3ZKXB

Ternary bace2 xaperone complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
111
structure length
111
Chain Sequence
QVQLQESGGGLVQPGGSLRLSCAASGFTFSSAIMTWVRQAPGKGREWVSTIGSDGSITTYADSVKGRFTISRDNARNTLYLQMNSLKPEDTAVYYCTSAGRRGPGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords BETA-SECRETASE 2
publication title Mapping the Conformational Space Accessible to Bace2 Using Surface Mutants and Co-Crystals with Fab-Fragments, Fynomers, and Xaperones
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2013-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zkxB00
3DGGA 2VXQH 3S35L 1H8OA 2ITCB 3BZEB 3C2AL 3G6AA 1UFUA 1Q9OA 7CGTA 3EYVA 3G5ZA 3I9GH 4FFYL 2X4NA 5E6ZA 2BX5A 2RIKA 4DUWA 3MLZH 2UZXB 3D5OF 2PW1B 2X1QA 3GK8L 2HTKD 4HWEH 4U3XA 4PS4L 5FB8B 4CN6A 2RCSL 2X2YA 1U93A 4V1DE 4NNPL 1BM3L 5I1IH 3PIQB 4Z7QE 4KKBC 3RVUC 1D5IL 5D7LE 1WBXB 1BF8A 1PKQA 5LGJB 3VFWA 1LQSR 3DROA 1XGYH 2DL9A 1FO0H 3SGKA 4RIRA 4LLWA 5HVWA 3DO7A 4P2QA 4X6CE 4NT6B 3O6LH 4X6EA 2ARJA 4KTEL 3RVWD 1G7QA 4CGTA 3GI9H 1R5VA 3BFOA 3MLPA 4HKBA 5BCAA 2IQ9H 3O3EB 1YEGL 3QQ3B 4P23C 5D2LB 5DRZA 4K3GA 2ICEB 4P2RE 4PV9A 3ES6A 4GKSB 6FABL 4ZUWB 1QLFA 1FL6B 3MGAA 4X9BA 5D1XB 3KPRD 4MNGE 1TVDA 2W0FA 4KK6C 1VHPA 5ID1B 1HCVA 2APBA 5CP3H 1I1FB 3LKNA 5D2NE 4YPGA 3LAFA 5IEHB 4ORGB 3QUZA 1SVZA 3EOAB 4LQFL 4JN2A 4JG1L 4NJ9L 3QRFM 1RUQL 1ZT1B 4WENB 1T89C 2EKSA 1MSPA 2DJUA 5I66A 3OAZK 2CSPA 1XR8A 4NRZB 5HBBA 3JUYA 3X12B 5GGSB 5B3JF 1SJHB 1JWUB 2X6MA 2EIEA 5J1AB 1ND0A 2D7TH 2HWZL 3P4LA 3KPOB 4PJAB 2JIXB 1UJ3B 3HUJB 4FTVB 4N9OB 4OF0A 3RU8H 1P53A 2PO6D 1FFPB 4PJ7B 3PWJB 4PJIA 3BUYA 2NY4D 2OR9L 3EYUL 1K2DA 4GXUN 5D1ZD 4LEXL 3B9VA 4CVXB 3BD5A 4TQEH 3KPSA 4S1QL 5IHBA 1E28A 4CBPA 3OXRB 1LNUB 4YHNB 4L8SC 2YUVA 1FVCA 1OGAD 4TVPE 1KTKE 2F74B 4G42B 2FLRT 1IAKA 3I02B 2FX8H 1ZS8A 2DJSA 2ERJC 4WWKB 5AAWA 4P46B 1C16A 1A6WH 2F53E 2B39A 5J13C 5E5RB 4MJ4A 1G7LA 3OHXA 1LEGA 4LLMB 3TT3H 3O8XA 5DC4B 2AV7B 1CLOH 5AD0A 1KTDA 1A3LL 1CQKA 4MAUL 2WINA 2L0DA 2YSSA 5EO0A 2V5TA 3FT2A 4UDTA 3QEGL 2EDYA 1OM3L 4M7LT 3OB0K 4HWBL 4WUUB 1U8HA 4Y4KA 2ARWA 4Q9RL 3DV4B 5DJXA 3RNQA 3VMNA 5T5FH 3F7RA 4YHML 3EJZC 1HIMH 3W2DL 1Y0LB 4WFGE 3S36L 1A4JA 5C9JB 4GAGL 3C5ZB 4L3EE 4G8GD 4C4KO 1JFQH 1FDLL 1IMHC 5JW4R 3NN8A 4POUB 5C08B 4YO0B 3S96B 5F96L 1DLFL 2WSKA 5F1IA 1W72L 3FZUD 5TF1H 1R0AL 3GRWL 5C6PB 3WLBA 1ZEAL 2VZSA 5GZNC 1PSKH 4L4TB 5DFVC 4YC2B 1WWAX 4PUBH 5FCUH 1ROWA 3KPNB 3GB7B 4LBEA 4P5TD 4JVUA 4DKDC 2VXSH 1OAXH 3AY4C 1SBSH 3I2CH 1U95A 2LE9A 3QT2A 1B0WA 3VI3F 5C0IB 2QL1A 1N2RA 4ZS7H 4I77L 1I1YA 1VDGA 3CDGA 4ELMF 3IDMB 1DE4A 1XZ0B 1S9WB 2ICES 1OCWL 5D7SL 1KTRL 2AEQH 3D18B 3ALPA 1EIBA 5HHVH 3V6ZB 1KCRL 4JDVB 4I0PB 4MNHB 3L6FB 2YN3A 3EYSL 5GHWH 3PGFH 2P8LB 1U3HD 3CSBA 1N6VA 1I1AB 4HPYL 5DRXA 4J8RA 5HYEA 3KXFE 4QT5B 5ICYA 1MWAB 2H8PB 4XWGL 3AXLB 2Q76B 4OKVA 4Y2DB 3MROB 3BIAX 3CDCA 3H6JA 1QD0A 2PNDA 3L5WA 4OZHB 2MPAL 4K94C 2FWOA 4IRSA 5DJ0B 4ZOBA 1NBYA 3ZE1F 2R0ZL 4NGHL 1I3GL 1SM3H 5JR1H 2HKFL 2O5ZH 5EA0L 4XBPB 3TWCH 3RZCA 3GBML 3TBYA 4LU5L 1RZFL 5LWYH 3D0LB 1H3TA 1YN6B 4JZJA 5IOPB 4QRUB 1CFTA 2A83A 1N8ZA 3C8KA 5L2KD 4PRBA 2AJXH 1NGXA 2BMKB 5MHSD 4MDJB 5HYSB 1RU9L 1P9MC 3CFIC 3RWHA 1I8MB 4Z6AT 3IAGC 4UT6L 4KQ3L 2RFXA 1MHHB 3QEUA 3C60D 1K85A 3WCYA 4OFPA 3UDWC 4P4RA 3NOIA 3PDOB 5T1LD 5KZCD 5CJOL 1Q72H 1WBZA 1EFXA 4DGIH 4P4KD 4UB0L 1T6WA 3HZVB 3MRMB 4XP6L 3O6KH 1RZJL 4NKOA 4TSCL 3CFDA 3D9AH 1UM5H 1MLCA 3X17A 1VEPA 5ETUB 4Y4FB 4U49A 4JR9H 1S7UA 4LMQE 3SDAD 2R0LL 4TRPL 3VH8B 5IBUG 3KYNB 1JHLL 1A5FH 1P2CB 4GRWE 3JSSA 1LP9A 1W0YT 1Z0NA 4OAWA 5T3ZD 4I48A 1MAJA 1P4LA 2X89A 1E6OH 1A64A 4AZ8A 2ITCA 4G6JH 3BZEA 1BREA 2DQEH 4JQVA 2CLRB 5EC1B 3MLSH 1KPVB 1N5AB 4ELKB 2BY2A 1ZGLB 5FYKL 5T1DH 4Y16C 3KG5A 5TDNB 3KLAB 3B4NA 3OKEB 1AO7B 3PIQA 1JHTB 2Y25A 1QSFD 4IMKA 2NY1B 2W60B 3ZDXE 3CFCH 4NQEB 2EH7H 3MREB 2JB6B 3QDMD 1WAAA 3PHQB 4G6KL 5DJ8B 4XNUH 3TN0B 3CSPA 1IGFH 3TNMB 1X4ZA 4CJ0A 4P2OC 1GGIL 3UROR 1PDKA 3MSPA 2HAZA 2PN5A 1A02N 5CGTA 4PRHB 2R8SL 1NBZB 3WHXB 4LGRB 3O3EA 5DJZA 4DGYL 4JKPL 1IT9H 5E1AA 5HHME 5JDJA 2VDOL 3I6KA 2P5WD 2XZQL 4MJ6B 1B88A 4F2MA 4KPHL 1D5XA 5E24E 1FL6A 4QTIH 5IESL 3AGVA 5IGXH 1IE5A 5E94B 3MV7D 3NMEA 1RIHH 5ID1A 3AU1B 1HHJB 4M1DL 1I1FA 3JVGC 3TA3C 4Z95L 4OFVA 5D5MB 4LLVB 1T7VA 1EEQA 3GFUA 4N0CC 4R97C 3RL1B 2BVPB 2H3NA 4HPOH 1ZT1A 4K23L 4L5FL 2BFVL 4PJFB 3W0WE 5MERB 2VDNL 5KS9F 4NRZA 5I6XB 5FKPB 3FMGH 3HE7B 1NAKH 5GGSA 3HG1D 1JWUA 2EDHA 3C09B 4PRIA 4Q9BA 5A2LH 4CN4A 5J1AA 4NNXB 2FDBP 1BD2A 3KPOA 4PJAA 3K81A 3HUJA 4XI5C 4FTVA 4BSVB 3UTPD 2EO1A 3VFVB 1OPGH 3O4LD 2D4DA 4LHUD 1FFPA 4PJ7A 3PWJA 5DJYA 3WNOA 4C54A 3HAEH 4NHCL 5GRJH 4J23A 5FIEA 1U8PB 4YHYB 2BOCA 2XY2A 2J1KA 4CVXA 2W0LA 5GRVL 5FKAB 2YD7A 3O6FD 3AVEA 4EKXA 3SGJC 3OXRA 2MCPL 4KKCC 4MXVE 1IKNA 4YHNA 2BRQA 3WO4C 2D3VA 4EDWH 3QJHB 4GS7C 3HE6D 1H0DB 1OL0A 3F6IA 3MFGB 4WWID 4UTBH 3Q5YA 4M93B 3DXAA 4WWKA 5C0GB 3ILPA 4P46A 5IMOB 3DX9B 4QXUL 3GI8L 2NY0C 3L3KA 3FT3B 3CSGA 1KB5L 1PZ5B 3VFTB 3CH1B 1TETH 4KRMB 3JTTB 4LLMA 4QHNB 4LSQL 5JA9A 5E5UB 5FO7A 2ICWJ 2YPLD 4Z7UF 1OLLA 4NQSA 3QIBD 3T09A 4S1SL 1AD9B 4OGXH 4X4YB 1JRHL 3TPUA 4MJ5A 4WUUA 5F9WC 3BJ91 2XY1A 4PRDB 3DV4A 1NEZB 3QUXB 2OL3B 3MLRL 3SE8H 4JAMB 1II4E 3LD8B 5DQDL 3LKQB 5SWSD 2HA1A 3I3BA 3RJDA 3C5ZA 3VFPA 1XGTA 3SKOB 3O2VL 3NFSL 4LARH 5FF6A 2VZTA 5C08A 4MJ2A 2V9RA 4YO0A 1N64H 4JRYA 5TFSH 2BRRH 3RWEB 3PXHA 5DT1L 2GW5A 3UZQA 4D9QE 1DVFB 1JPGB 3VXMD 3K8KA 4L4TA 5IIEB 4C83B 5IBTH 3KPNA 4UU9B 5E2TH 5JW4M 3FB8B 1QO3A 2GTWB 2NXZD 4ZYKB 2P8MB 3JXAA 1IM9B 1P4IL 1I8LA 2A0LD 2XKSA 3X3GL 4HIXL 1F5WA 5F7NC 1GL4B 5L0QC 4J6RH 3G04B 1OP3H 4MNQD 5EZIL 3ECBA 2CJUL 1S9WA 5K59E 1OTUC 5LBSH 3U4AA 4O5LL 1ETZB 4LHQB 2Z8WC 2VLLA 5CJXA 3MRJB 2HRLA 3WYRA 4JDVA 4KZDH 3D69B 4I0PA 2PYEB 1YC8A 3L6FA 4MGXA 3QZWB 2A9NL 2P8LA 1X3DA 1I1AA 5JHDE 1P7QA 1A9BA 3ARBA 3BQUB 4FG6D 2N1KA 4JQXA 1MWAA 2H8PA 4QHUB 3AXLA 3T0WA 4KJPD 3Q3GB 1YMME 2HLFC 1KSRA 3SCMC 4OZHA 4KK5D 3AS0A 5ADPH 2AV1A 3P77B 1FPTH 1TVHB 4FZEH 2DQIL 2K7QA 2NYYD 1GGBL 1BF2A 3D0LA 1YN6A 4P2YA 4BFBD 3CUPA 4PGZA 5EBLA 3UCRA 4JHAL 3NPSB 4OLXL 3VFMB 2BMKA 4IBLT 4ONFL 3ZMRA 4OCRH 3HNTL 1FFOA 5T3XD 1TCRA 4JDTL 3DMMD 5DJ6B 2R1XB 3QUZD 4LSDA 1UACL 1EGJL 2XFXA 1PAMA 3F7YA 2E8YA 3CD4A 1TZGH 5BO1H 1FAKT 1NGPH 4HH9B 1EERB 2NY5L 3RJQB 3PDOA 3H3KA 5I0ZA 2VDML 4NCC1 2J5LC 4X8XA 4E42B 3PABB 2PTUA 1KIQB 1F13A 2FEDC 2IQAB 2WANA 3HZVA 3MRMA 4HIHB 5KN5B 1ACYH 4GKZB 4Z7NF 2FH6A 3BKYL 3TH2T 5DTFA 2IMNA 4HEPG 2VDRL 4K3HA 2B7DT 4Y4FA 2LTQB 2JF1A 5EU7C 2IGFL 1AQDB 2J8OA 3PL6C 2QSQA 4O2EB 3VH8A 1FZJB 3KYNA 3O6ML 1P2CA 1J11A 3FQXA 1CWVA 1FQ9C 4HWBA 4FQJL 3TV3H 2K7PA 4Z7WF 2ZCHL 4GAJL 5EBMB 3RVXC 4OLWH 2E8ZA 3RI5K 4X5LA 2XXMB 1WWBX 2HT2D 3KPSD 1TQBC 3MLWH 2EH8L 2WP3O 2CLRA 4LSTH 1KPVA 4NUGL 1EUUA 3MRHA 2X7LB 4XP1H 4IOFC 1T7YA 2Z9TA 5TDNA 3KLAA 4TULH 2RAMA 2XN9A 3OKEA 1HWGB 4FABL 1WIOA 1AO7A 1QFOA 1JHTA 4JFEE 1MEXH 4TUKL 3UBXI 4J3VA 2W65A 2W60A 1AC0A 1MCOH 4YWGL 3VXRE 1W8OA 3O8XD 4XPTH 1HXYB 5TE4L 4NQEA 5E7FA 3ORJA 2JB6A 3IS0X 3IU3B 5DJ8A 5I1KL 4N0YH 1IZJA 2CKBB 2JJSC 2FJGB 4LSPL 4BZ2L 1S7SB 3TNMA 1AGFB 5E5MA 2VZ3A 3EW3B 1J86A 2P8PA 4KTDH 4WU5B 4YXKL 2CK0L 3HLAB 2NR6C 3HZMA 2YA2A 3MO1B 4Y4KD 3QUYC 4RMUA 4PRHA 5DS8B 5GISH 5DMKB 2NNAB 5EDXA 5I1HH 1FVEA 1FNFA 1JGVH 4K71C 1MVFA 2X41A 2QADB 4IRZL 1YJDH 2G5RA 4BZ1H 3BIBX 4YEEA 1DL7L 4HS6A 3GSNL 3I6GB 3O9WB 1IARB 1Q94B 4TNVK 4ELMB 5BRZE 1HHJA 3OKOB 4R4FL 1V7NH 2N7AA 4YFLF 3QEQB 1XAUA 5D5MA 5DVMA 2P44B 3RL1A 4UT9L 1BAFH 4LSSH 1VFUA 2AK1H 1LDSA 3S5LA 3UXFA 2ZG1A 3BW9B 4M00A 5MERA 3KS0J 4P59H 4XT1C 5ILTL 4K3DH 1UWXH 3HE7A 4JZNA 3WNMA 3ET9F 2R2HB 2OZ4A 4XPGH 4LCUA 4HX1B 2AXFB 4NNXA 3RTQB 3OKNB 2IJ0C 2IG2H 3DVIA 4BSVA 1Q0XL 3VFVA 3WDJA 4GXVH 5KVFL 1WZ1L 1Q9LB 1M7IB 1FYTE 1GGCH 2PXYB 5CEXB 1B0RA 3VXUB 3LRSB 4FQCL 4GBXB 1WC7B 2WBJC 2E27L 4JE4B 4TNVF 1BQSA 5FKAA 2G9HB 3GSWA 5C6TH 5IVXE 4N8VB 4X98B 2R15A 1T0NB 2OTUB 4NWTH 1H0DA 3P4MA 4PJEF 2FX7H 2RQ8A 4IRSD 2KDGA 3VWKB 1XF3B 5C0GA 4YLQT 3RZCD 5IMOA 3WIIL 2R2EB 3DX9A 2EXWC 4JO2H 4O9HL 4R96A 3LN9A 3REVA 3VFTA 3B9KB 5GS0D 3CH1A 3JTTA 5I1DA 1H3GA 4UOW0 3TO2B 3VXTA 5L88L 5HJ3B 2ZZUT 1HEZB 3D87B 3E8UH 4G9DA 4DN4H 2YA1A 2PKDA 3EDDA 3OKKB 3C08L 5HI5D 4X4YA 1NC2B 4P5MB 1I9EA 1OD7A 4Q58C 4NZUL 2DLFH 1WTLA 4NOFA 4YR6B 2OL3A 2BNQB 4JAMA 4MQXC 4X5XA 3HC4L 5FV2A 1EFXD 1A1NB 1G6RH 1VEMA 5EU6B 3SKOA 3C6LB 4PJCE 4XP4H 4GSDL 1MRDL 3OKDB 4EUPH 5MEPB 1BP3B 1L6XA 2QBWA 2XQBL 1KIRB 1ZGLP 5C0EB 3O4OB 1KYOJ 1EV2E 4F15B 3MUJA 2MSPA 3N9GH 5MEQB 1DVFA 1J8HE 1JPGA 1P4BH 5AZ2L 5A3ID 4OIAA 4C83A 1UZ6E 1FZOB 3FB8A 3MV8B 4G9FE 1BEYH 2X89D 1D9KD 1E27B 4YHZH 4QTHB 3T0EE 4HKXB 2G60H 2Z8VC 4Q7DA 3VRLE 3VFRB 2VXQL 2VISA 3C8HA 1L9NA 3I9GL 5DD0H 4QGTA 2ZSWB 2DLEA 1FHGA 3MLZL 1I85C 1NH6A 2V5RA 3MRPB 4HWEL 1A7PL 1ETZA 1VPOH 3FKUS 1U2HA 3NACL 4U6VH 3MRJA 3I6LE 4NP4H 5I1IL 2PYEA 5E4EC 4V2CB 1SYVB 3U79A 1PEWA 3GMOB 1XGYL 3BQUA 4JRWA 1FO0L 2E7HA 3KLHD 4ZPVA 4WV1C 3C5JA 3TNNB 5BVJA 1AIFB 5DHVH 3BE1L 5C3TA 2UWEE 2AK4D 5J11C 4XAKE 4WTZG 3SDCD 3P77A 3GI9L 1TVHA 3WKMH 1F02I 4MQTB 4QRRE 2IQ9L 1ZHKA 2IAMC 3VD3A 4D9LH 1FP5A 3L3IB 3RGHA 5KS9B 1CT8B 4ZAKC 1YJDC 4FQXC 5E2WH 3VW3H 5F7YC 2EE6A 3RHWF 2R1XA 4L8SB 4A6YB 2G2RB 3TC9A 3U9PH 3QDHA 4LPXA 3LKPB 4NFDA 4HH9A 4PJ9B 2NY2D 4UDUB 3GIVB 2ERJB 5B39G 2V2WB 4EN3B 4E42A 5FM4A 2DM7A 2H2SD 4DKFL 4LCCC 1KIQA 4BQ6A 4L9LB 2IQAA 2EEAA 3RDTA 1HYRC 1WSST 5IB1B 4I3GA 3SJVB 1FL5B 3HPJB 4DOHE 5IWLC 5KN5A 1G7MB 5DVNA 4PRID 4GKZA 4E41A 1YYML 1BFTA 4IRJC 3UTZB 1B2WL 4S11A 1XF4A 4X4MA 1KULA 1BD2D 1EXUB 3VDBA 2CXKA 5EIIB 4O2EA 1FZJA 1JGLL 3PQYB 1JYXA 3DYMA 2R9HC 1YA5A 4OBSA 1INDH 1R3IH 5EBMA 3UPAA 1Z3GL 3V6OA 2AJYH 3MR9B 4Z7UB 3QCTL 5HHOB 4MDIA 1P7KB 3QPXH 3CXHK 4LMQI 4CU7A 4M6AA 4PYGA 4ODSL 5HHQB 4EI6B 3DXAD 2EO9A 1AKJB 1CE6A 4P46D 4XMLH 3SBWA 2FX8L 1S7XB 2HFFA 1OP3K 2WNGA 1A6WL 3UBXG 1E4KA 4PRPB 2FJGA 1S7SA 3F58H 1AGFA 3CMOH 1CLOL 2WIIA 3L7EA 2XRAH 2XTJD 5JIIA 4S10A 4EQ2A 2D7OA 4PJGF 5CWSB 1AGDA 5DS8A 2PUQT 5DMKA 2NNAA 1VERA 2J6EH 3VG9C 2NY6C 4WHCA 5GRXG 5LGHH 4PPTA 4LNVA 1YY9D 1JMXA 2KL6A 5JO5B 1HIML 1B90A 4OUOA 1QBMH 4KU1A 2E5EA 1IAII 2B2XH 1J1OH 3I6GA 5C08D 3TYFB 3BDBA 1VGKB 4I1NB 4H8WH 1Q1JL 4JVPA 4JRYD 4UOJA 3WIFB 2GSIA 3VE0B 3GIZL 1Q38A 1KELL 1RUML 15C8H 1IAIL 2Y06H 3QEQA 3LZFH 3ME0A 4L4TD 3S9DB 4E5XB 2DICA 5DO2D 4PUBL 5FCUL 1D6VL 1I7RB 3NZ8B 4ZOCA 4WI8A 3TIDA 1KJ2H 5D8JH 4HBCH 1OAXL 5H8DA 1SBSL 3BW9A 2EDWA 3KJ4C 1RZKC 1KT2B 1MH5B 1A6UH 3KPRE 1DBBH 4HKZB 4DGVH 3VWJC 3BDYL 2R2HA 2SEBB 4ZS7L 1N5YH 5LG1A 1JWMB 2IPTL 1XF5B 1TJIH 4HX1A 3UP1A 3RTQA 2OXGA 3OKNA 5E7BA 4JM2F 3OJ2C 3B3IA 4RMSA 5DZOA 4RFOH 3IDNB 3QXDB 1AY1L 1KLFA 1PYWB 1AHWC 2AEQL 2EDEA 4I0PD 4N8CH 5IJVA 1Q9LA 3OKYA 5HHVL 5ACZB 1M7IA 4AIOA 5CEXA 5CGYD 2AW2A 4HGWA 3JZ7A 3VXUA 1I1AD 1P7QD 1KXVC 3ARBD 5BV7C 3L7FB 3PGFL 3TP4A 1XCQB 5DK2B 2BHZA 3K0WA 2G9HA 1KBGL 1IFHH 1OT2A 3QUMB 3TJHD 5IB2B 2OP4H 4XCCH 3D48R 1T0NA 1N6QH 5KAQG 1GPOH 1K4CB 5T5NG 5EUOF 3VWKA 1XF3A 4HXAH 2OJEB 1SM3L 2QKIA 4D2NA 3TWCL 4W81A 2P5EE 1YEJH 3GHEH 5LWYL 1CFVH 2YD1A 4WW2C 3IDIB 3B9KA 4OV5A 3LEVH 2LU7A 3H9HB 3TO2A 3WNKA 3ILQD 3LIZL 3HRPA 3NFNA 5KTEL 1HEZA 5SWZB 2AJXL 4DW2H 5H94A 3AREB 1OGAE 3BSZH 1RZGB 4HC1H 1GC1H 3GSXA 4HUXA 1JGDB 1NC2A 4D94A 1ZOXA 4P5MA 4Y16B 1EDQA 2BSTB 5D7JC 4OGAC 2XWTB 3I3DA 1I4FA 3E0GA 4G6FB 2BNQA 3P0GB 5EB9A 3BO8A 4GXUM 4R7NB 2EE3A 4XBGA 4NKQB 4U0RB 4Z7WB 1FL3B 1Q72L 1HI6B 3LB6D 3C6LA 3CFBB 5T3ZH 4DGIL 5MEPA 4G3YH 1LO3L 3LQAL 3QQNA 4WHYG 5CUSH 4PJHE 1KIRA 4E0RB 3HR5A 2HT3C 3O6KL 3D9AL 3L3JB 1F97A 2YPVH 3WEXA 4Y4FD 1IAMA 3PGCB 4P2OB 1MF2H 3JWDL 3MX0A 4JR9L 4G8FB 1A5FL 3QIWC 1ADQH 5HGBA 1BMGA 2XA3A 4WGVB 4P23A 1WICA 4G8GE 2Q6WB 5GJTH 2AP2A 2C1OA 1XGRB 4QTHA 3RGVC 3FRPG 2ATKA 3QHTC 2MKLC 4HKXA 2Z8SA 4HT1H 1L7IH 2YOCA 1E6OL 4APQC 3VFRA 4G6JL 1D3CA 1ZXQA 2DQEL 2MJWA 2NX5B 1CFQB 3UAJD 2ZSWA 4KROB 1LE9B 1TJGL 3VFSB 3VI4E 4R4BA 3MRPA 5T1DL 4EOWL 2XN9D 4KY1H 1AO7D 3WXVH 1KPUB 4R97B 4NQCB 5GS3A 1OWWA 5H35A 4PJ5A 1T89A 4NQED 3HZKB 4HK3N 4WO4B 1SYVA 2BHYA 4ODXB 4ZDHA 3VGAC 1T03H 3GMOA 4KRPC 3CFCL 3WJLC 3OKLB 4OF5A 1FNEA 4UNTA 2EH7L 3TNNA 1AIFA 1P6AB 4PD4J 3AMLA 4XNUL 1CICC 2K3TA 5IBUB 1IGFL 1FBIH 3RIAK 4PRHD 2XTLA 4Z18A 4NCDA 4RQQB 4WI4A 1G84A 4L3CB 1T4KB 1YEFL 1WEJH 3SDXF 3QFJA 2YD4A 3BDXA 3FQRA 3LPGA 5H37G 4XTRD 1IT9L 3EGSA 3HS0A 1CT8A 2ICCA 3E1F1 5I1LB 4QTIL 2F54B 4R6UA 1RURH 4RGOH 5IGXL 4ZODA 1RIHL 4H8WC 4L8SA 4A6YA 2ENYA 4PY8I 1R5IA 4KKLD 2M26A 1SEQH 3QJFB 3F7VB 4OZIF 4PJ9A 1YEKL 4UDUA 5IVNA 3GIVA 5CJQH 3OPZH 3D0VB 4HPOL 3RL2A 4GKOA 3BEWB 4L9LA 5L2KE 1OB1B 3ZLQC 3BAEH 3SJVA 3HPJA 4P99A 3HE7D 4GOSA 1U58B 1G7MA 5MHSE 3PP4H 1CLZH 3MPCA 2H6PB 4LFHD 5A43C 1KC5L 1S7TB 1NAKL 3FMGL 4FMKA 1YECH 4PJEB 1YEHH 4NN5C 2DKUA 5EIIA 3NZHL 3PQYA 2QHRH 2Z35A 1KV3A 4IIQC 4MCYB 3VU2A 1RMFH 1OPGL 4O2CA 5JTWA 5BQ7A 1OAYL 5D1QB 2J8HA 3I3EA 2BNUB 5J89A 5GRJL 5LKNA 5F9OH 3ARFC 5E8PB 5A2FA 3VD7A 3G5YA 1S5HB 4Z7UA 5EU4B 5F72S 5HHOA 1P7KA 4KKAC 1IVLA 4ODUB 3ZDZE 5HHQA 1TFHA 5EOCJ 3TT1L 4JO3H 4EI6A 2YD3A 3WE6B 3FTGB 4EDWL 3B9AA 1AKJA 5GRZA 4X80H 3QQ9D 2B1HH 3CCHB 1S7XA 4UTBL 5T3ZE 3IDGB 3O41B 5EOCH 1ERNA 1U42A 1QA9B 4X4ZA 5C8JA 3NTCH 2WK2A 4QWWC 3TO4B 5I73C 1U8LB 5AYUH 3V52H 1CE1H 5L0QB 3VMPA 1VCAA 3F7PC 3PWNB 4ZTOH 2Y36H 4DK3A 3UPRA 3ZKQD 5CWSA 4Z7OF 2X4PA 5FYKD 1D5BB 3MV9B 5F89B 1QSFE 3D3VD 1GC1C 4MA1C 3SE8L 5JO5A 5I8EB 4Z5RA 4C59B 3QNZA 3TYFA 1VGKA 2HP4A 3QDME 1B9ZA 5J06A 1S8DA 4LPVA 4KXZH 5I1EH 3S3JA 4MCZB 4N5EC 3H9YA 4YNYB 1N64L 2BRRL 4NJAH 1FO0A 3FRUB 5B22A 2FCBA 1JF6A 5J9PA 2VRAA 2Q87A 3DIFB 32C2B 1PD6A 1I7RA 4XHJD 1DQJB 3MCLL 5E2TL 1LO2H 1KLGB 2P5WE 5HGAA 1A6PA 2GJ6A 5GS2H 5E2VH 2JCCE 1KTLA 2J8UE 5E2JA 5F3HB 4BQ9A 3DX7B 4JVWA 2GJZB 1MLBB 1CF8H 3MV7E 2SEBA 1HXMB 1I1CA 2L7JA 4Y0GA 1JWMA 4J6RL 2HFTA 1P9MA 3OKMB 5JHLH 4FFVD 4YXLH 1YEEH 5F1KC 3MRDA 2B0SH 3N85H 1RIUH 1W72B 4PP2B 3QA3A 3QXDA 4OFYA 2DTML 2PYED 3CFKB 5EO1B 1B0GA 5ACZA 5CP3A 4PB9H 2AAVA 3MMEB 4KZDL 3DVFA 4OLVH 2C3WA 4RMQA 4XH2A 3BQUD 4KUZL 1NSNL 5C9KA 1XCQA 3HG1E 2BNRB 5DK2A 2GT9B 4XCNB 3HPLA 1BFSA 4JLRB 1CXFA 3QUMA 3H9ZA 5IB2A 3IFNH 5I2IB 4GW1A 4Z7QF 5ICXB 4L8CB 3UTPE 3O4LE 4LLUB 5ADPL 3LS4H 3KPMA 1FPTL 3U7AA 2ZUYA 2BCKB 2KPNA 4RGND 4ZFGH 2OJEA 5FYJU 4Q6IC 3PWLA 4X6CF 5C86A 4F3FB 4NFCA 4QRPA 2QR0B 4ZQKB 3H9HA 1CG9B 3V5DB 2C7UB 1DN0A 1RZGA 3QWRA 4B0MM 4QRSB 3W39B 1CDYA 2NXYC 4Y16A 4Y19A 3PV6A 3ULVD 2XWTA 5DHYA 3ZZ1A 3BYTA 3PV7A 5BO1L 4HGKC 5DLMH 4ZNCD 2FBJL 3RDTD 4OLUL 4ZUTB 1FL3A 1HI6A 4LVOC 3CFBA 4U3HA 2BDNH 1KNOB 4E41D 2YPLE 4CW1B 5M7QA 2OTWB 4KVCH 3BH9B 3ZKXB 4E0RA 4QRTB 5DMIH 2HMID 1ACYL 4NO5A 5F3BB 2FSEA 4JY6B 3VGEA 4P2OA 1NAML 3SDYH 4G8FA 2YC1B 2VZUA 5SWSE 4K71B 2ZUUA 4IMLB 4HLZH 1F00I 1AP2A 5EC2B 1XGRA 4KH2A 4ZSOA 2AJ3A 1JNLL 1IEAB 4OLWL 2DMBA 4P9HH 1WJ3A 2NX5A 5E99L 1B3JA 5KAQF 4LSTL 1NCNA 4LF3B 5T5NF 3T4YB 2WW8A 2ZJSH 5FV1L 3VFSA 1EVUA 3K8MA 5KW9H 4PJGB 3VXME 5BOPA 1DUYA 2DF3A 4KK9D 1KPUA 43C9B 4OSUL 1I9IH 1QHPA 3BGFC 1MEXL 4M1CD 4OF6A 2Y07H 2C3XA 2YHGA 1ZMYA 1MCOL 4ODXA 4WI2A 4XAWL 4A2LA 4U0QB 4HMCA 4XPTL 2AABL 4MNQE 4BSWA 4HZLB 4LCIH 4JKKA 4N0YL 2UVEA 1ES0A 4L3CA 2BSRA 4OIIH 4HUNB 5HHPA 1HSAB 1OW0C 2QADD 1PKQE 1FE8H 2C9AA 5GISL 2DOCA 3C6SA 5I1HL 5DUML 1U3JA 5B8CB 3IDUA 3MBXH 4JPVH 4LCWA 5GJSH 5DJ2B 2FJHB 1RHHA 2ZOKB 3WL9A 4NC0B 3CC5B 5I1LA 3SGJA 3T04D 2F54A 5FYLD 5ESVA 1FFRA 4AEEA 2ZUQC 3QEQD 1K4DA 4JM2B 1HWHB 1V7NL 3QJFA 3F7VA 3LKOA 3S8WA 1BAFL 5ERWB 1C12B 4JHWH 4LSSL 1Z9MA 3BEWA 2AK1L 4P2CG 1OB1A 5ACLA 2OR8A 1CD1B 3G5VB 5FUCE 5T3XE 3IXTB 2H6PA 4K3DL 4G43A 1QP1A 4YBLC 3RTQD 1OOAA 2OS7A 1YMHA 4PJEA 4U1MB 5KVEH 4YQXH 5EUOB 3CVHH 1T1YB 3FQUB 1LK3L 5DMGD 3UTTD 4ZS6D 1NCWH 4GXVL 3V4PL 3STLB 3X14A 1WT5C 1F11B 2BNUA 4KJYB 4P3DB 1FGVH 2XZAL 3BPNC 5E8PA 4Z78B 1K6QH 1S5HA 5EU4A 3SKMB 4F7MB 4G7VH 2X10A 1NFIB 3GO1H 3OF6A 4NRYB 4OI9A 1AQKH 3WE6A 3VWKD 4NWTL 3LHPH 2FX7L 5SX5K 4KJWD 4WW1B 1AXIB 4Y2OA 4PJIE 1CN4A 4LPWA 3IDGA 4OT1L 5D9SB 1QA9A 1HHKB 3U2SB 3WIHH 1NL0H 4ZD3H 3KPSE 1LEKA 4JO2L 3CXDH 1A4KB 3MLVH 1AD0A 1U8LA 3DARA 3L5XH 3R0NA 1JYNA 1YQVH 5INCB 2HH0H 3E8UL 4H1LG 4XVTH 4DN4L 4D0DB 1WGOA 5ITFB 3WFCL 4NUJB 1NC2D 4C56A 3VDAA 1MIEH 3MYJB 4FQLH 2DIAA 3ISWA 1D5BA 2BNQD 3MV9A 5F89A 4KKBD 5EIQA 1C5DA 3RVUD 3PP3K 3VRJB 5I8EA 2ZUVA 1SHMA 4XP4L 1KJ3L 5GGSY 4G8EB 4PJDB 4PD4K 4WV1B 4YNYA 3HC3H 3KYMB 4Y5YC 1FRGH 2Z0BA 3BZFA 1JHKH 3FRUA 1MCCA 4LLDB 3SCMA 5J11B 3N9GL 3ZE0E 3D2UB 1P4BL 3DIFA 1NCBL 3RWIB 4P23D 2R23B 1DQJA 3W9EB 3HZYA 5MEND 5EN2A 2FYYB 1JN6B 5FK9A 1BEYL 1WV7T 3DVGB 1MCKA 4NQDB 2B8OT 3DX7A 2GJZA 2NY7H 4KK6D 4F8TA 3ULUH 4GRWF 4KK8C 5DD0L 4HBQA 1NCCH 2JK5B 4M5ZH 4P9HC 3HI6H 1IC5H 3BESR 1VPOL 1WFNA 3SDXB 1TENA 5EO1A 3WN5C 3GKWH 1BFOB 4PJ5D 1Z5LA 1ZLSH 3MMEA 4PR5B 2J3SA 1AGCB 3BMWA 4NP4L 5DEFB 1HH9B 4C55A 4MXQC 3QDGA 1KG0B 1INEH 3MA9H 3BPLB 1JVKA 1YUHB 4XCNA 2BVUA 1T0MB 5JQHC 3L3GB 1A6ZB 4I5BB 4JLRA 1MCPH 5A16A 2EYTB 5I2IA 1S7QB 2EZ0C 5E2UH 3QFJD 3ZDXF 4OZIB 3WKML 1BOYA 2EXYC 2XA8H 5CEZH 1R3KA 4NWUH 4FXGB 1SJEB 2Z4QB 4HK3J 1TNNA 2DQGH 4X9FA 3S97C 4D9LL 3H8NA 1SEBB 4ZQKA 5GRYA 3V5DA 2BK8A 2C7UA 1VFAB 4N0UA 4XRCB 5ISZD 4LIQE 3CJJA 3F12B 3U83A 4FQQB 5E2WL 3HI1B 2V2TB 3S88H 5EG6C 1RPQA 2H2PC 4QRSA 2E9IA 4MJIB 1M4KA 5E6IB 2YPKB 1J18A 2V2XB 4TPRH 4OZ4B 1VADB 3U9PL 3K2MC 2VLRB 3K1DA 2QSTA 1M7DB 1ZLUH 4ZUTA 4F9PC 3HA0A 1FNHA 4KI5C 3SOBH 3SJVD 5J4MA 1TZHA 3P3YA 1KNOA 3QSKB 3B5HA 4CW1A 3MRRB 4QRTA 1EEYB 1H8SA 1BIIB 1VGEH 4JY6A 1E0OB 3QO0B 5C0FB 3C8DA 1FN4A 4JREC 5CGMA 3PQYD 3ZSSA 2YC1A 3WD5H 3EJZD 3VG9B 2YWZA 4Q97A 4IMLA 4TOYH 2ICWA 3O2WH 4MD0B 5EC2A 2ZUWA 1R3IL 1NC4B 4JY4A 4NC1E 1GZPB 5HHOD 2DQJH 2E6JA 2AJYL 1M6OB 1MREL 1G9MH 1HSBB 1ZAGA 3IVKB 2ZNWA 4PRAB 2X4QB 3BWAB 5GZND 1KEGH 4HHAB 4WI5A 2W0PA 3LN5B 5B39B 3VFGL 4OLZH 1LP9E 4OCNC 4F7EB 3L5HA 4K2UH 5DFVD 1BX2A 43C9A 1T7WA 2EEBA 1CL7I 2HJLB 4XMLL 3BPCA 1A7BA 2ZKHH 2Y4SA 4X6DA 2ARJQ 2EIBA 5GIRA 1EMTL 3Q0HA 3HI5H 4F9LC 2C1PB 4MXVF 3SY0B 1EAPB 3KJ4B 5F9JB 4QXWA 5C0NC 5DMYA 1F90H 1YEDB 4HZLA 1CL7L 5CJBA 5IMLA 2R4SH 1P7HL 3QCVH 2BERA 2IF7A 4GFTB 4Y8DC 3CMOL 3ZE2E 4GH7B 1NFKA 2I9LA 1FH5H 3WXWH 1JZ4A 5HDQL 4MWFA 1FZMA 3UYOD 3DV6A 2BVEA 1WZLA 1ZT7B 3IF1B 4JO4L 4BZYA 2Y5TB 2J2ZA 1U8OB 3BIKB 3LH2L 4V2BA 5DJ2A 2GY7B 1WAAE 1QBML 4I8DA 2FJHA 2B2XL 5DJAB 1EO5A 2XWBB 1J1OL 2WBJA 4JZOB 3VA2C 5BV7B 4H8WL 1EVTC 1G7IB 4JM4H 2VTFA 4NHUA 5DD3H 2AK4E 3LMJH 4U1LB 4JN1L 1X5ZA 4ZXBB 3TJEH 5L9DH 3RUGB 3IJYB 1T1ZB 4WI3A 3DHJA 3UBXB 2YR3A 5HDOA 1R3JB 5DHVB 3RA7H 2GJ6D 4QNPF 1F3RB 1KJ2L 5D8JL 4HBCL 1ZE3C 2VIRB 4L4JA 2C3GA 1W0WB 3IXTA 4V1DB 1MWAH 5ICZB 3U0WH 4DGVL 1YN7B 3BP7B 1N5YL 4J4PC 5F6HJ 1T22A 1TJIL 5I8KH 4U1MA 5D7LB 1A7QH 4I13B 4OFYD 5CZXC 5EUOA 3ULUC 4EVNB 3FO0H 3FQUA 4RFOL 5MI0C 4PV8B 5FO8B 2GAZA 4N8CL 3B5TA 3B6SB 4X6CB 3E6HB 2YWYA 4DUXA 1F11A 4XB7A 1BZQK 4U6HB 1QRND 4KJYA 4P3DA 4PRIE 4P5KB 4Z78A 5IQ7H 4ONOA 5IHUH 3SKMA 3BN9C 3IFLH 4F7MA 1BD2E 4PJAE 3L3HA 1HHGB 3HUJE 2H26A 1NFIA 3M17B 2OP4L 4XCCL 1KIPA 5D1XC 2DQCH 1N6QL 1NANH 2QQNL 4PJ7E 4WW1A 1GPOL 5D9SA 4OCLC 5TGBB 1HHKA 4QRPD 4MNGB 4HQQL 1JL8A 2V7HA 3PWVB 1T5XA 4WRLA 1YEJL 3MQIA 4LVNB 1A4KA 2Y1VA 3GHEL 5D2NB 3RGVB 3BEVB 1IEBA 1RJYB 5INCA 3D85A 3QWRD 3RFZC 4FQ2H 4D0DA 5ITFA 1WIPA 4NUJA 3BSZL 5I1CL 1ZA6B 3DXAE 4GAFB 4HC1L 4Y16D 4Y19D 1I85A 3MYJA 1GC1L 4G6FD 1I8KB 3RPIA 1N3NB 4Z9KB 4PJXA 1X5JA 4HUVB 3VRJA 1LK2B 2DWEB 1DUZB 1CGVA 5HGDB 1D6EA 1UJ3C 4EQ3A 4H0GA 2FEEI 5T3ZL 4LPUA 4G3YL 2NY3C 5CUSL 4KRPB 4PJDA 5TE7L 2DIJA 2XTJE 4WV1A 3DHMA 1GYAA 3GJFK 4P2OD 1CFBA 2YPVL 5CHNB 5E8EB 4LLDA 1AI1H 5I1JH 1MF2L 2HFEB 3RWIA 4J3UA 1EHXA 5DR5H 2IAMA 1ADQL 4GKNB 5DRWA 5C08E 2FYYA 4JRYE 3DBXB 3DVGA 4JDZA 5CD3B 4WWKC 1IKFH 2CO6B 4NQDA 1R3HB 3EFFB 2NX5D 4LL9A 4ZAKA 1N4XH 1L7IL 4FQXA 5L6YH 2M2DA 1NCDL 3MTRA 3T77B 2DQDL 4ZOAA 4L4TE 3TA3D 1J87A 5L2JB 3VXOB 2F53B 3ARTA 3MYZA 2JK5A 8FABB 1G9MC 4N0CD 1RUPH 2ORBL 4KY1L 4FFWC 3WXVL 5J3HC 5LCVL 5D96C 1U9KA 4PR5A 5IMMB 2WMPA 5E56A 4LCCA 1UWGH 1OP5H 1KG0A 3W81A 1EBPA 4Z0XB 2DBJA 2P24B 1LO4H 5IWLA 4Y7MA 5DQ9B 1YUHA 1T03L 1T0MA 2FLBT 3L3GA 1H9VA 2XZZA 1A6ZA 4IRJA 2EYTA 1O7SA 2D0FA 4R26H 3DTXB 2O61A 3SDDB 4UBDC 1FC1A 1FBIL 1S7QA 4XI5D 2XNAB 3U0PA 3T3PE 3QFDB 4OZIA 2IMMA 4LCWD 1WEJL 4IIQB 2A74A 4FXGA 5E8OA 2Z4QA 2EC8A 1V3LA 2X05A 4YC2C 5GGTH 1F3DH 5I17A 1F4HA 1QSZA 2EDBA 2F54D 3HB3C 5E9DA 4XRCA 1N0LA 2OZ4H 4OZHE 5JW5B 3F12A 4FQQA 4KKCD 4Z8FH 1XR9B 2BVQA 3HI1A 1FNAA 4D0CB 1RURL 4MJIA 3MJ8B 2YPKA 2V2XA 3DRTA 4LOUC 3OJMB 1SEQL 1DLHA 3P9MB 4NC2B 1M7DA 3U7YH 1XH3A 3NPZB 3ZSTA 4XP5L 5CJQL 3OPZL 4CN1A 2NY0D 4L4VB 3BP5B 4UINL 3MOQA 5FGSA 1U91B 4HK0B 2GK0A 3BAEL 3MRRA 1EEYA 4G6AC 3TH3T 4DJMA 3PP4L 4WTZA 1XCTB 2HTLC 5EFIB 1CLZL 3U48A 4MQSB 2R69H 5C0FA 3U7WH 3B8YA 2EDJA 1PJ9A 3KYKH 3Q6FA 4QCIB 4NKIH 1I3UA 3CX5J 1CXHA 1YEHL 1GOFA 4Y2DC 5GRWA 1ZWIB 2QHRL 3R1GH 2VR4A 4MA1B 1RMFL 3TF7C 4MD0A 2YRLA 1G9EA 1L9MA 1X4XA 1BLNA 1MFAH 1NC4A 4QF1A 4K07A 1GZPA 5F9OL 2IPKB 1HSBA 5C71A 3IVKA 4PRAA 2X4QA 1G6RA 3QXVA 1TDQA 3OF6D 3KJ6L 4HHAA 4F7EA 4JO3L 5T33H 4X80L 2VN4A 3QRGH 2B1HL 5DXWA 1U8IB 5EOCL 4X0KB 3GNMH 4H0IA 5IVXF 1EAPA 2LU3A 1DEDA 5F9JA 2FO4A 2GITB 2AJUH 1OAKH 1W0VB 1YEDA 5AYUL 3V6FB 5IHZA 4DZBB 3VWJA 1AJ7L 1AE6L 3GMNB 3V52L 4C56D 1CE1L 4X7TB 2XN9E 2CMRH 1ZHLA 4ZTOL 2Y36L 1AO7E 1OTUD 1CXLA 3MA7A 3NIFE 3QXAA 3MV9D 4JEGB 3L5IA 5FCSH 4L1HA 4MLSA 5IEKB 1U8QB 1ZT7A 3LY6A 3EJJX 4P49A 2Y5TA 3BIKA 1U8OA 3DYOA 4NQEE 3B9DA 2VQTA 2HVJB 1N0XH 5DJAA 5DK0B 4TSBL 4U6XB 1U6AL 4TUJB 2FGWH 4MB5A 1G7IA 1F4YH 5I18H 5I1EL 4GRWB 5D93B 2HLFD 4PRHE 3SCMD 3A67H 4M48L 4WTXA 4O02H 4J2XA 5DURB 3BKML 2YUXA 2O5YL 3RUGA 3IJYA 4ZNEA 1T1ZA 3EO1B 4PJCF 1EAJA 4RRPG 1R3JA 5DHVA 2ZPKH 3L3OB 3AS2A 4WHTB 2VL5A 4JFFA 2YUZA 1LO2L 3KVQA 1J5OH 4L8BB 1GZQA 2VIRA 4WW2A 4MA3B 2R29H 1HDMA 1FSKC 2NY1C 4V1DA 5ICZA 2FJFB 1OP9A 1UC6A 1CF8L 1FZKB 5D5ME 1UZ6F 3BP7A 5C09B 1ZLUK 4D0BB 1G0DA 2N56A 5D7LA 5JHLL 3FQTB 4YXLL 4PJ8C 4DKAA 1SVCP 3TN0C 1GIGL 4EVNA 1OHQA 1QLRB 1RIUL 2B0SL 3N85L 5D7JA 3RQ3A 4PV8A 5FO8A 4AEHL 3B6SA 4PGEA 3E6HA 4YHIB 2FEDD 3RVVC 3QDGD 4PB9L 5IR1B 3DWTA 4U6HA 4OLVL 2X4UB 1PY4A 1OAUH 3SKNB 2RJMA 3MBEB 1UKSA 4DVRL 1HHGA 4NO2B 2BSSB 4ERSH 3IFNL 3IDYB 3M1BB 5J6GB 3O3UN 2A73A 3WUWG 3PL6D 5HHMB 3S34L 1HH6B 3LS4L 3BRGC 5TGBA 1RJLA 4ZFGL 5K9JH 3RVXD 1JTTA 2P46B 1MPAH 1UKQA 3RGVA 1V3JA 2UWEF 1QOKA 3BEVA 4APQA 1RJYA 4YHPA 3Q6GH 5F44A 2VDQH 1QUNA 3AROA 3V5HB 3FQWB 4IOFD 2C4XA 2ADIB 5L8JB 3S4SA 1FG2B 2J4WH 1I8KA 4QY8A 4OM0H 5ENWB 5FM8A 5KSAB 3TM6A 2DWEA 1DUZA 5DLML 5HGDA 2XZCH 3E3QC 4XB8A 4HV8A 4OJFH 3GUTA 4TUOB 3T8XB 3WJLA 4XPBH 4KVCL 3HNVH 1T0PB 5DMIL 3P4OB 4AM0A 3VGHA 4L29A 1E4XH 4D3CH 4GUPB 5E8EA 3MXVL 1CICA 2NR6D 3MRNB 5FYKE 1WCBB 1NMCB 2P7TB 1MY5A 1KLUA 3QUYD 4XP9H 4P9ML 2F9BT 3C5SB 2O93L 3D3VE 3QZWG 3SDYL 4AENB 3L5JA 4Q6YA 4H88L 4AEIL 5CIPB 2MCG1 4M93C 3DBXA 1I3RB 5CD3A 4GW4A 2J6EA 1CR9H 1R3HA 1HKFA 2M1KA 4RSVA 1NFDE 2JLLA 5HYQA 2R56H 1MI5A 1Z9SA 2CKBH 1WWWX 3T77A 4P9HL 3BXNA 3X11A 3VXOA 5L2JA 3RWFB 2F53A 2ZUQB 2ZJSL 3FAXA 4HEME 5ITBH 3AUVA 4M7ZB 4GG8B 3JBG7 3CSYB 4JFPB 2XACC 3X3FH 3GMLB 1RFDL 3K1KC 5IMMA 5KVGH 1UCTA 3THMH 2MQ0A 4WJ5B 3FJTA 5EU3B 1UYWH 2Y07L 3QUXC 4Z0XA 1J05B 1TITA 3LD8C 2P24A 5IFAH 3O3BB 5DQ9A 4YDJB 5TE6H 3IAPA 4JANB 1NCUA 2PTTA 2VC2H 3NFPB 3K74B 4LCIL 4RA3A 4BK4A 3QR2A 3DTXA 4NN6B 1RJZB 4K8RH 3ABZA 4X5WB 1B4JH 5DUPH 4LP5A 2XNAA 2QTEA 2PYEE 4NBXB 2B4CL 4OIIL 2VAJA 2P47B 1FE8L 4IIQA 1JI2A 4R7DB 1DVFC 1XEDA 2EICA 5CZVH 2WBJD 5GJSL 3MBXL 4JPVL 1OSZB 2AI0H 3ARFA 4NOBA 4YE4H 5CD5C 3LKRB 4WVRA 1IL1B 2XPGB 1GHFH 4D0CA 1BVZA 4HIEB 1J0KA 5EWIL 3QH3B 4OQ1A 3W82A 3NCFB 4LHUG 4RGNE 2W9DH 3TBVB 3QIUC 2D7PA 1J0YA 2VDKH 1MJ8H 2ADJB 5HDLA 5E08L 4WEMB 1FAIH 1GGYA 2EXWD 1IEHA 4D8PB 4L4VA 4IEFB 3BP5A 2W07A 3FONA 4JHWL 5GXBB 5JZ7C 1RULL 1I7ZA 2AXGA 43CAB 2N7BA 1C5BH 3BP4A 3H3PH 3H3BC 5EFIA 4LKXA 3FO9B 3IGAB 2PYFA 4GQPH 4KVNH 3ULVE 2W59A 5KVEL 2ID5A 4LIQL 1A21A 1T1XB 1QTYT 3GSRA 3NCYS 4MQXD 4YQXL 5JHDB 3CVHL 4HC1A 4XBEH 1NCWL 1ZGLM 4E41E 5IW1B 1IC4H 1YMMB 1S7VB 1BGXH 1HHIB 3ZKNC 1EJOH 3H42H 4X4ME 1FGVL 1SMOA 2BC4A 5GS0L 1K6QL 1AGBB 1HYSC 1NLBL 5D7KD 2BOBB 5C0AA 3NPSC 4G7VL 5T1KB 4AL8H 2NTFB 3HMXH 1F4XH 1JNHB 1AQKL 3VJ6A 4LLQA 5LAXB 3UEZA 4R8WH 4U4BA 3LHPL 3K4ZA 3OZ9H 4GLRI 3V6OE 1U8IA 3ZYZA 4X0KA 1BBJB 2WQRA 4LSUH 1J1PH 1NL0L 4F33B 4ZD3L 2QV2A 4FP8H 3D85D 4RAUB 1ADQA 2GITA 1OAQL 1W0VA 3L5XL 3V6FA 4JRXD 1YQVL 1JE6A 4ZOEA 3GMNA 4Y88A 5IMKA 2HH0L 4KTYA 1MCDA 4UT7L 4BKLB 5JXEC 2GYSA 4XXCC 1OP5K 1MIEL 3MRFB 5IEKA 4ALAL 4BH8B 4QHKJ 3LRHA 3LQMA 2LTQC 3DYPA 4LDEB 4QRQA 3A6OA 4QXGH 2VLJA 5C07A 4KMTL 5JQ6H 1TPXB 2F5BL 3TH4T 5DK0A 5HGHB 3CFEB 4U6XA 4TUJA 4CVZB 1A6AA 2P43B 5MEOA 4OI7A 2XKUA 4OV6F 5DJCB 1CDCA 4MLIA 3DUSB 1WZMA 1UWEH 2DLHA 3HC3L 1FRGL 1JHKL 3MGTB 3EO1A 1RVFL 2IAMD 1DQQB 1M71B 4PJHF 3L3OA 3CH8A 4WHTA 1MNUH 4Q6IA 2D9CA 4S1RL 2CIIB 3IDJB 4L8BA 2FHCA 4H1LB 4Z0BL 4N8VG 4ZAKD 4MA3A 3GJFB 4FQXD 1MHPL 5FYLE 4U2ZA 3NABH 3SE4C 1FZKA 2NY7L 3QEQE 5HD8C 4HIJA 4JFEB 5CFHA 3ULUL 5C09A 4UI2A 2DQFB 4MVBC 4D0BA 1C8PA 5FYJH 3N1PC 3FQTA 1Z2KA 4M7JH 1F2QA 3K8LA 1NCCL 4PBXA 4HIIB 1QLRA 3HI6L 5HYFA 4JPIA 2OM5A 1MFCL 3MNZB 2X1OA 4CNIB 1DSFH 3GKWL 4RFEB 4YHIA 5IR1A 4OD1H 4QXTB 4UQ2A 2X4UA 3MRLB 1AGEB 1YPZA 1S7RA 2LABA 3VI4F 4IOSD 3EDJA 2CKNA 1LGVA 4IRJD 3FFCB 4U6YA 2BSSA 3O9WC 1EHAA 1MCPL 3CX5K 4YDKL 4LPTA 3M1BA 4A6YH 2HG5B 3GGWB 1K8IB 2EYRB 3NH7H 1HH6A 5FA4B 3UTTE 5HVGB 4IHOA 3I84A 3IJHB 1BJ8A 2R9HD 1QFWI 1JWSB 4K8RC 4Z7VB 1DBJL 4D9RD 1PG7W 2C3HA 5BRZB 2UZYB 2Z92B 2DL2A 2VOTA 2DQGL 3ROOB 1NCAH 2CDEB 3O3DB 2C5DC 1DFBH 5E9DD 2WBWB 1EHNA 4BK5A 2QQQA 1SJVA 1NKOA 5BZDB 5IFHH 1JNNL 2DM4A 5K9KB 3FQWA 4M43H 1I9RL 1UG9A 1KEMH 2ADIA 3S88L 4ENEC 3PNWB 5ENWA 1BIHA 1EHLH 1EPFA 1QSEB 4R90H 3L9RA 1CDJA 3SOBL 2APFA 1RZ8A 3T8XA 3TVMB 4W6XB 1BQLH 2PXYC 4JCLA 3D25B 2XICA 3P4OA 4GBXC 4PBVC 4GUPA 1T7ZA 1VGEL 4F37K 3RNKA 3MRNA 2EDNA 2DM3A 1WCBA 2R4RH 2BNQE 4GMTH 2X1PA 1A8JH 3BYYA 4AENA 2AGJH 2NY6D 1OW0A 3VXNB 2ITDB 1FNGB 2V17H 3EYQC 1NC4D 2D0GA 5CIPA 2E9JA 4DN3H 3O2WL 5IVXB 4AQOA 2E6QA 3RKDC 2APVA 4M6OH 1TVBA 3ZTNL 4Y1AA 5DYOB 2UYLB 4J3TA 2DQJL 3NA4A 1G9ML 1F2XK 2BXYA 3B9KC 3FO1B 4KHTL 3FFDB 4OZGE 3O11B 4LNRB 3H7BA 3RWFA 4OD2B 1JGEA 3WNPA 1LILA 2AKRB 1DBKL 1GAFL 2X4TB 5EZOH 1AXTH 4ZFZA 1FCCA 5CEYB 4JFPA 1MCLA 5MENE 2ZCKH 3GMLA 1KJVA 1JPFB 4LPCA 4MX7B 2ZKHL 5F7MC 2E3VA 1TTFA 3D39A 4X8JB 1J05A 3HI5L 3TZVB 2VQUA 5D72H 2JB5H 3O3BA 3VWJD 3T0DA 5CSZB 3ZTJG 4F37F 3C6LC 1F90L 4Y5XC 3NFPA 1UXSA 2R4SL 5IVZB 3QCVL 2WWKT 1RJZA 2YK1H 2J12B 1FH5L 1T2QL 3MODH 3O4OC 4Q0XH 5CCKH 4PJCB 4K94H 3MLUH 2BHUA 1BOGB 4PJ5E 1S3KL 4F15C 5MI0B 4POYA 4R7DA 2EDRA 1H3VA 4ONGL 4PTUA 4ZFOA 1WT5A 4NPYB 4KDWA 1URLA 3FT4B 4JY5L 3LKSB 3ARUA 4W68A 1ZLWK 5DD5H 1P5UA 4M61A 1IL1A 1UQSB 3OJVC 4JM4L 5DD3L 3S98A 3LMJL 4G9FB 2XWJB 1ZV5A 3QFJE 3QH3A 2ADFH 3SQOH 1C7SA 4XZUA 3TJEL 4JFOB 4JB9H 3T0EB 3T2PA 2ADJA 5F7KC 4JFFD 4WNQB 4HUWA 3RA7L 3LS5L 5JDSB 4U1SB 43CAA 4KV5E 4LLYA 4X6FB 3HTLX 3SGEI 5ISZE 3QULB 3MGOB 1E4JA 1OGTB 1MWAL 3FO9A 3H7LA 3IETB 3QUMH 3IGAA 5F88B 3U0WL 5C0DB 4PIRF 1ODAA 5I0DA 3QG7H 4MS8C 5I8KL 2YRPA 5K9OA 5CSGA 5D7JD 4OGAD 1T1XA 3V0WH 2JCCF 4WFED 1ED3B 5JHDA 2J8UF 3FO0L 1M7XA 2EDLA 3SJVE 1EK3A 3OAYK 1HHHB 1S7VA 1HQRB 5FXCH 2HT3D 3FAWA 5IQ7L 2NY3B 1KCSL 4K9EH 5KSVB 1AGBA 1EUTA 3GMMB 4PLJC 5IT2H 3IFLL 1ONQB 4Y5YA 2BOBA 1FGNH 5KG9B 3AB0B 3RRQA 3PQYE 3G9AB 4P0DA 5F8QC 5T1KA 1UXWB 2XYCA 2F8VA 2NTFA 3F6LA 1JNHA 1RV6X 4HF5H 4QOKB 3QQ4A 4I4WB 4OTXH 1R3LB 2OBGA 1HCFX 3QIWD 3O45B 1NUNB 4QHLA 5IW6A 5JXAH 3PGDA 5GSVB 4HXBH 4LLAA 5IKCB 1BBJA 3GMPA 5F8RC 5HHOE 4OLYH 3RGVD 5IM7B 4JGMA 4PJ9C 1CDUA 4APQD 3EHBD 4EN3C 1MY7A 4AEFA 1AFVH 1JMZA 4L9LC 3LEYH 3P4NB 1AR1C 4QYOB 1F4WH 4HFWB 1J8KA 4HUMB 1RZ7H 2Q3AA 1T83C 4FQ2L 3IRPX 3PG2A 4ZO8A 2CGRH 3W11C 3DX8A 4BH8A 4DOHB 1TTGA 3WN5A 5D6DC 5D96B 3V6BR 3KPLB 2F15A 4KUCD 1H3WM 2XXCB 3CFEA 5HGHA 1A14H 4L9DA 2W1NA 3ROLB 3BJLA 2LAAA 1G7HB 2H9GB 5DJCA 3DUSA 1CICD 4NM4H 2CXGA 5EUKB 4K7FA 4MA8L 2Y6SC 4NNYB 3HCVB 3GSOB 4R3SB 2OSLB 4FHBD 5I1JL 5DGQA 1VSCA 4OB5H 1MCWM 2X4RB 1DQQA 1M71A 5KOVC 4O51A 5INDB 5IG7B 3VGDA 2CIIA 2ZSVB 1U92B 4H1LA 2W9EH 3ARDB 3GJFA 1MI5D 1A7RH 3BGMB 4N9GB 1LDPH 5CAYB 4PRNA 1NLDH 3MC0A 2ZNXA 4JFEA 4ODWA 1VACB 5L6YL 3BVNA 4M03A 4XPAH 4TN9A 3JTSB 2Q86B 4HIIA 3GK8H 2GJ6E 4RGMC 2PW2A 2RCSH 3HFMH 4RFEA 3FOLB 5GZOC 1BVKA 4F9PA 1Q0YH 5I76B 3MRLA 1UWGL 1AGEA 2R0KH 4CU6A 2R39A 1LO4L 3KHQA 3FFCA 1Q9KA 3ARGC 2EE9A 5C2BL 4K7PL 4R26L 2HG5A 3GGWA 1I9JH 4JJ5B 2Y23A 3IJHA 5EZJB 1JWSA 4PY7B 4PGJA 4Z7VA 4OD3L 1QRNE 5A40E 1RIVH 2Z92A 4CUCA 3QUKB 3CVHA 1YEGH 3ROOA 1JF5A 3ARFD 5GGTL 4YAQA 3UTSA 4KKAD 2FB4H 6FABH 5BZDA 3STZB 2OZ4L 3VFNA 4Z8FL 2PR4H 3T4AA 3IT8D 5DA4A 4R0LC 4UV7H 2H1PH 4HWNA 3AAZB 4CU8A 4QRPE 3MCKB 4L4VD 4G8IB 2H41A 1QSEA 4QWWD 1CDBA 3ZDYE 4JG1H 4NJ9H 3W5NA 1NGQH 4F9LA 1YQ2A 3WIHA 1HKLH 4Y19E 1HOCA 2B1AL 2OI9B 1IGJB 1T66C 2R69L 5JPNB 3U7WL 3SN6N 3MRKB 3SE3C 5IV2A 4NKIL 3P0YL 1CIUA 4ESKA 3SKJH 5DQJA 5IF0B 4CKVX 2ITDA 1FNGA 3X13B 3R1GL 2VN7A 5SV3A 2ADGB 4CDGC 3HR6A 1MFAL 3O3AB 4AMKH 3VCLA 1S9YB 4N5ED 1ZLVK 2OR9H 3EYUH 4EBQH 4EDXB 5C0AD 4WU7A 2WLZA 5FECB 3H9SB 3FO1A 3FFDA 3O11A 4OD2A 2NY4B 4UQ3B 1NMAL 2AKRA 3DGCR 2P5EB 4JKLA 2X4TA 4K9EC 4UILH 3AREC 3MOAH 5FDWB 4OUUB 5C0BD 2PW1A 2OL3L 5T33L 4ZSOE 5GGVY 4MSWB 3QRGL 4MX7A 5FB8A 1OGAB 3V0AC 1UM4H 1CTOA 2NX5E 1HN1A 1OF2B 5HYJB 3AFLA 1CU4H 4U0RC 1FSKB 1EO8H 1QZ1A 1WBXA 1OAKL 1BVLB 5LGJA 3ZHDA 5IVZA 1X6LA 1C7TA 4J4PA 5F6IC 4AH2B 3A6BL 2WWMC 4YEFA 2CMRL 5L8KB 4FQPA 4MAUH 4PJ8B 4NT6A 3DX6B 1JV5B 3GJEB 1U41A 1MFDH 2VLJD 3UPCA 5C07D 3V4UL 1NDGB 1OM3H 4B7LA 5SWQB 4M7KH 4Q9RH 3QXWA 2P49B 4YHMH 3S36H 1LHZA 3FT4A 1N0XL 3QQ3A 5D2LA 5CS7A 2ICEA 3G08B 4XCYB 1F4YL 1FG9C 4GKSA 1UQSA 4F7TB 1FDLH 5I18L 3BH8B 3DOSA 4ZUWA 1TCMA 2QEJA 4XNXL 3A67L 5B21A 3DSNA 3B8SA 5EO9B 4MYWB 1W72H 1R0AH 5D1XA 4LCWE 2WUBH 1V3KA 4KROC 1JI1A 3T1FB 2ZPKL 5IEHA 5JIKA 4ORGA 5JDSA 1IILE 3L1OH 1FC2D 3EOAA 4X6FA 3VXQB 1J5OL 4WEBH 2F54E 3O0RH 4ODHL 2OXHA 5CKAA 4M6NL 3QULA 2Z8RA 3JUZA 3ZE0F 1A6VH 5C09D 5C0DA 4WO4C 4U1HB 2WZPD 2NXYD 3E2HC 4I77H 2GUOB 3X12A 5GS1C 1SJHA 5B4MC 4KI1A 1IQWH 2VERN 1OCWH 5D7SH 5GGVH 2JIXA 1NJ9B 1UJ3A 1G0XA 1HHHA 1VFBB 4G80B 1HQRA 1KCRH 1NKRA 1OAUL 5KSVA 5M94B 3GMMA 5DSCB 5IQ9B 1ONQA 4C58B 5KG9A 2OMBA 1E4WL 1U3HB 3MRIB 1H8NA 4HS8L 4QOKA 5C1MB 4XWGH 2HJFB 3O45A 1LNUA 3F5WB 3ULVL 2MPAH 5GSVA 3MACH 1BQHG 2F74A 4G42A 4W4OC 3SGDI 5K9JL 5IM7A 1I3GH 3I02A 3MZTA 2HKFH 1PEZA 1MPAL 4LU5H 1CLYH 2A1WL 3V7MA 3WDIA 1QR1B 2C26A 3P4NA 4HS3B 4LCYB 4HFWA 5GGQH 2YD5A 3Q6GL 1JRHI 2VDQL 5F7UA 2F5AH 2IWGA 3B2VH 2VNCA 1RU9H 2AV7A 5F1SA 5L2KB 1JP5A 4HLJA 2J4WL 4OM0L 4KQ3H 4CMHC 1MIMH 2XZCL 4LKCB 4OJFL 3PE9A 3ROLA 3C60B 1FNSH 1Y0LA 4C56E 2OCFD 5C9JA 3WUWB 4H5SB 4ZO7A 5D1QC 1I1RA 5KZCB 5T1LB 4XP6H 4XMPH 4Q2ZB 3MV9E 1RZJH 4BM7A 4P4KB 4XGZB 3GSOA 2OSLA 3S96A 5CP7B 4BELD 3Q5TA 5IB5B 2X4RA 2Y7QB 3CXHJ 5IG7A 1YY8B 4MZ2A 3QI9C 1AR2A 3PWPD 2ZSVA 4FQIH 1U92A 3ZT7A 5I15H 4Y1AD 1MFBH 3BGMA 3GB7A 4HFUH 1N7ML 4W70A 5JW4Q 4XX1E 4UIKH 3TO4C 4LHJB 5C0IA 1VACA 4FZ8L 2UUDK 1NDMB 3JTSA 2Q86A 4UIMB 4XXDB 4U1KB 4U1IB 3QIUB 1JZ5A 2I5YH 3IDMA 2UZIL 1XZ0A 2XKNB 3QG6B 1ZVHA 4EEEA 3D39D 5I76A 3D18A 1DTUA 2X70B 1EZVX 3THML 1BPVA 1VESA 1UYWL 1DDHB 3V6ZA 5IFAL 1T1WB 1F58L 5GS2D 5I1GH 4MNHA 1M05B 2LQRA 4XWOC 5TE6L 1QSFB 5D71H 2QSVA 5JW4N 1C5CL 1U8MB 4GRLC 4OF3A 5L8LB 4P2QD 5FYLL 2DS4A 3S5LG 4K8RL 2GCYB 5DUPL 4QT5A 4JJ5A 4YZFE 5CBAB 1DJSA 3WFBH 3QDMB 2Q76A 5EZJA 3QDGE 4PY7A 3MROA 3ARVA 4Y2DA 4DQOH 3UTOA 3FHQA 3P0VL 1CD8A 5DJ0A 3ZE2F 5CZVL 1NEUA 3QB7C 4IDJH 3KR3H 2AI0L 4Y5VB 4XBPA 4YH6A 3RWDB 1PVHA 4OCMC 3STZA 5EU7E 5IOPA 4QRUA 1JPSL 3F8UB 1GHFL 2MQ3A 3NIGE 4S2SB 2DWDB 2JCCB 4MDJA 1WAAF 2J8UB 5DC9B 5HYSA 4M1DH 4JQIH 2W9DL 3MCKA 5C0RH 1I8MA 2AS5M 4Z95H 3MV7B 2VDKL 1MJ8L 4GT7A 4I2XB 1MHHA 3BKJL 3EYFB 4N0UE 2P45B 3AS3A 4OQTH 5CMAB 3SE9H 1C5BL 1DQLL 4HMEA 4YPJA 3H3PL 2QQLH 1SY6H 2CUIA 1IGJA 5JPNA 4EI5C 4L3AA 4UNVA 3MRKA 4KVNL 4NBYB 4NM8H 5ALBH 5KJRL 2EC9U 3S6CA 1QBAA 5FGBA 3HG1B 3L3DB 1YYLL 1MFEL 3X13A 1V7MH 5ETUA 4DCQB 2PF6A 5F7FA 2MTPA 3MZGB 3O3AA 5EORH 1U3YA 1S9YA 1ZA3B 1EJOL 3O4LB 4NHCH 3I50H 1B4RA 5FECA 3H9SA 1EBAA 3DSFH 4LHUB 4MQ7B 1UZ8B 4YFDB 2P5EA 2VMFA 2MCPH 3U0TB 1MRCH 4AL8L 5EC1A 3HMXL 1F4XL 3IFPB 3O6FB 1N5AA 4OUUA 3TIEB 1UCBH 2RB8A 4ELKA 1ZGLA 4KRNA 2FATH 3BX7C 3OZ9L 1S78C 4NZDA 3HE6B 3HUJF 2A2QT 5HYJA 1J1PL 5MP6H 1S9XB 2BSED 4PGCB 3GI8H 4NZTL 4M7LH 3CPLB 3CLEH 3G6JE 4RFNB 1JJUA 2Q7YB 2VKXA 4KK8D 2HVKB 4NDMB 3ZKXC 4AH2A 4HCRA 3DUUB 4KHXH 3MREA 3OAUL 2C4FT 5AYQA 4PJ8A 3PHQA 1T5WB 4U7MA 3UYPA 1JV5A 4X6DE 3TN0A 1U2CA 2YPLB 2CR3A 1U8JB 1NDGA 2VLMD 4J3XA 3QIBB 5EIVA 1QLEH 4MXQD 4QXGL 1NBZA 1Q9WB 3TEUA 2NMSA 3WHXA 1DBAH 4YIQB 5FGCE 2CDGB 2RGSA 3O2VH 3G08A 5F7EH 1X5GA 4UUJB 4IM8A 3QXUA 4F7TA 1YNLH 2I60H 1UWEL 2F19L 4MJ6A 2EZ0D 3OBAA 3DETC 3OR7B 4LSRL 3S35X 2EXYD 5E94A 3V0VB 4P3CL 1VKXB 1RZJC 3AU1A 3T1FA 3P9LB 1LVEA 5EBWB 2YEZB 1MNUL 4LLVA 3M45A 4XPHH 2BVPA 2XT1B 3WS3B 3VXMB 5SX4I 4RDQF 1JBJA 4PG2A 4AYFA 3IJSB 4PJFA 5I30H 2NXZB 4U1HA 2H2PD 5I8OH 5GGTA 4R2GC 5ADOH 3MOBH 5IROC 5FKPA 5FYJL 1Q9OB 2B5IC 4NO0B 4M7JL 2X4NB 3ESUF 2GY5A 1KCLA 1EEZB 1VENA 3KS0H 2VDLL 4MNQB 4KI5D 4O5LH 3KHOA 4GAYB 1DSFL 1RUAL 1U93B 3Q48A 1VFBA 4G80A 1L6ZA 3MJ9A 1Z6JT 1LEIB 3FFCD 4M9PA 2DQUL 5B8CC 5GPRA 2AERT 4GMSH 5DSCA 2A9NH 3EFDH 5IQ9A 1PKQB 1Y6NR 5LGKA 4RRPA 1U8PA 2APXA 1ZKAA 3MRIA 3EYOB 4LLWB 3DO7B 4A6YL 3UZVB 2HJFA 2WBKA 2ARJB 2BJML 2NTSP 5J12C 4JM2C 2CO7B 3QJHA 1R5VB 2HRPH 2DQIH 3P73B 4EIZC 4LSVH 1GGBH 3UTSD 5F9DC 3MLYL 4LRNH 1DFBL 3T3PF 3CZJA 4MAYC 1QR1A 1GOHA 5D7KE 1UGNA 4HS3A 4LCYA 2NZIA 3ES6B 3FT3A 5IFHL 1PZ5A 2X4SB 3V4VH 2Y72A 5FUOL 4QHNA 1UKTA 3UYRH 4M43L 1KEML 2OYPA 1KPRB 3NAAH 2W0FB 2A38A 1QSED 1EGJH 1AD9A 2D4FA 1MUJB 3DMMB 5DWUH 9CGTA 4OZHF 2VB5A 3ZHKA 4LKCA 2XIDA 5DK3A 4JN2B 4PRDA 4WI7A 1NEZA 3QUXA 2VDMH 1V3MA 3C60A 5C0ND 4JRXE 1S9VB 3LKQA 3MFFB 4H5SA 2EKSB 1J12A 1X9QA 1NBQA 2B20A 1OQOA 4YHKL 4Q2ZA 4Y5XB 3VGGA 1DQMH 1KFAH 4PJXE 3BKYH 4WIQA 2DBLH 2R4RL 4GMTL 1H3PH 2NZ9C 3NCCB 3TFKC 3RWEA 4RAHA 5IB5A 2Y7QA 3G6DH 3ZO0A 3G9VA 2IGFH 4YX2L 2BVYA 1YY8A 3NGBB 2V17L 3O6MH 1HINL 4PJDE 1V8HA 5IIEA 1RZKH 4UU9A 4ZYKA 2GTWA 4FQJH 2P8MA 5IFJB 4GAJH 1IM9A 4PJBF 4LPYA 4BSJA 4MMXC 4FQ1L 2FX9L 3ARWA 4NFBA 4X7SH 5K93A 1OAZH 1NDMA 3KPSB 3G04A 5EZOL 4UIMA 1B6DA 4XXDA 4U1IA 3QIUA 4GRMB 5DC0A 4YDVB 2X09A 1FVCB 1A7OH 3LDBC 3RHWK 1T04B 3SHSA 1J10A 1IAKB 1ZS8B 3CFJB 1DDHA 4XNZC 4BA8A 5BV7H 3IDXH 1RZIB 4ZUVB 3U4BH 1HNFA 1T1WA 2JB5L 2VZOA 3D69A 1C16B 1M05A 3N1QC 3S36X 4X7FC 1JTOA 4J4PD 3PHSA 3QZWA 5HI3C 4AT6B 5F7HA 1G7LB 4JCMA 5I1KH 3O8XB 2GCYA 5CZXD 3GBNH 2YK1L 5AD0B 3ULUD 3IU4H 1KTDB 1S9KC 4QHUA 3MODL 5CCKL 3QDMA 4K94L 3MLUL 3Q3GA 2CK0H 2VO5A 3O6LL 3VA6A 1UEMA 4UDTB 5GGUB 3T65B 4YXHH 1L7TH 5K9QI 4Y4KB 5DJXB 3RNQB 4JKWA 3NIFF 3BN9D 3RWDA 4KFZC 1A4JB 3QHZH 5J57B 4S2SA 2W91A 3MJ7B 5D1XD 2DMCA 4AJ0A 3VFMA 5L7XH 2DWDA 2ADFL 2J8UA 2JJTA 4DTGH 4D9RE 4MD5B 2DMKA 4JB9L 3UJIH 5DJ6A 1E6JH 3WSQH 4I2XA 1IC7H 3DO3A 4UAOB 5E9DE 5CEZD 4OF8A 2A77H 1CD0A 4LAQH 4LBEB 1PGRB 2E7BA 3PABA 1U95B 3BPLC 5ILTH 3GM8A 2FO1A 3QUML 4HIHA 4JFQB 1N2RB 5I9QB 5JOFB 3QG7L 5JXEA 4XXCA 2IC2A 5KVDH 2BXZA 2AEWA 3HG1A 3V0WL 1F3JB 1DE4B 2JIXD 4FTVD 4DCQA 4YBQC 1AQDA 4ZUUB 2D7TL 4M62H 2MWCA 4MA7H 5I71B 3RZWA 1BZ7B 1ZTXH 2VWEC 3RU8L 3HKFA 5IT2L 1KXTB 1UZ8A 4ZO9A 3ETBF 4QOKD 1FGNL 3PJSB 4J8RB 1X7QB 4BUGA 3U0TA 3FOMB 3IFPA 4HF5L 3TIEA 4TQEL 4OTXL 2X7LA 4OKVB 1DZBA 5E6IC 4N1EA 5JXAL 3VD9A 3KLSA 4HXBL 3HE6A 4WWKD 2FWOB 3WS6C 4OLYL 5BVPH 1XMWA 25C8H 1S9XA 4H26B 3BPOC 4J3SA 4PGCA 2Q7YA 3SE4A 3LEYL 4LAJH 1CFTB 1F4WL 2QJDA 1HXYA 1T2XA 2A83B 2NW3B 3ALWA 1N8ZB 1RZ7L 5C70A 3DUUA 4PRBB 2UY7A 1NGXB 3IU3A 1T5WA 4FFWD 3TT3L 2CKBA 2CGRL 5DD1H 5J3HD 3MRBB 2ZWLT 3RWHB 3C08H 1X5XA 4RMVA 1U8JA 4WU5A 5D7IE 3QIBA 3HLAA 4RGMB 4WUUD 2RFXB 4NZUH 3MO1A 3UZEA 3OWEA 2EIDA 4ONHB 2GIYA 4TVPH 4WUKH 4P4RB 5JPMB 3C5ZD 1KN4H 1A14L 5C0CB 4UV4H 5T5FL 1WUNT 4K3JH 1N59B 3ARGB 4BUHA 5HPMB 2NY5C 4JKMA 4NM4L 4UBDD 3O9WA 4WEUD 4NKOB 3CFDB 1JFQL 1MJUH 1Q94A 3OR7A 3WBDA 4WFFD 4ELMA 1VKXA 2LU4A 4OB5L 1WFOA 4WHYH 5TF1L 3OKOA 2NQCA 5EBWA 2YD9A 3I75B 2YEZA 3U46B 1PSKL 3WS3A 4DFHA 3PDDA 3HB3D 1A1OB 1KENH 1JZ3A 1WIUA 2YBRB 1LDPL 4OAWB 2VXSL 1TZIB 3RUGE 1NLDL 3I2CL 4ZNEE 4CL7A 1D9KB 1TQCB 2X4OB 2HN7B 4LOUD 4NO0A 3N0PB 4R0LB 4XPAL 4JFFE 2H45A 1CGYA 3QXTA 1EEZA 2ED8A 4IJ3C 2AXFA 4MNQA 1NFDF 3ZKSD 1A7PH 4RISH 4GAYA 3HFML 1DBMH 3NACH 1KUMA 1Q0YL 1LEIA 2E7LC 4G6AD 1JPTH 2PXYA 2K1MA 1NUFA 2HTLD 2R0KL 3PXJA 3LRSA 4GBXA 1WC7A 4NIKB 5GHWL 1A3RH 3EYOA 4WFEE 1I9JL 3BE1H 4Y2DD 3MUZ1 2GFBB 3JV0A 4X9GA 4ZXBC 4N8VA 4JGJA 4X98A 4C57C 2OTUA 3RWJB 2AK4B 3P73A 5GRVK 3SDCB 1RIVL 3RY6C 3BP6B 2R2EA 5DJZB 3VGBA 5JR1L 4KGLA 2O5ZL 2YD6A 5E1AB 2FB4L 4UOW1 3QAZB 1PKOA 3I6KB 2X4SA 5BS0B 4F2MB 1D5XB 5H37H 2PR4L 4X99B 5HJ3A 4UV7L 1KPRA 2H1PL 1BJMA 3Q5OA 2VH5H 5FO9B 1FIEA 3BT2H 1QR4A 3OKKA 5HHXH 1MUJA 3DMMA 4GG6E 3RVTC 3BZ4B 3HMXA 1MAMH 4YR6A 2H3NB 3QISA 1NGQL 4DKFH 4JFZH 1S9VA 1A1NA 3TCLB 3MFFA 4GJTB 2NY2B 2APTA 5EU6A 4Y5XA 3OKDA 1HKLL 4NQXB 4JFXB 2EEDA 1YYMH 3BHBB 5F6IB 5C0EA 1B2WH 2V9TA 5KSBF 4PRIB 2KQMA 1PY9A 3GDBA 1UM5L 4WGWB 3SKJL 3LOWA 4PP1C 1FIGH 1BD2B 1LO5B 3KAAA 5MEQA 1FFNB 1JGLH 4FXKB 2VR9A 3GBLA 2ESVB 1FZOA 5JOPD 4QHMB 3ULVF 3MV8A 4AMKL 3H9SD 5IFJA 1JYVA 4KZEH 3HMWH 5DJYB 3QHFH 1Z3GH 1E27A 3MXWH 4LVNC 3CU1A 4EBQL 5D2NC 3RAJH 2P5ED 5SX5H 4ZPTB 2BOCB 3QCTH 1DANU 3WLWC 2DI9A 4PFEA 4KGJA 4UILL 4GRMA 3MLSL 4ODSH 4YDVA 3MOAL 4LRIC 4JFDB 5A2IH 1VFMA 5HYJD 1T04A 1WISA 1MI5E 5DD6B 3CFJA 3DXAB 1UM4L 3ILPB 1RZIA 2NY1D 4ZUVA 3P11H 5ID0B 1U8KB 2YMXH 1CU4L 2D0HA 4GRWH 1EO8L 2VLKB 3L3KB 4AT6A 2VXUH 1CS6A 4PJ8D 5FO7B 3ZKMC 3TN0D 3PP3H 3E2HB 3QNYB 1NUGA 3NCMA 5GS1B 4I3SH 4NQSB 3DPBA 1S5IH 2XTJB 3RVVD 3QP3A 1MFDL 5GGUA 2IBBA 3T65A 3ZT5A 3TPUB 4MJ5B 3EO9H 4M7KL 3NA9H 3SO3C 1MCRA 5K9QG 2DYPB 3VFPB 1XGTB 3L3IA 5FF6B 4I18B 1Q1JH 5KS9A 1YNTB 3MJ7A 4PB0H 3GIZH 4WI6A 4JRYB 4NZRH 5LXGH 4MD5A 1KELH 1WITA 1RUMH 2WUBL 2OK0H 1IAIH 2ED7A 4F8QA 2G2RA 4DAGH 2EC9T 2FL5B 3LKPA 1D6VH 3L1OL 3RBSA 5CLTA 3H2WA 1QO3B 3O0RL 2V2WA 4WEBL 4EN3A 4HAGA 1A6VL 5IK3B 5IB1A 4JFQA 1FL5A 1RJCA 1T83A 3BDYH 1J9CT 5JOFA 1XF1A 1PBYA 1HNGA 5IJKC 2IPTH 2Q3ZA 4L4VE 3UTZA 3SDDC 1EXUA 3ECBB 1F3JA 5IBLC 1T3FB 5D6DA 1IQWL 4CMHB 4ZUUA 2CK2A 5GGVL 1AY1H 1XF2B 1G7JB 2VLLB 2EDTA 2ZUXA 2I24N 1BZ7A 1SMAA 3WJJC 5BXFB 4AIZB 5EBGA 5BJTB 1P7QB 3PJSA 1A9BB 3ARBB 1KBGH 3MR9A 4RBPK 1X7QA 2VITB 1FFQA 3FOMA 1ZVSB 2XOTA 3PF2A 1RUKH 5EU5B 2ZP0T 2X42A 4O58H 2YD2A 2AV1B 1NGYB 1X5FA 3MACL 3QI9B 3BD3A 3EOTH 4XNQB 4H26A 3U36B 5C0AE 3S3SA 2DRUA 1DCLA 2COQA 4NKDB 1CLYL 1K3ZA 2PCPB 4G7YH 1M1SA 3QDJB 4KDVA 3CUPB 2ICWI 3LIZH 5GGQL 2NW3A 2VDPH 5EBLB 5KTEH 2F58H 2VABB 3OR6B 1TETL 2F5AL 4PRPA 5C0BE 3B2VL 1FFOB 3MRBA 1TCRB 2L7UA 3P9WB 1QQDB 2XFXB 3F7YB 5CIPH 1MIML 4OGXL 3QUXD 4ONHA 2VZ1A 4U2YA 5I1AB 4LP4A 4X9IA 1G0YR 1TNMA 5JPMA 2MQCA 2DLIA 5C0CA 2E9BA 1D5MB 4PJBB 1FNSL 1JK8B 1EEUA 2VR5A 1N59A 1LO3H 3ARGA 3LQAH 5EPMB 5HPMA 4GRLB 1CGWA 4LARL 1WFUA 4XMPL 2CRMA 4I0KA 5I75C 1BQHB 3WIFA 1QHOA 2VLJE 5C07E 3VE0A 4JG0H 5DTFB 5TFSL 1IQDB 1DVFD 1GXEA 3JWDH 5FUZH 3I75A 5E8NB 3U46A 2DJ4A 4E5XA 1A1MB 3MRQB 4FQIL 2CLZB 3F62A 4OCXH 5I15L 1IM9D 3FQXB 1MFBL 3NZ8A 1A1OA 5IBTL 5CD5D 4HFUL 2YRZA 2YBRA 3R8QA 1TZIA 2H32H 2JJUA 3ARSA 4UIKL 4LVHC 1G7PB 1D9KA 1KT2A 1CXIA 1MH5A 4AG4H 5GGRB 4H0HB 2X4OA 2HN7A 4HKZA 4R0LA 1MHCB 3QIUD 4KMQA 3MRHB 1TJGH 5J1SC 1XF5A 3CK0H 3VXSB 3V7AE 4EOWH 1RAMA 2I5YL 5JZ7D 5DF0A 3PHOB 3OQ3B 5E03A 5LBSL 3IDNA 2XN9B 4OZGF 1PYWA 4YJZL 5C09E 4DK6A 2W65B 5I1GL 2DN7A 5D71L 1GRWA 2D03H 3L7FA 1RI8A 4CMMB 4EI5B 3SE3A 4BQCA 2W9LA 5D93C 4JPKH 2GFBA 5E5MB 3WFBL 5ANMB 2P8PB 4HGMA 4GO6B 3EJYC 1YPZE 3HZMB 4NQTA 4DQOL 4PLKC 3RWJA 4G6MH 5KBNC 3S37H 2EECA 1YEFH 2AK4A 3SDCA 1K4CA 2OMNA 5FHBH 3ZKND 3BP6A 1FVEB 4M3KB 4FZEL 1HYSD 2DQTH 4IDJL 3KR3L 4HS6B 3IDIA 5BS0A 4FMFA 4DUVA 4X99A 1X6NA 4M5YH 4YHOH 5SWZA 5K33A 4OI8A 3AREA 4OCRL 3UJJH 5FO9A 4JQIL 2VJXA 4Q9CA 5C0RL 1ULVA 1JGDA 3BZ4A 1YEKH 3QWQB 2BSTA 1TJHH 1IAOB 4PY8J 1TZGL 1NGPL 4K55A 4KKNA 4R7NA 3TCLA 2AVGA 3S5LB 4OQTL 3SE9L 4Z7WA 2QQLL 4NQXA 1SY6L 4JFXA 5JXED 1LO0H 3OGCB 3BHBA 3MBEC 1KC5H 4KAQH 4JZNB 3U30C 4POZC 3L3JA 4NM8L 5ALBL 3K2UH 4LCUB 4KV5F 3PGCA 2G75B 3IDYC 3JWOH 2JE8A 1LO5A 3NZHH 5CBEB 1V7ML 4Y89A 1FFNA 3B43A 4M3JA 4FXKA 3N1MC 2ESVA 4NSKB 4QHMA 3QNXB 2CRYA 5EORL 1OAYH 4CVWA 4U3CA 1B0RB 5JMOC 2Q6WA 3I50L 1RSFA 3TV3L 4YK4C 3DSFL 5ECJE 4OZFH 4ZPTA 2IANB 3B83A 3ZYIA 1IGTB 3MLWL 3GSWB 1MRCL 1CFQA 1LE9A 2QHLA 3TT1H 1U0QA 1UCBL 3PWPE 1QFUH 4JFDA 2NW2B 2FATL 3P4MB 3RY4A 4XP1L 4Y1AE 5DD6A 1U8NB 1WCQA 5KSAC 4TULL 4NQCA 2I25N 3ARXA 2ED9A 4XX1G 1ITCA 5MP6L 5ID0A 1JF1B 1U8KA 5HD8D 3CMGA 4M7LL 1Z0MA 3ZYOA 2VLKA 3HZKA 3CLEL 4R96B 4WO4A 3REVB 4MVBD 4R2GB 5I1DB 2J7LA 3BUTA 3VXTB 3O2DH 3OKLA 3QNYA 4G9DB 4KHXL 5GS1A 2B5IB 5EOTB