MJJB 4W70A 2QTEA 1VEMA 4LEOB 1YJDH 4JO3L 1EHAA 4HK3N 1CF8L 5FUZL 3WFCL 4KUCD 4KJQC 4YHLL 4GRWF 2JELL 3EHBD 3SDXF 4L9LB 1SYSB 4LVHC 5FK9A 4X98B 3RVTD 2G2RA 2G5BA 4AH2B 3U7WL 2R2BA 3HNTH 4WENB 5D1ZD 2O61B 4PJ8D 1T66C 4R7DA 4XBPA 5KOVC 3O8XC 1P84J 2WWKT 5ESVB 2QADB 5D7IA 4M62H 4KI5F 4P46A 1V7ML 3BIAX 3HLAB 4Z0XB 5T5NF 4NQCD 5DS8B 4P2OB 4QNPF 1EH9A 4PGJA 3SDYH 4A6YB 4PFEA 4G8GB 1HHIA 4N0UB 4O9HL 5FHBL 5H35A 3SDXA 2BJMH 1UM5H 3CH1B 5JW4N 1CIDA 5GZOC 3G08A 3MLPA 3IDGB 5KSAC 1A7RL 3OB0K 4HULB 3U2SB 5IM7B 1LEGA 1NQBA 2HTKC 5F9OH 4FZEH 3Q1SH 3HI5H 4XAWL 2NY2C 3VFNA 1RZKC