5EC2A

Kcsa with v76ester+g77da mutations
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec2A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec2A02
2ICEB 3PQYB 2R23A 1W72A 3I02A 4NKDB 2WK2A 3VDCA 4DVBA 2PETA 1CBVH 2AJZA 3WHXA 1ZT4A 2YS4A 1MFBH 1CBVL 3LAFA 2XN9A 3MR9B 1MCWM 1MFBL 2Q20A 3W9DA 5DRXB 4WO4B 2V17H 4ZS6C 4MXQC 1TZIB 4WEBH 4ZO8A 2V17L 1HHIA 2K3TA 3OQ3B 4IRJA 3V6OE 3PIQA 2XY2A 4WEBL 2VLKE 1BLNA 1OD9A 4F2MA 4GT7A 5HI4D 4R97B 3LZFH 2WBKA 1NC2D 3LZFL 1TVBB 3QXAA 3VI4E 3UDWC 5GS2D 4I2XE 4UQ2B 2JF1A 1I4FA 2XQYG 4NQXB 5HI4C 3S5LB 4D3CH 4PV9A 4RFEA 2LU4A 4U3CA 4D3CL 1BJ1J 2QKIA 1V7MH 1F45A 3BWAA 1C16A 4G9FD 1V7ML 2FBOJ 5IWLA 4AT6A 3KDMB 3QUKB 1GC1H 4HZLB 2N56A 2CXGA 3WXVH 1GC1L 1I1CA 3PWPA 4OZFB 2EIEA 3WXVL 2BNRE 2XY1A 3WNOA 1G6RB 1A1NB 4PTTB 3GJFK 1WBZA 2X70A 5T5FL 4M6NH 5D70H 5J13C 3D39B 3CFDA 4M6NL 5D70L 1KLUB 3MSPA 5I8KH 4YIQB 1S9YA 1SJHA 1M7XA 3KPOB 5TDOB 3O9WA 4JDVB 5I8KL 3U9UA 1EFQA 4KK8D 4NO0B 5FUCE 1EHNA 2QSTA 3HZKB 4P3CH 5IVXB 5EZLA 1P7QD 3WFCH 3ZL4H 3UTSD 1HHGA 4P3CL 2BJMH 4JLRB 3WFCL 3ZL4L 2VTFA 2BJML 4JFEB 4D2NA 43C9B 4HK3J 2WIIB 1IMHC 3INUH 1I3GH 5F7HA 2BXZA 4YHIA 5FDWA 2HN7B 3INUL 1I3GL 1JPGA 2DIBA 4JN2A 2B20A 2QQNH 4PJ9D 4HWZB 3T1FB 2QQNL 3DUSA 5GGUA 1M7IB 5BW7A 3KLHD 4HKZB 3OB0K 4X5LA 4ONFH 4Z7OF 4LHUG 4LLVA 1QHPA 4ONFL 5C0RH 3DMMD 4PJ9C 1NFKA 2JJWA 3UTOA 4UV7H 5C0RL 5L2KA 2HT2D 1RK1A 1W0YT 4JAMA 4PG9A 4UV7L 5CGYC 5JW3H 1FG2A 3OWEA 1D5XA 5I16A 3EO9H 4NNXB 1DQDH 5JW3L 4PREA 3EO9L 3RUGB 2NY5C 1DQDL 2VZ3A 2ERJB 3SDDD 5EU7E 2APTA 3UPAA 3TC9A 1AJ7H 4CVZA 2ZUUA 2HT2C 4OCRH 2BOBB 3HE6A 1AJ7L 4OCRL 4RAVA 5SWSA 4G8FB 5EBWB 3L3HB 5DSCA 4JFXA 3T0ED 3O6FA 4K7FA 4NWUH 4I5BA 3BW9B 5ACZA 4NWUL 5C0AA 5MERA 5CHNA 3S8WA 3WE6A 3FO2B 2NX5A 3GJFH 4OB5H 3BUTA 3MYZA 4OB5L 3EGSA 2ZG1A 3X12B 3VXQA 5F7NC 4FZEH 5KG9B 2F54A 1FO0B 4LLDA 5CKGA 3T3MF 4FZEL 2OR8A 3VI3E 4FABH 5CS7A 3LRSB 1UADC 4JRXD 2KL6A 4FABL 5I8CA 3GIVB 5L8JB 3RQ3A 1OSPH 4PGZA 2UY7A 4NHUB 2XACC 2WAHA 1OSPL 1OGAE 1VEMA 3WNNA 4PJGA 4NCC1 2HRLA 5DHVH 4HWEH 5C0BB 4HWEL 2D7MA 2QR0A 1JN6B 4MNHA 2NNAA 4RZCB 3EUUA 4J1UB 4Y2DC 5SV3A 2APXA 5DJCA 6CGTA 5F7WC 2F53E 3OB0H 3BEVA 4WI9A 3QULA 1MH5A 1IKNC 4U1LA 4JDTH 4OZHB 3VH8G 3C2SA 4DCQB 1PG7H 4JDTL 3S35H 1ZE3C 1PG7L 3KLAB 5H37H 4KMTH 3B6SB 5DEGB 3S35L 3VXRD 1WT5C 1AE6H 4KMTL 4GBXB 1QLFA 3T04D 5IVXF 1AE6L 3QRGH 4G6AC 3SOBH 2A83B 3BGFC 3L9RA 3QRGL 4KU1A 5IB5B 3CNKA 3SOBL 3LMJH 3FT3B 3IETA 2NY6B 2VDMH 3LEXA 3LMJL 2VDML 2XKUA 3OR6A 5DUPH 3VFGH 4OUUA 2HFEA 1AI1H 4Z7NE 3RWHB 5DUPL 5TDPA 3VFGL 5IB2A 1AI1L 4UQ3B 5IKCA 1XCTB 1L4IA 1I3RB 3GBLA 3GMMB 2BMKA 5EO1A 1IC7H 5TGBB 2XXMB 1IC7L 4PB0L 5IJKC 3NIDF 1QSEE 5IF0B 4AL8H 5JXED 1GGIH 1U3HA 4AL8L 1GGIL 4JRYD 4MJ5A 4BA8A 3F7QA 4EI5A 3DIFB 4ZTOH 1JPFB 2CKBA 3HPJA 2EEDA 3V4UH 5ICZA 4NKIH 5TJWK 5F8QC 4ZTOL 1X5IA 3GMLB 1QTYT 3V4UL 5JXEC 4NKIL 3IU3A 2O5XH 3VDBA 4RGMB 1AH1A 2O5XL 2DBJA 3T08A 4XHJD 2GFBA 4TUKL 3QNZA 4FG6C 3AMKA 1GIGH 3VCLA 1IGJB 4AIOA 5MEQA 4PJAE 4GFTB 1T21B 1BD2D 3MJ7A 1GIGL 3HI5H 1YQVH 4MJID 4I18B 2IPKA 4PJBA 5CP7B 4L9LC 3HI5L 1YQVL 4UOJA 4MNQB 1FYTE 4Z78B 1KTDB 2Q3ZA 4R7DB 5LGJB 5TH2A 3G5VB 4XHJC 2MHAA 3L1OH 3OAUH 2DYPA 3P4MA 2UWEA 4PRNB 3L1OL 3OAUL 4IRSC 3QDJB 4CNIA 3B5TA 4JE4B 1F4WH 4OZIE 4TVSa 3RIFK 3U83A 1F4WL 4I9WD 3QO0B 3SGEH 1A7OH 4D0BA 3SCMB 1PYWB 4GLRH 1A7OL 1N26A 4EKXA 3PWLB 4XRCA 3MGAA 1MJUH 4Y5VB 3I2CH 2MCPH 4FQQA 4AEFA 1TXKA 2GTZB 3QPXH 1MJUL 3I2CL 3QZWG 4P46B 5EUOE 2MCPL 1FAIH 4LVOC 5D7JB 3QPXL 3WS3B 4MXWH 5ISZB 1FAIL 4MXWL 1KCRH 2YOCA 1QFWM 2EC9U 3MFFA 4LGPB 1KCRL 2I60H 4UNVA 5FECA 1TNMA 4LPVA 3TBTA 2I60L 5E8PA 3VGDA 2X7LB 3GI8H 1RMFH 1ZKAA 4WHYH 3GI8L 5T33H 1RMFL 3ARWA 3RL1A 4OZHF 5T33L 5E5MB 2XA8H 3SDXA 2XA8L 3MROB 1U8NA 1TMCB 4Y16C 3RKDD 1EAJA 3TCXA 4G9FE 4KROD 2W65A 1T1YB 4YDJA 3D9AH 3VXMD 1XAUA 1DUYA 3W0WB 4M61A 4EIGB 3D9AL 3MLVH 4ODWB 3ZHDA 3D69B 2CD0A 3IGAA 4U1NB 3EFFB 3MLVL 4HZAA 4X5WA 1XR8A 1RSFA 4D94A 4KJPD 3RKDC 2JCCF 3FO1A 3C9NB 3VFMB 4HULB 1ZS8A 1UFUA 4KROC 3GBNH 3BWUC 4YHNA 5GS0D 4KK6C 4FOMA 2VDPH 3GBNL 3BPCB 2YPLD 4YDKH 3KNBA 2VDPL 4OQTH 5BMFH 5IHZB 4YDKL 4OQTL 4KJPC 5GJSH 1FZOB 5BMFL 4Y5XA 1H0DB 3O2WH 1IILE 4PJ5B 2VO5A 5GJSL 4JY6A 4LCCB 1ED3B 3WLWD 3O2WL 1QQDB 3MRMA 1FVEB 5DK2A 4NYLA 5GGSA 1VA9A 3QB7C 3I6GA 5F7FA 3UTSE 3WEXB 4H25B 2EDKA 4GKSA 3L3GB 3UTZA 1DN0B 4JEGB 4JR9H 4P57A 5IOPB 4LLUA 4Y4FC 2X41A 4KGJA 4JR9L 3DRTA 4ZPTB 2Q87A 1KG0B 4P4RB 2JK5B 4Y1AD 1RUPH 5BOPA 2QADD 4Q97A 2SEBA 4X6DA 1RUPL 5D6CB 3TLRA 1TITA 5D2LF 4RGNB 3C5JA 4LBEA 4PRBA 2ZUQC 3TO4D 3WUWG 5BVPH 4M5ZH 2XYCA 4ELKB 5BVPL 4M5ZL 2QADC 2ARJB 4U1IA 1JV5A 5D2NC 4PJ7A 1XF1A 4O2EA 4OV5A 1QHOA 1I8LC 1JGLH 5J7CC 1BX2A 1JGLL 2ZUTA 3VH8A 2LU3A 3QDMD 2R1WB 4MGXA 4EUPH 1ZLSH 3QIBD 3DXAD 3C60D 2UV3A 4JZOA 3TPKA 3QG6B 1ZLSL 2XWBB 3T0EE 1IAKB 2ITCA 2OX5A 4DUXA 3MLYH 2RGSA 5EO0B 1MVFA 1YDPA 3MLYL 5IP4A 1N6UA 5IW1B 3SO3C 4NC1E 1QSFA 3KXFB 1FL6A 1P5VA 4R3SB 1OP5K 3DUUA 3JV4B 3TZVB 3GMRA 1VFMA 4QHMB 4P0DA 5F88B 5IG7A 3MRIB 2DTMH 4LKCA 2A74A 1IE5A 1BBJB 3MRBB 1LILA 5D71H 4P3DB 2DTML 3P9LA 2R8SH 1RZ8A 4L3EB 5D71L 1HNGA 2R8SL 5INCB 5E7FA 3PV6B 5FV1L 2PYEB 2YSSA 1GC1C 3L3DB 3R0NA 5FO7B 2J4WH 1XIWB 1F6AA 2J4WL 1OARH 2C9AA 4JM4H 4NM4H 1OARL 4JM4L 4NM4L 1R5VB 4AH2B 3PWNB 1CT8B 1PKQE 3BDYH 2BNQD 2NTFB 3P9WB 4MQ7B 3BDYL 3MRPA 3BZEA 2C1OA 4X4YB 1AGFA 1KXTB 4NQCB 5JPNA 4XNXH 4YE4H 4O2FB 5IW6B 4TUOA 4XNXL 3VXRE 4YE4L 3TJEH 1B3JA 1MSPA 2HTLD 3ZYJA 1INQB 3JTSA 3TJEL 5HHOA 4P4KB 4ELMA 1WCBA 3OX8A 2VWEC 3LIZH 3VGEA 3VWJD 4B5EA 2OJEB 1EMTH 5DVNA 3P9MA 3V9FA 2NTSP 3LIZL 3OKDB 1EERB 1EMTL 4LCWB 1BMGA 2AK4D 2CUHA 1R5IA 4DTGH 4L8SB 5JQHC 3IKKA 1FC1A 4DTGL 2APBA 4LPCA 3B9EA 5DJAB 3WKNA 3TNMB 3NA4A 4MAYB 2FX7H 3CFEB 4PJDE 1NC4A 3BPOC 2NZ9C 4LCYB 3QZWA 2FECI 2EDJA 4KJWD 1S78C 5EOCJ 4C56D 4XP5H 1SMAA 3TBWA 4Z7VA 4ZFZA 1OP5H 1KT2B 4TNVF 3CMOH 4JRYE 5I2IB 4XP5L 4U1GB 3SKOB 5IIEB 1XZ0A 5F1SA 3CMOL 3QUMB 4GG8B 2H8PA 2IBZY 4MXVF 4KJWC 5ETUB 4G8IA 2FGZA 5JNYA 1RULH 1RULL 4MQSB 4FP8H 3L5JA 4IOSD 3L95B 3MMEA 5C0ND 3ARSA 5E5RB 5FK9B 1MUJB 1JWMB 4FP8L 4KKAD 4PP2A 1EO7A 2NXYB 1FN4A 1BD2E 1Z5LB 4CAGA 1U8QB 1CLCA 1R3HA 4HT1H 4L4TD 5KS9F 1KJMA 1RD6A 3NIFE 4JQIH 3OKMA 4MYWB 3KPRB 4JQIL 4WVRA 1QFOA 4JZJB 1GGYA 3DOSA 3UEZA 1N6VA 3GI9H 3O6MH 4K7PH 2F74A 5GGTH 2ZCHH 3GI9L 3O6ML 4K7PL 4X6CF 4I3GA 1JYNA 2PCPB 5A2IH 5GGTL 2ZCHL 4I9WE 5FV2A 4XNMA 3TF7C 4N0UA 4P2RA 5IMMA 1ZVSA 4WI8A 4Y88A 3K7UA 2N1KA 4DJMA 5KSAB 1OAYH 5BRZA 5J11C 1OAYL 2VIRB 5D93C 5DMYA 3K2UH 3ARGD 5E1AB 3MRFB 4HH8A 3K2UL 3U0TA 4G7VH 4PRPD 4X99A 3CX5K 1YEFH 4G7VL 4R0LA 1YZZA 2OZ4H 1YEFL 3O8XA 1U36A 3D0VB 2OZ4L 3KPQB 3FL7A 4YR6B 5BS0A 1JZ3A 5SWQB 4PLOB 3O41A 4PGJA 4OCSH 4U05A 3EOBB 2HT3D 4CMHC 1S9VA 3O4LD 1T7XA 1PVHA 4OCSL 1U2HA 3E6HB 2IFGA 3UTQB 3MRCB 4OF0A 3DYMA 4GQ9H 3VXME 3O2DH 1T89A 3TN0A 5BJTA 1F42A 5IFJB 4GQ9L 5T1LB 4U2YA 3O2DL 1LDSA 4RX4A 4F7EB 2VQ1B 3U30C 2HT3C 3JVGA 1VKXB 1A9BB 3HC0A 2Y7QB 4OCMC 2Y06H 2VLKA 1I1AD 5EBMA 4GKNA 3SKNB 1J8KA 2Y06L 3ALPA 5I0ZA 2DJ4A 4NHCH 4ZO7A 1YN7B 5FKPA 5FAAA 4I0KA 5E00A 1F11B 2YPLE 4I0PD 4NHCL 2WANA 4ODHH 3ARBB 1L7TH 3MODH 3PGDA 4ODHL 3V6ZB 4OLVH 1L7TL 3OGCA 3MODL 3O0RL 4OF5A 3UYPA 3U1SH 1I1AC 4OLVL 5I1AB 5DRNA 4I2XA 3U1SL 1A8JH 3P73B 2XKNB 4E42A 1KB9J 5HY9B 4I0PC 1XGTA 4PRHD 2VE6B 4PGCB 3UJIH 1HCVA 4X9IA 3ZTJH 2CLVB 3UJIL 4ZFFA 3AREA 1N8ZA 4QRRD 5L2JA 4JM2F 3WIFB 2VKXA 2G5RA 5T3ZD 2BNRA 4PJFA 1NEUA 4Y1AE 3FQXA 2QQLH 2XKSA 2VMFA 2VZVA 1CFQB 1N2RB 1R5WA 4NWTH 2QQLL 4XWOD 4GS7B 1ZANH 4NWTL 4BSWB 1I1YB 2VERN 3CVHB 1ZANL 5B22A 4HFUH 3WFBH 4M6MH 4TVPH 3K1DA 3ZZ1A 5B3NA 4HFUL 3WFBL 4M6ML 3G08B 3EDFA 4TVPL 4ZUVB 3MBEB 3EAKA 3QIWB 4OM1H 4R96A 1CS6A 3BSZH 4E5XA 4OM1L 3P4LA 3BSZL 1TDQA 3U46B 2GJZB 2VR4A 4U6XB 3TVMD 2EO1A 3V6FA 4DFIA 3G5YA 1LEGB 2AEPH 4GH7B 4G8GD 3O81A 4A6YB 3QDME 2AEPL 3TM6A 3DXAE 5E8OB 3W2DH 2WINB 1FFNA 3W2DL 4N9OB 3P11H 5E8NB 4ALAH 3P11L 4QCIA 4ALAL 3IAGC 1CD1A 4XNZB 1NAMH 1FSKC 4NN5B 2VDNH 3RAJH 1NAML 4U0RB 3TP4A 3LKQA 1HEZA 2OXGA 3RAJL 3GMPB 2I5YH 5INDB 3GK8H 3EIFA 4WUUD 4HGMA 3SDAB 4K8RD 1FIEA 3GK8L 4K3JH 5ACLA 4K3JL 4YHYB 5F3HA 5FO9B 3EHBD 4BFGA 4M9PA 4YBQC 1YMMB 1WTLA 3NPSB 3QEQD 3M07A 2AAVA 4I3RH 1LO3H 4I3RL 1LO3L 4PUBH 2ATPA 4KMLB 2P7TB 4XAWH 3EHBC 4QOKB 1XF3B 4XAWL 4Y5YC 2CDGA 2UYLA 2Z31D 1XF5A 2DDQH 2BSTB 1H3WM 3BQUB 4GW4A 1CFNA 3RA7H 2DDQL 1K8IB 2BNQE 3RA7L 3QDGD 3TCLB 2ENSA 2B4CC 3FFDB 5I1DA 1IC4H 1A6WH 2HP4A 4OFKA 4OM0H 5DD5H 1IC4L 1OAQH 1A6WL 5DD5L 4OM0L 4WW2C 1A2YB 2VWEE 4OCXH 1C12B 3PL6A 1OAQL 3K74B 3LY6A 4MCYA 4OCXL 5AD0A 5IFHH 3GSRB 3RZCA 1RIVH 4ONHA 4HBQA 1TZHB 5TF1H 5IFHL 2HFFB 2UVEA 1RIVL 3REVB 3SE8H 5TF1L 1YMHB 3BP6A 3SE8L 4RFNB 4N68A 5KANG 3QFJB 4MD0B 3P77B 3KR3H 4FZ8H 4YXKH 1T03H 3KR3L 4FZ8L 4HV8B 4YXKL 4RMRA 2AK4E 4OFIA 3PXHA 1T03L 7CGTA 3RJDA 1ZHNA 3ZDXE 3BP5B 1Q9WA 2BVQA 3TA3A 2DLTA 2IF7A 3BZFB 4V1DB 3H7BB 1Q94A 2F53A 3LKRB 1TFHA 4GRWE 3T2OA 3RGVB 2OM5A 1A5FH 4LL9A 4XXCA 1X44A 3AY4A 1UB6B 1XGRB 4C56E 5I74C 1A5FL 2EDNA 4XTRD 2HFGH 4PYGA 3T8XA 4OZGE 3GM0A 2HFGL 4UT6H 3VDAA 4IS6A 1MRFH 4UT6L 1HI6A 5DGRA 1MRFL 3FMGH 4PB9H 3QCUH 5HHNB 2A77H 1ZMYA 3FMGL 4PB9L 3QCUL 2FJGB 2A77L 3HI1B 3QQ9D 1GVIA 4P5KB 4QNPF 2ZSWB 2DAVA 4UDUB 4L4TE 3QBTB 2D7NA 3EYFA 3TPUA 1FNHA 4ZAKD 4NUJB 2WMPA 5BOZG 1N3NA 5GRUH 4R4ND 1MAMH 5KVFH 3CK0H 5GRUL 5HPMA 1QSEA 1D5BB 1MAML 5KVFL 3CK0L 5KVEH 3MRQA 4KMQA 5KVEL 4MD5A 4ZAKC 1U8HB 3X3GL 4R4NC 2X4NB 5F1IB 1QEWA 2HJKB 5CEYA 2OTUA 3B3IB 4YPGA 5JIPA 4NBXB 2OQJA 2CRYA 2YWZA 4JFOB 3PWVA 4XB7A 4JPVH 1NGWA 5J6GA 3LKPA 4P5TA 3EJJX 4JPVL 1VDGA 1Q9KB 2JLLA 4OI7A 3CUPA 4PJAA 2V5SA 1SJEA 3WNPA 1DCLA 2W60B 3IDNB 1DVFA 5E94A 1NGYB 4RQQB 1EXUA 1X5FA 1D9KA 3CXHJ 3U6RA 4IM8A 4HIXH 1FYTA 1NMCC 2YN5A 4R7NB 4HIXL 4PRPE 4Y8AA 4I48B 3A6BH 3ZHKA 5HGDA 2D4FA 3A6BL 5C07B 3WJJC 2NY1D 2YZ8A 4GLRI 2PUQT 4OZIA 4NQDA 3O4LE 5DHYB 1GGUA 2DLEA 3O11B 4LPXA 4ORGA 5B4MD 2NY1C 1Z9SA 2IANB 2PXYB 4PJXE 4WRLA 2R1YA 1X7QB 1JZ2A 5EUOA 2CR6A 2MTPA 5J8OA 1LP9E 1G7PA 4NQUA 3UDWA 2CLRA 4YO0A 5B4MC 4Y19D 2DL9A 5ESQA 1HDMA 1G7JB 3NBNA 2XNAB 5A16A 1TVHA 1MJ7H 1NC2A 5EC1A 5IB3B 5E4EB 4QWWD 1MJ7L 1BOGA 4R4BB 3NOIA 4HMEA 4ZDHB 1WZLA 2EYTB 5DJ8B 3TESA 1DLHB 4D9RD 1OCWH 1YC8A 3FKUS 4LRNH 4L29B 1OCWL 1Y18A 4PRHE 4QWWC 3IFNH 1ODAA 1HIMH 4LRNL 3IFNL 3HLAA 4U1KB 1HIML 4HK0A 4QRRE 3H0TB 5DMGD 5C92A 1U58A 1SQ2N 1PLGH 2DD8H 2GITB 4MCZA 2XTJC 3OJDA 1PLGL 5T3ZE 2DD8L 1FVCB 3HG1B 4K23H 1JUFA 5CCKH 2EH7H 4LVHB 5EZJA 4K23L 5CCKL 3F6LA 2EH7L 1V3MA 3BIBX 2HH0H 2G60H 4MSWA 3MLPA 2X1QA 5TDNA 3H2WA 4FFWD 2HH0L 2G60L 3BZDA 1A1OB 1JYXA 5CJ8A 5D1XC 5KZCD 1VFBB 3RDTB 4KKLD 4K94H 3N85H 3C8KB 3VFSA 3D2UD 4K94L 1QLRB 1NBVH 5CIPH 1PAMA 2FJHA 5HI3D 1NBVL 1U8LA 4FFWC 1P7QA 4NDMB 3UTSA 4HX1B 4FXKA 4KKLC 4W6XB 4JREC 2GTWB 4G8GE 3IDYB 1QBLH 4CJ0A 1FVDA 5HI3C 1DR9A 1BAFH 1QBLL 1I7ZA 3CFBA 3MUGA 4PJ9A 1BAFL 3SQBA 3PQYD 2MQ3A 1WIUA 4OGAD 4ZPVB 3SPVB 3MLWH 1UJ3C 1JF1A 4ZUSB 3DMMA 3OPZH 1L6XA 2VXQH 3MLWL 2BHZA 4WO4D 4H5SA 3OPZL 3G6DH 5CEZH 2VXQL 1ORSA 5DMKB 4ISVA 4JPIA 1FZMA 3G6DL 2J2ZA 4WUUE 5CEZL 5CEXB 4M1GH 2E5EA 4BJLA 4OGAC 4M1GL 4LDEB 3SDDA 1H9VA 3VRLF 4RA3A 4WO4C 1BVKA 2HFTA 1R6VA 3L7FA 4NZJA 4W6WB 1C5CH 3QEQE 1KJ2A 3DVNA 3HKFA 1TPXB 4PLJC 1C5CL 1CXFA 4J8RB 3T0EA 4Q2ZB 5F9JB 5K9KA 5ID1A 2EC8A 5GHWH 2IAMB 5DYOA 2P8MA 5JIIA 3V2AR 2LV4A 5GHWL 3T1WA 2DQDH 2GIYA 1Y0LA 1TTGA 3ZE1E 2DQDL 1P7HL 3NCMA 2IMNA 3QDGE 4UMGA 4JHAH 5FKAA 5EPMB 3TBSA 1K2DA 4JHAL 2E9JA 3PDOA 3BP4B 4BSVB 4QRUA 5D96B 1ZV5A 3VXPA 3FRUA 4AM0B 2XG4A 1T0MA 4UU9A 4JRXA 3D39D 3SGKC 4HKBB 1UB5B 2RCSH 4QYOB 2RCSL 4QHNB 1A47A 1P84K 1A1MA 2EYRA 3MFGB 4MDJB 4APQC 1H3PH 3RIAF 4J3UA 1KIPA 4NO0D 4LDLB 1H3PL 2CLZB 1OGTA 2CDEB 3WIHA 4LPTA 2IADB 5CMAA 4UOW1 3O45B 3QXVA 4C83A 3HNTH 5ITFA 3CFCH 1T1ZA 1PKQA 4JFED 2D0FA 1KTKE 3FTGB 3CFCL 3HNTL 1AHWA 3WNMA 1WT5A 4AQ1B 5JZ7D 1D5ZA 4RMUA 3IKCA 4ZMAT 2VXSH 3IXTA 5HGAB 2VNCA 5JA9A 4XP9H 1E28A 2VXSL 1N59B 5HVFB 4PJIB 2GUOA 1FL5B 1PEWA 4XP9L 3CJJA 3EDKA 3VXRA 4GAGH 1A3LH 1PG7X 2IQAB 3WHE0 1NGQH 3ULUH 4GAGL 3S35X 1A3LL 1IRAY 1NGQL 2C7UA 4OF3A 3ULUL 3L5IA 3KYNB 3RBSA 2D3VA 3FJTA 2DM4A 3V5KA 4ODSH 1AP2A 4X4ZA 1QPPA 5I17A 3F5WA 4ODSL 4PTUB 4PJHA 3L5WA 2EEBA 2AVGA 4RAUA 4UUJB 4HS6A 4ODXB 4NSKB 2CK0H 3RWEB 4PJDA 2BC4A 2P5WB 2W0LA 4HPYH 2CK0L 4RCAA 3ROOB 1G7MB 5FOBB 4HPYL 5JXEA 3KPPA 2ERJC 4FQJH 4PJCE 4R9HA 4HLJA 3BKJH 4FQJL 5M94B 2D31A 5I0DA 1BFTA 3BKJL 2NCMA 2EIZA 1BZ9A 3FB5A 4JFPA 4L8BA 1C08A 1KELH 1MCEA 3P30H 3PP4H 1KELL 3P30L 4L9LA 3PP4L 1C7SA 4ELMF 4U6HB 1E4XH 2IH1B 5K9QG 1TLKA 3DX8A 2CIIB 4MA1B 1FL3B 3O3AB 1E4XL 4ZQKA 5CFHA 5DFVD 1BD2A 4GOSA 4HWNA 4MJIA 1RVFH 1H15A 5E08H 1EFXB 1LE9B 1CK0H 2JB6B 3DX7A 5FYJD 1RVFL 5E08L 1CK0L 3WL9B 5AAMA 4M7ZB 5CJ5A 3RPIA 5JPMB 5DR5H 4U3XA 3DARA 3O4OC 5DR5L 3DO3A 2ADFH 4F7CB 3D3VB 1N5AA 2GAZA 2ADFL 5E6IC 1LK3H 5C0BD 4Z7VF 3RI5K 3U7AA 2EZ0C 1LK3L 3CPLA 3Q3GB 3MRNA 4WU7B 4NCDA 1FZKA 1T2XA 2H3NA 4XCEA 1CGVA 1HHHA 1T6VN 4J3TA 3GGWA 2VLJB 2F5AL 4GXUM 3QDHA 3MRJA 3MJ9A 3QWOB 2EIBA 4IMLB 1XCQB 3MCLH 3CFKB 4JVWA 3QO1B 3MCLL 1IQDB 4JDZB 3UO1L 4ZUUA 4NZRH 4X7EC 4GBXD 1X5GA 5EG6C 3HRZB 4W4OA 3V7AE 4NZRL 1BM3H 1U93A 4Y19E 1BM3L 4LF3A 2AV1B 5FB8B 5B3JF 2NY6D 2IH3B 3E3QE 2NW2B 4C54A 4Y16A 4GBXC 1CG9B 5CBEB 2BOCB 2D03H 4QKXB 3OAYK 1LNUB 4NO3B 2D03L 3JZ7A 3V0AC 5IR1B 5KSBE 1HSAB 3GHEH 1BQHB 2BSRA 4D9RE 3SJVB 4MAUH 2NY6C 3GHEL 3NCFB 5T1DH 5HYJB 4MAUL 4U6TA 4LQ1A 5T1DL 2DIJA 3VXMA 5EU4B 4QHLB 2W59A 5FO8B 5K33A 5B39A 2HLAB 2X4OA 4FA8A 5I75B 2X4RA 3KYMB 4H1LG 2BZDA 4XI5D 3RX7A 1KCUH 4B7IA 1KCUL 4L4VB 4X5XA 5EDXA 2YPLA 3NPZB 2XFXB 4GRMA 5ADPH 1IEAB 3RNKA 5HYSB 5ADPL 3GMOA 2I25N 1P1ZA 1YPZE 3RWFB 4XI5C 3BOVA 2DJSA 1WFOA 4M48H 1G9NC 3OKOA 1MFNA 2VL5A 4M48L 1CFBA 4ODUB 3IAQA 4RGMC 4NZDA 4Z7OE 5KANI 4BQ6A 2IEPA 1I8MB 1E27B 3HCVA 2YXFA 2FWOB 4OGXH 1FCCA 3BH8B 4MD4B 2E8YA 4OGXL 3CGTA 2P24A 4I18C 1QFHA 2KQMA 3STLB 3QDJD 8CGTA 5DJ2A 1R3JA 1E4KC 5C0DA 2X42A 1AGCA 2ICCA 4X6EA 4Y1AA 5FYKD 1FDLL 1DN2A 3PQYE 3BEWB 2R2CA 3MCG1 1ADQH 2R2BA 2RB8A 5DDHA 3SCMD 3HMXH 1ADQL 3GEWB 2EDYA 3TO4A 4Q9RH 1S5HB 1I8LA 2ZG2A 4UBDC 3PJSA 4Q9RL 1WFTA 4XWGH 4P46D 1BWWA 5D7JD 3MUJA 4XWGL 5ISZD 5SX4H 3NN8A 3SCMC 1Z0NA 3OAYH 1DBKH 4A6YH 1VERA 1WC7A 4XBGA 3RL2A 1DBKL 3IFPA 4A6YL 3MCKB 4Y5VC 4MB3A 3L3JA 4GAYB 4BH7A 1EDQA 4F7TA 1KIQB 4P46C 1B0RB 4MHHG 1J0JA 5D7JC 1MFCH 4WTWA 4AK1A 3QDMA 3W11D 3CSYB 1A64A 5DRZA 1MFCL 4KTYA 2V2TA 3DXAA 5DA4A 3C60A 3H3KA 1HOCB 2VABA 4LLMA 3PHQB 2G9HB 3G04A 4DGYH 4NT6B 3ZYZA 4JFFB 4DGYL 4PJFF 5KVDH 5GS1B 2VLRB 3HAEG 4G9DB 5KVDL 2ICWI 4PJ8B 3UXFA 5I66B 5F70A 2E7BA 4NCC2 4QGYA 4W70A 2Y5TA 5I76B 3W0WD 2ARWA 2H2SC 5DXWA 4KK5D 4H8WH 4MB4A 4H8WL 4ZFGH 5JW5B 3NVQA 4ZXBB 4ZFGL 1VGEH 3CDYA 4NKOB 3ZKND 1VGEL 4JJ5B 1N5YH 3IRZA 3RNQA 1EGJA 1FORH 1MWAL 3D39E 3VFTB 1N5YL 3OG4B 1FORL 3VXOA 1PY4A 4HIEA 1CXKA 2P45B 4PJ5D 3MNVB 1A14H 3MOAH 3Q5YA 4IIQB 1A14L 3KPMB 1S7UA 3MOAL 5IVXE 5A1AA 4X7SH 3BT2H 4X7SL 1HH6B 1J88A 1I8IA 5HYFA 2E6PA 4JFEE 3MRRB 3NCYP 4LLYB 2GI7A 3BT2L 1A7PH 2VDRH 5DD6B 4BZ2H 5ANMB 4NC2B 1A7PL 2VDRL 1H3VA 3FQWB 4OLYH 5JO5B 4BZ2L 5DVOA 1DQJA 4OLYL 1YEJH 3GSNH 3LQAH 5DUBA 3ZKSD 1YEJL 3B9VA 3GSNL 3LQAL 1G7QB 2Q7YA 2HT4C 4RGND 4G8EA 2OTPA 3JV6B 3NIDE 5FEBA 4M8VA 4M4RA 3ESVF 3MJ8A 1AR1C 2VSDA 4M62H 3B8YA 2AK4A 3NFPB 4M62L 1Q8MA 2OL3A 3AC0A 3MREA 5FHBH 3VE0B 3S9DB 3B83A 5F9WC 5FHBL 1WCQA 1A6AB 4HMDA 3K2MC 4HCRA 3TT1H 3V5DB 4WDIA 4F8TA 3S3JA 1OSZA 1U0QA 3DURB 4K71C 3N9GH 2VN4A 4BELD 4C56A 3MZTA 1YEDA 2H2PC 3N9GL 2WWKO 3FB6B 5HHXH 3Q5OA 3UPRB 1NPUA 1J1OH 4GRLD 4OZGA 1T1XB 5HHXL 4H0IA 3QIUB 1FFPB 1J1OL 1MY7A 3MGOA 1IGYB 1EEYB 3KXFD 2A6JB 2OTWA 3HC3H 5FGCB 5F7EH 4F37K 3TZVD 3HC3L 2QV2A 3G5ZA 5F7EL 1NMBH 1ZHBB 1NMBL 5IBLC 5C09B 4X6FB 1A6TB 4KK9D 1QRNB 3VD3A 4PJEB 2QEJA 4CMMB 4L4TA 1FE8L 4L3ED 5EH1A 5FYJE 3TZVC 3MUHL 1JGDA 1PQZA 2WWKT 2PYED 5JORA 4N8VB 2VOTA 5A40E 1REIA 1XIWD 2K1MA 4H1LA 2DKSA 4KKCC 1TCRA 3FT2A 1P4LB 5C0BE 3TNNA 3BAEH 4UNUA 4EDXB 1UQSA 1ND0A 3BAEL 2GY7B 5D5MA 1P7KA 4X7FC 1XIWC 3QQ3B 3ZKQD 1W0VA 3UX9B 5H8DA 4K7PX 3DV4A 1YY8A 3I85A 3LEVH 3LEVL 1BQSA 4OZHE 5J13B 4AG4H 3DGGB 4Q9QH 4HUKB 1S9WB 2E7LC 4AG4L 3NZ8A 4Q9QL 1C1EH 5JTWA 1Z9OA 2GEEA 5BCAA 3H9HA 1DDHB 1C1EL 4HDIA 1MCNA 4OV6F 3FN3A 3I75B 3P0GB 1F13A 4U6YB 3OKKA 2I9TB 1GZQB 1X9QA 3REWA 4PRPA 4MMZC 2V2XA 3PWJA 4UNTA 4J3XA 3MJGX 1HKFA 3QEHB 4LCWD 5I18L 1WIOA 4MMXC 2G5BB 1GRWA 5JDSA 4AIZA 1U8IB 1QP1A 3MO1A 4P4KC 1FNEB 4LCIH 1KN4H 5LAXA 1AQDB 2H32B 1B6UA 4LCIL 1NEZG 1KN4L 3O4LA 4M1DH 4MAYD 3DHMA 2GT9A 3I3DA 1YA5A 4M1DL 3CFJA 4N0CC 3UTPD 4PJXA 1I4FB 1A6ZA 3MGTA 1IBGH 1JE6A 1I1RA 1IBGL 1XGQA 1FH5H 4MAYC 1LP9A 5IQ9A 2BCKB 3BWAB 1FH5L 1I1AA 1QOKA 3L6FB 2AXHA 3STZA 5C0JA 1R24B 4IHOB 5DTFB 4OD2A 4I0PA 4JM2D 4U1GC 3ULVH 3IXAA 1JWSB 1VADA 2ZSVA 3ULVL 3BX7C 3FZUC 3WDJA 3LN4B 2NXYD 3HAEA 2EKSB 2B39A 2GSGA 5D2LE 1D5MB 3BD4A 1KB5H 1CZ8L 1W2KT 4PRHA 1KB5L 4U1JA 4MS8D 5C08E 3T4YB 3KPRD 3GUTB 4QRRA 5K93A 3CC5B 5KVMC 2NXYC 2WWMD 3NIGE 3B8SA 15C8H 2EE6A 2Q6WB 2Y07H 4P23B 2YXMA 3QDJE 5JW4R 3WV0A 15C8L 2Y07L 3BESR 1T04B 1OPGH 2X2YA 5FYKE 4MS8C 1FNGA 4S0SD 1OPGL 1X5AA 3ISWA 4RMVA 3S4SB 4PJEF 4JZJC 2BRRH 4HUWB 2BRRL 1AFVH 2B8OT 3HZMB 4YFLI 1QNZH 2VZTA 5KSAD 1W0WA 3FOMB 3IJYB 1AFVL 3DBXA 1NUGA 1QNZL 3EW3B 1GZPA 1IM3B 1KUMA 4D0CA 4DZ8A 3WXWH 5ISZE 4JFDB 3WXWL 3QJHB 3VFNA 4HIIA 3NCEB 3MQIA 3V7AG 2NYYD 4YGVB 4GKZB 1X5JA 1EBPA 4CADB 1QFWI 2QQKH 3OXRB 5FM5M 1MCIA 4G8GA 2QQKL 4GJTB 1AR2A 2BVPB 5IMOB 4G80B 5IMLA 2CIKA 4Y4HB 4XBPB 2NYYC 1AGBA 1HKLH 4HUNB 4CVZB 4QF1A 1CDHA 1HKLL 4UDTB 5E6YA 1FYHB 2MSPA 3VFVB 1ZOXA 3B9KB 1CGXA 3GB7B 5D72H 3W0WE 4K7FB 4PR5A 5T1LD 4YH6A 3DROA 5EO9B 3RVTC 2Q8AH 5D72L 8FABA 1F90H 3QPQD 2Q8AL 1F90L 3P4NB 4WUUA 1MCRA 1MLBB 1ITCA 1VACA 4H26A 3C09B 4XP6H 5K9QI 3IJSB 4XP6L 2XV6B 4X4XA 3ARBD 1NFIA 1OW0C 3IDIB 4Y5YA 3QQ4B 3JWOH 4XGZB 4X8XA 3QEQA 3K8LA 4PJ5E 3JWOL 5F9OH 5C0IB 5DC4B 2XI9A 4HEME 3V0VA 4JVUA 1CI5A 5F9OL 2CUIA 4QRTA 1X3DA 1ES0B 3OKEA 4XNUH 4F3FB 4YDVA 1F00I 4XNUL 2WUBH 1FBIH 4FFZH 1J10A 2WUBL 2JKXA 1TNNA 4N90D 2AXFB 4FFZL 1H8NA 5MEOA 3FONA 1KJVB 4GMTH 2HLFD 3QDGA 4GMTL 1A7RH 3ZDZF 1ZWIB 2IBBA 3GSUA 1JZ7A 1A7RL 2FNBA 4LCUA 3E1F1 2J7LA 2I9LA 1NGXB 2NX5D 2ZOKB 5KN5B 4F7MA 1NUNB 4LIQH 5JMOC 2HLFC 4RGNE 3SN6N 1U91A 2Q3AA 3BEVB 5J3HD 1MH5B 4LIQL 2FIKB 5D9SA 1S7VA 4UAOB 2P4AB 4L4JA 4XZUB 4BQ8A 3MBED 1CE6B 1N0XH 4NRXB 4YDLB 5JW4N 4HUVB 3TYFB 1N0XL 4GS7C 1YN6B 1FHGA 5J3HC 1EEQA 1BWMA 4IRSB 4MXVE 3U4BH 2Q86A 3U4EA 2GJ6B 2H26B 5EC2B 1RJZA 4HG4K 3MBEC 3U4BL 1HQ4A 3MRLB 1M7DA 3QIWC 3LKNB 5ALBH 5IEHB 3OKNB 4P2QB 4XPTH 5ALBL 1ZT7B 4M93C 5DJDA 3ILPB 1S9KC 3QI9B 1C5BH 1XFPA 2VDLH 4S1SH 4XPTL 2BSED 4ESKA 4QT5A 1JMXA 4LPUA 1U8MA 4S1SL 1Q1JL 2YBRA 3O3EA 5C0GA 5JLZB 3KWWA 3CZFA 1AIFB 4YX2H 3S5LG 4YX2L 5FCUH 1NJ9B 3KXFE 2PO6B 2YHGA 2YD2A 5FCUL 5EIQA 2FHFA 1LO0H 4ZOEA 4FRWA 1LO0L 4X6CE 1NEZA 4HKJB 4NO5B 1U92A 2FSEB 5EU3A 2GHWB 2YPVH 4OZFG 4NN5C 1IKFH 2YPVL 5LVEA 1IKFL 5EFIB 5HDOA 1YMMD 3ME0A 4L3EE 2OMNA 4ZAKA 5C0FB 3I9GH 1XH3B 3SDAC 2PYEE 3I9GL 5H94B 3VCLB 3WLBB 4H8WC 4MWFA 4YHYC 4PJCA 3AVEA 2FO4A 4QOKD 4HW6A 4WI4A 5EORH 2BFVH 2ZUSA 3KYAA 3IDMB 5GSRB 1E4XI 5EORL 2WSKA 2BFVL 1WUNT 3X11B 3BQUD 2FH6A 5DI8B 4LKXB 1O0VA 3T65A 2Z8VC 3QXTA 5IROA 4FFVD 2Z92A 4WHTB 4L8DA 5JHDA 1ZAGA 3BQUC 3NCYS 1HXYB 2R69H 2R4SH 1CIUA 1LEIA 4Z0XA 4PJHF 2R69L 2R4SL 3WJJA 1WISA 2E9BA 1ZEAH 3IU4H 4MLSA 2AJXH 1ZEAL 3QFJD 3IU4L 4M02A 4YAQB 1RJYA 3BO8B 2AJXL 5GGVH 1HE7A 4LCWE 1OWRM 4F33B 5GGVL 1LD9A 1OF2A 3LQAC 2GCYA 1EEUA 4MHHI 4GG6B 4Y4FB 5HYQB 2JJTA 5D7IB 4V1DD 5GRYA 5FIEA 4NQEB 5L8LB 1ROWA 3RGVD 1BFOB 3OV6A 3UTPE 3OL2A 4K3EH 4D0DA 4U1HB 1WJ3A 4K3EL 5HJ3A 1KPRA 5E8EA 4MJ4A 4LHUB 1CU4H 3FO0H 1BFSA 1OTSC 2RQ8A 5IJVB 3HNSH 1CU4L 3FO0L 1UXSB 3RGVC 3HNSL 1FLTX 2A1WH 5EU5A 1PFCA 3O3BB 2A1WL 2XWTB 1AO7D 2ESVD 5MHSD 3OKLA 3RWIB 4ERSH 1S7WA 4ERSL 2A0LD 1C5DA 1E4WH 3W9EB 5CSZA 4YHNB 3F12B 5KSBA 3PP3K 1XF4B 2IPUK 1J7VR 3CCHA 1E4WL 1U8PA 1V05A 4R6UA 1ZHKA 2UUDK 2FHBA 2WNGA 2FL5A 2HG5A 5A3IC 3F6IA 1EEZB 2F15A 4BM7A 4Q58C 3ELAT 3KPRE 3LKOB 3SO3B 2H9GA 4ZG1A 2F9BT 9CGTA 1HHKA 5C0EA 3ECBA 2V7NA 2GK0A 2G75B 1G7HA 4PYHA 4B7LA 2PKDA 4IEFB 3OXSA 3RVWD 5DQ9A 4DZBB 3VRJB 1V3JA 3L3OA 5ESAA 4ZFOA 5GGTA 1RZKC 3A0OA 5JDJA 5DEZA 1J0ZA 3HS0B 3RVWC 1YPZA 3MLSH 4YHOH 4HAFA 4TNVK 3MLSL 1YJDC 3D2UA 4YHOL 2VYRE 5IM7B 1U6AH 5IMKB 1HNFA 3G6JB 5KSVB 5F21B 1U6AL 2VUOA 1GPOH 4KRMB 3W5NA 4JY4B 4BK5A 1JV5B 1GPOL 2GQHA 4PJ7B 3RVXD 5C07D 4FQHB 1O7SA 1OAKH 1GGBH 5C6PB 2VRAA 4KHXH 1B9ZA 3B2VH 1OAKL 1E4JA 1GGBL 5ID0B 1UJ3A 3QUXC 3B2VL 5C3LD 3PQYA 3C5SA 4NKDA 1DQMH 1LMKA 3K4AA 1MHHA 4K55A 1DQML 5FA3A 2C4FT 4YBHA 2IAND 1MI5B 2PXYD 2FEEI 3MR9A 5DRXA 4WO4A 1TZIA 2YK1H 5ERWB 2YK1L 4XNYH 2V2WB 3PP3H 4XNYL 4LPYA 3E2HB 5T3XH 2UUDH 3ALXA 4ODVH 1TVBA 3BGMB 3PDGA 5T3XL 5LWYH 4ODVL 5LWYL 1WBYB 3BMWA 4UQ2A 4NQXA 5BZDB 1IEBB 3AROA 3S5LA 2MQ0A 3QRFM 1YYMH 4DWHA 1YYML 1INEH 4N90E 4LSVH 2P43B 3QUKA 1INEL 4LSVL 4HZLA 2YEZB 2IC2A 2B5IB 3ULVC 4OZFA 1G6RA 1A1NA 1CWVA 1ETZB 4PTTA 5D1ZB 5B38B 1RZJH 4IOFC 3JTTB 2NX5E 4PG2C 1RZJL 2P8LB 3VGGA 3D39A 3BZEB 5HSFA 4RWHA 2BY1A 2EEAA 1AGFB 1KLUA 1MCHA 3MRGB 4YIQA 3KPOA 4LVHC 1BQUA 5TDOA 1T7ZA 3GJFB 4JDVA 1Q0XH 4TUOB 4NO0A 4KXZH 2GY5A 1Q0XL 2YA0A 3HZKA 4FQXD 5IVXA 5LQBH 3U2SB 4HWUA 5LQBL 4JLRA 1PJ9A 2JIXB 1BJ8A 3RDTC 1BOYA 4JFEA 3OX8B 4J3SA 4XNQB 43C9A 2WIIA 2HN7A 4QNPE 5I6XB 2ZP0T 3RX8A 3S34H 4HWZA 1ACZA 4BYHA 3LN9A 3T1FA 3X14B 5EN2B 3S34L 5IB4B 1HYSC 2BVTA 4TSAH 1M7IA 4HKZA 4Q9CA 3IDYC 4TSAL 5D93B 5DHVB 3FOLB 3G6JF 1IGTB 1JYVA 2A6IB 1F2XK 4ZSOB 3FN0H 3MA7B 1ZXQA 2UVFA 3FN0L 4NNXA 3AB0B 5EB9A 3NZHH 4NN6B 3RUGA 3NZHL 1UKTA 4CUCA 1J05A 5SWZB 1YMME 2Y23A 2BOBA 4CMHB 3TYGH 1QO3B 1R3LB 5EBWA 3L3HA 3TYGL 3ZT5A 1ZGLB 2YUXA 2ED8A 2XIDA 3BW9A 1F4AA 4UILH 2IAMD 1R3HB 2K9UA 4QOKE 3QFDB 2FRGP 4UILL 4EIZC 1KLGB 3FO2A 1TPXC 2BHUA 3X12A 3GDBA 2IAMC 5GZND 5KG9A 1FO0A 2F74B 3HUJB 1KXVC 4TSCH 4UB0H 4TSCL 4UB0L 2V7HB 3LRSA 4Z77B 1RZ7H 4XCYA 2VJXA 4LSSH 3W39B 1RZ7L 4P2YA 3VGFA 3ZDXF 3LOWA 3K46A 3GIVA 4LSSL 4F8QA 5GZNC 1B0WA 3X13B 4LLWB 3V4VH 4NHUA 5C9JB 4FXGB 5D96C 3FQUB 3QFJE 3GBMH 4NUGH 3GBML 5H35B 4LQFH 4X8JB 4NUGL 5SX5K 5F3BB 4LQFL 4YUEH 5IBUG 5C0BA 2X89A 1FNSH 4YUEL 1JN6A 4J1UA 1FNSL 1FCGA 5E0QA 5FYLD 1IZKA 4V1DE 2PW1B 4PRIB 3S36H 3EYOB 4PGBB 1W72H 3S36L 4O00A 1W72L 5F6HJ 4OZHA 4DCQA 5I8EB 4NNYB 5F89B 3KLAA 5EOTB 4KRLB 4KDTC 2V9TA 5DEGA 3WUWB 4XT1C 3LHPH 2E9IA 2R2EB 4GBXA 1P69B 1OAXH 3LHPL 5DRWB 3X3FH 1OAXL 3AU1B 1NCNA 2A83A 5IB5A 3X3FL 3KPNB 1DUZB 4WFFD 2XXCB 1Q38A 5T5NF 2FZ3B 1AO7E 1JVKA 2MQCA 4OF8A 4I77H 5D1QB 1KJ3H 2ESVE 1YEHL 5MHSE 2APVA 3UTTB 4Q6IC 4ZNEA 4I77L 1KJ3L 3ESUF 3SKJL 4MZ3A 3RWHA 4QTHB 4UQ3A 1XCTA 1I3RA 3GMMA 5IEKB 1FAKT 5D5MF 5IVNA 5TGBA 2P5WD 2NPLX 4RWYL 3BHBB 3TFKD 1L0XA 5IF0A 4PV8B 3QH3B 4CBPA 1FSKB 1PZUB 1XGTB 2X10A 3DIFA 1MNUH 1JPFA 2YWYA 3H7LA 4WI6A 5JOFB 3SE4A 5HTSA 1MNUL 1N8ZB 3GMLA 4RMSA 5CJXC 3Q6GL 2EYSB 3KPLB 5L2JB 3RWDB 3I6LD 4KAQH 1FRGH 1AC0A 1OT2A 4LAJH 4KC3B 4KAQL 4BKLB 1FRGL 1OP9A 1AC6A 1IGJA 1L0YA 2J3SA 2WW8A 1T21A 4KTDH 2YC1B 5D2LA 4I18A 1EFXD 1K5NB 5CP7A 3FHAA 4KTDL 5SX5H 4L3CB 3ARZA 2A73B 1E4KA 2H6PB 4Z78A 2AJ3A 1KTDA 1OQXA 4NKMB 4GAFB 4R7DA 5LGJA 5IHLB 2E27H 3G5VA 2XZCH 4EXPX 4OLEA 4OD1H 4KKNA 3JWDC 4PRNA 2E27L 3SDCB 2XZCL 3KS0J 2W07A 4OD1L 3D3VD 4BUHA 5C07E 3QDJA 1Q72H 1B4JH 2DI8A 3HUJF 5DQJB 1LEKB 1Q72L 1B4JL 1CTNA 4NC0B 1LP9F 3QO0A 1BF2A 2VLJD 4HIHB 3DV6B 1PYWA 3SCMA 3ZKMC 3DRQB 2BVOB 3PWLA 1YEIH 3EZ8A 1EPFA 2IANE 4XMKH 4Y5VA 2XZQH 1W8OA 1YEIL 1BJ1H 2GTZA 1U3ZA 4XMKL 2XZQL 2ZNXA 3G5XB 4P46A 5D7JA 3WS3A 5CJBA 1OOAA 3P4OB 5ISZA 2OMBA 4YFEA 4K2UH 1CDUA 1TJHL 4K2UL 3PWUB 5D7KD 2X7LA 3ARVA 1K4DB 1MCJA 4K3GA 1KPUB 3MX0A 1JI1A 1M4KA 4OFPA 4HUUB 3V8CA 5ICYB 4O58H 5J1SC 3SJVD 4JCMA 4O58L 3C6LC 3MROA 43CAB 5HYJD 4WI3A 4FHBD 3FQRB 1RURL 4WJ5B 3NGBB 4Z7QF 3HR6A 1T1YA 2NW3A 1J0IA 3W0WA 3GSXB 3AAZB 3QHTC 4ODWA 3EBAA 3S96B 3D69A 1DBBH 3EFFA 1HZHH 3KYKH 1DBBL 3N1GC 1HZHL 3KYKL 1S8DB 4TTGA 4EUPB 3RHWK 3C9NA 3VFMA 1E6JL 5BO1H 3OMZA 5BO1L 3KJ4B 4PRAB 2M26A 1GAFH 2M2DA 3WFDH 4PPTA 2CJUL 5IHZA 5IB1B 1GAFL 3WFDL 5I75C 5C71A 5I1GH 1FZOA 4PJ5A 1BEYH 1YECH 4ZOBA 5I1GL 2XQYK 4LCCA 3WKMH 1ED3A 1MFAH 1QSVA 1BEYL 1QQDA 3BFOA 1TQCB 3WKML 4CW1B 1MFAL 1FVEA 1DSFH 2EE3A 1CE1H 4HH9B 1DSFL 3WEXA 3DI2B 4H25A 1CE1L 4MLIA 4XPFH 5DEFB 1NSNH 5EZIH 4WFED 4XPFL 3L3GA 1NSNL 1OGAB 4KHTH 5EZIL 1DN0A 3TBVB 4CVUA 4KHTL 5F7MC 2OLDA 5IOPA 4WENB 4ZPTA 1KG0A 4S1RH 4Y0GA 2JK5A 4KZEH 4CDHA 1DLFH 2HA1A 4S1RL 3TJHD 4LFHD 1V7NH 4KZEL 2AQ2A 5D6CA 5HI5D 1DLFL 3NABH 1V7NL 3NABL 3T0VA 1UH3A 2ITDB 4ELKA 4KUCF 4TUJA 2ARJA 3TJHC 5HI5C 4IRZH 2DQEH 1KCVH 4IRZL 3Q1SH 3ZO0A 2DQEL 1KCVL 3C5ZB 3Q1SL 1QR4A 4KVNH 1NCCH 4ELME 3TH3T 5E4IA 1FNAA 3GNMH 4WW2F 4KVNL 1NCCL 2R1WA 3GNML 4OKDA 3S3PA 3QUZB 3B9DA 4Q74A 3L3IB 3QG6A 4DFHA 2XWBA 1VGKA 1G1YA 3M17A 3OBAA 5T3XD 4J2XA 1IAKA 4JFFD 4KV5F 3RIFF 2NLJB 5EO0A 3Q6FB 5IW1A 3WO4B 2CKBH 3KXFA 3FQTB 5I1EH 2CKBL 4R3SA 3MLUH 5GS1C 3JV4A 5I1EL 3TZVA 1QSZA 3MLUL 1UH2A 4MZ2A 4PJ8C 3VFOB 4ZXBD 4QHMA 5F88A 3MRIA 1BBJA 3MRBA 3QUYB 1OWWA 3AMLA 4P3DA 3QXWA 1NCBH 2FECL 4L3EA 2DQIH 1NCBL 1INDH 4IBLT 3PV6A 2PYEA 1SEQH 2DQIL 4P48A 4WCYH 4NQDD 3L3DA 1INDL 2EXWD 1SM3H 5FO7A 1SEQL 1XIWA 4WCYL 2I27N 2DQGH 5HHQB 3FAXA 2DQGL 2UZIH 3N1QC 1CDIA 1R5VA 2UZIL 3PWNA 5T1KB 4AH2A 1CT8A 2XTJB 3FHQA 2LTQB 1BVLB 5B3JE 3ORJA 5FYLE 1M05B 2EXWC 2E7LA 1SYSB 2NTFA 3C8HA 4MQ7A 4UOW0 4NPYB 4X4YA 3BP7B 2CXKA 2VAAB 4NQCA 1DQQB 3MRHB 4PJIE 1QPXA 4O2FA 5IW6A 1CICD 1NCTA 3HE7B 1INQA 1CL7H 4P4KA 5HDQH 4EQ2A 2Q1EA 1CL7L 3ZYOA 1D3CA 4XXDB 5HDQL 4BZYA 1LWRA 4WFFE 2OJEA 3OKDA 4LCWA 2X1PA 3CMGA 4JREB 4AENB 4HEPG 4LNRB 5E99H 4PJCF 2GYSA 4L8SA 5IUSA 5F1KC 5CD5C 1JYWA 3QISA 5CBAB 5E99L 5DA0B 5DJAA 3HNVH 3TNMA 4MAYA 1H3UA 3CFEA 2P5WE 3F65A 3HNVL 2LFGA 4LCYA 4O02H 3RIAK 1DANT 4O02L 4FXLA 4X83A 2QL1A 4RMQA 1KT2A 1CD0A 2J6EA 2XPGB 4N9GB 5I2IA 4XCNB 3SKOA 4ETQB 5IIEA 4RFOH 2GJJA 3BXNB 3QUMA 4ZS6D 4MXQD 4RFOL 5A2LH 4GG8A 4G9FB 2W92A 4G42B 2DKMA 4RSVA 2W9EH 4P2OB 5LBSL 1P4IH 3ABZA 4LU5H 5ETUA 2W9EL 3MZGB 1P4IL 4GKOA 3I6LE 4JM2A 1T22B 4LU5L 4BQ9A 3RWJB 4I3SH 1IVLA 4WU5B 4HJGB 3L95A 4I3SL 4XVUD 3QIUC 3BPNB 3R06B 1MUJA 1JWMA 3D6GA 4PRDB 5FK9A 5IK3B 5I19H 1A9EA 5C09D 1Z5LA 5I19L 1U8QA 2R2HB 1QRND 4ODBD 1WFUA 4U4BA 3EO0B 1HXMB 2HKHH 1JHLH 3RFZC 5CP3A 2KKQA 2HKHL 1JHLL 4OUOA 3WFHB 5HD8D 4XVUC 2BXYA 1IAIM 3ARDB 3KPRA 1UM5H 3D3VE 4JZJA 1C8PA 1ZLVK 1UM5L 4LEOB 4POZC 1U8LB 4HPOH 1NBZB 4HPOL 4X9HA 1RI8A 4NQVB 2DTSA 5BQ7B 3F7YB 1Z2KA 2PCPA 5HD8C 5E9DD 3ZE2F 1KYOJ 4NQTA 1UZ6F 2PNDA 2A6DB 4X9BA 2VLJE 1NMAH 4C57C 1NMAL 3DYPA 1MRCH 2EKJA 5KSAA 5BVJB 1MRCL 2FGWH 3BIKA 4PJFE 2VIRA 2FGWL 4APQB 5T5FH 1NH6A 5E1AA 5KSBF 1IM9B 3MRFA 5MEPB 1TJIH 5HHMB 1S9XB 1TJIL 1P9MC 1NDGB 1G7IB 5D7KE 1PY9A 3D0VA 3KPQA 4YR6A 2D0HA 5SWQA 4XMLH 2DQCH 3NACH 1SEBB 4RISH 4XMLL 3SDDB 3SJVE 3Q5TA 4WHCA 2DQCL 3NACL 2R1XB 3E6HA 4RISL 4N1HB 5HYJE 3UTQA 5CKAA 3DX9B 3MACH 4LEXH 2C4FU 25C8H 5DWUH 5IVZB 2VZUA 3MACL 4LEXL 5IFJA 25C8L 5DWUL 4EQ3A 5T1LA 4F7EA 2VQ1A 2NXZC 4HC1H 5DF0A 1OW0A 1YPZF 1VKXA 1ZVYA 1A9BA 4HC1L 4HWBA 4NJ9H 3EYQD 5CGYD 1MCBA 5JXAH 1X5ZA 5IVOA 3SE9H 4NJ9L 1OB1B 1U8JA 1YN7A 5JXAL 2WM0A 2EE2A 3SE9L 1F11A 1MCLA 3RVUC 4GQPH 3ARBA 2HVJB 3ROLB 4D8PB 3V6ZA 4WI7A 5C9KA 3EYQC 4JFYB 2VB5A 5I1AA 1NAMB 3P73A 2HJFB 2XKNA 1H8SA 5HY9A 1ZLVH 2VE6A 4PGCA 2ICWB 4BZ1H 5ELIA 3VJ6B 2CLVA 3S88H 3KGRA 4BZ1L 2AABL 2BX5A 4WFEE 2QTEA 5J06A 3S88L 3UBXG 3PF2A 2ZG3A 3CSBA 4Z76B 3WIFA 2CO7B 4P23D 5I1KH 3T2QA 5I1KL 4C83B 1WF5A 3KPSB 1CFQA 1N2RA 4WW1B 4NOFA 1BIIB 3IFLH 4BSWA 4KXZI 3CDFA 1LQSR 3CVHA 3IFLL 4P23C 3G08A 4AJ0A 4ZUVA 3MBEA 1KCLA 3HMXA 3QIWA 2I24N 5CSBA 1JNJA 4JZNB 1KPVB 2ATKB 3O4OB 4JFDD 3ZE0F 3E8UH 4ZOCA 2GJZA 3U46A 4U6XA 5E6IB 3E8UL 4F15B 2ADJB 1LEGA 1FC2D 3V52H 4Y2DD 4A6YA 3V52L 5C0CB 5BW7C 4K3HA 5E8OA 1MQKH 2WINA 4GSDH 1MQKL 4Y4HD 4JFFE 3NCJH 4M8QB 1CGUA 4GSDL 5E8NA 3NCJL 4HFWB 4U1MB 4JFZH 2BC4B 3B9KD 4JFZL 4G6AD 1GSMA 1SY6A 2DQJH 2IGFH 5GSVB 4Y4HC 3VXTA 2DQJL 2IGFL 4JRYB 3GMPA 4V2CB 2HTKC 4NFCA 3HE6C 1L7IH 3FQNB 3B9KC 1L7IL 1X5HA 1J0YA 1QVOB 3HZYB 5FO9A 1YMMA 1CQYA 2CKNA 3F62A 4ETYA 4PY8I 2VN7A 1I7TB 1G9MH 4MNGB 3C09C 1NGPH 1G9ML 5FM5O 1NGPL 2P7TA 2X4TB 4QOKA 4TQEH 2C4XA 4HS3B 1XF3A 4P9HH 4TQEL 4P9HL 2BSTA 3BQUA 4PB0H 1NBQA 1K8IA 5ANME 3V0WH 3TCLA 3FB8B 3V0WL 3FFDA 2ZNWA 4B53A 2LABA 3GKWH 1A2YA 3Q48A 3GKWL 4FG6D 1QUNA 3GSRA 3RUGF 5EOCH 4KQ3H 1TZHA 2HFFA 3VFRB 1KEMH 1CGSL 2GW5A 1EV2E 4KQ3L 1YMHA 5DC9B 5EOCL 3REVA 5KSUB 1DEDA 1TJGH 1F4YH 1KEML 1BBDH 4TUKH 3QFJA 1TJGL 1S7QB 4MD0A 2O61B 1F4YL 3P77A 1BBDL 5E7BA 4JQXA 1TIUA 5CWSB 4HV8A 4IRSD 3KVQA 4L8CB 4UAOC 1PG7W 2BSSB 3BP5A 1Z6JT 4N0RA 2Y72A 4MJ6B 5E2VH 1OD7A 4YDLC 3BZFA 4V1DA 3H7BA 5E2VL 5DZOA 3LKRA 4P2QD 1WEJH 1ZLUK 3RGVA 1WEJL 4M6AA 1JHTB 1UB6A 2ORBH 1XGRA 2E7HA 2ORBL 1JFQH 4DGVH 3I6KB 4JQVC 4NQDE 1JFQL 4F80A 4DGVL 1KV3A 4EI6B 3EYSH 4P9MH 1KB9K 3QI9C 2WLYA 1T0NB 3EYSL 5FHAH 2PO6D 4P9ML 1JPSH 5FHAL 5HHNA 5FGCE 4N1EA 5FYJU 1AO7A 1JPSL 1PD6A 2FJGA 3HI1A 1JWUB 3LV3B 2ESVA 5I1IH 4P5KA 3QCVL 5I1IL 2ZSWA 4BSJA 2GSIB 1QRNE 1U3HC 2PO6C 4PJEE 4YNYB 4UDUA 3BRDA 1VEOA 4GRMB 1I7UB 5H2BB 4NUJA 2OXHA 3LS5H 4N0FB 1FJ1B 3SY0B 4EI5C 5DMJB 3LS5L 4Y16D 3GRWA 1D5BA 4K07A 3QWRD 5C3TA 3WFZA 5DD0H 2EH8H 2IMMA 5DD0L 2EH8L 2R0ZH 1U8HA 1RHFA 4KI5C 2R0ZL 2X4NA 5F1IA 2HJKA 5E9DE 3B3IA 3LPWA 3N0PB 4JFOA 3EOTH 4KK6D 3W5MA 1T5WB 3EOTL 4EVNB 1I9JH 2DN7A 4QRQA 1RUKH 1Q9KA 2CRIA 2N7BA 5E2TH 1I9JL 2VZOA 1RUKL 5E2TL 2W60A 3IDNA 3VXUB 1NGYA 5HGHB 4RQQA 2NY3C 2LQRA 3UBXA 4R7NA 2CDFB 5J1AB 1CDBA 1A4JB 4M9OA 4GW1B 5C07A 1RU9H 4RMTA 3S98A 1ZLUH 5DK0B 5F8RC 3B2UC 2A2QT 1RU9L 4Y4FD 1HINH 2WBJB 2FBJH 1UXWB 4JO3H 1HINL 5DHYA 2FBJL 1QKZH 4JO3L 3O11A 4OLUH 5F93C 5CIPB 5I1HH 4B0MM 1UWGH 4P99A 2X4QB 4NQED 1QKZL 4OLUL 3QIBB 5I1HL 1UWGL 4BUGA 2IANA 2PXYA 4U49A 1X7QA 1XR9B 4PS4H 4I1NB 4PS4L 5DUMH 2XTLA 4BH8B 1IZJA 5DUML 5FM8A 1G7JA 2XNAA 4B50A 3U0PB 5M7QA 4OFDA 5B8CB 3ZDZE 5F9WB 5IB3A 1H3TA 4R4BA 3DYOA 3NIGF 1OLZA 2P5ED 3IFOA 4ZDHA 1RJLA 3LQZB 2EYTA 1JNHB 5DJ8A 1DLHA 3B9AA 5GISH 3H9SD 4K71B 2X1XR 3ES6B 2BNUB 4L29A 5GISL 3WSQH 5EU6B 1MIMH 4WI5A 1G6VK 1I85C 2DM7A 3WSQL 4XH2B 1MIML 4U1KA 1U3JA 3QA3B 3H0TA 2FJFB 3TH4T 4PG2A 4C59B 2DQHH 2GITA 2X4UB 3LQMA 2DQHL 1FVCA 3HG1A 3I50H 4NQSB 1UKQA 3I50L 2VITB 5ESVB 4AMKH 2HVKA 1S7SB 2BNQB 2C1PB 4AMKL 2X9WA 1A1OA 5JOPD 1T1WB 4MDIB 1I9EA 5A43C 1EZVX 3QNYB 3C8KA 5EWIH 1QLRA 3T0BA 4JFDE 5EWIL 4FQXA 5EZOH 4NDMA 5J89A 4JRXE 5EZOL 1YY9D 4HX1A 3IYLW 1ZHLB 2PYFB 4LASH 3RY4A 2E8ZA 3IF1B 3VWJB 4LASL 4X98B 3KLDA 5FGSA 2GTWA 2AEWA 1K4CB 1MJJA 2NY0B 1YY9C 4MX7B 1RIUH 3ZYIA 1BFVH 4DN4H 2ADIB 3TBYB 2FR4B 4FMKA 1RIUL 1BFVL 4DN4L 1BQHG 4GRWB 2HJLA 1ZGLM 4ZPVA 4IMKA 4R2GC 1MI5D 3SPVA 3MC0A 2I07B 2AV7B 4ZUSA 1FV1B 4C56B 2QSVA 5K9OB 4PLKD 3V95A 2DB8A 5DMKA 4X9GA 5CEXA 5J6HB 3IDGB 2B2XH 3NH7H 4JFQA 3LN5B 2B2XL 3NH7L 4LVNB 3MRKB 5KAQF 5I1JH 4PLNC 4PLKC 1CCZA 5I1JL 3UJTH 1HHJA 3K8KA 3UJTL 4J8RA 3VA2C 4CU6A 1MHEB 2YD5A 2NZ9D 5HYSG 4Q2ZA 5F9JA 4PJHE 3NFNB 1KGCD 2IAMA 1S78D 1AGEA 3E2HC 3OHXA 1BP3B 3VGBA 1WWBX 2OK0H 1TTFA 3CX2A 4GW5B 2OK0L 5B21A 2VDOH 2VDOL 5EPMA 3FRPG 4WUKH 4OIAA 1Q0YH 1YYLH 4FNLH 5D1ZD 3BP4A 4WUKL 4BSVA 1Y6KR 3B5GA 1Q0YL 1YYLL 4FNLL 4AM0A 2OR9L 1MCOH 2XZAH 2B5IC 4HKBA 1UB5A 4LFHG 1MCOL 1MHCB 2XZAL 4QYOA 2E9WA 4QHNA 4F7PB 2Z93B 2Z35B 5D1ZC 3Q2CA 5FA4B 1AGDB 5C86A 3IJHB 2CLZA 2F5BH 2CDEA 2IADA 2YUWA 1J5OH 3ARGB 3O45A 4MJIE 2F5BL 1Q9LB 2JIXD 2DL2A 4PBVC 4XPHH 1J5OL 3QCTH 2CSPA 4XPHL 4PGEB 3MOBH 3FTGA 3QCTL 4KDTA 2C3VB 3MOBL 4QHUB 4DOHB 4E41B 4P2QE 4I0CC 1KEGH 3HPLB 1CL7I 5HGAA 1KEGL 3SGJC 4KTEH 3B4NA 5LAXB 1BZQK 3V79C 1N59A 3ZSTA 4PJIA 1FL5A 3S36X 4KTEL 3K1KC 4Y4KB 3VG9B 2YRPA 1ONQB 1ZT1A 2IQAA 1ORQB 5I6XC 3TV3H 2ZKHH 2XZZA 3QHFH 4OKVB 3TV3L 5I8OH 2ZKHL 3KYNA 3ARPA 4ORZC 3BMVA 3QHFL 1A6ZB 2QJDA 4G43B 5I8OL 2YD4A 1YNLH 1BREA 3GSOB 1B0GB 1F3JB 1YNLL 4PTUA 1F4HA 3L7EB 3MLRH 1XGPB 2AI0H 5GS2H 3MLRL 4UUJA 5SWZD 3T4AB 4NO2B 2AI0L 4ODXA 3T77B 2CRMA 2R0WH 4NSKA 3IXAB 3RWEA 1F2QA 2P5WA 2R0WL 3AB0C 1DANU 4NN6C 5FOBA 1G7MA 3ROOA 5CJXA 2WQ8A 2EXYD 2GSGB 2UZXB 1MQ8A 1S7RB 3FB7B 2DJUA 4EDWH 4EDWL 3UBXI 3PE9A 4LSUH 5I73C 2P8PB 4LSUL 3MNZB 1HQRB 2EXYC 1UJTA 3HFMH 4U6HA 5CJQH 2IH1A 3ZMRA 2CIIA 1FL3A 3HFML 3O3AA 5CJQL 5TE7H 3CU7A 3ULUF 5TE7L 2BERA 1P53A 3BUYB 4I4WB 5F1NB 4P9HC 1EFXA 1LE9A 1MCCA 2JB6A 3GZKA 1PDKA 4Z95H 3WL9A 1AD9B 4Z95L 5JPMA 5FF6B 1CDGA 3O0RH 3VGHA 4NGHH 1EH9A 4F7CA 3D3VA 4HBCH 4NGHL 3GM8A 4HBCL 3OF6A 4HLZG 3VFNB 3IAPA 3CU1A 4GG6E 3Q3GA 4WU7A 3TVMB 3MLXH 4F9LC 5MENB 4DKEH 2J12B 4PRID 3MLXL 4DKEL 3RY5A 2VLJA 4OT1H 4NQEE 1RAMA 5DS8B 3QWOA 4IMLA 4OT1L 1XCQA 4U0QB 3CFKA 3AS1A 1QR1B 3QO1A 4QLRA 4TULH 1UACH 4JDZA 2FLRT 4TULL 3ILQC 1UACL 3HRZA 2ZUXA 5D2NE 3PGCB 3DX6B 2F8OA 4GMSH 4OIBA 2AV1A 5FB8A 5IV2A 4GMSL 1JPST 3K80A 2OI9B 2IH3A 3OJ2C 2NW2A 5E24E 2R0LH 5D1QD 2LVEA 2AJVH 4XHQA 1CG9A 3UTTD 5CBEA 2VXUH 2BOCA 2R0LL 3PNWB 2AJVL 4NO3A 2VXUL 2P5EE 3PHSA 1KCSH 5IR1A 3EFDH 3IVKA 1KJ2H 1HSAA 1KTLB 1KCSL 4M93B 1BQHA 3KYOB 3EFDL 1NDMB 1KJ2L 3H9SE 3SJVA 4X4XB 3BN9C 3F7VB 5D8JH 1OY3B 1VHPA 5HYJA 3RRQA 3C6SB 5D1QC 5D8JL 4UTBH 3V6OC 5T1MB 4UTBL 3ZSSA 5EU4A 4QHLA 1T0PB 5FO8A 4XB8A 4N8VG 1RZGB 1GHFH 2HLAA 4YDVB 4WHDA 2W0FB 4QEGA 4X0KB 3LKSB 1GHFL 3L3KB 3KYMA 2ICES 2Z31B 4L4VA 3VRIB 5JHLH 2XFXA 4PGDB 3MBXH 1A6PA 1IEAA 3AXLB 3HZVB 5JHLL 5JOPE 1DE4B 5HYSA 3MBXL 4X7TB 4YBQD 4HKXA 3RWFA 3TGXA 4CDGC 4HUXB 4WTXA 3VW3H 3T3PF 5J12B 4RIRB 3VW3L 4ODUA 3ARFB 4Z6AT 2YD9A 3G6JE 3VD9A 4KUCD 2EDQA 1WICA 4WFHD 3WIHH 1I8MA 1E27A 1X6LA 2FWOA 3WIHL 3SDCD 4QY8A 1Y6MR 3FRPA 1CFSB 1A6VH 3WN5B 3BH8A 4MD4A 1MWAB 1A6VL 2EDBA 3DTXB 3KG5A 3STLA 1U41A 3ZDYF 1VB9A 3SKMB 2NZIA 3EKCA 1DQTA 1P6AB 3BEWA 4PD4J 3SDCC 4LRIC 1HQ4B 4K7PY 1J87A 5FUCC 4JJHA 3OR7B 3DVFA 2PR4H 1S5HA 3A6OA 4IOIB 3QXUA 3WHE1 1MI5E 2PR4L 1L9NA 1Z9MA 1OM3H 2NR6D 5AG9A 1OM3L 1MCWW 4K3DH 4JHWH 3D0LA 1R3KB 4K3DL 4JHWL 3SDYH 2E6QA 4ZD3H 3V6BR 4ZD3L 3SDYL 4Z5RB 3MCKA 3GSNB 4GAYA 2IALB 2NR6C 3LRHA 1KIQA 4HIJB 1B0RA 5AZ2H 4TOYH 1AXTH 5AZ2L 5BZWB 4OI8A 4TOYL 1U8KB 1AXTL 1PGRB 1A7QH 4H20H 1IAOB 1CTOA 3PHQA 3RI5F 2G9HA 1K3ZA 2OS7A 4NT6A 1A7QL 4H20L 2Q8BH 3UZVB 4JFFA 3D85B 1KGCE 4LARH 5E5UB 2Q8BL 2VLRA 2H41A 2C3WA 4G9DA 4MJ2A 4LARL 4PJ8A 5GRWA 3IRPX 5I66A 5DGQA 1T3FB 5I76A 4U1SB 1JTTA 4KDWA 1IC1A 3GSQB 2X9XA 2R15A 5JW5A 1AD0B 3V5HB 1EVTC 4ZXBA 4ZUTB 1HK6A 3NGBC 3RWGB 4RRPG 1CVSC 3HRPA 1MHPH 4NKOA 4X6BA 4OSUH 4JJ5A 4ENEC 1MHPL 4OSUL 3VFTA 1NBYB 4Z7WB 3HI6H 3S4SG 1FZJB 4FQPA 4P5MA 3HI6L 1QA9B 1MJ8H 5GZOD 1MJ8L 3KJ4C 4IIQA 1WSST 3KPMA 1M71B 2X40A 2D7PA 3IDJB 1MCPH 2RR3A 2BVEA 3ZT6A 3CDGB 1MCPL 4NN7B 1HH6A 1PZ5B 5F7DB 1N64H 3MRRA 4LLYA 4ZUWB 5DD6A 5GZOC 1N64L 5ANMA 1TQCC 3MV9B 1JGEB 3FQWA 5JO5A 3GO1H 1BVZA 2HYMA 3GO1L 3RKPA 4S0TD 4I13B 5HHPB 5D6DC 3MJ9H 2X4SB 3X3GH 1G7QA 1O7VA 4MA3B 1CICA 3MJ9L 2OSLB 3NAAH 5D5ME 3EDJA 2WIMA 3NAAL 5HVGB 3FT4B 1KNOA 1U42A 1WV7T 3JV6A 1T2JA 1NAKH 4YDIH 5CLTA 5JHDD 3JWNC 1NAKL 4YDIL 1VFAA 2HRPH 3NFPA 5AAWA 1UVQB 5DJ0A 3DJ9A 4Y19B 4N5UA 2HRPL 3JBG7 3VE0A 3AY4C 5HHVH 2D7OA 1A6AA 5SWZE 3QUXB 5HHVL 4OAWB 3V5DA 4Q9BA 1U2CA 5DMIH 1EJOH 3K0WA 4QRPB 4V2BA 3MRDB 3DURA 5DMIL 1EJOL 1NCWH 1B90A 3C5ZC 3ZT7A 3OJVC 4DN3H 1NCWL 4M43H 4DN3L 3RWCB 1I1FB 1DEEB 3FB6A 4O2CA 4M43L 3UPRA 2Q76A 3D18B 1T1XA 5F97E 3QIUA 1FFPA 3QUZC 2R9HD 1IGYA 1KFAH 1EEYA 5CJOH 5EIIB 5DJZB 5CJOL 1KFAL 2A6JA 4M7LH 4QGTA 5GS0H 4M7LL 2V7NB 1MCFA 3VFWB 4C58B 3HUJE 5GS0L 2FD6H 1SYVB 3GMNB 4G6JH 5EUKB 1ZHBA 2FD6L 2R9HC 4G6JL 3WO4C 5C09A 3QUYD 1A4KB 1CLYH 1ZA3B 1A6TA 4X6FA 1QRNA 2F58H 4PJEA 4CMMA 1CLYL 5LGHH 2F58L 1F3DJ 3VGAB 4HGWB 5LGHL 1LE5B 5KZCB 4N8VA 3VFPB 4ZYKB 1U95B 1G7LB 1ITBB 1BIHA 2F8XC 3QUYC 3UZEA 2FYYB 4EDXA 4P5TC 5T1KD 2XTJD 5FOJA 5E9DA 3G9VA 2LAAA 3QQ3A 4CU8A 4PRIE 1KC5L 1DVFC 2BHYA 3GMQB 1HH9B 1R3IH 3U9PH 1KB5B 4Z7WF 4KDVA 2NY4B 1R3IL 3U9PL 2J8OA 2LTQC 5D1XD 1S9WA 3C5SB 5FUOH 1Q9OB 4J4PD 1SHMA 3HE7D 5FA3B 5FUOL 1MHHB 1TENA 4Z7QE 2XA3A 1DDHA 3AGVA 3ZLQC 3I75A 4U6YA 3JUYA 2I9TA 1GZQA 3QXDB 3BZ4B 4OF7A 1F02I 1VESA 2DLFH 1P2CB 2WBWB 1NQBA 3MV7B 3QEHA 5DURB 4J4PC 4ZO6A 1MAKA 4CRPA 3UTTE 1RPQA 3HE7C 4QRSB 2DLFL 2G5BA 3IB4A 1U8IA 1FNEA 1OP3K 4XC3H 1AQDA 4S1QH 2H32A 4XC3L 2BVYA 4S1QL 4W81A 1BF8A 3MV8D 1EAPB 1V3KA 3QR2A 5I1LB 3U4AA 1JP5A 5AUMB 5C7XH 4X7DC 2M8XA 1H5BB 5C7XL 1VENA 1X5XA 2YRLA 1QFWH 1ZSDB 3THMH 2BCKA 1QFWL 3L6FA 3THML 4P2OD 5L0QB 4KH2A 1R24A 4IHOA 5DTFA 3F58H 4Q7DA 3K4DA 2O26U 4JANA 3H42H 3F58L 1EK3A 4JGJA 1EGJH 1JWSA 5CGMA 3H42L 5EBLB 3EOYG 1EGJL 3LN4A 3ALWA 4P2OC 2EKSA 5ALCH 4PLJD 4RMWA 3IDXH 5B39G 1NGZB 5IHBA 1D5MA 1XGUB 3M1BB 5ALCL 3IDXL 1I3UA 3FO9B 1U8OB 2JJSC 2PN5A 2KQNA 4WFHE 3T4YA 3ARDD 3BPNC 1EA9C 3GUTA 2ZOLB 3CC5A 3KPTA 1UZ8B 5ENWB 3WMSA 4ZOAA 2F8VA 3MJ6A 4RRPA 4S2SB 2Q6WA 4P23A 1IGIH 1IGIL 4WWKB 1T04A 1UENA 4O5LH 1T4KB 4MB5A 3ARDC 4FTVB 4KJQD 3S4SA 4O5LL 2P42B 4HXAH 4KK8C 5L7XH 4HUWA 4HXAL 4F37F 5L7XL 3HZMA 3S6CA 3K8MA 3CD4A 3JV5A 4J6RH 3FOMA 3IJYA 4KV5E 3PXJA 1VCAA 4J6RL 3K81A 5J4MA 4UV4H 5ECJE 1IM3A 4KJQC 3W81A 4APQD 1ZVHA 2W9DH 4UV4L 1TQBB 4JFDA 2X44D 1M6OB 1IM9D 5J57B 3BRGC 2W9DL 2WV3A 3QJHA 3FFCB 4XVSH 3M8OH 1S7XB 1N4XH 3ULVF 1OP3H 1X6NA 1WVZA 3DLQR 2WZPD 5HHMD 4XVSL 3M8OL 1N4XL 2OL3H 4YGVA 4GKZA 1NUFA 2Z91B 4CADA 3BJ91 3EOAB 3OXRA 4Y2DA 2OL3L 5ICXB 3KLHC 1E6OH 3VWKB 4HCRH 3DO7A 1E6OL 2BVPA 5IMOA 4HCRL 4GRWH 4TVPD 3DNKA 1IKNA 4G80A 3GSWB 4Y4HA 3DMMC 4QXTB 4XBPA 5FXCH 1J05B 4GUPB 1KBGH 2AEQH 3WJLC 3H9ZA 1DP0A 1KBGL 4UDTA 2AEQL 3VFVA 4LLQA 3B9KA 3GB7A 1AXSA 5EO9A 2Z8RA 3SDDC 4N0YH 3UZQA 3VD5A 1CFTB 4LP4A 4N0YL 3P4NA 4TYUA 1MLBA 2DQFA 4RA0C 1CYGA 4Q6IB 3LH2H 3T0EC 3IJSA 3LH2L 3E6FB 5TQ0H 2DS4A 1S7TB 3IDIA 4KWUA 3QQ4A 4XGZA 1RZIB 5TQ0L 1IL1B 1JNNH 3CZJA 5C0IA 1JNNL 2MKWA 4NC1C 5MI0C 4XCYB 4YHPB 1ES0A 2D9CA 5IJKA 4F3FA 1JMZA 4H1LH 1MVUB 4H0GA 1BZ7B 1T83C 2AXFA 3BVNB 1YNTB 4YZFF 1KJVA 4WIQA 4U7MA 1RUMH 1ZWIA 1RUML 2ED7A 5CLWA 1PX4A 3KPSD 1NGXA 4P3WA 2ZOKA 5JW4M 2J8UB 5KN5A 1TETH 2AXGB 1WAAF 1TETL 2FIKA 4F57H 5EBGA 4XZUA 4F57L 1T5XA 1CIDA 1XEDA 1CE6A 4NRXA 2RHEA 5JHDE 1PEZA 4HUVA 1AHWC 2KH2B 3TYFA 4JKPH 4J23A 1YN6A 2YPKB 4JKPL 3IS0X 4Z7UB 4IRSA 1HILB 5E6ID 1UGNA 3K3QA 2GJ6A 2H26A 5EC2A 2EZ0D 3CH1B 3H9YA 3MRLA 4M1CD 2RIKA 3LKNA 4JQVA 5C0CD 3I84A 6FABH 2BDNH 1FGNH 3N1FC 3VXNB 3OKNA 4P2QA 5IEHA 2JCCB 6FABL 4N5ED 1ZT7A 2BDNL 1FGNL 3ILPA 3QI9A 5JUEH 1LK2B 3MA9H 2X89D 5JUEL 4F15C 5CD3B 3EYUH 3MA9L 1OLLA 2DWDB 5CAYB 1T80A 3EYUL 5JLZA 3PV7A 4M1CC 1AIFA 2F5AH 4HUMB 4N5EC 2QLVB 3JV0A 2PW2B 4LAQH 1NJ9A 2FX8H 3BPLB 2J5LB 3CFIC 2PO6A 4LAQL 4WNQB 4TTDD 2FX8L 3BH9B 12E8H 3UO1H 2DICA 1CGTA 2G2RB 12E8L 4NO5A 4HKJA 3PGFH 2FSEA 3ZE2E 5E2WH 1UZ6E 3BYYA 1HSBB 3PGFL 4IJ3B 5E2WL 3HAEH 5EFIA 3TIDB 4TTDC 5B38G 4J12A 1RJCA 4KJYA 5C0FA 3C6LB 1A3RH 1XH3A 2Z4QB 4DEPC 5H94A 1A3RL 3FCTB 3WLBA 2PTTB 4TNWK 1NKOA 3QWRA 5D7LB 5D2LB 4PJIF 3IDMA 1KIRB 2AJ3B 5GSRA 1I8KB 2XTJE 4JKLA 3X11A 3ARYA 5T3ZH 5C08B 1NFDB 2PF6A 5DI8A 3UJJH 4LKXA 5BV7H 5T3ZL 3UJJL 2VXVH 3GKZA 2WLZA 5BV7L 3BISA 2VXVL 5T5NG 1C7TA 1YEEH 4WHTA 4JVPA 1YEEL 4UT9H 5J0BA 3KAAA 4OLXH 5AWNH 1HXYA 4UT9L 1FFQA 1I7RA 2Z8WC 4AQOA 4OLXL 5AWNL 4JG1H 5E1HB 4JG1L 4DW2H 1BHGA 4DW2L 3SGDH 5DJ6B 4YAQA 2AKRB 3BO8A 4F33A 4UIMA 1A0QH 3QAZB 2AW2A 1A0QL 1EBAA 4GG6A 3ULSB 4Y4FA 4MNQD 5HYQA 2MPAH 3LSOB 5D7IA 4IDLA 1P6FA 5HGBA 2MPAL 3MLTB 4D9QD 2J8UF 1D6EA 3MV8E 4G7YH 4W4OC 3BKYH 4NQEA 1JGUH 4FQLH 5H37G 4G7YL 3BKYL 1BFOA 3C8DA 1JGUL 4FQLL 1G0XA 5DQDH 4U1HA 5IT2H 4UBDD 32C2B 4JHZA 1FDLH 4BFIB 5DQDL 5ADOH 4LHUA 1U9KA 5IT2L 5IJVA 5ADOL 5D2NA 1JK8B 1UXSA 4Z7UF 5FGBC 4PY7B 2NW3B 4K8RH 5DD3H 3O3BA 4M7LT 5TQ2H 1FFOB 5F9DC 4K8RL 5DD3L 2XWTA 1B88A 3D48R 5TQ2L 4OLZH 3SO5A 3RWIA 1I85A 4OLZL 3CXDH 4Y7MA 2P5EA 3W9EA 3CXDL 3F12A 1XF4A 2X4PB 3H9SA 4YC2B 2DMKA 1JJUA 2FEEL 2BY2A 1EEZA 4XPAH 3RTQB 3U82B 2B4CH 4XPAL 3LKOA 2B4CL 3N50A 5TE4H 2W9LA 5GS0C 1U3YA 1IAII 5DLMH 2VC2H 2H2SD 5TE4L 4A2LA 3ZE0E 2G75A 5DLML 2VC2L 2H1PH 2LE9A 4EZMA 4DZBA 3VRJA 2H1PL 3P2TA 1ZA6B 4CVWA 5I71B 5F9AC 3WLWC 2Y9RT 4KFZC 5DJYA 5F7KC 1FQ9C 2BK8A 2YR3A 2L7UA 3D25B 3SKUD 3BKMH 3MNWB 2XWJB 3HS0A 2EDDA 3BKML 4WI2A 1EJ6A 2F19H 3TWCH 3VXUD 1IFHH 5DJXB 3WNLA 3S7GA 2F19L 3TWCL 4OCYH 1IFHL 1MWAH 5IM7A 3AM8C 1CXLA 4OCYL 3NCCB 5IMKA 3G6JA 5KSVA 3O3UN 3UYRH 5HHME 4TUJB 1NFDF 4JY4A 2FATH 3UYRL 5IBUB 2FATL