3ZKXB

Ternary bace2 xaperone complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
111
structure length
111
Chain Sequence
QVQLQESGGGLVQPGGSLRLSCAASGFTFSSAIMTWVRQAPGKGREWVSTIGSDGSITTYADSVKGRFTISRDNARNTLYLQMNSLKPEDTAVYYCTSAGRRGPGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-SECRETASE 2
publication title Mapping the Conformational Space Accessible to Bace2 Using Surface Mutants and Co-Crystals with Fab-Fragments, Fynomers, and Xaperones
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 30
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2013-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zkxB00
4X99A 4Q0XH 3S3JA 1FZMA 5C9JB 4P4RB 1IT9H 3DYPA 5JTWA 2DAVA 3VDAA 4UIMA 1EXUA 2C3VA 3SDAC 3TIDA 1NDMB 1YN6B 1XGUA 4GG6B 4MJ6B 1HQ4B 1NGQL 3CMOH 1A1NA 3VD9A 4XNQA 1BQHG 1SHMA 4PJFE 1IM9A 4D94A 1FNLA 4G5ZH 4X7TA 1ACYH 3UYRH 4OZFH 3FB6B 1U8JA 3KPSB 3TC9A 4OZHF 4YAQB 1YEIH 1MHHB 5HYQB 4BFIA 4F7MA 4LVOC 1IRAY 3WFBL 3Q2CA 2XN9E 4C4KT 2PTTA 2V7HB 4PP1D 5A1AA 3V52H 2YUZA 5CJ5A 2XY1A 3HE7B 4JFDB 1KBGH 2FJGB 3EFFB 1CE1H 1AP2A 4F9PC 4DUWA 5JXAL 1DBML 5C07E 5L88H 3BUYB 2ZCLH 3HE7C 1Q94B 4D0BB 2UV3A 3LPWA 4U05A 4Q74A 15C8L 3K2UL 4WFEE 5B4MD 1INQA 4AEHL 2DJUA 1RQ5A 1OAZL 3HB3C 5EUOA 4HCRH 5F9OL 5GS0D 4N8VG 2EH7L 3VWJB 3QHFL 1IVLA 1MCOH 4HWZB 5BV7C 2VDPH 1NCTA 1CWVA 3MLVL 3SDCC 4PJHB 1OGTB 2XQYK 2RCSL 1FAIH 3MGTB 3P9MB 4L3EB 4LKXA 1YYML 1N5YL 1HQRB 1G9EA 3QI9A 1GZQA 2LV4A 4NPYB 1A7OH 4LHQB 4PRAB 2F58L 4WNQA 4PGCB 2XTJB 3Q3GA 2WWMC 3EFDH 3HMXH 4LSDA 1HYRC 1RHHA 1WBYB 5C7XH 2NMSA 1MPAL 5ITFB 3GJFA 2YK1L 4KI5F 4P46C 3KYKH 4GUPB 3UTSB 1RAMA 5DRWA 5K9JH 5FDWA 1ZLVK 1OSPH 1UXWA 2NY7H 4K7PH 2FGZA 1U2HA 1X5FA 2VXVL 4Z7NE 1FZKB 1OTTD 3D9AL 4QEGA 2XWTB 5T1KB 1MREH 2R4RH 3C5JB 5FYJE 1U8KA 4RGOL 5ADPL 2NZ9C 2WP3O 3VCLB 1CU4L 2EKJA 3GHEH 4XRCA 1ZTXL 5EOQH 1A6WH 1G1CA 1UZ8A 2CR3A 4Z0XA 5CEYA 3C2SA 1RJZA 5C0BB 4KI5C 4GRLC 1BD2A 2OMNA 4JPIA 3GMNB 5BJTB 5ISZE 2VZVA 4GMTH 5DEFB 1WV7T 3U7WL 4ZXBD 1N8ZA 1BVLB 4RAHA 3DVIA 1GAFL 3TNNB 2AKRA 3U0WH 1CT8A 5AYUL 1HSAB 4DUVA 1X5HA 3REVB 4NO0D 2OTWB 3TN0D 1LEGA 4ONOA 1ZVHA 2AQ3A 5HHQB 3T04D 1R3JB 4FQXD 5DLML 1CGSL 3IETB 1F3DH 1H9VA 3H9SB 3RWHA 5I30H 4MA8H 2APTA 1DN0B 3ARGB 3BEWA 4IEFB 1U8PA 2XN9D 5H37H 5GZND 1A7QL 4HPOL 1MY5A 1RVFH 4QWWC 3W9DB 3ULUC 1OY3B 4X6DB 4WW2B 1T89A 1DTUA 4YFDB 1NC2A 4Y5YA 5C07D 4YNYA 4NM4H 4URTB 3C5SB 2EE9A 2Z4QB 4LSVH 1A2YB 3U4BH 1RU9H 5F7WC 5F7YC 1NLDL 4ZOBA 5FCUL 3RY4A 3QIWD 2ADFH 4N5UA 2OP4H 4P57A 4MMXC 2QQQA 3MLRL 5F7UA 2XTLA 3TZVA 1BFTA 3VFSB 3ZHKA 4ZPTA 5E24E 2Q6WB 5C0AA 4X4XB 5DDHA 1N2RB 1DQQA 3FO9B 4YZFE 1P2CB 4NJAL 4XHJC 1UQSA 4U1LB 3FTGB 2PXYA 3OAZH 4NNYB 1IGMH 1ZT1B 3EYVB 1YJDC 1JNNH 4F7PA 1PLGH 4GQ9L 5DMIL 4JFOB 5JMRA 1FNSH 4IMLB 2HTKD 4HT1L 1DQDL 3RU8H 3MYJA 5A2KH 1YEJH 4PJBA 3TO4D 1U3HB 1BZ7A 3DX6B 4PP2B 2VUOA 3D1MC 43C9A 1CBVH 5JOFB 1H15B 1JK8A 3HCVB 3QIUD 2MKWA 4L4TA 2UYLB 2DBLH 1EGJH 5DMGD 4MAUH 4Y2DA 3K0WA 1OB1B 4I0CC 3HUJB 3BSZL 4U3HA 1MNUL 1K4CA 3QEQA 2X4UB 1I3VA 4GLRH 4TSAH 3WCYA 2QQKL 5GSRB 1GPOH 4P0DA 5FYJD 1L6ZA 5E8DH 1BZ9B 1IAOA 2GJ6A 5TE6L 2VISA 5TDNA 4LNRA 5CEZH 1JRHH 2W9DL 3L1OH 4X7FC 1A7PL 1GC1C 2NY2B 4DKAA 4N8CH 4WEBH 3Q1SL 4P2QB 4UTAH 2WANA 3MXWL 2FO4B 4OF6A 3THMH 2F53E 4JY5H 5DJZB 5C8JA 5JR1H 4U33A 5E6YA 4Y1AE 1I1FB 1P6AB 4NQEA 5ISZD 1ZLSH 4NZDA 4JY6A 4PJBF 5IBUG 4HH9B 2RFXA 1NCNA 1R24A 2JELH 1X5AA 3OKEB 3PP3K 4XP1L 5E5UB 5FO7A 3L7EB 3OTTA 3VJ6B 4GMSL 3L3DB 4KTEL 5MERB 3N0PB 3LCYA 1HKLL 2OXGA 3L9RB 4PTTB 5GGRB 2GJJA 4DGVH 3LH2H 4YBHA 5DD5L 4KKAC 1LP9B 4PRPE 1JL8A 2X89D 3CVHA 3HE6B 4HBCL 1F2XK 3C5ZA 4ETQA 1ONQB 2HYMA 3EO1A 1WISA 2G5BA 2H9GA 5F3BA 3MCLH 4OBSA 3BHBA 3IYLW 3SKNB 4P2OB 1WBZB 1UC6A 4NQXA 1N64L 5JIHA 1NCAL 1A0QL 2Z8SA 4JRWA 4UZGA 4OM0L 2EIBA 3H9ZA 2D7PA 4RWYL 3NCYP 4GG8B 5FKPA 4IRZL 2BSSA 3FMGL 3VWKA 1HH6B 1X7QA 2DWDA 5FK9A 2B4CH 1TFHA 1UM5H 1PG7X 4PJXA 1GGCH 3B9EA 2UY7A 2W65B 3DARA 4KMTL 5FUOL 5BZWB 4Y4HD 3MV9E 3IFPA 4XP6L 3SOBH 2DYPA 4HWEL 4NT6B 2AXGB 4EZMA 3GJEB 1N0LA 3TYGL 1UT9A 1I7ZB 2WAHA 3TP4A 2EIZA 4NKOB 1NBYB 3AAZA 4OFKA 1NLBL 4O2CB 4JFPA 2FWOB 1HZHH 3BKML 3V6FA 3H42L 5DK2A 5ID0B 1J05A 1CICD 1U36A 4NN6B 5D7JA 2ZKHH 3WO4C 4OB5H 1JGLH 3C8KB 4XXCA 3QXDB 4RX4A 3ZDXF 3NAAH 2L4OA 4W6WB 3RQ3A 4Z95H 3T8XA 2VDNH 3NPSC 3J8F7 4MNQB 5GGUA 2A2QT 4HK3J 4IRJA 1PZ5B 4I9WE 1S7QA 4OLYH 1T22A 3TJHC 4MDJA 4R26H 3NVQA 3MYZA 1VPOL 1AD0B 1F4YH 2BDNL 3MNWB 5HPMA 2OI9C 3ZL4L 3SO3B 2Q87A 1KN4L 1S78C 2X05A 5FYLE 4PJXF 1CGVA 3T4AA 3RP1A 3IDMA 4PRIE 5T5FL 1WZ1H 3T3PE 3I6LE 1M1SA 2W59A 3P9LA 1DDHA 1IBGH 2Q3ZA 4YDVB 5EOCH 5IEHA 2F54A 2ZOLA 4YIQB 5IFAL 3DX8B 4JFQA 4JM2A 1OAYH 4JN2A 3LS4L 2IBBA 3BN3B 3V6OA 5DC9B 2A6IB 1AGBA 1NBZB 5CZVH 2CDFB 2DLEA 4NJ9H 4XPBH 5C09E 2Y07L 4FZEH 4XAWL 1UB6B 4JEGB 2DQDL 2F53D 3PWLA 4N0UA 5EPMB 4Y1AD 3X14B 4YBLC 3T0EA 3B9DA 5JHDA 2FEDD 5DD0L 4E42B 3REWB 4XTRC 1DFBH 4XNXH 4KDVA 4ZUTA 4QYOA 4EUPA 2I07A 4B50A 3CD4A 3MUHL 3GKWH 2DWEB 4F7CB 4KTDH 1WC7A 5E2WH 1T2JA 4PJCB 2CLRB 2FCBA 1XF4B 4PRPD 4PJ9B 1NCBH 4LP5A 1BQHB 1LDPH 3MOBH 3JWOC 3IDJB 3QEUB 4Y16A 4RZCA 4U2YA 4MA1B 2YD9A 1CI5A 3QDJD 3PUCA 4HKZA 5D7JC 2PYEB 1YEKH 3R4DA 3MA7A 5HYFA 5E1AB 4YDJA 2O5ZH 4U2ZA 5FFLA 4H20L 4JM2F 2Z91A 3MJ9H 4MS8C 1KLUA 4WV1A 3I6KB 3K1KC 3CVIH 4NRYB 4XBGB 2HT2C 2B20A 4JO4H 4KKLC 3RFZC 5IROA 4OFVA 4DQOH 1HXYA 5KTEH 3S37L 4HWNA 4JHWL 5C0CB 2B1HL 12E8H 5D9SB 1NGZA 3HI1B 5CFHA 2VABA 2NY6D 4OGAD 2QQLL 1HK6A 1KELH 3G6JE 3KPOA 1JHTB 4XPHL 5BO1L 4I4WB 3VXSA 4JO1H 5HVGB 1E27A 4L3CA 4DVRH 4GAGL 3FQXB 4HZLA 1JHLL 4DK3A 2R2HB 5BOPA 3W0WE 4OGXH 1UXSA 3BZEA 2ZCKL 1BM3L 1GL4B 1M6OB 4S1QL 3UJIL 1CZ8H 1MVFA 1C5DA 1U2CA 4BZYA 1I7RB 4JM2C 4R4BB 1PDKA 1JZ6A 4ZUUB 4NQSB 3RI5K 3W11D 2GCYB 4KKBC 1EMTL 4I9WD 5B3JE 1JV5A 1WWAX 5KVGL 3TBSA 3IAPA 3GB7B 3RVUC 2HMIC 1KTRL 4HDIA 1K4DB 2H41A 2XWJB 3T0EC 1CD1A 1TVDA 4K8RD 5DJDB 4WGVB 4C56A 5FYLD 3GIZH 2PO6B 5L2KE 5BRZE 4ERSL 2VDOL 4HC1H 5FGRA 5D7SL 2EYRA 4JFFB 1RUAL 2M8XA 4PRID 3CFJA 4XB8A 3HRPA 1EX0A 5DT1L 3I6LD 4XNMB 2IWGA 1YEFH 1RUQH 5IMOB 3FQNA 1ZHLA 2WBKA 4G6MH 4Y16C 4QCIA 2KH2B 7FABH 4M62L 3O2WL 1M7XA 3AS1A 4LLDA 4OZIE 4PJ7B 3ES6B 4GRWF 5EORH 1NGYA 1LEIB 4ODBD 1OCWL 3BIKB 4UT7L 1MFCL 5C09D 3IU3A 1K8DA 1FE8H 4WEUD 3KR3H 5JW4R 1IC7L 4X98A 3QQNA 4FTVA 1EBAA 1N0XH 4OCYL 3L3OB 3OKDA 2ICWB 3KPSE 4HFWB 3MBEA 4DFIA 3V6ZA 5HVHB 2LVCA 3IS0X 5I8EB 1KB5L 3D2UA 4OSUH 2Y36L 5IROC 3SGDH 3MRHA 2ARWA 3IDYB 1FO0L 4KUZL 2Q20A 5EC1A 5DA4A 4BUHA 1QSFE 3EDKA 1FAKT 4U1IA 5FUZL 4LSSH 3Q0HA 1YZZA 4GXVH 1V05A 1GGBH 1FL3A 3D0VB 4EDWL 4NZRL 4L1HA 5E00A 1QFWM 4TNWK 5E94B 3BP4A 1INDL 1MVUA 4RAUB 4NRXB 2N1KA 1G7QB 3LY6A 1EFXD 4U6YB 3KLAA 3RTQB 1AR1D 5D7IB 5DS8B 3EJZD 1CFSB 2YZ8A 4U1JB 3CC5B 1HE7A 2CDGB 3Q6FB 4DN4H 1N3NA 3L95B 3B5HA 1JWUB 2ATPA 3SKOA 2DQJH 3PWPA 4PY8J 1KT2B 4H5SA 2NW2B 5JPNB 5DFVD 1AGDB 4JCMA 4Y2OA 2WNGA 4L3EE 1N5AA 3RRQA 3TCLA 2OX5A 4OAWA 3L6FA 4YR6B 4LPYA 2P5WA 2XTJE 5EO0B 1I8IB 4I0PB 1IGCL 5DMJB 4XVTL 4X9GA 4BSJA 2BOBA 4I0PC 1TPXB 1S9WA 4E5XB 1OGAB 1AXSA 5EFIB 4G6FD 1YPZE 3B43A 3ELAT 4HIHB 5I76B 4R2GB 1OM3L 3UTSE 3W0WD 5EU4B 1CQYA 1IQDB 1L4IA 5D71L 1OP5H 1INEH 3CCHA 2NY1D 4OT1L 2UVEA 3PIQA 3QQ3A 5DI8B 1HYSC 5JHLH 3MGAA 1QPPA 5AZEH 1ZHNB 4JDTL 1GOGA 3AY4A 1Q0YH 2BVYA 5CD3B 2K9UA 3DSFH 2HFGH 5C0RL 2XNAA 1DBJH 4FQCH 1YNLH 1S7XA 5DJAB 3RDTB 3RPKA 2DQHH 1GXEA 4GAFB 2O5YH 5FGBA 2R29H 3B8SA 4IRSA 3P73B 1AD9A 4Z7VE 1DSFH 4KH2A 3T0XA 4HJ0D 4BH8B 5ICZA 5L2KD 4P59L 1RK1B 25C8H 5BRZD 5BMFH 4TNVK 4TYUA 4MQTB 2Q8AH 4QHKJ 5C0BE 3SN6N 1E28A 4JJ5B 5FECA 3T1WA 4Y4FD 5JZ7C 5CP7A 4NNXB 1K8IA 3HS0A 4PB0L 3WNNA 4MX7B 3SGKA 1AQKL 4V2BA 2KPNA 5K9QI 2BOCA 4HJJH 3U36B 1QTYT 1EEZB 2YSSA 1S7TB 3VH8A 2ESVA 3O11A 3PV6A 5JUEH 1HHKB 1TETH 3RKDD 3HZVA 3FFDA 5MEQA 5HGHB 2CGRL 2VXSL 2ZSVA 1T6VN 1BECA 2PTVA 4LCCC 1FGVH 5GIRA 5BQ7B 3HMWL 1F58L 5EIQA 4M1DH 3KPSD 1ERNA 4QHNA 2ZCHH 2F8VA 4GKNB 1B0WA 2VYRE 2OJEB 4P23A 3BZFB 3O3EB 1Q9LA 1QSFD 4GS7B 1DBAL 4X6DE 2IH1B 3KJ4B 4LDOB 3NFNA 1ZOXA 3EO9H 1L0QA 3RY5A 2BSRA 3QUXB 5F6IC 5DUML 3ZT6A 3Q5YA 4O00A 4OFYD 2AV1A 2ICES 5JA8B 3A67H 3GHBL 3UTTA 1ZT7B 4EI5A 1AH1A 3S35L 1JGUL 5E8OA 1T21A 1OARH 1PG7H 3CDGB 4HULB 4JFXB 3EIFA 1CGWA 1Y6NR 3QG7L 3VWJD 2NNAB 1HDMA 3K7UA 5T1MB 3G5ZB 1PVHA 5DQDH 4P5KA 4BUGA 4WI5A 1X5LA 1AHWB 4M1CD 2F19H 1CLZL 4L3ED 4MJIA 4V1DA 2ORBL 3PWUB 3EYOA 1HOCA 1MRDL 1T80A 3PDOA 3S5LA 5EBMB 4FXGA 1T1XA 4FXKB 2VDMH 3DVGB 5IMKB 1I4FA 2XTJD 1VFOA 2EEAA 4P2RB 1JFQH 2C1OB 4G8FB 4C83A 3DRTA 5C0IB 4F8TA 1EHLL 2FSEB 1TCRB 4N0CC 5HI4D 4KDTC 3OXRB 5GGTH 2PNDA 3ARDB 3WE6A 3H3BC 3O2VH 3UTSD 2VERN 5AUMB 4QNPF 4I48A 1KV3A 3I6GA 3IDNA 4JZOB 1UH3A 1OHQA 1P53A 3U9UA 3NIFE 2EDLA 3DV6A 3MRRA 2NYYC 3HUJE 5I1AA 2JCCA 4B0MM 5K9OA 1CD9B 4RWHA 4YHML 2FECI 3RJQB 1CR9L 2XRAH 5L0QB 4LCWA 2X4RA 8FABB 2V7NB 1YUHA 1HHHB 1D5MB 5L0QC 4UB0L 1U95B 1SBBA 4FZ8H 1UFUA 1WCQA 3HG1B 2OK0L 4L1DA 1XF3A 3V4UH 1FG2A 1UZ6E 2OJZH 2BHZA 4JR9H 5J11C 3QUML 2P24B 4P2QE 3U7YL 3P0YH 1UM6L 5C0BD 5MEPB 3I2CL 5LGHH 2DQEH 5FKAA 1KC5H 1DANU 4K7FA 2X42A 5GHWH 5KVEL 1QRNA 2H6PA 1UGNA 2R1YA 3QUZA 2IGFL 3SGEH 1SQ2N 2DKMA 3C6SB 5D2NB 4M48H 4Q9RL 2XZQH 1U3ZA 3NIDF 4MJ4A 3VFGL 1MIEH 2ICWI 2LU4A 5HYJA 1TVBA 2ATKB 2ZOKB 4TSCH 2WBJB 5D2NC 5GRUL 1ZGLM 1ZANH 2A74B 4Q6IA 4P9ML 5EIIB 5C0NC 1H3GA 1KPVB 2A9NL 5BOZG 3OAZK 3AFLA 1LP9E 4QRPA 4RMTA 2JCCF 3WLBA 1U93B 2ZNWA 2GSGA 4YXKL 3FOLA 1P1ZB 4M8QB 3ARGD 3MRNB 3ZT7A 1D5BB 2ZUTA 4P9HC 4K9EL 4X8JA 1T4KA 1VFAA 1ODAA 3GBLA 5C2BL 1QSEA 1J0IA 1URLA 3QUYA 3ARED 2BCKB 4M6OH 4S1DD 2V9QA 1H3PL 3CX5K 2P5EB 2D7TL 4WW1B 4MHHI 3QDGB 4LLYA 3GSVA 2VLLB 4FQJH 4ZUVB 3KHOA 5J12C 1J87A 4OQTH 3MC0A 3MZGB 3QULA 4YPJA 3FT4B 4NUJB 4WU5B 4HV8A 4CVUA 3KLHC 2E6PA 2WUBL 3B4NA 4OLVL 4HIXL 3CSGA 1Q0XL 4G9DB 1J1PH 1LHZA 2NCMA 3BJLA 2OSLA 3LQMA 2R0ZH 1FNEA 3WKMH 1MOEA 4X6FB 1C08B 2K3TA 2VXTL 4TVPL 4F7TA 1NC4A 4HIEA 3QCTL 1KFAH 3D3VB 3EO0B 1S7UA 5TDPA 2W1NA 2IMMA 1G7HB 5ACLA 3D18A 2P47B 2FRGP 1EUTA 1M7IA 3HC0A 4MNQE 3ZTNH 3P2TA 2AJXH 4OCRL 4KK5C 3S8WA 2RQ8A 1FVDA 4GFTB 1U3HD 4JPVH 4GKSB 3RX5A 5EZLB 4U1MB 3QUZC 2IPUK 1IKFL 5I1LB 3QIBB 1QO3B 1KJMA 2I26N 5BS0B 5A2JH 4KVNH 1DQMH 3F7VB 2GYSA 1G6RL 4MNGB 3W39B 5JNYA 3OAYH 4U6VH 4AEFA 4O5LH 3CUPB 5BZDA 1HEZA 3DUHA 2DJSA 2P48B 5HY9A 2ZPKL 3LN4A 3VRJB 4HKBA 3GO1L 2MFNA 5GSVA 1FRGL 1XF5B 1F00I 5KN5B 1CXIA 2X7LA 2NY0B 4HK0A 1WICA 3B9AA 2NY2D 3TH2T 5L2JB 4ZFZA 1CDBA 4NC1E 4TTDD 2CIIB 2OR7A 4P2QD 1I3UA 4CDGC 1MAML 4WDIA 2QL1A 3ULSA 4J3WA 3VW3H 3OB0H 2QSCL 1BQLL 1MEXL 1A3LH 3NIGF 4H26B 3QUYC 2ITCB 3GMRA 3GGWB 4XWGL 3BGMA 3FO1A 1UH4A 2N7AA 3EOBA 1JWMB 2X4SA 2D3VA 5HHPA 5J89A 1HCFX 3PWJA 2AJSH 3EHBD 3OJDB 3T0BA 2GITA 3SO5A 4APQB 1XF2A 4Z5RA 2P7TB 4PJCE 3G5VA 4Q0XL 3DYMA 4APQC 3HC3H 1AO7B 3HE6D 4ISVB 4UTBH 5DK0A 4BZ2L 2J88L 4NO5B 3DROB 5IHZA 3KDMB 5I73B 1A6ZA 3MFFB 3R06A 4AH2A 1GZPA 1U8LA 1L7IL 1JTTA 2PYEE 3QO1A 5DWUH 5C6TH 1TENA 3LS5H 4P2OD 1UADC 1X5ZA 2IQAA 4FP8L 3O6FB 3ZZ1A 2M26A 3CMOL 4XC3H 4FS0A 3O6FC 2D9QB 5DJXA 3LKOA 1R5VA 3RWEB 3TVMA 2XWBA 5JO5B 2C3GA 4Q9CA 5DC0A 3NH7H 4YHPA 5CD5D 1JUFB 1MHCB 4LSRL 1KB5A 5ANMA 3AB0B 4OI9A 5D5MA 1FO0A 4OD3H 1RZ7L 2JIXA 5EU5A 2BNRA 3WHXB 3ILPB 2JJUA 3UAJC 1T5WA 3DX7B 2VL4A 1FDLH 3WS6C 1MIMH 4MAYB 4YDLC 4LMQI 1G9MH 3LEYL 1CK0L 2A1WL 3MLYH 3JUZA 1B0RA 5HGBB 4ODHH 4IS6A 4NRZB 1NL0L 4ODSH 2NY5L 3WO3B 4I2XB 4R4FH 2JB6A 3SDXA 4HQQL 3EGSB 5C92A 3FAXA 4NQVB 4LARL 2VJXA 4QHUA 3U30C 4MNQD 1MJ7L 4KHXL 1MCOL 3G5YA 2WIIA 1EFQA 5KSAB 5DQJB 4WFGE 2ICEB 3DTXB 5I18L 2IH3A 1XGPB 4CNIB 4OCSL 2IADB 3B9KA 4X0KA 2DLFH 4PPTA 4S1SL 1X4YA 3LD8B 3NGBC 1JGEB 1JPGB 4IM8A 5BV7H 5D5MF 2V17H 4M7LH 3HMXL 1TJGH 4L3AA 1I9IH 4HIIB 2RAMA 3ME0A 1TQBC 1WSST 3OR7A 1QKZL 2PETA 3FO0L 4FHBD 3CXDH 4X5LA 5A3ID 1AI1H 2ZUVA 1KEGL 4I3RL 1DBBH 3FCTA 4FQ2H 2P8MA 3WIHL 5FA3A 3BPNC 3PP4H 3ZKQD 1JYXA 5CJ8A 4PJ7E 1YEEH 5KZCD 2NY7L 3MNVA 3EOYG 4KMQA 3O9WC 5ESVA 4EUPG 4EI6A 3SDXF 2EYTA 4RGNB 1MREL 4XP4L 4ODUB 3PGCA 2VLRE 1KSRA 3TA3C 3D25A 4YQXH 5LAXA 5E6IA 5IM7A 2HT4D 5HGDB 4R7NA 5DUPH 2JTDA 1ZGLB 4F7MB 1QP1A 2EIEA 1G1YA 2NZIA 2DQGH 2MCPL 1PKOA 3OMZA 4XCFL 1L6XA 5DTFB 4PJ9D 5KSVA 3C60A 2VDQL 1HIML 5C0DA 5J9PB 3BP6B 1VFBA 1PYWA 4OCMC 4GMTL 4QRSB 4OLXH 3ZE1F 4OLWL 1QFWI 2EO9A 5KS9A 2PYED 5FAAA 3ZKMD 1W0VB 1MCSA 5JXEA 4X4ME 3WXVH 5ID1A 4WRLA 2BJMH 1X5XA 4MQ7A 3TH4T 1INQB 3KPNA 4NQCE 2ED9A 4CN1A 3OX8B 4UT9L 4BQBA 4EBQL 5I30L 1NFKA 3WKNA 4M5ZL 4XPTH 4XXDA 4YXHL 3J7HA 2W92A 1BHGA 4QO1A 4K3JL 4OD1H 1NUNB 3ZE0E 1ZLWK 1AKJA 4N9GA 2GTZB 5I1DB 2O5XH 3QI9B 4NC2B 2QJDA 5C0EA 2X44D 5C3LD 1OGAE 4AM0A 4CDHA 4PBWD 3CK0L 3Q3GB 3HZMB 4KJWD 3BP7A 5GJSH 5IB5A 3RGVA 3VGFA 4TQEH 1PQZA 3QWQB 1AGEB 5F97E 1I7UA 3M17B 5D8JL 2ADFL 3ISWA 3WD5L 3VXOB 1KPUA 3OGCA 2OP4L 5KS9F 3GJFH 1UXWB 4JAMA 3UPRA 1KIUA 1JPFB 1HI6A 4ZSOA 1OAUH 4RA0C 4M6ML 2IC2A 4MJ5B 1RIHL 5CJQL 2EO1A 4UDUA 4WFGD 4EQ3A 2MJWA 4N1HB 3I50H 3V5DB 3QO0A 2PO6D 2DI8A 1TJHH 5E6IC 1YY8B 1AR2A 2X4TB 5J6GB 4JFFD 5HJ3B 2GUOA 3DPBA 3RU8L 5I75C 2WLYA 3C8DA 4NP4H 4OGZA 2WQRA 5D1QA 1L0XA 3VG0L 5KSBB 5E99H 4R6UA 3C60C 1T1ZA 1D5XA 3KPQA 1S9XA 1UZ8B 1OSZB 3MA9H 2BVTA 1BD2B 1MY7A 4PJDA 1E4XH 1MWAL 1XCTA 5J13B 4N1CA 4HJGA 4J12A 3D0LA 4NBXB 4O2EB 3ZE2E 3RVWC 4U0QB 4PBVC 3JV0A 5INCB 1T20B 2X09A 2IG2L 5FM5O 3H8NA 1PJ9A 2CSPA 4FG6D 1WVZA 4BK5A 2BY0A 5CEZL 4MMZC 1CFQA 3UXFA 4HIJA 3EDJA 3KYMB 4FQIL 4AENB 4X7EC 2WZPD 1BBDL 3QUMA 5D6CB 2C4FT 4WEBL 5FO8A 4KV5F 3THML 1IEAB 1BJ1H 4D0CA 5KANG 4JDVA 5D7LB 5JR1L 1FLTX 4ZD3L 1B90A 3F5WB 4NZTH 1CXHA 4PJIE 3HR6A 1XGRA 4ZAKB 5GGQL 4YDIL 5SWZE 1MFDH 4XCNB 2YEZA 3QXAA 4Y5YB 1EHAA 1N4XH 3JV4A 1XMWA 1CL7L 2H32A 5E8PA 5MI0B 3RTQD 2W9EH 5F7EL 2YD8A 4PJDF 4PY8I 4ZS6C 5DD3H 1Q9OA 1V8HA 1CS6A 2A6DA 2DLTA 3LZFL 4NQCD 3EYQC 4O4YL 3EDDA 4PUBH 3PWVA 3T4YA 3RAJL 3QWOA 2X70B 2J8HA 5L8LB 3RNKA 2IAMB 3TZVB 4KRPD 3IDUA 4FFYL 1FPTH 2NLJA 4K71C 4MQSB 1XGYH 4IDJL 5ACMA 2MQCA 4WFFE 4P48A 5DDHB 3MLSL 3RWJA 1DQQB 2R0LH 4YBQD 1UQSB 3TT3H 1JGDA 2PXYB 3LQAL 3T08A 2GFBB 2XZCL 1OGAD 1YY9C 4HUXA 1NGXA 1VSCA 4R2GD 2B4CL 1HHGB 4KPHH 2C3WA 4CVXB 4E0RB 4K23L 1DQLL 3MYJB 3M8OL 5ETUB 3ARFB 4WY7L 4CVZB 1JGVL 1WFUA 3JWDC 1DZBA 4U1SA 3TIEB 4QF1A 4QOKA 2OTPA 5F1SA 3I85A 2WINB 3MRPB 4Y2DB 4L8SA 5A40E 5E8EA 1NFDB 3RDTD 1ZEAL 5I15L 1X5JA 2OL3B 1WZLA 2AAVA 2ZKHL 3KPMB 2HKHH 4MVBD 1HILB 2W38A 3HG1E 1VGEL 3VH8G 1G9NL 5C0JA 4I0KA 1RIUL 3PJSA 1UA6L 4LCIL 3LKPB 4L9LB 5D70L 4OLYL 1NAMB 4XAKE 3TPUA 3LN5A 2C26A 4JPWH 1F4YL 3S97C 3KPTA 6FABL 5EC2A 3L5HA 3T1FA 4JRYA 4K2UH 5JPMA 1P7KA 1Z5LB 1NAMH 3RI5F 3N1QC 4ELMA 3S88L 1RZKL 5C6PB 2YXMA 1NGWA 3STZA 2H8PB 1XR8A 2RFXB 1R24B 4G7VH 4K3DH 4YDKL 1YECH 4NKMB 4OD2A 4Z6AT 5EO1B 5ACZA 1W72B 3MCKA 4LLUA 1IGYA 1QFPA 5CZVL 1A9BB 4HXBH 3KGRA 2YPLB 4YC2C 2J12B 4NJ9L 4O2FA 5ALBH 4U31A 4FZEL 5DSCA 3V0WL 5DVOA 3TT1L 2G5BB 3UTZB 2H9GB 1DLHA 4DN3H 5F3BB 4JKKA 1QOKA 2E8ZA 4J6RL 1D6VL 1M7DA 3QUXD 2BVOA 3CVHH 4YUEL 1B4JH 1MF2H 3R1GH 2P5EE 3DMMA 43CAB 1NFIA 1BX2A 5SWZD 5FKPB 2NTFB 2P49B 1DFBL 3IKKA 4K07A 2G5RA 4XNXL 4X6CE 1X7QB 4EEEA 3QHTC 1I8MA 5H94B 3S5LG 3BJ91 3KPRA 1SJVA 2VXQL 1G7PA 1WWCA 4HXAL 4PJXB 2HN7A 4X80L 5CBEA 5SWQB 2VMFA 4KTDL 2VH5L 4MXQC 4ELMF 4GH7B 5ICXB 2DYPB 4XC1H 2BNQB 5MP6H 3LEVH 1LDPL 1J1XH 5ENWA 3VFTA 1MCPL 1R3KA 3FB5B 3VMOA 1BBJA 2EIZB 4ZO6A 2WWKO 4X7DC 3ARTA 3QH3B 3D3VE 3UJJH 5DK2B 5FHBL 2O5ZL 3G04B 4P2RD 4D9QE 3UZVB 4EIZC 2W9LA 5MENA 1KJ2B 3WUZA 4ZTOH 3MJ9L 4UBDC 4XGZA 2ERJC 1HXMB 4ZNEA 3JWOH 2EZ0C 4TNWF 2CRIA 4NCDA 4HGWA 1S5IL 5T1LB 3MV7A 4XI5C 1YMMB 3ARDD 4JO4L 2NXYC 4NGHL 3BE1H 5GGUB 1KJ2H 3VDBA 2BERA 5DA0B 5IVZA 3HC4H 4IRJB 4DQOL 3BRFA 1S7QB 1T22B 1I3RA 2HT3D 1WEJH 3RWIB 1U8HA 1UM4H 3CXHK 3MBXL 4MNGE 3TO2A 1PKQA 1E4KA 3ALWA 3NA9H 2LU7A 2IANA 4XZUA 1UB5A 4G6AD 4PLJC 4WVRA 4JO1L 4RAVB 4DZBB 3BXNB 1YA5A 3CPLA 4ORGA 4DVRL 4OF7A 3T4AB 5F1OB 3GFUA 2IFFH 2R39A 2VKWA 4HMDA 5I1IH 1NMCB 5L9DL 5FYKL 3HG1D 4GQPH 2UWEB 4KHTL 3X12A 1QBLH 4CKVX 4U1GB 1L7TL 3I9GH 1H3XA 1WBXA 1CF8L 4JN2B 2DQUL 2CMRH 4U1GC 4BFGA 2Z93B 4XAKD 4M7ZB 1FIEA 2NTSP 4EJ1C 3IB4A 1Y0LB 1DVFA 4Z7UA 5I1EH 3KPLB 5DYOB 4WWKB 2HVJA 4EN3A 3D39E 3L3KB 2PYFB 2FEEI 1G7JA 2WBJD 5JHDB 4M1GH 1GOFA 5E2JA 1J88A 1VEPA 1RUPL 4ENEC 1A1MB 3ILQD 4Z7WE 5DHXB 4JZJA 4CU7A 3SKMB 1CIUA 3V0VB 2GIYA 1IEHA 3CZFB 1RUQL 5DO2C 2EXWD 5E9DA 3WIHA 1SEQH 2B5IC 3WUWA 3VXNB 3WBDA 4M61B 4CN4A 4NQDB 1T1WB 3PL6A 4QRRA 1ZS8A 1P9MA 4EUPH 4XMLH 3JV6B 3NCYS 4ZFGH 1N6QL 1FE8L 2NXZB 3MPCA 2XQYG 1NEZA 3T2NL 5I8OL 3WFZA 2YN5A 1T0MB 4U1KA 3MA7B 5F3HB 1X9QA 1N0XL 4WUUE 3C6LA 3GMOA 3FQTB 2P5ED 2A0LC 3OAYK 1A4JA 1KLUB 3VRLF 4LHUA 2VZ3A 2XPGA 4DVBA 5IESL 2VL5A 2X5PA 5KVDL 1NGQH 4MQXD 4Z7UF 2VAAB 2DD8L 1HXYB 3GM8A 1RK0B 2F8XC 3Q5OA 4LSSL 1I8LA 4FQHA 1E4KC 3FT3B 1HH9B 5SWSB 2EDRA 5HTSA 3FQUB 4L3CB 2W07A 3D3VD 4I2XE 1N59A 4RFOH 5FF6B 1BREA 2B39A 4GRWB 1UKSA 1ZA6A 4Y5XA 4D9QD 4YHLL 3BZEB 4F33A 3FFCA 1OTSD 5JXAH 1LE5B 4RDQF 2BNUA 3KLSA 1RJYA 1A6AB 2DQJL 4JLRA 3DGCR 4GRWH 15C8H 1LQSR 4P3WA 5SX4H 1VA9A 3OWEA 5EU3A 2VE6A 4M6AA 1JYWA 4F9LA 3HPLA 3S34L 3MLZL 2X41A 3QIBD 3H3PH 1OAZH 5BS0D 3QNYB 4K94C 5IFJA 5F9OH 4HDIB 4EN3C 5IF0A 1I1YA 2EH7H 3QHFH 4LLWB 4POZD 1O0VA 2Z92A 4KJPD 4Y0GA 5C0FB 1CD1B 5IOPB 3U6RB 3D69A 3MLVH 3S37X 1W8NA 4FFWC 5FDYA 1YYMH 1LK2B 2I24N 1MI5E 5D1ZB 5I66B 5HPOA 1UJ3A 2EDNA 4D2NA 1FFOA 1TNNA 2VSDA 2ARJB 1I9EA 3QDMA 2NY0D 2GJZB 4LCUA 1DBKL 1B0GA 2XICA 5ABDE 5I2IA 1NCCL 2AJVL 2FYYA 4NKQB 1MPAH 5AZEL 4X6EA 3WXWL 1Q0YL 2YOCA 1DUZA 2YK1H 4LDEB 4LK4A 2YMXL 1NGYB 4FQCL 1CVSC 1X4XA 4FTVB 3C6LC 2VITA 2E27L 3D39D 3E2HB 4NBZB 3WHE0 2VXVH 4JFHE 3OKMB 4PJ5B 3E0GA 3MBEB 4Z7OF 2KKQA 3D9AH 3V6ZB 4D8PA 1FYTB 1P7QB 2Q8AL 3X3FL 1RULL 1HHIB 4WI3A 3MRHB 1F97A 1Y6MR 3O4LA 1FV1A 5EC1B 32C2A 1U42A 4RGOH 4LOUD 5ADPH 4JY4A 1CU4H 5EU6A 4OCXL 1MWAA 2HTLC 3CFEA 2XXCB 1I7TA 4KDWA 1ZTXH 4W6YB 1FL3B 4W81A 1KXQE 3Q6GL 1F11A 1S9KC 1GCFA 2CQVA 1G7LA 1FNGA 5TE4L 4RMRA 4D3CL 3AXLB 1MCRA 2C3XA 3JZ7A 4JPKL 5TDOA 1OAQL 4Q97A 1S7RB 3KLAB 1R5IA 1PG7W 4WWID 2DIJA 1C12B 3CZJA 3KNBA 4LLVA 3ZKSD 3U7WH 1MQKH 1D5IL 4PLOB 1VEOA 5AEAA 4JGJA 4BKLA 3VFUA 1N3NB 4HUVA 1MELA 1MUJA 2ATPB 2YPVL 4JZNA 3SKOB 3PWPB 5AYUH 4F9LC 4WFHE 1HHJB 3BI9X 2BC4B 4AT6B 2R23A 3QWRD 1N5AB 2DQFB 3HPJB 2GW5A 3LOWA 3HRZA 4G8IA 5ALCH 4MAYD 1T5XA 5DLMH 5FEBA 3P3YA 2VC2L 1HWGB 3GK8L 3KXFA 4JO3L 4P49A 1AGFB 4C59B 4NNPL 2BOBB 3FN9A 1KCVL 3K8LA 1FL6A 1UJ3C 1U8NA 1RUKL 1A7QH 5DJYB 3LN9A 3UPAA 4HPOH 3UO1L 5B39B 3SDYH 4FQLH 1HINL 3N1PC 3GSUA 5FV1L 3GSNL 3K4DA 5ESQA 4L4VA 3B2UD 4UDTA 5DQDL 5GQBA 2CK0L 3DO7A 3BIAX 3QQ3B 5EG6C 5INDB 3SE3A 3BH8B 2OTUA 2Z31A 3BQUA 2G9HA 4E41B 1EO8H 1S7XB 4I77L 4FQQB 1LO5B 3MLRH 1CE6B 2MMXA 4N5ED 1SVZA 2Q1EA 4IRSB 1ADQL 5LCVH 2K1MA 4DZ8B 1FFPB 3LAFA 3VFRA 5ICZB 1G0DA 3O2VL 3KYOA 3DLQR 2I25N 1BD2E 1LILA 3LSOA 1X5YA 2ZZUT 3OF6A 4WU7B 4GT7A 3HS0B 4OI7A 3QJFA 5F9JA 3CDCA 3ARWA 4HT1H 5AZ2L 1DQDH 4XCEB 3V95A 2XA3A 4JG0L 3VH8B 2Y06L 3PV6B 1SEBA 2VR9A 5IR1A 4N1EA 5TH2A 4HUNB 1G7MA 1UVQB 1TZIA 3PNWB 2DF3A 1T1YB 3WJLC 2ZSVB 2Z9TA 3QUKA 2W0KA 2ZUSA 3NCFB 1SMAA 4WI7A 1BP3B 3GUTA 2QBWA 4JFHD 1PD6A 3BSZH 1MNUH 1T7XA 4IOIA 3P0YL 3TYFA 3LQZB 3P40A 1UWXH 2JJWA 2QQKH 5FYKU 4HG4K 2KUTA 1KC5L 5GHWL 3MLUL 5D7LE 3LEXA 1Q9LB 5TE6H 1QLFA 2W9DH 3MRJB 1A7PH 3GJFK 3B3IB 4C58B 3Q1SH 1AE6L 2AV7A 2Y5TA 5DJ8A 1CXLA 3UTTB 5FGCB 3CH8A 4EI5B 3BWAA 1D9KB 1U92A 1MJUL 5E8OB 4EVNB 3QDAA 3MLPA 1SY6L 4UU9B 4W68A 1F6LL 5TPWL 3D5OF 1AIFA 1D9KC 2ICCA 5F1IB 1JWSB 3LKRA 1HDMB 4XP1H 4N68A 2FIKB 4WFHD 1FFRA 3BQUC 4HMEA 5EUKB 1RSFA 3MRIA 4GMSH 3S3SA 5SX5H 3S96A 3JUYA 1HKLH 1L9MA 1XH3A 3FQRB 3F7YB 3QI9D 1HOCB 5DD5H 3SCMA 4FXGB 4Z7QE 1T1XB 1F6AA 1I4FB 4HBCH 5J8OA 3O8XB 4M6OL 5I8KL 5JORA 3DYOA 3DRTB 1GGTA 2A6KA 3FB8A 1N64H 3LIZL 1BIHA 1MCLA 1NJ9A 4QTHA 4OM0H 3ARSA 4I48B 4L4TE 3I6GB 3T3MF 4IRZH 2P42B 1KUMA 1RZJC 4L29B 5JDSA 3U9UB 2MNUA 4KJQD 3S35X 3MRRB 1QSVA 1I3GH 4KMTH 5FUOH 1ES0B 1S9VA 2AABL 5CSZB 3QEQE 4NO3A 4HWEH 1IQWL 2WIMA 5GZOD 2FLRT 3PDDA 5F9DC 4NIKB 4PP1C 4YEFA 5GPRA 1NLBH 1CDJA 5DEGA 3BKMH 1DUYA 4PR5A 1XF3B 3RNQA 5HHXL 4ZXBA 1BD2D 3HZKB 3VD7A 4UINL 2MKLC 1FIGL 1QRNB 5I16A 4XNYL 5B4MC 2WSKA 1IGTA 1EV2E 3KJ6L 2H6PB 3DVNA 4NQEE 1C16A 1DQML 1AJ7L 4PRHA 5BVPL 1YN7A 3MQIA 2QSQA 5BXFB 5DZLA 3TN0A 5CAYB 1QLEL 4KGLA 5GS0C 4FQXA 3UTPD 5I1JH 4UQ3B 1TVBB 1VPOH 5EU7C 3TBWA 3ZHDA 1X5GA 2BDNH 3ZL4H 4Q6IB 1KN4H 4FQPA 2YRLA 5C0GB 5FO9B 4NFDA 3BEVA 4TOYL 3VG9B 3WLBB 4I3SL 2GSGB 3ZDXE 2AEIT 2I60L 3FOLB 1OPGL 3DUUB 4XVSL 5C9KA 5T5FH 1IAIM 3UC0L 5D7LD 1VFAB 3OKOB 4JQIL 1A3LL 5DHYA 4R0LC 5IFAH 2O61A 4ZAKD 5HXMA 1NC2D 1KTDB 4XAWH 2HVKB 3ULVD 2DQDH 4PJXE 1OP9A 1MRFL 1OTTC 1GGYA 4DUXA 2BNQE 2BVUA 4HV8B 5TJWK 3HC3L 5DD0H 4UTBL 4HLZG 5IG7B 1TZHB 3WNPA 5KSUA 2IAMD 3TZVD 2BK8A 4Z76A 5TF1L 2EYSB 1FNEB 2P8LA 4JN1H 5FV2A 4YGVA 4F7TB 3UDWC 4S2SA 1JPSL 4S11A 4NM8H 3RVXD 2PXYD 1VENA 3WFHA 3QRFM 1S7UB 4GBXB 4ODTL 5F9AC 4Y5VA 1YMME 4ZDHB 3D18B 4GAJL 1T0NA 2A38A 1BLNA 2HJFA 3RL1A 1FZJA 1MRCL 5J6HB 4EDXA 4ZXBC 3F62A 1FVDB 2Q86A 3ARFD 4H20H 2BZDA 3FQWB 3UBXA 5AD0B 1ZLVH 1GH7A 2I27N 3AS2A 3R0NA 4L4TD 5CGTA 4QT5A 5LGJA 1RZ8B 1FCCA 2CDEB 2GK0A 4NFBA 3TN0C 4GJTB 4Y2DD 2VUYA 1P4LB 5JNYB 1CFNA 4FQXC 4DCQB 3S37H 4JHWH 2B1HH 5ILTL 3ARBB 3RUGA 3SEPA 2XN9B 3MRGB 3HZYA 1YEHL 2YD5A 5DFTA 3FRUA 5E2TL 3TF7C 3LN4B 3P4OB 4HKBB 5I9QC 2UWEE 3N9GH 1A6VL 1J8HA 2WQ8A 5GZNC 4XPHH 5BO1H 1IE5A 5E5MA 4J8RA 4LEOB 1MFBH 2X7LB 3WIFB 5A43C 3V6OE 4GAGH 1EIBA 5ISZA 4JFZL 2ZCKH 3GSXA 1BM3H 3MGOA 3TJHD 4S1QH 2ZSWA 1UEMA 3UJIH 1TDQA 2XZAL 1KCSL 4LLMA 4YO0A 3ULSB 3QIWB 1YEGL 1OT2A 4N0UE 3MNZA 2DLFL 4O02L 1H8NA 2K7PA 2DM4A 1NGPH 5DUBA 5JHDE 3V0AC 3RWCA 4LVHB 4FQ1L 1EMTH 4RNRA 5BV7L 3BGMB 1G6VK 2V17L 1NANH 5IFHL 5KVGH 3QZWB 1TJGL 4NYLA 3CH1A 4Z7NF 1TXKA 1WCBA 2J5LC 1ZVSB 5FOJA 3LRSB 3HR5A 1LE9A 1X5IA 4P3DA 3CXDL 1XF2B 3PG2A 2V2WA 4ODXB 5KJRH 1A6TB 2CO7B 1ORQA 2OQJA 3WL9A 4HKJA 2VDOH 1IJ9A 5EB9A 1B2WL 1WFTA 2XFXB 4H0GA 3C5ZD 5F88A 3RUGF 5IHZB 4W6XB 4AH2B 2MQ0A 5DT1H 4WUKL 4P5MA 2HTKC 3RA7L 2BXZA 3TO4C 3QIUB 3HAEB 2F9BT 4Y89A 4BSWA 4I18B 4M62H 3G6DL 3O2WH 3QIUC 2BX5A 1R5VB 1EVTC 2HLAA 4UT7H 1OCWH 5IP4A 3VWKD 4L8CA 4YQXL 5DMGC 4MSWB 1IC7H 3T2PA 4YHPB 4G80B 1XIWB 1LWRA 5DUPL 1KB5B 2HJKA 1QFOA 5ANMB 3FN0L 4OCYH 3DJ9A 5D5MB 5E7FA 4LASL 2DYPD 2BNQD 5MEOA 2VDLL 2BMKA 5SWSE 1VEMA 1KB5H 2Y36H 5DMKA 4HHAB 5B21A 1ZVYA 5B8CA 1FO0H 8CGTA 4KUZH 3ET9F 3MRFB 4U7KA 5E4EB 3MV8A 3MRKA 1B0RB 1QQDA 4GRWE 1MHEB 2ENSA 5FUZH 5F7LB 4O51B 5T3XL 4IS6B 3LKSA 4JVPA 4EDWH 2JB6B 1INDH 4TVSa 1T7VA 1YMMD 4LDLB 1PEWA 2APFA 4F7EA 2FR4A 4RFNB 3V8OA 4D9RE 4IRJD 3P0VH 4RFNC 1G7IA 2DQTH 3O3AA 2FBJL 4OD1L 3MJGX 4AEIH 4YLQT 3BRGC 2CLVA 3VI4F 2I9LA 4LKCB 3B9KB 1A3RL 3T09A 4C56E 5AYQA 3RL2B 2EDHA 5CZXD 2C1PB 1RIVH 3UX9B 4DK6A 4AY0A 1S5HB 2A83A 3WS3B 2HFFA 3AUVA 4GKOA 5GJSL 1OLLA 4YZFF 4JB9L 3ULUL 3OR7B 1IGCH 4XVTH 3RIAK 5CJOH 3QG6B 3GSNA 3BD3A 2P8MB 3KPPA 5HHVL 4P2YA 5T3ZL 1Q72L 3S4SB 4YHIA 5D71H 4FTVE 4WJ5A 4Y4HB 1JTPA 4U0RB 4Z78B 4OT1H 4WWKD 4Y4HC 3WUWG 3LV3B 5JHDD 2BRRL 4DTGL 1ADQA 3O45A 4RDQG 5C0RH 1FYTE 4WIQA 4PRPA 3QJHA 3I3EA 5LAXB 1NEZG 2BVPA 5IM7B 3V8CA 3MO1B 4G42B 4LPCA 3VXTA 2GKIA 4NWTL 3NCEB 3QDJA 3CAFA 1CICC 4X4YA 2GSIB 4JANB 5GS1C 1YJDL 3KS0J 2VIRB 1TZGL 4NQDD 3BZ4B 4LHUG 4P59H 4R7DB 5HSFA 1ZHBB 5C0DB 5B8CC 2JJTC 2AXFB 4IIQA 5DJ0A 4PY7A 4GOSA 3PWNA 3FJTA 2NXZD 1VADA 3AU1B 3JTSB 2YN3A 4HUUB 3K4ZA 1D6EB 1O5DT 4PB0H 3ZSSA 1AQKH 1YMHA 2E3VA 4OFDA 3VXUA 5KVEH 4R3SA 2CPCA 1QR1B 4ODWA 1YEDB 4ESKA 4HUWA 3PWPE 4XVUD 2CGRH 2VXSH 4YHKL 2X2YA 3UYOD 2LABA 3HN3A 3HMWH 5DD1L 1BOGA 4UQ2A 5DF0A 3ARYA 3BP5A 4NZTL 1NDGA 5SWSD 3UYPA 3WDHA 1Z3GL 1GVIA 3MRQB 1KACB 1GC1L 5HDBF 5C0EB 5I71C 4XMKL 2LQRA 3EOAB 5K9KA 2ADJA 3MUGA 1BQSA 2G2RA 3FT2A 3EJJX 3T65B 5K59F 1DBAH 4ZYKA 1ZV5A 4WTXA 2B2XL 5DD3L 5IB5B 2FX7L 4TUOA 3RGVB 1PQZB 3BKJL 1VACA 2P46B 5DUMH 4G8EA 3O3DA 3EYFB 5CIPA 5I6XB 1IGJA 1ZKAA 3OKKA 1SJEA 3GHBH 4D9RD 4K55A 2A6JA 2FEDC 2QSTA 4PGDA 3S35H 5CUSL 4E41E 4MYWB 4ZSOB 2VAJA 5CILL 2XKUA 4ZUSA 3LRHA 4CW1B 5E1HB 5HYIA 1BVZA 4WTWA 2W0LA 3QG7H 5IHUL 2BSTA 5DZOA 2YD3A 3DXAA 5IGXL 2NPLX 5HYSB 1ED3A 2AXJA 1CLZH 1MFEL 2ORBH 3LVEA 5D1ZD 3MRBB 1Q1JL 1T2XA 2GUOB 5I19L 4BSVB 4XT1C 1UJTA 5JW4M 3BN9D 3BW9A 5IVXB 3ZKNC 5D1QB 4EOWL 5JW4N 2A9ML 4B5EA 4LPWA 1S9XB 2D31A 1R0AH 1CCZA 4XVJL 4IIQC 4LP4A 2DLIA 5ECJE 3FOMA 4RQQA 1KIRA 3TBYB 2JJSC 4OCWL 1MLBB 4PJGF 5JQHC 4FTVD 3MRDA 3MV9B 2IPTL 5DURB 5DD6A 2NY6B 3L3GA 3DV4B 9CGTA 1U8OA 3IDIA 3IXTA 3MBED 1TITA 4OGAC 1FYTD 1P7QD 3BPCA 3D2UD 4YHMH 1CFQB 4PGEA 1FL5B 3M07A 1CR9H 2NY3B 4PTUA 1FORH 3GKZA 1FNHA 4MZ2A 3C9NA 3OKNA 5FO8B 1C7TA 4PV9A 1C5BL 1EFXA 3VFMA 4QNPE 1WGOA 2OK0H 1CDCA 4K2UL 2E7BA 5CJXA 1A1OB 1S9YA 1LVEA 4MD4A 4QY8B 3QUMH 3MRLB 3U7YH 4QHLB 2C5DC 4DAGL 1UM6H 4OJFL 4CADA 3I2CH 1CDGA 3CFBA 4I5BA 3UTTE 5FGCE 3W11C 4B53A 4NSKA 1MHPH 5TQ0L 3CU7A 3VGHA 1SJHB 5BVJB 1JNHA 3VFGH 5IWLA 4RMWA 2H32H 5F1NA 4K8RC 1Q38A 3PWPD 5GRUH 3H9HA 1VGKA 1I1AB 4X7CC 3G6JA 4P9MH 2E5EA 4U6HB 2A9NH 3L3HA 4V1DE 4LF3B 5IBTH 2IPUG 4R4ND 4YXKH 3W0WA 2D0HA 3CVHL 5DGRA 1B4JL 1AQDA 4K9EH 4MB4A 4HUXB 1NGXB 5C2BH 1GIGH 3NIDE 3IKCA 2XIDA 3L3IB 2ITDB 3IGAB 4BH7A 2FATL 1JF1B 4HLZH 1H3PH 2D0GA 3ROOA 5DHVB 5MP6L 4XNZB 2D7TH 1SYSA 3DBXA 4GRMA 1J1XL 4AK1A 5E2UL 4NN5C 4TULL 2MHAA 5EULV 5B38A 4NHUB 4QF1B 4QOKB 1LO4L 4E41D 5CJBA 2H26B 4LIQH 1UKQA 3IXAA 5L2KA 2WUBH 4OI8A 2ZUXA 4OLVH 1NPUA 4HIXH 4LCWE 4GW4B 2Q8BH 1VESA 5D6DA 4IRSD 3GSRA 2VB5A 4XP5L 3JWOL 1NSNL 3HNTL 4P4RA 3EJYD 1EH9A 3G6JF 5C0JB 4TVPH 3BKCH 1NDMA 1YN6A 4GG6A 3B5GA 1BGXL 1GOHA 2XA8L 3X3GL 4MJ6A 1QRNE 2EECA 4RGMC 1AR1C 3EJZC 3T1FB 1KJ3L 1RMFL 1G6RB 4JRXA 5HYJE 3FB6A 4KMLB 4FOMA 1NGWB 2PF6A 5SX5K 1IKFH 5DFVC 1JJUA 2VDRL 3LKQA 2VQ1B 4OD2B 5IWLC 1K85A 5TGBB 3E3QE 2J6EL 5GGSY 3DSNA 3HE7A 4JFDA 2FJGA 3EFFA 4YHYB 2CMRL 4C54A 2ZPKH 1FVEB 3QSKB 4YK4C 4D0BA 1Q94A 4P23D 3GO1H 1HSBB 1IAII 5DSCB 1FRGH 3TWCL 4JQVC 4Y19B 4PG2A 1QSEE 1U3JA 3U48A 1BAFL 2X9YA 4Q58C 2NY1C 5DRZB 3I02A 1LK3L 4BM7A 4UNTA 2GTWB 4M1GL 4LSUL 4GG6F 1BX2B 3VWJA 1MAMH 4N0FA 4JGMA 4HWZA 3NFSL 3UTTD 4EI5D 2CKBL 3HI5L 1BQLH 1MEXH 4PJHA 4JGUA 1OGTA 2GT9B 3MGTA 1MCEA 1JZ5A 3P9MA 4L3EA 5CBEB 1G7PB 3PGDB 5D2LB 3MR9B 4XPGH 4NPYA 3CSYB 1EHXA 4XBEL 3OJMB 4HF5L 4PRAA 2VZOA 4ZQKB 5BRZB 2AJ3A 4HJ0C 2DBJA 2FECL 2H1PH 2DM3A 4ACPA 4HGMA 4V1DD 4F15B 1WBYA 5C08B 4Y4FB 5ITFA 2EDBA 1DLFL 4M93B 5D6DC 3NMEA 4GUPA 1K5NB 4BZ2H 2J88H 4Y4FC 3UTSA 3O8XD 1YQVL 5GISH 5EN2A 3GSOB 4XGZB 1L7IH 4U6XB 4OZIB 4F8QA 3MV7B 4QKXB 4OZFB 3RKDC 4FP8H 4W4OA 4HS3B 5CS7A 2R0KL 2AEQL 1FZKA 1RD6A 1UWEL 4NWUL 2M1KA 3NZHL 4XCCL 5T1KA 5IB2B 5I17A 4M7KL 4LSRH 3P77B 5DRXB 3TO2B 1PKQB 3VCLA 4XWOD 1UB5B 1I1RA 4PJHF 1RZ7H 4M43L 1QSFB 4GRLA 4RFOL 2Q7YB 4LCWD 3BAEL 3LEYH 1CTNA 1CK0H 2A1WH 4DGYL 3GMNA 3DECA 5BJTA 5DEFA 1WBXB 1CFVL 1NL0H 3CFKA 3IRZA 4PIRF 1BVLA 2NY5H 4J3SA 4M9OA 4PG2C 1R6VA 4CU8A 1EEQA 3H3PL 4HQQH 4R9HA 2WM0A 1QRND 1NBVL 3QPXH 1HSAA 4LARH 4BZ1L 3NZ8B 4P2CG 4ZO7A 3REVA 1MJ7H 4KHXH 2OTWA 5D93B 4KU1A 4Z7UB 3VWJC 1XCQB 1JZ3A 3SE9L 4DOHE 3H9SA 5E03A 1EJ6A 5I18H 3RVTD 4M1CC 1NAKL 2ADGB 4OCSH 5J1TC 4LPTA 4PV8A 2Y5EA 3H3KA 4S1SH 1DEEB 5IBLD 5GS3A 3W9DA 1XZ0B 2AEPH 2XTJC 1KXVC 4X6DA 4WW2A 2F74B 5DVKA 3KHQA 4UUJA 2V2XB 3DURA 1YPZB 4QRRB 1GGUA 5HI4C 1QKZH 3FO0H 1IC5H 2Z4QA 1A2YA 1KEGH 4I3RH 1NEZB 3WIHH 3GMLB 4U1KB 1JIBA 2DDQL 4P99A 3C09B 4YHOH 4ZOAA 1A4JB 4QRTB 3DNKA 3TBVB 3V7AG 4W4OC 5DGQA 1Z2KA 2I5YL 5ANME 1CLYH 3PQYB 1TMCB 5D5ME 5EUOF 4X9HA 4XP4H 1B6UA 3P4NB 4X4XA 2BNRE 3FO9A 1P2CA 4L5FH 4H25B 2D0FA 4Z7VB 4U1LA 3FTGA 2XT1B 2ZUQB 1ZT1A 3NTCL 1PBYA 3WEXB 1EPFA 5DR5H 3MJ8A 1JNJA 2MCPH 3FONB 1NC4D 4IMLA 4NN7B 4XCFH 3ULUF 1X44A 3UBXG 3WLWD 2VDQH 5D96B 2X4NB 1V3MA 1HIMH 1N59B 3DX6A 4GBXD 4PP2A 4X6DF 3SDXE 1ZA6B 1H3WM 4GW5B 4WW2F 3LMJL 3IRPX 4Y5XB 3L7FB 3WDIA 5JOFA 1H15A 1FH5L 4F33B 2P8PA 3HCVA 4QTIL 1MQKL 4OLWH 4QRQB 2BNUB 2XYCA 1ZWIA 2RIKA 1QBML 4JLRB 1F8TH 1OB1A 3HUJA 5EU3B 3G9VA 2WP3T 4HS8L 2ICWJ 2BFVL 2BVEA 3STLB 2X4UA 2EE6A 4UT9H 5ALCL 4LBEB 2WK2A 5GSRA 1EAPB 4EBQH 5IFJB 4M5ZH 3EAKA 4YXHH 2FX9H 1IFHL 4N9OB 5IB4A 2H2PD 3D69B 3ARBD 2G75B 4IOFD 2ADIB 4K3JH 1NCWL 3ARGC 3ZE1E 1A22B 2Q76A 2CIKB 4J4PD 3SDYL 4FQLL 1FFOB 4R96A 2FO4A 1KLGA 3QDMB 5EO9B 1Y18B 3AREB 2VDKL 5J3HD 4WW2C 3CK0H 4HS6A 1UCBH 1VB9A 5FGSA 5LBSL 4AIZB 3AREC 3O41B 1TJIL 5CINL 4S1DC 5F44A 2FYYB 1VCAA 1FN4B 4OLEA 3FKUS 4X6EB 1U6AL 4WFED 2Z35B 4HH9A 3OKEA 4G3YL 5D8JH 1EO8L 3WD5H 5IW1A 2IBGA 4UV4L 3L3DA 5FCSH 4X9BA 3L9RA 3BVNA 4PTTA 1J0KA 1E6OL 3NIFF 1KYOJ 1CD8A 1WUNT 2EH8L 4M6MH 1RIHH 4J1UA 1MCIA 3HUJF 5CJQH 5LCVL 4D9LH 4F58L 4LU5L 1OOAA 4PS4L 3IJYB 1AY1H 1CXFA 4D8PB 4OBRA 1UG9A 2Q3AA 2AK4B 4OKVB 3O4LB 1FV1B 3SKNA 32C2B 1WBZA 4P2OA 3H2WA 4JFYA 4X6BA 1KGCE 1OAXL 1OQXA 4RIRB 4BA8A 2YS4A 4GG8A 2GAZB 2ZG1A 1F11B 3VG0H 1G7LB 1H8OA 1U3HC 5IT2L 1W0YT 2LU3A 1JE6A 1MWAH 4DFHA 4F2MB 5JDJA 4X9FA 3TFKD 3TVMD 1WAAE 2AXGA 3U1SL 3GJEA 1BFOB 4JREB 3ZMRA 1XIWD 1A8JH 1N7MH 4BKLB 3O4OB 4HUVB 4NKOA 3MX0A 1NBYA 4JZNB 1RZIB 4O2CA 1KPRB 2FWOA 2ID5A 3BIBX 2IG2H 5ID0A 2BNRD 4YPGB 5GRZA 1YNTA 1KIPB 3HRZB 2HJLA 5F71A 4KROB 4L8DB 3MRMB 3NABH 1JN6A 3KXFB 4FQIH 1BBDH 2E9IA 4MNQA 2NY2C 4F57L 2AERT 2D2OA 1U8NB 1WWBX 4ZD3H 1RZFL 3N1GC 1W8OA 1JYNA 3MNWA 4ZUWB 5GGQH 4YDIH 1IGFL 4BQCA 3RZCB 1CL7H 1IARB 4PRNA 5ICYB 3DO7B 4ZSOE 1QFUH 5F7EH 4PJAB 1MH5B 2OTUB 3EHBC 3LZFH 1JI1A 2Z31B 3MJ7B 1H5BB 5C70A 3X17A 4O4YH 5GRJL 3B9KD 4ZS7H 3RAJH 1NKOA 2APVA 4G9FB 2F8OA 1TCMA 3HE6C 4FFYH 1EO5A 3DX8A 4IDJH 2A6IA 4P9HL 1NBZA 2LAAA 2CDFA 4NDMA 3MLSH 1JHKL 5IVXE 3NCJL 1QG3A 4M3JA 1UB6A 3AC0A 3KYOB 4P2OC 3LQAH 4R8WL 3NACL 1BIIA 2XZCH 5EPMA 5H35B 1ZHKA 2ZP0T 5HDLA 3QJFB 3V6BR 5F9JB 1QFWL 4K23H 2PW1B 3LB6D 1DQLH 5CD5C 3M8OH 1I3GL 4E42A 3NCMA 3REWA 3V2AR 3VXRA 4WY7H 3QFJA 1HKFA 5C2UB 1JGVH 1FHGA 5HVFB 5TH2B 5L7XL 2DWEA 1IAKB 2EKSB 4F7CA 1RUML 2EE2A 4NC0B 2CLRA 1XF4A 4PJ9A 1F4XL 3QCUH 1ZEAH 1F4AA 1D5ZB 3IDJA 3QEUA 5I15H 3FO2B 1I8KA 4IOIB 4AYFA 2EXYD 1ZLUK 3TYFB 1ND0A 4NN6C 5E1AA 1VGEH 1G9NH 4X5WB 1UYWH 1RIUH 3S7GA 1KGCD 1UA6H 2XACC 4LCIH 5D70H 1JZ7A 1GYAA 3T0WA 4NRYA 5EOTB 4XBGA 5I1JL 2JE8A 4JCLA 5JOEA 5JXED 3D85B 3GMQB 2AV7B 2Y5TB 5DJ8B 3W81A 6FABH 5C0CA 3BWAB 4YEEA 3QXVA 3S88H 1RZKH 3SO3C 3G6AB 3HI1A 2J6EA 1V3KA 4MA7L 3MOAL 3N1FC 1J12A 5GS0H 3F58L 1JHTA 2YR3A 3LKRB 2VLKA 5IW3A 4I3GA 3EUUA 4YDKH 2ED7A 1R3HB 2XI9A 3MRIB 5J06A 5IJKA 3L3JA 1F42A 5EBGA 1M6OA 5A3IC 5KZCB 3IVKA 1I7RA 4WCYL 4R97B 4R4BA 1SM3H 4JM4L 3TPKA 3MLTA 5IUSA 4OUOA 3V0WH 4ZUUA 2YD1A 5TFSL 4PGZA 3TT1H 5LXGL 4NQSA 2FJFB 4NC1C 5CCKH 4J6RH 4ODVL 4H8WC 2CKBA 3E6FA 3RGVD 1D6VH 1GHFL 4YUEH 3GB7A 2CRYA 4QTHB 1OLZA 4TUKH 3RBGA 5C1MB 4QLRA 5DJDA 4QOKE 3G08B 4RFEB 3MACL 4HBQA 4G6KL 1OW0A 4JN1L 2PO6A 2HP4A 2VXQH 5AWNL 4X80H 4HXAH 2AGJL 3F8UB 4TVPE 4X83A 5IHBA 2O93L 3QA3B 3AGVA 2YA1A 2HT4C 3MLWL 4K3EL 4JFFA 2VH5H 3JSSA 3QNXB 5LQBL 3DRQB 4NM8L 1EUUA 5J7CC 4XNMA 4PJ9C 1MCPH 5IMOA 4AIOA 4U3CA 1TTGA 1F3RB 1JF5A 4MA1C 5FHBH 4JKPL 4GAYB 1LEIA 3RNQB 5D1QD 3BIKA 5DRNB 3DX9B 1S5IH 3JV5A 3OHXA 5E0QA 3L3OA 3DVNB 4NGHH 4ELME 3WNOA 4PRHB 1WF5A 2ICWA 4HFWA 5I8EA 3MV9D 3IF1B 5DURD 5A16A 5T33H 2YBRB 5HGGS 3VE0B 3B2VL 3MBXH 3BPOB 4LPXA 3N9GL 5KG9B 2EDEA 1MFBL 1ZAGA 4N8VB 3D0VA 3P30L 2NY3D 4HWBL 3S9DB 3O3BB 2B0SL 3JBG7 4KKNA 2JB5L 1A64A 2ZUYA 4RAUA 5F21B 4Y19E 4U1NA 4NRXA 1G7QA 3RIAF 4WI8A 5L9DH 5IJKC 5FYKH 5IB3B 4KHTH 4PREB 3FAWA 5D7IA 5DS8A 1CFSA 1L7TH 2AXHA 5DHYB 1CF8H 5CEXA 4GLRI 1NGPL 3CC5A 3NCCB 3QRGH 3VFNB 5HYEA 2DQUH 5FIEA 2CDGA 3Q6FA 1DP0A 2DTML 3L95A 4G7YL 1JWUA 3U2SA 1L0YA 1OP3H 3PHSA 4GO6B 3F6LA 5E08H 1AGDA 1WZKA 1JRHI 4GXUM 5D2LE 1U8MB 3L5XL 1DJSA 4XX1G 4YR6A 4OV5B 5KJRL 1QEWB 5EO0A 3IFLL 1I8IA 4I0PA 1OW0C 2E6JA 1I1AD 2PO6C 1RUPH 1REIA 4Z76B 5C08E 1RI8A 2P8LB 4E5XA 1ZLWH 3VXPB 4HIHA 5JIIA 5EU4A 1KB9J 1FBIL 5MENE 4S2SB 1KJVB 2HFTA 3WFHB 2X4PA 3MV7E 4CMHB 1ZMYA 5B38G 5DI8A 1N6QH 2D7NA 5I8OH 3T2NH 1ZHNA 2HJFB 2BVQB 2YC1A 5CD3A 3RL1B 4EQ2A 5JW3H 1FZJB 1JPTL 1R3LB 2VWEE 5D7IF 2H2SD 3TNMB 2LTQB 3QCVL 2Q86B 3OG6B 5DJAA 4EIGB 2VLRB 3UBXB 1T03L 4ELKA 4YFLI 1PKQE 4CVWA 3P73A 4RRPA 2BY1A 4KZEL 4QOKD 4WI2A 1T7YA 1ITBB 2VLME 5HVHC 4FG6C 5IESH 5KVDH 4BH8A 5IB1B 1SYVB 1BJMA 4TVPD 4XHQA 2DD8H 3IDYC 1KCLA 2E7CA 2E7HA 3ZE0F 4JJ5A 1ZA3B 4OKDA 3WIIL 4P5TB 5FYJH 4NNXA 4MX7A 2EZ0D 4J8RB 5E5MB 1A3QA 1KCKA 3U36A 1EEZA 3UJTL 1S7TA 2AJYH 4HPYH 1VKXA 1HHKA 3VRLE 2DOCA 1OQOA 2NXYD 3P0VL 4YHLH 2DQTL 5FOBB 4LCCA 3RTQC 4AEIL 2V9RA 1MCWW 2R1WB 4S0SD 4NQCB 3E8UL 2DN7A 4YO0B 4DEPB 4Z7UE 2UZYB 4NKIL 5BQ7A 2FHCA 4M5YL 1J10A 3EYUL 1OL0A 2FJHB 5J0BA 2FX8L 3FZUD 2APBA 3RWCB 3BYTA 1RIVL 4KRPB 3S34H 3MLZH 5EBLB 4KJYA 4NZJA 3V5KA 2YA2A 4GKNA 5J1AB 2KL6A 3NFPA 3MUZ1 4KRPC 5ESAA 2CR6A 1P84J 1WCBB 1QLRB 3BZFA 3O3EA 4L8BA 5CJOL 4P3DB 1H0DB 2F15A 2IH1A 5E9DE 3SDDB 2BY3A 1CD0A 4YBQC 3WL9B 4QRRE 2IALA 1TPXC 4TRPH 4Y8DC 3QB7C 4FFVD 4Y19D 4R2GC 3P0GB 1ZT7A 3H0TB 1DBKH 3CDGA 4QXUL 2VSCA 4JFXA 2XKSA 1NCCH 2AJVH 3KG5A 3DMMD 3X11B 3WXWH 1IMHC 2HLFD 2YMXH 4FFZL 5DJCB 2HLAB 3ZE2F 3PQYE 2FZ3A 3NPZB 4MGXA 3WN5B 1AHWA 2CUIA 2PN5A 1YNKH 3WDJA 3U0PB 3WN5C 3RDTC 4KKCD 3PWUA 4XPFL 3CFCL 2E27H 2J1KA 4PGBB 4TUJB 4FXKA 4MVBC 4JKWA 1HNFA 3DVGA 4KK6D 4MD5A 5IMKA 4AJ0A 4P2RA 2JJVA 4OLUH 3TH3T 5MEOB 3EYSL 3V5HB 1I9RL 2BMKB 4KQ4L 5DFWH 3X3FH 4KDTA 1RULH 3K74B 4PJ8B 5C08D 2FSEA 1TCRA 3OXRA 4Y4KB 3MV8B 3MRKB 1QQDB 2HFEB 2GQHA 4OCXH 3WSQL 2OXHA 3Q6GH 4JZOA 1QYGL 5F93C 3MV7D 4MXWL 5TE4H 5IMLB 5IK3A 4D3CH 5JLZB 3STBA 4JPKH 1OAQH 2FR4B 5IKCB 4Z7OE 5LG1A 3MMEA 3E1F1 3RVVD 2CRZA 2F5AH 1D5IH 8FABA 2V7NA 1D5MA 2FEEL 2YPVH 1A7NL 2CXKA 5J1SC 2VLMD 4XNUL 2ILLA 3NA4A 3HG1A 3LPGA 4JHZA 5IBUB 4NKDB 4C57C 5EA0L 2A83B 2P24A 3PDGA 3EOTL 3IFOA 3U82B 2FO1A 5MEPA 1BVKB 4GS7C 2VC2H 5CMAA 3GK8H 5LWYL 3QDME 4JO3H 3W82A 2IPKB 2NY4B 5D1XB 3KJ4C 4PJIB 2BP3A 4NNPH 1XGQB 2EDJA 3QUXC 3GSNB 3VFWB 1LDSA 5SWZB 1KCVH 1A9EA 3C6SA 3GI8L 5D2NA 1NQBA 1RUKH 3SKJL 3UO1H 3KPPB 3IJHB 3WV0A 2L7JA 3WFDL 2ZOKA 2WBJA 2RJMA 1HINH 2QKIB 4MCYB 1Q9WB 2A74A 3GSNH 5H8DA 4PJEB 3ULVL 4WJ5B 1DVFD 1KIQA 3IDXH 1S7SB 3OJ2C 2NW3A 2CK0H 5D4QA 5IQ9B 1ZXQA 4BYHA 3H7BB 1U93A 3OKLA 1A14L 4UILH 1P1ZA 1AHWC 2AJZB 4M8QA 5DJ2B 5IIEB 3MRNA 1D5BA 5E5RB 2AK4E 4I77H 4LAQH 3O4LE 1BEYL 3MROB 4HAFA 4LCYA 4O58L 3PHQA 3U4EB 1ADQH 5EU6E 1R0AL 1WK0A 2OYPA 2BCKA 2YRZA 1DE4A 3PL6D 3ZSTA 4QRRD 2YUWA 5DJ0B 3ZKXB 1NCDH 1T66D 1OAKL 4WW1A 3PWNB 3QDGA 3ARDC 1T6WA 1CTOA 1A4KA 4UOJA 5I1GH 3L5WB 2VLLA 2UVFA 4KUCF 1LGVA 1TVHB 4KTYA 2E7LA 3JWDL 3FT4A 2FIRT 4NUJA 4WU5A 2HT3C 1CLCA 5AZ2H 2EDDA 3VXUB 4JG0H 2Y06H 3QAZB 4LHUD 5CEZE 5A2LH 4U49A 3CLFH 4ODWB 3BMVA 3PQYD 4FXLA 4G6AC 5CP3A 1FORL 4X6FA 3DGGB 3T77A 3OGOE 1WTLA 2OL3L 2EDQA 1CQKA 3K2MC 4B41A 3EO0A 4UQ2B 2MQ3A 3KXFE 1LO2L 2AQ2A 3BP5B 2EEBA 4X5XA 5H2BB 4MA3B 1RFDL 4G43B 4HKXA 5K9KB 3MLUH 3FT2B 3SGDI 2VXUL 4P4KB 4OUUB 1MHPL 2CJUL 1CG9B 1U8QB 3ZDYF 5EZLA 4PJGB 2ZG2A 1CDIA 1VACB 1QO3A 5BS0A 2FL5B 4L4VE 5CIPB 1AE6H 4LRIA 3UZQA 4PJAE 3F12B 3BPLB 3RX7A 3CUPA 2WBJC 3OKKB 1GRWA 5FM4A 1MJUH 3DI3B 5IBTL 1SY6H 3BPLC 5TPWH 4JQXC 4RSVA 4ZTPL 5CIPH 3VRJA 3ILQC 3GMMB 4G9FE 4UOW0 4K8RH 1XF5A 3DXAB 5KN5A 2EXWC 1NUFA 2JLLA 2X1PA 3BGFB 1ED3B 1S7VB 2Y72A 3DHMA 5L2JA 1GIGL 2EC9U 3RWFB 4KZDL 2R69L 1KCRH 3WHE1 3QISA 3QDMD 1BFVL 4Q2ZB 3BGAA 1WTGT 1BMGA 5I8KH 3GBMH 4H26A 5HHOA 2AS5M 2Y9RT 2ITCA 3ROLB 1OTUD 3BO8B 3AMKA 1JWMA 4LSTL 3LIZH 3OR6B 1OF2A 4X6CB 3I75A 1KIRB 4LIQL 3OJDA 2E7LC 4MQXC 4APQA 2Q8BL 2QR0A 4GKZB 1N6VA 2P7TA 2LVEA 5F89B 3BISA 1AO7A 3QNZB 3BWUC 5E4IA 4ISVA 3IXTB 1P5UA 4NO5A 3DROA 4DKEL 2AABH 3KDMA 5GGSB 1KEMH 3BKCL 3BPCB 1IQWH 4PGEB 1NBQA 1YDPB 4WO4B 4JG1L 3GSQB 2AK4D 3ORJA 35C8L 3O4LD 4OCNC 2HWZH 2OBGA 4AEEA 3O6FA 3ZDZF 1WT5A 1MCHA 5EU6D 3C9NB 3OKNB 2EDYA 3RWGB 4PV9B 3VFMB 1KENL 3PE9A 1OTSC 3OPZL 3RWEA 5HHXH 3T3ME 1S9YB 1SBSL 4MD4B 1MHCA 1FJ1B 4ONGL 3B6SB 3CFBB 4UINH 1FIGH 4XNYH 3KJ6H 5F7DB 4JFEA 1U58A 3QIBC 1AJ7H 3T0VA 3WS6A 5BVPH 3ILPA 3DX7A 3O6LL 4WI6A 1QLEH 4JHBA 4M4PA 3VGBA 3GRWL 1IL1A 4CMMA 4LRIC 1TTFA 5CEZD 4MAYA 4KJPC 1JF6A 4HWBA 4OZGB 3BYYA 1VGKB 3OZ9L 1FFNB 5HGBA 1A7BA 3L3HB 4NRZA 4YWGL 4F3FA 2DM2A 1BQUA 4TOYH 4I2XA 4KROD 4MWFB 4I3SH 3HNSH 3QHZH 2NY0C 3KXFD 5GJTL 3KYAA 2I60H 1OPGH 4XVSH 4NQVA 4QXTA 1QRKA 3MRCB 1ORSB 1J0YA 2SEBB 5DVNA 3UC0H 4JQIH 1IM3B 2D7MA 5KSAA 3IKCB 3CLEH 2ICEA 3DTXA 1XGPA 4XPGL 4CNIA 3RZCD 3D39B 5HHNA 3LDBB 2IADA 1U8IB 2QADD 4L4VD 5HI3D 4WTZA 1J1OL 5CWSA 3MSPA 4PRDA 3MREA 4GW1B 4KY1L 1MRFH 2H1PL 5B38B 4FMKA 2Z31D 2AK1L 1G0XA 2X9WA 4HIIA 4Z7WB 3ZTJG 4O9HL 2W0FB 2P1YA 2Y7QA 4OF5A 5K9QG 5GISL 4G9FD 4LOUC 4OFPA 5GS2H 1R3IL 3GSRB 5TF1H 3SDAB 2DKUA 4C4KO 3HFML 5I73C 3U0TA 3DUSA 3OAUL 3O9WA 1MCKA 2X4QB 1JPSH 1QA9B 4ZFOL 5EBWA 2LAGB 4KK8D 1WT5C 2J4WL 4ODTH 4WUUB 3TA3A 3W9EB 2CLZA 2V5TA 3OF6D 1MCJA 4GAJH 2D7QA 4ODUA 3SY0B 4PRHE 1MRCH 2IF7A 3B9VA 1RJLB 3TJEL 4JRXB 3AB0C 4LVOB 1G9MC 3K8KA 5HGDA 2HKFL 5DVMA 3NN8B 1ZGLA 4XCYB 5FM5M 2FD6L 5DTFA 3LKQB 3ARPA 5FYKE 3UCRA 4MAYC 4M7LT 4QRUB 2EDXA 4KK9D 5J9PA 3BP6A 3GM0A 2OZ4A 5ILTH 4QRSA 1ULVA 1YEHH 1C1EL 5E2TH 1W0VA 1E4WL 4FN0A 3R0MA 1A6VH 3QPXL 3ECBA 2OCFD 1F4WL 2RHEA 3INUH 1Z0MA 1MFNA 3OX8A 4JFZH 3CU1A 3I02B 3B2UC 4LLQB 4S10A 5F7NC 3D85D 5BV7B 4OZHB 2XZAH 1KCSH 4LGPB 4XH2B 3SDCB 4N0FB 5KSAC 1YEGH 2J7LA 2C4FU 2BSED 4K94L 4O02H 2OLDA 4FQ1H 2GTZA 4M9PA 5I1DA 4OGYL 1CGTA 2AEPL 2A73B 4NCC2 5IEKA 5IFHH 1Z9LA 3LD8C 1A02N 3PABB 4N5EC 3QXWA 3SGEI 3O0RL 1PY9A 4PD4J 1NMBL 5IW6B 3V7AE 1IGIH 2AJ3B 3HZMA 4UIKH 1MI5B 1F3JB 5F96H 1J18A 1IC5L 3GSWB 4P46B 1KULA 1TIUA 3HLAB 4X99B 2HAZA 3SCMD 1FZMB 1T04A 1AGEA 4J2XA 4MJ2A 1B2WH 1EXUB 2C3VB 3M17A 4UIMB 1K6QH 1EO7A 3VXOA 1NUDA 2AEWA 4YHOL 3TIDB 5EN2B 2HRPL 2X1OA 5IVNA 4WUKH 4ETYA 3KS0H 1XGUB 4JDZA 4XMPH 3RA7H 1JPFA 2MTPA 1CLYL 3S36L 4MJ5A 1O7VA 1KN2L 1Y6KR 2VLJA 4LPVA 1A1NB 4PB9L 4XNQB 4KVCL 3G6DH 3U9PH 4RGNC 4L5FL 2R8SL 1Q9KA 4MXVE 2CRMA 3V5DA 1IM9B 4X7TB 4FMFA 5I17B 1U8JB 1P4IH 1J0HA 2DM7A 2WLZA 4U4BA 4W4NA 4BFIB 1YY8A 5DR5L 2X4TA 3FN0H 1KG0A 5J6GA 4HFUL 5HJ3A 4LASH 3RUGE 2V2TA 2PTTB 4BQ8A 2VDLH 4GRLB 5KSBA 5CBAA 1J8HE 1OSZA 3VU2A 1AP2B 1OP3K 1F8TL 4O2EA 5T3XH 3CFKB 4IJ3B 5L8KB 5INCA 1T20A 5EUOB 3VFVA 4AL8H 4PRHD 4IJ3C 2FX9L 4J3OC 5IHLB 2FBJH 5KW9L 3KYMA 3O2DL 4AENA 4LKXB 3UTOA 1A5FL 5D6CA 2IQ9L 1GZQB 2B1AL 5HD8D 5IV2A 1A3RH 4WNQB 3QI9C 1IEAA 4PV8B 4Y8AA 4XPAL 3ARZA 5FYKD 5D7LA 2EICA 1UCBL 3BT2L 1CVRA 3F5WA 4LSQL 4MHHG 3RKPA 1QVOA 2X1QA 1RHHB 4N0YL 4JHAL 4ZAKA 4XCNA 3GJFB 4UUJB 2NX5A 4JB9H 3DURB 3ULUH 5KSBF 5DRWB 5FDWB 4KQ3H 4ONFL 3SJVA 5HHVH 5T3ZH 3VI4E 1Q72H 1U91A 4D9LL 4KJQC 1AY1L 2X70A 2IAMA 4OF8A 4DKDC 3GBNL 5DXWA 5AG8A 4TPRL 2R1XA 4MZ3A 3EBAA 1B4RA 2QQNL 1E0OB 1U8KB 2BRRH 4DTGH 5GZOC 4N90E 5C3TA 2NR6D 1DL7L 4OV6F 2FH8A 3RIFF 4XRCB 2GFBA 2XY2A 2KDGA 3QR2A 3MV8E 4NWTH 3MJ8B 4Z0XB 5CEYB 1HHGA 1RJZB 4CVXA 4E0RA 1ROWA 1YJDH 4JPIB 1TZGH 1DN2A 2MOVA 5ETUA 3QQ9D 3ARFA 4CVZA 4RRPG 4X4ZA 5J13C 3K80A 1A6UL 2P8PB 4M3KB 1N8ZB 4GSDL 1N7ML 1EZVY 1MJ8L 3TIEA 2AKRB 1ZWIB 2WINA 3MRPA 1CT8B 3ULVF 1NFDA 2VLRD 2Y4SA 4YX2L 1QACA 2OL3A 4N0RA 1LEGB 3KPMA 1HILA 2DMBA 3RWHB 3NABL 5GRXG 4YHKH 2C9AA 3BEWB 3DETD 4IHOA 4YHNA 5IB4B 1U8PB 3LKPA 4L9LA 5DD1H 1UWGL 2YUVA 1NAMA 2Q76B 4P5TD 4ZO8A 2P45B 1Z3GH 1J8HD 4Z7QF 4R96B 3VDCA 1GC1H 3OSKA 2X4OA 1KLGB 4XMKH 1NC2B 4YNYB 4HS6B 1Z5LA 4ZAKC 4OFIA 1AGCA 1T89C 2FHBA 4Y5YC 1QFUL 4M7JL 2B2XH 1RY7B 5MI0C 2FX7H 2H8PA 4PJEE 3BKJH 3ULVC 3OQ3B 5LVEA 4OIIL 4NKMA 5IW1B 4ZS7L 2JK5A 4P57B 3WMSA 1J5OH 4M6NL 2KZWA 5EO1A 2W60A 3BVNB 3U79A 5CUSH 1W72A 1AC6A 1WZMA 2YPKA 4ZPTB 4J1UB 1NFDF 2IAMC 5CILH 3TZVC 1A9BA 3LPFA 4Z18A 5C0AB 5LGKA 2YPLA 5I1CH 2J8OA 5HDBE 3T2QA 5IHUH 4KAQL 1WITA 2Z8RA 1W2KT 3QDJE 3UTZA 5K59E 3SDDD 5IGXH 1LEKA 3P4MA 2PCPA 3RVXC 2PXYC 4CJ1A 1MFEH 4F7PB 3A6OA 4FABH 1X6NA 4POUB 4JFYB 4X6BB 3PGFL 3NCBB 43CAA 2VZ1A 1Q1JH 5I19H 2NTFA 4PJBB 4EOWH 1BZ7B 2A9MH 4ZFFA 4LVNB 43C9B 5H94A 1JK8B 5JOPE 4XVJH 3ARFC 4HD9A 4L4TB 4Z8FL 5SWQA 1RZJL 3EDEA 3VXUE 4LVNC 3S3PA 3WNKA 1GGIL 5ICXA 4PLKD 6CGTA 2BNQA 4OCWH 3GIVA 2F5BL 3QCUL 3ARQA 4LQFL 4Y2DC 2Q7NA 4Z0BL 3O3UN 1D3CA 1K4CB 2IPTH 3FB5A 3QEQB 1S8DA 1ZE3C 4NQUA 4A6YL 1BPVA 3QH3A 3WO4B 3WFEH 1CFTA 2UZIH 5F7FA 2XKNA 3G04A 4NFCA 5E2VL 1IAOB 1YNTB 2QEJA 2GJ6B 1KJ2A 1UYWL 2VISB 4N90D 4LNRB 5TDNB 4RCAA 2HJLB 1HXMA 2MCG1 4PJ8D 3NPSB 5T1LA 1JN6B 4Y4KD 4L9LC 3TV3L 1YMMA 3MV8D 2DIBA 1X4ZA 1UACH 3S98A 1KOAA 1C5BH 4DW2H 4PJGE 1FLRL 5E8NA 2NQCA 5C8JB 4RMUA 4YXLH 4F80A 4NQEB 2OI9B 3RWIA 2B7DT 4DAGH 4OJFH 3GRWA 4JY6B 5GS0L 1MQ8A 2WUCL 2R9HD 1F13A 5FO7B 3ESUF 4PRNB 4RAVA 4DZBA 3BXNA 5FHAH 5TQ0H 4H0IA 3HI6L 3EZJB 3OV6A 3DXAE 1MCDA 2B8OT 3CVHB 2HA1A 1XGTA 1SM3L 2UWEA 3C5ZB 4ETQB 3D6GA 3EO1B 1QD0A 3IDGA 2AVGA 3C5ZC 5CCKL 2DI7A 3BHBB 4NDMB 5HGAA 2Z93A 2NY4D 1FZOA 5D1XD 4NQXB 1JZ2A 1N6UA 4LPUA 4RISL 2YA0A 2RB8A 4TUKL 4U3XA 1Y0LA 4YH6A 1WQVT 4YBLB 3V4PL 3I3BA 1BIIB 2APWA 2BSSB 2A77H 3KPLA 5DYOA 3VWKB 4WWKA 3QFDA 5JW5A 3L3KA 2PYFA 1J0ZA 1ZHKB 2DWDB 5FK9B 4OZ4A 3VWKC 1C5CH 4H8WH 2FATH 1F4HA 3ZTJH 1M05A 3IFPB 3VXRB 1TLKA 1A1MA 3QFJB 4LEXL 3SKMA