1D2OA

Crystal structure of a single b repeat unit (b1) of collagen binding surface protein (cna) of staphylococcus aureus.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
187
structure length
187
Chain Sequence
ETTSSIGEKVWDDKDNQDGKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDLPKYDEGKKIEYTVTEDHVKDYTTDINGTTITNKYTPGETSATVTKNWDDNNNQDGKRPTEIKVELYQDGKATGKTAILNESNNWTHTWTGLDEKAKGQQVKYTVEELTKVKGYTTHVDNNDMGNLITTNKYTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords COLLAGEN ADHESIN
publication title Novel fold and assembly of the repetitive B region of the Staphylococcus aureus collagen-binding surface protein.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 42
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05738 Cna_B Cna protein B-type domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2oA01
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2oA02
2Y1VA 1D2OA 2X9WA 2XIDA 2XTLA 3GLDA 3GLEA 3RPKA 2X9ZA 4BUGA 2XICA 1D2PA 2X9XA 3B2MA 2X9YA
chains in the Genus database with same CATH superfamily
5KVDH 4PGCB 2VN7A 2L7UA 2G2RB 3DI2B 1AKJD 3EYUH 5CJQH 3IDGB 1I1RA 4JO4H 4OF7A 5K93A 3THMH 1UT9A 1IM3B 3U79A 2VDRH 3ULVL 5LWYH 2W88A 4NNYA 4MD4B 2J88L 1R17A 1YN6B 2FL5A 4Y5XB 1IL1A 3AFLA 4APQA 3L3GB 4FYTA 1GAFL 3ULSA 1UB6A 4DFHA 1KYDA 1TCRA 3H2PA 2Y1YA 1LILA 2LR4A 5FHAH 1ZRUA 2Y7OA 3V0JA 1KTBA 4N3TA 4YO0B 4ZK8A 3VXQA 3K6DA 3HRZC 3LRKA 4CUCA 4CSSA 1BQHB 3SGEI 1SDDA 2CM6A 2A6JB 1A4JA 2TAAA 3C6SA 3GRWA 2Z9TA 5DZ9A 4AZ8A 5CBEB 5JMOC 2XZCH 3GBLA 4WO4D 4MBOA 2VXVH 2CLZB 2X9YA 2IOOA 3HC4L 2DIJA 2A1WL 1ZLUK 1FN4A 2NY1B 1LYQA 4Z5RB 1BEYH 4PYGA 2BINA 5KVDL 5TF1H 3BLBA 3NAAH 1UVQA 1K6QH 1MWAB 3RDTC 3AITA 4OLUH 3EYUL 5CJQL 4JO4L 5GGRB 5MEPB 1UD5A 3THML 4Q6IB 3IB4A 2EYTB 2VDRL 3HBGA 3TIEB 5LWYL 4HGWB 1SZNA 1X7SA 5FGCB 1NOFA 2XXMB 3S3DB 1YEGH 4MSWB 4ODTH 4B41A 2BHYA 2A7BA 3M8OH 1ORSA 4D2NA 4U1MA 4KRNA 4OCMC 4HFWB 4YFDB 1MOEA 4NAQA 5FHAL 32C2B 1QFOA 5LLIC 2F58H 4IBQA 1G9MH 4OZ4A 5DVNA 4XVJH 3N55A 4UM8B 3BZDA 2R1XB 2UXGA 3A6OA 2O6CA 1ET5A 4Z8FH 2EXYD 3SE3A 2WHVA 2XZCL 3EJZC 4EN3B 3QDJE 2VXVL 2DJMA 4ODBD 3DX4A 3LKRB 3L4YA 5IB2B 3LQZB 4O5LH 4QRTA 4L4VB 4HUUA 4XB7A 3D0AA 4EO5A 2P5WE 1AO7D 3NAAL 3R4DA 5H35B 5FOBA 2MNJB 1BAGA 1GJUA 4OLUL 3O41A 3Q7JA 4FLOA 3I6GA 7TAAA 2BVOA 3EOBA 3T0AA 5EU3A 3WJMB 2FE0A 4LFHD 1YEGL 2PTTB 3ARWA 3M8OL 1J1OH 4LGPB 1ZT1A 2AK4B 3SYPA 1MPAH 2YSSA 5EO9B 4WIQA 1QSEB 2E8ZA 4I5BB 4UAHA 2F58L 4Z3EA 4GBXD 3TT1L 4DESA 2HFTA 3OPZH 1G9ML 1F13A 4XVJL 4JM2B 2B20A 4WUUA 4UTBA 3R8BB 3CN3A 4LCWE 4P9HH 1REIA 3LTVA 3PG2A 3O9WC 4Z8FL 1MREH 3MLSH 1Q94A 2L4OA 1EXGA 1TFHA 3LMJH 3IYLW 1DLHB 3F5WA 3SKUD 4JO1H 3CQFA 3QDMD 4O5LL 5AVWB 3QZBA 4ELMB 5IVXF 4U3SA 3U1QA 1R6VA 4MJIE 1K5WA 3ZSSA 3IEAA 3MNVA 4GEIA 2A4CA 5I8EB 4PR5B 35C8H 1WD9A 1HSBA 2YD8A 4EVNA 5E6YA 5F9WC 1HXMB 4JFXA 3TS8A 3FT2B 3AM8A 3TN0C 4LPCA 4E41D 3MLWH 1AZNA 5ACLA 3TVMB 2Q3AA 3PQYE 5BW7A 3PFQA 1YNTA 4KROC 1MPAL 2P5ED 5DJ6A 4FABH 3NSDA 3CBKB 1QLFB 2JQAA 3LKSA 3TIDB 5H4YA 2R29L 4NZTH 1MFVA 1FLRH 3IAGC 3OPZL 4XH2A 4JFOA 3IPBA 3P0GB 2ATKA 3HE7B 2BSDA 3DGGA 2PKDA 1F45A 4P9HL 5IB1A 2H8PB 1P4LA 1YYMH 1UM5H 3MLSL 2LT9A 3LMJL 4PIBA 4XZUA 3SDYH 3SKOB 1P9MC 1JPST 3K2KA 3TZVD 4JO1L 4XHJC 4NXSA 4NWUL 1B2WH 5BOZG 1SLXA 3VQLA 1CS6A 1WP6A 4QHMA 1EEZA 5EBMA 2WQSA 3ARDA 3AWFA 5C0DA 4GG8A 4N2FA 1BD2A 1KPVA 1UG9A 35C8L 4LSVH 5I6KA 1CURA 2ZG1A 4G8GD 5HYJD 5HI4C 4KJPD 4TPRH 2EUXA 4G2AA 2XFXB 5IB4B 2WN3A 5E1IA 4LL1A 1WH0A 2DI9A 1JV5A 3C60C 1ZV5A 1KJMA 2FX9H 3BPOB 3JTSA 5FUZH 2DWYA 4FABL 2XKUA 4ZOEA 4CC4A 4MNQB 2EH7H 3QAZC 1MFNA 2ZUWA 3V9FA 4ZMWA 4NZTL 1FLRL 1DQJA 1DZ0A 1KTJA 3GI9H 4B3EA 1S7TA 3BSZH 3BEVA 1VLXA 2FYYB 1JXKA 3S97C 3U83A 1FQ9C 3QUZB 3HMXA 4ETQB 2R2EB 2TSAA 2XY2A 3Q6GH 1X4XA 4KY2A 2CU9A 4TTDD 3TO4A 4BQ8A 4QIRA 3Q1EA 4NQEA 3UL4A 4WI5A 2IAMB 2AJVH 1JK9A 1FL6B 1ZA3A 3SDYL 4XNMA 2EE2A 3R8QA 3P73B 3EGXB 5IVZB 1BJ1H 3H9SD 3NBNA 1B2WL 4XP6H 1EFXA 5E56A 1T80A 2DQEL 3IMVA 2D31A 3ZDYF 3EDEA 2JKXA 4U1NB 3L3OC 1FVEA 3PL6D 3VW3H 1NGXB 2ZD0A 4TPRL 4XCEA 4KHTH 3JVFC 1I85C 3P2TA 4HCRH 1ZS8B 3GSWA 5J9PB 3EFFA 4FJZA 3JWDH 3UTQB 5BVPL 2FX9L 5FK9B 1D5BA 5IB5A 2VMFA 2XWCA 4YSEA 4AIOA 2EH7L 5JIDA 3GXNA 5GS1C 2NY6C 4FQ2H 3GI9L 5KZCB 1XF3B 2J21A 2GEQA 2ZJSH 4KXDA 1S7UA 3MR9A 1FH5H 5FYLH 3ZL2A 3TF4A 2J4WH 4FMFA 3F7YB 4MZ2A 3K72A 3VCLB 5F1IA 5DC9B 3N41F 5I15H 4BA0A 3IJYA 2E46A 1OZTG 1ZEAH 4WWKB 4XP6L 2QADC 1SXZA 4OR1A 4IIQB 3KLHD 2DIEA 4MS6A 2W60B 2VISA 3V6OE 3PABB 3TYFB 4ZG1A 2WGXA 5F7DA 4F2EA 4NKMB 2HAZA 5EC1B 3TONA 1AHWB 3QO1B 4KHTL 2A74B 5JOFB 2C9VA 4GQZA 3Q43A 2AABH 1BJMA 3QFJD 1BSIA 1E9PA 3JWDL 2BZDA 4WI9A 1AIFB 3N2JA 4X5QA 1JZEA 2F53E 3RWDA 1OCZB 1QFPA 1RXLA 1U95A 4GKNA 2QGDA 4PS7A 3GXUB 4ZSOA 4YVNA 4PJ8D 4JHWH 3T6WA 5DJCB 4PVNA 4KK6C 3R18A 4HMCA 4U1JA 5D7LA 3GSVB 2E3VA 3F12B 3QNYA 2ZJSL 1ETA1 1P4UA 1TZGH 3VWKA 3K6SB 1FH5L 3L3HA 4V11A 5FYLL 2I69A 3U0WH 2J4WL 1IQDA 1GMEA 3Q9PA 2XBZA 4JFPA 3X3FH 1KGUA 3NFSH 4KTEH 4XO4A 3W9DB 4K07A 3SY0A 5I15L 2KT6A 2JCWA 3CXHJ 4ZNCD 4F2ME 3F7QA 4DT2A 1TZOA 1BECA 1ZEAL 1ECYA 5L0QC 4E36A 1AOZA 4KI5D 4P5TC 4HBCH 5DRWA 2LE9A 2V2XB 1T4KB 1QLRA 1T7ZA 3FCSA 4OKVA 2DWEB 4AMXA 2ZP0T 3LIUA 4E42A 1D7BA 1EDHA 2VDQB 2AABL 2VAAA 3TOPA 3FOLB 3FU5A 4LPUA 4POYA 1JGDB 4L18A 4D9LH 4OQ1A 1WT5A 3BD3A 3F64A 3TJEH 5E8EB 4BCZA 3QUXD 2VAJA 2FQGA 3VXOA 2PW2B 4JKKA 4TLUA 3POHA 2AI0H 1TJIH 3HBPA 4HCIA 4JHWL 3BGAA 2FX7H 3NTCH 4PJBE 3U0WL 1FFOA 1IX2A 4G7QB 1NAMA 4G7YL 3QDGB 4H8QA 5C0AA 3PWVA 3X3FL 3NFSL 4KTEL 2XQYG 3R19A 3O45A 2J1YA 5CINH 4C56A 2FSEA 2F61A 3WY3A 1RZPA 3FOMB 3GJFK 43C9B 4JDZB 4YGVB 2ZXGA 4XPAL 4AQEA 5GIRB 3HG0A 4E5XB 1YNKL 1Z5HA 2VDPH 2ZKWA 4UOZA 2WLIA 4GSUA 2X53A 1I1FB 3WI9A 2BS8A 1E7UA 3DRQB 1GSMA 4NRZA 2CMRL 4MLIA 4AYFB 2OSYA 1MDAA 1X4YA 1N70A 2AS5M 2UWEE 3BZFB 1XL6A 2EDOA 2MWCA 5E99H 4N8VB 3V0GA 1AKPA 4L1TA 3DDFA 1KDJA 2UY6A 1UB5A 2C9PA 2C8NA 3LCYA 3TJEL 4OJDH 4W9DC 1T1ZB 2AI0L 1TJIL 4MB5A 2FX7L 3NTCL 4UQDA 3ZQWA 2C3GA 2Y7QB 1CDIA 3GMLB 3LPPA 3VG0H 5IJVA 1ZSDB 2B77A 3B6SB 3D39A 2VC2B 3QISA 1P5UA 3RKPA 2EEAA 4RIRB 2H26B 4U0RB 4G42B 2JSFA 5CINL 1AFVH 2GPZA 3KM2A 4GRWE 5IOPB 3ZE0E 2B16A 4UIKH 3CCHA 2WXIA 1GW0A 4DO5A 1HTYA 1LHZA 4ZMXA 4P2RB 4NC0B 3WELA 4Y5VC 3CC5B 1NCCH 3VMNA 1AI1H 1NL0H 3ABZA 2IXQA 4G6AD 3WEAA 3Q6FB 4RDQF 1WLHA 1DANT 4LEXH 2F7IA 2EXSA 5IQ9B 4AZUA 4OZGB 3TH2T 2RJMA 1U8OA 2BZCA 1P7QA 4S1DC 1PKQE 5E99L 4PCTA 4YFEA 5B8CA 1JDCA 3QYNA 3FQTB 1A6AA 1MG3C 3G5XA 3D25B 3ZW3A 3EKCA 3PIQB 1AQKL 4NP4H 4NO0B 1BZ8A 5FO7A 1IMHC 2I07A 3CBJB 3OQRA 4L1BA 3T0EA 3ZKXC 4FG0A 4XOAA 2UX7A 1MCLA 2NDGA 4RFNB 4GEJA 3VG0L 3AG4B 5IM7B 1QFHA 1LEGB 1TENA 5AOJA 2QFRA 3OKDA 4WGKA 3B8YA 1SY6A 3LRSA 1OP4A 2F6AA 4FQXB 1AFVL 3QJRB 4UIKL 3LIZA 4U3HA 1SJVA 5LCVL 4Y4HC 3UTSD 1CD8A 1KGCD 2Y6SD 1IGYA 1NCCL 2EYRB 1AI1L 1NL0L 3Q01A 3TT3H 5IG7A 3ZDXE 1B0GB 4NS0A 2AJUH 1W72B 1C08B 2OL3H 4A6YB 5K39B 3FFDB 2DBLH 2WO3B 3PWPA 4LEXL 5EO0B 3VX0A 1KTCA 3MOQA 5T1JA 1JGUH 4FMVA 5KS9A 2JB5H 1I7UA 3QXAB 2FIKB 1DFXA 1AP2B 3RE0A 2X4SB 1IGTA 3UBFA 5DZPA 4M8QB 4NP4L 4JFZH 4YDVB 2W9LA 3L45A 2EZ0D 3HB3D 4PGJA 3HE6A 2XN0A 5ENWB 1Q1PA 4WI2A 3QFGA 5F7LB 4ZMZA 5B1BB 2WQXA 2NQCA 3X3GH 2Y7SA 3HI1A 5AVVB 3CLWA 4KJQD 2PYFB 4FQIH 4NN6C 4IYKA 3V6BR 2CCWA 2OX5A 3SDAD 4I3GA 1RIUL 2VLLA 1JPFA 5F3BB 3KGTA 1GZQB 4N2MA 4I88A 5IJKA 4X98A 2R59A 1T5XA 2WXPA 3TT3L 1ZT7A 2B4CC 3DO7A 5F7YC 2AJUL 1ZTXL 1MW1A 1MCPH 4JFFD 1HDMB 2DBLL 4IRJC 5GGQH 3HN3A 5LDSA 5GHWH 5HJGA 1JGUL 2D7NA 4NKDA 1T6VN 1UJ3C 3CTTA 3X13B 1U3HC 1DBAH 3IETA 3U6RB 4D94A 1ZD6A 3HG5A 3QO0A 1V27A 3GNMH 1U0QA 2RQEA 3V0EA 4NBXB 1UC6A 4U33A 2D03H 3OAYH 4X5XB 3VYPA 4JFZL 1T3FB 1H3TA 4CVXA 3ATEA 3QJFB 5F7AA 4Y5YB 2MQCA 4PJEB 3P11H 3SDDC 4H26A 4I9XA 3S4SG 1OF2A 1OGPA 1UCTA 4PJ9C 4YFLI 5M94B 1JXDA 2AJXH 4O2FA 4PV9A 4C8XA 4YUEH 4HJUA 3X3GL 3MLUH 3KLSA 4L1SA 5I1DA 2UY7A 3ZY7A 4FXKC 3RNKB 2LU5A 3G08B 4D8OA 2XX0A 1KJ2B 3CWGA 2FECI 3DJTA 1ERNA 1UD4A 4FFVD 4L8DA 3UO8B 3WYRA 1Q1JH 3DV4B 1MCPL 1F4WH 2GHZA 3GXFA 4H25A 4BZ1H 5JR1L 5GGQL 3CZNA 3OKNA 5GHWL 1NKGA 2JKLA 4A6YH 1CGWA 3CN4A 3V7AG 3DJSA 5FHBH 1DBAL 5TGBB 5HYSG 1I1YB 4A55A 2VB5A 1F3RB 5CO1A 4EUPA 2BXYA 3GNML 3GWJA 4RGOH 1QABA 4F37K 4GW5B 5BQ7A 2D03L 3REVA 3OR6A 5JHDE 3MGOB 3DRTB 3MMEA 1OW0A 3P11L 5IGXH 3WNJA 1Y0LB 4YUEL 4V1DD 4C4BA 5D7JD 1WCBB 4RAUA 5EBLA 5I75C 5H94A 4DP9X 3MLUL 2D2OA 4M29A 2YO3A 1I8IA 4OD3H 5B1JA 3DX6A 3DECA 3LS4H 3DGCR 5EU5B 4UI2A 5C08B 1D5ZB 2P8MA 3VSTA 5JHBA 1Q1JL 1DVFC 4KX8A 4N26A 1F4WL 4Z7OE 3BVVA 4ERSH 4BZ1L 4LSSH 3RWCA 4TVPH 1W72L 3AACA 4A6YL 1EXUA 5EDSA 1TG8A 1NAKH 1U8MA 2V8MA 5FHBL 4UU9B 2B5IC 4PY8I 5IWLA 4DVBB 3SGKC 1X5FA 4YZFE 1HOCB 4QHKI 4RGOL 5AW2B 1QFWH 3NSCA 5MERA 5J1SC 2YD6A 3J8F7 3US1A 1BHGA 1MZYA 2SEBB 2AQSA 1L3NA 3VXRB 5IGXL 1C16B 2CXGA 5C0CA 4M6MH 5EG6C 4E9LA 2K3HA 5CLWA 5CCKH 4H8WH 4LCWA 4C55A 4RRPA 4IKNA 3WE6B 5I19H 3A22A 4JK0D 1GTNA 3DJZA 4OI7A 2K9FB 2IIJA 5AW6B 3OB8A 3ARBB 2EIBA 2G5RA 5FYJD 4OD3L 3QZMA 3ZQ9A 3LS4L 1NBCA 4MJIA 5JDJA 2JIXD 2I5YH 3SPVA 5KN5A 1NBQA 1OT2A 4NOBA 3PGDB 2GTZB 1TZIB 3QCUH 3U30C 6TAAA 2OMNA 2AANA 4ERSL 5FECA 1F1AA 3BKYH 3CFCH 5F88A 4LSSL 4L9LB 1H3GA 5HDQH 2V2TA 2IH9A 1PFOA 1R4XA 2JI1A 2HX8A 5BO0D 1O9ZA 3GMPB 1QFWL 3D33A 2D3JA 4D7BA 2MKLC 4KDWA 4DGVH 2QKIA 1WZMA 3MRGA 4BJLA 4GBXB 5DJ8B 4QXTB 4M6ML 2NW2B 2Y7NA 2EECA 5AZEH 4H8WL 3R06A 4K23H 3MJGX 2YPKA 5I19L 2VDLH 2MIZA 3JV5A 5KWYC 3G6JB 1SYSA 3NFPB 4RAVB 1O7SA 1ROCA 4NZRH 2RB8A 4ZUTA 3QDMB 5GGUB 4Q8BA 2WLKA 1IVTA 2I5YL 1MJJB 1XB8A 3QZLA 4L4TE 3N1GC 1OPOA 5SX5K 4EDXA 2QR0A 2L04A 4M56A 3L5XH 4C83A 1DHKA 1XZ0B 3BP7B 3BKYL 3CFCL 4S0SD 5GZNA 4HSAC 5LB1A 3QNZB 5D1XD 3L95B 4AUYA 1YECH 1R75A 3I84A 5D1QE 5CLYA 5HDQL 1NFIA 5C3LD 1SMDA 2OMWB 4PB9L 4E41B 4BQ6A 2KI6A 4GSXA 3OR7B 5DD1H 4Y2DD 4BFIA 2HT4D 3QPQC 4OGQC 3WFZA 5ESQB 2EJ1A 3QEUA 1KLGA 2BOCA 4JFTA 4MJ2A 3PWUA 5E6IA 3SE3C 2A5UA 4K9EC 4HC1H 4B9GA 4OFQA 1CICC 4TYUA 3BWAA 5AZEL 5CEYA 3RY4A 4EKJA 3LPWA 4LU5H 4Z7VE 1UA6H 3FRUA 4K23L 1A4AA 3IJHA 3OXSB 2VDLL 5I8KH 3MJ7A 3C6LA 4YMPA 3INUH 4NZDA 2F0CA 5DS1A 4TVPE 3UTTD 2XWTB 2ICWA 3DLQR 2WWMC 3ETSA 2MJWA 1GYVA 1D5MB 4NZRL 3TBSA 2VUKA 4FNUA 2VR9A 4PS8A 5AOZA 3ZT7A 1Q9LA 5DVOA 1KEGH 2FEEI 3WFHB 2FSDA 2GJ6D 4K3HA 1MAJA 3RVUC 5JLZB 1GZHA 4KRPD 3UERA 4I0KA 1J5IA 3L5XL 2X9WA 3Q5TA 3B1UA 1YECL 3RGVA 3NJKA 5IMMA 1E9OA 1QR1A 3SJVA 4Z76A 5AOIA 4G43A 5BRZE 1XR8A 4M61B 5EU6E 1TTCA 4B96A 4NDMB 1PAMA 3P9MB 4HMDA 5DD1L 3LXCA 2K0RA 2AQRA 4S0TD 4YHIB 1NEZG 4FQQB 4G8FB 3SDXB 3DVFA 4HC1L 5IFJB 2Z3FA 4JY4A 5H2BA 4LU5L 4EI6A 1UA6L 3SKMB 1E42A 3VFTB 4HFUL 1YUKB 1UKTA 5I8KL 3ZHDA 3DVGB 1QSFB 1KCUH 4I9WE 2RFXA 3QUYB 4LOUC 5JOEA 1ZOXA 3G6DH 1ND0B 3LD8C 1KEGL 3KGUA 1G6RH 2ODHA 4WEEA 5ESVA 3LDBC 2E5EA 3V6OA 4CN6A 5K9OA 1FORH 2B3IA 2GT9B 2VLRA 5BW7C 4FL4B 4OJCA 2AJSH 3NFNA 4QY8B 1I7RA 4UUJA 2XICA 3ARUA 3PL6B 3ZGIA 5GQBA 3STBA 3OL2A 4R26H 2F53A 3D52A 2M2DA 3SD2A 2E7DA 2VLJE 4NLAA 1CIUA 1MXGA 5DDHA 5IQ7H 3LHPH 4N2GA 4AQ1A 3N40F 3O2VH 4GUPA 1DUYB 2EKSA 3IAQA 1KYOJ 3D6GA 5F8QC 1UZ6E 1BIIA 3RKDC 3S5LG 4G82A 4AE1A 4KXCA 4L37B 1KBGH 5E5MA 1ASOA 5HTSA 4BZYA 1KCUL 3G9AB 3MLTA 5KSVA 5BZDB 2V5RA 2XWZA 4KOCA 5I2IA 3OJDA 3G6DL 2Q76A 1F97A 2GBTA 3UAJC 2NY5H 3IU4H 1G6RL 4DP8X 1FORL 4QYAA 5FDWA 2K8MA 1UM6H 3DMMC 5AB1A 3BSZA 1HKFA 2F15A 4CC4C 5I1AB 4FD0A 3IMUA 1BXVA 2J6EH 2YBGA 2QVKA 4R26L 2DTMH 4GRMA 3PE9A 1W80A 5FM5M 5TJWK 4ZX3A 3EJUA 4X42A 1LNUB 1X9QA 5A16B 1AE6H 5SX4H 3S3JA 3FKUS 4MXWH 4JDTH 3KJ4C 5IQ7L 3POCA 1TQVA 5DQ9B 3O2VL 4WSGA 2MFNA 3A21A 3UROR 1MI5D 4PJBA 3EBGA 1F3JA 3TNMB 4HS8H 3BX7C 2PPCA 1KBGL 4PPTA 1U3YA 2CUMA 2NXZC 1CTOA 4FFWD 1JN6A 1A9EA 4FTVE 4HCRA 3MUY1 1WJ3A 3IDMB 4DEPB 3C5ZD 3JBG7 4XC3H 3AU1B 1I3RA 2NY5L 3IU4L 1LJMA 2HVJB 4QDGA 3QWQB 3BXNA 3FQ1A 1MEXL 3CPLA 3DI3B 5BCAA 1YEEL 2FLRT 1UM6L 2AEQH 3GSQA 5E1AA 1CXIA 1FL3A 5FA4B 1P2CB 1DP0A 4PBDA 2UWEA 2J6EL 1F11B 3BGMA 1SBBA 5CXPA 2B7DT 4BSWA 3MRQB 4KY1H 3IMRA 3IPFA 3ARGA 1AZZC 3L1FA 4HW6A 1AE6L 3UPAA 1SXCA 1YVLA 4MXWL 4JDTL 4R2GC 2X4QA 4HZLA 4GRWF 3QUXB 1M53A 2A73A 4GPVA 3FO2A 5GZOD 2EDBA 3QIUA 4WFGD 4A1RA 5J13B 4AQZA 4HS8L 2XJLA 2DMKA 4YDNA 4H8PA 4KPHH 1KN2H 2PYEE 4KKAD 5KUKA 3HVDA 4M7LH 1SXAA 3REWB 4BFEA 5CM1A 1HCYA 2BVPA 4MA1B 3T4YB 5GSRB 2N0MA 2EYSB 4XC3L 4NQSA 3ZKMD 1IT9H 2P8LA 4PWGA 3UFIA 4ZYKB 2EVIA 4UIMA 5LQBH 3IFLH 4PJGF 5C0NC 5AVTB 4KAQL 2VR5A 3SCMD 3RL2B 4YE0A 5DVKA 2ZOTA 1XD1A 1GZPA 4OCXL 1AGDB 4LCCC 5KSAD 5IHBA 1TYJA 1NCUA 2W65A 4HUCA 4AMWA 1PKQA 4ZS6C 2CO7B 5F93C 4ISVA 1ACCA 5MENB 3KYOA 4AK2A 3SDCB 2E7LC 4OSUH 4KY1L 3VGAC 4POZD 5DHVH 2EDJA 4HDIA 3WS3B 3ETTA 2VABB 3ES6B 4NNXB 3LV3A 2X09A 4HK3N 3ZTJH 1S5HB 2AXFB 1A6UH 1X5IA 3GGWA 4PRIB 5DFTA 3TA3A 4HPHA 4ES8A 3MAWA 4LP4A 3JT0A 3FBQA 2EC8A 3SE8H 1E4WH 3DX9B 4Y8AA 1UWGH 5DFWH 3ZE2F 2K78A 2O5NA 1QRND 3QDAA 1JZDC 1IRAY 1FAIH 3ZDXF 1KN2L 4BUGA 3C5SA 1MHPL 4XCNA 5HDBF 3DX7B 4M7LL 4PJXE 2NSXA 1E67A 4MB4A 5DUJA 1IT9L 4NPJA 2VXQH 4PTUA 2DQCH 3CH8A 3IFLL 2XSKA 5IQMA 4FKEA 5JNYA 1XR9A 4OV5A 4HIJB 1BZ9B 1IC7H 1A6WH 5MI0C 2CGRH 3L8QA 3BP6B 4K3DH 3DO3A 4GG6E 1PQZB 2H0PA 4Z7WB 5EF2A 4I2XB 3GZOA 1AY1H 1XXDC 2D2CC 4KNQA 3U6XS 3CFNA 2CJUH 4X99A 1FO0B 4OSUL 4JY6A 3RVWD 4HWNA 3NJVA 1N26A 3IFPB 3G5ZB 3WN5A 3CX5J 1IEAB 4EI5A 4WV1B 1A6UL 1WA2X 1V7MH 3OTTA 2IH3B 1XMWA 1OGAD 3DO4A 1NPJA 4NZJA 5D7EA 2PR9A 4HJSA 1E4WL 3SE8L 2V9TA 4D0BB 3OWEA 1UWGL 4IBSA 2Q10A 5F1KC 4U1SB 3QEQD 1NCWH 4B95C 1FAIL 1RIHH 2YJQA 3NCXA 3OAZK 5D2LE 5T1LD 3RJOA 1SJHB 3CFBB 2AQPA 5I0ZA 4O51B 3ATAA 1IGFH 2J2ZB 1N59B 3FONB 5DTFB 1J48A 3KH3A 2DLIA 4MAYA 3CDCA 2DQCL 3C08L 1JMXA 4Y4KC 3WXVH 3GJEA 1IC1A 1ZVYA 2ZYSA 2AQNA 1IC7L 1A6WL 1R3LB 3Q5YA 2OYMA 2CGRL 3PJSA 4Y16B 3R7RA 4K3DL 5CSZA 5J6HB 1I1CA 1KGWA 1AR1C 4PP1D 1Q38A 3H7BB 4O2EA 1NICA 2XN9B 4PJ6A 3BD5A 4RAHA 1NWPA 3ME0A 1AY1L 4YIQA 2ZX6A 3NOIA 4M5YH 2HT3C 1WTLA 1V54B 1YQVH 2BRRH 3DOHA 4HJ0D 4Z7NF 3NIGF 4PJ7E 5FUCC 2FNWA 3WDHA 5I71C 4J3OG 2WCPA 5EUOF 2WXNA 1OCRB 4AJ0A 5TDNB 1V7ML 5D7SH 3GBEA 4IS6A 4JANA 3K1KC 3H2WA 4QRPE 1R0AH 3SO3B 3MRIB 3LRLA 1S7SA 3ENEA 3JQOB 3S4SB 1JYXA 5EH1A 2XIDA 3WHXA 2WB7A 3NCWA 3VRJB 3DBXB 1NCWL 4N1CA 1RIHL 4LVHC 4PRHE 2WBWB 4WVRA 3KLKA 1P53A 4N4YB 3RURA 3VXME 3VXPB 1M7IB 1NUNB 3V5DB 4A7GF 3VJ6A 1P4BH 3KL0A 3WTXA 4YS4A 1IGFL 5AW3B 1U8LA 3SDAB 1GGCH 1T04A 5L2KE 4I18C 3IKKA 5E4AA 3WXVL 3FN9A 3MBEA 3IXAA 5E9DA 1QBBA 2JKNA 3RVTC 4IU2A 3NJXA 4V33A 4WDIA 4P5KA 4LZKA 4RGMC 5GJTH 3GLEA 4N9GA 3VI4B 4JFFB 2IALB 3RWIB 2IDCA 2IJ0C 4LVNC 4PWEA 5B7MA 2EDXA 3KPPA 1S7VB 3MO1B 4NC2B 4HUNB 3T0EC 5I8CA 4M5YL 5E24E 1KPUA 2BRRL 1UOVA 1YQVL 2AEIT 3VFPB 4P99A 4P3DB 4M00A 1SXBA 5HYSB 5JA8B 2K70A 1SOQA 1FO0H 4AV5A 4XN7A 5D7SL 3OHXA 4X7TB 1UKQA 3HHSB 4Q0XH 3O3DA 1R0AL 4HT1H 2V3EA 5HHQA 5GPRA 1BWWA 2OL3A 3KPNA 3GM8A 3T8VA 3NIDB 2ZAHA 3MODH 4Z7OF 3VXUD 4Y1SA 1P4BL 1CYWA 4DAGH 3INOA 4IOFC 3X14B 2FUTA 3IMBA 4ZT1A 3E9UA 5KVFH 1PTZA 3N85H 4ZFOA 1B0RA 3K4AA 2CCLA 2BIPA 3HZYA 1YY8B 3LN4B 4YZFF 2YUZA 1TTAA 5ABAA 3PGCA 3GMRA 5GJTL 5IEKA 2NX5A 3ALPA 1FNLA 4YDKL 4KKCC 3EJZD 5HHPB 4XVSH 3FO1B 4NFBA 4H0IA 1TFPA 1UWXH 3HE6C 4F5CA 5CILL 5IV2A 2LW3A 4L2LA 3QXTA 5HPMB 5JDSB 5E8DH 3BIKA 1QWHA 2YQ2A 1TZHA 1PX3A 3QEHA 4P2OA 2BOBA 3Q0HA 2ESVB 1QFUH 1FO0L 2X44D 5DJ0B 2XTJC 5IUSA 4L8SB 1KSRA 2V5MA 2IADA 4ENEC 2J1WA 2Z6FA 5C0IB 4Q0XL 2VWEC 3T1FB 4HT1L 5HHOD 2OYLA 3MRMB 1HE7A 1YMMB 4DGWC 2VERA 4KZ0A 4V1DB 5D7JB 2ZZUT 5IJKC 1CDHA 2VTFA 4JS7A 2C3HA 3MODL 3UG5A 4R4BA 4JZJC 4DAGL 4JJHA 5KVFL 4WKZA 3N85L 5EBGA 2ICCA 1GC1C 2BIQA 2DYPB 3U7YL 1SQMA 1YCSA 4JEGB 5C09E 1LQBC 3O9WD 1E9QA 4LLVB 1BW8A 1PZ5B 3MOBH 2WKGA 4OFVA 4XVSL 5BS0E 1J8HD 2ZYHA 5DA4A 5DJXA 1TQCB 1H5BB 2PP9A 4ZO7A 4CKQA 1N3NB 1JWUB 2J8HA 2Q0ZX 3T3MB 1PMYA 5E8DL 1GYCA 2AJYL 3F58H 5F0MB 1QFUL 3LPFA 3EGSA 3CZFA 4MXVF 2AZAA 1AXSB 3BI9X 4GW4A 1ZHKA 4YC2C 4ZQTA 2PPDA 3TN0D 1LL1A 3E3QE 3G5YB 2ITCB 1DQDH 3EFOB 3IFNH 3O0RH 2FD6L 4PJDA 3L4WA 3J07A 4UM9A 4Y1AD 1AH1A 1OTSC 5FFLA 1AGFA 5E94A 1KC5H 1DANU 4HS6B 1CF8H 3KXFE 1EJOL 2AQQA 3MJ9H 1HK6A 5DJYA 2FEJA 1MSPA 4IOSD 3AJ7A 3RWFB 3OKEB 4XXDA 4L4TA 5TF0A 3CSYB 2JIXB 5INDB 1A21A 1OB0A 1FFQA 5AD0B 4S0HA 4IK7A 1MFBH 5CZRA 2BMKB 4MQ7A 43CAB 5CJXA 3K46A 3MOBL 3KPLB 5D1QA 5ALCH 3BQUB 3IMTA 5L4JA 3E6FA 2ZE0A 4KVCH 4U1KB 1OW0C 1X5AA 2JLPA 1W0WA 3ZLQC 4GXUN 3WNKA 4NQXA 4XHJD 2FEDC 1PX8A 3LHAA 5CGYC 1PU0A 1Y7VA 3F58L 1RHHA 2MHAA 5D96C 2DD8H 5F9DC 1EMTH 4E0RB 3ULVC 3GC3A 4P46A 3H0TA 4BZ2H 3OX8B 4JQVA 5B1JC 2YD4A 4PY8J 5B3JF 3BP5A 1HZLA 4Z7VA 1DSFH 2V17H 5HI4D 3P40A 1DUZA 4HCGA 3NZ8B 1INDH 5AW0B 5LAXA 3O0RL 3IFNL 3C60D 4N6RB 3RFZC 3S2AA 3KGSA 2GSGB 5E8PB 2OQJA 3C8DA 1CF8L 1S9XB 1EFQA 1UA3A 3I6KB 1KV3A 1UEMA 2HN7B 3MJ9L 4X0KA 5C7XH 5EOTB 5I1LB 5F97E 3IDIA 1F00I 4MJHA 2FGWH 3SGEH 4JE0A 3TBTA 2F9BT 4FNQA 1O9VA 3O3AA 3GZKA 1K5NB 1MFBL 1E4KA 5F1OB 4OBSA 1LP9B 3O6FA 1U8NB 3BO8B 5F9AC 1JIBA 1Q9WA 5ALCL 4HH9B 4KVCL 3FU8A 2BWDA 4B53A 5BRZA 3HR5B 5BRQA 4MJ4A 2EILB 4FADA 2JFCA 5AAPA 3LZNA 3IT8D 4ANUA 2LLNA 2F8VA 5IMLA 1AD9B 3VDAA 3BP4B 4BZ2L 3V0DA 1NEZB 4FQLH 2MEJB 1DSFL 2V17L 5GGSB 3OZ9H 4XOEA 1INDL 3MV9D 5L4MA 3DHPA 5JW4R 1WV7T 5TDOB 2ZAIA 2JQZA 3AXIA 4OFYD 1D5RA 2BNUB 3ECUA 1HHKB 5FFGA 3C5JA 4JFVA 4HX1B 4OCRH 2QLVB 4PJHA 3RIAF 3UH8A 1M05A 4GLRH 1BLNB 5C7XL 5GRWA 1JGIA 3FJTA 1K9TA 1WAAE 2NY6D 4W68A 1JHLH 5KYYB 2GJ6B 3MYJB 2FGWL 4KRPB 1C1EH 3LXBA 2X6AA 1YPZA 4BQCA 3QWOB 2FK9A 4AENB 2BIMA 1KLFA 1WK0A 4WJKB 5HHNB 2KLRA 4YLBA 4NSKB 2GK0A 3OAWA 4G1MA 2HLAB 1BQ5A 4AM0A 5IMOB 1WUNT 2FB4H 2LQRA 2QADD 3BUIA 2DQ6A 5SWZB 4NENB 2VLJA 5AYUH 1D9KA 1OP5H 1W8OA 4N3UA 1T0OA 1LQSR 1TMCB 2IQAA 1RCYA 3DOSA 4KMQA 5KSBF 3PAUA 1B9ZA 4OU3A 3UEZA 2YGOA 2P7TB 1U8HA 4R4NC 2EO7A 3CSPA 1U21A 2B1OA 4ADJA 3PWLA 3T6QC 1N19A 3WTVA 4U1IA 4LSTH 1WFMA 3OHMB 5TK4A 3VI3B 3TCLA 3U0TB 3S5LB 2DIAA 3RPBA 4P0DA 5KVMC 5DK0B 1JGLL 3GUTB 3GSXB 3T8XA 1Z9OA 4HPOH 2ALWA 1C12A 1G9MC 4OCRL 4OB5H 5GZNC 1QI5A 2APFA 4UTBH 2HUEA 5HGHB 5FF6A 4X6EB 1RI8A 1JHLL 4KK6D 3T3PE 3EF7A 2YIHA 4R7NB 1C1EL 2C9UA 2H2SC 4HC1A 2I26N 4NYLA 4N2NA 8FABA 1UCBH 3HUJF 4WFHD 4GAYA 5DRNA 5E03A 3S37H 2H41A 1CL7I 1PLBA 2YAMA 4JPWH 4R7VA 3CSFA 2FB4L 4PJ5E 4KTGA 3RL1B 2X42A 3BIAX 3NA9H 4P23C 2O5YH 1ZHNB 5AYUL 5L2JB 4FI6A 1COBA 1PEWA 3C6LC 3NACH 4P5TD 3GBNH 5BOJA 1JZIA 4PB0H 3MV8E 3LNDA 2AERT 2K45A 3I75B 4PJIB 5DUMH 2CXKA 2F1EA 1A5FH 1IM9A 4PRPB 5MEOB 1FNEB 4LSTL 5IJCC 4XVTH 3AREC 5BJTA 2A6IA 2JKIS 2Q2EB 2JKSA 3CHSA 5LNDA 3HG3A 1G7LA 1P4IL 4YSUA 5FA3A 4TVSa 4HPOL 4FERA 3PV6B 4L8CB 5A6IA 4OB5L 4APXA 2B0SH 3AB0B 4FCHA 3FTSA 1N68A 1ZGLB 4UTBL 4GP8B 2WLJA 3B9AA 4JAMA 3BESR 2CR6A 4NIYE 5SV4A 3RGVC 4P9HC 1DN2A 1R5WA 3MGTA 4IHOB 1WZ1H 3BPCA 4AT6B 4GIAA 4DP0X 2ENPA 3MV01 1G7QA 5TQ0H 4IK6A 4JY5H 1UCBL 4WHDA 1QO3B 4DVRH 4MB1A 4JPWL 2QBWA 3W11C 1JZ4A 1SLWA 3WLWC 1EZVX 3V5KA 2O5YL 4ZAKC 4PGEA 4DZBB 1SEQH 4HJIA 1EAQA 3KVQA 3NACL 3C9NB 4AYBA 4PB0L 4QRBA 2ZWZA 4I4WB 3G6AA 5IHZB 2GCYA 1G6RA 4LVEA 5KYXA 3N43F 5DUML 5E4EC 2KDYA 1A5FL 3N0AA 1FV1B 4W1TA 1MI5B 4LHUD 1MRFH 1DQQA 3BAXA 4XVTL 5AUMA 3RVVC 1CLZH 3D51A 1YY9D 4EAEA 3WY4A 3L3IA 4GXVH 5GS2H 4U1GC 2B0SL 4NKOB 4YAQB 3C5ZB 1A47A 2I24N 2X4UA 1S9WA 5ABDE 5K9KB 3QUMH 1KIRB 5F3HA 1VHPA 1WZ1L 5E5LA 2R8SH 2QDVA 3UZVB 5JORB 5TQ0L 3CDZB 1HX0A 4JY5L 3H56A 4DVRL 4EN3C 5L88H 1ZV2A 3IJEA 5KVEE 4AQ1C 2JB6B 4FYRA 1CLOL 1KJ3H 4G6KH 2HX7A 3QHTC 4XMTA 1XCQA 1SEQL 1U58B 5J6SA 4PG9B 4AG4H 4KJWC 4DPBX 2YXVA 4M4PA 1F58L 3ZKNC 1VKXB 4UT9H 4LKCB 4YBHA 4Y19D 5B1AB 4JCMA 5KJ4A 4KGLA 1SHWA 4WU5A 1RSFA 2P5PA 1MRCH 1MRFL 5FO9A 5MP6L 2AZUA 4S1DD 1MCRA 4Z7UF 5EFIB 4Z77A 3E8UH 1A6TA 2VSCA 1YG9A 2R1WA 3MJ8B 4RVBA 3NSYA 4ZS7H 1OM9A 2WZ6A 5KYNA 2VR7A 1CLZL 1KBVA 2XKNA 2O26U 4L4VE 4PJXA 1HHJA 1S8DB 2YMXH 5ETUB 1URZA 5DGQA 2BSBA 1T20B 4GXVL 4X7DC 4GG6F 3DXAD 1HQRB 4YR6A 1XH2A 3MC0A 2CDFB 4QT5B 3O3BB 3ARFC 3QUML 1M71A 2WKOF 2MNWA 1UH4A 3QIBA 1CD1B 1R3IH 4JM2C 5A6LA 3MRBB 4WWNA 2R8SL 1IAOB 4JR9L 4BK5C 3EUUA 3D8MA 2F7OA 3L7EB 1RZFH 4LBAA 3IKCA 1NBZA 3DX2A 3ZMNA 5J06A 3L9EA 5L88L 5KSAB 2AK4E 2EAEA 4PGBB 1E3ZA 3IE9A 3MLXH 1HN1A 5I6OA 1QSEE 1OAZH 3APMA 4M7KL 4G6KL 2VIRB 4QRUA 4Y4HD 3C6EA 1E2ZA 4KVPA 1SPDA 1NFDE 4AG4L 4KC3B 4QGTA 4GKLA 3BVTA 5ICYB 4HV8B 2OK0H 2EIZA 4UT9L 5B1CA 3UJIH 3UTOA 2G75B 4XX5A 3ZDZB 2NZ1A 2LOEA 3N91A 4N8CH 3DIDA 3JWDC 5ICZA 1MRCL 3RG1C 5BUGA 3SHSA 1QRNB 1LD9A 4O02A 3E8UL 3BAWA 1Y6MR 3GRBA 3WIIH 2W0FA 4ZS7L 3NPSB 3AT8A 1UD8A 2ZQKA 3Q44A 1VGKB 4KMLB 4ELME 2YMXL 5D2LA 5HY9B 5CR8A 1BQLH 3EYFB 4AJYV 1BEXA 3SOBH 1SF5A 5I66A 5JIIA 2WJ7A 2PP8A 1DDHB 1R3IL 4TUKH 4EF3A 1OAJA 4OLXH 1MCDA 2QHRL 3VXTB 3ARGC 2ITEA 5BQDA 4PRDB 4HQQH 1RZFL 4Z7QF 3BVWA 2V7NB 3MLZH 3ULAB 5CEZH 1DO6A 1CJYA 3MLXL 1OAZL 2WSDA 4OZFH 4PJ7A 2Y24A 3BVDB 1TPXC 3QIUC 2HKHL 2J3SA 3IRCA 4WEBH 4XB8A 5B21A 3BKMH 3M45A 3T2PA 3B7SA 3NSFA 4L5FH 4HWZB 4MCNA 1PVHA 2VDKH 1E2WA 3UJIL 2YUWA 4IRJD 4QRPA 1OGAB 4N8CL 3RWHB 5JIKA 3BJLA 3T65A 4PJFF 4PW3A 1FYTD 4IU3B 1U3HD 1TJHH 2XWBA 3EYOB 5CBAA 3QEQB 3WIIL 4PGDA 1IGJA 3GS4A 3VXMA 5FYKH 3BPOC 1MCQA 1BQLL 2X4TA 2EXWC 3EBHA 3M1CA 1RERA 3SOBL 3I6LE 4AGOA 5L2KA 3WIHH 5ACZA 3SDDD 5D2NC 1XGYH 4PJ9D 5D7IA 1NGZA 2ALAA 1IAII 2DLHA 4TUKL 1NC4B 2DQHL 4OLXL 2XWRA 3BZ4B 4JFHE 3M86A 4IGBC 4ZMNA 4HQQL 1ZVNA 5J1AA 3KBEA 2JQMA 3MLZL 5CEZL 1KCRH 1KTRL 4RX4A 4BFKA 4HUXA 4MNQE 4M3KB 1K8IB 3H9HB 3QH3B 2BP0A 4NQVA 4WEBL 4IRSA 5KBMA 5TDPB 4A66A 2BERA 4L5FL 3B2XA 1FFPB 2FVNA 3M1OA 2HJLA 2VXQA 1VACA 1OWRM 2YD2A 3HNSH 1CQKA 5AKVA 4PRBB 1YSOA 4X4ZA 4WU7B 5CCJA 3V4PH 7CGTA 5FFOA 4WW2F 1BCIA 5FYKL 1F0LA 3DIFB 2E0PA 2EO9A 2DM3A 3IDYB 3WNLA 5CLTA 2ICEA 3RPIA 1MH5A 3VNYA 3X12B 3WIHL 4EXKA 2GW5A 4Z3HA 3MX0A 4HEPG 1XGYL 4ZW7A 3SEPA 2NZ9C 4L1LA 1I4FA 3S88H 1C9SA 1FL5B 3FUMA 4DH2A 1FZMA 3WN5C 4AQAA 1CG9A 4EI5C 3DHMA 1KCRL 4ZRGA 3NCCB 1ZJAA 4QPEA 2WLLA 2ZNWA 3HG4A 4J3TA 5TE7H 5CEXB 2H32H 2HG0A 2CKBB 2N01B 1EAPA 3BEWB 1DVFD 3RDTB 2G9HB 3MBWB 3UAAA 3HNSL 5E1QA 2CH8A 3C8KA 1BYPA 4KDTC 1K85A 4J3OH 4UDUB 4PREB 2A74C 4GKZA 1RMFH 3V4PL 2K8QA 2BNQB 4LSRH 1FSKC 4ZFFB 4D3CL 4HWBH 4ZX6A 1F3DJ 4JZOB 1OB1B 2WTPA 3BH9A 2XC8A 1L7TH 3O6LH 2NXYC 2F8IA 4DEUA 2GJZB 1QMUA 3H55A 3WHE0 1NOAA 2Z8RA 3TEWA 1KIPB 5ID0A 2YGPA 5IR1B 3S88L 2NY3B 5DHYA 1NH6A 5HJBA 4I85A 3ROOA 1M1XA 1Q72H 1UXLA 2X3BA 4WGWB 5C09A 2VQ4A 5AAMA 4NRXB 3CDGB 4CGUB 3QRLA 5BS0A 3K81A 5C0GA 1B9KA 2A6DA 4PQXA 2G4GA 2Y06L 1EBAA 3D4GA 5AZUA 5E8OB 2ZF8A 1URIA 3IJSA 1JOIA 5TE7L 2J12B 3SZ6A 1ITCA 4FXLA 2CLVA 2PCFB 2X3AA 4M93B 4GSQA 1OIOA 2X89A 4NQCB 3PYCA 5CWSB 4ZDHB 3EH4B 4LVOC 2VLME 4EOWH 3STLA 4WFFD 1TTUA 5DEFA 1K3ZA 4UB0H 3BLKA 4RGNB 4ZO9A 1WYJA 5E08H 1RMFL 1NANI 2BP3A 3OKKB 4DCQA 4HWBL 1ETB1 4BKSC 1KY7A 4JRWA 2QGEA 3KXFA 2M26A 3VWJA 3JTBA 3O6LL 3BW9A 2QVMA 2CIIB 2EP6A 4TUOA 3H6AA 3WLBA 2WCSA 2YGNA 1XIWA 3N5AA 1G7HB 3RQ3A 4RISL 2CDEA 4FC3E 1N5YH 4NHUB 1Q72L 2P80D 1G6VK 4W4OA 4ODVH 4ATWA 1JBJA 3O9WB 3VACA 3NQIA 5C9JA 1BA9A 2ZUXA 3FQRB 4HIHA 2X4PA 1J8HB 3OHXC 4M9OA 3E6HB 4G80A 2AKRB 3SBRA 3AAZA 1BZOA 2O72A 4QRQA 4WNSA 2VSDA 3GS7A 4WW1B 3O8XA 2ZIDA 2X7LA 1PD6A 2CKBH 1JCVA 3PAYA 3ZTCC 2BHZA 3U2SB 5SWQB 3OKOB 4PY7A 3ULVF 4AM0B 3KWWB 4GJTB 5F9WB 1KB5B 4UB0L 5F1SA 3RTLA 5JOPE 2PW1B 5DGRA 5E08L 5D1ZC 3TN0B 3WJLC 1ZXQA 1INQB 1R3KA 3NN8B 4Y1AB 4NN5C 4KROB 2BY1A 1ZTXE 4CU7A 4TTGA 5KANI 2BNRE 2Y07H 4JFDD 4Y2OB 1CICD 1N4XH 4N87A 4LCVA 3N44F 4CNIA 1N5YL 4DNLA 2C3WA 3MQIA 5EULV 5IFAH 4ODVL 2X0VA 3NABH 4P2OC 3WL9A 4O4YH 5IBLC 2JK5B 5JO5B 1PDKB 1YNLH 4U0RC 3N06B 4UQ3B 2ED7A 2WZ5A 4UWQB 4BEIA 2ROXA 3V10A 2IDSA 3FB6A 5IW6B 5EU6D 3MFFA 4IRZA 5IK3B 1JPTH 3TCTA 3BISA 3MRJA 1DO5A 3RVUD 1S7XA 4MGXA 4YLCA 4NZUH 3QWNA 4IKLA 2L3BA 2PABA 3JWNG 4OV6F 2CKBL 3IXTB 4NGHH 1N5AA 4DN3H 4DK3A 1MAMH 3B3IA 5ISZE 1WAAF 2KZ1B 1M2OA 5CJOH 1JVKA 1DJYA 4XMZA 2OMUB 4H20L 4DTGH 4WUUD 3C60B 1IE4A 3N42B 2YEVB 1KPRA 2LTQB 4LASH 2IF7A 4P2RE 1H8OA 3OMZA 1HHHA 1QWUA 2IAND 3QAZB 2Y07L 4QXGH 3B43A 4XGZB 1N4XL 4BSJA 5F9OH 4RZCB 1MHCB 2WSPA 5HPOA 4OZGE 1PX4A 3ILEA 4TRPL 3WKPA 1K4DA 5IFAL 3W2DH 3RB5A 2XNAA 3NABL 1B4LA 3LKNA 4O4YL 4J4PC 1YNLL 1OD9A 4LOUD 3FB5B 4RQQB 2A9BA 5I5MA 3JUYA 3S2CA 3TTSA 4ZZFA 1CXFA 4M48H 3LZFH 4X7EC 2DL2A 3VYNA 5LG1A 1SFDA 3LSOB 2X4NA 1LVEA 2KBGA 4WI6A 2YXWA 4DQAA 2FECL 5B3SB 2I25N 4XAWH 4NZUL 1SVCP 1AC6A 4JKWA 4X6CF 4NGHL 5AVRB 4P3CH 4DN3L 2ARWA 5JPNA 1MAML 3L3OB 1KLUB 2P24B 1D5XA 3SKNA 2QVTA 3U9PH 2ICWI 4U4BA 1RK1A 3HAEA 2X70B 4PLKC 3HFFA 1DVZA 3MV9B 1CFQB 4NO3A 4YDIH 3UZQB 1MLBB 4LASL 2FHCA 1FBIH 1DZBA 3IU3B 4Z7IA 3W0WA 5I18H 5CJXC 3I9IA 1Z9SA 4QXGL 2X40A 2BSRB 2DQIH 4IJTA 1JNNH 5JW4N 2NY6B 5F9OL 4P5RA 3S37X 5CD3A 1EHKB 4BH8A 3RKDD 5F6IB 1OOAA 1S7RB 1MY7A 4LPYA 5IW1A 7PCYA 2Z4QB 3W2DL 3OKMB 2ED9A 1FG2A 1S5IH 1SDYA 4IEFB 1DJSA 2C7UB 4QRRB 3MRRB 4P07A 2HRHA 4A2EA 3LZFL 3CFUA 5A3IC 1OLZA 5SWSA 4UNIA 3UAJD 4PJ5A 3ALWA 2VW4A 4ZUWB 2AGJH 4WTWA 2QADB 4HK3J 3CVDA 3OSVA 4OZHF 2E9GA 5LGJA 4JZNA 3F7PC 4XAWL 4NUMA 1JRHI 2ZUQC 5EIVA 4OIFA 3CDFA 4Y88A 3BHBB 1I82A 3DMMD 4P3CL 4AKOA 4D0DA 5CKGA 5DO2C 5IZ7A 3U9PL 3UACA 3VXSD 4NT6B 2A0LC 3FAXA 5KYWA 1AGEB 1K2DA 2BSSB 1KB5L 3P4MA 4URTB 3ARZA 2Z8VC 1T0NB 3N1QC 3BUDA 4YDIL 3HW7A 2JXMB 3VGDA 5F0PB 4HLZH 4FKKA 3ZYIA 3HCVB 4IHBA 4FQHA 3V7MA 5I18L 3O6FC 2O6PA 4JE4B 4H8WC 4MJJA 1A3RH 2C1PB 5CAYB 3TBYB 2EDEA 2RQ8A 1IM3A 1JNNL 5DYOB 1KGIA 2VUYA 1I8KB 4NBZB 4B9YA 1TZAA 3DX8B 5GS0H 1KGYE 5I6LA 4Y5XA 1UD6A 4JFUA 1S5IL 3BWZA 4U2YA 5E4OA 1KIQB 3KBFA 3FTGB 2NXZD 2F54D 1WBXB 4LCIL 3V4UL 5AW9B 3EGDA 2VZOA 2X6VA 4OFIA 3PNWB 1PZCA 3QC6X 2AGJL 4PJEE 1SOSA 1A7NH 4Z0XB 1RZQA 2BIIA 4WY7H 4GS7C 5KVGH 1U8QB 3W9EB 5DJZB 5E6SB 4JFQA 3T0XA 4RFEB 1T0MB 4JM0A 3IF1B 3TO2B 1SJXA 2EIJB 3RIAK 4YHPB 5HGDB 2WINB 2OV0A 3LPGA 3V5HA 3U36B 1T89A 1AIZA 4OCNC 2KH2B 2OSXA 4J28A 3PHQB 3AGVA 4JRXE 2EDYA 4JX0A 4CVZB 3NSXA 3S35H 2J6WA 1MWAA 5DMJB 3AG3B 5DRXB 3Q06A 4R2GD 4RMBA 1LTXA 1A3RL 5GGRA 1JZJA 1XEDA 1WDAA 1O7VA 4Q6IA 4LOEA 4Z3FA 3BCFA 2X4RB 1I7ZA 5GS0L 5CLXA 4MSWA 4LPVA 3VG9C 5A6MA 2UZIH 4QXWA 5T1KD 5FKPA 4HFWA 4CU8A 4OJEH 1NCHA 3FQ2A 4HKZB 4MX7B 3D0VB 2ZSVB 2Z91A 3FU7A 4LBEA 1D7FA 1MHEB 1A7NL 5C0ND 3IWUA 4LLQA 1XZWA 5I1KH 1BX2B 2FJGB 4WY7L 5KVGL 4PP2B 4QHLA 3OGCB 5EB9A 1T0PB 3KPRB 4IBVA 2R1XA 3HR6A 3LNHA 5C2UB 2NDFA 3PP4H 1A65A 5ES4B 4FQJH 4ZS6D 4P4KA 4FNPA 5CMAB 1RZIB 1J0ZA 4MMZA 1RZ8A 3LQZA 5IESH 2V7HA 2DDQH 1B90A 4HJGB 3LEYH 5C1MB 4NPYB 1FZJB 3FU0A 1YHPA 3WMSA 5C08E 1SQ2N 4U1LA 4V2BA 1P6WA 3B2VH 3MSPA 4YK4C 4M1GH 5E6ZA 4FQCL 3D4ZA 2H0EA 4F8NA 1ZGLM 1V55B 3FO9B 1WVZA 4GW1A 2ZUTA 1JDAA 3D4CA 4JM2F 2UZIL 1R5VB 1MRDH 4QD2E 3LVTA 1WF5A 4FCAA 4W6XB 3ARBC 3G04B 3RWGA 4N0FA 3V52L 2PETA 4K73A 3FF8A 1QSEA 2WIIA 4OD2B 4I5BA 4OCSH 4S1RL 1SEBB 4PJGB 2FEEL 5DEJA 2EDWA 1NFDA 1LK2B 4Y5VB 3NRQA 3DPBB 4PLOB 4ELMF 4HA1A 1DTUA 3JWOL 4C4KT 5AG9A 3BUYB 3LKQB 1J0HA 3L3KB 1CO1A 3PP4L 1IC0A 4Y19B 4W81A 2Q8AH 4FQJL 4WI0B 4O2CA 1DLHA 2QVIA 4I3RH 3D3VD 5IESL 1BDYA 2DDQL 1JI1A 3AT0A 3WY1A 4DF9A 2K6WA 4N90D 1CVRA 3LEYL 4JG9A 3ZOAA 3D09A 2WTRA 3FB8A 3B5TA 3BVUA 4QNPE 3F6IA 5TH2A 2SODB 5JW5B 1AO7E 2R0ZH 2VZ1A 3B2VL 2ZXBA 3KHOA 4F93B 1S7WB 4M1GL 4BBWA 1O6SB 3P4OB 3ZKXB 4GI8A 4HGMA 1VEPA 3GKWH 4X5RA 2OMYB 3JVGA 3T6ZA 4GKSB 1LO4H 4I77L 3TVMA 3RTQA 3FRPA 4LDLB 1H9DA 3TEUA 2WYIA 3A6BL 4XCYA 1AHKA 4GKOA 1E8WA 3EG9A 4OCSL 5I6XC 1QLFA 4S10A 4RZKA 5EUKA 1Z0MA 2LVEA 2OM5A 3VGHA 5FR3A 4XNZC 4Y4KD 1B4RA 3IJ9A 3QUKA 3KS0H 5EZIH 3KCPA 1KFAL 4OIIH 4TULH 3B2DC 4FLRA 1JG9A 4DZ8B 4W9ZA 3QUMA 2OR8A 4G59C 2V8LA 1AR1D 4H0LC 1LGVA 3G6JE 1JGEB 2Q8AL 4B9JA 1N6QH 1VJSA 1U41A 4I3RL 4R7XA 2VLKB 4LOVA 1DE4B 2HT3D 4PRHD 1JHKH 5C97A 3HC3H 4HG4K 3QDME 5AOMA 2FO1A 4DKAA 5DEZA 2D4FA 1HL5A 2QPEB 2R0ZL 3P69A 5HGAB 2EKJA 2Y9RT 5CZVH 1OLLA 4Z78B 2B59B 3S48A 1YEFH 1CGUA 2I60L 1SXSA 2W0LA 1Z3RA 2YKLH 3GKWL 3LN5A 4DUVA 5EEXA 3HPLB 5EZLB 4E41E 2BPBA 4MYWB 3V79C 1F1DA 3ESMA 2H9GB 3IWVA 4HP5A 4NN6B 2NY5C 4GXUM 3TGXA 3VQMA 4F7TB 3I3DA 1E3FA 1SBSL 4H8VA 2A38A 5A2CA 1X5YA 4DEWA 4M02A 5KG9B 2FO4B 2VXUH 5EZIL 3RVTD 3GIVA 4N86A 4TULL 2Y1VA 4U6TA 2IPKB 3GB7B 3QUZA 3OG6B 4ETQA 2W80C 3RHWF 3ULVD 2MQ0A 2C3XA 1CE6B 2IAMA 3LNEA 4XB3A 1N6QL 1P0SE 1BVNP 1R1CA 5E5UB 2D9QB 3QIBC 1FZOB 1JHKL 1U3HB 3HC3L 4HUWB 5IVOA 4BSVB 2R2BB 4KWUA 3D06A 4Y4FA 1TF4A 1VENA 2OKMA 3B9KA 3I9GH 2YPLB 1EEYA 3HG1A 4OCWL 4R3SB 4I48B 4NC1C 2J5LB 2V37A 2B1HL 5CZVL 3SDDB 2X0UA 5ILTH 4PJ9B 2C1OA 4AQOA 5E2WH 4JQXA 2MCAA 4G8GE 3HVNA 1RL1A 2MNUA 1ZS8A 1RSYA 4FFZH 3A47A 2AQTA 4QAWA 1IAIM 1TQUA 4JFYA 3ROLA 3DYPA 4IOFD 3FB7A 2CE6A 3ZTNH 1WBZA 2E9BA 1TT6A 1EGJH 3O4OC 3SDXE 2GQHA 4R7DB 1XBRA 4OVUA 2VXUL 1XF3A 4KNTA 2H1XA 1XXFC 2UVFA 4YHMH 2J8UB 2BWIA 5GRVK 5E2TH 4KKCD 3QA3A 4WHCA 1PIFA 3FCUB 1QSFE 4L3FA 4C59B 4KH2A 2AJ3B 3HE6D 1J0JA 1PZSA 4TQPA 4UQ2B 1CTMA 2WVSA 5HDLA 1G9HA 4IOIA 3H9SE 4Z95H 5D71H 5E00A 1AHMA 1UH2A 3I9GL 2QJDA 2XTJD 4OZFA 3I85A 3QJSB 3HBQA 2NNRA 4NI6A 3Q2WA 3SPIA 4ENED 3O4LD 4S1QH 1TLKA 4NKMA 5ILTL 3UG3A 4LEBA 5E2WL 5EC1A 3MV7A 3QO1A 4YPGB 1FNAA 3KPQB 4KBPA 4L05A 1OP9A 3EHBB 3MUGA 4FFZL 4UINH 2VMDA 3QVAA 3QQDA 2DWDB 3U46A 3PNRB 5HYQB 2FWLB 3CFTA 4JKPH 1F4AA 1JL8A 3FYIB 4XO5A 5DS8B 1NC2A 1EGJL 3FFOA 1MHHA 3DK2A 1MJ7H 3D1MC 2Q7YB 2DICA 2XVLA 1JFHA 1R3HB 1UUSA 3P2BA 9PCYA 1DVFB 1E28B 4L2YA 5E2TL 4LF3B 4UQIM 2ZX7A 4WHTB 3ILQC 4OLEA 4LCUA 4AGMA 3HHRB 3HC2A 3CZGA 1CT8A 3K8KA 1V05A 2B5IB 2CG9X 3TA4D 4WENB 4Z95L 3RZCA 1NPNA 5D71L 1U8CB 1T22B 2MPAH 2D0HA 1LO5A 5J6GB 1RZJH 3ARSA 5J5EA 1TVHB 2XDHA 4S1QL 3P3SA 3DTUB 1MCOL 2GSMB 3NJFA 4PM1A 3WFDH 1AC0A 1OALA 2BVTA 3X2QB 5AZ2H 5I8OH 2QZ5A 3FOLA 4UINL 1IQWH 1OTSD 2EO1A 3TFKC 3V4PA 2E6PA 3FFCA 5E8EA 2PW2A 5FEBA 4NNYB 4JNXA 1MJ7L 2FL5B 3TEYA 3ULSB 3U30B 1HEZB 1Z3GH 1TCRB 2BFVH 4H4NA 1EHAA 3GSNB 4DKEH 3CSGA 3MLRL 3HI5H 1N0XH 4GO6B 2FEDD 2XY1A 3VXQB 2RD0A 5CGYD 2DMCA 2IPUG 3HZMA 4ORGA 5GIRA 3EOAB 3GMQA 2JCCA 4HLEA 1XHHA 1EAOA 1SDDB 4KRMB 1A4JB 2RACA 2BNRA 3WE1A 1RZJL 3WSQH 3FMGH 3L48A 3C6SB 4KI5E 3DRQA 1DVQA 4AZ8B 2H32A 5JXAH 4UOW1 3OF6A 4LEOA 2IO5A 4MXQC 1A1OA 1XX9C 1F41A 2PPFA 1QUPA 3ATDA 1FN4B 1DL7H 3BZFA 2X38A 5AZ2L 5I8OL 4AIEA 1IQWL 1SN5A 4ATTA 1UVQB 5I0WA 3HI6H 4G8AC 4ZOBA 1ML0A 4OKDA 3K6OA 1H8NA 3V6FB 3EJQA 1I8MA 1VZHA 3ZYOA 1H3WM 2COQA 1A7QH 4EUPG 1KTKE 1ORSB 3I50H 4U1MB 3B6SA 2AITA 1Z3GL 5ISZA 2BFVL 3VFMB 2R2CA 5DS2A 4DKEL 5IOPA 2YMOA 1EX0A 3EJSA 3HI5L 1YJDH 1N0XL 1N9PA 1VADB 3L08A 4JGMA 4JHBA 4OZGF 4OZ4B 4XHQA 3SDCC 1HT6A 4AY0A 4P2RA 4ES9A 5EMYA 4E9RA 1Z32X 3KDMA 1OE1A 5AAMC 2O93L 4H1LB 2YEQA 1CU4H 1UOKA 1VZGA 3WSQL 5JXAL 3ABMB 4JFDB 2UUDH 1E4XH 4YSRA 2BRQA 3AGWA 3NESA 4QRTB 4IQHA 1DL7L 4HUUB 3NQKA 2XG4A 3RY6C 1S9VA 3IDXL 5DC4B 4FYSA 4PJAA 1T66C 3D25A 3HI6L 3PIQA 3I6GB 5ITFA 4IDLA 3EOBB 2F68X 2EACA 5EU3B 4Z3IA 3D2UD 4D0CA 4JBSA 1A7QL 1TEFA 3QNXB 3HTLX 4NQUA 1JXFA 3LB6C 1E30A 5IM7A 1AZUA 1ZT1B 1NM9A 5EPMA 4QJ4B 3VWJC 1WWCA 2YSSB 1NKRA 3S36H 6FABL 1BWMA 2VJXA 3FCBA 1YJDL 4ZNEA 1UACH 3QI9D 3QQ9C 2O6FA 4FI7A 3HRPA 4PMEA 2NY0B 4RRPG 4WUUB 1J0IA 4C58B 3FCTA 3U7WH 3UZEC 2K7QA 3FFDA 2YRZA 4R4ND 1NINA 4M1DH 5HDRA 4XX1E 4XVUC 3F5WB 3H7LA 4RLDA 5IREA 4Z7WE 5KANG 4I2XE 3QXAA 3L54A 4U3SB 2WZAA 2Z35A 3BWUC 4GIPD 3MGAA 3MNVB 4X83A 3UTZA 3D34A 3O8XC 4XZ4A 4A7SA 4CGTA 2ZWYA 5GZND 3I6SA 2CDGA 1GGUA 3C09C 3CH1B 4QMEA 4YDVA 4EVNB 3ZHKA 3LD8B 3GXMA 4MA7H 2UXTA 1OV8A 5ENWA 3CQPA 4I0PD 5DJDA 3MV8D 2H2SD 1E6OL 3VSQA 3VD4A 4GO8A 4K8RH 1YNTB 2CHWA 5DJ6B 3S36L 1T7YA 2RTTA 4GSDH 3LKSB 3JWNH 4P2QA 3F04A 1G84A 1UACL 4XH2B 4JFOB 2Z0BA 2ATKB 4P23D 2DWTA 1A1MA 1EZLA 3DGGB 3UTSE 1KGCE 5SX5H 3Q13A 2H0JA 3C6LD 7PAZA 5IB1B 1P4LB 2OCJA 4GOSA 4PAZA 4X5PA 3PGFH 3U7WL 1CWVA 3Q8CA 1HDMA 2YD5A 4M1DL 4MMYA 4XZUB 3T2NH 3U4EB 3SO3C 3WHE1 1J9QA 2VM9A 2EE0A 3EH1A 4YX2H 4PJEF 3LVEA 1I8LA 3ARED 2CHZA 5B39B 4QHMB 1EEZB 2LLGA 1H15A 3AS3A 4WEMB 3ARDB 5EBMB 3ZE1B 2IH1A 1KB9K 5C0DB 1MUJA 4KKBC 4GG8B 4BUQA 1BD2B 5D6CA 4X7CC 4X5XA 4D7PA 1OO2A 3QJFA 1OTTC 4MA7L 3SJVD 2V3DA 2YA2A 1QLEH 3RIFK 4K7PX 1ZWIB 1JV5B 3HUJB 5HVWA 4K8RL 1B3IA 4FF9A 2R2HA 3JTSB 3DMMB 3EADA 4DWHA 2ZOKA 3VMOA 4GSDL 3S35X 4PVBA 3VXSB 3W11D 1IBYA 2VN5A 1DQJB 3WLWD 3KGRA 2CAKA 3BEVB 4JRXA 3RNKA 4WWID 4QO1A 1DCLA 5DZVA 4ZAKD 4YDLC 1KJ2A 2WCGA 1AKJA 4MD0A 3PGFL 3VMPA 3KJ4B 1KF9B 4NQEB 5AG8A 4PV1C 3L3DA 1PSKH 1EA9C 3HZ3A 1AD0A 1ZA3B 3A3YB 4JFFE 3T2NL 3WD5H 4LRIA 3WTSA 2ZTBA 4XNMB 4BK4A 4YX2L 4K9EL 3WIFA 2AXWA 1OSPH 3T9WA 3P30H 4QHUB 4OLWH 5IROC 1VCAA 3RVVD 5K1JA 4P4RB 2VLRD 2F54B 1P7BA 3CZSA 2D31B 4GW5A 2P8PB 1G7JA 4UNTA 4XCEB 2ZXWB 3QHFH 3VU1A 2APVA 4H0HB 1QLEL 1Y0LA 3EFFB 2EDNA 1PEZA 1WCBA 3IS1X 5EEVA 2DEWX 1VFAB 2DZEA 4MCMA 5IB5B 1SDAB 4B5ZA 2KQNA 4EN3D 2ITDA 3CVHA 4I89A 4WO4A 1M56B 3W3BA 1DQVA 4JM4H 5CSGA 5B7FA 3LZLA 2Q86A 2YEZA 3WAJA 5EU5A 1S7UB 3MR9B 2HLFD 5B7EA 4KJWD 1D5ZA 2YBRA 4HJTA 3EJPA 4OH2A 3ZKND 3MV11 4KXZI 5T5FA 3F84A 4FG6C 4R2GB 1FCGA 3K72B 4DP5X 1PSKL 5FXCH 1YZZA 3GT6A 4LLYA 3WD5L 1CFBA 5DWPA 3QORC 4YHOH 1T1XA 3IJYB 4FRWA 1XSJA 3ZGHA 2J5WA 4M7ZC 1OSPL 5T1DH 3ZRSA 3P30L 4UU9A 4OLWL 4B5EA 1ZLVH 4CMHC 4ODWA 1XF5B 2VISB 1HOCA 5T1KB 3BN3B 4IM8A 5BXFA 2XOTA 1U8JA 2ESVE 3NCBB 5F7DB 2Q87A 2DKMA 4BQ9A 2SEBA 4AYID 3ARFD 5D6DC 5GXBB 1AXIB 3QHFL 3B2MA 4JM2D 1XCTA 3BE1H 5HHXH 1YMME 1U42A 4U6YA 4FXGA 1E9PB 3MJWA 1MCEA 1RAMA 4V1DE 3AS2A 2VITB 3RWDB 1U95B 1RK0B 4NO2A 1TQCC 1H5BC 4D9QD 2XT1B 1KZYA 4JM4L 4LKXA 4U1JB 1HH9A 3QNYB 3VWKB 3L3HB 1AO7A 3PGDA 2XZQH 1IQDB 2WVVA 2HPTA 2DMBA 3IRPX 3FQNA 3HMXH 4BA8A 4F2FA 4HS3A 3SY0B 4ODUA 4XMKH 1KT2B 4Z7UB 3MCG1 1YUHB 4YHOL 2JJWA 5T1DL 4NLHA 3R4RA 5FCSH 2ZKMX 1O7DE 1HSAA 4GQ9H 4N2CA 3ZQXA 1RFDH 3T3ME 1EUUA 4QLRA 5DRWB 5G4MA 1OQXA 1TXKA 4YXLH 4AM0Q 1NDTA 3G6JF 4GRLC 1GA2A 3JV0A 1QLRB 3C87A 5AW5B 3FCSB 1QTPA 4GBXA 4OKVB 5FYLD 4YBLC 3T0BA 4E42B 4X6DF 3BE1L 5HHXL 1ZK5A 2V9UA 5MI0B 2JNZA 4OJFH 3NFPA 1HAWA 5FYJE 4WTZA 5CCGE 4WUKH 3QDMA 5GGUA 2JH2A 4DGYH 3D3VB 3ZKSD 1A4KA 3RFRA 1MCCA 1T21A 1ADQH 3FU3A 3HZVA 1FFOB 4J1UA 2XZQL 5C0AB 2FIRT 3EJYC 3PWVB 3BRFA 1XZ0A 4U1HA 3K1DA 5AAWA 4J3WA 3BP7A 3O45B 3HMXL 4C56B 1UYWH 2FSEB 3MA7A 3QNZA 4XMKL 2MMXA 1CXLA 4YHZH 5CJ5A 4AQEB 2W1NA 4AW4A 3BYTA 1BVOA 4GQ9L 1RFDL 2OXGA 3N1MC 3ZUCA 3JSSA 3NJIA 2P5EA 3V4VB 4YXLL 2L7EA 4NRZB 5ESQA 3KLAB 1XH0A 3O2WH 4YE4H 4KK8C 5I9QB 5IB3B 4R96A 1YO4A 1NCJA 1UZ8A 1CFNA 1ZANH 4MDJB 4LIQH 1ADWA 5I0YA 4Z7QB 2E9IA 2IFFH 4IGBD 4FULA 2BW5A 1NCGA 2Q1EA 2UY6B 2QKSA 4AEHH 5EU7E 3FQUB 3GSRA 3TV8A 3BKCH 2XWTA 4OJFL 1MWOA 1AR1B 5IJDC 5BUAA 3WNPA 3CHQA 3KVDD 2NUPB 3TZVA 4X9HA 2XWJA 3QJTB 3QXVA 4DGYL 3T2QA 3MNWB 2IQ9H 1ADQL 3NJGA 5JLZA 1DN0A 2DQTH 3KD4A 5EV7A 2J1KA 1UXMA 2B15A 5EN3A 5G5DA 2X2IA 2F1AA 1UYWL 1LP9E 3GLZA 4G8GA 5HYJA 1AACA 3CCHB 3HJEA 5D1XE 3UP1A 1N0LB 4YHZL 2YXMA 3BAEH 4L0ZA 4KXBA 4NXKA 4M61A 3CFKA 2CJSA 4NDMA 4LVHB 4W6WB 3P9MA 2IXQB 1FZKA 1WIPA 1XSOA 2XWXA 4FFYA 4YHIA 3QJQB 5FGBA 3D12B 5JPMA 3O2WL 4YE4L 4AW7A 4IKJA 3SDXA 1A02N 1U8OB 4PG2A 1E65A 1QQDA 3DSNA 4I18B 1P7QB 1ZANL 2Z0UA 2NZ9D 2YAPA 3ALXA 4RGMB 3G5XB 4N8UA 2NR6A 2VR3A 4EI5D 3BKCL 3OD3A 4LVNB 3QW9A 3UTTE 5FO7B 2R4SH 4PRNA 1B4JL 3T0EB 2AV7A 5FO8B 3MFGB 3H9SA 1UD2A 1FF5A 2JF1A 1E8XA 2AW2A 1AQDB 3JVGC 2GJ6E 2DQTL 5DF0A 4ODHH 1L9MA 4MLSA 3RTQC 4FQPA 3UGUA 4ZX5A 4WGVB 3LRSB 1NAMH 1R9FA 3PL6A 4J8RA 5IVNA 1J86A 1MW3A 4F80A 1C5CH 5HJ3B 5T3ZL 3BAEL 5I5IA 2CK2A 4N8PA 4RWYH 2EXTA 1JNJA 1IGYB 3MTXA 4W93A 1IJNA 5IG7B 1OKEA 4DO4A 3GJFA 4WTQA 4AVJA 1K8DB 1N64H 5LDUA 4IBYA 3QZNA 1OSZA 2J20A 4P5MB 4U4IA 5KS9B 5LBSH 1SJMA 1I7UB 4F8TA 2QQLH 2WBKA 3VI3E 1QYGH 1IGTB 2DWSA 4M6OH 2ZXAA 1MJ8L 4M5ZH 3VFVB 2R4SL 3Q2CA 1MNUL 3HE6B 3BZ5A 3MHZA 2V2WA 3ARPA 2JMRA 1C5DB 1O5DT 3UX9B 2YQBA 3PHOA 4DW2H 1TJXA 1AGBA 4ODHL 3AVEA 2E9JA 2FRGP 5F7MC 2XTJB 2IGTA 4HJJH 3GLDA 3CDYA 3NSJA 5JW4M 4YL4A 5HGGS 1NAML 1H3XA 1WC7A 3OWRA 3ZZQA 3O4LB 5I1AA 1CE1H 4FNLH 4LIQE 1AG6A 1JHTB 3H3PH 3S98A 3T0DA 1C5CL 2VLLB 3CN2A 1A6PA 3KPTA 1J9TA 4RWYL 2XQBL 5E9DD 4BV1A 4X98B 2R69A 3QFJA 2FQEA 3QNFA 1VFBA 5T1MB 4EIZC 2CRIA 1XGRB 1HL9A 1UGNA 2NLJA 5J7CC 4JZJB 1N64L 2GITB 3AB0C 3RHWK 1JVOA 1G1CA 4R5TA 5K9QI 4HJ1A 3VFRA 3QWRD 2ODIA 1M7DB 1AQMA 4R0LA 4PJ8A 1FNGB 4NKDB 4EQ2A 4HSQA 2QQLL 1LDPH 2G0LA 1TCMA 1YEKH 2C5DC 3BKJH 3IETB 4PRPE 3ATBA 5EOCH 2MCG1 1KDIA 3QDGD 2BLFA 1QYGL 4M6OL 2DS4A 1EIBA 4KFMA 1LWRA 4M5ZL 1MFAH 4Y9GA 1SVBA 4HSCX 4RH4A 1G9NH 3AU1A 4FFZA 1OF2B 1VDGA 1VEOA 2XV3A 4ZMYA 1UA7A 4O2FB 4DW2L 2Y7LA 3BGFC 4HJJL 1EGJA 1GGBH 2EEXA 2E9WA 1CFSA 5F9JB 1CE1L 4FNLL 3HKFA 3KE0A 3H3PL 2BP8B 4RETB 5LO7A 3ZHLA 2UY7B 2L7JA 2OJEA 2H2PC 1F11A 5D1ZD 4DP6X 3MRQA 3LIZH 4YDZA 4FAAB 4OFKA 2NX5D 4AKPA 2ICES 5A2FA 3DPDA 1FAKT 1ZPLA 3D50A 3OKNB 3QUXA 2OLDA 4JN1H 1IAIH 3BSGA 4A7QA 4KXAA 5EOCL 1YEKL 1MI5E 2PR4H 4A2HA 4P2OD 1EERB 3HZKB 4Y9CA 5BQ7B 2OR9H 3PDOB 3N3EA 3OR6B 4OF3A 4Q89A 1MFAL 1RJYA 1UGKA 3MMEB 4L9DA 3L5WA 4TKWA 2EYSA 1OSYA 1J05A 2XUWA 1OT4A 4KO9A 2HVBA 2X1PA 5EBWA 5EBLB 5LXVA 3ECBA 5H94B 4LPWA 5D96B 4DKFL 2FR4A 1QNZH 2NNFA 1GGBL 4PW4A 4S2SB 3EYVA 1AGDA 1I8IB 4OZIA 2NY7H 3DX6B 1YEWA 4KQ4H 1UOWA 4XMVA 1ES0B 2Z4TA 3LIZL 4NFCA 1LEKA 2P8MB 2BSED 4Q9RH 3WS3A 4G8EB 1A9VA 3ES6A 4YQXL 4NO0D 1S5HA 3RWCB 3PXJA 5LUMA 4JN1L 1PYWA 1IAIL 2DL9A 3KW8A 3PP3H 5TE6H 3T4AA 1Y18A 2WLNA 2MOGA 1OCOB 2Y5TB 3GTVA 4Z3GA 2PR4L 2FAUA 4WFGE 3AABA 3W5MA 4J4PD 3MLYL 5T3XL 2Z31C 2VQTA 4N22A 3W81A 4FQXD 5C0CB 1BAFH 2R7EA 2A83B 2ARJA 4LCWB 3F00A 1CDYA 2FJHA 1JTOA 4AGLA 1QNZL 1ED3A 5AYTA 3BP6A 4GMTH 5D4JA 3OC5A 2NY7L 4Z7WA 1W8EA 4M62L 1BF2A 3HFML 2IDTA 1AQHA 1SUHA 3SPVB 4PWKA 1ZPUA 2YR3A 1QBLL 2LFEA 1X3DA 2BCKA 3CSBA 4Q9RL 3BWUF 4HD9A 5FECB 1NDGA 4ZXBA 4I1RA 1AZBA 1Y6KR 2P46B 1M3IA 3CQQA 4KHXH 3ARTA 3D2UB 3TBCA 5TE6L 2OULB 2V2TB 1Z5YD 1CFVL 2LVCA 2FLBT 4U1SA 2HVKB 1AS8A 1PY0A 1QRNE 3DX0A 4UTAH 1U3ZA 1PW3A 3R1GH 2GEEA 3A4FA 4KOBA 2X6BA 4EUPH 1WTGT 3MRGB 3OJVC 2OXHA 5A3ID 3H2QA 2J2ZA 1N59A 1BAFL 2WLHA 5F7BA 3VSUA 3UTSA 3R06B 4X6CB 2ROYA 3VFNA 4DKDC 3EO0A 2VRAA 2H47C 1R3LA 1F02I 1PZDA 5FV2A 1SYSB 4J3OC 3GSUB 3VM5A 5J6HA 4OUUB 4GMTL 5EU4A 4KGJA 3KLQA 5DO2D 1QACA 3NIFF 1ZGLP 1NANH 2A0LD 1BOGA 2XTLA 1TJMA 3O6MH 4JG0H 4JRFA 4EDXB 2QR0B 1ET8A 2CR0A 4C83B 3LNIA 4XBPA 3WN6A 1Z1WA 3A0OA 5TDNA 3HIZA 2VJ0A 1E2VA 4ECNA 1U6AL 4KHXL 3O2DH 2EDLA 1NFIB 3COOA 1OGAE 2VR4A 1FDLL 3MRDA 3CN1A 3ULUE 5TTRA 2ED8A 3UMNA 3VRJA 5HVHC 2O30A 1OXYA 2EEFA 3QEQE 4AMKH 4BFIB 3QT2A 3R1GL 3PLYA 4MKTA 2OSWA 3OAYK 3QEUB 3QJZA 2BOCB 3QQ3A 5HVFB 1S9YB 3VI4F 4XXWA 5EEZA 1EHLH 3BAYA 3SPGA 3WENA 4OZHB 3BWAB 4N20A 3SDAA 3E0GA 5CEYB 3FRUB 4P23B 4LRNH 1OK0A 1H6EA 1FVDA 3IJHB 3PWNA 3C6LB 3HN5A 4P04A 3RWIA 1CZ8H 5FC9A 3TBSB 3ABGA 1N18A 1VEMA 4R8WH 1Q9LB 3WO3B 3VSVA 3SY6A 5C92A 3MACH 1ORQA 3AREB 3LH9A 4FP8H 3VFPA 1PZUB 3B37A 4PWHA 3T1WA 4EIGB 4LL9A 3IDYC 3NIDF 3I3BA 4XE0A 2CIKB 1M9SA 1NGPH 4FE9A 1XF4A 4LSUH 3BUQA 2DKUA 3BDYL 3O2DL 3RGVB 1E9OB 1QR1B 3SJVB 4Z76B 4G43B 4ZTEA 1XR8B 5FAAA 4UTCA 3U9WA 2MTPA 3T6VA 1AGCB 2VJ8A 4FMKA 4AMKL 5C0FA 3W1ZA 3ZHNA 1T2JA 4Y0GA 1ASQA 2WBJA 2XV6B 1EHLL 1RD6A 2YN3A 1J87A 2ENYA 4JY4B 4X80H 5DI8A 3CGTA 1SN2A 5H2BB 3VVVA 4EI6B 3MI6A 5DMYA 4ZAKB 4N2OA 4LRNL 5C08D 5IEHA 2VW6A 2CKNA 3CU1A 1ZY9A 2C9AA 2RFXB 4A63A 1FLTX 4RNRB 1CZ8L 1GSKA 3AW5A 2VKXA 5E4EB 3S8WA 5HHPA 3FO1A 5E70A 4R8WL 4HPYH 5C71A 3MACL 3TBVA 4FP8L 2JJTC 2V3FA 4FN0A 5ESVB 3S96B 5K9OB 5AKRA 4M6AA 4TUUA 2J56A 2VLRB 2Q3ZA 1SM3H 3UJTH 5C8JA 1NGPL 4U1GB 1FUNA 1I7RB 2WGNB 3PJNA 4UUJB 3VXRD 3EF4A 4GLRI 3GI8H 3X11A 1NCIA 1NGQH 1MCNA 3MRMA 3LEXA 2NY3C 2KKQA 4V1DA 2F53B 1BFSA 4XN8A 5FW8A 3QYMA 3DUUA 3ARBD 3SSGA 1KN4H 2ZP9A 5KBPA 3HEIB 4K55A 4L3CA 3VXUE 3RUGF 4AQ1B 4MFHA 4X80L 4GUPB 1MLCA 1M9WA 1BIIB 4MA8H 3TURA 1JE6A 1BEYL 5ECGA 5TF1L 1TDQA 2BSCA 3KYAA 4M93C 5EA0H 4AXWA 4ANWA 2PTVA 1K6QL 3T3MF 5LN4A 5E5MB 2N3JA 3U4BH 2BO0A 2K6YA 2WQ8A 2Z1KA 4K5NA 3MLTB 4P57A 1W2KT 3W57A 1OAKH 5KSVB 3QJHA 5I2IB 2FCBA 1ESOA 2Z93A 1XAUA 3OJDB 4J23A 1BYNA 4RGNC 3BQVA 3K3QA 4HPYL 4XWOC 4Y7MA 3GMMA 4ODTL 1N3NA 1JWUA 4FLQA 5FDWB 5D72H 2TRHA 1FGNH 4FQ1H 1SM3L 3UJTL 3E8VA 3FN3A 1U8PB 4OGAC 3ARFB 1NGQL 1PG7X 3UPRA 3RNQB 4GAJH 5HHOE 1OK8A 1TZ8A 3V8CA 2IWKA 3FF7A 4KH9A 1HHGA 2A9DA 1KN4L 3AWGA 1HKLH 3SGJA 2BHUA 2D4DA 2YAFA 2WD0A 3EBAA 4LLUB 4MA8L 4XO8A 1F3JB 2JIXA 1HI6B 4N2HA 3WJJC 3VX1A 1JZ8A 1JRHH 4JQIH 5EA0L 4FHJA 1DBMH 5EC2A 1L6ZA 1RIVH 5DZJA 2GABA 3U4BL 1OAKL 1JN6B 4X50A 5C6PB 3KPLA 2VERN 1RUAH 3NP4A 5JW3H 5FB8B 4UNVA 5IVXA 1I3RB 1J8HE 3QHZH 3BXNB 3CPLB 5BPPA 1J1OL 4KNUA 4PD4J 5D72L 2H3KA 2VMJA 1C7SA 1FGNL 4FQ1L 3BYYA 4HIQA 4WKXA 2VXTH 2ZPKH 4E0RA 5E1AB 3OX8A 2VL5A 2EC9T 2UWEB 3CU7A 1BVNT 5HYIA 4M9PA 2XU9A 4BSWB 5JQ6H 3NDYE 3V8OA 4KRLB 4JJ5A 3ARGB 5A43C 5F7HA 4RFOH 4JG5A 1MREL 3II3A 4Y1AE 5E8PA 2VE6A 2X4QB 4HZLB 1BF5A 1LP9F 2A73B 4JO5A 3LRGA 3V0IA 2HFFB 3Q8FA 3FO2B 5EOTA 5CJ8A 1TPXB 3QIUB 1JRHL 1CD9B 3AG2B 4JQIL 1DBML 1RIVL 4U7MA 1EO8H 4PFEA 1KTDA 2R51A 4UQAA 3ZE0B 1VSCA 2BVPB 1RUAL 5JW3L 5D1XA 3WFEH 2IC2A 4NKQB 4NQSB 1A7OH 1KBKA 1GGIH 1UURA 3SBWA 1BM3H 3QIBD 3MLWL 3QHZL 4UIMB 5DC2A 3LQAH 4H44C 4JPIB 2EUVA 1NMCB 2LTQC 4AQ8A 1BFTA 4FXGC 3ASOB 4Y2DA 2VXTL 3CVCA 4QAMB 4X4YA 4F91B 1G7MB 2EXYC 5F44A 5GS0C 2HTKC 2W65B 1H0DB 5D2NB 1PKQB 3ZL1A 3D9AH 4ISVB 1GGYA 3KYOB 2ATPA 5JQ6L 4IGBB 2VN3A 1CUOA 2O1AA 1YYML 4HDIB 4RFOL 2X28A 1QSFD 2JWYA 1UM5L 3PWJB 3QUYD 3UTTA 1KCLA 3DV6A 4X9YA 1ID5I 1R24B 2QQNH 2NCMA 5KYYA 2GJ6A 1J1XH 4ONHB 4HETA 4JHAH 3RI5F 5ESAA 4PYHA 2BS71 5CN1A 3KL5A 1EO8L 3C5SB