5EC2A

Kcsa with v76ester+g77da mutations
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
molecule keywords Antibody Fab Fragment Light Chain
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec2A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec2A02
3ARWA 1BIIA 5LGKA 1J87A 3TYFB 4LKCB 1ZHKB 1NC2A 1I9EA 1CIDA 3U2SA 4X7CC 5JW4N 2UWEB 1OW0A 3RDTA 4Y1AA 2NNAB 3NIGF 4TUKL 3Q1SL 3MJ9H 4I0CC 3CH1A 1ZHKA 1CN4A 5CJ8A 2WBKA 4S1DC 5INCB 5HHOE 3NTCL 3H7LA 5C70A 2P5EB 2Q6WA 5BZDB 1RIVL 1ZEAH 3O4OB 1TNMA 3THMH 2A38A 3NH7H 2H2SD 3INUL 3KPSA 5IJVA 2HG5B 2WP3O 4QRQA 1FO0L 3CAFA 5EC1A 5BZDA 4YBQC 4W6WB 2VZ3A 4UMGA 5IVZA 1F6AA 1UM5L 2FX8L 4XI5D 1AGFA 2CO7B 2QJDA 2ZUQB 1FSKB 4Z8FL 5ICZA 5M94B 4H8WC 1DEEB 4QTHB 3B6SA 2X9XA 4X4XA 3MRJA 4G42B 1DANU 1X5YA 4EN3A 1ZHBB 4RAVB 1MHEA 2W9LA 5D2LF 2GITB 3GJFA 2VDLH 3EYQC 2YD7A 5BQ7B 3BSZH 4ZSOE 4LDOB 5BRZA 5HVGB 5BVJA 4WCYH 2NR6C 3IS0X 1PX4A 4DGVL 4OSUH 3I9GH 3TT1L 3DMMD 1QLEH 1YPZE 3DURB 3FFCD 3E6HB 3Q5YA 4G7YH 1FL5A 4NKDB 4MCYA 2UUDH 5SWZD 4QOKA 4UQ3A 5KOVC 2OXGA 1WZLA 3ARYA 5A2KH 4XCEA 5FXCH 1RZIA 4RGND 1BD2A 4HKZB 4X99B 3B5GA 5L6YH 4POYA 2C3VB 1T5XB 2XWBA 3KPRB 3DRQB 3OJDB 3ARVA 2BOBB 5T3XL 1EXUB 4XAWH 3MYZA 1NDMB 1BQUA 3CGTA 4EIZC 1PJ9A 2H1PL 4JDZB 3G9AB 1KTDB 3UZVB 3EFFB 3UROR 3S96A 4WJ5B 3UTQB 4Z7UA 3GHEL 3BGFB 1XH3A 2WWMC 2AV7B 2RCSL 4ZSOA 4PUBH 2DL9A 5DD5H 2I25N 1F4XL 4LMQI 3ARXA 3UBXI 3NN8B 4IRZH 5CEZL 1V3LA 5FO7B 2JIXD 3KXFB 1VFOA 3D87B 2IMMA 3V0VB 2BVQA 3IXAB 4PJ5D 3D0LB 3SDXE 4LPUA 4YBLC 4GRWB 4R2GB 3OV6A 4MB3A 1DQML 3RL2A 4S11A 1HNGA 1ZLUH 3IXTA 3A6BL 2EIZA 1WAAE 3MR9A 5L2KA 5FHBH 5FAAA 5GS2D 3LPFA 3IRPX 1YEKH 4OZHF 1JGVL 2YD2A 4U0RC 5IK3A 3SQOH 3HI6L 2FZ3B 4XP4H 2AP2A 4MNHB 5E00B 2FX7L 3IXTB 2JJWA 3ZTJH 1R24A 4DGIL 3MRHB 4ODVH 1T80A 4OD3H 1DQLH 2G9HA 4WI8A 2XTJE 4KTDL 3WLWC 2R0KL 6FABL 4NQVB 3O2VH 2CRZA 4YDLB 4TQEL 4UQ2A 1KFAH 1MAML 5CKAA 1U8KB 1P9MC 3PJSA 1MHCB 1JNHB 4WO4A 3OMZA 4WGVB 2BMKA 1MF2L 2AVGA 4KPHL 4XNMA 1G6VK 4NRXA 5A2FA 1HINH 4P2YA 3FMGL 4BQ8A 4LP5A 4KAQL 1NL0L 2EH7L 4WUKH 2Z8WC 1QFWI 2P45B 2I5YL 1NEZG 2FR4B 4P99A 4MAYD 4E41A 4JGMA 1MHHB 4XT1C 1EHNA 1NCAH 3O4LA 3PV7A 3RWFA 2VLJD 3UJTH 1LGVA 3ABZA 5DJCA 4DN3H 1WZMA 2FGWH 4GSDH 1PW3A 3S8WA 1BVKB 3H3PL 1DLFH 4PG9B 4RFEA 1JZ2A 2LTQC 4M43H 4CVZB 4WCYL 2DOCA 3P9MA 5EO9A 1L9NA 1KTKE 4C4KT 2MCG1 5K9QG 1IEBA 4FG6D 4YX2H 3GEWB 4UV4L 3AM8C 4K7FA 5F9DC 4Q6IC 1GGTA 3NPZB 2GYSA 5D2NE 3T0EE 5C92A 3MRPB 4MMXC 5EO9B 1B88A 3FO0H 2FIRT 3PQYD 3VFSA 2WM0A 4TRPL 4Y4HD 2AV1A 4ZXBB 1R3KA 4JREB 4KZDH 4XVSL 3QXDA 5GGUB 4MCZA 2EDQA 3BIKA 2OSLA 2PR4L 3OAZK 7FABH 4GAGH 1BPVA 5FKAA 1I8KB 3C60D 5FKPA 1SEQH 5F9JA 3VDBA 4KJQC 1JNNL 2E6QA 5IBLD 4I1NB 3C5JA 4I77L 5C0AB 1LHZA 5C0EA 4G6AC 3CVHB 4HBCH 1PLGL 2P8LB 2X4PA 4XP1H 2ZOLB 4G43B 3V6OE 5BXFB 5D72L 4R8WH 5EO0B 4NZRH 1CXHA 4YFLF 4JQXC 2MSPA 3O4LD 2NMSA 2KUTA 4NJ9H 2DQGL 3MBXL 3S4SB 3V6FB 5EU6B 1NAMA 2P8LA 2WUCH 1F42A 4AENA 5EPMB 5J1TC 3F12B 4TNWF 4LF3A 2HYMA 3NCBB 2XA8H 3FHQA 5C71A 4O02H 1FFNA 5DQJB 4X6CA 3QDGA 4HKXA 4IRSA 4PRHB 1HNFA 3ARDB 1Z9SA 4WI7A 3KPQB 1P7QA 4HW6A 4BKLB 5CINL 5F72S 2RB8A 5ACZB 1JP5A 3C08L 4DKDC 4NO2A 2OMBA 3V7AE 3KPQA 2JELH 1JI1A 5C0RH 4BZ1L 1UXWA 1JF1B 3VGBA 3MOAL 3GSUB 2KQNA 4FQXB 4OIIL 3HG1E 4Z7UF 3DXAA 4FQLH 5MENA 1I8LA 4WVRA 1QR4A 4QHUB 5CJBA 4LSRH 4YFEA 1K9TA 1A4JB 3BPNC 4FG6C 4LSUL 4MGXA 3VE0B 2OTUA 4NKQB 3OG4B 5L9DL 1WEJL 3JVGC 4GW5A 5JHLL 4Z7OE 4K8RL 2WIMA 4KK5C 4UDUA 2R8SL 1XGPB 3MCKB 3GMRB 3OAYK 3DXAB 4KV5F 4X6CE 4Y4FD 1N0XH 4HLJA 4KUZL 4MJIE 5KW9H 2IAND 4N8CH 2NXZB 5E08L 4JFDA 4JB9H 3PABA 1ZHNB 3IETB 5GS0D 2V9QA 3G04A 4KRPD 2ZUVA 1CXFA 1L7IH 2OTWA 4NFCA 1RJZA 3STZA 3SDAC 5CGTA 2GSGB 1XCTA 2HFEB 5F9WB 4B53A 4FQIH 3SGEI 1E4XL 4JRYA 4NHCL 4ZYKB 1KXQE 1MLCA 2JTDA 1INQA 3G04B 3HLAA 3DX9A 4U1NB 3HR6A 1ZLWH 1EK3A 1GHFH 1TCRB 1GC1C 1CR9H 2FB4L 2EIDA 2O61A 2P46B 3DNKA 1FRGL 2EXWD 4QYOB 4KGLA 1P2CB 1INQB 5I73C 4LAQH 1HDMA 3HZYB 1YA5A 4N9GB 1CF8L 1KEML 3ARED 4DQOH 4YHZL 3V0WL 1CXKA 1A7RH 4P9HH 4O2EB 3VFPB 3SE9L 5A3IC 5K59E 4U1GC 4RMUA 4G8EB 4H20H 2I9TB 3FT2A 3E2HB 4PB0H 3WFDL 4Y5VB 1FYTB 3N85L 4LRIC 5F3HB 4PY8I 1HSBB 4O2EA 3VFPA 5IQ7L 4ZFFA 4KKBC 2FCBA 3QIBB 5IM7B 1JGUL 2I9TA 3GSQB 4JPWL 4Y5VA 4CDGC 2W1NA 5I1IL 5D6CB 1HSBA 4ZFOB 2GK0B 1B3JA 1J86A 5CCKL 1F4WH 4P23A 2Y06H 3SDDC 4R4BB 1ZE3C 4QGTA 3MFFA 4AL8L 1M1SA 3IF1B 4A2MA 4PRHE 1INEL 3S35X 1LNUB 4L4TE 3QCTL 3JUYA 4P23B 4OI8A 2X09A 4M6OH 4QRQB 4CN6A 1FG9C 4MDIB 4N68A 4PJ7B 4XHJC 3QHTC 3MV7B 5CD5D 3S88L 5M95B 1QFWM 2AJXH 4OZGF 1F90L 4JAMB 4MLSA 3SKMA 1U9KA 5K9JL 5EZJA 5IVZB 3EO9H 5KJRL 2ENYA 2FIKB 2GTZB 5ICZB 4LNVA 1OAUL 2NY6C 2Z31C 2ZCKL 2E7CA 4NZDA 1K5NB 3BUYA 2JB6A 5IV2A 2B39A 3MV7A 5F97E 2DQDL 4QT5A 5AWNL 1H3TA 5E0QA 1N59A 3EYSH 4HWNA 2R69H 1KF9B 3P9LA 5I17A 3UAJD 3BWUC 4ONGL 1FE8L 4U6HA 2GTZA 1DN2A 1GSMA 1PKOA 4F7TB 5J7CC 3KPLA 1XEDA 5E6IA 1PX3A 3Q6FA 3BKYH 2QQLL 1NCCL 2CR6A 4ODUA 5FDWA 4BK5A 3P30L 5KSAD 3V6OC 4NKDA 1N0XL 4KUZH 3ZSSA 1QLRA 3MRBA 4IRZL 1OY3B 3BH8B 4WIQA 4Y19B 2AK4D 4NHUB 1OL0A 3M8OH 1XGUA 5B22A 1IAKA 5KVFH 3TNMB 3OKOA 1KCUL 1U8LB 2NX5A 3GSRA 5CGYC 2CMRL 4HKJA 3KLHC 1FCCA 1DBBH 1FH5H 3KPRA 2D0FA 3ULSA 4NHCH 3VI4E 3DIFA 2RFXA 1IC5H 1NCDH 4WJ5A 4NQEB 2ITDB 3B9DA 2X4SB 4Z18A 5CP7A 1QFOA 3BVNB 4ZFZA 2HT4D 2AV7A 1J05B 3ULSB 3OQ3B 3LKQB 5ECJE 4EDXB 3DIFB 4MVBD 5C2BH 5AYUL 5D6DA 4MDJB 3TCLB 3I2CH 1T20A 4PBWD 1ZANH 1CGSH 4Y5VC 4GW1A 2F58H 4K07A 5K9KA 4Z5RA 4P9HL 2WAHA 4Q6IA 4HHAB 5F7DB 3D0LA 3LQAL 1WZ1H 3QG6B 2EYRA 1NCBH 4M5YL 1V7NL 4UAOC 3W5NA 1PLGH 1MJJA 4QRUB 4IMLB 3HMWH 3S9DB 1A8JH 4ZTOL 3FB8B 4WU5B 4I18A 4DKEL 3WV0A 3DBXB 2ZSVA 2CIIA 2R1XB 3E1F1 4BZ1H 2Z92A 2AI0L 5F7HA 3H3BC 3KVQA 3QHFH 3REVB 3MFGB 4R4FL 1T3FA 3RBGA 2DICA 5DHXB 1CICA 4CJ1A 3QJHA 3MXWH 2DQTL 5GS3A 3QUMH 3EJZD 5C0CA 2AEIT 5CGYD 5F3BB 3GKWH 5K9OA 3KLHD 1U3HD 4PJDA 4LDLB 4ZAKB 4WY7L 1UKSA 2Q8AH 4G8GD 4OLZL 4Z7WE 3OF6D 4JFFE 5FYJE 5F7UA 4PJGE 5HPMB 4RIRA 1U6AL 4AEHL 1F2XK 4MSWB 2N7BA 1AD0A 3I75B 4UOW1 3S36L 2HT4C 4N1HB 4XC3L 1OP5K 3RIFK 3MV9B 4NRXB 2E3VA 5LBSL 4RGNE 2B2XL 4ZG1A 4GAJH 1AD0B 4WI5A 4F3FB 3QEQE 1KIQA 2XTJC 2DS4A 4HAFA 2OYPA 4AQ1B 3SKOB 4OFKA 4JQIL 2ESVB 4F7MA 2K3TA 3DV6A 2CO6B 3VFUA 3O4LB 2X1WL 4HUXA 1HHJA 4M9PA 5DUBA 5I1LB 3EO0A 2IADB 3ILQC 5DJCB 1F8TH 4IOFD 4P23D 4F3FA 5GGVY 3U0PB 4JRWA 3KR3L 5EO1B 4D8PA 4LLVA 5C0BD 3WNOA 3RX5A 3U48A 4F7EB 1KCVL 4GRLB 4NC2B 1J5OH 2HVKB 2FJFA 3RNQA 1QRNE 4WWKA 1CD0A 2VWEE 1UM4H 2D0GA 2MKWA 1QA9B 1EJ6A 3NMEA 3VG0H 4NQEE 4GRLA 4EDWL 5F9OH 4ZD3L 4KI5E 3NAAL 3HC3L 5TDOA 1R3KB 5DJZB 5C6TL 2YD8A 2ZCLL 3OF6A 4XCCH 1QA9A 2OSLB 1SHMA 3LCYA 3MV8A 4UV4H 4Y1AD 5FKAB 1LK3H 4FQ2L 4JFXA 4KMTL 3L7EA 3QI9A 4PG2C 3WSQL 3D39B 1I85C 5E6ID 5IBTL 5CILL 5BMFH 3PL6B 1F58L 1ZK9A 1VADB 3VXMA 1CQKA 2A6IB 1HKLL 1WBXB 4HV8A 5C0GA 5IMKA 3I2CL 4QRTA 1RJYA 2E8ZA 2P48B 1NGWA 4HK0B 4BSVA 1J1OL 1G6RH 4LPVA 2OR9H 5F9AC 5FGCE 4OCSL 3GBMH 3O6FA 3P4NA 5F89B 1UXSB 2R9HC 3DI3B 1WFUA 4LIQH 2ZKHH 4LBEA 4DKAA 2H3NA 3MUHL 2FD6H 5DRXA 1F4XH 1YEGH 1MIMH 4DAGH 5C08E 2C1PB 4Y4KB 1BGXH 1UCBL 4YE4L 4E9LA 3QDGB 4HKXB 5TH2A 2BSTB 4H5SA 4MA7H 1UXSA 5D7JB 1IVLA 1ZHLA 3HR5B 4OD3L 2OL3L 5DEZA 4Z7VA 4LVEA 1JHTA 4ZPTA 4JN2A 2RCSH 1TCMA 3WE6A 4I9WE 4JM2B 5DF0A 1ZHLB 3AREB 2VZTA 3JWOH 3SDDA 4LARH 5KSUA 3OXRA 1M7IA 5T1DH 2ZZUT 4P23C 3MJ8A 2O93L 1JHTB 1W0YT 1IAOB 4MLIA 3B9VA 2QSCH 3O3BA 3WKML 4G9DB 2ADIA 4EI5D 2DDQL 5JW4R 4QHUA 1Y6NR 3SDDB 1B9ZA 1T21B 3UXFA 1D7FA 3WMSA 4UIMA 1BAFL 1NH6A 2QEJA 2EDXA 2P44B 2FATL 2EE2A 3GMRA 4JRYD 1OM3H 3QCTH 2GJ6A 5EORL 1Q9WB 5LJYH 4ISVA 1IGYA 1LD9B 2R1WB 1NLDL 3ARZA 3T2PA 3LS4L 1NUNB 1X7QB 1EFXD 2P47B 3LHPH 1EEYA 1MWAH 1UT9A 1F4WL 3GMOB 4QRPB 5CJXA 4GMSL 1RIUL 2OXHA 4WV1C 4XGZB 2ZUYA 4FFWC 4I3RL 3VGAC 3WIFA 5T3XH 1BJ1J 4U1NA 1OP3H 1K8IB 2CKBH 1T2XA 3SGKC 3D39D 5JXEC 3VG0L 4XGZA 1QNZL 4F33A 5DEGB 3RGVD 1AGBB 1BVLA 4HX1A 5D2LE 1RU9H 1WT5C 4TSBH 3HRZA 3SDAA 1GGCH 3ZDYF 4ALAH 3W0WB 4OF7A 1FZJA 3A6CH 3DYOA 4JFZL 1KCVH 3QUYD 4UDTB 3QH3B 1UGNA 5D7LB 1CDHA 4GS7C 3M45A 1J7VR 4ODXA 4FMFA 4NC1C 5FB8B 5DD5L 1UEMA 4XB8A 2IQ9L 5GRWA 4GMTL 3MNZA 3MLPA 4PGDA 2VLLB 4GMSH 2X4OA 1MJUH 5JA9A 3AFLA 4XH2B 3BGFC 3MJ7B 1NEZB 3EJJX 4LHUB 3VD3A 5CGMA 1J0JA 2GSIB 4CMMB 2VLLA 5IB3A 2ZKHL 4BFEA 5CEZE 3HAEG 2R0WL 2QSQA 3TJEH 2AKRA 4LFHD 3O8XD 2BX5A 3G6AA 2EICA 4JDTL 4G6JL 5E1AB 5D93C 2I9LB 2VXUH 1IC4L 5TFSL 1CG9A 4TVSa 2PXYC 1CFQB 5DK0B 3R06B 3S35L 1B2WH 2DWDB 1A7NL 3K2UH 5I18L 3JSSA 2FIKA 1NBYB 4ZO8A 4XCNA 1JFQH 1E27B 2D0HA 5D5MB 1FORL 1WBYA 3HNVL 5ICXA 4JANB 1Q0XH 3WIHA 3NFPB 4XWOD 3OPZH 3HKFA 3P4OA 1IC7L 4LSUH 4XCYB 5DJ0B 4OZGA 1JGDA 4DWHA 5F9OL 2BNQB 3ULVC 4FFYL 3QYCA 4BFIA 5FCSH 3F6LA 1X5AA 5F71A 5CSBA 5C0RL 5JLZA 3IU3B 4QCIA 4EBQL 1OF2A 4WI9A 3INUH 5KS9E 4G6FD 1IT9L 4OKDA 4OCSH 5EIQA 4PGBA 3BFOA 3HC4H 3RI5K 3O4OC 5JLZB 3GSRB 3SBWC 1MQKH 4OT1H 4NO0A 1EUUA 2V5TA 3SDDD 3ZE1E 4PRDB 2Y25A 3V5DB 4XCFL 2XA8L 4UT6H 2ITDA 4I0KA 5EU7C 4HXBL 4JO3L 3CFIC 3SE4A 4NO5A 4G9FA 3V5DA 1AP2A 4C57C 4JJ5B 5ANMA 3JWDL 2W0FA 4M1DL 5TFSH 3QA3B 1BOYA 1I3UA 4QRPD 4LGSB 4KJYB 4JO4L 1NLBH 2UY6A 1FNSH 1MCLA 3TV3L 2YEZB 1GGUA 4Q6IB 4G9FB 2PNDA 1HKFA 2APXA 1WWCA 4NWUH 1VA9A 3GBNL 2HJFB 3F8UB 5FA3B 5GXBB 5GSRB 4WDIB 4UTBL 5E6ZA 4JDTH 2F74B 2PXYD 3LRHA 2FX9L 3UYRL 1SQ2N 2DJUA 3QDJB 3CSBA 4LOUC 4HMCA 1T3FB 2ED8A 2DLFH 4YXKH 4Z6AT 1W8NA 5HDOA 5KZCB 2B8OT 5EN2B 4ELMA 3BO8B 3PL6C 2H2PC 5DZLA 1U8IB 1HYSD 4U1KA 5HY9A 4P4RB 4B50A 3UJIH 5GIRA 3N1PC 4PFEA 2DAVA 4M5ZL 5F6HI 4Q9QH 1CWVA 1A3RL 4OGZA 4IS6A 5FYKL 4K8RD 3KNBB 5DWUL 3MXWL 1MI5B 3OKEA 1N3NA 1NCWH 3HNTH 3K2MC 3KYNB 1VFMA 1RK0A 5DD3H 4YAQA 1J11A 4V1DB 2XV6B 2VXTH 3FQRA 1QBML 4I3RH 5AD0B 1OT2A 4W70A 2EDYA 4PS4H 1H3WM 1KGCE 1RIUH 1HHJB 5DUBB 2ORBH 2WBJA 2WW8A 5I1LA 2ZP0T 3LKPA 2RGSA 3GB7B 3H9YA 3BRGC 2GCYA 1RK0B 1HHHB 5F7LB 1V7NH 5T1MB 4LEXL 1XF3B 5SWSE 4HCRA 2P1YA 4NFDA 5TE4H 1HQRB 1OPGL 2KL6A 4G5ZL 3DSFH 4R2GC 3O3DB 3NCJH 4FS0A 4YDVB 5E95B 1N5YL 4RGNB 5IHLB 2XN9E 3EOAB 2X5PA 4HJGB 1FORH 3RNQB 4NUJA 4S2SA 4G6KL 3QXVA 2BRRL 3MRQA 3BQUC 1NGQH 4JY4A 4L4VA 4XXDB 4IRSC 2CDEA 2VRAA 4HJGA 2YXFA 3HI5L 2F9BT 2EIEA 2DIAA 2IH3B 1A14L 3O2DA 3IDMB 2IBZY 4KVNL 3VFTA 1AXSB 2NW3B 1P9MA 3F65A 3QNZA 1IGJB 3O11A 4X6CF 1UJTA 5GS0H 15C8L 4PD4K 4QXUL 3S5LB 4M00A 3ALWA 4ONFH 1YEIH 2VQ1B 3RHWK 3ZDZE 1S9VB 5IMKB 3QFJD 5ICYB 2QL1A 1EEUA 1FFOB 5GRUH 2JK5A 5CBEA 3PNWA 5I8EA 1XR8B 2GW5A 1JZ4A 1IAIM 1F3DJ 1RZGB 1E4KA 3GM0A 3QWQB 4PJ5E 4YLQT 4MJID 3U79A 3WEXB 5E94A 2YKLH 1NFDF 2UZXB 5D96B 4DVBA 4ZPVA 1X6LA 3Q6GH 4ONFL 4JY6B 2KDGA 3NPSB 5DD0L 2B0SH 5BCAA 1DJSA 5T33L 3TN0D 3RWIB 4XP5H 2V7HB 1XR8A 3P11L 1TTFA 1GGCL 1A3LH 3KJ4B 2Z8SA 3VCLB 1CFSA 1I7UA 1F97A 1V3KA 1G6RA 3CIQA 4YK4C 2PYEA 1Y6KR 2OJEB 3A0OA 4N5UA 4RQQB 1VESA 3SGDH 1IKFL 1FSKC 3GBML 2ZUQC 3B8SA 3HAEH 3VXTB 4ODTL 4JN2B 4HKZA 4X99A 4U2YA 4EUPG 1CFSB 3O8XB 5KANI 3WFZA 3V52L 2MCPL 5DJDB 4XBGB 5IG7B 3IFPA 3LQMA 1NUFA 2VQTA 1A7RL 4KHTH 3WUWG 5KTEL 3PG2A 2XIDA 2I60H 3UTOA 1Q94A 2D7TL 3C5ZA 2BFVL 1MFAH 4PLKC 3T08A 4GO6B 1XH3B 4HJJH 5KS9F 5IG7A 2VABA 3IFPB 1T21A 2YXMA 3LDBB 3WDIA 4YHIB 2RIKA 3JV0A 5IFJA 1ERNA 4LGRB 2X2YA 3W82A 2IAMA 4YGAB 1Q94B 5IOPA 4NFBA 1DFBH 2V9RA 3NAAH 4CADB 5T5FH 2P7TB 1DUZA 3TO2B 5C09E 3EFDH 5DUML 2B20A 2R1WA 2JF1A 4WTXA 3ESVF 2HTLD 5J57B 2A74B 2CLZA 5FV1L 4X6DA 1SJXA 3D25A 1UB5A 5IMMB 1UWEL 4J4PC 5JW4M 1CU4H 2DWEA 5LGJA 5DMGC 2ADGB 1CL7H 1SYVB 2R4SL 5KG9A 3MJ9L 1NCWL 3GSNB 1AI1L 2GAZA 4X6DB 1DVFA 1GAFL 4M1DH 1NANH 3REWB 1SY6A 3L3OB 1KT2B 4E41D 4PLJD 4YXKL 4JY5L 1CGTA 4MJ6B 5IBUB 3SE9H 2ZOKA 2GAZB 4NN6C 4HWUA 1YQVL 3MRIA 2Z31B 3HTLX 3U4BL 4M4PA 1MJ7H 4GG6F 4DUVA 4O2CA 3OJVC 5HHQA 1AJ7H 1EV2E 2D2OA 4LLMB 4V2BA 1KG0B 5I15H 2HKHH 5IEKB 1QPXA 2NY3D 1NMCB 4X8JB 4AIZA 3VI4F 4XNMB 5TDPB 2IF7A 3OXSB 3QUML 4MB4A 4PJIF 4DEPC 4Y5YB 5FB8A 5IFAH 1G0XA 1VGKB 3WNKA 3D0VA 1Y6MR 1BZQK 3D85B 4OF6A 5DHYA 4LLMA 5I66B 4PV8B 2IAMD 3H9SA 2JCCB 2VL5A 4MXWL 2X4RA 4PRIA 1RQ5A 3MJ7A 1LEIB 4PJCA 2DQTH 2ESVD 1HHKB 1RUPH 2H32A 3PHSA 4JRXB 5IBTH 5HVWA 5DTFA 5CIPB 3VXOA 3CSYA 4KK5D 1U95A 3WXWH 3ZHKA 1NFKA 2XQBL 4MXVF 5HGAB 4LPXA 3UPCA 4GRMA 3T0WA 4K7FB 3DLQR 3RX8A 5HYJA 1PVHA 2ZCLH 1FNFA 3GSWB 4EOWL 1YEHH 4JRXA 1YY8B 3HMWL 4PLJC 3DJ9A 1CFQA 4U1GB 1VENA 2BFVH 4J23A 5BJTB 4KK8C 5E03A 2DWDA 3WFEH 3O6MH 1FHGA 1WJ3A 3CDYA 2J7LA 4L3EA 4MJIB 1DN0B 3QR2A 1KACB 2UVFA 5CEZD 5E2WL 2UZYB 5GGUA 4MCZB 1N5AA 1FZOA 1AHWB 7FABL 3DYPA 3P4OB 3QDGD 1N4XH 4MJIA 1JJUA 4M93C 5EBLB 3T0DA 2V5SA 1F8TL 2VE6A 2EDLA 3N1FC 2R56L 1AHWA 4L1HA 4OZFA 1G9MH 1OD7A 1QSEE 3MV8D 5CS7A 2OI9B 1J8KA 1OF2B 1B0GA 3MV7D 6CGTA 4H26A 4UB0H 3IDIA 2F53A 3MBEC 3RVTC 1MAKA 1T22B 2CXKA 3PHOA 4KWUA 1TTUA 4J3SA 4YHML 3ARQA 5H37H 4W4OC 4FTVE 4J1UB 3HC0B 4JM4H 4M1CD 1FPTL 3F12A 1A6TB 4M7JL 3UTZB 4LU5L 4DVRL 3DGGB 1CFBA 4YIQB 5DRWA 15C8H 2XG4A 3TVMC 1G7JA 1MQ8A 3JWDC 4OZHB 4PRHA 5EOCH 3QZWB 2OP4L 4TPRH 2DB8A 2MQ0A 5DVMA 2VJXA 1KUMA 2HFFB 2BERA 1UYWL 2VL4A 1A6TA 3UTZA 2XRAH 1U92B 1NGXA 4X4YB 5IHBA 4JPIB 4QXTA 3O2WH 1J9CT 1NQBA 1DBML 1TZIA 1UWXH 4M4RA 4ZDHB 3TP4A 3MLVH 4ZOCA 1BFOA 4JKPL 3IFOA 5D1QB 3GJFH 3RWCA 2GT9A 1Z5LB 5DMJB 3VXRE 3WNPA 5EH1A 3QEQD 4M62H 3ZL4L 3MNVA 5F8QC 2D7NA 4FFVD 3X12A 4QNPE 5IB1A 1Z9LA 4PY7B 3N0PB 5IROC 2I07B 3UYOD 3GSOA 1A4JA 4ODVL 2W9EL 3RWCB 2BNRB 3SE4C 2O26U 3LOWA 3WFHA 2F74A 1IM9A 4MXQD 5TE4L 2IPKA 4PJ7E 3QFJE 3L3GA 4NSKA 4MYWB 3O9WC 4CKVX 4J7RA 3FAWA 3RWHA 4D94A 5E4EC 3DVIA 3L5IA 1Z3GL 2NZIA 3JV4B 4PR5A 4JPVL 5EOCJ 1X5ZA 1QSEB 3PIQB 4PJEF 1QFWL 1S8DA 2OTWB 1T0MA 2EXYC 4Y2DD 2DMCA 3S3PA 3DMMB 5C0FA 1CE1L 4HUKB 3BO8A 1RZJL 3BOVA 2QHRL 5FIEA 1W0VA 2IBBA 5IB4A 3MXVL 2FJGA 3HCVA 1J0IA 1KJVB 5FM8A 3NA9H 3SDCB 4PRHD 5DUMH 4OGYH 3SOBL 4HCRH 1DFBL 4NBXB 3ZHDA 3VXPB 2BDNL 2VXQH 4PLKD 2W0LA 1FRGH 5T3ZL 1ED3A 1JGEB 1IFHH 1N3NB 2YD5A 3ULVE 4JREC 3CLFL 4KUCF 4W68A 5I2IB 4DN4L 3DOSA 3D1MC 3SDCA 4YAQB 2W9EH 3G6JB 4RISH 5JNYB 2YN5A 4KZEH 1CF8H 4KI5C 3U9UB 1BF2A 4ONHA 3RVTD 2VDKH 3Q2CA 3MTRA 3EOYG 5F7FA 1ES0A 2IFGA 4P2CG 3U2SB 4OUUA 1YNKH 4ODBD 1AGEA 4OM0L 1AQDA 3V4PH 3KLDA 1HHHA 3JUZA 1S78D 4IIQA 4M48L 1TQCB 4ONGH 5DA4A 1T7YA 5IW3A 4X7TA 4LU5H 5FHBL 3QQ3B 3TC9A 1I9JH 4H8WL 4HF5H 1AQDB 3P77B 4E0RB 4NWTL 1QVOB 1HKLH 1R3JA 4J3WA 5FK9A 2X05A 4M1CC 1YNKL 4YHKL 3VFRB 3AAZB 3W9DA 3ORJA 1OAZH 3QEUB 2MTPA 5F6IB 5DVOA 2N4IA 3TEUA 4JM4L 1A14H 5CMAB 5HDQH 4NKOB 1I7RB 1JWMA 2BNQD 2E6PA 1Q9KA 3QWRD 3CLFH 3U30C 4RMRA 3BZDA 4DAGL 1XF4B 3RGVC 5L8JB 5DRZB 2C4FU 3BE1H 1J1PL 3H9HB 4NM8L 1KEGH 4PJBE 5KSBA 4GKSB 2BRRH 3BEVA 3DRTA 3QNZB 4EN3B 5I75C 5C0BB 5L2KE 3BRDA 2OS7A 1FL3A 5J6HA 3GJFB 3KXFE 5EUOA 4EXPX 1LO2H 5KVMC 4ERSL 3PF2A 3H9HA 5GQBA 5MHSD 5DHVH 1G7PB 3DRTB 1S7RA 5CBEB 1N59B 4GG6B 1OWWA 3HMXL 2AAVA 5IQ7H 1UCTA 2EDJA 1KN2L 5EFIA 5EUOB 3E6HA 3HUJB 4U6HB 4U0RB 2FEEI 1CZ8L 3KJ6L 4M03A 1KTLA 3I02B 4XRCA 4NRYA 4PRPE 3OWEA 1S7RB 5D7SL 5EUKB 1BIHA 2VZ1A 1JWUB 3Q6FB 3WHXB 5HYSB 2CDGB 4KHXH 5IESH 4LFHG 3ULUH 4CAGA 4XXCA 1KPVA 3AGVA 4Z7UE 1L9MA 3MUGB 4XMLH 3SKNA 3L5HA 2GJZA 1KTLB 4I2XE 4GQPH 1G6RB 3T3PF 4XI5C 1S7TA 3DETC 3AXLA 1A6UL 2R2BA 2YPVL 4WV1A 2VZVA 5E9DB 5E5MB 3MLYL 3TBSB 3L3IA 4CNIA 1W2KT 3TNMA 3TBVB 2VN4A 4Y7MA 3C87A 4DOHE 1O0VA 4PJCF 4HKJB 4J8RA 1TZHB 5IKCB 2PR4H 4RX4D 3NCEB 4UNUA 4Q9CA 4UU9B 1TZGL 5D2NA 3J7HA 4U4BA 2RFXB 5IHZB 1WIOA 4P0DA 4S1SH 2W38A 4HUNB 5FM5O 4TPRL 4I77H 4QXGL 2H6PA 3H8NA 4KI5D 4WFGE 5EU4B 4LMQE 1CS6A 1DQTA 3ECBA 4Y4HB 3CK0H 4ZXBD 4Z7NF 2W60A 3NFNB 2BY1A 4ZFOL 5IFAL 4Q6YA 5JIPA 2CK2A 4PJ8C 1OGTB 4KZDL 2VOTA 2ZPKL 4KC3B 2NTFB 2XWJB 4M5ZH 2A1WL 2VR9A 3TFKD 2FBJH 4LASL 4RA0C 2A77H 3O0RH 1RUQL 3ECBB 3MR9B 3U0TB 4EVNB 3NFNA 5EIVA 5IHUL 1DLFL 5IK3B 3RL1A 5I76B 4D9RE 1JZ7A 4OF8A 3BIBX 3BKMH 4APQC 3FB8A 4WU5A 3FQWB 4GMTH 4YX2L 3HE6C 3MRHA 5IFHL 4OV5A 4OT1L 1MCOL 4OLWH 1QO3A 1GYAA 4KRNA 2CQVA 3EAKA 2J4WH 4NQXA 4P3CL 1QRND 5FA4A 3QDMB 4UT6L 5EBWA 3N9GL 5IESL 5C0CB 1U8KA 4XHQA 4FZ8L 1QKZH 4PJDB 4RBPH 4HG4K 3BGMB 5ETUB 4J4PA 3RKPA 4WW2B 1TJGH 2XZCH 5DJ2B 5HHOB 5HPMA 1LEKA 4K7PL 4MSWA 2IBZX 4K3HA 1WAAA 4G80B 4Y1AE 4AJ0A 4JO4H 4YGVB 3MRLA 3QEQA 4FQ1H 1IL1A 1YEHL 5LXGH 5I1EH 3UBXG 5DDHB 3WLBB 3TF7C 1LO0H 1R5IA 5EIIA 5J4MA 5MEND 3X17A 4EUPA 5DQDL 5EOTB 5CIPH 3PWPA 1RFDH 3RDTC 4NN5C 1MVUB 1NGPH 3IDGA 3IAGC 5DT1L 1A1OA 4MXQC 5FUZL 1YYMH 2VO5A 4PJXA 3T0EC 5JOPE 4H0IA 4PJCB 3QUXC 3MLSH 3SGJA 3EDJA 4KHTL 4URTB 3PGDB 1T6VN 2NYYD 3VD7A 4D2NA 4A6YH 3IDGB 3BPOC 1U3HC 1JNNH 5IUSA 3DVNA 3WO4B 3T1FB 4HF5L 5D9SB 1KPRB 5F1SA 3MLZL 5DMGD 4PB9L 4F7EA 4FXGA 3QUZC 3PGDA 2HVKA 3FKUS 5MP6H 5KAQF 4Q7DA 3OAYH 3TBYA 5DFVC 4OFYD 1KCUH 5K93A 4PJFB 4ONOA 2NY1D 5CWSB 4EBQH 5BJTA 1JPSL 3QXDB 3OGCB 3ILPA 3TBWA 5DURB 1GC1L 4HH9B 3W11D 4ETYA 4XNUH 2ED9A 4BQBA 5DJ6B 5HVHC 1BD2E 4P2RE 2DN7A 4R26L 5I74B 4L3EB 3OX8B 3GJFK 5EA0H 5GJSH 5I1HH 1H15B 4GQ9H 1D9KB 3DV4B 3SDXB 4NM8H 3D3VE 4NO3A 1S7XB 4S1RH 3PHQB 3KPNA 3TO4A 2ZOLA 4YXLL 4RFOL 3T3MF 3HE7A 1FE8H 4BK4A 1HSAA 3GMMA 5ACLA 1RJCA 4PJIA 5JQ6L 3CFKB 4Y16D 5GS1C 3TM6A 3KPNB 1G7IA 1A6ZB 1ZVSA 5L2KD 1OAYH 1J0HA 3DX6A 5J0BA 4RGOL 1R0AH 1IC4H 1TLKA 4XPFH 5DS8B 3FN0H 3IDIB 4ZFGL 2Q3ZA 2HKFL 4R97C 3EYSL 4D0BA 3BMWA 3EJYC 1YQ2A 3KLSA 4J1UA 5JQHC 1HCVA 3DX6B 2EC9T 1P4IH 4FQHB 4K9EC 1YY9D 1A9BB 4WEBL 5BMFL 1MJ8H 3TT1H 3KPOA 3CCHA 3DUSB 1P4BL 5EU7E 3M1BB 3HS0B 5I1GH 4MNQA 4Z95H 2QADC 1ITBB 3T2QA 3WS3B 1QACA 1ZKAA 4FQXA 1C5CH 2F53E 3KPOB 3K8MA 4XP4L 1DDHB 1ZS8B 2NZ9C 5B39G 1QZ1A 4KDTA 3PP4L 4JR9L 2FATH 4I4WA 4JM2A 4M7LH 3W11C 4UTBH 2WV3A 1AXTH 4K7PH 1SEBB 2FO4B 4Y8AA 1OAYL 3X12B 3E3QE 4Z0XB 4U1IB 1U8MA 1JRHL 1U8HA 1V3MA 5T33H 1XGTB 5GRJL 1V7MH 4DFHA 3N9GH 1EVUA 2AXFA 3HNTL 3O2WL 4R7NA 5T3ZE 1IEHA 3UTTE 4M9OA 3PWUB 2HT3D 5DC9B 1FV1B 3ZE0F 1EHLH 2X4QB 3BKJH 5FECA 5EWIH 3IDJB 1U8HB 5E7BA 3UJIL 5AZEL 3NA4A 5ADPL 3RPIA 4KRMB 3LS5H 4F2MA 1ZLSH 3K46A 1FV1A 3DVFA 1J88A 4GFTB 3RP1A 2ID5A 3IDJA 5FYJH 1JWSB 1W0VB 4YC2B 1BZ7A 3H0TB 2JELL 2Y36H 2A1WH 2X41A 1G7QB 2NY0D 4N1EA 4MJ4A 4LLQB 1EGJH 3QCUH 4W4NA 5B21A 1OM3L 4MNQD 3BHBB 4YZFF 2C1OB 1MFDH 5HYQB 3U36B 1QSZA 4Z78A 4YDIH 3ZDZF 5FUCC 1I1FB 1JGEA 2DLTA 4LRNL 4G8EA 4YC2C 2IANE 3ESUF 3U9PL 1GGIH 3VWJA 4LLQA 2R8SH 3CUPB 4ONHB 3JV6B 3V8OA 1IM3A 3VWKD 1N4XL 5DMKA 2EKSB 1JK8B 4CMHB 1NCUA 1NLBL 2OR9L 4LCWA 5BV7C 5DZOA 3VWJB 1OVZA 3GUTA 1J12A 4X7TB 3T2NL 2J12B 5GS2H 3VXQA 2W91A 3BT2H 1T5WA 2EXYD 1Y18B 4R8WL 1E4XI 2AJSL 1YNLL 1QBAA 5FUZH 5I0DA 4WUUE 2NNAA 4C56A 2A83B 4XCFH 3ARPA 4OLXL 4U7MA 1A7NH 2R1YB 3BW9B 3SKUD 5FO8A 4BH7A 4K3EL 3RTQA 4OZIE 2W92A 35C8L 1YEJL 1JYNA 2W9DL 1UQSB 2P24A 4O02L 2FWOA 1CIUA 4P57B 5F1KC 2X4NA 5FO8B 1MCSA 1ZV5A 4Y16B 4X8XA 4P3CH 1RIVH 2YPLE 2YRPA 2DM4A 4JDVA 5KSBB 4XBEL 2JB6B 3CFEA 5IV2B 3W39B 4N0FA 1Y0LB 4FZ8H 2DQGH 2DYPA 5DMIL 4ORZC 1NJ9B 3WFEL 4JKWA 3GKZA 1YN7A 3DROB 5HHOD 4RRPG 1RVFL 4Y19D 3RZCA 4OQTL 4KKAD 3QFDB 4PD4J 4GG6A 4N90D 4IRSD 4XCCL 3V4UH 3MOQA 1I3RA 4XNQB 3WYRA 2XQYG 4K94H 4P5TD 1QLRB 3QFDA 2LU3A 1JWUA 5GRJH 1IEAB 5HYSA 2R4SH 3QAZB 3UTSB 1UZ8B 1JYWA 1RURL 2AXJA 3DURA 3GK8H 1IQDB 1MCEA 3RVUC 4WY7H 4FQQB 4HDIB 4YNYB 3ULVL 1R5WB 1IAIL 3PQYE 3B9KB 1DBAH 3MLWL 3U1SH 3QI9C 4PG2A 4XTRD 4OCYL 1T1ZB 4YHPB 2UUDK 5E9DE 4JO2L 4IOIB 3TBVA 5TQ2H 3U4EA 5T5NG 5HI4C 5J13C 1WWAX 1UWEH 3I6KA 5F6HJ 2X7LA 1H3GA 1CTOA 4N8VG 1RMFH 1UJ3A 3VG9C 1M7DB 3BPLC 1FCGA 2NQCA 3EGSB 3K0WA 5DJXA 2JJUA 3GMPA 4K7PY 4TSCH 2VDOL 4B7LA 5T5FL 2H45A 1Q1JH 4BELD 3UTPD 1H8OA 3UDWA 1I3GL 3LKNA 4HFWA 3V5HB 3PWJB 3EGSA 2DD8L 3QT2A 2WBJC 4K3DL 4DGYL 1NFDB 5HI3C 4PJAA 5DD1L 1CBVH 2FEDC 1NL0H 2EH7H 1T7WA 5J1SC 2O5YL 1NPUA 5TJWK 4IMKC 2I27N 5C9JA 1UACL 2YEZA 3V0VA 2NY5H 1BBJB 1KELL 3PWJA 3MJ9A 4MWFA 2CIIB 3V4VL 1NCAL 5A2IH 5C7XH 3BAEL 4MXVE 2ICWB 2JJVA 1E4KC 2PUQT 3VD4A 4UTAL 3T0EB 1BM3L 1F13A 2Y7QA 3EJYD 4X5XB 4XPBH 4W6XB 1HXMB 1ITCA 5IEHA 4U1HB 5K9OB 1IJ9A 1DBBL 4G8GE 4XPGH 4RGOH 4HIHB 4K71B 3L5XH 3KDMB 3SCMD 1A2YA 2JIXA 1MCJA 3MV9E 2CGRL 3IJYB 4JFED 5EORH 1KJMA 3HI6H 4L4VE 4UV7H 3RUGA 5EN2A 1A7QL 4HIIB 4WW2C 1BEYL 3D85D 5C1MB 4WW2A 2SEBB 3HPJB 1ADQA 2QTEA 5ENWA 4XX1E 2JJSC 3C6SA 1BJ1H 5KVEH 2YD6A 3FQNB 3PJSB 4F15B 5SWSA 4JFEE 3MLUH 4HIIA 4YWGH 4M02A 5H2BA 4KVNH 5GISL 5D8JL 2X70B 1PKQE 5ENWB 4HUXB 4ELKA 3OKEB 1U8NA 2OM5A 3RWJA 1TVDA 3PWPB 4OFPA 4QHMA 3VGGA 3ZKND 4NPYB 3IAQA 3CZFB 1A1OB 5HYEA 4NIKB 3CFBA 4OLUL 5CSGA 5H2BB 3EYOA 3L3HB 5H94A 3CDFA 2P4AB 1NGQL 3Q48A 1T1WA 3LKPB 3GB7A 2EH8L 4IJ3B 3RTQD 2Y23A 4YO0A 1GPOL 2ZUTA 4LVHB 4YHMH 4Y1AB 3CFBB 3HNSL 4YZFE 1JV5B 3PWLB 1BWMA 1KPRA 3WHE1 4YUEH 3T65A 1G84A 4KGJA 1EX0A 5I9QC 4JO1L 4LCCC 3B2VL 5E1HB 4NUJB 3MGTB 4LLYB 4WTZG 4GRWE 4PRID 2YOCA 1JZ6A 2E7LC 1ZGLB 4GKZA 1SJHB 4PRAB 2CDEB 2EDBA 4JFEA 4DW2H 1XF1A 2KPNA 3TWCL 5JOPD 1UJ3C 4BJLA 2VH5H 4ZXBA 4LEXH 2GEEA 4BYHA 4NNPL 5DR5L 1A1NA 1D5XA 5JW5A 2YUWA 1YYLH 4PRAA 1FP5A 1AGDA 3O6FC 5FKPB 3VFTB 2HTKD 5J11C 4IRJA 2FH6A 1RUMH 5IVNA 5JUEL 3C5JB 4HC1L 5DFTA 3BSZL 1ZWIB 3VXRD 5F21B 4U1SA 5E70A 5LAXB 5F89A 3OGOE 4IRJB 1BD2D 3I9GL 5BRZB 3HRPA 5CAYB 1MWAL 2VQ1A 1JYVA 5HDLA 2WP3T 1ZWIA 3EDFA 2V2WA 1D5BB 4JFPA 3TGXA 3PNWB 2HMIC 1UM4L 1KNOB 1F3DH 1OARL 3BKML 5D7JA 1EZVY 1OB1B 1QYGH 4CU8A 1Q1JL 2ICWJ 4F8TA 3S36X 2EE3A 5ITFA 4FQHA 4OZHE 2HLFD 4NQDD 1A9BA 4XPTH 4S1QL 3M1BA 3CZJA 1EXUA 1G9MC 1FZKB 1M7IB 4TVPD 3BH9A 3P4MA 2APFA 1RULL 4JDZA 4PLNC 4OCYH 1CFTA 4HK3J 5MEPA 4R2GD 5KVDL 3O3BB 4FOMA 3U30B 3Q0HA 5BRZE 1J8HD 1P4LB 3L9RA 4KDWA 1YZZA 3VG9B 5IB2A 1JN6B 3P4MB 3RTQC 3AY4C 3GSUA 4UIMB 3AS0A 3P4LA 4FP8L 4WTWA 4JB9L 4LHUG 4M7KL 3SEPA 2D7MA 4U1IA 4EKXA 3T77A 1UM6H 1OARH 1VFUA 2VABB 5DZNA 5JHDA 3ROOB 4YHIA 3I85A 3IXAA 4P9HC 2DBJA 1YEGL 5EU5B 4B7IA 1IGTA 4MQXC 4CW1B 2ZSWB 5TE6L 1NMAL 5I8CA 4Q58C 3ULUF 2ZWLT 3QULA 1VKXB 3ES6A 3HMXH 3IETA 3H7BA 4PJDF 5E8NA 3SDYL 2CLZB 4WO4D 1G0YR 1K8IA 4H88H 4K2UH 4OLVH 4K3EH 4LVOC 3TVMD 3IFNL 3ES6B 2WLZA 1UZ6F 4YQXL 1BHGA 4F33B 3TH3T 2VKWA 1DVFB 1NSNH 4X7SL 1QYGL 3QHFL 4YEEA 5KOMC 1AO7A 1I8IB 3M17A 4PP2B 1Z9MA 3O3EB 1K2DB 4XP9H 1AKJB 2E7HA 4JQXA 3BDXA 5HHVL 3SDCC 43C9A 1XAUA 4KFZC 2ZOKB 2AABH 2XACC 4JG0L 5I1EL 1ORQB 1QSFE 2KZ1B 1BZ9A 3GMQB 1JFQL 1AD9A 1A6WL 4Y16C 4DK3A 5L0QB 3NZ8A 4UT9L 1HHIA 43C9B 4KI1A 4YDKL 5EOQH 3OJ2C 4UIKH 1LP9A 5E4EB 4NP4L 4IM8A 1AGCB 4FQPA 5J11B 3SJVA 1S9WB 1X5JA 5JUEH 4N5ED 3MRKA 1OAZL 1ACZA 3VXQB 5ADOL 5DHYB 4CMMA 3QUYC 1WK0A 1YEFH 3H9SB 3SGEH 2AJVH 2JCCA 1NBZB 4MA3B 5I1CH 1PEZA 3O9WA 3BP5B 1EHXA 4JPKH 3SQBA 1QQDB 3MRKB 3C6LD 2GK0A 3C60A 3F7RA 3G6JF 2WLYA 5IJKA 5D1QC 4QRRB 5E8PB 2Z0BA 1WTGT 2XKSA 4KVCH 5JZ7D 2FWOB 2PO6B 5IMOA 4XVUD 3UTTD 4K9EH 1CT8A 1FBIL 2B1HL 2VDKL 2VISA 4OZFH 4XCNB 5FV2A 5GRUL 3V6BR 1DQJA 3NA9L 2H9GB 3QQ9C 4PBVC 4JAMA 3SKMB 4HUVA 3SPVB 2ARJA 1NAKL 2R0LH 1MCHA 3FCTA 1KSRA 1MCWW 1KIRB 4KAQH 4XPGL 2VXUL 2ARJB 3CH8A 4B0MM 1N0LA 1MY5A 2RHEA 2G60L 5LQBH 1FAIL 5GGRY 2MQCA 2E5EA 3MBEB 5AWNH 3FFCE 3LKOA 5CD5C 3VH8A 4Z7OF 4KMQA 4XVTH 3B2UD 3FB7A 4R90H 1TVBA 2IWGA 1IQWH 4X5LA 4LKXA 3UTSA 4LQFL 5EG6C 4X9GA 4QTIH 1FVCA 2V2TA 2XNAB 5IB5B 2AJXL 1QEWB 5K9JH 1MEXL 4P49A 1MREH 4NO0B 3ROLB 4HLZH 4H0GA 2P5ED 4TUOB 5HPOA 5H35B 4RGMC 5HHMB 1I9IH 1IAKB 1AHWC 2X1PA 4K71C 2BDNH 2VXQL 1QEWA 4KY1H 4JG1L 2OQJA 5CUSH 4HS6A 3R1GH 1U91B 3AMLA 1JTPA 1RK1A 1M7DA 4MHHG 4N0UB 2COQA 3B5HA 4S0SD 2VXSL 4YIQA 5DRWB 4CUCA 4M6ML 2Z4QB 1K8DB 3KYKL 3BWAB 3L95A 5BVPL 1P4IL 1RZJH 3TZVA 4ALAL 1HH9B 4NJAH 4NCC1 4JPWH 1FC2D 3UAJC 4ZFZB 5ITBH 4LEOB 5L88L 4Q9RL 3V5HA 4H1LH 5GISH 1JHLH 3TYGH 3T0XA 2NY6D 1KLGA 2WNGA 1FN4A 1BFOB 1CBVL 3EDDA 2YK1L 3CX5K 4DK6A 3HN3A 3VE0A 3S37L 3GO1H 4L8BB 2IC2A 2R0LL 2FB4H 3QG6A 4YFLI 4LLAA 1T1YA 5C0ND 5JDSA 2YA2A 1GXEA 4P2QE 4FQXD 3LV3A 4R97B 3VRIB 3VRLF 4KMLB 5GS0L 1F11A 5EZLA 3T3ME 4Y8DC 3MMEA 1IRAY 2QQNH 1L7TH 4WW1B 1OGAE 2Z92B 3L3GB 4JHBA 3L5XL 5FCUH 3TN0A 3RVVC 2GSGA 4PJIE 3MACL 3SDAD 3SKJL 3TN0C 2DQHL 1CLCA 1G7HA 4P2OA 1K4DB 3IJYA 1CFNB 1MSPA 1QSFA 2H1PH 2ICEB 2QQKL 4HWZA 4IDJL 1T0MB 1HOCA 3SGDI 5JO5B 3RVWD 3TN0B 1RZKC 4KQ4H 5C0FB 1X5IA 3H9SE 2BVUA 4PJ8D 1L7IL 1C8PA 1S9XB 4WEMB 4QYOA 5KJRH 2BZDA 1KIPB 1LO5A 2AQ2A 2FJGB 3HCVB 3MNWA 4HWZB 3H2WA 3TZVD 4NQSB 4P46A 4PREB 1X5FA 3DHJA 5F7MC 4KJPC 1Q9LA 1S9XA 4F9PA 1T0NA 4XP9L 3TCXA 5ID0A 2K7PA 3RWJB 3MZTA 5IW1B 4WWKC 4I9WD 2ESVE 4OSUL 5IF0B 5T1MA 2FSEA 1A6WH 2Y5TB 3QPQD 3EYOB 3L3HA 3NIGE 4JM2F 5E24E 4S0TD 3CLEH 1T03H 5D6DC 4GKOA 4NN7C 3WNLA 2JB5L 1FJ1B 2KQMA 4U6YA 3C2AL 3BAEH 1KXTB 5EO1A 4D8PB 3C8KB 4WU7B 3O41A 5HI5C 3I6GA 3AM8A 1JV5A 3PWLA 1FL6B 4TNVF 5D6CA 4ZFOA 1BBDL 1WCBB 5DRNB 1X5XA 2JLLA 3LDBC 3P77A 1HXYA 3PWPE 1R3JB 3K4DA 1JHKL 3RDTB 3O41B 4OIBA 1KCRL 1REIA 3VFRA 3SDYH 1ZA3A 3ZTNL 1YDPB 2IAMC 2XXMB 3ZE0E 2NY5L 5ACMA 1L6XA 4AZ8A 3DUUB 5DWUH 1AXSA 3TBTB 2NW3A 1D5XB 3BT2L 3O8XC 5JOEA 3CSGA 3MOBH 1YDPA 4DJMA 3S5LA 3VWJC 1V3JA 3VMNA 4JFXB 4OCXL 1HILB 3VFVB 4K94C 4G6MH 5SWQB 3BEVB 3PE9A 4X98A 2EECA 2A2QT 4LLDB 4MJ5A 4CDHA 2LQRA 2D03H 2ZNXA 5J3HD 4Z76A 4TRPH 4F7TA 1CGUA 5F93C 5A40E 5IR1B 4PBXA 1XR9B 4NNYA 3KPLB 3HE6B 1ZGLM 1P1ZA 4R7DA 2ITCA 5FUOL 2BSRB 1MRFH 1SYSA 2XXCB 4PY8J 4GXUN 3QO0A 2EEAA 3RVWC 4JQVA 1NMBL 3U1SL 3L1OL 2M1KA 3I02A 4KK8D 1KJ2B 4M6AA 1A9EA 4BA8A 4UILH 3HE6A 3WFCH 3CFCH 5ITFB 5DFVD 5JHLH 4IMKA 2G5RA 6FABH 3O3AA 2AJYH 4QNPF 3OKOB 5LWYH 2ARWA 2AK1H 4I5BA 4MCYB 1S7TB 4XBGA 3LZFH 1T2QL 5E5MA 1BX2A 3L3KA 4TYUA 2PYFA 3VDAA 5MEPB 4HXAL 4ZPTB 1RZIB 1RI8A 3O3AB 4ZTOH 3B9AA 1FGVL 3OKLB 5D7IE 3UTSD 2BSSA 4KK9C 3WNNA 3X11A 3WXVL 1YYLL 2NX5D 3VJ6A 2P5WB 3GHBH 4ZTPL 5C09D 3UTQA 1XIWB 1N64L 1FYHB 1NEUA 2BSSB 4TNWK 4HC1H 5ABDE 5LGHH 4NRZA 1T0PB 3ZT5A 1YEDB 1BBDH 3FO9B 4XC1H 1HINL 3W9EA 1UB5B 2GIYA 3QULB 1C1EH 1PZ5B 5FGBC 3SE3C 1SYVA 1MY7A 4MQ7A 1OLZA 3H7BB 4DKEH 1OAKL 5J9PA 2J6EL 3ARFC 1RPQA 3IB4A 4OUOA 5JA8B 1PKQA 4JFFB 1EMTH 2VLKE 5I76A 1EZVX 1FFRA 1NCBL 4M5YH 4GBXC 3QJHB 2DJ4A 5K33A 2IG2L 1D5IL 2MHAA 1NBVH 4P2QD 2EYTB 4OZFG 1FFPB 5I0ZA 5L6YL 1KB5L 3SQOL 1DL7L 3CPLA 3WDJA 3UO1H 3OBAA 3CVIL 4ZUTA 2VSCA 5E00A 1G7LB 3HZMA 3S3SA 3B2UC 1R24B 5I6XB 5CLTA 2A0LC 4OF0A 4PJBA 4X4ZA 1AGBA 2G9HB 4XNXL 1AD9B 3WIHL 3MV9A 2DQJH 2XN9B 3TNNA 3CPLB 5HDBF 4WI3A 3MZGB 3FRUA 4G8GA 4M7LL 2BHUA 4HK3N 2AQ3A 4M6OL 1IE5A 3MRLB 2ESVA 2X4RB 4PRIB 1I9IL 4HGKC 4GAYA 4ODXB 4M6NL 5DDHA 3HI1A 3WLBA 5GHWL 5DSCA 1Z6JT 3QXAA 3L6FA 2NXZD 3EO1B 4G8GB 3ALXA 2L7JA 5DUPH 5DT1H 4MA3A 3R8QA 2V17L 4ELME 2NY3C 3BP5A 3RWFB 3CMOH 1KENL 3GMLA 4FZEL 4LHUA 5L7XL 4ZUVB 5GGQL 1YY8A 3AUVA 1UWGH 2YRLA 4RFEB 2A6KA 4POZC 4F8QA 4RMSA 3IU4L 2Q7YA 4IOSD 1UH2A 3KLAA 4WUUB 1GZQB 1YUHA 4QWWD 4U2ZA 5DVLA 4O2FA 4JRYE 3G9VA 3PDDA 3ULUD 4PGJA 2BJML 2QKIB 4TTDD 2VXTL 2H2SC 3U46A 1MRCH 3QUXB 5CJQH 3RWDB 2V7NB 1URLA 4JPVH 2X10A 4IDLA 4Z95L 3L7EB 4OI9A 4U3HA 5D5MA 2LV4A 4GRLD 4PB0L 2X4UB 3PQYA 3BZEA 4OCWL 3MCLL 2DKSA 4PJ9A 4OD1L 5F7WC 1I7TB 4IRJC 1NGYA 3NCJL 1I8KA 4RFNC 4P9ML 4PJHB 1EIBA 3LKOB 1IARB 4OZGB 5C0AA 4AEEA 3LY6A 3DXAE 2PF6A 4BSVB 3WN5C 1MCBA 2XPGB 1TXKA 4LKXB 2FJHA 1NGYB 4L3AA 1RUQH 3IKKA 3P4NB 3O6FB 1TFHA 3V9FA 1FVCB 3CFKA 1S78C 2YUVA 5D1ZB 2D4DA 1YJDH 3NZHL 4NZTH 2R2EB 2AJVL 5AZ2H 4YR6B 3JBG7 3MQIA 5DLMH 5FYLD 4PJFF 2MNUA 5GRVL 3HG1B 2C1PA 2HKFH 5D70H 4UZGA 1NAMB 4OKVB 3FL7A 2WINB 3G6DH 2XY2A 4RFOH 1P69B 5EU3B 4NQCB 5T1LD 3NIFE 2DDQH 3RAJH 3LPGA 4BQ6A 3NTCH 4WTZA 5TDNA 3QDGE 4APQB 4N0UA 4I0PB 2D03L 2XN9D 3P0VH 1VFBB 2UYLB 4TTDC 4X4MA 3BWAA 3JWOC 5IROA 3CD4A 3P40A 1F3JB 3WE6B 3OR7A 3HS0A 3VRJA 4LVHC 5I1KH 3FQTB 4AT6B 1UKTA 2FD6L 2OL3H 1H5BC 4JJ5A 5ANMB 5ALBH 1JYXA 3GRWL 3IJSA 3CFJA 3TVMB 4F37F 5MP6L 2ZG3A 1JF1A 4MA7L 4Y2DB 2BHYA 4ENEC 1U6AH 4AT6A 3QIBD 1T1YB 1NFIB 3EYFB 3OAZH 4F7CB 4NSKB 1N64H 3X14B 4PJHF 3KS0J 2HJFA 5FA3A 5KSAC 1U58A 1IGYB 4F15C 2WZPD 2B5IB 1A6PA 1UADC 1WVZA 1EJOL 4GW5B 3RFZC 5CINH 1IZKA 3EBAA 4GRWF 1QSEA 1WF5A 4W4OA 5E5RB 3MCKA 4Q9BA 2Y07L 2Z93A 1EEYB 1MIEL 4PV9B 3X14A 5GS1A 2WIIB 5FECB 5IFHH 2HLFC 4GS7B 4NJ9L 5FGRA 4XPAL 4EI5B 2IANA 4B41A 2NY7L 4QWWC 4NM4L 4F2MB 5ELIA 2AJUH 4JFQB 4PV9A 3NGBC 3AROA 1T83C 3OB0K 4JRYB 1LO5B 3ULUL 3AU1B 4F37K 1JNJA 2H8PB 1WWWX 5E9DD 1JPFB 3G6DL 3WL9A 4NT6B 1TCRA 5A3ID 3U9UA 3OL2A 1BQLH 2VLME 2C1OA 4YDIL 3B9EA 5FUCE 1LDSA 3K4AA 3HE7D 1XGQA 3UDWC 5HYSG 4JFHD 3S98A 1UEYA 3HZYA 5IF0A 3NZHH 4NZTL 4KQ4L 4NT6A 3A67H 4P5TB 4F57L 5HGHB 3ZO0A 5I75B 3D6GA 1J5OL 4G6JH 1ZT4A 4OCRL 1QSVA 1XGQB 1NUDA 2NY0C 2BRQA 5GRXG 4QOKD 1FO0A 1X5HA 1RZ7L 1UKQA 1FL6A 4JY5H 4R96A 3CH1B 1VDGA 1F3RB 3TPUB 4LSQH 4FXLA 3EOAA 2APVA 4GT7A 3CC5A 1HXYB 4S2SB 3UYRH 2Q6WB 4NKOA 3HPLA 3WD5L 2A83A 1K4CA 4JVWA 1ZA3B 3G6AB 3T4YB 4DEPB 5J06A 3SJVD 3GO1L 5AZEH 3K7UA 1X44A 1NC4A 3M07A 5KAQG 3RIAK 3VI3F 3KPSB 1W72B 3QJFB 5C0NC 4NWUL 3BN9D 3AREC 2IH3A 2LAAA 3PL6D 5EC1B 4WHYG 3HPLB 3H3PH 1QRKA 5J89A 3AB0C 1FL3B 1F6AB 4O00A 3BN3B 3B5TA 1LNUA 5KBNC 2J8OA 2J8UA 5IW6A 5ITBL 3PP4H 4OJFH 3ZTJG 4QXGH 4G42A 4MJ5B 2D9QB 2BP3A 3KYOB 5I71B 3CMOL 2N1KA 1ZTXH 5EFIB 5SWZB 3WFBH 5D71H 1DBJH 3FO0L 4HUUA 4GW4A 3MA9H 3RZCB 4RMTA 4NNYB 4C54A 1PQZA 4DGIH 2P5WE 4WHTB 2J6EA 4LLWB 5J6GB 3QO0B 4XZUB 1CGSL 1EUTA 3MUGA 5JIIA 3KHOA 3I3EA 5CZVL 4XNQA 3MROB 4U6VL 1A9EB 2V2XA 2EH8H 2VB5A 1B4RA 2IPUG 4JY6A 3MODH 4YPGA 3L3IB 4CNIB 5DR5H 1CI5A 1II4E 2ADFH 3ZYJA 3IDXH 2IJ0C 1U42A 3T1WA 4HWEL 4PJ9C 3QXTA 1S7VA 4J8RB 4JLRB 1RUML 3KJ6H 4RQQA 3ZKNC 2J1KA 5KSAA 2O5XH 2PYFB 3MV11 5CSZA 4AM0B 2Z31D 1OWRM 3BP4B 1BFVH 3STLA 2ADJB 2V6HA 1W72H 2X7LB 5D2NC 2QQNL 4JLRA 5E2TH 3L5WB 3RY6A 4ERSH 2VC2H 4UINL 4BFBD 1SVZA 3UX9B 2YA1A 3Q6GL 3NN8A 1E4WL 3IDYB 2DQIL 2FECL 1K6QH 2XWJA 1ZLUK 5BV7B 1KEGL 3L5WA 1EFXB 1CXIA 4PJFE 5T3ZH 2PYEE 4WI4A 4GRLC 1NFDA 3U7YH 3ARGC 3W9EB 4OQTA 2C3XA 1CDGA 1YPZF 3JV5A 4CADA 1JHLL 1T89A 1I9JL 1AFVH 5E6YA 3NPSC 5JZ7C 4Z5RB 2BVEA 4MQ7B 2ZUXA 5D96C 2NX5E 3TJEL 1V5JA 3WS6C 3D25B 5C7XL 1RSFA 3ZYOA 4EZMA 4XMKH 1FLRH 2XTJB 4MNHA 2IBGA 5D1XA 1EFQA 1LDPL 1MWAA 3H42H 1XF2B 4HH8A 2Q7NA 1AFVL 4HIHA 4QRSB 5DD1H 4CL7A 1EEZB 3VU2A 4EI6A 3REVA 1R3IH 3LEYL 2NY2C 4DFIA 2F54B 2FL5A 3LPWA 4MJ6A 3MLSL 4MAYB 3RQ3A 2C3HA 1MWAB 1KJ2L 2D7QA 4NQED 5HJ3A 2VDMH 1E28B 3JTSB 4ZAKA 1ZSDB 1EMTL 1BEYH 3GGWA 3GHEH 4EI6B 1GJIA 1IL1B 4IS6B 4DTGH 4Z7WF 2MFNA 1R5IB 3KNBA 3QXWA 3CU1A 3RZCD 4RDQF 5DQDH 4OZIF 4XAWL 2DQCH 3RWEB 3JTSA 5SWSB 4OF5A 4LHUD 4X8JA 5JXAL 1VEPA 3GGWB 3UBXB 1MLBB 4GAYB 1LO4H 4Y5YA 5GSVA 2E9IA 3QXAB 1U8NB 3RVVD 4QHMB 1FGVH 4L4TA 1CE1H 3DVNB 3UBXA 3P9MB 2CRMA 3FB5B 4FHBD 5D9SA 3VFUB 4YEFA 4GBXD 1DQDL 1IEBB 2YA0A 1R3HB 3X13B 2H32B 5JMOC 3TBYB 1HHGA 1BWWA 3U0PA 5KANG 2A9NL 2VDOH 1UVQA 2WBJD 2WWKO 5CUSL 3QO1A 2X89D 2ATPB 3FB5A 4LSQL 1P7QD 5GGVL 1XMWA 4M1GL 2Q7YB 3WSQH 5MERA 4WI6A 2B2XH 3V6ZB 2DRUA 1BQHG 1I3GH 4AY0A 1RMFL 1WFNA 2CKBA 1HHGB 3ZKQD 3UMTA 4LLYA 1MUJA 5F44A 4J3TA 2ATPA 4JZJA 3MREB 4DCQB 2FLRT 4EDWH 1EBAA 1KCRH 4TVPE 2BVTA 2CKBB 5GJTL 2AJ3A 4JZNB 2VLJE 3FQXA 1KLUA 3W2DH 2EDEA 4U33A 4I2XA 1N5AB 2PTTB 1GGBH 3F7YA 1H8NA 1AI1H 4R6UA 2PW1A 5E2WH 1MELA 1S3KL 3CNKA 5E7FA 2AJ3B 4JZNA 4LSPL 3MGOB 1JRHI 4PRPA 2XPGA 4U1SB 3I84A 4ZNEA 2EO9A 3T0ED 5I8EB 3PL6A 2DI9A 5ESVA 5B3JE 4Q0XH 3HAEA 4WFFE 1D6EA 2A6DA 2R2EA 1MJ7L 1D9KC 3FFDB 4JQIH 5KW9L 3MGOA 1AQKL 4OCXH 4GBXA 3VXSD 3W5MA 4H26B 3DYMA 1T04B 3RWIA 1JZ8A 5DO2D 3WJLC 1RUKL 3CCHB 3VCLA 3ARDA 1OB1A 1MFAL 4XC3H 2IFFL 3TIDA 4HWBA 5EZOL 5TDNB 4AMKH 4YHYC 2QQQA 3G5ZA 3UJTL 5DMYA 3VXTA 4NC1E 3K1KC 2C3WA 3O8XA 3VGDA 1AO7D 8FABB 3TIDB 2BNRE 2Y07H 4WW2F 1MH5A 5ERWA 5HHME 3FQTA 1KN2H 1IT9H 2FO4A 1QBLH 1F4YH 5MENB 5FYLE 1P4LA 3L9RB 4NUGL 5D1QA 3TVMA 1JL8A 2R2HA 3MRMB 4P5KB 3VXRB 1N6QH 4XMPL 2G75B 5JIKA 1JN6A 1UWXK 3FO2B 3VGFA 2EYSB 3QDJD 5I1AA 1HI6B 3P73B 1IGIH 4IRJD 2J8HA 4TQEH 5GZND 3EYFA 5I30H 1E4WH 3V8CA 3CX5J 5D72H 1B4JL 2K1MA 1FVDA 2O5ZH 4YHLH 2BNRA 1ZHNA 4GKNA 4L9LB 4U6TA 1YMME 4OTXL 3P73A 5TF1L 3EDEA 2ZSWA 3JTTA 3KPTA 4MVBC 4HFUL 5GGRB 1GIGL 1S7SB 1U0QA 4H8WH 1Q9WA 5AYUH 1OD9A 4PGEB 3RWHB 2A9ML 1I8MA 3DO7A 1ND0B 3FOMA 4UT7H 4YK4B 4RMQA 2X1QA 4KH2A 4QHLB 3JTTB 4OLVL 3LQZA 1S7SA 4OM0H 1RZ8A 2DMBA 5ALCL 1KCSL 2FGZA 4G8FA 1VFAA 3U36A 5I73B 3TPKA 1P5VA 3RKDD 5IB4B 2P43B 2AQ1A 3ZLQC 2NCMA 3KPMB 4ZNEE 5ADPH 4PP2A 3V4PL 2VDRH 5I8KH 1CQYA 2YR3A 1O5DT 1W0WB 5HHQB 4OCWH 2VSDA 1BZ9B 2NW2B 3CDGA 2PW2B 2HWZH 4XB7A 4G9FD 4KQ3H 1M4KA 4FFWD 3SDAB 3ZDYE 1JPGB 1C5BL 3LEVL 3W0WA 1UH3A 5F3HA 4H1LB 1ULVA 1HHIB 4K8RC 3OJMB 4HS3A 4KV5E 2OL3A 3QFJA 1ZT4B 4TSBL 3QRFM 5I66A 1L0XA 3L5JA 3IGAA 1AE6L 1HZHH 2PW2A 4IIQB 2UY7A 5KVDH 4X7EC 4H1LA 2WQRA 4HS3B 5FOJA 5LG1A 1INDH 4YBHA 3BISA 3UPRA 4R3SB 2NY4C 1QVOA 1OGAA 5I1JL 1A5FH 1DTUA 2YBRB 2CK0L 1NEZA 5BVPH 2P24B 2P49B 1H3PH 1Z3GH 4JGJA 5F1IB 1HH6A 1MREL 2YS4A 3FHAA 1IKNA 1F4HA 4HZLB 5IBUG 3SE8H 2Y5EA 4X83A 3LHPL 3BKCL 4I8DA 4KPHH 2DYPD 2HJLB 1SM3H 2XOTA 3LKSB 4N0FB 1N7ML 1Q9KB 3TZVC 3ARFD 1J0YA 2DMKA 1FDLL 1R3IL 3FRPG 5IW6B 1C5BH 1DN0A 3MLVL 1A7PL 1KLFA 1QFHA 1K5NA 3BUYB 4OF3A 5MENE 5JTWA 3K1DA 3VFMB 2CLRB 3TH2T 1FZOB 4ZFGH 3KYOA 3P9LB 5I17B 3ET9F 5DI8A 4M62L 3ZL4H 2ORBL 5A1AA 3LS4H 5SWZA 5D7LD 2DKMA 4TVPH 4HUUB 2QSCL 4ZUUA 3VGAB 5ICXB 3K81A 1INDL 3MLZH 4HZAA 5IVOA 1FAIH 5LQBL 1AY1L 2CLVA 3MLUL 1I1AD 4OI7A 4XRCB 3LN4B 1MNUL 4POUB 4UB0L 3I50H 1T1ZA 2Q87A 1A0QL 4OLYL 4TUKH 1BREA 3QIWA 3UJJH 4KJWC 1PY9A 3U4EB 2LABA 2NX5B 3AS1A 2Y1VA 1K85A 4RWYH 4BQ9A 2NY7H 1MOEA 3JWDH 4L1DA 2I24N 4P2RD 1DVFD 5LXGL 2ZUUA 4YXHL 1ACYH 2MPAL 5DJXB 2DLFL 3BDBA 3LSOB 3HZVB 4TUJB 5H8DA 1AKJD 3CFDA 2X4SA 3BPCB 4HS6B 1A7OL 3B4NA 3BVNA 3BDYL 1W8OA 1U92A 1QLFA 5E2VH 4BZ2L 1TPXC 4JVUA 4QXTB 3B3IB 4QXUH 2DQDH 4O5LL 3L95B 1YNTA 5IHZA 1FQ9C 2DLIA 3HZVA 4P46D 3QHZL 4PJAB 3CFDB 4MDJA 4GG8B 2H6PB 2GJ6D 3EIFA 4Q97A 1BECA 1Z5LA 5K9KB 3HUJE 1UACH 5ID1A 5FYKH 3MBED 3QRGL 1KPUB 4HLZG 1DBKH 1FYTE 2KZWA 5FF6B 4D0DA 2VDPH 3GSOB 2NTFA 1T7ZA 4KJYA 4Y5XC 4QO1A 4R0LA 3IJHA 4MJ2A 1WSST 3O2DL 4KKLC 4OGAC 4OCLC 1A4KA 4P48A 3DBXA 4U1HA 3WFHB 3GSXB 2R1XA 2LVEA 1JGLH 4JQVC 4Q2ZA 9CGTA 1T7XA 1G9NH 2OBGA 1NKOA 4XPHH 5CCKH 4NM4H 2JIXB 3KXFD 4QKXB 4WDIA 4ZS7H 3S34H 5JPMA 4QRRE 4WFED 5F3BA 3ZT6A 1LO0L 1OPGH 2FBOJ 2VUOA 1AQKH 5AUMB 2UVEA 1U8QB 3DMMA 1C16A 3HNVH 3QDJA 4Q74A 4X7DC 1IAII 3X3FL 3LEXA 2DTSA 1UC6A 1FVEB 5SV4A 3QB7C 5IGXL 1K4DA 2CSPA 1DLHA 3FTGB 5E99L 2F54A 2FL5B 2EC9U 1FLTX 2XKUA 5C0JA 1HOCB 1PG7L 3BGMA 1AR2A 1S5IL 1C16B 3QDME 3MV8E 2IGFL 1TVHA 4BSWB 4G3YL 3GSNH 5DJ2A 4WO4C 1KIPA 1ED3B 2QADD 1OAXH 2YRZA 2Z8RA 4NC0B 4A6YB 3NIFF 5I2IA 4PREA 3CZFA 4YGVA 1WWBX 5FYLH 4XWGL 2HA1A 1Q9LB 4HIEA 4F58L 1RUKH 2BXYA 3MLYH 3O45B 8CGTA 3CXDH 4TN9A 1F6FB 4KKCC 5EOTA 3MO1A 2MQ3A 1LEGB 1OSPL 2WQ8A 5E8EB 4L4TB 3QWOB 4O4YL 4EIGB 1CGYA 1HYRC 3T65B 1JF6A 4QHNA 4YBLB 3QQ3A 2UZIL 5BW7A 1R3HA 3X13A 1KBGH 1IGCL 2PXYB 1EVTC 4QGYA 3U0WH 4F58H 4G6FB 1WTLA 1CFVL 1EHLL 3V95A 1NMBH 5DVKA 4GKZB 1ETZA 3KYMB 1EAPA 1KB9J 1OHQA 2L7UA 2X44D 2NY4B 1D5ZB 3QISA 5CMAA 2Q8AL 1JHKH 3N1GC 4Z7QF 3OGCA 2YSSB 3KYMA 1ETZB 2VTFA 4XP6H 4J6RH 5KN5B 1XGYL 2F19L 4HJJL 5ESQB 3OX8A 4P46C 4HXBH 1A22B 3IDNB 4WGWB 3RUGF 5TPWL 2OI9C 2K9UA 1X5GA 2HH0H 4Z7WA 2JJTA 5LAXA 4NOFA 1M71A 2JCCF 3PHQA 1ZANL 1EO8L 5CFHA 1JGVH 3NACH 3BEWA 5C0CE 3HG1D 4Z7NE 4HWBH 2XTLA 2PTVA 4M93B 3ARSA 4PRPB 4LHQB 4P2OC 4F7PA 2R29H 4MD0A 3MUZ1 5AG9A 5ILTH 4HUMB 1WICA 3G08A 4BFGA 3ARFA 1A6ZA 4D9LH 3FFDA 5E6IC 1DBKL 1GL4B 2YWYA 1LO2L 5IT2L 5DVNA 2X4TA 4PJXF 2AEPL 4Z77A 1MCKA 1T04A 4OQ1A 4K7PX 3SKJH 1R0AL 2W07A 1D3CA 5FCUL 2E27H 5B39B 2C7UA 4M8QA 1KCKA 3HR5A 4UQ3B 1UWGL 4I18C 5I1KL 4ZAKD 2OR8A 2GK2A 4XP5L 4XCEB 3TBSA 1HE7A 3HNSH 3DTXA 1OTTD 3CLEL 1T03L 1YEIL 1I7UB 1GVIA 1ODAA 8FABA 3OJDA 4JN1H 3KWWB 4LSDA 1KJ2H 1DE4A 4HIXH 1MH5B 5ERWB 1DDHA 4M6NH 3QBTB 1YMHB 5JHDD 4WRLA 2HTKC 1Z0NA 4I4WB 5I1HL 3AY4A 5F96H 5F88A 2BOCA 3UJJL 4UOJA 5HHXL 3H42L 3VWKB 1UB6B 4PRBA 2RAMA 3FO2A 1NCCH 4X5WA 5BOZG 3A6BH 3I50L 5EU5A 5IT2H 1P7KB 2J2ZA 1JMZA 4CW1A 2ZCKH 2BCKB 4LCUA 5F7NC 3MRRB 3KYKH 4OAWB 1WBZB 5F88B 3KXFA 5EUOE 4GKNB 4L9LA 1CD1B 2AXFB 2CRYA 1R3LB 4JM2C 4L5FL 5FYKE 3NABL 3H9ZA 5D8JH 2D7OA 1MJUL 3D3VD 3PGFH 2P7TA 2ZUSA 4N0UE 1FDLH 2NLJB 4Y4FC 5DHVA 3QDHA 1KC5L 3IDXL 3DSFL 3HZKA 4HGWA 2HJKA 1IGMH 4JN1L 3LIZL 5D7JC 4QHLA 4TSCL 4G6KH 4NQXB 4Y4KC 2DWEB 5LGJB 3ZE2F 3T8XB 1NGPL 1AKJA 4XPBL 1NAMH 3D9AH 1BZ7B 3GSNA 3H0TA 4L3CB 5DEGA 2JJSA 3FZUC 5E2TL 5DJ8A 5ETUA 2EDKA 3QPXH 3SCMC 2V5YA 2VLKB 1YMMD 3VXNA 3GI8H 5FYJU 3JWNC 4XP6L 2YPKA 4JHAH 1MRDL 1I85A 2RQ8A 3T0AA 4G80A 2Z31A 1JNHA 3QUMB 2BHZA 3C6LB 1PEWA 3WKMH 1S9WA 3QEQB 4XVTL 4UTAH 5KVGL 3GK8L 1YJDC 5F70A 2EZ0C 5C08D 7CGTA 3F5WA 1QKZL 4V2CB 4W6YB 3VXNB 5EIIB 3C5SB 4M6MH 2OL3B 3FRUB 3QFJB 1F02I 2Q3AA 3JWOL 3S6CA 1KG0A 1ZEAL 3VWKC 1M6OA 1U41A 3C6LA 4LSSL 2FR4A 2ILLA 5DURD 5DD6B 4TSAH 3DXAD 2I26N 3FOLA 1CR9L 4HIJA 4R3SA 4GXUM 4LCCA 5EA0L 1OGAB 5TPWH 3QIBC 3C09C 4KQ3L 3EYUL 1NGZB 1UCBH 1UG9A 4YE4H 3ARUA 4LP4A 5ANME 4K9EL 1HH6B 3BI9X 3E2HC 1F2QA 4BH7B 4G9FE 4P2QB 1YECL 2MJWA 5FM5M 5GZNC 4QY8B 1XCQA 4FNLL 5CWSA 1T2JA 5DK0A 4TULH 2H9GA 3GIVA 4PJAF 5ADOH 1UQSA 4NGHL 1A47A 1PGRB 2OZ4H 4GRMB 3KJ4C 1ZT1A 4OBSA 2CKNA 1FG2B 4O2FB 4Y16A 3MLRH 1NBYA 4XPFL 4NKMB 3RWGA 2FHFA 3DO3A 1KJ3H 3EHBD 1KIRA 1H15A 1N26A 2WSKA 5EOQL 4YDKH 3VFMA 1WZKA 3IRZA 3BIKB 4OFYA 1I1AA 2FRGP 4HIXL 4NO3B 4ETQB 3G5XB 2W0PA 2BVPA 3PXHA 4NKIH 4JGUA 1GZPA 5T1KA 2X4UA 1CGVA 1Q9OB 3MRDB 3PQYB 3BZEB 5DMIH 1TVBB 3GI9L 3QDAA 4GAJL 4NYLB 4WNQA 2XQBH 4G43A 5BXFA 1I3RB 3BP6B 3KYAA 2GKIA 3WO3B 4NCDA 5KSBE 4UBDD 5C8JB 5H35A 1A3QA 2NXZC 3ZSTA 1R5VA 2PCPB 3QIUA 4G3YH 4PGBB 4MA1B 5GGTL 1I75A 2WWMD 1MQKL 1O7SA 1VPOH 4O51B 5A2JH 3HE7C 4YR6A 3E3QC 4ODWA 3R0NA 3QEHB 2X6MA 4OLXH 2F53B 1RIHL 1FFNB 1HEZA 3T09A 5A43C 1EHAA 2EKJA 4KDVA 2WINA 2VDQL 1HH9A 4RAHA 2E7LA 3NACL 1KTRL 4NQCA 1YEJH 3HC0A 3ZKMD 3B9KD 4WWID 1ZT7B 4RGNC 4OZHA 3RI5F 1QFPA 2V5RA 3QP3A 3ARGB 3QZWA 4WEUD 1FN4B 2H26A 3U4BH 4MNGE 1ONQA 5BV7L 2F19H 2AXGA 1IC7H 2EDHA 2QHLA 3GFUA 3ARDD 4HBCL 2A77L 1OTSD 4X4YA 1QR1B 1SEBA 2ICCA 1X3DA 3WKNA 4LSVH 4OM1L 4Y88A 3ARGA 3BX7C 1CLYH 4NZRL 2YPLA 3IFOB 5D5ME 25C8L 3C09B 4X9BA 2AXGB 3KHQA 1CVRA 5J3HC 4D9RD 1OGAD 2Z91A 4X6DF 3DWTA 4UNVA 3RY4A 3BN9C 4N1CA 1L4IA 2HFGL 1CL7I 5GGSB 4P2OD 1G0DA 4XPTL 2H41A 4L3EE 1X4YA 3MV01 5E8DL 2Q8BH 3TJHC 2B1AL 2C9AA 4LSTL 2ICEA 3R1GL 4U3XA 3V6OA 4UI2A 4PJ7F 2EO1A 1ZLSL 1OTTC 3Q3GB 1A6AB 2DF3A 3KDMA 3LEXB 5GZOC 1ZA6B 4MD5B 1U8IA 1FVEA 1SBSL 1NCTA 2W0KA 2IANB 3BKJL 1MLCB 5I1GL 2CJUL 5C0JB 2HVJA 1AC6A 1DQQB 1T6WA 4U1LA 5ISZB 4MQTB 4BM7A 1UM6L 1PYWA 5IMLA 3PWVA 3SCMB 1A6AA 2SEBA 5EULV 3TT3H 1T0NB 3C6SB 3AU1A 3IS1X 5E2JA 1P2CA 5IW1A 4ZXBC 4X0KA 2H8PA 3S7GA 1B0RB 2FSEB 2VLRB 4BSJA 5AD0A 1IM3B 3SE8L 4C56D 4HIEB 3TYFA 1AR1D 1NC2B 3RDTD 4ELKB 1WIUA 3ULVF 3MO1B 4JCMA 3C2SA 5BRZD 3DVGA 3LN9A 5E8EA 1QPPA 4LCWB 4I3SL 5JNYA 1U8JA 1B6UA 3TWCH 2DM7A 1E0OB 1YJDL 5H94B 1QFWH 3AB0B 3KS0H 1LE5B 4UBDC 4MAUH 4YBQD 3L7FA 1CYGA 1WCBA 5DRNA 1FH5L 2LTQB 3RJQB 5IM7A 2G2RA 3EFDL 4YO0B 1IKNC 3GSQA 3ZKMC 3QUYA 2CKBL 3GBLA 3QPXL 1MF2H 4HPOH 2NR6D 1VACA 2AI0H 4KK6C 4XXDA 3I6LE 3RJDA 5I8OH 1CDBA 1MCNA 1IMHC 3TPUA 1KYOJ 3PGFL 5L2JA 4OD1H 5JIHA 3E8UL 5HTSA 2DLHA 4JCLA 1A21A 1MFBL 4OLEA 3MGTA 5FK9B 1LO3L 4S1DD 1B0WA 3MFFB 4FTVA 1S5HB 2YSSA 1K4CB 3S5LG 1IGML 3FN0L 3W9DB 5J56B 4HKBB 2EDWA 5D7IB 5KN5A 1AGFB 3MLXH 4ZOEA 5ESQA 1HILA 1MRCL 5CJQL 2R2CA 4XNXH 4EXKA 4FMKA 3LH2L 4R4ND 3V52H 1KGCD 3W39A 4UT7L 1IGJA 4LLDA 4HMDA 1MHEB 3MV9D 3GIZH 2IQAB 2VR5A 1BQHB 3SDCD 1KB5H 2GTWA 1I1RA 3WFDH 1S7QB 3BD5A 3BXNB 1C7TA 3VD9A 3N06B 3DECA 5K9QI 2BSRA 5J6HB 3FAXA 3FT4A 5FYJD 3MRFA 4KJPD 4P3DB 2VXVL 3G08B 4HULB 1CLYL 1KJ2A 4HFUH 3ZZ1A 5E6IB 1A0QH 4OLYH 4QOKB 1JUFA 4PJAE 2V2WB 3ARBC 4N0CD 1D5BA 4RCAA 3BKYL 3U7YL 4Z77B 2V7HA 4XZUA 1KNOA 1LILA 3SOBH 1B4JH 2QR0B 1MFNA 1HIMH 4M8QB 4EI5C 3MC0A 3B9KA 5EUKA 3BH8A 5DGRA 5C09B 5KZCD 1CDUA 5F9WC 3L3KB 4XNUL 5C0CD 3QQ4B 2BNUB 1KPVB 4HC1A 3OKLA 2GJZB 4NUGH 5C2UB 4OLUH 5CEYB 1OP9A 1IGFH 2CDFB 3V4VH 2VZUA 3BESR 1MPAL 3B83A 3X11B 5E9DA 3EO9L 3WHE0 3QUKB 3GJEB 5KSAB 2VLRD 4AM0A 1A3RH 3MJ6A 2BY0A 4NQEA 4X6FA 1AXIB 2AK4B 2YC1A 4PJ5A 2R23B 1P84J 5FO7A 4ORGB 3X3GL 5IB2B 32C2A 5CBAB 1BJ8A 3D3VA 2WMPA 4JFFD 3FO9A 2VUYA 2EXWC 1H5BB 2YN3A 3MRRA 1WBZA 4ORGA 5C9JB 3ARBA 3VXUA 2VDRL 3MBXH 5DK2A 5I8KL 2EIZB 5L2KB 4LSPH 4UILL 3BMVA 4Y89A 1H5BA 1TIUA 3ZDXE 1YEEH 2NLJA 4IMLA 4Q0XL 4X5XA 5LWYL 3ARBB 3STBA 3VXUB 3WIIH 3AC0A 5AAMA 2MHAB 4KROB 3T0BA 1CD8A 4PS4L 2DQEH 2DLGA 3REWA 1PY4A 3BJLA 3RIFF 3OAUH 3FQWA 5D1XB 4C55A 5C0IA 4PP1C 1C08B 4O4YH 5IVXB 4L3ED 3QIWD 1MHCA 4WO4B 1KULA 5DJ8B 4QRSA 2IALA 2BMKB 1EEZA 2XN9A 4BQCA 1EA9C 3DGCR 3M17B 2XZAH 5MEOA 3HPJA 3S37X 3QDMA 1MCOH 4OLWL 4LASH 3NFSH 4O2CB 1ZVHA 3WN5B 1BMGA 1ADQL 1MHPH 4YHLL 3FQNA 4L9LC 3MCG1 3FONA 5D7KD 3V0WH