1D2OA

Crystal structure of a single b repeat unit (b1) of collagen binding surface protein (cna) of staphylococcus aureus.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
187
structure length
187
Chain Sequence
b'ETTSSIGEKVWDDKDNQDGKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDLPKYDEGKKIEYTVTEDHVKDYTTDINGTTITNKYTPGETSATVTKNWDDNNNQDGKRPTEIKVELYQDGKATGKTAILNESNNWTHTWTGLDEKAKGQQVKYTVEELTKVKGYTTHVDNNDMGNLITTNKYTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COLLAGEN ADHESIN
publication title Novel fold and assembly of the repetitive B region of the Staphylococcus aureus collagen-binding surface protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Structural protein
total genus 42
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05738 Cna_B Cna protein B-type domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2oA01
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2oA02
2X9WA 1D2OA 3RPKA 3GLEA 2X9ZA 2X9YA 2Y1VA 4BUGA 3B2MA 2X9XA 1D2PA 2XTLA 2XICA 2XIDA 3GLDA
chains in the Genus database with same CATH superfamily
1U2YA 2ESVB 1PY4A 2A0LD 4LBAA 3UDWA 2IAMB 2FEJA 1P6WA 1NIDA 5DJ0B 4OM0H 3V6ZA 1Y0LA 3GTVA 3NFPB 4H1LH 4OF7A 1K2DA 1QABA 2YAFA 3AS0A 1CDGA 2VMFA 4YL4A 3K4ZA 3DYOA 4PH8A 5AZ2L 3P0YL 4MZIA 4YUEL 4PJHA 4MS6A 1PJ9A 4MHHG 3HI5H 2MCG1 4I88A 1QSFE 2HVJB 3TYFB 3P30H 4FQ2H 4ZOEA 3O9WD 2R0LH 2NPLX 4PWKA 4XP6H 2B39A 3SY0B 5TK2A 5HYSG 4GRWB 4KRPC 1YYMH 1DVFB 3QFJD 2YXWA 3LY6A 4IEFB 1SXBA 5GHWL 3ARFD 4UF7C 5DD3H 4ZOCA 2YUZA 1NAMH 4K4KA 2WY3B 4AGMA 4C57C 1H19A 2C1PB 1JERA 2G4EA 3KPMA 1XD1A 4PG9A 5LNGA 2Y4SA 5T1MA 1X7QB 3P4MA 5LG6A 2X41A 3EGXA 5ITFB 3V7MA 4E9XA 3ARBC 5C09B 1KBPA 3RI5K 5TE7L 2L7QA 3K2MC 4Q52A 4I3SH 1NINA 1IGCH 1HH9B 4XB8A 4HVBA 4IRJC 2ETWA 2CU9A 2YPLE 4G70B 4Y4KB 1IKFL 5SWSD 4X6DE 1Z5LA 5SV4A 3BJLA 2UZIL 3ARED 3LIZL 5MENA 2L8AA 4AMKL 5KYUB 1TZGH 4PLJD 4FLSA 4O5LH 4PUBL 3DO4A 4LNRA 1Z5YD 2QELA 5DC4B 1PLAA 2H32B 2QKIA 4GG6B 3CGTA 4PGDA 3ZDXE 1MCDA 1SN5A 3UPRB 3EYUH 3GLDA 2JH2A 4YPJA 3UBHA 2CDEA 1OLZA 1F1AA 1TJIH 2QPDB 3UYPA 1CURA 5TPWL 3U2JA 4R0LC 3NCWA 3EZ8A 3TJPA 4FNRA 2XKNA 4YO0B 3UC0L 3C8DA 5D5MA 3FU6A 5CUSL 2AANA 2YXFA 1SMAA 1VFAB 2YRZA 3AY4C 5IWLA 2XT1B 5KVEL 3LKRA 3SBRA 5GGVL 5EOTB 1Y6NR 4HPOH 2HFEB 3UPAA 2FLBT 1SJMA 4EI5B 2ZX6A 1KIRA 2B59B 2ZCKH 3TO2A 4CU7A 5I66A 2WXKA 1AZZC 2XKUA 4HIPA 1AGBA 3P9LB 3CFDA 2FE0A 4LQFH 2G9KA 2F8XC 1EZVY 4WSGA 1MQKH 1NFDB 2A6DA 4L1BA 2XZQL 3OMAB 4M7ZC 1I8KB 5IBUG 1QI4A 3UJJH 5C6TL 3C75A 2FJSA 4K8RC 1KB9K 4KXZH 1JI1A 4ZAKD 3O9WB 2BNUB 2OP4H 2ZSVA 1MFAH 5F7WC 1KJVB 5BRPA 3QFJB 4ABVA 2CO7B 3PG2A 3CFKA 4PJFB 4N8VA 1D5BA 1TVBA 3VVWA 1MPAL 1RIVH 5FO8A 2VISB 3O6KH 3RPIA 1NMAH 1QFHA 4FFVD 1KGIA 4JY4A 4F15C 4PJ6A 4HISA 1XGZA 5BOJA 4MZRA 5DZAA 2E9JA 5IHWA 3VG9C 3M46A 1YECL 1JDDA 1HX0A 3D3VD 2K0RA 4B9ZA 1A9BA 4PGJA 1DJYA 4PJ9B 1R46A 5K5YA 3EJQA 5F3HA 1G7LB 3WJMB 4NKMA 5JYLA 2FJGB 2J4WL 2C9AA 5FPIA 3V5KB 5KVGL 3KPPA 4YFDB 3CBRA 2VR7A 1UA7A 5SWSB 1FFTB 1E3XA 3RDTA 5JPMA 2P48B 4YQXL 3RZCD 1G43A 3AREB 2XLLA 2H2PD 1HDMB 2NZIA 3GXPA 4U1GB 5DMGC 3L9RA 5E4AA 3FU5A 3GIVA 5EF0A 4MNQB 2W1NA 3IETB 5L8JB 1KXQE 1OEZW 2IC2A 1WT5A 5C0RH 2WVVB 4CMHC 1BF2A 4NERA 3LKSA 4Q89A 4FERA 5DVLA 1T0NB 3SIKA 1JPFB 3GZOA 1JHTA 4N0UA 4G6FD 3TN0D 3L6FA 3TEXA 3FB6B 4R8WH 5J6SA 3U1PA 4PJGF 2K3TA 3KWWA 5D70H 4S2SA 1OGAD 3OAZK 1V3LA 4XGZA 3SDYH 3FC8A 3RVVC 3P4NB 1WAPA 4P57B 4MD0A 3OKOB 4K3DL 4BQBA 4P2RA 2AK4E 4ZTPL 1JPSL 4LO9A 1FL3A 3WXVL 4WFFE 2PW1A 4ANVA 2XX1A 4NM8H 4FC3E 4NN6B 4Y19E 4YWGH 3LRLA 1M6OA 4XN1A 4DN3H 1NKOA 3HZMB 5JOFB 3QEUA 2D31A 4JMXA 5LBVA 1M4KA 4Z7WA 3PL6A 1QR1B 2XQYK 2WLLB 4HT1L 4PJ8C 4LASL 4AQOA 2VUOA 3PU7A 1CLCA 2P5WE 3OPZL 3TZVA 4N2KA 1EBAA 3TM6A 1GGCL 4K5NA 4PJHF 4ZAKB 5MEOA 2VZTA 1RZJL 1A64A 3RKDD 4JDTL 1IBGL 1KCBA 5GZOA 1W15A 3IE9A 4Z7QE 2M2DA 2JJVA 3DX2A 4J8RB 4LHJB 4TV3A 3MGTA 3PWUB 1TO5A 4IU2A 3OJMB 3STBA 5AVTB 4Q2ZB 5D4HA 3RL2B 1WP6A 3LNHA 3QUYB 3VRIB 2G30A 3U83A 3DSFL 4NUGH 3D3VB 3APMA 5CR8A 5AVZB 4ZJ9A 4J27A 4HGKC 4LGRB 5IMOB 5DD0H 2P4AB 4DOHB 3IJYA 4YDKL 4WK4B 4Q9RL 3FRPG 1MKFA 1TQVA 2DQIL 4ANUA 1D5IL 4JFDE 1CDCA 2YD2A 3NGBC 3GF8A 1N18A 4BFNA 1MJ7H 1T89C 3AQZA 4GP8B 2ADIA 1IBYA 2HT3C 5AVSB 1DEEB 4HC1H 4E0RB 4F37F 5IHUL 1GYAA 4NZRH 5EOCJ 5T5FA 5JORA 4GEIA 3RU8H 1IQDA 3U2SA 2ZXCA 3ABLB 2OFQA 2NXZC 4UIMA 4KJQC 4WWKA 5DTFA 2JELH 3PDOB 4QUOA 4ZZKA 4ENEC 1I4FB 4NZJA 5C0CD 2B4CH 1L9PA 3RIAK 3HZVB 3UC2A 1HSBA 1QRND 1XSIA 4GW5A 2JMRA 3I6KA 3TN0B 1G9NL 3FSWA 4NIYE 4NXSA 3SCMD 4Y4FB 1KCRH 3RE0A 1ZVSA 1OGAB 1ZA6A 3AJ7A 4H8WL 3AS1A 2EYSA 3QEQE 4UQAA 1FV1B 3DDGA 4FQIH 1WAEA 1JZIA 1JWMA 3IMSA 2XZZA 1CGWA 4BQ8A 4YFEA 1WH0A 2FSDA 1KB9J 4KMTH 5KSBA 3RWIA 1BZEA 4I18A 4KKNA 2LV4A 2IOOA 4U1JA 3SKJL 2VYRE 3MREA 3T4YA 5FUOH 2F53D 4R2GC 1CCZA 1FC1A 3MA9L 3SPGA 3UIYA 4WK2B 3UBGA 1N59B 4DKFL 2XYBA 2ZUQC 1ILSA 4LLAA 5DEJA 1WAAE 5FXCH 4BKLA 1UOWA 1OARH 5F1IB 1WYJA 4ZS7H 5JOPE 1QBLH 5MI0B 3AW5A 4FAAB 1FC2D 3WCYA 2HKFL 3CU1A 3GBNL 4NQUA 5HI3C 5FYLE 1KGYE 2KDGA 4XWOC 4W1TA 4YEEA 1WCBA 4F7CA 4ZW7A 5C0JA 4HA1A 1NGPL 2FD6H 2BNQA 3CVCA 4IBZA 1KXTA 5DO2C 4E2OA 5KSUA 5I1DB 2XSKA 3LPPA 4KV5E 4UU9A 1QBML 4OZFA 2IANA 4LGSB 1SFDA 1IGJA 3RJQB 3DVFA 3V52H 1XH0A 3VYNA 5IJKC 2HFGH 2CLZA 5I6LA 1TZOA 1CFTB 5JTWA 4N2MA 3OL2A 4ZFGL 4LSRH 5CMAB 3JWNG 1EJOL 3U0PB 3F62A 2NY2C 2FGWH 2GK2A 3P0VH 3AMKA 2VE6A 3DMMA 4IOSA 3F01A 1NDGB 3NCFB 3P73B 1NEZA 1HOCB 4BSVB 2V5MA 4RGNC 4ZO7A 3H3BC 2YUVA 2NCMA 2ZUTA 1I3RB 1PAZA 4UUJA 2VZSA 2HLAB 3FRUB 4KZDL 5I74B 4CILA 3PWVA 1Q1JL 3L5HA 4LLMB 5EU6E 4B5ZA 2A9AA 1FVCA 5C0CB 4DP7X 1IVTA 4X5XB 4NRYB 3MRNB 4UINH 4WNQA 5L2KA 1QRNB 5J5EA 4KZEL 1TSHA 1U93B 4YSDA 4FTVE 2CO4A 4QGTA 1Z9LA 4XO8A 1CF1A 2VLME 2YAEA 4WTWA 1KJ3L 1PEWA 1MWAL 5KVDH 5AKRA 1PZCA 4GAFB 3MJ9H 2WBKA 4AYMC 1UZ6E 2IDCA 1ZT4B 2BNRB 2FIKB 3QDGE 4XN7A 3QZWA 4H8VA 1OY3B 5IW3A 3VNYA 1A3LH 1SOSA 2MJWA 4HOMA 2VUKA 1I9JH 1AO7D 1FE8H 4MA7L 1LEKB 4KJPC 4AYDC 1FVEA 2MSPA 4XN5A 5HJ3A 1QMUA 4ZUUA 3GMOA 4R4BA 1Z9PA 1WIUA 1R5VA 3C09B 1PQZA 3WFEL 3JWOH 1FFOA 2EE6A 2F53B 3D06A 1EJ6A 1XXFC 4JM4L 3CE1A 3ARUA 5GS1A 1GMEA 4CKVX 3EF7A 2E27L 4UBDC 4XPBL 5D7EA 4Z7WF 1W72A 3GM8A 4IRSD 4ZFQA 3AUVA 3O3AA 1RUAH 5DUMH 1IUZA 1GZHA 3CVIH 3QQDB 4H5SB 2FBRA 5EC1B 3GKWH 1RHHB 1RH8A 3MFGB 2LLNA 1X5AA 4S1SL 5B38G 3ES6A 1NSNH 3KXFD 3RZCA 4OZGA 2X4RA 3QC5X 3TV3H 1GC1L 2GFBA 4JPVH 2ZWSA 1UB5A 4FTDA 3UO1L 4BCYA 4R97B 3OGCA 2AQPA 1G87A 3LH8A 3R4RA 1HINH 2AEIT 4QRQB 3MACH 3JWNH 3QUMB 3C5SA 1XIWA 4KROC 5JHDD 4WFGE 4YHNB 2Y36H 5AVVB 4Z8FL 4GSRA 2UZYA 1X6LA 5ACZB 2JLPA 3DBXA 5SX4H 1UWXK 4WFHD 4WWOA 3EFOB 3FU3A 4F91B 1F18A 1CLVA 4Z7VB 3CFNA 1I7RA 2PP9A 4HW6A 1JK9B 2A38A 4XXCA 2BVPB 5E70A 1WZKA 2GK0B 3BT2L 4KK8C 4WHTA 5DJXA 1ITBB 1C5DB 1ECYA 1RZFH 2J2ZA 1WBYA 1PY9A 4N90D 1IFGA 3TLRA 3RTQD 2FGZA 4FOMA 4OLZH 5D93C 3PYCA 4PIRF 2W92A 4G7VH 1PX8A 3TA4D 5DYOB 4IHOB 3B3IB 4R7DB 3ROOB 4D0DA 2IMNA 1N19A 4GAYA 5E6SB 3QWOB 1T21B 4GQ9H 1IAIL 4I4WB 1T5XA 3TIEB 2RFXA 2MQ3A 1TLKA 3FMGL 3NN8B 1J1OH 5KVFE 1X9QA 3R1GH 1J05B 4AKPA 2R2HB 5TE6L 4CN6A 3HAEB 1OK0A 4TNWF 3QO0A 4DGWC 1LNUA 2EXSA 1AO7B 5E6ZA 1ACXA 3BKJL 3CBKB 4N85A 4G8IA 4OVVA 4WNJA 3O0RH 3UAJC 1BVNP 4P8QA 1UA6L 4I2XA 4ZO8A 3AY2A 5CZVH 3WLWD 1CTMA 1KYOJ 2BY0A 3O3EB 3P9WB 5TF1H 1IGFL 5KSBF 2PYED 4FQXC 1A4AA 3NUKA 2PO6C 3KJ4B 4G5ZL 1G9EA 3CCHA 4R5XA 1JZEA 4JM2B 3L48A 3QAQA 3KVQA 4L8SB 4MKMA 3MNMA 2FWOB 2WJ5A 5F0JB 1E65A 4QXTA 3HE7D 4PW4A 5JDJA 2WNWA 1U92B 4NO0A 2OMUA 3ZKQD 2VDRB 2WUCL 3KXFB 3KJ6L 3DV6A 1GHFL 4KHTH 3X12B 4WI3A 3GSWA 4QT5B 2Q20A 2DQFB 3L3OA 2NCEA 2H8PB 1MCIA 2VLJA 1ETJA 3ASOB 1QSEE 3OAUL 3N43F 4YSAA 4PCYA 1RKRA 5ECGA 1HJBC 1TEYA 2IDTA 3AT0A 1OSZB 4LSSL 4KKAD 5JHDB 5AVYB 4YH6A 4ZSOA 4RFEB 3ZE1F 1XF4A 2Q3AA 3I9GH 5G4MA 1LJMA 2W80C 3T4AC 1IC4H 3VE0A 3VXTA 3CDCA 1JP5A 1YC7A 2VDNB 2EEFA 3MI6A 5KTEH 4QRSB 1ZHBB 1J7VR 4X9BA 2Z4TA 4UQ2A 4LIQL 5JXAL 1M53A 4HEPA 2CK0H 3GMRB 4Q6YA 3PFUA 3TOPA 2Y3NA 2AJXL 3US9A 1LK2B 3MLXL 1LD9A 3MYJB 8FABB 5J8OA 3WGUB 2A9BA 3QG7L 2VC2L 2ZCLL 1LM8V 5LO7A 4DETA 1VDGA 3KD4A 3RTQB 2E9WA 3I02A 4TYUA 1OF2A 1BIHA 1EX0A 5AZ2H 4FQJL 2EXWD 4YUEH 4ADJA 1FRGH 4U1SA 2Y5TA 5DHMC 3FTGA 1E28B 3CSPA 2V2XA 4UILH 3LN5A 5SWZA 2XFXB 5D7KD 5KUKA 5L0QB 2MEJB 2LABA 4LCCB 5G55A 5CEZL 1E4WH 2OL3L 1ZD6A 5FYKH 5DU7A 5GHWH 5BQDA 1YO4A 3OB8A 3V8CA 5JPNB 5IUCA 5EO1B 3QR1A 3Q5TA 5CLTA 3GXIA 3IXTA 3M7FB 3WUWG 4FP8L 3QXAA 3VI4A 3NIDE 1E8ZA 4KH9A 1MRCL 4QHMB 2YR3A 3HS0A 4GUQA 3BLKA 4ZTEA 2XXCB 4J23A 4ZQTA 2FZ3A 3JVFC 4E42A 2PYEB 3HG2A 3LKOB 3Q9QA 4LVOB 1CC3A 2MWCA 2Q76A 3UZQA 3J7HA 3L3IA 1NCDH 4XNUH 1EAPB 4UDTA 3HE7B 2UZIH 3LIZH 1IEAA 4X8JA 4AMKH 3WO4C 2J1WA 4I48B 3UBXI 1PD1A 3DETD 4OF3A 2EYRB 4MDIA 1P5VA 3MUUA 3NCYP 4HOXA 4LPTA 4XMVA 5I0ZA 4N6RB 1EDHA 4LVHB 3RGVC 3H8NA 4NQXB 3LKNA 4WI0A 3ZT6A 3C8KA 2XYCA 4NUJA 4G6JL 4YHYC 7CGTA 2BC4A 3FFCB 5AG8A 2X4OB 1J12A 1F13A 1PZ5B 2IAMC 4I8DA 4BINA 5ABDE 5I1JL 1VKXA 3GXMA 2X9ZA 4JZNB 3S35X 3U9PH 1KB5B 1IRAY 1TVHA 1YUHB 5C2UB 2IBBA 1BXXA 1MIML 2ARWA 3Q8AA 5CUSH 3WN5B 1E40A 1FSKC 1O75A 4IU3A 4C56E 4F93B 4XMPL 2UUDK 2PUQT 4X6EA 4FQPA 2VZ1A 5GGVH 5SX5H 3F2LA 4HQQH 4JKNA 4YSQA 1ZT7B 4FQHA 2WIIA 4OZIA 4N0CC 4F3FB 3OMNB 1FBIL 4X8GA 1Q94A 1LE5B 1A6VL 1DVFC 3QDJE 4UV4L 1JF1A 4WWPA 4QLRA 1ZHLA 3SKMA 1H6FA 1SNRA 3J27A 4B7IA 2PWDA 3BDBA 3Q48A 5GJSL 4AUYA 2W94A 3G5VA 2A74B 1D7DA 1AQKL 1WGOA 4OM1L 4WJG3 4XHJD 3AT9A 4ELKA 1FLTX 5C71A 2VRAA 2DQ6A 4P99A 2ZWKA 1YEWA 2C9PA 4HH9B 5EORH 1IC7L 4S1QL 4HIHB 3CPUA 4IRSA 1XGQB 3D39B 4J12A 5B7FA 1XZ0A 4KUCD 1MOEA 2DWSA 1C1EL 3QXWA 2XTJC 5AVXB 3FOLB 1IL1A 2B2XL 5F21B 4JRXA 5BRZB 4B9CA 1I1FB 4M62L 2CK2A 4OJCA 4AV4A 3OZKA 4KO5A 1YECH 1JTPA 3TA3D 3WYRA 2XWJB 4XAKE 1E0OB 1YNTB 5KAQF 4U33A 4KKQA 3UERA 1EXUA 3BESR 2NLJA 4KPHL 3SGJC 2EVGA 3RX9A 4MD4A 2ICES 1HL9A 4HWEL 3EFFA 4AYGA 3MRJA 3ECUA 3TCLA 4YQXH 4NOFA 1T1XA 5ADPH 3OAYH 4XNMA 4XPHH 5IR1B 3Q5YA 1ADWA 3LAFA 4TQIA 4FJZA 4OIAA 5BOZG 5IOPB 1JL8A 1S7RB 4V2BA 2E7LC 1ACYL 3WIIL 3DRQA 5AL0A 2X42A 3O3BB 3JT2A 3L5WB 2VR9A 4XNZB 4G8EA 1QR4A 4IBYA 3RHWK 1NOAA 1SLUA 3TTSA 2UY7A 3DROA 1CFMA 3FO2A 4L9DA 3UCQA 5L7XH 4EI5C 5H4ZA 3NZUA 5EU4B 1EK3A 1QLRA 1SMOA 3BSHA 1DQML 5F1KC 3WOVA 5D7IA 2VLRE 2EDQA 3F00A 4QHLB 1BBJA 3B2DC 5DHVH 2UWEE 5HVFB 3JUZA 2YD1A 3OJVC 2YAQA 2HXAA 2OMYA 4K3DH 1QNIA 1JPSH 5DQDL 3F5WA 4PWHA 1F6AB 2I32A 5LAPA 1I7TA 2J5WA 3STLB 1VLXA 5TGBB 2GHZA 4A7GF 4DGYL 5DR5L 1OV8A 5LBSL 2ZPKL 2VIRA 2EE0A 4P5MA 3FTXA 4Y2NA 1FL5A 3MCYA 2WD0A 1AGCA 2EUWA 2Y7QB 2VR4A 4LASH 1HL5A 2B4CC 3HN3A 2FO1A 2WP3T 2Y25A 5ABAA 3S37H 1WITA 2EACA 3MMEB 1CFSB 2G75A 35C8L 4B53A 2X1XR 1GGCH 2IVFC 2ZUSA 1CICA 1RZJH 4N9GA 3T3PB 4JDTH 3VW3H 1IBGH 3OXSA 2Z1PA 2FLRT 4PJ9C 4NZ8A 1DJSA 1HXYB 1M71B 2ED7A 5C0BA 3OKEA 2ADGB 3ZDYB 2X87A 1FI8C 1H5BC 1YEGH 1H8NA 2XVLA 3QIWD 3DGGA 3MAWA 2HRGA 2ATKB 3HHSA 3DSFH 4G8GE 2DF3A 1H8SA 3JV6A 1J0IA 1D5XA 4FXLA 3VI4F 3CZLA 3VXME 2IWGA 3NCCB 1ZHKB 2F8OA 3MO1A 3OKMA 4YDKH 7PCYA 3FONB 1ED3B 3FSOA 5DF0A 2DQIH 2D7NA 4Z7AA 2A6JA 3BPCA 3U48A 3LXCA 4BBWA 4Y4HA 4F9PA 4D3CH 2AQ2A 3L3HB 4XTRC 1R24B 1T7WA 3EOBB 3ARGC 3IDYB 3UP1A 3LOWA 1JYVA 2WO2B 2YGNA 3NSCA 4QJ3B 4YHML 1O6VA 1EO8H 1OCRB 5IHUH 4TSCL 1KXHA 3EJUA 5IMKA 1SYVA 2QSVA 3NRQA 3T77A 2BOBA 4XVTH 4XRCA 3FO1A 3T1FA 4J6RL 1R3LA 5TQ2L 1T3FB 2JKJA 3ZE0E 3VXOB 3MLUL 3SE9L 1IKNA 2CXGA 1IIIA 1I7UA 3FTZA 2CHWA 2JE8A 1JGVL 3VFUB 4AM0A 4QHPA 1UOVA 1G9NH 2EEXA 2XQBL 5T1KD 1CFNA 3HG0A 5FYJD 4URTB 1XCWA 4AQ8C 4DERA 4Y16D 3OLIA 1YPZE 4YE4H 3H55A 3AU1B 5LN8A 3CZSA 4UTCA 5IB4B 4RVBA 2JB5L 4Z0XB 3VH8A 5J1AA 3ULUD 2CBMA 5EUKB 2MTPA 4QCIA 4AGOA 4P9MH 3AT8A 1B90A 1T1ZB 2WAQA 5CGBA 3FTSA 3SKJH 4OZIF 3QJHB 4OCSL 4XE0A 1YEDB 1QZNA 5IW1A 4DKFH 4OLXL 5I19L 1A3QA 4PJCE 2JJTC 2VAAA 1YN7A 1NBYA 3QUYC 2RALA 4N5EC 5CWSB 3F05A 1OGTB 3I9AA 3CN3A 3E2HC 1J9TA 1WFJA 1RFDL 2ZXDA 5KUMA 3TC9A 3H0TA 1YSOA 2YIHA 3MRHA 4HK0A 1U36A 2IPUG 3IAQA 4RBPK 1TDQA 1WZ1L 3TJHC 3BKMH 4JGMA 3S4SA 3MRPA 2VDKH 1S7XA 3GSUB 4P5KA 4YPGB 1NGZA 1F4YL 3IN2A 3FQRA 4FLQA 1M7UA 1MHHA 4JGUA 4NM4L 2H2PC 1QBMH 3VACA 3BGMA 2YJQA 2F0CA 3MLRH 4NQQA 3RBSA 2W38A 2X4SB 4U1LB 1N6QL 3LZOA 4DUWA 1NOFA 3JWOC 1C16B 3DSNA 3S5LB 1TU2B 5JXEC 3GUTB 1HEZB 2YZ8A 3MRBA 3VXUA 4EUPA 1EJOH 2NW2B 4Z7OF 1WVZA 1TQWA 1OSYA 4WUKL 1N64H 1U8PA 1AQMA 1E5ZA 1RLBA 3ZHFA 2A6IA 5F7EL 4Z3TA 5CBEB 1MI5D 2E46A 3FZUD 4UNIA 2OMBA 1PVHA 4WJ5B 2PCPA 1MEXL 2ORBL 4JJ5B 5EEYA 3LVEA 4Y4FC 2G3XA 2CGRH 2Y06H 4NUQA 4IBUA 4HUUA 4ZPTB 1KIPA 5G5DA 1NEUA 2NR6C 1Q1JH 3L1EA 2EECA 1OPGL 3GMQB 2QJDA 3NP3A 3QI9C 5EZOH 1OALA 5EIQA 4KZEH 1NCHA 1NMCC 1QYGL 2VITB 2NUTA 2WAHA 5T1KB 1DJIA 3NA4A 5I0WA 5BXFB 1TUPA 2B7DT 4FA6A 2BIIA 1KJ3H 3EYOB 4EQ2A 1MJJA 1MWAH 4Y16B 1BQHB 1HN1A 1XF5A 4Y1SA 1ZCRA 5D7IF 5C0AE 1KC5H 1DBKL 3NQIA 3S5ZA 3TASA 1OAZL 1TTGA 3FOMB 2F15A 1U3JA 1X4YA 1TVDA 3VQ2C 4URKA 5K1VA 3IB4A 2PCFA 3C5ZB 4PJAA 3BGAA 1UXSB 3H9SD 3KPSA 5J11B 4JM4H 1TG8A 3QNZA 5E5MA 4MAYB 1Z0NA 2GSIB 1WSST 1RJLA 5EZIL 3PV6B 4BHUI 5HYJD 2E27H 1GRWA 3KCPA 1ASQA 4XPBH 3F6IA 4NCC2 3MX0B 1F3JA 3LV3B 1LL1A 2WBJD 4ZPVB 2E7HA 4RGMB 3T6XA 4Y1AE 5K9QI 2Y2TA 5C0EB 3BSGA 3ZK0A 3QC6X 4PRHB 3WTWA 2NNRA 4UANA 5IHZB 5D7LA 1N4XL 3QBTB 1N5AA 2BK8A 2X44D 4WENB 5I73C 5GIRB 3A22A 1YQ2A 1PKQE 4JB9L 3SO3B 7TAAA 1U42A 3UO1H 2JTDA 3H2WA 5GGSA 5TH2A 5F1NA 3GSVB 3TEUA 4E41A 4I9WE 1S5HB 3MA7A 2LU5A 3FQNB 1P5UB 4WUUD 5D2LE 5EOQH 4ZUTA 1SF5A 3AM8C 3VRJB 4ETQB 5KJRH 2XZAL 3DBSA 3RX7A 4B9JA 3ZIYA 4MCMA 1OB1B 5I74C 4ERSH 1H9DA 4CDGC 3INOA 4IGBA 3FQUB 2NTFB 1GR7A 4C83A 1QFWH 2LFGA 1UZ8B 1AI1L 1MI5B 4NO2A 1CDJA 3BAEH 3BT2H 1CLYH 4HCIA 2WQUA 1MVUB 4DP1X 5EU3B 2JCCF 4FKHA 4H40A 4N2GA 4F80A 3S35L 4CSSA 1THAA 3F58L 4UZSA 4X4MA 3DX7B 5AOKA 2R0WL 3UTZB 4HGWB 5J6HA 2O61A 2DM2A 4OZHE 2R69H 4HS6A 2XWDA 4FNQA 3WFZA 3D34A 1ZWIB 2Z93B 1W8EA 1QWNA 4N2FA 2DQEL 4XP4L 4M9PA 2APBA 5GQBA 4WV1C 1XCQA 3G5ZB 4ZXBD 2DJSA 4FF9A 4XT1C 3ZYJA 2YD3A 5EH1A 3HR6A 1WWAX 2Q3ZA 1M2VB 3FU7B 5I6OA 4B0MB 3BKJH 1FYTD 1FZKA 3FW6A 3W2DH 3GXTA 1EH9A 4AW4A 3CDFA 4X83A 2I9LA 1LWRA 1UA6H 3T0VA 3ULSB 4E5XA 1IGFH 2IV8A 5CEYA 4L3CB 4YE0A 2J6EH 3UTPD 1KNOB 3FSVA 5HPMA 4XP1H 2AQNA 2H45A 4ABUA 3FS9A 2JB6A 4R97C 4CADB 1J8SA 5I1IL 4GKLA 4F7MB 3WXWL 2IXQA 2PABA 2WBJB 2W60B 3BYTA 3FQXB 4FEMA 2JSFA 3QG6B 1SVCP 5IP4A 3QDMD 3RIKA 2H2SD 2OTPA 2WUCH 4AGQA 1HYSD 2PWFA 2VN5A 4PRBB 3UJTL 3V2AR 2GVYA 4P23D 4GQPH 1PCXA 1MHCB 4WSKA 2W0KA 4HYTB 2VDMB 4AYFA 1WISA 3E9TA 3VU1A 1O5PA 3OAUH 3PGDB 3VFSA 1L9RA 5HDOA 2FEDD 4LSSH 1GZQA 5DSCA 4LSDA 5CM1A 3VVVA 4ZDHB 1OLLA 4O00A 3F7YA 2EDDA 3ZDZF 2NY5L 1HSAA 3AXLA 3LHAA 4N2NA 5B39B 12E8H 3GJFA 5AW4B 5CO1A 1OAYL 1OQXA 3P02A 4HWBH 2HPOA 5I9QB 4RFNC 3IK2A 2AJXH 2OCJA 2VQ1B 4L37A 4PG2C 5E2TH 3H9YA 3TNNB 1NGYB 1QO3A 3QO1A 5F7DB 2IPTL 1SOKA 3C08L 43C9A 2BFVL 2CQVA 1JWSA 3GPSA 5AUMA 4ZFZB 1HEHC 1ZIBA 3BKYL 3D30A 4LRIA 3FQTB 4Z3HA 4J1UB 4FQJH 4BZ2H 3C60D 3HVNA 2X40A 2KZBA 1I1AD 4AQZA 2QQKL 5JIQA 5GRVK 3TVMA 4DKAA 5E6ID 4IIZA 5A2JH 4GUPA 4YSTA 1XR8A 5EBLB 1UXMA 4FXGB 4IBWA 1LO2H 5DQJB 2B0SL 2R8SH 3PAVA 4QR7A 4ZXBB 3VO0A 1HI6A 2OL3H 2X1PA 3CG8A 3KJ4C 1H8LA 1XVSA 1NGWA 3QE5A 5JW4N 3IDNB 5FO8B 3HHRB 4JM2C 3OG6B 3NQKA 4L8SC 4CU8A 2BWIA 4HPHA 1FYTB 4RWHA 2PP8A 4XPAL 3ZGIA 2V6HA 2WIMA 3BIKB 3HC4L 3R7QA 5DCCA 4JO3H 4CC4A 4DWHA 3QFGA 4HGMA 4J3WA 3UTOA 4MQ7A 2AI0L 1CUOA 1CFQB 5EC2A 3DTXA 3KPRA 4PJAF 4MJIA 4D9RE 3WDHA 3D4GA 4G7RB 5ESQA 1R9FA 4K71C 3THMH 3KBFA 4FHBD 1BFVL 4CGTA 5BV7L 4GMTL 5C9JA 4HK3J 3ZZQA 2JQAA 3GHPA 3TCTA 2DJUA 1DUYA 3UBXB 1O5DT 3E8UL 1KN4H 4PJIB 1W0WA 3HI1B 4DZBA 4GT7A 1BWWA 3GK8H 4ODXA 5J13C 3E6FA 1UACL 4PREA 3HR5B 4NXKA 3W9EB 3QIUB 3WIHL 2DM4A 2DIEA 5I1JH 1T20B 2XN9E 2EDNA 3RTQC 4LPWA 3IRZA 1J5OL 1SVBA 4GFXA 4S2SB 2P45B 4DGVL 4XGZB 3QUML 4N0YH 2FX8H 4JQVA 3ARDC 4MXWL 1MIMH 4O02A 5ETUB 3SE3A 1PDKB 1PGRB 1RHFA 3BVNB 3QORC 4RAHA 3W82A 4J3TA 1W91A 4A7QA 4NQCD 3NIFE 2K9UA 2VLLA 1UOLA 2KZ1B 2FWLB 3ASNB 2A73A 3R18A 3TBTA 4KX9A 5KG9A 1T04A 3FT3A 4KRLB 4KITB 3LDBB 4WIQA 4HLEA 2ENSA 3MZTA 1A6VH 4UV4H 4UQIM 2G5UA 4P5TA 1YMMA 3QW9A 3GSRB 4JRYE 1DLHA 5DS2A 1FL6A 2CR6A 4P3DA 3V4UL 3LQZA 5L2JA 1A7OH 3UCRA 3KL3A 1I1AB 4WI4A 1UVQA 1JRHL 4Z0BH 2DMBA 4OM1H 4EN3D 5IEKA 1EAOA 5E6IB 1ET7A 4LU5H 3A3YB 5HYJA 4G43B 4FS0A 2YPLD 3OLDA 1IQWL 4S1QH 4LOEA 3GS4A 4LVOC 3T8MA 5BS0A 3SJVB 1ECZA 5E4EB 1RZQA 2IMMA 4CJ1A 1NUDA 1C1EH 4G1EB 1NIBA 3GC3A 3R7RA 3STZA 3D25A 2CMRL 5EIVA 1YQVL 1ZGLB 3O8XD 1XO8A 3T3ME 1A1NA 3JT0A 2IIJA 4YSUA 1ULVA 1F41A 5I5IA 3Q05A 2GITA 3MGOA 2MQCA 3IMBA 4HH8A 3QZLA 2O6FA 4LVHC 4PRIE 2NDGA 3WI9A 1M3IA 2DYRB 2ZOKA 3LPOA 3PP4H 5MEPB 3MV11 9PCYA 4ZS6D 2EKSB 4WUUA 3CDZB 4KPHH 3HG3A 1FHGA 4HWEH 5BMFH 4RWYH 4PJEA 4HKJA 1IC1A 1RJZA 4HHAB 1MCBA 3VXRE 5IB5A 1NM4A 4MMZA 4OCNC 3A4AA 3KPNA 5KYNA 1S9WB 3D6GA 1J9QA 1ACYH 1YEIL 4NWUH 4Q6IB 2NYYD 4ZD3L 1KJ2A 4D0BB 4JFEE 3QJZA 1T7YA 4LSVL 5MHSE 4HV8A 1JDAA 5FS5A 1F86A 4JN1L 3W0WE 5LCVA 1VADB 2X38A 1QRKA 1NTDA 3QISA 4NO3B 1HSBB 5CHNB 3CUPB 3EGDA 1G6RB 3K6SA 2BIQA 3K5RA 4GI9A 3MLSL 1FZJB 1GYVA 3E80A 3F3HA 2WN2A 3W11D 2WB1A 1QSFB 1CGXA 3TP4A 5BOPA 3SDCB 2ZXBA 4K7PX 3GJEA 2WHVA 3KS0J 4GS7B 5MEQB 3U30B 2ALWA 5EUOE 2A74C 5DQDH 1P7KA 2E86A 2M1KA 4F9LA 5ISZE 4D8PA 5LBSH 2P8LB 2P44B 3IDJA 3MREB 2D7MA 4GRMA 3VFTA 2ICWJ 3OHMB 3QVAA 4H13C 2I9TA 5EZLB 1BECA 2XZCH 4LDEB 4W9DC 2QPFA 1ONQA 3ULUF 5IFHL 1NGQL 2A9NL 1ZANH 3Q5OA 4KUZL 2VRQA 4EN3B 2ITFA 2PKDA 4AGNA 3II2A 35C8H 4HJEA 3AC0A 2WW8A 4XCCH 4M7LT 2YPLB 1JZ2A 3KYMB 4Q8BA 4K5PA 4PWGA 4F5CE 1AIFB 4X6DB 4ZTOL 1MJ8L 2MOVA 5ESVB 3V6OC 3BP5A 4DN4L 3RVWC 2Q7YA 3RVUC 3ARWA 5GSVB 4M3JA 3QDMA 2A3TA 1D7CA 1QFPA 3IFNL 2GPZA 2XHNA 5FA4A 5FV2A 1HOEA 2O93L 4GKZB 4JFOB 2A77H 3O8XB 4DH2A 3PJSA 3WHXA 2I27N 3K3QA 1SZNA 2QVMA 3DETC 4P23A 5IROC 3RURA 1AHMA 2CGZA 2DIBA 2VQ4A 3DX6A 3KYOA 4PMFA 1JV5B 1UJ3B 3QXUA 4B9IA 4PGBA 4IK6A 2Q8AH 5DZVA 4BFBD 3KPOB 5DJYA 1BMZA 4OJDH 2TRYA 3NSFA 3ZT7A 1Q90A 2FH6A 5KBLA 1KSRA 2VH5L 2LAGB 3EXLA 3VSUA 3IDIB 1ILUA 5JLZA 4K94C 2C3GA 1FO0A 1KJMB 4YHMH 3BC9A 5I6XC 1UH4A 4W9IC 4OFQA 2AK4D 3DA0A 1FZOB 4WU5A 5AZEL 1XR9A 3CDGA 5CCGE 4WVRA 2EEDA 3CFEB 2WXGA 2FQGA 3KLKA 3PWVB 5LWYH 5INDA 4Y19D 1LDPL 4K9EL 3NJJA 3SE9H 4WWNA 1UUSA 3T8XA 1DCEA 2WKLA 2ICEC 2OMZA 3S36H 1JGVH 3C2SA 3DUSA 1T2XA 4PV8B 4P0DA 1QZ1A 1OVZA 2P5WD 3C60A 2CDGB 3LEVL 3LZPA 4YDIL 2VLKA 1AR1B 3PFQA 2V0AA 4Z3JA 3TO4A 3ARZA 4Z77B 2WN3A 5IQ9A 4PP2B 5BZXA 3NSDA 3SBWC 1RURH 1WG3A 2JB5H 6PAZA 4UQCA 1T4KB 4FKKA 3QWNA 1L9TA 4HCRA 1AS8A 3LKQB 2KT6A 1KB5L 2EDJA 4OUOA 1KLGA 2C1OB 2G3MA 1P84J 2K6YA 4B6ZA 4MD5B 3C8HA 3KBPA 1R5VB 5T5FH 3RWGA 3VD4A 4Q56A 5AVRB 2OZ4L 3M6DA 5JO5B 4M8QA 2OULB 4OLXH 5CU9A 2NY3C 4CNIA 3O3AB 3H7BB 1G7JB 2P7TA 3ILPB 3CFJA 4MLIA 3LNEA 4DP2X 2DYPB 2XKSA 1P7HL 4PN6A 2R2CA 5D2NC 1PBYA 4JFDD 1E30A 4IIQA 4ZQKB 2BM3A 3IU3A 4XVSL 1RY7B 5F8QC 4A7UA 3UTQA 4R5TA 3GI8L 2GCYA 5KS9A 1DQQA 3I2CL 3ZSTA 3RNQA 4G8FB 5CD3A 1UB5B 5CAYB 3BVDB 2J8UA 1R5WA 4AQ1A 1ZOXA 3O3DB 3WFDH 2ITCB 1F4YH 3GMLA 5F89A 3RNKA 1JXKA 4NM4H 2E56A 1JZ4A 5DYFA 4RGNE 5E56A 5AQ0A 4XXWC 4LF3A 1M56B 1N6QH 5LGYA 2H3NA 2ICWA 3SODB 1S78D 4PSRA 4Z5RB 3VJ6A 4G3YL 4BGDA 1HHHA 1R47A 2D3NA 4ISVB 3IGLA 1T2QH 1KELH 3D51A 4WUKH 1MAKA 4QRUA 5A6IA 4GBXA 2DL2A 3BPNC 3O11B 1F3RB 1GGIL 1DBAL 4FFYA 3VWJA 2HYMA 1RU9H 2GY7B 1BD2E 4PJEF 2EUVA 3QEQD 4FJ6A 3IWUA 2Z31C 2R23A 2ZF8A 3AXHA 2OMVB 3D12B 3BLBA 2AK4B 3HZKA 4H26B 4M5ZH 4YVUA 3QEHA 5DC2A 4HZ1A 3JTSA 1ZLUK 4NQCA 1YNLL 1AQDA 1HZHL 4XNYL 1N7ML 2VXTL 4HKZA 2W95A 1I85C 4Y19B 2AV7A 2EUZA 4UI2A 3BEWA 1M05B 1YEFH 5FECA 2V17H 4WEMB 1YG9A 4GAYB 5DEFB 2WWKT 4WW1A 2QVIA 5DUPH 4OZFH 4HIJA 3L45A 3TJEL 4CMMB 4AG4H 2P5WB 3LVTA 2E7CA 1YY9C 2E9BA 2XA8H 6FABL 3S8WA 5JOPD 2E6PA 4PJXA 1ZVHA 4K94L 2EABA 2EZ0D 3MLWL 3U1SL 4HPYL 1DBKH 5FYLD 4IMLB 2NNXA 1BVLB 2Y7LA 3M8OH 4G8IB 4Z7QB 3SKOA 3DK0A 4AC4A 2LT9A 4JZJA 5HD8D 1DLFH 2CGYA 2R1WB 4K5OA 4Q7DA 1ZE3C 3MFFB 4PRAA 1XB6A 4TXVB 3D2UD 1A6UL 3IS0X 4GKSB 5K1NA 4L1TA 5EZIH 1NZRA 3F6LA 1CE6B 1TZ8A 4W9EC 4A2LA 5CFHA 1R34A 3DX8A 4HAKA 4AJYV 1F1DA 2MCMA 4V1DE 2YPKA 4X4KA 3MUY1 3N91A 1ADQL 3KE0A 4LLWB 3IXAB 4M03A 3LD8B 4N25A 4ZX3A 2AEQL 5AW1B 2CDFB 3DVNB 1OWRM 4JFDB 1M57B 2Y22A 2QZQA 4KJYA 3C6LD 4EE2A 2YOAA 1VERA 5K9JL 1A6TA 4L9LB 5SV3A 3EYQC 2R1XA 2W0FA 2GJZB 4PV9B 1E2WA 3QZMA 2VLJB 5I8OH 4KKLD 2MOGA 4FQCL 1NEPA 2X6MA 2Q87A 2DTML 1DSWA 1NKGA 3B43A 2Q9OA 5EU6D 2XZAH 4PJIF 4ELME 4Y88A 5I1KL 1G7QB 1U6AL 2IG2L 4QF1B 2MH4A 5CJXA 3OKNB 2IALB 1FH5H 4FG0A 4FTVD 1W72H 1DN0A 2VLMD 2VJ0A 2X6AA 4EI0A 1AI1H 4CW1B 3HIZA 2IFFH 2J56A 2I85A 2YN3A 1UXLA 1A22B 4JO2H 3W39B 3IJHA 1WTGT 3QDGD 4KQ4H 2GBTA 3L9YA 5ILTL 3H3PL 3S35H 3ZE2F 3SZ6A 4Y16C 1KBWA 2R0WH 4JEGB 3BO8A 4OJYA 2OCFD 4X9GA 3BHBA 2DI8A 4NP9A 4JR9H 3G5YA 4PGZA 3WTVA 3CFCH 4BQ9A 1UWEH 4O2EA 3BAJA 1U8HA 4MB4A 1NC4A 3DECA 4HZLA 4XP4H 2CPUA 1DBJL 2E9IA 4D0CB 3B7UX 3C5ZC 5I6KA 5J11C 4UIKH 3IDGB 2PXYB 4MAYC 2ZKXA 3U36B 2CXKA 4HSCX 3B9KA 5AW9B 1HILB 3INUL 3KDMA 4JGJA 2FJUB 2Q7AA 3SDXA 4NQVB 2GEQA 2GTWA 3MV01 3REWA 2AERT 3CH1B 4RIRB 1DDHB 1BF5A 3MOBL 2BOCB 2HRLA 5JIPA 1FLRH 2QVTA 4NRXA 3UZEA 3ESPA 4MSWB 3UMTA 3D2UB 2BSRB 2WYTA 3SO3C 3ZQ9A 1L5GA 1ZLWK 1JGLH 1KXQA 4WFGD 4F8OA 2X9WA 3D33A 3DVIA 2A9ML 3ZHKA 5I1IH 1INQB 4P46A 5ICXB 4WDIA 2EILB 1P5UC 4TLSA 4HKXA 4DO6A 1D5ZB 4AQEA 4EAEA 2ZX5A 3HS9A 1D5MA 3IFLL 4ABQA 3FUFA 3UJTH 2YQ2A 4TLUA 3CFTA 1A21A 4XH2B 1CDHA 4AK1A 2WSPA 1F00I 5KS9F 5EFIA 3GQFA 2XQ0A 3P1VA 1GAFH 3MNZB 4DEUA 2J8UF 3UDWC 4AE0A 5E24E 3LS5L 1X5GA 3FO0H 4XCYA 2JK5B 5EU6B 3OAZH 4MCNA 2BVTA 2P3YA 1SRDA 4QAMB 1I1RA 3WAKA 2A4ZA 4HOWA 3WDIA 3FTWA 1FYHB 3D0AA 3WAJA 3RWCB 1T0MA 4Y5VA 1ZRUA 4FTVB 1EHLL 3F7RA 3NJNA 2F7RA 1OAYH 3MRKA 1CDIA 1LO5A 4J6IA 1FNSL 4HFWA 4FFZA 1YAZA 4N28A 1SHWA 3QDGB 1KLFB 3VX1A 1JGEB 5JIHA 3CFIC 4J7RA 2DI7A 3BKYH 4K7PL 4B3VA 4F58L 4TF4A 1XH1A 3LRSA 4KQ3H 5HYQA 3L5IA 5EZJA 3L5XH 2VZOA 1E6OL 4TNFA 3I85A 1T5WB 3IVKB 1UM5H 1SJEA 2V2TA 2ZXAA 1WCQA 4NQEA 1K4DA 2B0SH 3LSOB 4HETA 3UROR 3GRWL 3T2PA 4PW9A 1Z9OA 1FG2B 4BEIA 2BXYA 4GQRA 3PWPE 1P0SE 4Y9BA 4O58L 2PETA 4Z7UA 5KOMC 4BKTC 4M4RB 2O1AA 4UT9L 4PJ7A 4EVNA 2OMXA 1LE9A 1AVAA 3UGEA 2W88A 4HD5A 2H1PL 4KTGA 1KN2H 4XPAH 3F7VA 1R3JB 4PJXF 5FYJL 2BP8A 3B6SB 1UYWH 3FT2A 1IFHH 2D7PA 2IH3B 3HC4H 1AGFB 5HHNB 3VX0A 5DJ8B 3Q8CA 1NH6A 4PJBE 5GGVY 4BZ1A 3DOHA 1ET8A 1QSED 3QGVA 3GB7B 3SSGA 2BP5M 3PAZA 3ULUL 2QKIC 5JHMA 4MJ5A 2BSBA 2HRHA 2AEPL 4Y7OC 2LTQC 3RFZA 3BQVA 1G1YA 3IN0A 3HAEG 5FGCE 4B96A 4BRJA 5HGHB 2ESVE 3DO7B 3DTDA 4HKBB 3ZKMC 4RSYA 3CFMA 1TQSA 3MZGB 3S2CA 1A8ZA 2M83A 2Z92A 3ZDXF 5BV7H 4GMTH 1I8MB 3HC3H 4TSAH 5AKVA 3NIGF 4HU2A 1P4LB 5FM5O 3D4YA 4U7KA 2HX9A 5F7MC 2J5LC 1PAMA 3IEAA 3ZTNL 2PWGA 3QEQA 3TT3L 1WD9A 2JKIS 3RKPA 4OH2A 4WO0A 3BD3A 2CNYA 1UACH 2IAAC 3DJRA 3JXAA 3K91A 3Q1EA 2G0LA 4I77L 3WIHH 5TTRA 2P28B 3JTTA 3BH9B 4BFGA 1KBGH 2VL4A 5LQBL 4G82A 4MCYB 2QDWA 2BXZA 2XG4A 3EDJA 3CVDA 5BUGA 3D52A 2CCLA 1ZSDB 4Y5YA 2XN0A 5ERWB 4MXWH 4DVBA 2XXMB 1NBZB 1NCTA 3ATAA 1JPGB 2VZ3A 3HA0A 4MQXC 2K6WA 4P9HH 3AROA 2ZAGA 3H56A 3BZEB 3ELQA 4UM9D 1TJMA 3GSXB 2VKXA 3FT1A 2AK1L 3MQIA 4HDIB 4ZXBC 4UOZA 5DUBB 2XTJE 1SBSH 5ACMA 4IOFC 3CSGA 3G6AA 4J28A 3Q6FA 5GGRB 5GRJL 1WFIA 3QJFA 5JIDA 1TPXC 3V4UH 1M9WA 3KYAA 5CN2A 4A7SA 1JRHH 2VMDA 1B0GB 1BG9A 2NY1C 2YMTA 4MZ2A 2J73A 4KKBC 4F20A 1GZPA 1ZT1A 4ECNA 1PJWA 4NKOB 4EXPX 2J21A 2V8LA 4GG6E 1XGTB 5E03A 1XD0A 1KG0A 3BW9A 3K71A 4UT7H 4RA0C 4BSJA 2AGJL 4O02L 1ZV5A 2IDUA 3C6LA 2G4GA 5JPMC 1JFQL 2VWEC 5FGBA 1PIFA 5C07E 2LW3A 2MKLC 3BH8A 3IF1B 4O2FB 2NX5E 4XC3H 3WNJA 1KIQB 3SDXF 5IJVB 2ZT9C 4PJ5A 2APXA 2F74A 3CPLA 4CSZA 1QSEB 3MXWL 1GIGL 2QADC 2QGDA 4ODSL 3GEFA 5DHXB 1L6ZA 2GBUA 2A7BA 1RZ7H 4QDGA 2BVEA 1JMZA 2VDQB 5D1XB 5E8DL 3ABKB 1U91A 1KBBA 4OFIA 1JG9A 1XEUA 1JHLL 1MFBH 3QIUC 4RA3A 2CHXA 5JUEH 1J8RA 5ESAA 5AW5B 5FF6B 4M29A 4C56D 5KYXA 1Y7VA 1P7QA 4Q58C 1P1VA 1J1PL 5E2JA 1CL7L 4DUXA 5HDBE 1CGTA 1G7HA 3O6FD 4POYA 1JFHA 4UZGA 4ZYKB 4R3SA 2VXUH 5H35B 3RJOA 3TPUB 2VR8A 1A4KB 3O45B 4FD0A 2P1YA 1KTRL 1OE2A 3QDJD 5GS2D 3EH3B 2MTAA 1WF5A 2BSDA 1IAIM 2PF6A 3V95A 2C9UA 3GUFA 4KI1A 4NI3A 3A6CH 3Q2VA 4WI5A 1TJHL 5ITBL 1WZAA 2C7UA 2I07A 2VDML 5TDPA 5I5JA 2F68X 4H0IA 2X6CA 2YEZB 2WXPA 1JTTA 3ET9F 2DIJA 2CUAA 1WICA 3JV5A 2Z35B 5LDUA 2G2RB 1JGUL 2Z65C 5AW3B 4UM9B 2YGVA 3ENEA 3PWLB 4GAAA 5IVNA 5GZOC 4BXVA 1JNLH 1FGNH 1NCCH 4F1SA 1CLOL 2ZKYA 3MGAA 1C8PA 1IARB 1BFOB 3Q1SL 3L7FB 2MKWA 3SGEH 3NIDB 4F1ZA 5IW1B 3N2JA 5DZ9A 5KYYB 1MW1A 4BK8A 1NGQH 4KUZH 4XAKD 4X99A 5F3BA 5B3JF 4Q9QL 4M5YL 3ECQA 3VI3E 3PWNA 1ND0B 1KTDA 3PIQA 4GG8A 4MNQE 2D7TL 4B9FA 4IK7A 1XGYL 2WTOA 2Z8RA 3ZO0A 3TBVA 1FCGA 1EFXB 1S9YB 3U4AA 1MJ8H 3E7JA 4H8PA 1IAKB 2IBGA 3GMPB 5I8EB 5GGTA 2IPKA 3IFNH 3S3CB 4JPIA 4Z7UF 3IMRA 4WF7A 2BHZA 4OV5A 1RUML 5E4IA 3CXHJ 4GKOA 4PJ7F 4KKCD 5HJGA 4AZ8B 1Q8MA 1U58B 4WU7B 2EIEA 4OLWL 1UWXH 4YDJB 5KJ4A 1LP9A 5E8OA 1IC5L 5KSVA 4HIXL 4WWKC 2AJVH 5ICZB 1BBDH 1UWFA 2V7HA 4NLAA 5HVWA 2R7EA 3PDDA 1CFVL 4EUPB 4YEFA 4L5FL 3CXDL 2ARJQ 1HHIA 2YC1B 2N59A 2VH5H 1MN4A 3EBIA 1VENA 4CVXB 2VLRD 4L29A 1WS7A 5TFSH 4LBEB 4Y2DA 4C56B 4OVUA 5T1LA 4DAGL 4NPKA 5DZJA 2EDFA 4CRPA 1G7PA 3O6FB 4NSKA 3TYGL 1KIPB 3CIQA 3X11B 4AT6B 3SDCC 5JHLA 3V4PA 5DJ2B 3NESA 3EDDA 4C4BA 2DY2A 3I75A 4QRRB 3QCTH 3HE6A 4JW3A 5E08L 2OJEB 4K9EH 5J9PB 1P1ZB 3QDJB 1EPFA 4JHAL 4U1MB 2DQTL 1GMIA 3EJZD 4I18C 3EO1A 4XN9A 2G5RA 3ZT5A 2EIZB 1CGSL 3LEVH 2JLLA 4LLDA 4E9YA 3T5WA 1PFOA 1KYUA 2I24N 3MV7D 3QIBA 4OGYL 3QQ3A 5I8KH 2NY4C 2VO8A 3VD3A 3NCBB 4ZZFA 2UXGA 3BJ91 4L1LA 2FUTA 1G4MA 1U0QA 1BZ7A 1XCXA 5HYSA 3EFDL 4AJWA 1UWYA 4PRNB 3SDDA 3D7PA 4HJTA 4HEMA 3PP3H 2ZXQA 1Q0EA 4UQEA 5KVDE 3ZR5A 5DQ9B 4L1DA 3QUZA 5ICYA 2VR6A 1F97A 1T4WA 3N1FC 4MFHA 3EJYC 2AKRB 3NA9L 3BE1L 3NOIA 4HUXA 4PGEA 1L6PA 2KC0A 4FZ8H 5IQOA 4G8GD 1JVKA 4GYBA 2R0KL 4HCFA 3VXMD 1MAML 3G6JB 3P4LA 4TUOB 1QACA 2RACA 2KLSA 3NDYE 3RVXC 2YBRA 3X3GH 4NB7A 4JZOB 4EOWH 5IB2A 3GSQA 3A4EA 1U8CB 1UJ3C 2APFA 3S2AA 1N5AB 3UTTA 1AZBA 2EYTB 2ZKHL 4ZS6C 5F8RC 3I2CH 4GW4B 3DUUB 1JE6A 2QPSA 5FW8A 1G0XA 4HCRL 1NL0L 3FF8A 3H9HB 4NJAH 2BCKB 1HS6A 4HWUA 3DMMC 3SYPA 5IMLB 1GJUA 2MCAA 2OKMA 4ILDA 4UMSA 4G3YH 3IJEB 3Q43A 1E4KA 1ZLEA 1ORSA 1PS3A 2LLLA 4MMXA 5ANMA 1CQKA 3U4BH 4LCIH 1OTUD 5CGYC 1TYEB 4J39A 4GEJA 5D6CB 4Y9FA 2VLRB 4HUWA 4NO2B 3U7YL 3MC0A 4HALA 1NCIA 2UWEB 5EU5B 4KC3B 4WEEA 3LNFA 4MNGE 1VPOL 2ZG2A 3U25A 5HY9B 3NFNA 1AR1C 4EDXA 5CIPB 3ULAB 4BGLA 2VXTH 5GRVL 1YEJH 3NCXA 3KLAA 4BFEA 2HUHA 1RZ8B 2HG5B 1IGIH 2JKLA 2O30A 3LNIA 5I1LB 3M07A 4K3EL 2XNAA 4DP0X 4LE8A 1YUKB 3T0EE 2CIIB 4HJGA 1NM9A 4HBCH 2DJMA 4DZ8A 4WEBH 2N3JA 2VZUA 1S7TB 2QBWA 2DQCH 4JE0A 5GS1C 4U6YA 2BSTA 1G9ML 5IFJB 3U1SH 4HPYH 4GH7B 4X6CE 3AWGA 4C4KT 4JY6B 1PEZA 2WTRA 4YHOL 4FFYL 2H1LM 2ZCHH 2BSED 1TNMA 5EV7A 2NQDA 1B0IA 2AMGA 1PZSA 4K07A 1FNEA 1BAFH 1NFIB 1PYWB 1EEUA 3S98A 1D5RA 2ZCZA 4XMKL 3W37A 4NPJA 4G8GB 3ARPA 4QOKA 1GPOH 4UYQA 2NW3A 4DK6A 3DHUA 4MB5A 5FM5M 3HCVA 3VXMB 3PUUA 5D7HA 4KX7A 4LQ1A 2JIXA 1SN2A 1XIWC 3GFUA 3NJXA 2ZWYA 2IQ9L 2MRYA 2AEQH 5A7BA 1DTUA 1PSKL 5E8EA 4IJ3C 4NPYB 1DQLL 3PNWA 3HNSL 1RUPL 3JWDC 3PLYA 4OD2B 5DFWH 4BKSC 1CLZL 4AYID 5E0FA 5AFAA 3IDUA 3SE4A 2MCPH 2ARJA 5LKNA 3MV8D 1OTSC 1AXSA 2YA0A 5KYWB 4XXCC 4Z18A 1I9IL 4FQCH 4XCEB 4NENA 4XWGH 1DQDH 1KCUL 2DTMH 2X4PA 3MNVA 4K0OA 3HUJA 1OANA 3MCKB 3ZE0B 3E1ZA 1RPKA 4UB0L 2BNRE 5I1KH 3CMGA 1U6AH 2IG2H 1PTZA 4HC1A 4JN2B 4BIKA 2J1KA 2UUDH 4APXA 1KT2A 1LP9F 5F1OB 2X1OA 4G7YL 1V7MH 4H20L 4YAQB 5F7BA 1ZAGA 3ZL2A 1YN6B 4Z78B 1WV7T 4O4YL 3EO0A 1AE6H 4YHLL 3IE4A 4YSEA 3CSYA 3VXSA 5JA9A 2EXYD 4K3HA 3H3PH 1YJDC 1OM3L 3O2WL 2OBGA 3NZSA 5IHLB 4ZUSB 3ILEA 5LUMA 3RY4A 1H9VA 2I60H 3TF7C 1I8IB 5INCB 2CO1A 3CX5K 3S5LG 3UYRH 3V5HA 2P52A 4F7PB 3QH3B 3GS0A 2WCPA 1WWBX 1WBZA 1QPPA 2X70A 4ZW3A 3VD9A 1DBJH 5TDNA 4PJCB 4N3UA 4Y5XA 2HT4D 2B3RA 1G7IB 5AVWB 3R8QA 3B1UA 4M9OA 1NGWB 4Y1AD 1S7UB 1X5YA 3BN9C 3INUH 2VMJA 4YVNA 5DJAB 2WXFA 3ETTA 1L9MA 2C3VA 3WNKA 1MFNA 1IGTB 2AJYL 1J18A 3LD8C 1T03H 1SHSA 5DLML 1IT9L 2YD6A 3MOBH 3NAAH 5CD5D 4Y8DC 4YSCA 3MBWA 3CLFL 4Y2OB 3G04A 3QCUL 5FYKE 1K8DB 4L9LC 3U0TB 3I50L 4I9WD 3Q8EA 25C8H 4R90H 3KZ8A 4C59B 4M6OL 1IU1A 4AE1A 2XUWA 1RZIA 3B4NA 2WC7A 3CHSA 3NSXA 3RUGE 1BQHG 2NNAB 3PHQA 4AMXA 1HAUA 4EEEA 3UP6A 3F85A 3FRPA 3UABA 4ICXA 3ABMB 4LCWA 4LLUA 2ZZUT 1U8MB 1JVLA 3NG5A 3N1MC 3PY9A 5DEGB 2IGTA 5AWNL 4HUVB 2NYZA 5AVUB 4CUCA 2R59A 4TNVF 1S8DA 1JVOA 3B2XA 4LOUD 3TIDA 3V0VB 2NUPA 2XY1A 4WW2A 4YDZA 4D9QE 4HUMB 3ZRSA 1MLBA 3LS5H 4OCYL 2NMSA 4M1GH 1SM3L 2JNZA 5CLZA 4PWFA 4MTMA 4FNUA 3OM3B 4YGVA 4PU2A 2OYKA 3G08B 3LQMA 4AVIA 5DRNA 1KPUA 2C26A 5DK0B 3KWXA 4HXBH 3ZUCA 3CVHB 4FG6C 5BUPA 1MW0A 3ZMRA 1OXYA 3T04D 1AXTL 3L5JA 1EHLH 4U49A 3F12B 1AKJA 4H0HB 4NRZB 1D9KD 3MV7A 4NFDA 2VLLB 3JWDL 2W07B 4WO4A 5E5RB 3T65B 1AZUA 2Z6FA 1AACA 1ZLDA 3GGWB 4NFBA 5C0AB 5GRWA 3CQPA 3ME0A 4JKKA 4FFWD 2PXYC 4L4JA 1MRDL 3H54A 3QQ9C 4F58H 4K2UL 2GTZB 3RFRA 1J8HE 4JQXA 4WTZG 3MJ9A 4ZI8A 4KRNA 1GOFA 1UFUA 1E6OH 1WFOA 1KF9B 3MCG1 4XXDA 4RAUA 2W65B 3HS0C 1H8OA 1A1OB 3QP3A 3E3QC 5CCKL 4H25A 4PCSA 4KI5F 5F7AA 2C34A 3ULVF 3DO3A 4PPTA 3IWVA 4O58H 3FN0L 3IAPA 4G9FA 1MCSA 2UYLB 3Q3GB 2DWEA 1JIBA 4Y1AB 2DKSA 3GJFH 4UT9H 1AD9B 1H3TA 2WZ0A 2X3BA 4JPSA 4P9HC 2YLKA 3K6OA 1PKQB 4FFZL 1IM3D 3LEXA 4YBHA 1IJNA 5FKAB 3BVVA 2AXJA 4XN4A 3CHQA 3OBAA 4FXKB 4M93B 1NWPA 2H1XA 2WXQA 5F9DC 1ETB1 3ULUH 4NYLA 4RNRB 1E4JA 3KMDA 2V9QA 5D2LB 1JF6A 1CVRA 5BVPL 4F2MA 4XO9A 4HKJB 3GPEA 1RJZB 1UFGA 1NBQA 5L88L 4UYPA 4XVUC 3NEXA 3IJSA 2ADJA 4OLUH 5HVHC 2AQQA 3D08A 4LLVB 1E4HA 2H3XC 3CQFA 4Z7NE 1UQSB 3RAJL 3AADB 1BREA 1YPZA 3V8OA 3ZTNH 1ESOA 4KRPD 3QPKA 5EO9B 4ZFOA 1CYXA 3O4OC 4IS6A 1FA4A 1MH5A 4GSUA 4M7KL 4YHKH 4OZHB 3IDMB 2F7PA 4IOIB 1EZVX 2L3BA 2XRAL 5I17A 5IB1B 3CWGA 4Y7MA 1AP2A 1CFBA 4ODUA 4Q0XL 4DJMA 1QA9A 4JDVA 2ZWNA 3K6SB 1INDL 4NQDA 4PI0A 1MHPL 3ZTCC 2IQAA 3ARBD 4PRDB 3BP6A 2R15A 3CX5J 4MA8L 4YX2L 4X4XB 5FDYA 1D9KB 1QNZL 2R2EB 4HG4K 5I76B 1P7KB 2XY2A 1YC8A 1XBRA 4X50A 1J87A 2K7QA 2JKSA 4U3HA 1BDYA 2H7WA 5EPMA 1VFBB 2CM6A 5GRJH 1VACB 5DK2B 4NUMA 4AIZB 1FP5A 5T3XH 3Q6GH 5B1JC 3VYPA 5EBWB 5B1BB 4PWIA 3WEXA 5B39G 2K4WA 3BLPX 4UDUA 1N2RB 4OSUH 1BCIA 4PGCB 1FFQA 2EDKA 2JCWA 1WQVT 3U7AA 2IO5A 5F6HI 4RBPH 4D9RD 1QVOA 4X5WB 3EAKA 2CO6A 4PSPA 3RB5A 4O02H 1H0DA 4I0PB 2BCMA 2G9HB 4HWZA 5B8CB 1SUJA 4K7FA 5B38A 4F8NA 4XNDA 3A5VA 1DSYA 3IPFA 1I3GL 4KO6A 1IM3B 2F5BL 2H9GB 3FCTA 5DVNA 4JFVA 4A2EA 3U9UB 3PXHA 4KO9A 3K72A 5FFOA 1OOAA 1E9QB 1NCJA 3MV8A 1GIGH 1ORQA 4ODSH 4R96A 5IB3B 4UQ3A 4QO1B 1CZ8L 3M17A 1O9VA 1HH6B 3QUXA 5D1QE 4MJ6B 4X6FA 1AR2A 3WFBL 3FB8A 4NUPA 2XN9D 4TTGA 3GMNB 3OR6B 5E8DH 2ENPA 4JVUA 3ARSA 3V79C 2RTTA 2VDOB 4ZW5A 4K8RD 1OP3K 4AK2A 4IQHA 1CL7H 5AD0B 4AEHL 4X0KA 2DLHA 3FUJA 4KRPB 1BZ8A 4DGIL 3LJ3A 3FPYA 4NN7B 5BVJA 3LQAH 4S1RL 3KVPA 4MS8C 3FF7A 5ITBH 3RP1A 4A7VA 3VFOB 2ODHA 1CT8A 4M43L 3ARBB 5GJTH 2YK1L 2F8IA 1MDTA 2F54A 5BRZE 5EF1A 3UBXG 2V9RA 1WA2X 1SBBA 2A4CA 3KGUA 3U0WL 3MV9E 1MXGA 3VXQA 3O4LA 1KCKA 1JGUH 4ABWA 2ED9A 3MN8A 2PCYA 5HHQB 4KXZI 1AY1L 1CICC 5IFAH 2YXVA 5LAXB 5B3NA 4APQA 4Z76A 1ZMYA 3V6OE 1AOZA 1MNNA 2ZJSH 3ATFA 2Z1KA 3NRFA 1OZUA 3Q1SH 4IJTA 4OQTL 5KVMC 1KJ2H 5JDSB 5D72L 4AYBA 5DMGD 3T6WA 5I1HH 1RZKL 2O5XL 5GGUB 4TSBL 2R29L 2V7NA 3GINA 2BINA 5LCVH 1QTYT 4MAUL 1A4JB 1MCEA 1C08B 4PRID 4W4NA 3A4FA 2DWDB 2VW4A 4AXWA 1UATA 4UTAL 3N41F 5C8JB 2F1AA 2D7TH 4FDWA 1JN6A 5DZOA 1XGYH 3LPFA 3V7AG 3MRMA 5CZXC 5F96L 4A2GA 3RNQB 4XI5D 4CVWA 5D1XC 4A7TA 1J0JA 3JYCA 4L4VA 4Y4HC 4WHCA 5IW6A 1RUMH 1E9OB 1FFRA 4MCZB 3RVVD 4AZUA 4JFED 5FUZH 1T7XA 5L6YL 1QX1A 2GT9A 5MHSD 4JUSA 4OLWH 2H3NB 3W0WD 2VL5B 1OCWL 3U46A 4EZJA 1D2OA 2X4QA 2X5PA 3B9DA 4BCXA 2GUOB 1CXLA 2XWBB 5HDQH 2XN9B 3D07A 4P2QA 4OLYH 1FZMB 3DGDA 4QRUB 5E6UB 1HZLA 3NBNA 3NP4A 3K2UH 1WFUA 4X9YA 4B9PA 1NLDL 2R1YB 5FB8B 4M7ZB 2D9CA 4A2MA 5AYUH 3FB5B 2PTUA 2O4EA 1JNNL 5IKCB 3NIFB 3K2IA 4KVCL 1U33A 2CKBB 5FKPA 2FJHB 3SQBB 3TYGH 1QUPA 2XV2A 4QJ4B 3T6VA 5FO9A 2Q7NA 1B2WL 4OCRH 5GGTL 1AQHA 3DXAA 3ZW3A 5FECB 1YPZF 1U8QB 1SMDA 1RSFA 2HG0A 3ISWA 5T33L 1SUHA 1U8NB 4JRYB 4M1DL 3G5XB 3WE1A 2HJKB 1ACZA 3J2PA 2IPUK 2COQA 2EKJA 2EDTA 2F08A 5DD6B 5BJTB 1OQOA 3L3JA 2KHAA 3HG1E 4OGYH 5D4QA 3HRPA 3LZFH 3K2KA 4FGMA 1BZ9B 3OR7A 2GJPA 4I1NB 4WY7L 3NEEA 5MERB 4N86A 2V3FA 3OKDA 5IF0A 4C8XA 4YLCA 4IRZA 3BPLC 1MUJA 1NCNA 4KZCA 2VM3A 5D2NE 2Q6WA 3MJ7B 3FCGA 5A2CA 4PJCF 4HIEA 3MNWA 1FO0H 4Q97A 2GC7C 4NKIH 3GSNA 1CWVA 4AC2A 3MRQA 5KVFL 1R6VA 3NA9H 2HT3D 1EQWA 3BE1H 1TKWA 3OAWA 3QAZB 2XVGA 3WUWA 3T3MB 15C8L 1DBML 4EBQH 3EYVB 3B2UC 3NPSB 4OFYD 2J3SA 3V4PL 2AXGA 4JLRB 2VDPH 4JANB 4D9LL 2R0KH 1MAMH 2NXZD 4PRIB 4XOBA 4CMHB 1KFAL 4ENED 3L3DB 2BW5A 2Z4QB 4KKZA 5E1HB 1QLFA 3TS8A 4QWWC 1DFXA 4OIIL 4HULB 1XL4A 1A6TB 4ALAH 4JFYA 1DFBL 3HEIB 3VGDA 2WXNA 1QASA 2CJUL 1RJCA 3L7EA 3TPKA 3VXRB 2H6UA 3LTVA 3MXVH 2V33A 3HNVL 4HCRH 2Y1ZA 4GNKB 1HKFA 4BWUA 1YEKH 1S9XA 2AJZA 4XOAA 4AWJC 4YFLF 4ONHB 4PY7A 1B6DA 2ICCA 3W0WB 1S7VB 1UWGL 3DUHA 5AENA 3CZUB 4L4TA 3O6FC 5H37G 1K5NA 5DRZB 3S3DB 1F90L 5KSAA 3MRIA 3V9EA 5I1EH 1EHXA 5F70A 4P2YA 4QTHB 3SE8L 3LKPA 2Y9RT 3MRRA 4R2GD 2W81C 1OP4A 3M86A 1B0RB 4NNYB 3U7YH 4XP9H 1MJUL 4PP1C 4RZCB 2IJ0C 1U95B 1VPOH 2QTEA 3QR0A 2VDQL 5EUOB 1AGEB 2WUBH 3B2MA 4CVZB 4L3AA 1UJTA 4E68A 3MLTA 4IRJA 2AFNA 5FHBL 5GXBB 5IJDC 1W0VB 5HI3D 3L1OH 5HHOE 5ISZB 1K6QH 3N9GH 4RDBA 2HLFC 1FAKT 5CEXA 4JFFE 3X3FL 4BXSV 2L04A 5DO2D 4OCLC 4KRMB 3QHZH 1FFPA 3NK3A 4KVNL 4NBZB 3WJLC 3WIAA 2W8CA 4C54A 3SQRA 4BFIB 2ZWLT 3IU4L 4I9XA 3R0MA 4UQ9A 2JFCA 4YHOH 3VM7A 4FNSA 4FFYH 1BZQK 1XTLA 1OD9A 4IBSA 1TCRB 4R0LA 3PHOB 2NY2D 2BP0A 1IAOA 3GWJA 3MUGA 5GRYA 3VB8A 1Q4NX 3O3UN 4UM8A 4B50A 4XMKH 4AUUA 4A63A 5BO0D 3AY4A 4HS3B 4RGND 3NCYS 2WBWB 4ZMLA 4R7LA 2ATPB 4AKOA 3U6RB 3GHEL 5E9DE 1DQVA 2NXZB 4RAVB 2E59A 3N42B 5A2KH 2MHAB 4JG1L 2IQ9H 1HQ4A 4AQEB 5D71L 3SQOL 2UX6A 2E3VA 3IFPA 3A4DA 1S7WA 1RPUA 3HNSH 4UAOC 1CXHA 1Q9KB 4ZK8A 2R2BB 4O51B 4OUUB 5E1AA 1RUPH 1T6WA 3J8F7 3MJ8A 1GOHA 3AAZA 4PJDA 4IGBC 4ODWB 5C08A 1BD2D 2JXMA 4YNYA 1F4AA 1SFHA 1D6VL 4NNPL 3HLAB 3MRFB 1O7VA 1MCOL 4R7XA 4TS6A 1XGUA 3GSOB 1CPUA 2NXYC 1NQBA 2GY5A 5T5NG 3DLQR 2GJ6B 4KJPD 5D9SA 5LLIC 3BQUA 1LEIB 1BYOA 1MFCL 5DHYB 5JZ7C 1K9TA 1CQYA 1DVUA 1RVFL 3V6FB 5HHXL 2FSEB 4R2GB 2OMWB 3H3KA 2P5ED 3Q8FA 3L13A 4LSQL 1DSFH 4O4YH 4J3OC 4A6YB 4YHLH 4UBDD 3MROB 4AQAB 2HJLB 2LHAA 1NGXA 2PYFB 4AH2A 2BMKB 1DO6A 1OM3H 1JS4A 2LVEA 3O2WH 5C0IB 1H6UA 1M6UA 3UAFA 2Q2EB 5HYQB 3L3GA 1CJYA 3SO5A 2K4AA 1R1CA 2OR9L 1KLUA 2QSCH 2C9QA 3H42L 4KNSA 2ZP0T 4FQQB 4MWFB 5T1DL 3ILDA 4EXKA 1RK0B 2K8QA 1Q9WA 5IVXA 1H3PL 1QQDB 1A6ZB 5I6MA 1X5IA 1YCSA 2IH1B 4KNQA 2V9TA 1PZ3A 2ZOLA 1R19A 5HHME 1DHKA 4KROD 4V1DD 3FN3A 2A83B 3ZRFC 3FQWA 1BEXA 1RERA 1CN4A 2V3DA 1NIAA 3HKFA 4PJGE 3HNTL 1M1SA 4G80B 5LB1A 5CP7B 3EYSL 2AJYH 4WI2A 5DLMH 2D2CC 4QHNA 4I5BA 3CLFH 4MNHA 2WO3B 3I6SA 1GGTA 4IKNA 3ZPDA 4KK8D 1ZEAL 1PIGA 3I50H 2NQ3A 4MX7A 1CVSC 4M6OH 4RGNB 4JFEA 2VDLH 4NJ9L 4F7EA 1R0AL 3E38A 4KOBA 3LH9A 5IVOA 2WXHA 2XDHA 3A24A 1VRSA 4LCYA 1FNGA 1KZQA 4N2HA 3OLEA 1ETZB 5J1SC 4N8UA 3VD2A 3CLEH 1R75A 2OQJA 1KXVA 4K23L 4RMRA 4W9ZA 1ZJBA 4PIBA 5HGAB 3UG5A 2OTWB 2Y23A 4AX3A 1A65A 3V4VB 2WZ5A 3VXPA 5KANI 1VZGA 4PJ8A 4PJHE 5I5RA 2J43A 1AFVH 2P8MB 3CZFA 1KTLB 3HB3C 4AL8C 1BA9A 1JHKL 4X4YB 3PGFL 4KTDL 1G7MB 2DPKA 1MZZA 3C9NB 2RAMA 1KPRA 1XV8A 4K3JL 4N2BA 4ZMTA 3TBWA 4MRCA 3ZO9A 4BA8A 1CMOA 4GP4B 4KGJA 5IEHA 1RIUH 4JFWA 3C5JB 3UAJD 1SY6L 5I8CA 3IBEA 1I75A 2YKKA 4LRIC 4P06A 4DW2L 1HHGB 2DMCA 3EBAA 1AXTH 1WFMA 4GI8A 3NZ8A 3AMLA 3OF6A 3FFDB 2YQBA 2PO6D 4OJEH 3GS7A 3COOA 3D85D 2X7LB 3FCUB 3MKGA 4YIQA 3FT4A 2H0JA 3ROLA 2FR4B 4JKPL 3LZQA 1T1YA 1JWUB 3PWJB 4PS3A 5E00A 2XWTB 2V5YA 4J4PA 1LO4L 2COVD 5FO7B 4UMGA 5F3FA 5LJYH 3QULA 2W0LA 1BFTA 1XWVA 4MXQC 3SYQA 1BIIA 2W0PA 4HK3N 4K2UH 4NT6A 5CGTA 3NJFA 5MENE 3QCVH 4N20A 4X9IA 1KULA 2YOCA 1RCYA 1BVKA 1MCLA 3N85L 4CC4C 3ALXA 4FG2A 1RUQH 3SEPA 4KROB 5C0GB 2GSGA 3HPLA 3SKNB 1E27A 4V1DB 1UB6A 5I5MA 3QZNA 5GRXG 4JQIL 1C12B 3WFHB 3ZY7A 2FVNA 4R7NB 3WIFB 2G5BB 3U4EA 4FNLH 2WQ8A 4AVKA 5I1AA 3OPUA 3HMXL 3AABA 4FFZH 2YUXA 2R83A 5AB2A 2AEWA 5D5ME 1KDJA 3CN2A 1F11A 3D0VA 2XWEA 1K4CA 4LHUD 5HHVL 1U8JB 3APDA 1DE4A 1M7DA 3LRHA 4ELMB 3JQOB 3KPLB 4DEPB 4JPKH 4P2OA 5FA3A 3Q06A 2VXSL 4XOCA 3SPVA 2KKQA 3ZTJG 4N24A 3P77A 3Q2CA 3UX9B 4JQVC 3RAJH 2IBZX 3QXDA 2JI2A 4P4KA 5LXVA 4U6TA 2GI0A 4PRPA 2QV2A 3APFA 3KWUA 3QA3A 1A4CA 4PJDF 2E8ZA 1NUGA 3ESVF 4M7KH 3VGAC 1H3VA 2PTTB 2OK0L 5JQHC 1TZHB 2XRAH 4MA3A 2LQRA 5C0FB 4P3CH 2FO4B 4Q0XH 4BZ1H 1INDH 5BZDB 4QRPA 4RX4D 2R56H 3QQ4B 1ML0A 1JZ7A 2DWXA 4H1LB 4YX2H 4EO5A 4RFOL 4YR6A 4JDEA 2PO6B 3QT2A 1HQRB 1X5XA 3D85B 3FH7A 1FJ1A 3KYNA 3LN4B 5IVZB 2KLRA 3S34L 3R0NA 5E8PB 4BJLA 4LKCB 4TULL 2FL5B 5IJKA 1MCWW 2AJ3A 4AL8L 1HHJA 4OCXL 4AJVA 4UOW1 5A1AA 4QY8A 1K8IA 4PB0L 1F6FB 3RWHA 5AAWA 1JYWA 5L4IA 1QKZL 3RGVD 4ZX6A 3CFBB 3F83A 5EEXA 3KCWA 2BIOA 4Z3GA 1JSYA 1U8LB 4KQ0A 2BLFA 5I71B 1NAMB 2B9BA 4QHKI 1P2CB 3ETBF 3OJDA 5E94B 3WLBA 3I9PA 3LQAC 1KTDB 3T0DA 2KBGA 2QLYA 1QHQA 2ESVD 5F88A 4FXKC 4M93C 5IVXF 2IAMD 3W1ZA 5J57B 3MRDB 1SJHA 4DFHA 5EEUA 2HFFA 3BWAB 1T1WA 1AH1A 3T4AB 1MFDH 3I6LE 3D0LA 1HL4A 4FABL 1N0XH 4M56A 3SD5A 2A1WL 4N0UE 5DC0A 4DVRL 5D1ZA 3OXRB 1I3GH 2AXFB 1Q38A 3QJSB 1PLGL 2JJWA 5H2BA 5BW7A 3DVGB 1BD2A 1FG9C 3HZYA 4MMZC 2EXTA 2J1ZA 3CJJA 3CN4A 4N0CD 5EB9A 1FVDA 3DRTA 3FCSA 4LHUB 4P2RE 4Y89A 5GS3A 2UY6A 3HMWH 5KBDA 3WFBH 1DVFD 4OKVB 3PAUA 4ORZC 3JVGC 3WMQA 5A2AA 1IIKA 5KJ7E 1KB3A 1UCTA 3L95B 4V11A 2HH0L 2VXQL 4KHXH 2VJXA 3ZKSD 1E9PA 3SGKA 3MBXL 1DQJB 1XXDC 3UTSA 2LFEA 5IUSA 4Z7WE 1NANI 3KPQA 2P5EA 3C6SB 3LRKA 4A55A 4L3EA 3H7LA 5K93A 3CU7A 4PTTB 5C09D 4AEHH 2EAEA 3MCLH 1OAKH 3RL1A 3KLDA 3LXBA 1LDSA 2HKAA 5LHDA 1ES0A 3EOAB 3BUTA 4OD1H 5ID1A 3X1GA 4F33A 2XTJD 3LMJH 4MXVF 5D7JA 1W6WA 4S1RH 5FCUL 3MBEA 3CAFA 1AJ7L 2BVYA 4NDMB 4JHVA 5TE4H 4H2CA 4RQQB 2YK1H 1U8OB 4CGUB 4JHUA 3VFNB 5CP3A 3U0WH 1DR9A 4NAQA 2N1TE 5EU7C 1CG9B 4F27A 2VW7A 1BVOA 3PWPB 3UJIL 4NFCA 4P07A 1OP5H 3QYMA 4LB8A 2FX7L 1DL7L 4GO9A 2OA9A 4BSWB 4W9FC 2H0PA 2CLVA 4YXLH 1MCKA 2QTVA 4DEWA 4TUJA 5C07D 2APWA 2NX5D 5D72H 3IKCB 2O5XH 2OL3A 3OC8A 4I0PC 4TSBH 4PJBB 3RGVB 1Z3GH 2Q86B 1F1GA 1FIEA 3QDHA 4HIQA 5I1GH 1F8TL 2Z7UA 4PD4J 2IADA 3CNKA 5TDOB 4GI6A 3M1BB 4YHYB 2ZNXA 2O6DA 5FGCB 4R84A 3UZVB 5DJCB 3ZHDA 5LNEA 2I25N 5EBMB 1GVIA 1WE5A 3GHBL 4EI5D 4JFQA 3VTAA 1SYSB 2JQMA 1I7ZA 1FGVL 3VFWA 2SEBB 4X7TB 1I8LA 3FKUS 1I9RH 2UZXA 4WGKA 1FSKB 4XBPB 1V55B 2VN3A 1G0DA 3ARTA 2WCGA 3U4KA 2G60L 3SE6A 4HMDA 1QLEH 1OL0A 4ONFL 1YY8A 2O6PA 2DQHH 1E5YA 4M61A 1OCWH 5EO0A 5ADOH 4UNUA 2EICA 4XCNA 4HFUH 2Y7MA 3LNGA 43CAB 1X5KA 3RVTC 2VXVL 4IDJH 5FFLA 1KTKE 3DURA 1U3HA 4K15A 3MRCA 2H6PA 4H88H 5C0DA 5KSBE 4KTEL 1RXLA 1V7NL 5HHPA 3MR9A 3K6DA 4NN7C 4UQBA 1KIUB 5K9KB 1IC0A 1UXWA 2PW2A 3ECBB 4FQXA 2DZEA 4JPWH 2A9DA 2HCZX 3GT6A 4ZUVB 4ALAC 2WO4A 4U2YA 4ZG1A 4JCWA 5A16B 3TEZA 4JFXA 2DBJA 2OSLA 3DHPA 4GY4A 4MMYA 4PJ9D 3D69A 4JS7A 1JNHB 3GBLA 5GGTH 1B2WH 3BEVA 4MB1A 1EXHA 1R33A 3NABH 1RZPA 1A3RH 3PGCB 4ONGH 3RDJA 4AVHA 4GAJL 5HGBA 2QHRL 2XTJB 3BSZA 3EG9B 2K70A 3IFOA 4NZUL 1ZS2A 2CJSA 4XBGA 4H2AA 1MZYA 3P9MA 3VWKA 5IT2H 4PVBA 2BNQE 3NSYA 2OMNA 1CK0H 3PQYA 2BSTB 3SDAB 2EIJB 2CLRA 3ZE1E 2EO1A 3FYIB 4MNQD 3EJCA 3T2LA 1A7QL 5CLWA 4XNQA 5F7NC 1LO3L 2IANE 4JFSA 1P7BA 2J72A 4N0FB 5LGJB 2OX5B 3DWTA 4UT6L 4N5UA 2P8PA 4NQSA 2WZAA 1G1KA 1C5BL 4IIQC 4Y9GA 2ZE0A 1LMIA 2FJFA 1G9HA 4XTRD 3ARGD 4LSUH 5C07B 4L3FA 3RIFK 1DBMH 2NX5B 5JHLH 3V4PH 1KMGA 5DT1L 3CVBA 1R5IA 2FO8A 4AQ1C 1AXIB 1PZBA 3EJTA 4DPRA 4U05A 3CIAA 2XVBA 1KFAH 5FDWB 5IBTL 2DQDH 5I2IB 1MHEB 5DDHB 5DS1A 3T0AA 3W5MA 5HDWA 3RY5A 5K39B 4X9FA 3KYKH 1DFBH 1IEBA 1V8HA 5FV1L 5GGQH 4Y0GA 1CI5A 3CC5B 1EDYA 2CJUH 1DN2A 5E8NA 5L2KE 2IWFA 1R3HB 2X1WL 4GBXC 4IRZL 2XACC 3GDBA 3VWJC 5HDBB 4UWQB 3VA6A 1EMTL 4C55A 1BQSA 2GBAA 3EH2A 3GSNL 4JG9A 2Y7NA 5DD5L 2BRRH 3BUYB 4WKZB 2GI7A 2CO2A 3V0WL 3RA7L 3K8LA 1B9ZA 2J44A 4L8DA 4YDVA 3WHE0 3D50A 3SE8H 4GIOA 5T3ZE 1A2YB 1SEBB 2VABB 3S4SG 1HIML 2YSSA 4GRLA 4RX4A 3MRLB 3N55A 1MJUH 3ATDA 3QUYD 3F64A 2X4UA 1IGYA 3HN5A 3IS1X 1JZGA 4N5ED 4R4FL 3GMMA 4FNTA 5LXGH 1F3DJ 3GD1C 3TWCL 1OAUL 5FHBH 5L8KB 3QXVA 5DJ6A 2HLEB 3FBKA 4LKXB 5LVEA 4X98B 5CSZA 5EF2A 1NC2A 4NCC1 4PVMA 2NZ9C 1M2OA 1CO1A 5DXWA 3F84A 2VDOL 5F9JB 4I3GA 3FB7B 3TJHD 4EUPG 4M02A 1H5BB 3UEZA 1SDDA 1TQBC 4JZJC 4LLQB 3X3FH 4QHUA 3GO1L 3MTXA 4GW1A 4X5QA 3UGUA 3VG0L 4ZMOA 3QYNA 1GCFA 4OZGE 4ZOBA 3HI6L 1R3KA 1VGKB 4HAGA 3QAZC 1KPVA 4LEOB 3A6OA 3FXIC 4KVNH 5LBSA 4U6HA 3VI3B 3NPSC 3FYEB 4DP5X 1S7SA 5L9DL 2BZDA 1OT2A 2Y07H 1JZ6A 3IU4H 1QUNB 5JXED 2YZ1A 1EHAA 2IAMA 1UD2A 4NAMA 1L7TL 4XMWA 5DJ0A 1NBVL 1DBBL 4RZKA 3RWEB 4KK9C 3NFPA 3G04B 2P80A 2OW7A 4B0MM 2EE2A 1MFVA 1UOKA 1JYXA 5FM4A 4OV6F 3ARGB 4OFDA 3BVXA 3L2LA 4U1NB 4KFZC 3P3RA 4XI5C 1HK6A 4Y4FD 4YDLB 2OTUB 2EEAA 3GHEH 4YLQT 5B1CA 3HFML 2XOTA 2HVJA 3TYFA 2NR6D 2EO9A 3QJXA 2BS71 4JG1H 4UZUA 1XSJA 3US0A 4C4KO 5GGSY 1KYDA 3SY0A 4ADGA 3TFKD 3ULVH 1LK3L 5D71H 1T66C 3W9DB 1BWMA 2CRZA 3G5WA 1JV2B 1DVFA 3QI9D 1FAIL 4B97A 2WXRA 4IEFA 3FU0A 4NHUB 5L4JA 5LG1A 5CJXC 2IF7A 4W68A 1VCAA 2OSXA 2F8VA 1QTPA 4ELMF 4NHCH 4WFEE 3P2TA 2C1PA 4XP5L 1UD6A 1D6VH 3A67L 3CZKA 3K7UA 5IG7B 1E5CA 1G1CA 4TPRH 3CHOA 2A4EA 3S97C 1X7QA 4R9HA 5ITFA 5C09A 3O6LL 4IBTA