5EC2A

Kcsa with v76ester+g77da mutations
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec2A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec2A02
4G8EA 3HZVB 3QCVH 2Z31B 4U6YB 2AABL 3QHFH 1HYSC 3OV6A 4WI2A 3ZSTA 3VFWA 5DJ8A 4JHAL 2X4QB 2VLRD 3H0TA 3L5IA 4LPXA 4P99A 1KJ3H 1XGYH 5CJQL 1EZVY 4TVPH 4YGAB 4F9PC 3B6SA 2BY0A 5EOTB 4O2EA 1KJ2A 1MJJA 5JTWA 1ES0B 1E6JL 5EPMB 2HRPH 4R2GB 4P5TC 3QWOB 3ULVE 1KENL 1QEWB 3GJFA 1Y6KR 1R24A 3JUYA 4M93C 1I1FA 3HNVH 2F74B 3BKYH 4QTIH 2H2PC 1HWHB 4MB3A 2Q7YB 2P42B 2GSIB 2JJVA 3MXWH 4KJWD 4M62L 4N0CC 4NZUL 1XF5B 2NY1D 5ITBH 5E08L 1X5KA 4DQOL 1NAML 4MGXA 4NHCL 4JRYA 1U58A 4WU5A 5DGRA 3VD4A 2CSPA 3JWDH 4K8RC 4POZC 3FN3A 1ONQB 3I02B 1UM6H 2VDKH 4D3CH 5DEFB 2DQUL 3QO0A 4UV4H 1KCVL 5I8OH 5K93A 2R9HD 2ED8A 1QSEE 2EH7H 2YPKA 5TDPA 1XIWA 4HUMB 3SPVB 1D5XA 5C1MB 4KPHH 3EYVB 4WDIB 5GRJL 2JE8A 2D31A 1LO0L 1EXUA 4X6DA 1I3RA 3MV7B 4G6AD 3IDXL 2XA8L 4G8GA 1UJ3C 4FQ2H 1OAUH 3FZUC 2PXYB 3RPIB 4PREB 5IB3B 1T2XA 3WDJA 3WSQL 1E28B 3C9NA 2CKBL 4S1RH 3SDAC 3P9MA 4P2QB 2V7NA 5K9JL 4XP1L 4ZO6A 1ZSDA 2BCKA 4Z0XA 2Q20A 5T3ZD 5DJDA 3O4LE 3T65B 4OV5B 2WBJA 5CBEA 3TLRA 4OIIL 1RZKC 4MXVE 5FM8A 1QR1B 3T09A 1RIUL 4N1CA 4U33A 3DYPA 4H88L 1D6VH 4BH8A 5HXMA 1A9BA 1IGYA 2CLZB 2ICES 4LNRB 3HE6B 2K3TA 3LN5B 2EYTB 4S1DC 4GSDL 1WWWX 3EJZC 4JFYB 1EJ6A 3RX7A 1RJLB 2FX9L 1A3LL 2HAZA 1NGPL 3D0LA 2X40A 1YEEH 1JVKA 1XGTB 3K4DA 4OUUB 1E4XL 1AGBB 3K46A 3RGVA 3HAEH 4RAVA 3LRSB 5I8EB 1T0MA 4W4OC 1OM3L 4N1HB 1ZA6B 5JIIA 1U8NB 4G6FB 4PGEB 2FNBA 4UV7H 4WEUD 4WI9A 4UNTA 4OGAC 3FO0L 3UTTE 5E2WL 5KG9B 5CIPB 4XP6L 4B41A 1BQHG 2EO1A 4HS8L 4WGWB 5JHDA 4XPHH 4QRPA 1F3DJ 4JGJA 4DKFH 2HWZH 4GRLC 2NXZD 3G08B 1AE6L 3AY4A 4MNQE 4Y2DB 4JPIB 2NMSA 4LAQH 2W60B 3QQ9C 5C0RH 2AJUL 2XNAA 3DVNB 3O2VL 1I8LA 4B0MM 4XVJL 3VRIB 5I75C 2YPVH 4Y4KB 4GG8A 3KYKL 5L8JB 1CDIA 4XB8A 4KKCD 5DD3H 4JZJA 3NBNA 5D7JD 3W2DH 4WJ5B 5F7UA 5C0EA 3CFCL 3SDCD 3SGEH 1JYWA 1TVHB 1U95A 1S7QB 1NCTA 2IPTL 3PNWA 3ULVC 1HXYA 2H3NB 2BNRA 5FCUH 3ZE2F 2R0WL 3FQUB 3X11B 4R7DA 1F5WA 4KMTL 1QRND 4IRJA 4ZS6D 5H94A 1T3FB 5IBTH 4QGYA 1RZ7H 2X70A 2H32A 1LEIA 2A83A 4RQQB 4KJPC 5JDSB 4HKZB 3PWPE 5CD5C 3BWAB 2AEQH 2XWBB 2X9XA 3I6KA 3NABH 2V5SA 4GKSA 2P7TA 4FZEH 1RUAH 1QYGH 5DUBB 2W9DH 4MJ4A 1R5VA 2HH0H 3MUY1 1XGQB 5F7WC 4DUXA 1FGNH 3QB7C 4XNMB 4KI5D 3OJDA 1WT5C 5D7IF 5DMIH 1JTTA 3ME0A 3FQXA 1X4YA 4WUUE 4ZS7L 1I7RA 1NBZA 3QIWB 3ZHDA 1Z0MA 4OUOA 1JFQL 4FQIH 3MNVB 2X42A 1T22B 1TITA 4KUCF 1LEKA 4E42B 1MH5A 5ABDE 2FB4L 3D3VA 2Q8AH 5MEOB 2DS4A 1RUMH 2ITDB 3RX5A 2ZG3A 5LGJB 3QO1B 3DURB 2DQHH 4NM8L 4R4BB 2UYLB 5I1JL 5C09B 1FJ1A 2MQ0A 3FQRB 3OPZH 1FP5A 5EBLA 5DTFA 3B5HA 3MTRA 1VFOA 4CN1A 4XB7A 3TV3L 3QDGB 3AMLA 3ZYZA 1LO2H 4F58L 3VWJB 5IWLA 5E1AA 1RIHL 3DMMC 5JZ7D 3Q3GB 4PGCB 4QXUL 5E0QA 4PIRF 3S35H 5JORB 4W70A 4HXAH 3KJ6L 4Z7UE 2BNQB 3UROR 4S0SD 1K8DA 3H42L 3LS4L 3FO9A 5KSUA 2GJ6E 1K9TA 4WI3A 1BX2B 3QNZB 4JDTL 4CJ1A 3FRUB 2ATPB 1UYWL 1G7QB 4G9FB 2A9NL 5SWZB 1S7WB 1BOYA 1INQB 3V8OA 1Z9SA 2M2DA 3N9GL 4NQCA 3D39D 3LDBB 2ZOLB 4OLWL 2NY3D 3ARZA 1YMMB 4H1LA 3CSGA 4KV5F 2VH5H 5ICZB 1YUHA 3E0GA 4PJFE 3NCMA 1HQ4A 1G9NC 1KFAL 4HWBA 1BZ9B 3PWVB 1TENA 3RWFA 5IHLB 3MOBH 2XZAH 2Q8BH 4ZQKA 4GO6B 1R3JB 5D7LA 3LVEA 1NGXA 5I1IL 5HGAA 1RFDH 1HKLL 3QUMB 4G5ZH 4NRZB 4FTVB 3QIUD 5FYLH 1P7HL 1YA5A 1UZ8B 3I6LD 8FABA 5CINH 4P3DB 3IGAB 4CADB 3U0WL 2XV6B 1P7QB 4XVSH 1AKJB 1QTYT 5KVFL 3K8KA 1K4CB 4XBGB 4YIQB 1X9QA 2VISB 5C7XL 4XPGH 3HPJB 4ZSOA 1I8KA 1CL7H 3IJHB 3LD8C 3TM6A 4C4KO 2BRRH 4PG2A 1LP9F 1RD6A 3RNKA 3F5WA 3IU4H 4GW4B 4X8JA 5F88B 4P9HC 1JPSH 1UA6H 2AEPL 2E27L 4HGMA 4WFHD 4YH6A 4ZYKB 2E6JA 1CDYA 1KGCD 2AQ1A 4IOSD 1IJ9A 2OI9B 5L6YH 1FNEB 5D2LA 3JTSA 2R29L 2APTA 1NBQA 4GKZB 4HPOH 2HJKB 2YD6A 3VGFA 4A6YA 5T1KB 2O5XL 5JW5B 2FHFA 4TUJB 2IH3A 5F6HI 3N1PC 1ORSA 5DJZB 5I6XC 2CH8A 1JYVA 3V52H 3QIBA 3L3GA 4OLUH 4TPRL 2DIAA 3PWLB 1IAKB 5ACZB 1AQKL 3SDXF 2X4NA 4K2UL 3QUZA 3IDYB 4JFEA 2EYSA 4MWFA 1B0GA 3GSWB 5FYJH 2IQ9H 4R2GD 3LB6D 4JZOA 3IJYA 5IK3B 4Z77B 4U6VH 5EUOB 1MRCH 1ZANH 3R06A 3MUGB 5ENWA 3QWRD 3FT2A 2RGSA 4ODHL 4OCNC 4L3EE 1A7NL 2JCCE 5F7LB 5KJRL 5IB1B 1C7TA 3O2WH 2XWJB 5C0ND 2HT2D 3O4OB 3BPNC 2CUHA 4R90L 4XVUD 5MP6L 4NKIH 5CSGA 1QFWI 3G5ZA 3KYMB 3RKDC 4WENB 2F8VA 3TWCL 2VO5A 2YMXH 2Y7QB 2KZWA 5KS9E 3AU1B 3B3IB 1BOGA 4RWYH 5C0BA 1RMFH 3PV6A 2ZOKB 4JAMB 5CS7A 1D5BA 3OSKA 3D48R 1QSFB 2I07A 3L3OA 3OKEA 3CFBB 3ABZA 1UGNA 5HHNA 2MJWA 3PABB 1KJ2L 2OL3B 4QT5B 4P2RD 1JF5A 2C3HA 4LLDB 3OR7B 4Q97A 5CP7B 2R69L 3GSQB 3MV7D 4V2CB 1MQKH 3VFSB 5KBNC 1W0VA 1A1NB 4HPYH 2V17H 5KSBF 4LCIL 2ZUWA 4RISH 1EEYB 2PXYD 3TYFB 1AD9B 3V0WH 4PD4K 3RP1A 1CIDA 1KCRL 3ZKMD 1QOKA 4XC3L 1AIFA 3X3FH 2RR3A 4P2QD 4HKJB 1DEDA 4LL9A 2R23A 2PW2A 3L6FB 1T20A 3MLTB 1EZVX 4UU9B 2P48B 4NNYA 1G7PB 5JPNA 1VADB 1PY4A 2ADIA 3SKJH 5DMKA 4J4PC 4UTAL 3S37H 1UADC 2IWGA 1LE9A 3VFPA 5IMOB 2FH6A 3GI8H 3HE6D 1FORH 3FN0H 2CJUH 5C08A 2Z0BA 4K8RH 4K55A 4JKPH 5DMGC 5D7SH 2OS7A 3O6FD 2Y25A 2JJSA 5HI3D 3TBWB 2YSSA 1HQRB 3K8MA 4BSWB 3KPRA 4NWUH 2WZPD 4NNPL 4MMZC 1RY7B 3WL9B 2CIKB 2DI7A 1Y18B 5FB8B 3HZYA 5IIEA 4G6FD 3JTTA 5GS2D 3DVIA 2BHYA 1KIPA 3VWKB 3NOIA 4ODVH 2VIRB 4QRRE 3NIDF 1DBBL 4EQ2A 4Y2DD 4HG4J 2WWKT 2JB5H 1U3HC 1T21B 4NN6B 2NY0C 4XI5C 2A77L 3IFPB 4IDJH 4RZCA 5IFAH 5INDB 5KSAA 3GSVB 1RUPH 3S5LG 2YD2A 1FGVL 2AJSL 2GFBB 5IFHL 5KZCB 4LRIC 2HKFL 1YEFH 2QQNL 5HJ3B 3C6LB 5J1AA 1E4KA 2Z91B 3SE4A 4APQB 3P4MA 5GRVK 3FMGH 2P8LA 1ZLUH 1FFOA 2XN9E 4YHML 3BGAA 4M4PA 1XF2B 1D6EB 4WV1A 2EH8L 3JUZA 3QH3A 1CFNA 3Q5YA 4GW5B 3BISA 3E3QE 4FQLL 3ULSB 4PJCF 5FKAB 5IBLD 5C9KA 2X4TB 1H3PL 3QUKB 5E2UH 3M17A 1WAAA 5AWNL 4KK5C 2D0GA 5HBBA 2Y06L 2FEDC 1IKNA 1G7JA 2R0LL 3A6CL 3MLZL 4HEPG 1WV7T 1DN2A 5GGRA 3U4AA 5EZLB 5D71H 5F6HJ 4KRMB 1XCQA 3P0YL 1MI5D 2ICWA 1YPZF 2CUMA 3UTQB 4AIZA 1NFIA 1D3CA 2C1OA 2WQ8A 2V7HA 4CMMA 1IQWL 4PJ8B 4ONOA 3QI9B 4LCWA 1DEEA 1AR1C 1DANU 4WY7H 2MNUA 5EO1A 5HGBA 4ODTH 3FT3B 1YEJL 3DRQB 1N8ZB 1KJVB 4IMKA 3LKQA 4KAQL 4YHNB 2GTZA 4M6OH 2JIXB 1TPXB 4IOFD 2OR9L 5GZNC 2CQVA 3ZKXC 4MJ5A 3A67H 3D87B 1VESA 1FDLL 5GRUH 2P4AB 4XZUB 4Y4HC 5MENB 1ZHBB 5GXBB 4MAYC 3LEVL 5FUCE 1DLHA 4JHZA 1MOEA 3ULVH 4MNGB 1E4JA 2VZUA 3UBXB 3BZEB 1CU4H 4YHIA 5J57B 3HMXL 1K4DA 3L5XH 2DWDB 4LCYB 4UT6L 1Q94B 1CFSB 1GC1L 1WLHA 2BNQD 3QXDB 2IANA 4JFPA 3WHXB 2J6EH 2NR6C 1DQML 1T66C 3MRCA 7FABH 3KLHD 4XPAL 5FUOH 4HGWB 1FN4A 1DUYA 4ZAKB 5TGBA 3TN0D 4U6XB 4MLIA 4TSCH 4G9FD 4QY8A 3S7GA 4QXTB 1VFUA 1LO4L 4X83A 4C56A 3CAFA 3C09C 3I50H 2Q6WB 3OWEA 3S3JA 5FA4B 1CDHA 1JNHB 3CU7A 3DUSB 3WLBB 3W11C 2A9MH 1C5BL 3KS0J 4NQTA 1YMMD 5HYJE 3QXTA 4JVUA 4YXKH 3CVIH 3JWOL 5BCAA 2HT3C 2E9WA 2CDGA 1HHJA 2OCFD 3B9DA 4QGTA 3QHZH 4JLRA 2X9WA 2FECI 5D2NA 3VXUB 1JZ6A 1IBGH 1TJIH 5T3ZE 4XP4H 4H26B 3VG0H 5JA8B 3L3HB 5MEPA 3ROLB 2F53A 4NDMB 1JWSA 4HV8B 2OMBA 4AG4L 1KLGA 2DQJL 4LSPL 4R4NC 2BVQA 2EYRB 1TCMA 4PRHA 1QFWL 2XZQH 1MHCB 4BH7B 5I1KH 1EBPA 3WEXA 1KJMB 4RFOH 1NDMB 5DHVB 3FN9A 4FTVD 5JIPA 3OXSB 2YRZA 1BJ1H 2CGRL 2V2XB 3SJVD 3NCYP 3UO1L 1A1OA 1P7QD 3DHJA 5LAXA 1N0LA 5MEQB 1WBYB 4NUGH 5I1GL 3HUJF 2HTLD 1MCBA 3EYUH 5CEXB 1NKOA 1NLBL 4NQDB 4KVNL 1FIGH 2WIIA 5DRXA 3RU8H 1XT5A 2BDNH 3MBED 3BUYB 2AXGB 1WFOA 4LLQB 5EUKA 3BIKB 1S9XA 5D1XA 4XH2B 1NCAH 4PBVC 4QWWC 1IC7H 4BQBA 3MODH 4LLUA 4PJHF 4BQ8A 2P8MB 5HDBF 4MJIB 4HK3J 3PL6A 4X6CB 1YYLH 2WWMD 1FQ9C 1MFBL 1J0YA 1ZLUK 4POYA 3G6DL 3HPLA 5KAQG 4HWBL 3A6BL 3TIDA 3PWUA 1JV5B 4KHTH 4HIXH 1EFXA 5DMJB 1TNNA 1JGUH 4G42A 1KCUL 4GRMA 5GGTH 1QFUH 2UUDH 5T1KD 3TNMA 1T1XB 3F7RA 2FL5A 2ICWI 4KKLD 3UTSE 1G9NH 4Q9RL 1GAFH 4QTHA 5BJTB 1T5WB 2A6JB 4ETQA 2XY1A 5IVXB 1UEYA 2BSED 3N1FC 4RFNC 1JZ7A 3AREB 1QPXA 3MRFB 4QRSB 3FFCB 3QCTH 4P2OB 5IFJA 1N5AA 5IT2L 1QRNE 4L4TA 4PJ7A 1RU9H 2CDFA 4KJWC 4P5KB 5C07A 3UYRH 5DT1L 1T7WA 2NY1C 1HCFX 1MEXH 2O93L 1A6WL 3HRZA 3HC4L 4PB9H 1LDSA 1YEHH 5JW4M 1TZIB 3RWCA 1BP3B 3QG6A 4P46B 4J3UA 5DJYB 4NO0A 4ONHB 4PJ9A 1JPGA 2OR7A 3UMTA 4N1EA 4AENA 4P9HH 1MCCA 4ZUWB 1X5LA 3U46A 3DHMA 3CD4A 5CLWA 4ORZC 4Y5YA 4LSRH 5GGUA 3BE1H 1G9EA 4PUBH 5AEAA 5D93C 2HG5B 2W65B 4HIEB 3BN3B 4AM0B 1FZMA 3VD3A 3D5OF 1QSFD 3TPUB 5BVPH 5FUZH 3EHBC 4WO4B 1NMAH 4JR9H 2C7UA 1FE8L 3G5VB 1EDQA 4G6AC 4Y7MA 2RIKA 4DAGL 4HWZA 1ZLSH 3FB6A 5FHAL 1MIEL 1S7SB 4LHQB 4LSTH 3QJFA 1IMHC 5DURB 4P57A 4KY1H 3O41A 3KPLB 3T0DA 1UEMA 3B5GA 1INDL 1FLRH 2R0KL 4J3TA 3I3EA 2EE3A 4G6JH 4Q6IC 3KJ4C 1P5UA 1K2DA 4OAWB 3C2AL 2UWEF 3D2UD 5F3BB 1JHLL 3MLUH 5HHOA 5FO9B 3IDNB 3U36A 4PBXA 3KYNA 1MUJB 1OTTD 1M05A 4ZTOL 3TVMA 2VXTL 4LDEB 5DD1L 1C5CL 1FYTB 5CAYB 3X13B 1KTDA 1BGXH 2ESVE 3P0VH 4PRNB 3D39E 3HHRB 2XQBH 4ZXBD 4PV8A 3RI5K 2F54D 1F4WL 2J4WL 3NCYS 3FAWA 2J8OA 4HIJB 2X89D 1YQVL 2CRIA 3C5ZA 1MRFH 4IRSA 4MLSA 4LLYA 3O3UN 5IUSA 3HC0B 4DW2H 4Y16B 5CP3H 1KLUA 4YXLL 3HB3D 4W6XB 1VGKA 2NXZC 4PGBA 4OFIA 5D1ZB 2ADJA 1G7IB 3NIFF 4Y5VA 3HI1B 4HMDA 5D5ME 4ZFZA 3V6ZB 3G04B 3VD5A 3TZVA 3TBSB 1LDPL 3UC0H 4KKCC 2AVGA 1A3RL 5D7JC 1FO0H 1QD0A 5BRZA 3VRLF 3BDYL 1AHWA 3SDCC 2FATL 4NN5C 3V4VH 5JDJA 3PHOA 2UUDK 4OT1L 1FC1A 2WUBL 4LVHB 1N7ML 3C6LD 1T6VN 3S34L 1CG9B 1OAKH 4YEFA 5HDLA 4APQD 1GZQB 1BWMA 5TPWL 4WFHE 4MCZA 2X9YA 1KGCE 5B39A 2AJYH 3D25B 1P2CB 1WWBX 4ZG1A 3M8OH 2X1QA 4M48H 5CJOH 2C3VA 1EVUA 3IB4A 1FNHA 2VLJB 3VCLA 4TQEH 2ZSVB 2FECL 4DKDC 4YDKH 4E5XB 5HPMA 3GMLB 5A1AA 4XPBH 2FZ3A 3RWEB 4BKLA 5TQ0L 5D6CA 4GMSH 1KN2L 4LLWB 1WGOA 1QRKA 3BWUC 5E9DA 5ESAB 5T33H 1U8PA 5F96L 4KI5C 5JXED 3BRDA 3MNZA 2NNAA 2ICWJ 1JHKL 3ZT5A 2CO7B 5CWSA 1AQDA 3QFDA 3QRFM 4ACPA 1NBVL 3PDOB 1DBKL 4M7ZB 4QYOA 5FGBA 5J11C 1A7QH 1RK1A 2FYYB 1BZ7B 3AGVA 3BJ91 2NY5L 1OLLA 4PJ8D 1GGIH 3V0VA 4XNZB 4XMPL 2J88H 2FR4A 4PB0H 3LEXB 4LRNL 5E8PB 2IMMA 4PTTA 3RDTD 5HDQH 4Z5RB 4I3GA 2IBZX 3O6LH 1BHGA 1T0NA 4KROB 3THMH 2ADFL 2HT4D 2MSPA 1V8HA 2L4OA 2JIXD 4XNQA 5I1HL 3LN4A 5GIRB 4JO1H 1YNLH 4I77L 5JQ6H 5TDOA 1FVDA 4JGUA 1XR8B 3MV01 3RL2A 3WHE1 4NKOA 4RBPH 1QLRB 3ZTNH 4JQXA 5D70H 3LKNB 1BFVL 2DD8H 2QQQA 4I0PC 2KZ1B 5JZ7C 3GHBH 2M26A 2MQCA 3B5TA 4K3JH 1XCTB 4JFXB 3B2UC 5FKPB 3U0PA 4ORGB 4JY6B 5IMMA 2ZUQC 4Q2ZB 2R0ZH 4X9HA 3KHOA 3OX8A 5DZLA 4NGHL 1ACYH 4ZAKD 3O6KL 2NY3C 1FL6B 3MV7E 3RWIA 4ZOBA 1UH3A 5HGDA 4HH9A 2QV2A 1PX3A 3SGEI 1C1EH 2C4FU 2AKRA 1AH1A 5M95B 3KR3L 3MJ7A 3WN5A 2IBBA 4P2QE 5D7IB 2GYSA 5L8LB 2J7LA 3VXUD 3ZL4L 3TBTB 4PJAA 3QEGH 4KKAD 4Z7NF 5KANG 5IB5A 1B0RA 2AERT 3QIUC 3QRGL 4LSVL 5D7KE 4KXZH 1EEZB 4OKVA 5DRZA 1I1CA 1QLEL 5DK0A 2AJZB 4MX7B 4L3CA 4JFFA 4X4XA 1X7QB 4LVOB 4X99A 3ALWA 4AYFA 2FJFA 3MREA 2ZCHH 1MWAB 5I66B 4TSAH 4FFWD 3VFTB 3INUH 4XMKL 1Q9OA 3MV9B 5CFHA 1KIRB 2WNGA 3FCTB 3S35X 4OCXH 4UIKL 5I74B 1A5FH 1Q72H 1N2RA 3MRLA 3V6OE 4PLNC 1WCQA 4F3FB 4OFYD 3SE8L 3B2VL 1DBML 4X6BA 3FT4A 5E94A 5C3TA 2YUWA 3O3BA 3DTXB 5AD0B 2E7LC 1SHMA 3LQAH 1HDMA 5CHNA 3L3JB 1IZKA 3BOVA 3R1GH 5JNYA 2PTVA 1OT1A 1NGQH 3GSNH 1OGTB 3GRWA 1TVBB 5TF1H 3T2OA 3HNTL 1DP0A 2GTWB 3MLSH 4X7EC 1AGCA 2YWYA 3HLAB 4IS6A 2YA0A 3UAJD 1HIMH 3CPLA 2HJLB 5EBWB 3QCVL 5I76B 3OMZA 1FG9C 5H37H 3QHFL 2NX5A 4MXQD 5C0GA 1IEAA 4GAYB 1S5IH 4YNYA 4HKBB 4JCLA 3IRPX 1ZS8A 3RIFF 5D2LF 1E6OH 1FPTH 1KJ3L 1XGYL 3KYOA 4PRPA 3G9AB 4UOW1 4P2OD 4QRTA 1TXKA 4TVPL 4TTDD 3P4LA 2RFXA 3HFMH 1P7KA 4QLRA 5BQ7A 2DI9A 3G9VA 2EDHA 1GHFH 2HRPL 5C0NC 3FOMA 3O9WC 3OAYH 1NUDA 3HNVL 4J8RA 4HHAB 3BKYL 3WNLA 4QTIL 5HTSA 1PKQB 3WDHA 4F9PA 1JIBA 3TO4A 4P46D 3MXWL 4G7VH 2NW3A 2ITCA 4NBYB 3L3DA 3KWWA 3DETD 1KG0B 3ARRA 5JMRA 1P4IH 2W38A 1MCKA 4P5TA 4RBPK 1X6LA 1LP9B 5SX5H 1XGRB 2PKDA 5CBAA 3NFSH 1UM6L 3CFIC 4LSQH 2VDKL 3STZB 4GKNB 4D3CL 1G6RA 5GSVB 2PW1A 4P23B 4UV4L 2QLVB 5I8OL 2R1XA 2N1KA 4PP2B 2BSSA 4H0IA 1SJVA 1P4LA 4L9DA 4DGVH 1T1ZB 5CZVH 1O7VA 2HVKA 2YZ1A 1WF5A 1CL7I 5C09E 3ZKMC 1NSNH 3BO8A 5I8CB 5CKGA 3L5WA 1REIA 4HXBH 4Y1AB 3QDGE 3SDXB 5GS1C 3DUUB 3UPAA 2BOBA 1NUNB 2VWEE 3VFRA 3U1SH 1I7UB 1JGVH 1OPGH 2BNQE 3U7YH 3ARFB 4S1RL 5HHPA 2VLKB 3BZFB 3IU3B 4XCEB 3QUXA 4HAGA 5BZWA 4J23A 4QOKB 1UJ3A 3GMRA 4G9FE 5SWZE 1FYTD 1YMHB 3O6FC 1ZHNA 3IAQA 2PF6A 1EJOH 3I2CL 1D9KB 4XBPA 1H15A 4Q9BA 3SDAA 1D6VL 1YMME 1T4KA 4L8SC 3VXRA 2FX8H 1YY8A 3V8CA 3V6OC 3SQBA 1GRWA 1OCWH 2WANA 4C57C 2NY2C 5D1QB 1PQZA 1F4YH 5GSRB 4P3WA 1FRGH 3ARBA 1DJSA 1YEEL 3ZE1E 4XXDA 35C8H 4Y2DC 4OFPA 1A6UH 3RZCA 2CKBB 3EOAA 1IM3B 1JJUA 5DVMA 2Y72A 4FTVE 2R2CA 3KLSA 1HHIA 4LQFH 2VQ1A 1Z5LB 1J05B 3P77B 3DROB 1DE4B 4M9PA 4DKFL 5DD5H 3T4AB 2ADGB 4NKMB 1YY9D 1HHKA 2X1OA 4FZ8H 4LAQL 4W4OA 2HFTA 5IF0B 5C0RL 3L1OH 4NPYA 4LAJH 1MHEA 2YPVL 1JF1A 3C8KB 2J3SA 4M3JA 3BQUB 4U1JA 1SMAA 4K23H 1A7OH 3HCVB 3MRHB 3GZKA 5DD3L 3MYZA 4KRLB 2ATKA 5IJKC 4QHUA 4YJZL 4MMXC 3W2DL 3S37X 4GKOA 4X4ME 1F6AB 3VI3F 1EUUA 5IBLC 1F2QA 1WCBA 4CGTA 2D7TH 2VLJD 5FCUL 1BQHA 1SJHB 5D96C 3DO7B 5ITFB 2LVCA 3AS0A 3I6GB 4N0FB 1MJUL 1OLZA 2GK2A 5LQBH 5JOFB 2VXUH 2RAMA 2FSEB 1RZ7L 1IILE 5ID0A 5HYFA 3OAYK 1I9IH 1BREA 4F7TB 2AEQL 3NABL 1S8DA 4GAGH 1JGLH 4FZEL 5GGSB 1RUAL 1QYGL 4GRWH 3KNBB 3L95B 2HH0L 4R26H 4WHTA 5AAWA 1PEWA 4OLVH 4M9OA 2CO6B 1S9WA 4IOFC 1AGDA 1FGNL 2J6EA 2VXVH 3GIVB 3HI6H 1WAAF 5EUOE 4MA3A 5DRWB 2B0SH 5EU5A 4PD4J 3Q5OA 3PJSB 3ZDZE 2UVFA 2GCYA 4PTUA 4P5MB 4I4WB 5T1MA 4FQIL 4XHQA 1CLYH 2X4RA 2YD5A 4G6KH 4XCYA 1DLFH 3F7QA 4WHYG 5LVEA 3QXWA 1WT5A 2Q8AL 1QSEA 1RUML 4JFDD 2AV7A 2DQHL 5SV3A 2P24A 3ARPA 3HR5A 1SMOA 3OPZL 2GK0B 5FGSA 5FEBA 3HZKA 3T2NH 1RURH 2DMCA 1NANI 1CQKA 2BSRB 5GGQH 1QSFE 3DBXA 5BS0A 3KLHC 2CXGA 5L0QB 4OM0H 1LO2L 4I1NB 1CD1B 3TN0C 5F7DA 5E8EB 4PJCB 1J1OH 1NPUA 5DQ9B 1UWGH 4RGND 5CILH 3S35L 2OLDA 3CK0H 3QDMA 4HXAL 3VXOB 1J8HB 4NP4H 1L6ZA 3PGDB 1WSST 1VFAB 5EC1A 3O2DL 4JPWH 1IAOB 5DI8A 3TCLB 1OT2A 1KC5H 3O4LA 4KJQD 3BZ4B 4X5LA 3GM8A 4HUUB 4JDZA 1YZZA 3DMMA 3KPPA 4L4VB 1VEOA 1YPZB 4UMGA 3KHQA 3P2TA 1A6VH 1HILA 2VH5L 1QHPA 4PR5A 1CLZH 4XCNA 3RVVD 1R5WB 1I1YB 4WWKD 3FQNA 4LKXB 4KUCD 4D9RD 4XGZA 3QULA 1JK8A 1ZHLA 4LF3A 1T0PB 3QZWB 4FQXD 3MOBL 3MRNB 4MSWB 5I1DB 2Q8BL 1F90H 3SKNB 4NCC1 2HTLC 3SDYH 1IKFH 4AEIH 3DRTB 1RFDL 4G5ZL 2GUOA 5FYLL 1JTPA 1ZGLB 5CINL 3MBEC 2IAMB 2EE9A 32C2A 1RZGB 4UAOB 4L3AA 3QDJB 2HFEA 4XPGL 2OI9C 1CL7L 2KDGA 2PR4H 4YBLB 4AT6B 5A2FA 3IU4L 5BOZG 1JPSL 4J1UB 2OQJB 5DJ2B 3HZMA 2ERJB 3W9DA 3SGJC 5L6YL 4JDVA 2HMID 4KKLC 2Q86B 3MLXL 3G5YA 4ZFFB 5J7CC 3KXFB 4AK1A 1UCBL 2BX5A 5I8KL 1PSKL 3OKOA 3U30B 3WNNA 5F89B 1U91B 1NC2A 1DFBH 1DQQB 5E00B 1PYWB 4U1LB 4Z18A 2CPCA 4P9MH 1I8IB 4D0DB 2ZNXA 3QEHA 1S7XA 1T7VA 3V79C 3V52L 3ESVF 4OLUL 3QPXH 4GXUM 4XAKD 4NYLA 3MRPB 4D8PB 4O4YH 2E9BA 5FYJL 2IQ9L 4NOBA 4KK8D 3GSOB 1LE5B 1F45A 2ZUYA 5DDHB 3T0EC 1AD0B 4U6VL 1PFCA 1ROWA 3FFDB 1MRCL 1ZANL 3HUJB 4X9GA 2FGWL 1K6QH 4MXWH 5C0FB 1T1WB 4WUUA 3T8XA 1UB6A 3U0TA 1T5XA 4HS6A 4HDIA 2NY6C 1H0DB 2BVPB 2GJJA 3LIZH 3O2WL 3NAAH 3NCCB 5IVZB 2BRQA 3GBMH 4QHMB 4PJ7F 2UY7A 1W72H 3JBG7 1A0QH 4NKIL 4RGMC 5FM4A 3VGAB 3GMOB 3RNQB 2DIBA 3GB7A 1GOGA 4PJHB 1X5AA 4LK4A 3NCJH 5EOCJ 2EIZA 1SBSH 2YMXL 2GAZB 2XI9A 4RWYL 4OF7A 3H3BC 3TP4A 1RMFL 1OF2B 1YN6A 2OXHA 3SN6N 4F15C 5MENE 4NSKB 4WFFE 4M4RA 5HVGB 1KLFA 4OV6F 4MNGE 1MQKL 5EU6B 3IXAB 2YEZA 4HPYL 2V17L 3V4UH 5EIIA 3ELAT 3O11A 1MF2H 3SKUD 1OTTC 4RISL 1FL5B 4XWOD 3V0WL 1I1AB 4ZPTB 2PTTA 2AQ3A 2Y36H 1NC4B 4G8EB 3QR2A 4YK4B 3WIHL 3ZO0A 3C60B 4LGRB 4GS7B 4XWGH 4DFHA 1HZHL 3X3FL 4IDLA 2BY2A 1JNNH 2VLKD 1VA9A 4PRDA 5DYOB 5FDWA 3UPCA 1MJ8H 4QOKD 3VFWB 1WZLA 4ZXBC 5FO7B 3H0TB 4JPVH 1J5OH 4PJFA 5IKCA 1FO0A 1D9KD 3SKJL 4WU7A 3MYJA 4O2EB 2DDQH 3S37L 1KJ2B 3L5JA 1KB5H 4ODUB 3CFJA 3GI8L 3FN0L 2CJUL 5F7EH 1VGEL 2BZDA 1WTLA 4K8RL 5D1QD 3HB3C 3GJFB 4JKPL 1N6UA 1R24B 5D7SL 1I1FB 3VXUE 3T0WA 3LKOA 1FAIH 4EEEA 2BVUA 1XR9B 4J4PA 1G7MA 3O81A 4NWUL 2E7CA 4HUVB 2G5BA 4Z76A 2XTJD 4JRYB 5J0BA 4WU5B 4L1HA 5CEYA 5CGMA 1LMKA 5T3XH 1N3NA 4ODVL 1ZVYA 4NZTH 4OCYH 5ANMB 5E95B 4KVCH 4UDUA 3O8XA 4QRUA 2DWEA 3WIIL 1X5JA 4X8XA 3L3KB 4NQDE 2OX5A 3QBTB 3D0VA 1Z9MA 5HI4D 2JB5L 4APQC 4CW1A 2YPKB 1Z2KA 5TDPB 5IFAL 3LCYA 1XIWB 1XF1A 4PJIA 2UWEB 1RUPL 1NDGB 1D5XB 2Y6SD 2LE9A 2IGFH 3OXRA 1JZ4A 1CDUA 2D0HA 4OQ1A 2E6QA 2DTML 1YEFL 5ESVA 2D31B 1EXUB 4MJIE 5BV7C 1I3RB 4R96A 4W4NA 4F33A 1N64H 2J8HA 4BSVA 1U3HA 3VFVA 3NZHH 5FK9A 2HA1A 3EZ8A 1YN7A 3FMGL 4G8GB 4YQXH 4X6EA 1C5DA 2C9AA 2IF7A 1LQSR 4LRIA 5JXEC 4U6HB 3RVTD 3C9NB 4NQEA 2V7NB 4K3GA 4ONGH 4Z0XB 4Q0XH 5E2UL 3REWA 1ZT1B 3UP1A 4MQXD 4D9LH 3BPCB 1ZK9A 4LCUA 2HFFA 3FAXA 1KEML 3S5LA 5IVXE 5L2JA 4LSDA 3DXAA 3RL1B 4NFCA 1L7IH 2ORBH 5D71L 3RDTC 3SCMB 2YPLD 2JCCA 1WTGT 3GGWA 3FFCE 4JY4A 3ESUF 2HT4C 4I18B 4NO2B 4JVPA 3BKCH 1JUFA 1M6OA 1FZOA 3UBXG 2MTPA 1BECA 4JJ5B 4WEBH 2MCPH 1VERA 3ULUD 3SQOH 5KTEH 3OGCA 3D0LB 1DBAH 4LIQE 4ODTL 1V5JA 4M6OL 1T0MB 3E2HC 3AC0A 3EOTH 1BMGA 5DR5H 3CC5A 5GRUL 3SBWC 5JHDB 3R0NA 1PZ5A 5IV2A 2DQFA 2NTSP 2X09A 3RGVC 1ZE3C 1XH3B 3WFBH 4OI7A 1TDQA 1F02I 2LTQC 5F9JA 4YPGA 5J1SC 1CU4L 2ZG1A 4QCIA 4GG8B 1XGUA 4XP9H 5B21A 4Y4HA 4ALAH 3RUGA 1BJ1J 2GJZB 3RRQA 5F7KC 1MJ7H 3QISA 4JVWA 4JZJB 5EOQL 3BP7A 2J6EL 7FABL 2XPGA 5C0EB 4O2CA 1VFBB 3ILPA 4LMQI 2Q3ZA 2FIKA 2Z4QA 1HOCA 3PNWB 4P4KA 4TSCL 3WKML 1NCDH 2BNRB 3BPLB 4L4VD 5SWSD 3I50L 4FQQB 1GGCL 4R7DB 5HHMB 3WFHA 4UUJB 3H7BA 5H94B 1U6AH 2EXWD 1AFVH 4YXKL 4KQ3L 3CVIL 3SKOA 4XCCH 5IQ7H 4JN2A 2X70B 4NJ9H 2H32B 4F7MA 1UXSA 2A83B 5D8JH 2GIYA 4IM8A 4G9DA 2VR9A 2R4SH 1IBGL 1TJIL 4LHUA 2P7TB 4NQVA 4XP4L 1RZ8A 5JOPD 3CIQA 3CLFH 1FYTE 5E03A 1R5VB 1S78D 3BVNA 1GL4B 2BXZA 4LLMB 4MQ7B 4KUZH 4HS3A 1MCWM 1JNJA 2XZQL 3MGAA 5I1KL 3MJGX 4RFOL 3OJDB 4NOFA 4OCSH 5KVEH 4RIRA 1IVLA 3QUYD 4JQVC 3BH8A 2E8ZA 3NACH 1NBZB 4PJAF 1JPFB 1UZ6F 3S96A 3KPSD 4R0LB 3QDJD 1V3JA 4NUGL 1PDKA 3IFLH 3CVHH 5KSVA 1LEKB 3EYUL 2WLYA 2H26A 3E6FA 2JTDA 1FIGL 3EJJX 4LLVA 2VL5A 4YXHH 2BDNL 3CXHK 3IETA 3VDAA 1Y0LB 4HLJA 4Z7WA 3D69B 5IMKA 1NCAL 1FJ1B 2JF1A 4E41B 3ECBB 4E0RB 3MODL 5EBLB 3UAJC 3B43A 4LOUD 4HLZH 1HEZB 1YYLL 5CUSH 2FJHB 5TH2B 3SE3C 2J5LB 4BFBD 3KXFD 2IFGA 1INEH 5E1AB 5LWYH 4LHJB 2Z92A 4KHTL 3TYGH 3HE7D 2FEEI 1JGUL 1D5MA 5GGTL 1QFUL 1K8DB 2E9IA 3FO9B 5KSUB 4P2OC 4TTDC 1G9NL 1EUTA 2IH1A 3V9FA 3L5HA 5DGQA 5LGHH 3HR6A 5MHSD 1GAFL 1I3VA 3RJQB 4WW2C 1I3UA 3MCKA 1WZMA 3P9LA 5F7FA 4NQCB 3BN9D 3O0RH 2VLRA 2VLJE 3DOSA 3RVXC 3W0WB 2DI8A 4LFHD 1DQDH 5C6TH 4H1LB 1KF9B 3QCTL 3GK8H 4BZ2H 5ICYA 4P46C 3RY6C 3UYRL 3DETC 5L8KB 1BM3H 3BD5A 2ZZUT 3LKRB 1MEXL 5MERA 4HF5H 1GZPA 1MLBB 3T77B 4PB9L 1YEHL 4FHBD 3WD5H 5IR1A 3RWFB 1CDGA 1ZT4A 4ZQKB 1FH5H 3BEWB 5D7LB 2EO9A 4GBXC 1NGXB 5E6IB 1G9MC 1R3LA 3IFNH 1TJHH 4KXZI 1JE6A 1HI6A 4P9HL 5J13C 3MA7B 1QLFB 2X1WL 8FABB 5DRNA 4OLXH 4F9LC 3LEYL 1CGWA 4JM2D 4LSRL 3BE1L 2VB5A 4PUBL 3WXVH 1AXTH 3VJ6A 2EXYC 1EGJH 3CDFA 5FUZL 4HIHB 1MFAH 2EDOA 3C8DA 4JR9L 1S7TA 4PYHA 3RNKB 2BVOB 1A6TA 4ZD3H 5M7QA 4X8JB 4LSTL 1VFMA 5EU6D 1QO3B 4ZO9A 5C6PB 4KY1L 4Z0BL 3GJEA 4WTXA 2D4FA 1FLRL 3UTPD 1J12A 5D2LB 3ZE2E 1I1AD 5DSCA 3TT3L 4KZDH 1BJ8A 5AZ2H 4G6JL 1J87A 4XNXH 3C60D 1Q1JH 4EN3B 5K9QG 3IAGC 1I85C 3UYPA 2FD6H 4S2SA 4A6YB 4QXWA 4HJ0D 1OD9A 4M1DH 4R97B 3MLUL 5ERWA 5DEGA 4PJ5A 5I1CH 3FTGA 2CMRH 4JFHD 5H35A 4M5ZH 1CGSH 1ORSB 5C0CB 1GOHA 4WFED 5BXFA 3L3GB 5F7YC 4XVTH 2X4NB 2NW2B 2EYSB 3P0GB 3D18A 4MWFB 1BGXL 3WXWH 3P0VL 1B0GB 2YC1A 5TE6H 2XQBL 1MHHA 1MLCA 5D7IE 3NCBB 2FBOJ 2XRAL 4JZOB 3KPNB 2VZ1A 4QF1A 1QNZH 1IAMA 2W92A 4TN9A 3R06B 2K7PA 4JANA 1G1CA 1MRFL 1RK0B 4KI1A 5IMLA 1X5ZA 4ODWA 3F7YA 5ACMA 3O3AA 1SJXA 3C5JA 3AB0B 2MFNA 1YY9C 1ED3A 1CF8H 2VAJA 5IW6A 3TF7C 3DGGA 3G5ZB 4LBEB 4LDLB 1MCOH 4MA1B 3IFOB 2IPUG 4JREB 5DHYA 2P1YA 4RFEB 3M07A 3UC0L 5C0BB 3MV9E 3VMNA 5DA4A 2I07B 4OM1H 1JRHH 1KIQA 3L3OB 3OKEB 3LPFA 5JUEH 5HHNB 2NZ9C 4GG6F 4ZNCD 4MJ6A 3VFMA 5I73B 2Q87A 4OCLC 1PJ9A 3SHSA 4ZFOA 1UM5L 3VW3H 3MRGB 1OAKL 4TULH 1W0VB 3MOQA 5D7JA 4U1NA 3MNWA 4OB5L 1SJEA 4ZUSA 2Q3AA 3B8SA 3SDCA 2AJYL 3CH1A 2XOTA 1N59A 3M8OL 4K9EC 4M48L 5CJOL 5DUPH 5E99H 1AIFB 4KV5E 3VD7A 1LILA 1YC8A 4U1MA 2C3XA 4OKDA 4YDKL 1UQSA 3MRBB 1QRNA 4U05A 2PO6D 2PW2B 3BZDA 3CUPA 5EH1A 4KK6D 1T20B 4FXGB 4XPBL 1KCKA 4YFDB 4U1SA 4FXKA 5CEZE 4GMSL 5T33L 5JPNB 1YC7A 5HHQA 3WIFA 3SCMD 1LE9B 1LGVA 2VLLB 1MFEH 3S36H 1A7QL 3LRHA 1QVOB 2B4CC 1GGIL 2J88L 4F2MB 2YSSB 3BP4A 3WS6C 3KPRB 5HDQL 3ULVF 2I9TB 3O6LL 1X3DA 2D7OA 1PKQE 3THML 3HZYB 5IIEB 3AUVA 2H1PH 4NO5A 5E5MA 4JO1L 1YNLL 3HI5H 5JQ6L 1LP9E 2XZZA 4U6TA 4WW1B 3ZTNL 3W9EA 2AXHA 5D70L 5BV7H 3DUHA 2CRYA 2X1PA 3MV8D 2OTWA 4V1DD 1R6VA 2DD8L 5LBSH 4RGNC 4FQJH 3GHBL 4JE4B 1F3RB 1TCRA 4JB9H 4RZCB 2FEEL 1ZLVH 5KSAB 3VGBA 4KJQC 4L29A 1I7TB 1EHAA 2R0ZL 2Y9RT 1KULA 1C08A 4BA8A 2PUQT 1ACYL 1YJDC 4BJLA 1EAPA 1ZEAH 3CCHA 3P4MB 5K9OA 1ZLWH 2P8LB 1QHOA 4Y1AE 1FFOB 4IMLA 3SDXE 1MCDA 5HHMD 3QH3B 1CFNB 5C0AD 3NN8B 1MQ8A 2IQAB 1C1EL 1VKXB 4WWKC 3W39A 3RI5F 3D39A 4NCC2 3L9RB 1E4KC 2MPAH 3PP4H 3GBNL 4EI5B 2VLKE 3M17B 4FQXC 2D03L 4CVWA 1G7JB 2QADB 1DQJB 4QOKE 3QEGL 4EDXA 4WV1C 2OJZL 4UILH 5GGRB 5A2JH 3UJIL 4LSSH 1WWCA 4TUOA 4MXVF 1VACB 2EDTA 4QRQB 4M6AA 2ICWB 3MQIA 4OZFB 2E7HA 2C1OB 3ISWA 4LEOB 3S97C 1WBZA 2BXYA 4LCWB 1DEEB 3VGGA 1M4KA 2EIEA 5EO1B 5HGBB 1ZKAA 4P2YA 2ZCHL 3QIUA 4TSAL 3RTQD 2BHUA 5K9QI 1FNSH 5D5MA 3LKQB 1NEZA 2GTZB 3INUL 1IEHA 1KPVA 4U1GC 4DK6A 3ORJA 3X14A 4ZDHA 4OCXL 4DKEH 1C12B 4MJ5B 1A5FL 1Q72L 2VKXA 2R2HA 4X98A 1GGYA 3E8UL 1URLA 5E7BA 1MCHA 1M7IA 4KFZC 1BLNB 3EO0B 1OARH 4PY7A 5F3HA 2HMIC 4E41D 2NY4D 2F8XC 2Z35A 1HHHA 4OGZA 3LQAL 4Z7VA 4BZ1L 3K74B 1JNLH 2DMKA 1HH6A 3R1GL 3GMMA 1NGQL 4F80A 3GSNL 3QXAA 3EDKA 4YHIB 3PV7A 5TF1L 3IT8D 3MLSL 3HN3A 2DM4A 3S9DB 2IANB 2A2QT 3MRCB 3H3PL 1CGYA 3VXQB 1FN4B 4U6YA 3LKSA 5TGBB 1YEIH 4GFTB 4QY8B 1S5IL 4C56B 3D1MC 1KTRL 4YR6A 3W0WD 3NH7H 1PBYA 3GJFK 2AI0H 3T04D 3IKCA 3S4SB 5ELIA 5EOTA 2CDGB 3HFML 2DQTH 5BVJA 2X7LB 4JLRB 4NRXA 4EI6B 1CDJA 5D2NB 5EPMA 4DZ8A 1GHFL 4LP4A 5F21B 3GKWH 5EZOH 5MEPB 2F53B 1HNGA 3RQ3A 1JWSB 1CICB 2VITA 4QXGH 3ARDB 1AO7A 1QQDA 3QWRA 2BVQB 2GHWB 4OI8A 4G7VL 3S88H 2L7JA 5E6ID 1JTOA 2YPLE 3WEXB 1BBJB 1P4IL 4G8FA 2DMBA 4HD9A 5JOEA 3O9WA 3TEUA 2VE6B 1A1OB 4G43A 2BC4B 4X7CC 5LAXB 2W0FA 3G6AA 3L7EB 1XFPA 2LAAA 3I02A 1CXEA 2B1AH 3NFSL 1N6QH 4LSQL 5B4MD 3NFNB 4OFDA 5K33A 2AGJH 2WIIB 1ZLVK 2H41A 5DRXB 2BVTA 2ZUTA 3J7HA 1KB5A 5TQ2H 2FBJH 4DGVL 1Q9KB 3P30H 5CZVL 1S9XB 3SPVA 1ZHKA 5TDNA 4U1KA 4P2RA 5INCB 1NSNL 3PL6B 3OHXA 4WDIA 1FFNA 1ZLWK 1IGTA 3UTTD 5F1SA 3MV7A 1GGBL 4PJDB 4HXBL 1EFXB 4POUB 4X7DC 2VERN 2PXYA 1B4JL 4EN3D 4PJCE 4GRMB 4MNQD 3OAUH 4Z95H 3TNMB 3U1SL 1EEUA 1D9KC 1JGVL 1OPGL 1J8HE 4XPTH 1E28A 1V7MH 3U7YL 2FL5B 5CZXD 5C0CD 1U92A 2ZSWA 4L8CA 3NZ8A 4LVNB 4QTHB 5GS1A 4MDJA 3T65A 4ETQB 4G8IA 1IGMH 4L4VE 1G9MH 1QR1A 1NGWA 1YPZE 5IFJB 5J6HA 4PJ7B 1SEBA 2CDFB 3EFDH 3PE9A 4NZDA 2Y5TA 2CLZA 3HE6A 3MFGB 2FX8L 3LN5A 2EYTA 2VDRL 3UJTH 3HRZB 2XTJC 1EH9A 1BBDH 3MLRL 3TBVB 1VDGA 4CU7A 3ZKQD 1F4YL 1U8QA 2Q76B 3O6FA 3STBA 3VXTB 1RJLA 1XMWA 2V2WA 4PJFF 3OKLA 4HZLA 5JOPE 2R8SH 3GM0A 3WJJC 1NQBA 1XGPB 1AGBA 4NO0B 4PJ9B 2JJTC 1JPGB 1A6UL 4HFUH 4OQTH 2BVYA 5I8EA 3V6OA 4AENB 4PGEA 4KDTC 1A02N 2RHEA 5HI4C 2XY2A 4ERSH 5KG9A 5CIPA 4DGIH 4HG4K 1KEGH 1L7TH 1BD2B 1Z3GH 1MNUH 5IEHA 3NMEA 1GH7A 2Y6SC 4X0KB 2QQKH 5DD5L 3MRIB 3QDJE 4L1DA 3U9UA 4Y2DA 5ADOL 5DZNA 4JPIA 3I3BA 2C7UB 5B8CC 3H8NA 2YD3A 1NGYB 3DVNA 3L1OL 1ZWIA 2HFGH 4N90D 3VRIA 4HWZB 4IJ3B 5J6GB 3CH8A 1IARB 4EOWL 1RZJL 4K23L 2VDMH 2X2YA 1BAFL 5GISH 1KSRA 2EDFA 4P57B 5IQ9B 4HCRA 4X7TA 2P46B 4FFYH 4WJ5A 2J2ZA 1CE6A 3OQ3B 1TVHA 1FV1A 3HAEB 3C6SB 1U8MA 4MQXC 1WJ3A 4U4BA 3QAZB 1QA9B 1T89A 2D7TL 2H3NA 5GHWH 3KXFE 4FRWA 1RAMA 4OZIF 4PJIF 3DIFA 3FQUA 2DJSA 5GGVH 4J3WA 5IJKA 4MD4A 1U8LA 5DZOA 1T3FA 5LQBL 2VXUL 1RVFH 4M6NH 1IFHH 5DJXB 1I7ZB 4BUGA 2JJUA 3OKKA 5JDSA 4HKZA 1I9IL 4HIIA 4ZNEA 4GAGL 3ULUC 1JGLL 3MOAL 2GJ6D 3V5KB 1JI1A 2YKLH 2K1MA 5ECJE 1Z6JT 4R26L 1F4HA 1KTKE 1XGQA 2N7AA 2XIDA 4HAFA 1MI5A 4C55A 4XNMA 3G6JA 4YHKH 2VXVL 3HI6L 2R1WB 3MGOB 2AK1H 4LLYB 4G6MH 1CXHA 1MCNA 2B0SL 3HUJE 3CX5K 4LASH 4XXCC 1ZAGA 4P49A 3MNVA 1CLYL 2JCCF 1T22A 4G6KL 2MCG1 1DLFL 1G7HA 3IRZA 5IHUH 4E42A 1RJZA 3TJHC 5IB2B 4ZUVB 4KHXH 4LKCA 1J18A 1OHQA 1K8IA 4IRSC 3T3MF 5LGJA 2VUOA 4LARL 4ODSH 4PJHE 4Y5VB 2HJFB 5HDBE 3DURA 3T2PA 4R4BA 3TZVB 2UYLA 2E7MA 3K81A 1UACL 1M71A 4K7FA 1L9MA 1R3KA 3EUUA 3T2NL 4LGSB 15C8H 1RURL 5GGQL 5I15H 3EFFA 4OM0L 2OZ4H 2XKSA 3BPOB 4AL8H 5KW9H 4KU1A 1DQLH 1J1OL 2IBGA 4PGCA 5JORA 3CK0L 2BNQA 3QZWG 1SY6L 4NP4L 5CJ5A 5EU6E 1U93B 2EXWC 4MCZB 4JPWL 4G3YH 1TQBB 1AHWC 5B39B 1KC5L 3TN0A 2ATPA 3HKFA 3P73A 4G9FA 2O5YH 2Z8WC 5F9OH 1S7WA 1NFDA 4B7LA 1INQA 3VCLB 3U48A 4FA8A 2B4CH 3RUGF 5MI0B 2ARJQ 5GJSH 5GRXG 4EI5D 5CGTA 1A6VL 1YMMA 5HPMB 3BIAX 1S78C 1IGJA 1X5HA 2FZ3B 2QADD 3BT2H 3WKNA 1CLZL 5D6CB 4JFHE 5ICZA 4JRXB 1HYRC 4G7YL 2X4SA 2FHCA 3MNZB 2NNAB 4ISVA 4MS8D 3QUYC 3WO3B 1AQDB 1JGDA 3MO1B 4QYOB 4N9GB 3OBAA 1RK1B 3PWVA 4UAOC 2WIMA 3NA4A 4IHOA 4IIQB 1F90L 1QBAA 4M8QA 2FR4B 3H9ZA 1IKFL 4AEIL 3MLPA 3QUMA 4YC2B 4FTVA 2ZUUA 3AMKA 1T0NB 3ZSSA 3AXLA 1L6XA 3V6FA 5FO8A 4NQSA 3IGAA 2XQYG 3SJVA 1P7QA 4D94A 4AQOA 4OF8A 1K4CA 4XBGA 4YIQA 2VISA 4WI8A 1NLDH 1FVDB 3RL2B 4JRYE 4LOUC 1OB1A 3FRPG 4JO4H 4NKOB 3IJHA 4L3ED 1O5DT 3DX9B 2PR4L 1LNUA 4KKBC 3V5DA 5ILTH 1F2XK 1YJDH 3RHWK 1OOAA 3MBEA 5ANME 2VYRE 4GW4A 3U30C 2MKWA 3HE7C 3BYTA 4LFHG 3NTCH 4ZYKA 4JN1L 4X4MA 1CTOA 3MBXH 5E6YA 3U0PB 1EHNA 2UWEE 1IL1B 5I0DA 2EDLA 3OX8B 4NQXB 2HJKA 3WUWA 2P5WB 3BN9C 4Z7WF 4M00A 4U3CA 5T1KA 1DFBL 5JW5A 3WNPA 4TUJA 4P9ML 2VJXA 4G8GE 5DJZA 5HGDB 3SGJA 1MCLA 4HH9B 1EGJA 2D7PA 3WLWD 2OP4H 4YHZL 2Y5EA 2AKRB 3QPXL 3EDEA 3CGTA 3MJ7B 4F7PB 5DC0A 4PJAB 4GG6B 4CN6A 3QA3B 5IK3A 3LPWA 1B0RB 4LPTA 4W81A 5EUOA 1CICD 3QNXA 4I3SH 3ARDD 3MUGA 4MXWL 2W0LA 4NM4H 4OKVB 4ZPVA 5C0DA 3RWDA 3MR9B 2DQGH 1G0XA 4JM2C 2V6HA 1F3JA 5DK0B 3PWJA 4F8QA 3LIZL 2DLHA 2WQRA 2XWJA 1SQ2N 3GBML 3CLEH 1V7NL 1W72L 3NIFE 1A0QL 4X99B 4EVNB 4NNXB 3T0EA 5KAQF 3TIEA 1LWRA 3NCJL 2HN7A 3VXMB 1SBSL 2VKWA 5ISZA 3BP6B 3N85H 5CSZA 3AU1A 3B3IA 1OAXH 4TVPD 3VRLE 1UXWB 1N2RB 3MRLB 4K7PH 3FQTA 5L2KB 5HVHB 4GT7A 4JZNB 4J3VA 3C8HA 4X6BB 3BSZH 3FT4B 3CFBA 5E94B 3PABA 5HPOA 5JHDE 1T7YA 2OL3A 1CCZA 3FO2B 5FHBL 2GW5A 4JO3H 3OR7A 4YDVB 1HDMB 2G2RA 5CHNB 4O2FB 3C60C 4JY5L 2BMKA 2D9CA 4GS7C 4AY0A 4Q9QH 2C1PA 3CDCA 2OTPA 1YNKH 3VFSA 1A3QA 1P4BH 3V4UL 3BJLA 3OKNA 2DL9A 5EN2B 1MF2L 3D85B 1EEYA 3TYFA 5KVDH 1AD9A 1LD9A 1AGCB 3GMQA 4IS6B 4C59B 1IT9H 3CPLB 4X7SH 4HJJH 2Y36L 2XA3A 4XWGL 4JKWA 1JNNL 5A2IH 4HKJA 2DLTA 3D2UA 4GQPH 5EA0H 2NX5B 1MJ8L 3SO3C 1IEAB 2E7BA 3L6FA 3SDDD 2BNRE 4JPVL 1J5OL 1ZS8B 5IP4A 3KYOB 4PRPB 1G7PA 4PJXA 1VADA 3CXHJ 1CD0A 5HHME 4QRTB 2OM5A 2RFXB 2DDQL 4L8DA 2Z8VC 3MFFA 1KB5L 1P7KB 3HMWH 1WIPA 1BQSA 3K4ZA 4H5SB 5CCKL 5F7EL 1IAIM 3V7AE 4NUJB 4ZXBA 3FOMB 4DGYH 2YD8A 2JK5A 2E5EA 2F54A 2BJMH 1OWWA 4J8RB 3TBWA 1FAIL 1HQRA 2X89A 1H3WM 4ZODA 3WL9A 2CIKA 4NZUH 3L3DB 3KWWB 5L88H 1IC5H 2AXFA 4WHDA 5FB8A 5E08H 1NAMH 2QR0B 1OWRM 2WM0A 3BAEH 3S98A 3BW9B 3ILQC 4R7NA 1F11B 4FP8H 5E8OA 4M93B 5E2TH 2VQTA 1V05A 3BKJL 3VRJA 5T3XL 1BD2D 2VIRA 5CBAB 3TO4C 1TQCC 4NZTL 4KVCL 2UV3A 4HSQA 1S7UB 1KCVH 2IMNA 1OSPH 1LO5A 1P4LB 5INDA 3ES6B 2IGFL 2GFBA 4BUHA 4J3OC 4NWTH 1MIMH 2APWA 4E41E 1BVZA 1PG7H 1ACZA 1CT8A 3BO8B 5GRJH 2JKXA 3AROA 1LO0H 3L5WB 4YE4H 2Z91A 3NZHL 1EO7A 4APQA 1KIUA 2PO6C 5DHXB 2XA8H 4YQXL 4KK6C 1LVEA 1A64A 4XP5H 2ZCLH 7CGTA 4GRWF 1D6EA 3MC0A 3VFRB 2H2SC 5I1AB 1U8OB 4GW5A 4NZJA 2IADA 1KV3A 3P4NA 3SCMC 1A47A 2JJWA 4ONGL 3QG7H 4I18C 4Z7NE 5E8NB 4Q0XL 3QUKA 4QHLA 1FSKB 2X10A 5BZWB 4D9LL 4RNRA 3IF1A 4M43H 1ZHNB 2OTUB 4HUXB 4NQCE 2J8UA 4XBPB 1H15B 3W0WE 5JXEA 1L7IL 2ORBL 4L9LC 4MDIA 5FGCB 3SDAB 1YY8B 2VSCA 3OR6B 4NJAH 3BKCL 1BVKB 1GOFA 3QUXC 4GOSA 4HK3N 3WMSA 4PJ8A 2WW8A 1S7VA 4WEBL 2MCPL 1WZ1H 3SQOL 5HYJD 5KTEL 3RDTA 4EUPH 4M02A 1E4XH 4XXDB 3DARA 1KJVA 3OKDA 1KNOB 2JIXA 5D7LE 4YZFF 2DL2A 1TIUA 3ALPA 4Y5XC 3EOTL 4JO2H 2AXJA 3TA3B 5DR5L 3EOAB 1QFHA 4OTXL 4O58H 1AXIB 3K1KC 4LCCC 1D5ZA 4XP6H 2HP4A 5I16A 2VQ1B 1ZHBA 3ARBC 4KI5F 2EDKA 4JG1H 4HH8A 4Q74A 1VENA 3V5HA 1SEQH 1HHKB 1CS6A 3RZCC 4MNGA 3WFBL 4EXPX 3V7AG 3BZEA 2DKMA 3UBXA 4NPYB 1AJ7H 3SBWA 3SO5A 3KYKH 1JF1B 4XP9L 4ALAL 5FFLA 2DWDA 4LCYA 1R0AL 1HH9B 2FJGB 1MJ7L 1CXFA 1JRHI 5HHXH 2ATKB 4GRLB 2V5TA 3QXDA 1A6AA 1KXQE 5IBUB 2AJXH 3CFCH 4NKQB 4HGWA 1AI1L 1WCBB 3S36X 2NTFB 3ULUH 4ZAKA 5I75B 4U6XA 5D2LE 1IQDA 5BZDB 3VXSB 1NCDL 4QXTA 1BQHB 5F6IC 4KMTH 4C58B 1JNHA 1JZ8A 4B53A 3UJJH 1U6AL 5J06A 4NRYB 1T04B 1AFVL 1D7FA 2H45A 5IQ7L 5L7XH 1EFQA 4NJ9L 5GQBA 4JRXD 1QFWM 5C0CE 3ZZ1A 2HTKC 3WFCH 2R4SL 1S8DB 4NC0B 4UT9H 5JIKA 5C0IA 1U8JB 3L3HA 1QG3A 4R0LC 1RZFH 3UTSD 3RTQC 4TNWF 4KUZL 4ZUTA 1AGDB 1KJMA 4H20L 3C2SA 5C9JA 5KVEL 4OCSL 3JWOC 1NUGA 5HYSA 2VAAA 5DD6A 1TMCB 3OXSA 4MA3B 4LU5L 5EU5B 3NACL 4Q9CA 3MJ9H 4PLOB 2GCYB 4PTUB 1FFRA 1WBYA 2KKQA 2NY4C 2X4RB 3CVHL 4HX1B 2VZTA 5CEXA 1MCEA 3U7WH 4XBEH 1FZJA 4YXHL 4JQVA 2AV7B 5F1NA 4OFYA 4WUKL 3BUYA 4LLQA 3BIKA 4WIQA 2P24B 5I1JH 3HR5B 2CLRA 1AGEB 5C0BE 4H1LG 4PLJC 3HZKB 5D5MF 1GIGL 4HJGA 4WWID 5BS0B 3UCRA 2HVJA 2YHGA 4YDJA 5GS0C 1R5IA 3KPQA 1CE1H 4I9WD 5I19H 5F7DB 1GXEA 2HRLA 1BF8A 5LWYL 3ETBF 4N90E 3TYGL 4DK3A 1RJYA 2P5WD 1F58H 1WIOA 3QDMB 4YBQD 3Q48A 5GGRY 1U8IA 2GSGB 1QPPA 2WBWB 4JCMA 3UDWA 4I5BA 5AZEL 4Z7VF 3HC3H 3SE3A 3WNOA 5LGHL 4N8PA 4JDZB 5BJTA 3DMMB 2CLVB 5IVXA 3CU1A 3O0RL 5J8OA 4JKLA 2J12B 5C6TL 1CDCA 4P2OA 3GK8L 4BZ2L 4XCNB 3Q6FA 5T1LD 5FM5O 5JLZB 4PV9B 1BM3L 4GW1A 2EDQA 4WW2A 1FVEA 1JWMA 3FQNB 4HF5L 2W07A 4XGZB 5JO5B 3MLYH 1JK8B 1J0KA 1ZHLB 4LF3B 4LPYA 4HUWB 5IEKA 4OF0A 1FH5L 4P46A 2XYCA 4I2XB 1N0XL 5B4MC 3RY6A 4ONHA 4R3SA 5DQJB 3IFNL 1TJHL 2GUOB 2I60H 3KPRE 3QHTC 2ESVD 3VXMD 2VC2H 4OLXL 2UZYB 3FO1A 1P84J 4F7CB 1JZ5A 2EC9T 3WXVL 4N0YH 1AXTL 1PLGL 3QQ4B 4HFWA 4X9FA 5F9WC 4GBXA 5L2KD 1EGJL 3BP5A 3P9WB 3TPUA 5LXGH 1P9MA 1MFAL 1ADQA 5FAAA 5CMAA 5B22A 4HWUA 4F9LA 2YD1A 4ZD3L 4EN3C 3VI3E 4D0BB 4V2BA 4R97C 1FNFA 5FYKH 2E6PA 3KPLA 3GSUB 2BP3A 3FQWB 3D85D 3LD8B 3HZMB 3W9DB 4JDVB 1Q38A 2R15A 2I26N 3U4BH 4KZDL 1EERB 5AZ2L 4OQTA 4XNXL 1Q1JL 2EDNA 2FD6L 4M1DL 2O5XH 5F3BA 5FO9A 3IDNA 2X6MA 5I1CL 2CMRL 2W59A 1CGSL 3IDIB 4KTEH 5C2UB 3QEHB 2JELH 4HC1H 1S7XB 3PF2A 4L8BA 4XVTL 4NYLB 2YR3A 1I85A 1FYTA 4PRIA 2BVEA 4PRNA 3WXWL 5TE6L 1QBMH 4PRBB 4WEMB 3AB0C 5I6XB 3CFKB 3WNMA 3V4PH 4HIJA 2P44B 1QNZL 4PJBF 5HYQA 3QFJA 5GZOC 5A2LH 3U0TB 2Z31D 4HS6B 5TE4H 3WCYA 4S10A 4JREC 5DJCA 2I5YL 5BO1H 1BQLL 4OFKA 1H8SA 3EYQD 3AFLA 3P4OA 2R56L 3OKMB 4RX4D 4LCWE 2H2PD 4Y89A 3GB7B 4ZO7A 1FG2A 2CRMA 4N0CD 3ZTJH 2EIZB 1MCOL 4MZ2A 3MROA 3HI1A 4URTB 3FHAA 3V6ZA 3G04A 3M1BA 3TBSA 1DTUA 3BPNB 3UPRB 3IJSA 2QSCL 4OM1L 1JRHL 2EDDA 1Q9WA 4K8RD 2XG4A 5JUEL 3BD4A 3BGFC 4JFOB 2FGZA 3GRWH 3SEPA 1Z0NA 3K1DA 4TRPH 2ICEA 5DXWA 1CG9A 3VW3L 4NHUA 2QKIA 4TULL 2ZCKL 2YEZB 5EIIB 1M7DA 1CFVH 4MAUH 3LQZB 1UB5A 3D25A 2PTTB 1CGTA 1A14H 4XX1E 5DUPL 2I9LA 3DI3B 3L7FB 2IANE 5E99L 2VLJA 4JRWA 4PRDB 2ZSVA 3B83A 3R4DA 4I48B 3GMLA 4C56E 5IKCB 5A2KH 1FO0B 4WU7B 3F6IA 5LJYH 4ENEC 3PHQB 3CFJB 5GS3A 4P3CH 2OZ4A 1MFEL 3IDUA 3S36L 3ARGB 5T5FH 1BZ7A 1NMCC 3CSBA 2G60H 5D2NE 1X4XA 3LH2H 3S3PA 1EV2E 2AEIT 4J7RA 2QJDA 1MVFA 2WP3O 4U0RB 4X6FB 3AM8A 1CR9H 3O6MH 3KAAA 1G7MB 2F5AL 2PYEA 4Z5RA 3SKMA 2F53E 4U1IB 2B5IB 5CJ8A 5F8QC 3EO9H 2DB8A 5M94B 1IAIH 3IDGA 5T1DH 3TA3D 3VA2C 2WBKA 2G5BB 4Z76B 1ZGLP 4I0KA 4RA3A 3CZFB 5CEYB 3FOLA 1XR8A 2N56A 1G6RH 3WS6A 2NY5C 5CSBA 5D7KD 4DTGH 5EOCH 5L9DH 2CR3A 3G6JF 5BV7L 1UG9A 4JFDA 4UDUB 5LBSL 4AMKL 2DM7A 5J9PB 4FQJL 43C9B 1U3JA 3D0VB 4O51A 4TVPE 4JB9L 3LKPA 4OZIB 4PJIB 1XCTA 4GH7B 4PP1C 1FGVH 1NH6A 4GRLD 2AJSH 4ORGA 1PW3A 3O8XC 3MLVH 4Q2ZA 4S1QH 1J1PH 2IBZY 1Q9LA 5ESVB 4RCAA 4R96B 4F33B 4BSVB 4OZFG 1U3HB 2IPKA 1A7RH 2NY0B 1ZEAL 4EI5C 4M8VA 1YN7B 2WINA 1OQOA 3QDHA 3VXSD 4F57H 4PJDE 5I71C 1C5DB 3KVQA 2QADC 4UINH 5DO2D 5E56A 5I17B 4NQEB 3F62A 1TTUA 2MPAL 3PP4L 3REWB 5D7IA 4Y4KD 4ELKA 2W1NA 3TBTA 1E0OB 1JPST 1EHLH 5L2JB 1UVQB 3DXAB 4UILL 1NJ9B 4WWKA 4LSSL 3GGWB 1ITCA 1Q0YH 4JY4B 1NFDF 4PS4H 1EEZA 3P0YH 4PJ7E 1RZKH 2LU4A 2VTFA 1M6OB 4FQXA 2AJZA 1MCPH 1FZOB 1IQWH 3BGMB 3PG2A 1X7QA 5I0ZA 4CMHC 3DSFH 2XWTA 3OGCB 4IOIA 4XX1G 4JFZH 5I66A 1FNSL 3MRQA 1T2QL 4DKEL 3K7UA 3CC5B 1AGFA 1WFNA 4OZGB 4KMLB 4BK4A 5I1EH 1OARL 4G80A 1PZ5B 3H6JA 5IV2B 2DQFB 1BD2E 3DTXA 1OAQL 5HSFA 2EIBA 3CDGA 3S4SG 1JNLL 1L9NA 1OGTA 3KPMB 1I1RA 3IDJB 1XGUB 3VXPA 1IRAY 4Y4HB 3RUGB 3QIWD 2GTWA 4MAYB 2XACC 1PD6A 4ZMAT 3QDMD 5C86A 4LPVA 3PWNB 4TUKH 3WLWC 4ELMA 3CX5J 4RSVA 2C3WA 1PX4A 2XPGB 4KQ4L 4O2CB 5EBWA 4QNPE 5I76A 1HXMB 3EAKA 2FIKB 1XF3A 1YEIL 2Z4QB 3RKPA 4X9IA 3DMMD 1LO4H 4GAYA 5EIQA 4HKBA 5C09D 5HVWA 5HY9A 1F8TH 1T83C 2WV3A 2B20A 1DN0B 3NH7L 5I2IA 3WFHB 3H7BB 3X12B 2AI0L 1A7BA 1CICC 3SKOB 3T4YA 3ARDC 4JN2B 2YD7A 2DQTL 3QDGD 3VWJD 2LV4A 1CFTB 4P4KC 1IGFH 4Z78A 3GSXA 3C09B 3GSNB 3PQYA 4LHUB 4NQVB 3F58H 3NIGF 3SGDH 3VH8A 3AS1A 4HHAA 1WEJH 3EJYD 4B7IA 1PKQA 3BVNB 4QXGL 1G84A 1CGXA 4HS3B 1QFWH 3S88L 1KG0A 4PGDA 5J3HD 3RVWD 2ZNWA 4RIRB 1OTUD 5SWZD 5JHLH 2CGRH 1R3HA 4CDHA 3S96B 5E6ZA 1A7PH 3BRFA 5EUOF 5GS0H 2B1AL 1N6QL 4GUPA 5KSVB 1MFNA 3STZA 5H2BB 5GJTH 2H26B 3WE6B 3E6FB 2XT1B 2AGJL 2YRLA 4PP2A 3AVEA 5HDOA 2FBJL 1IEBB 3F8UB 1T1ZA 1ODAA 3K2UH 4OJFL 3P30L 1CGUA 2HLAA 4Z7WB 1CLOL 5A3ID 3V95A 5IMKB 4M7KH 4NFDA 4TVSa 3LQMA 4WVRA 4CDGC 4CVUA 1GYAA 3CSPA 1BJMA 4I0CC 4CL7A 4LVNC 3BYYA 3SDDC 2Z92B 4WNQB 1NAMA 1AKJD 3DUUA 1FVCA 1M7XA 1D5MB 4AJ0A 3OAUL 4Z95L 4NC1E 5B3JF 3C5SA 4L4JA 4XPTL 3ZKSD 43CAB 1V7ML 5IGXL 1H5BC 1NBYA 3KLAA 2IH1B 3TBYA 1DUZA 3DX7B 3IU3A 2VDLH 4QOKA 3MCKB 5JMOC 3S8WA 3P9LB 1IC4H 2O61A 2VLRB 1YMHA 4DJMA 3E3QC 3RWGA 2GY7B 2H8PB 4P59H 1BQUA 1DBJH 1D9KA 1OAYH 3QQNA 5ICYB 5IW3A 3EFDL 4LPUA 4RMRA 3MLWH 4NKDA 4JRXE 4K7PX 3UJTL 3EOBA 1PZUB 2Y4SA 1BBDL 2AK4B 4RFNB 5GSRA 2G5RA 5FOBB 5IR1B 1V3MA 1JL8A 1I75A 4PJGA 4PJXF 2R8SL 1B2WH 3RZWA 4HFUL 4OQTL 2FX7H 2PYFB 4JG0H 1I4FA 1MY5A 3HAEG 2CK0H 1NCUA 6FABL 5DRNB 4ERSL 4DGIL 1KEGL 1L7TL 1AP2A 1MNUL 1Z5LA 3P77A 2QQKL 1DE4A 3MV11 3VJ6B 3WJJA 3MRJA 2XICA 2JJTA 4CKVX 3LN9A 3NCEB 1G6VK 1MFCH 3I75A 1S7TB 4KDTA 4R8WL 3A6OA 2HFGL 3L3IA 4N5UA 3QAZC 1A6TB 4UQ2A 3CNKA 5FUCC 3MRHA 5GISL 4PJEA 4WFGE 3GJEB 4FFYL 4WTZG 3JSSA 4EUPA 2G75B 2A1WL 5B8CA 2EKSB 3BEVB 2FO4B 3D9AH 5DSCB 1J86A 2R9HC 4A6YL 1UWEH 4I9WE 3PGCA 3Q5TA 1SJHA 1F6FB 5GHWL 2EE6A 3DO7A 4S2SB 4OZHA 5FYLE 5GGVL 5ITFA 1JHLH 4N8VB 5ERWB 2P5WE 3LMJH 5DEGB 4PJ5B 3FTGB 4N0FA 5H35B 3Q2CA 2RB8A 1RVFL 1IFHL 3VD9A 4OLEA 1FBIH 5BXFB 4Q6IB 4XMLH 4YGVB 4F7TA 3DECA 4ZOEA 2VXTH 3KJ4B 2BSTA 4RAUB 2XFXB 1S9VA 2FLRT 3D18B 3ARGD 5GGSA 1MLCB 1CFQB 3VI4F 3DV4A 2YPLA 3EDJA 4H8WC 3ARSA 4GAJH 4PJAE 1UZ6E 4YHKL 3GIVA 2AK1L 1KPUB 3TNNB 4K3DH 4KDVA 5DRWA 5IMLB 3QCUH 4ODWB 4LASL 5KOVC 3F7YB 5DK2B 1JN6B 2J8UF 1BIHA 3C5JB 4I4WA 4AH2A 4O02H 1PG7X 1DL7H 5DMYA 5IHUL 3BRGC 4DEPC 2DM2A 4X6DF 5B39G 1VEMA 5AG8A 1UKTA 4OLZH 2YN5A 3BPOC 2P49B 4ODSL 4XXCA 1W8OA 2VDQH 4MD0A 5DHYB 3VXME 1GGTA 1LDPH 1CLCA 2A74A 4KJYA 2GK0A 4PFEA 15C8L 4GRWB 3EGSB 5L2KE 2K9UA 4K71B 4MJ6B 5FYJE 5I15L 1CD1A 2OZ4L 3VFMB 3KDMA 4AL8L 5KW9L 4WCYH 1DQLL 4YDIH 2WUBH 4NIKB 2PCPA 4GLRH 3PGDA 3MJ9A 2EEAA 3MNWB 1SJEB 4YHLH 3VWKD 2A73B 4G3YL 3TCLA 3VFGL 4ESKA 3BZ4A 1N59B 4MA8L 5F9OL 3HG1B 4S11A 1CXLA 4L4VA 5E4EB 5SWSA 5GJSL 4UDTA 1QRNB 2XKNA 3CUPB 3KPOB 4F7EB 2NX5E 1UKQA 4IIQC 3BT2L 4U1SB 4FXKB 4HT1H 3NPSC 2ED7A 5JR1H 1YECH 1P6AB 4RGOH 1I9JH 5KZCD 4LKXA 3U9PH 4PY8I 5E1HB 4X80H 2QQLH 1TTGA 4KK5D 4ZS6C 3MRNA 1AY1H 3SKNA 3JVGC 1OGAB 2R4RH 3GNMH 3BP4B 1YDPB 3DRTA 4BFEA 3MXVH 5KVMC 3QUYA 4UOJA 4RMTA 5J11B 1U42A 3KPSA 1RZGA 1EO8H 4NO5B 5K9KB 5E5MB 4I77H 1A1MA 1NMBH 1NLDL 4UQ3B 3UTZA 2DLGA 4JO4L 2CIIA 3W9EB 2V5YA 1BFOB 5ILTL 1YJDL 1HSBA 1H3TA 2OTWB 4M1GH 2D4DA 4MHHI 1TCRB 4YBQC 1B6DA 3QI9D 1LK3H 1NCBH 3MBXL 3WS3B 5ADPH 4MAYD 4N0UB 1GGUA 1GJIA 4L29B 1H3VA 3DLQR 3KXFA 2QSTA 4I0PB 1C08B 1AXSA 3HE7A 3F7VB 4KTDH 1EAPB 5DA0B 1U91A 3CCHB 4GXVH 5C2BL 5E00A 4U1LA 2V9RA 5MEND 4YAQA 4WFFD 3EW3B 3LAFA 1M1SA 2OBGA 3LSOA 4XC1H 4Z8FL 5DJ6A 2OP4L 1KYOJ 2ZUQB 4TSBH 3NGBC 3RWHA 1KCSH 1DCLA 1IM9B 3H9HA 1FL3B 2ZKHH 1CD8A 2NY3B 1X5GA 3BXNA 5IM7A 4Z7OF 1ZTXH 3U7AA 4EDXB 3GSOA 3IYLW 3W11D 2GITB 4I3SL 5C0FA 1T1WA 1KOAA 1CD9B 5FGCE 2DQGL 4HKXA 1H0DA 2D7QA 5F1KC 3ZT6A 5DFVD 2BVPA 3GMPA 1FNGA 1WBZB 3QEQB 5IVZA 3IVKA 2V5MA 3CLEL 1G7LA 5DJ0A 3WUZA 5F70A 3RNQA 3O3EB 1JPTL 1JHTA 4WW2F 1NEZB 4XMKH 4HC1A 2QSQA 4JM2A 4ZOCA 1KPVB 3N85L 2EE2A 3OL2A 1OAXL 3MUZ1 4GG6E 4K7PL 4Z6AT 4X98B 1ZXQA 5J4MA 1M7IB 3V6BR 3BSZL 5F3HB 1QBLH 3H9SB 2Z35B 2EDWA 4JQIH 5EC2A 2A6KB 5EFIA 4JO3L 4Z7VB 3QXUA 1HH6B 4Q9QL 3GMMB 3QXAB 4CJ0A 1YNKL 3PUCA 3VFNA 4YHYB 1P4BL 3IXAA 3AAZA 4MQSB 2RCSH 1B9ZA 3O45A 2XG5A 4OCRH 4RMWA 4DCQA 4TOYH 3CXDH 4P2CG 3R8QA 1JP5A 3W5NA 3E6HA 1W72B 5JQHC 5EU3B 4X7SL 4HJJL 2IFFL 3VFUB 4NQDD 3WFEL 1L4IA 3C60A 2OR8A 1MAJA 4X5WB 5DYOA 3LKSB 5EA0L 3FB8A 3GI9H 4HK0A 5I9QC 4BQ6A 4YR6B 5FO7A 3VXSE 2P8PA 3SE9H 1CFBA 3IKCB 4MJID 1T6WA 1F4XH 4AEHH 2MHAA 5BVJB 2Z31C 4ODUA 3HMWL 4NRXB 3U2SA 4DZ8B 3EYQC 4DGYL 2AK4D 2BJML 2VXSH 2P43B 2R2EA 1JCKA 3MMEA 4N8CH 2VITB 1XR9A 1AO7B 1QQDB 1YNTA 4TTGA 1A22B 2VR5A 3MRMA 5L88L 1IC5L 4HUVA 3RVUD 3BAEL 1UH2A 3QT2A 4G8FB 4R2GC 3O9WB 4FP8L 3LB6C 3O3DA 1ND0A 4PY8J 5E2TL 4G43B 4LLAA 1H3UA 3RHWF 2W0FB 3G6AB 3ARED 5FF6B 1HHGA 3FFCD 2C4XA 4OBSA 4ZTPH 4XHJD 5ANMA 5B38B 1JGEB 1J1XH 4MNHB 5IJVA 3PIQB 4OCWH 1HWGB 3L3KA 2P5EB 4XPFH 2HT2C 1HINH 1KB5B 1OSPL 4XVUC 3REVB 2WMPA 4DZBA 4CNIB 2UWEA 3VE0A 1ZHKB 1NDGA 2BFVH 3MJ8B 5TDNB 2GT9B 4X5XA 1QZ1A 4U1KB 4P2RB 4NWTL 1MIML 5FECB 1UM4H 1PG7L 3OHXB 1FFNB 1OTSD 3EHBD 1IGTB 2ENYA 5ITBL 2YA1A 1U8KB 4YE4L 5BS0E 1OSZA 3TPKA 5ICXA 2GY5A 1FSKC 1OW0C 4DFIA 4L5FH 5HD8D 5IROC 2DN7A 4XP5L 2ZCLL 3JWDL 3IKKA 3OJVC 4U7MA 4O5LH 3QDME 4PJ5D 1DDHA 4U6HA 2JB6A 3TH4T 4WO4D 4PJBB 3DX6B 3RJDA 1U92B 3QG7L 2ZSWB 4L8CB 3NZ8B 1ZT1A 2EH7L 2PO6A 5GS1B 4MDJB 1S5HB 2VDNH 3BPCA 4G8IB 4OZ4B 2PXYC 3QEUB 4M43L 5DURD 4P4RB 4S1SH 3KLDA 4Q6YA 3I2CH 1NGWB 4Y4FB 3CMOH 4KPHL 3RL1A 5J6HB 1SEBB 3SCMA 3MRRB 3D6GA 2V5RA 2Y5TB 4H0GA 4I18A 3GBLA 4NO2A 4NJAL 2W9LA 3BHBA 3TA3C 2A6IA 4QHNA 2WLZA 2VN7A 4FQ2L 1OAUL 4JJ5A 4LP5A 1U8QB 3O6FB 5ALCH 1WZ1L 2IALB 2V2WB 1QKZH 3IS0X 3OKLB 4HZLB 5DWUH 4L9LA 1CZ8H 1IZJA 2FIRT 4OD3H 5ID1B 2Y07H 4L8SB 5IBUG 4I2XE 2B1HH 3HE6C 4JO2L 4XNYH 2NY2B 4O58L 1ORQB 4XNUH 5HI3C 4YEEA 5IEHB 2AJVH 1KBGH 4JG1L 1L0XA 3I9GH 4K94C 3U9UB 3MUJA 3MV8A 1SEQL 5HHVH 1XH3A 4LPWA 4V1DA 4Y5XA 1ZWIB 1EMTH 4LCCA 1AJ7L 4MCYA 5EBMA 3RGHA 2GJZA 1KTLA 4Y16D 4HULB 5DO2C 5HHXL 4LEXH 2EZ0D 4X7TB 4KZEH 2VLMD 4M7LH 5F1IB 5I18H 5D1ZD 2AJXL 2AP2A 1CE6B 2IG2H 1RUKH 4JFQB 1D5IH 1VFBA 2F19H 1FV1B 4UV7L 3ULUL 1U8MB 2F58H 4Y4KC 3H7LA 3HG1D 1DQTA 2DBLH 4XPHL 1X4ZA 3DIFB 4FQQA 4H8WH 5KSBB 2HWZL 5C0AA 4MD4B 1U8LB 4UUJA 3UJJL 1MJUH 5T3ZH 5L7XL 2VL4A 1O7SA 3OKKB 4BFGA 1K85A 1T89C 4HIIB 2B2XH 3WFCL 5D96B 4UT9L 2AJ3A 3CFEB 3HMXA 1RZFL 4XT1C 3BH9A 5JA9A 4LLMA 4MQ7A 4UT7H 1OGAD 4J12A 1MI5B 3U6RA 4MVBD 3GMNA 3G6JB 1OL0A 2ARJA 2VZVA 5IG7A 4HQQH 3MJ9L 5EWIH 1JPFA 4R0LA 3TH2T 2QTEA 5IBTL 3RTQA 2R1YB 2X4OA 1YEDB 1G7HB 2F5BH 4TNVK 2DOCA 1TLKA 4FFZH 4HBQA 3U7WL 3ZHKA 1RJZB 4U31A 4XBEL 4LKCB 1IAII 1K8IB 4OF6A 3OJ2C 1Y0LA 3QIWC 3D69A 2W9DL 1XZ0B 1M71B 4K7FB 4E41A 1EEQA 3ECBA 4E0RA 1R3KB 3VMOA 3F65A 4ONFH 4CU6A 5SX5K 1HEZA 1BIIB 2FJHA 3EFFB 4CVXB 3ARVA 5DMIL 5TH2A 1CE1L 5I19L 4KROD 5E8DH 1LK2A 5E4IA 1K5NA 3K3QA 4I0PD 3RX8A 5ESQA 1F58L 5H8DA 3ROOB 4YX2H 3UZQA 3O2DH 4HWNA 3Q6GH 3B2UD 3HC3L 2NXYB 3CVHB 3TN0B 3U4EA 3VWJC 2LABA 3P73B 1NFDB 4D0CB 2VWEC 3LHPH 1IM9D 1BEYH 3W0WA 5LCVH 3B9KB 1X6NA 3EJYC 1IGJB 2VQUA 4ELMF 2YK1H 1KCLA 2X4SB 3VXNA 5J3HC 3LKRA 1BVLB 3RVWC 1OTUC 4ISVB 1WZKA 4ZUUA 1JGDB 1MLBA 3MLYL 4OI9A 3T77A 3LDBC 5EB9A 4MJ2A 5C8JA 4LDOB 3MZTA 4IHOB 1MCIA 1CIUA 3QEQD 4LMQE 3BEWA 5A16A 4M8QB 2UVEA 5E6IA 2LU3A 4Y19B 4YFLF 1RHHA 5IVOA 1DVFB 2I60L 3MA7A 1QLFA 1UJTA 3AXLB 3V6FB 5FO8B 3UYOD 4NQSB 3SJVB 2VC2L 4PG9A 5A3IC 2E8YA 3WYRA 2OSLB 1HN1A 4N0YL 4UBDD 3DPBA 3ARUA 2DKSA 1MRDH 3VGHA 1OB1B 5LXGL 2A6DA 4HIHA 1U0QA 1ZOXA 3VGDA 3H9SD 1LNUB 3V5DB 3MBEB 2BOCB 2BVOA 2C5DC 2XZAL 1QO3A 1KPRA 3EO1A 1BPVA 3J8F7 5FYKL 3MX0A 3BD3A 3UTTA 1BZQK 4PJIE 3NFPB 4OZIE 3MLXH 3QPQD 3U4BL 4M7LT 3F12B 5EDXA 1UCBH 3MV9D 1A6ZB 4XVSL 5D9SB 5I8KH 1PSKH 1IGIH 1EA9C 3WUWB 3KG5A 4EN3A 4MNQA 5T5NF 4NO3A 1CDBA 2YBRA 2YUXA 1I9EA 3RIAK 4KTEL 2WWMC 5C0CA 2JELL 1F42A 2BNUB 2BRRL 4HC1L 3EZJB 5IESH 4WTWA 2CXKA 3IXTA 1MY7A 5I30H 2NW2A 4NQEE 5DQDH 1UA6L 4BM7A 1KN4H 4KWUA 3QSKB 1QBML 4Y2OA 2V2TA 3LS5H 3KPNA 3V4PL 2W0PA 3QNXB 1S9YB 2FGWH 1AO7D 4HPOL 1RK0A 2ED9A 3DXAE 3IDYC 4ZPVB 5C0DB 2R2BA 3RWDB 5TE4L 2N4IA 1F3JB 3PWJB