1D2OA

Crystal structure of a single b repeat unit (b1) of collagen binding surface protein (cna) of staphylococcus aureus.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
187
structure length
187
Chain Sequence
ETTSSIGEKVWDDKDNQDGKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDLPKYDEGKKIEYTVTEDHVKDYTTDINGTTITNKYTPGETSATVTKNWDDNNNQDGKRPTEIKVELYQDGKATGKTAILNESNNWTHTWTGLDEKAKGQQVKYTVEELTKVKGYTTHVDNNDMGNLITTNKYTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COLLAGEN ADHESIN
publication title Novel fold and assembly of the repetitive B region of the Staphylococcus aureus collagen-binding surface protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Structural protein
total genus 42
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05738 Cna_B Cna protein B-type domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2oA01
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2oA02
1D2PA 3GLEA 3B2MA 3RPKA 2X9WA 2XIDA 1D2OA 2XTLA 2Y1VA 2X9YA 3GLDA 2X9XA 2X9ZA 4BUGA 2XICA
chains in the Genus database with same CATH superfamily
3EJQA 1JZ3A 5HHQB 3CHRA 1NCTA 4GW4A 4AL8L 4YO0B 4X6CB 3HG1E 4OGXH 4YWGL 1IGTB 4FA7B 4IMLA 5KS9E 4GAGH 1A6PA 5E1GA 1WUNT 3SKMB 2WXIA 2H26A 5PCYA 1U0QA 3ZQ9A 4N5ED 4TQIA 3SDCD 2N56A 2JI3A 3AMLA 3CZFA 1TQUA 3FMGL 1KLFB 3F7RA 3N40F 3GSWB 5D1XB 1U8JB 1HINH 5TPWH 1DVFA 5HDWA 4HIJB 5HYSA 5IM7B 1NMBH 3LIZL 3IJHB 3NJVA 1FV1A 2VR9A 4WW2F 2UY6B 3FT3B 2C4FT 2DLGA 4Q7DA 1TG8A 5HYJD 1U3ZA 3I6GB 2YD7A 3BSZA 3G5XA 4J3OC 5C7ZA 1IQWL 3GHEH 4XBPB 1U8KA 3VXQB 2OTWA 4W9EC 1I85C 4HQQH 5CCJA 3IDMB 1VEMA 4P4RB 1WS8A 1ZHNA 4UDUA 3SOBL 3HS0B 4OCNC 5KYUA 3RY6C 3OKDB 5T5NG 4R7VA 2IPKA 2BVOA 3QO1B 3WN5A 4PU2A 3PPEA 5DO2D 3IKCA 4I5BA 1PDKA 2CKBL 2PP8A 3L3OA 4M3JA 4E9TA 5TE6H 2EE3A 4WVRA 4JDTL 4XX1G 2EXWD 2GSGB 1K5NA 1YEKH 4XNMB 5FKPB 2WLJA 4OCSH 5EFIA 3C6LA 1MPAL 2SODB 4R4FL 5DZOA 5ACZA 1OSZB 1RPUA 5I0ZA 5I1HL 4W9LC 2QEJA 3B2VH 1TTBA 4NT6A 4GAAA 1KTRL 5FM8A 4X5WA 2XX1A 1ZWIA 5TDNB 5HGDA 3Q8AA 2V5TA 3I84A 3LN4B 3HVDA 5T1MB 2RBLA 1UXMA 1CT8A 3S36L 4U2YA 4N0FA 1T7WA 4BFRA 5IFJA 4QTFA 4U3XA 1I7ZA 1RIVH 1NGWA 1VFAA 2WXOA 4PAZA 3WTXA 1DVUA 1FNSL 4PJDF 3BJ91 5FOJA 2ADIB 5I1AB 2WSDA 1WE5A 3FFCB 2H0EA 5I1LB 1UC6A 1BVNT 3ULVF 3V7MA 1ITCA 1JGVL 4A7QA 2QFRA 1MCFA 2GT9A 1MFEH 4PS3A 1TSRA 4WNQA 3DUSB 1OVZA 2DN7A 2YC1B 4S1QH 5KTEL 4LPCA 1JV2A 3EBHA 3WXVL 4UT9A 4EUPH 3QAZB 2H0JA 5I8EA 1XFPA 2JELH 1DANT 1ZHLA 4GT7A 5EUOE 3Q43A 3CBRA 1M7IB 1TT6A 4NBYB 2Z91A 3OKOB 4U1HB 2YPVA 1A9BA 3MZGB 1TKWA 2ZXWB 1OM3L 4PWKA 4K7PH 4KX8A 2XZQH 4OZ4B 4WV1C 4FNTA 3EFDL 4YBLC 2W0PA 1S3KH 3J7HA 4NKIH 1ED3A 4EZMA 3K6IA 4F8OA 2J12B 5F8QC 4ZUWA 2HFEA 2CLZB 4AQOA 2WXQA 2C1PB 2FIKA 3F58H 1WEJH 3DIVA 4NGHH 2NY2B 4IBQA 1KPRA 3FDWA 4P46B 5EH1A 1ZLSH 1KDJA 2JTDA 2FR4B 4H7VA 2D7OA 1UKSA 1KIUB 3VCLB 5GGQH 5D93C 4I4WB 4RGNC 2AJSL 3FO2B 3BO8A 4HEPA 2EVHA 3ABKB 4K3EL 1EDYA 3DGCR 3DPBA 1FG2B 4FEIA 1A0QL 1B2WH 1CDJA 4YLQT 4E42A 5IJVB 4HBQA 1JOIA 1E4KC 4AWJC 4ZFQA 3L54A 3FCSA 2VM3A 3VNZA 3WJMB 5HXMA 3E6FA 3RZCB 4AQAA 4IKJA 4ZUTB 2XBDA 4MJ6B 3IJ8A 4MJIB 4B9ZA 4XVJH 4FN0A 4GIOA 1HNFA 3QUMB 1AE6L 4Y5YB 4AITA 1F2QA 4JR9L 2OW6A 2APTA 3BH8B 1FYTD 1MFDH 3LEXB 4LEOB 1CJYA 4X4MA 4GSQA 1ZLUH 1RJLA 2Z93B 5J13B 2HG5A 3MUGB 1O75A 4D0CB 3R1GH 1GJUA 4ISVA 4APQC 1OCZB 4TTGA 1RZQA 5GZOA 1R9FA 3CX5J 3MNZA 4HLZG 3DTXA 4QRTB 4POYA 3ARGA 1MOEA 4N87A 3TZVD 2CPUA 4X80L 2A7BA 2IAND 4HKJA 4DP7X 2E7LA 1DBAH 5H4YA 2YOCA 4TQHA 6PCYA 3AG1B 4EN3B 5I8KL 2KPNA 2Z34A 3GSVB 4N2DA 1BLNB 2FJFB 5IQ7H 1WVZA 3CFJB 5IP4A 1QFPA 2WIMA 4R26H 3NZSA 5FO7A 2CM5A 5AL0A 4E5XA 4L8SC 2X4SA 4U6YA 1QABA 5BS0A 1FZKB 2E74C 3PGDB 5EZIH 1JGEA 1FFNA 3EKCA 4RDQF 3NIGE 3SBWA 5AB9A 5LQBL 4RRPM 3RPBA 3WHXA 1PLGH 1EMTH 2XFGB 5EU6A 4Q9RH 5CMAA 4LSRH 4XB8A 1SHMA 5HGAA 3BSZH 4K71C 1A7PH 2FGWL 2DKMA 4G5ZL 4OF3A 2PMZA 2FT7A 1HC1A 5GGUA 5A16A 1M42A 2Y72A 3CSBA 3CXDH 2NQ3A 4WEBH 3NIDE 1T1XB 4PJHE 1WITA 4IHOB 1HHJB 5JPNA 3K6OA 1NMAL 1T3FA 5E5LA 4ZPVB 2OR7A 3RI5F 1UXSA 2YBRA 5J7CC 2PYEB 2RACA 4GRWB 1V55B 4U4BA 4W68A 2AMUA 5IUCA 2DEYX 4XAWL 3W0WD 4WQOA 1M3IA 2XNAB 3P3TA 5IOPB 1NLBL 5I2IB 1BQLL 4OJFH 4NNPH 5FS5A 1UZ8B 3BP7A 3BHBA 4ONGH 4H13C 5FA4A 4EUPB 4OZIF 1SLVA 5I76B 1RK0A 3H4HA 4WLCA 3EJUA 1HNGA 2I25N 5K93A 2IQ9H 4XHQA 5CD5D 1C08A 1KCVL 3DURB 4TN9A 4ZFOA 1O5PA 3O6LL 2V33A 5BRZE 1NM4A 3WLBA 3T0XA 3S4SB 3HLAB 3RP1A 3JUYA 1YEJL 4LPYA 2IBZY 3FT1A 4X5PA 3WN6A 4ZW5A 1UD4A 2WVVA 5C09E 4JVPA 3N6YA 5DGQA 3MJ8A 5D1QB 2FX7H 3U46B 4KXBA 5FYKD 4LL1A 5J56B 3HRZA 4HEME 2WB1A 2ZZUT 3V6BR 1OP4A 4L8CB 2QDVA 3T3MF 2WBJA 4NI6A 3V0IA 3UABA 1TZHB 2CBTA 1FQ9C 2FQGA 3FOMA 4N1HB 3QQ9C 3BCDA 4WFEE 2BIMA 3KJ6L 5JW4Q 2DL2A 2MKLC 1C1EH 5GHWL 2ENJA 1XCTA 3VXRB 1JD9A 1ZIAA 4PLKC 4PRDA 4BJLA 2ROYA 4PRPB 3VD9A 5MEND 3TT3H 1AS6A 5EIIG 3LZFH 3ZGIA 1M6OB 1T89C 5DC0A 3QE5A 4KU1A 3P30L 4UT9H 4WF7A 5LNDA 1HK6A 3CZJA 2UXVA 4Z7NB 4PJCE 1IO4C 3DRQA 3PUCA 4M62H 1DLFH 1AO7D 4ZTPH 1U95B 2YKLL 5DT1L 3VFTB 2VDKB 4U1JB 3BXNB 1JF5A 1BVZA 4Y16A 1MRCL 1SPDA 3VXPB 2YPVH 4PIBA 3UBXB 4BZ1L 1QLEL 2PXYB 2LLLA 4S1RH 3ZDZE 1XF3B 1A2YA 4G9FB 5D5MF 1SEQH 1MCHA 4NRYA 4L3EB 5D1ZB 4LVHC 1J9SA 4QOKB 4XXWC 1I8MB 3ILPB 3QDGB 4HKXB 1J8HA 2Q0ZX 2UZYB 1G7JB 3VDBA 3HRPA 1IX2A 3T0WA 2Z31C 4KVCH 4ICXA 1KGIA 3DI2B 3BP4B 4L3AA 3F64A 1QNIA 4EXPX 3IE4A 2J2ZA 4KTEH 2H32H 3UZVA 2M26A 5MP6L 2EUZA 3L1FA 5BZZA 1WZ1L 4XNQB 3WS3A 3ARFD 1IIKA 4IGBB 4X6DA 4GW4B 3DRTA 3N44B 5ISZD 2BSRA 1ZDQA 4A39A 1D5ZA 2ZKHL 1EJFA 3QISA 3WEMA 3MLTA 3ARRA 3FU5A 5IQMA 3E3QE 2WJ7A 4L0PB 2WWKO 3CZFB 4E9YA 4IRZA 2NY0D 4N6RA 1EWHA 4WI0A 1EDQA 3DARA 5HYSB 3KYMA 3QEQD 1JK8A 2HJKA 4OZHF 4DZ8A 3QB7C 4F27A 1FV1B 3PWPD 2FWOA 1BMZA 4I89A 3I75A 5B7EA 1T0MA 2V2TA 2E9GA 2NY3B 4F7CB 3CFBB 5I17A 1GR7A 4AMXA 3CIQA 1QW8A 1VGEL 4LOUC 4TRPL 3BE1H 1GAFH 3OZ9L 3K2UH 4P07A 1U8KB 4YHKH 2OTWB 1JP5A 2I07A 2YD8A 4CGTA 3CLWA 2DJSA 3KLLA 4N2LA 4WWOA 1MNUH 1K3IA 5F6IC 3RL1A 1T0PB 2FX8H 1HN1A 5CJ8A 3WV0A 5LNEA 5KYUB 2W94A 2P28B 5DO8A 3HZYA 2IPKB 3D34A 4DGWC 3UYRH 2DTML 3V5HA 2BVOB 3WN5B 1EUTA 4D9RD 5KVEH 1DJXA 3IKCB 4I5BB 1PDKB 4HLJA 3L3OB 3WIHL 2AS5M 4JFHE 2FDBP 3OAZK 4W9FC 1K5NB 2GK0B 3MCG1 1K85A 3TFBA 1OT2A 3FN0L 3I02A 5TGBA 1BHGA 2OMNA 1TEFA 3C6LB 4KRNA 1FO0A 2F53E 5ACZB 4KNUA 4LPVA 4NT6B 2LAAA 5MI0C 1E5CA 1L3NA 1OAQH 1Y18B 3KG5A 3DMMC 2YR3A 3DJ9A 4OZGA 4NYLA 4X5WB 3ILQC 1QEWA 1AR1B 5HHOD 1ZWIB 5HGDB 5I1KH 1A4AA 2KDGA 4DVBA 2QMKA 3D3VE 1CT8B 1G1YA 4N0FB 3T0EC 4IK6A 5IFJB 5CSZA 3VXSA 2QTEA 1NGWB 1VFAB 1N4XH 2PCPB 3FH5A 5FR3A 2CMRL 1QHPA 2EADA 4K9EL 3FCBA 1UCBL 3LYRA 3NJKA 4AI7A 1FE8H 2ZOWA 2VO5A 4WTZG 2GT9B 4GXUM 1XL6A 2HH0H 2A1WH 2X09A 4J1UA 3H42H 4WNQB 3VFPA 5JR1H 4WFGE 2ENPA 2AK1L 3HB3D 1UWEL 1JV2B 3NCBB 1JFQH 4W6WB 3FT0A 5J89A 1A7BA 2L7QA 5AVSB 3R18A 3BWAA 3LH8A 4MVBD 4XNYL 5I8EB 3W1ZA 1ZHLB 2P8MA 3QZLA 1AANA 1NBQA 2YZ1A 1DQVA 4M48H 3CMOH 2APXA 4I3GA 4JPWH 3U7WL 1EVUA 4YC2C 3MACH 1A9BB 4AGMA 1TKWB 3PU7A 2J6EA 4L4TA 4AC4A 3ZU8A 2M8XA 3D33A 3O6MH 3VRLE 3N1MC 3QG7H 2DPKA 4G1MA 1ED3B 4XP4H 1U4EA 1MIMH 4ZUWB 3VYPA 5LO7A 2HFEB 2I27N 4PW3A 2FIKB 1GIGL 1KPRB 1ACYL 5FYJE 1QAWA 4I7ZC 5HVFB 4UWQB 2MH4A 3LQAC 4MNHA 4MJ4A 2NRDA 1XGYL 3E0GA 1JMZA 3BO8B 5EEWA 1JNNH 2PCXA 1F02I 3MCKA 3SKNA 4C58B 1FP5A 2C5DC 3O4LE 4FC3E 4PS7A 3DPBB 4NUPA 3ZE1F 4HUMB 5GZNA 1DZ0A 1I8IA 3NJGA 4L1DA 4E42B 4QCIB 3ZO9A 1QWNA 3FCSB 3LNEA 4HFUL 1D7BA 3E6FB 3WIIL 4AQAB 4IKIA 4PWGA 3JV4A 4QEGA 4FF9A 5CLTA 3B9DA 5KYYA 5DK0A 3T4AA 1GJWA 1XCWA 2F5BH 2BLFA 2X3AA 2ZNWA 3V6ZA 1VCBC 3FFCD 5LUMA 4JLRB 1BF5A 5I6MA 4TSBH 4GLRI 3V6FA 1AZUA 1ZS8A 2YGOA 2DM3A 1X4YA 4J8QA 4Y2DC 1QRNA 5JO5A 2HG5B 1WAPA 4ISVB 4Q56A 4OIIL 3WAKA 1RXLA 3BQUA 1N18A 3DTXB 3ARGB 3ZE2E 2NNAA 4RAHA 4BKTC 3Q8FA 4BQ6A 4JFFA 1PYWA 3FRPA 1GPOL 1HHIA 1FVEA 4YAQA 2YJLA 3DSFH 3QWRA 5D8JL 5FO7B 3S96B 4E5XB 4HG4J 4HETA 4ZFFB 4U6YB 2F2HA 2X4SB 4YHZL 1U3HA 4IRZH 4ZNEE 4TOYH 4DETA 5JLZA 3O11A 3UTTE 1XSOA 1JGEB 3QSKB 1FFNB 4M1GH 3AS1A 3AY4C 5JDSA 1JZFA 1E9QA 2ESVE 3R0NA 2Q76A 3WHXB 3QNZB 5EA0H 3BOVA 4ZDHA 2VAAA 1E6JH 5EU6B 5CMAB 3F00A 4LRIA 5HHVH 4NPJA 4FXGA 2NY2D 5HGAB 4P46D 3H53A 2FQFA 1T5KA 2CO7B 2C3VA 3MRBA 5ICYA 1ET8A 3ZR6A 4X8XA 4GAGL 5LBVA 2AFNA 4DAGH 1GRWA 3HN3A 1GS7A 1KGCE 2QBWA 3KPSA 3U48A 2OR9H 1NFAA 5JPNB 1HINL 5TPWL 1E8WA 1U36A 1T3FB 2C3WA 2O6EA 1NMBL 2YBRB 2H6PA 5IVZB 1F3DJ 3RZCD 4FG6D 2WXKA 3QZWG 3UMTA 4HYTB 5IKCA 4NJAL 3BP7B 3BHBB 4BCXA 1E9PA 3HUJF 5FA4B 4M6OH 3SDXE 1QFOA 5DHYA 5I5RA 3ZKND 3ULVD 5B21A 3GHEL 1THAA 2FEDD 3OTTA 4LLWA 4ZFOB 2YQ3A 4HQQL 4Z3HA 5I73B 3U4EA 5KSVB 1OE3A 5IJBC 2W92A 2X70A 3RGVA 3DTUB 1WA2X 4BFKA 4RGOH 2WVVB 3MJ8B 1NIBA 1AQHA 1O9WA 4QIRA 1T1YA 1D6EA 3HRZB 3LQZA 5TE6L 3VA6A 4EN3D 1EJOH 2XVLA 2WBJB 4OFPA 3D9AH 5IVXF 2ZSVA 1FLTX 2AQRA 1J8SA 1YEKL 3QUGA 1SQMA 4OD3H 3FOMB 4Q89A 4OCSL 1KYOK 4ZODA 3EH5B 3VXNA 1CFVL 1JZEA 1XCTB 4A7UA 4PRDB 1I7RA 3QEGL 3U7YH 1LNUA 2PUQT 5CJXC 4A38A 2GJJA 2N0KA 5I28A 4YJZL 1FORH 3QI9A 3FB6A 3O45A 4EE2A 3RFZA 3DRQB 1VFOA 4BSJA 2ORBH 1MFUA 3SBRA 1RIVL 3K46A 2ED6A 5F9WC 5CLWA 4Y16B 7PCYA 3B6SA 2LV4A 4WWKA 3Q5TA 2J6EH 4HD9A 3BGFC 2CD0A 2ZUSA 1A2YB 3VYNA 3VMNA 5LJYH 2XPZA 4NRYB 3PWNA 5D7JC 2GEQA 1MFEL 1ETJA 1J8HB 1U8IA 3ATBA 4U7MA 4W1TA 2UWEF 1S46A 3C8KA 4S1QL 4MRCA 2COVD 2PYED 3FZUD 3US9A 5LXGH 2J2ZB 3UZVB 1G7HA 2XJLA 2VJXA 4CC4A 3AU1A 1P5UC 2HRGA 3CJJA 3MRDB 2JELL 4FHJA 5BUAA 3ABZA 2X2IA 3WS3B 4PR5B 1BBJA 3CFQA 3H9HB 4X6DB 1O7DC 2BSRB 4UIMA 2WWMD 4J5VA 1D5ZB 1QTSA 4LVEA 1GYVA 5DJZA 4K7PL 3T77A 1FH2A 4M1DH 5D2LF 3MLTB 3P77B 1YNTA 1S3KL 3TBWA 2VM4A 3JBG7 2E6QA 2E5EA 1YECL 5D1QD 5TH2A 3F58L 1WEJL 4NGHL 4DZ8B 3RDJA 2E9IA 2BJML 1NOLA 4PI2A 1KJVB 2FWOB 1ZLSL 2VDNB 5IVXB 2ENSA 5LXVA 1JWUA 3I75B 4IOFC 1T0MB 2TRYA 3H7BB 2V2TB 2W80C 2ZOLB 5I17B 1UWGH 5GGQL 2NMSA 1KYDA 3P9MA 1T66D 4FAAB 3VXRD 4PRPD 1WIUA 3RTQC 4P99A 1ACZA 1B2WL 3BAXA 4EZJA 3W11C 3UERA 2XDHA 2Y07H 3UIYA 3RL1B 4HJEA 2VLJE 3GXMA 3LXBA 1EV2E 4X8JA 5EF2A 3UAJC 2WWNA 3HZYB 3CK0H 2R0KH 2L7EA 4PG9A 3V5HB 4K7FA 5EUOA 2O6PA 4Y9GA 3V9CA 1KLUB 4PJIE 4XCFH 4ODXA 3L5HA 5KBNC 1NFIB 4XE0A 3RVTC 4N4YB 1TXKA 2V5SA 3QXAB 4X7TA 4BWWA 4G9FD 4JFZH 3UXFA 1M71B 1U8PA 4FQ2H 4NAMA 3L6FA 3QUYA 3I02B 4L3ED 5TGBB 5D1ZD 2KLSA 4QOKD 3R1GL 4KKBC 3QDGD 2XWEA 4YSPA 1FO0B 2EIMB 1J88A 1CBVH 2KZBA 1F5WA 5GSVA 3ZKQD 3H9SB 4PBWD 4KK5C 4DUWA 1BJ1J 4NYLB 1QEWB 3KPLA 1KF9B 4XR8C 1DBAL 1SHWA 2FD6H 1PIGA 2CDFA 4P5SA 1OAXH 5IQ7L 4IGBD 5CSZB 3VXSB 1ETA1 4YSUA 4P9HC 1D7CA 1ILUA 1VGKA 4H25A 4R26L 2EVIA 4UQAA 4IRSC 4G6AD 2F7QA 4H20H 5K9OA 1S6NA 3H2WA 1ZXQA 3RWEA 5JIMA 3GXPA 43CAB 3P2TA 4XTRC 3U7AA 3UFIA 2Q2EB 1PL3A 4J1UB 3VFPB 1F2XK 1DZBA 1REIA 4GP8B 5G4NA 2K70A 2WWKT 1PLGL 1EMTL 2V4LA 4KUCF 4Q9RL 2H7WA 2GBUA 3IPBA 4LSRL 2DMCA 4AVHA 1ROCA 3MNDA 3V8CA 3BSZL 4ADIA 1A7PL 2WLIA 3IGUA 4NO5A 3BWAB 2NY3D 2QSVA 4B6ZA 5HHXH 3L5IA 2P8MB 4E0RA 1F6LL 2JJSC 3CXDL 3STZA 5JW3H 4WEBL 4JG1H 2Y6SC 2Y5TA 4U31A 5DMYA 1A4KA 1RLBA 3O6FD 1EH9A 3TBVB 3DJTA 1VHPA 4U0RB 2F7RA 3EYQC 4G1MB 5IROC 4OJFL 4NNPL 3C5JA 4ONGL 1KYUA 3NK3A 5JORA 1A1OA 1IGMH 4XI5C 3SGJA 4UDTB 3JV0A 4L37A 3BUTA 5EB9A 3C09B 3EJYC 4H8WH 2IQ9L 4N90D 5SWSB 5CEYA 2WLYA 4EDXA 4K8RD 4MNHB 1E5BA 3O2VH 2XTSA 3OG4B 4JPIA 3C6LD 4D8OA 3US0A 1USZA 1YYCA 3BKYH 5TE4H 1C8PA 1ORQB 2KLTA 4YDMA 2B5IB 3MCKB 3SKNB 4M93B 2XX0A 3O8XC 3UJTH 3C60A 4QHUA 1I8IB 1HXKA 4PY8J 5IVNA 3K0WA 2V3FA 2FX7L 2AP2A 1AR1D 2JCCF 2IADA 3JZ7A 4KK6D 2ICWJ 2OJZH 4AJYV 1XXDC 3JV4B 3VDAA 4IRJA 2WP3T 5JIQA 5KYYB 2LVEA 5DK0B 2VZVA 4H8HA 4PJHA 3FF7A 3V6ZB 3TT3L 3V6FB 2FSDA 2LE9A 1ZS8B 3LZFL 5JIPA 2IAMC 4FQJL 5JO5B 1QRNB 4UT9L 5DVOA 4WEEA 1OP9A 3ASOB 5L2KE 1T0NA 4XXCC 2OYLA 4NKQB 3BQUB 3ARDA 1OW0C 4M62L 1DLFL 4ZTPL 4GRLA 4LDLB 2NY5C 3M45A 2Z3FA 3MV9D 1WP6A 2NNAB 3HAEH 2YFNA 1HT6A 4EO5A 4GS7B 4HZLA 4JFFB 3N42F 3FRPB 4S1RL 4L0YA 1HHIB 1FVEB 4HWBA 5KS9F 1J05A 4LQ1A 4YSOA 1HIML 4M02A 4B97A 1SEQL 2XFXA 3L4YA 3TEZA 3RAJH 5JLZB 1MF2H 4KVCL 3O11B 3QCTH 4HBCH 2ZXEB 3IGKA 1UACH 4A2MA 5JDSB 3BRDA 4KTEL 1MW2A 3M86A 1RKRA 3QQDA 1E9QB 1NPUA 4XCEA 4ZDHB 2VAAB 5JZ7C 1KMGA 1JRHH 2XZCH 4LSPH 4NKDB 3KPNA 3TP4A 4BFFA 2R2HA 2Z64C 4JKNA 4ABVA 4H0GA 2JB5L 1F4WH 2P52A 2C3VB 3MRBB 5ICYB 2H2PD 1HEZA 1BF8A 4KK8C 3OAYK 4OQ1A 4G7RB 2Z65C 2R9HC 3ENEA 3NESA 1XF1A 1BBDH 4Z7OE 4WK4B 1GC1C 1OF2A 3J27A 3KPSB 3CVDA 3BAKA 1ONQA 1IZJA 5AOJA 3RWDA 2JCCB 1QNZH 4OGAC 2CK2A 3LRMA 2X6UA 2EDEA 2H6PB 1XTMA 2AW2A 1L4IA 4NAJA 5D7KE 1TNMA 4XN9A 4OB5H 2N3JA 3EXLA 2DWEA 1Q90A 3MRPA 1E9PB 1EEUA 2WQXA 5DHYB 3BE1L 2FCBA 1GAFL 3KGUA 5JDJA 1QHQA 3K2UL 1B0IA 4RDBA 4F58H 4YHKL 1QYGH 4LLWB 4ANXA 4QRFA 1MNUL 3U4EB 2FX8L 3WO4B 1AJ7H 4YHPA 2VOTA 2X70B 3K91A 2HPTA 4MAYA 3RGVB 1PEZA 2LTQB 1JNHA 2DYSB 1F13A 3IT8D 3UYRL 1JERA 1E2ZA 3WE1A 4Y1AA 3FSOA 1T1YB 2YSTA 3AJ7A 4APXA 1D6EB 4R5XA 3LQZB 1I4FA 3EF4A 3ZKXB 5DD6A 3UDWA 3T0AA 5LHDA 3A21A 1D2OA 43C9A 4TLKA 2WB7A 1L6ZA 2A5UA 5K9JH 2X0VA 4JRLA 3C5ZA 5JQIB 3F04A 3U25A 1S9KC 1I7RB 1TQBC 4F57H 2OTPA 1LNUB 2KZ1B 2YO3A 4TNWK 5DK2A 4IDLA 1SY6H 3P4NA 4AIZA 4B7IA 3C75A 1YYLH 2KDYA 3OKMA 2B2XH 1MH5A 5I1KL 3QI9B 3FB6B 3VH8G 1ASOA 4OCYH 3RFZB 5EU6D 4W9HC 1R3LA 3OSKA 4YFLI 3ZMNA 1N4XL 3B1UA 3UL4A 3NSFA 4AIOA 3SDYH 1CDIA 5GSRA 1RUMH 5TTRA 2CG9X 2ZYSA 3CZSA 2JKXA 4WWKB 1GOFA 2ERJC 8FABA 1LK2A 2J8UA 3L81A 1FAIH 5D7IA 4PS4H 1FE8L 4LARH 1NCHA 2KL6A 5L8JB 3WIFB 2FBJH 4YSRA 4ZS6C 2HH0L 1J12A 1IAIH 2A1WL 4FYRA 5C0BE 3WL9B 4ZAKC 1U8IB 5JR1L 5F21B 3C8KB 4OD2B 3VQLA 3MV7A 3U9PH 2Z4QA 3JWOH 1JFQL 1HEHC 3GXUB 5E4AA 1XH2A 2K0RA 1BGXH 4K3JH 2FX9H 3SGEI 2UXGA 1G7HB 1U6AH 4NO2A 4XNDA 5J6GA 4HIEA 4I18C 1HHHB 3AU1B 3VI4A 1WLHA 4WTQA 4ZFOL 2D0GA 1BBJB 5CP3A 1M1XA 4M48L 2J5LC 3UJIH 2XV3A 2R0ZH 3CMOL 3T1FA 5LWYL 1CGXA 2ICEC 1JPSH 4JPWL 4UIMB 2CUIA 3UP1A 2IEPA 1E43A 3MACL 1Z9SA 1W0VA 1OQOA 2JI2A 3MRCA 5KBMA 1ZMYA 3BIBX 3T77B 3O6ML 4X6FA 4YSEA 2AKRA 1XGZA 1YNTB 3QG7L 1IBGH 2NT0A 3IAGC 1KXVC 2Z9TA 3QJFA 4XP4L 3CDCA 3LHAA 3TBWB 1NM9A 1MIML 4PV8B 2Y7SA 4UB0L 5TH2B 3MN8A 2VUKA 3MJ9A 3QXDA 5AYUH 2FL5A 4WJ5A 2R1XA 1JWUB 1ZT7A 4MYWB 4JFYA 4Y5VC 4Y88A 1DFXA 3P9MB 1VENA 4EI6A 2HTLD 3LMJH 1JNNL 5D55A 1GYUA 2R2CA 4MWFA 3WNMA 4R6UA 2R29L 3SKOA 3QZNA 3K0YA 2X4NB 4MJ5A 5IBTH 2OP4H 5B1JA 1HZLA 5I74C 3B2PA 1QWHA 2VLRA 3EOTH 4X8JB 4NPYA 4XVSL 4JFTA 3GBDA 2VDMH 4PG9B 1CIUA 4HWBH 4K7FB 4JRYE 5EUOB 4PLJD 5DZ9A 4ODXB 2F5BL 4NXKA 2M1KA 4Y16D 2I7SA 2P49B 5CP7A 5C0EA 4UCFA 4TSBL 4X7TB 3M1OA 4TQEH 1R47A 1U8PB 4BIKA 4PPTA 3L6FB 3QUYB 5FFGA 1HE7A 3UOAB 4GUQA 3L7EB 4XWOC 1J8HD 5F6HJ 4MMZC 3K8MA 1DO6A 2GUOA 2VN5A 2YQGA 3TNMA 2ZD0A 5IMLA 5MEPA 4FFVC 1L9NA 3WDIA 4I0KA 3KPLB 4E41A 3FSZA 1R0AH 2CHXA 1YQVH 5I6NA 4ZQTA 3WKNA 2AQNA 3MJGX 1VGKB 4H25B 3NSXA 2OMUB 2EYSA 3GJEB 4AH2B 1URLA 2D3JA 5T33H 3BEWA 1BA9A 4IRZL 2WXNA 4TOYL 2H45A 5K9OB 3D4GA 2XWBA 3NSCA 1PQZB 4Y5XC 1UD5A 3MRJA 3D05A 3CLFH 4M1GL 5G5DA 4ZZFA 1IV8A 4WY7H 5CR1A 3SGKA 2HUHA 2VR7A 1R3JA 3QIUA 4G83A 5HHVL 4QRAA 4MS8C 4AJVA 4BZ2A 5GS0C 3BN3B 1U3NA 4NO5B 3RGBA 4AZUA 5FO8A 3D1MC 1JTOA 4PWEA 4E0RB 3LXUX 3BISA 2QSCL 3EOBA 2EDOA 3K7UA 5CBEA 5ID0A 2Y25A 1NCIA 1O9VA 3STZB 1JDAA 1FGVH 1XX9C 4FFZL 3RY6A 1U58B 2Y5TB 3D48R 3N1FC 4FRWA 4TS6A 5AZ2H 4XO4A 1A4KB 2OR9L 2OMXA 2JKIS 3RU8H 3D69A 4MNQE 1KN2H 4NI3A 4YMPA 1A7RH 3MNMA 4ODSL 3CN4A 1MDTA 2C4FU 3N85H 3ZDYE 5JORB 1A1OB 4M6OL 1I7UA 4R2GB 5HI3C 3HHSB 4L37B 5ALBH 4M8QA 3RVWD 1IUZA 4L9LB 5CEYB 4EDXB 1ADQA 4LLAA 5EHFA 5D2NC 2G9KA 3WENA 1TQVA 4JPIB 1AXTH 3NIGB 1S78C 1BVNP 4QY8A 3I2CL 4LCWA 3SE8H 4RGOL 3QHZH 3C60B 3H9SD 4PJCF 3GSNA 4G42A 2A2QT 2WQRA 3CHSA 4KHXH 2AJVH 2IADB 1RUAH 1XH3A 4I0PA 4HUUA 1YEEH 1YY8A 1NCCH 1EJOL 4HZAA 4UQ3A 5IQLA 5F96H 4OD3L 1IMHC 4IRJB 4XB7A 4PD4J 3ZDZF 1KCKA 1OKEA 5E4EC 3NIDB 1QLFA 4JM2A 3PFUA 3HBZA 4PJHB 1ZHKA 3UBGA 4WFFD 3U7YL 2Y2YA 2OI9B 4PWHA 3GBMH 4OJDH 3FU8A 3TBSB 4P5TA 1FORL 4ZI8A 1A6AA 3SQRA 3ZHLA 4N5EC 3SDCC 3QG6A 3ARDB 5I66A 1QI4A 2EECA 4C55A 2ORBL 4IYKA 2DKSA 2YFOA 3GS7A 3ROLA 2BH0A 3SDAA 4Q8BA 4B50A 1DJIA 4HZLB 1H3TA 2ZT9C 4RDQG 3OHXC 2AXWA 2ZYRA 2J6EL 3VGAC 1AZCA 4HK3J 2VDMB 4NZJA 4U3SA 4DCQA 5FYLE 2QSQA 3OKEA 3INOA 3ZSSA 3AITA 3KWWA 4ZX5A 2ADFH 5FDWA 5F0MB 1P7HL 1T20A 4MKTA 4TSCH 2YAFA 1OTUD 4NQQA 5C0CA 4CVZB 4ALAC 5LXGL 2Y2WA 1AKJA 3MJ9H 4JZOA 4WHCA 3QQDB 4XCEB 1IC1A 1DCLA 3KPNB 3AAZA 5KVGE 2R2HB 3AXLA 2QT6A 5DO2C 4D7BA 1KSRA 1Q9KA 3CSYA 5SWSD 4YSAA 4GUPA 1HEZB 4LHUG 2EXWC 4AV5A 2A9NL 4FMVA 4M1DL 1IQDB 3ZMEA 1WPCA 2Y3AA 4BH8B 4HUVA 3IVKA 4JPVH 2PR4H 2I32A 3CU7A 3HG4A 5KWYC 1OF2B 2ZXGA 1CZ8H 2YEZA 4XN8A 5GZND 5BW7A 5C7XH 3WFEL 1ONQB 1XO8A 3APCA 1EZUA 1JZ2A 2HJLA 3G6DL 3CFUA 1GGIH 2IC2A 2UVEA 1YEGL 2WSKA 4YHIA 3VMPA 5ANMA 4ES9A 3S5LA 2QGBA 4HOXA 1UWGL 1NIDA 2ICES 5C07E 3MFFB 5H94A 3NJXA 4HJGA 4APQA 3B5GA 1EX0A 4ONHB 2DMGA 4WUUE 2AQ2A 5L6YH 3QW9A 4JB9H 3ECBA 2Y07L 3BH4A 4M61A 1EA9C 1QRND 3LPFA 12E8H 1FIGH 1G7IA 4YHPB 3BQUD 4MAYB 1EXHA 1JNHB 1GSMA 4YDZA 5JW4R 3CK0L 2R0KL 1WK0A 1UZ6E 5T3ZD 1GZPA 2BNRA 4Y1AB 2VGLM 4APXB 4ATWA 1MSPA 3QXUA 1I4FB 4BRJA 4JFFD 1FI8C 4JG0H 5DD6B 1CC3A 5FM5O 4JFZL 4GSDL 5D4QA 1GKEA 1PAMA 1G9MH 2VLMD 3C5ZB 4G5AA 1EHLH 1I9JH 4R84A 1D3CA 2FWLB 2FT8A 2FO4B 2VISA 4OVVA 5DK2B 3P4NB 4AIZB 4DKTA 1A6VL 1R19A 1ZGLA 3OKMB 4DH2A 2WTRA 4J3OH 1P84J 2FD6L 4D2NA 1JVKA 1OAXL 2FH6A 1KPVA 3KLHD 1XB3A 3ZIMA 3FW6A 3IS0X 2MHAA 3LS5L 5GSRB 3FUFA 4BCZA 1CGWA 5F9OH 3BDYH 4H20L 8FABB 1LK2B 3S35H 2J8UB 1KV3A 3B8YA 4N2HA 5D7IB 2HKAA 2DH3A 2JTYA 5EIQA 2YRLA 1WWCA 1YEWA 4M03A 1QPKA 3KPSD 4LCVA 4UZSA 5CKAA 5I1DA 1WA0X 3IFLH 3F62A 4TMPA 2H1PH 5IBLD 5C0GB 2F54A 3MV7B 2Z4QB 1YPZE 3NJNA 4LPTA 4NO2B 1OOAA 5T3XD 1FFPB 5J6GB 4HIEB 4XODA 3VI4B 5HHXL 3ESPA 1BMWA 2NTSP 3EAKA 1M1XB 3V6OE 4QXWA 4CVXB 3T1FB 2CBQA 1FCCA 3MBXH 4LCUB 5JW3L 2R4SH 4JG1L 1CMOA 1ZA6A 2P80A 2F53B 3D07A 3MRCB 5F7DA 1Z9SB 1W0VB 2WTOA 3UO8B 4ZMXA 1X7QB 3Q9QA 4F7EA 1BZ8A 4KXZI 4X6FB 3GSNH 4L4VD 4X5XB 2AKRB 5F97E 3RGHA 1U92A 3RGVD 3QJFB 1P4BL 3FUNA 3D3VB 2HX8A 1IGML 5AKTA 1RERA 3NSJA 3TZVC 3EYSL 5I71B 4WJ5B 2R1XB 3MKKA 4H8WL 1ZT7B 4JFYB 3APDA 3CZLA 3O2VL 2BZCA 3SDDA 3CPUA 4EI6B 3BKYL 5F7HA 2YHGA 1SFDA 1YMHA 5TE4L 5DUMH 1TYRA 2FYVA 4F9LA 3UJTL 1RFDH 3SKOB 3Q05A 3AGVA 2O1AA 4WKXA 2GC4C 5E2TH 4NM8H 4KKAD 4MJ5B 3QI9D 5FDYA 3ZE2F 2OJZL 4NUMA 4NPYB 4M7KH 3VAEA 3ABGA 5D96B 3OGOE 2J1KA 5CP7B 3ME0B 4XXWA 1XEDA 5D72H 5C0EB 4WWKD 5E5UB 2MWCA 2EH7H 2VAJA 2Z31A 3ZRCC 1MREH 4FL4B 1NINA 4AC2A 1LEKB 4PJ5A 1ZS2A 2NUPA 7CGTA 3HFFA 3V95A 2CIIA 1MW3A 3SE9H 2GUOB 4LNRA 3TNMB 2HG0A 5MEPB 3KS0J 5IMLB 4GG6A 5HVGB 3C2AL 4HCGA 5ENWA 1CG9A 2EVJA 1EDHA 3CQQA 4E41B 2UZXA 4HS3A 2D2CC 4AYID 2L4OA 4KXCA 1CE1H 2CCVA 1R34A 5LAXA 5BMFH 3NN8A 5KAQG 3OMAB 3V0DA 1G0XA 5F7FA 1MG2C 1NFDA 1A02N 3TJHD 4OR1A 4AYEC 2EYSB 3QJSB 1OF0A 3QJVB 3O4LB 3A67H 3BEWB 4UUJB 3RAJL 3NCCB 4GBXA 2V8LA 4Z0XA 4KQ4H 3FSVA 1MF2L 5DD0H 2XWBB 3QCTL 4HBCL 4Q52A 2AVFA 3MRJB 5G5DB 1UACL 3LTVA 1S9WB 5FCSH 4FG0A 3B7TA 2YD5A 2WZPA 1JRHL 2XZCL 3IDGB 3H56A 3K80A 4QI3A 3SN6N 3QIUB 5CBAA 3WG7B 3L4CA 4C59B 1I31A 4HJUA 3KBEA 1F4WL 3TYFA 1D9KA 1OSPH 5DJ2B 3SDXF 3R7QA 5FXCH 3CIAA 3O4OB 4GQZA 1JPFA 4JPSA 5FO8B 2VQUA 1ESOA 3EFOA 4Z7UA 2BS71 4P2AA 3EOBB 5CBEB 3OLEA 1BBDL 1Q72H 2EDQA 4JFDE 4JKPH 5DK3A 5KG9A 4WK2B 5IJKA 5IEHA 2OMXB 1QNZL 3D69B 1DN0A 3WUZA 3IMVA 3IMBA 4WWID 1N0XH 1JAEA 4HPYH 1XIWA 1VESA 5M94B 3UC0H 2VJ8A 2AJYH 2WYZA 3H54A 1CL7H 1OP3H 4K3DH 4KV5E 4J4PA 1ASQA 3KHQA 5DF0A 1BOGA 1BWMA 1I7UB 3SPHA 3KJ4C 3NG5A 4M8QB 3PWLA 1HL8A 1W8NA 4A68A 1GL4B 4F80A 1EAPA 5D7LA 4F58L 1QYGL 2CO1A 4ADGA 1NBZB 3QUYD 3TTYA 5E2UH 2J73A 4ZXBB 5F9JA 3O3AA 1SLUA 1AJ7L 1GGYA 1T03H 1VADB 3DX4A 3TLRA 4LCWB 4R7DB 2GJ6A 3VSTA 3T0EA 3FQ4A 5ITBH 3GUTB 2DJUA 3X3GH 2WYTA 1DN2A 3GSNB 4G42B 1MCOH 1IZKA 4B3EA 1XH3B 4I0PB 4HUUB 3DJRA 1YY8B 1ZLVH 2EIZA 3QEUA 1MVFA 4UQ3B 1II4E 1SYSA 2ZX6A 1JFHA 4L23A 3H6JA 2ISDA 5K9JL 1WICA 1IGCH 4ELMA 3ARFC 1JDCA 4JFQA 1QLFB 4JM2B 3QCUH 1ZHKB 4F57L 5E1AA 3BD5A 4GMTH 3LNHA 5D71H 3CC5A 1SY6L 2C9QA 2J1YA 1DBJH 1A1MA 3QUXA 4FQPA 1TCMA 4P5TB 1YYLL 2B2XL 1A6AB 2BNQE 1IC7H 1ZSHA 1JYVA 3PDOA 3GBNH 4OCYL 3QG6B 4FNLH 4P06A 4PJBE 4H8VA 2AF2A 3WNLA 4B60A 5I66B 4M00A 2BSBA 2NY0C 3KBHE 4E2OA 3ROLB 3WEAA 3SDAB 1RJCA 3SDYL 4YSCA 1RUML 3GXIA 3U30C 3LD8B 4HF5H 1AXIB 4DCQB 4U3SB 1FAIL 3IRZA 4H0HB 4LARL 4PS4L 1FFOA 4FJZA 2XZAH 2W9EH 1IAIL 3KWWB 3HPJA 5FDWB 3S5YA 5EEZA 2MFNA 3HZKB 5E6YA 2WCPA 3I6SA 3WUWG 5J12C 1S7XA 1RIUH 3U9PL 1LDSA 4S0HA 3BZEA 1AHMA 4XOBA 2PO6B 3JWOL 5C0CB 4YSTA 4K3JL 1BGXL 1AKJB 1HE8A 2FX9L 3P3YA 4JZOB 3A4FA 3QIWD 5F2FA 5DZPA 1ZTXH 5D93B 3Q2NA 3AAZB 3C9NB 3AXLB 2R0ZL 4R2GD 3QCVH 1JPSL 5DRWA 3CSYB 1BQKA 4WK0B 4GUPB 2Q86A 4ODBD 5FHAH 5FLUA 5KSUA 1WFMA 6FABH 3NDYE 4HUVB 4IBVA 1IBGL 3DWTA 3IVKB 2EQDA 3BPLB 2ADGA 2YEZB 4RGMC 3C60D 3G9AB 2CBOA 4F91B 1LMIA 4IU2B 1RMFL 2HJLB 4CBZA 2MOQA 4KNSA 4TUUA 5AYUL 4YHIB 3PPSA 4PJIF 3GUFA 3WJJC 5ANMB 2GPZA 4X42A 1JN6A 2V5YA 3A4DA 3N9GH 4IRJD 4S2SA 5DC9B 1W6LA 2OV0A 1UENA 2FECI 3LMJL 1Z2KA 5IJDC 3VFWA 4HJGB 4APQB 3CV5A 3GTTA 3QXWA 1R17A 4YPJA 4JY4B 5EDSA 4WI3A 2GTWA 3ECBB 4M61B 2RD0A 4BRVA 5IBTL 2OP4L 4LIQH 1CYXA 2FO1A 1G7IB 3EOTL 2DWTA 3ARDD 5E9DA 4C56E 4K7PX 3UO1H 4K2UH 2VDML 1MCDA 1GZPB 4HWBL 1RZFH 3HB3C 1N26A 4I9WD 5DEGA 1W0YT 5TDOA 2XVBA 3TBYA 4ZX4A 5I1EH 4CN4A 4J6RH 1U8OA 3MROA 4TQEL 5DC4B 4FCAA 4MVBC 5BRZD 4LBAA 3AY4A 5EBLA 1TEGA 1FNLA 2FHCA 2YUVA 3E9UA 2EDDA 5I8OH 3MLUH 5C09D 3LNFA 1PLCA 1H8SA 2A6JA 2DQMA 2VISB 5KN5A 5FW6A 4AEIH 4IQHA 1ZGLB 4ZFZA 2G60H 2X1PA 3VXUE 1R0AL 2WTRB 2VDQH 4YR6A 2HRPH 3OWEA 1YQVL 2DEXX 1BQRA 1Z1WA 3QFJE 4H8UA 4MZ2A 4WFED 4AIEA 2V0AA 1KPVB 3ZDXB 2MTAA 2LQRA 2MHAB 2DDQH 1MCLA 1GTNA 5T33L 4X8CA 1K8DA 5EZLA 1XB8A 4YE0A 4NBZB 3VFSB 5I0YA 4F15B 3CLFL 3MBEA 2B4CC 2XBTA 4WY7L 3DJZA 2PW2B 3QZMA 2P42B 3COOA 4AEEA 4G2AA 1DDHA 3ESVF 5AQ0A 1LK3H 1QBMH 3S8FB 5GIRA 2O93L 1A3RH 4JFEE 3EW3B 4XPFH 1UZGA 4XO9A 1X5FA 2B39A 4N1CA 1BX2A 5DA4A 3QUZA 2C9PA 5I26A 1CFTA 3RPIB 2XLLA 5C71A 4NSKA 5FGBA 1FGVL 2C9VA 3ARUA 1UASA 7FABH 1ZA6B 3DYMA 4TVPE 2QVMA 4W4OA 5F7DB 5AZ2L 3RU8L 3OB0K 1IBYA 4F7EB 3PQYA 4UNUA 5DJAA 4ANUA 2P8LA 1EPFA 3AXIA 5AW5B 2O5NA 1U92B 2B59A 3B3BA 1AGFA 3BGMB 1MI5E 1BSIA 1W9XA 1A7RL 1G7MB 1VFUA 4RSVA 5CZXD 3DO3A 4Z3EA 4Y1AD 4JREB 2NXYB 3N85L 4GKOA 1KTJA 2GBTA 3F01A 2AJXH 3QAZC 5ALBL 2IOOA 2G4GA 4NXSA 1ZIBA 2I7OA 4UTBA 5K9QG 2OMZA 1TQCB 2ZCKL 3SDDB 3WBDA 1X9QA 1S7RA 1AXTL 2K78A 4QYOA 4AMWA 5B39B 1MRDH 1DEEA 1YMHB 1FN4B 4W9JC 5HGBA 1YAIA 1MCPL 3S3CB 3GGWB 3SE8L 5IB4A 1FDLH 1P4LA 3QHZL 1V5JA 3IPEA 3TFKD 3T4YA 2YGQA 4JO4H 1JZ6A 3E1F1 2AJVL 2H1LM 4KHXL 4F1SA 5I1JH 3PS6A 1RUAL 3QWQB 4U1SA 1YEEL 1NCCL 5B7FA 4ZUUA 3V0GA 1JHLH 2OPCA 5F96L 2AABH 4JPQA 4FKEA 3WDHA 4E9QA 2B77A 5JOEA 3L3DA 3ZBMA 3WU1A 3EO9H 2NY2C 3HC0A 2KUTA 4P46C 3D39A 2Z31B 5MERA 3UTSA 1YN7A 4HWZA 1EGJA 5DZLA 4PJ5B 2EP6A 2NUPB 1IAOA 4NQCE 1P5UA 2CIIB 2YD0A 3LQAH 4LNRB 5FW7A 3MV7D 2R4RH 3U9WA 4QF1A 3OM3B 3NK4A 4EBQH 1MFCH 3VSUA 4HAFA 3BVWA 5ENWB 2F7PA 1CG9B 5INCA 2R2EB 1R1CA 3FQYA 1M9WA 4HJTA 3E6HA 1OWWA 2UZXB 4Y89A 3RZCC 3EADA 4FG6C 4HS3B 4V1DA 3I85A 5KEZA 3DVGA 3VVWA 2GYSA 1X9UA 3SSGA 1KNOA 1V7ML 5LAXB 1N64H 1Z0NA 3NN8B 3SYPA 5C92A 3T9WA 5F1NB 2F74A 1NFDB 4XC1H 2AAVA 2FO8A 4OTXH 1TLKA 2F53D 3L13A 4Y5YC 2ADFL 1EJ6A 3CDZA 4Z7OF 3ZKNC 3ULVC 3QS3A 2J25A 4GBXB 4PHXA 4Z0XB 4RAVA 1VKXA 1GY1A 4TSCL 2FEDC 5IB1A 3K72A 3TBCA 3MJ9L 3Q48A 1HL4A 4QXGH 4MNGA 4CUCA 1QSVA 3D3VD 5IV2A 5L0QB 4M4RA 5CBAB 3TURA 1TQTA 3I3BA 4AQEA 4PVBA 4XP6H 3TYFB 1D9KB 2VDQB 3BP6A 1ZLWH 5I30H 3ES6A 4EN3C 1JPFB 3AW5A 3BX7C 2XY2A 4OI8A 4Z7UB 1BECA 5FYKU 1N10A 3WY2A 4FQXD 4JPVL 3WKYA 1SXSA 5L2KB 1CZ8L 4WFGD 5KG9B 5IWLA 1P9MC 5IEHB 1XD1A 35C8H 2VZUA 4RGNE 1DN0B 4G6JH 2G0KA 1GGIL 3JTSA 3CXHJ 1XIWB 4QRQA 3GSUA 1W6WA 1NTDA 1K5WA 4J39A 5GQBA 4AENA 5AKRA 2YQBA 2D3LA 3CFIC 3L95A 1MCCA 2X7LA 1BOGB 1IARB 3HC3H 3K2MC 1OP5K 4JHAH 4OBSA 4WI5A 1MWOA 3EDJA 2WD0A 3VFVB 4EKJA 1FNGA 3TTSA 3PWLB 4B0MB 2VDLB 1EAPB 5D7LB 4MD5B 5L6YL 2E4FA 2D4FA 3IFNL 4JB9L 2JLLA 3F84A 1FF5A 1BYPA 2TAAA 3GJFH 5F9JB 1RQ5A 3O3AB 4OCLC 3SQBA 1URIA 12E8L 1FIGL 3VUAA 3V4PA 3U4KA 2GJ6B 2QLYA 2I9LA 3IF1A 2HTKD 2WQVA 2N4IA 2GKIA 1U33A 4E41D 3FZUC 2D8KA 4L5FH 5AW4B 4IRSA 5FYJD 5C6WH 2EIZB 3QEUB 3FCGA 1EEQA 2IVFC 4JS7A 3QNXA 2JKSA 3HNSH 3HC4H 4GI9A 3T6ZA 1BIIA 2Y5QA 4MXVE 1H3VA 3EDEA 3CSGA 3FAXA 5A3ID 4OZGF 2Y7OA 1EHLL 4PLOB 5C08E 3O4LD 3Q01A 5IJCC 5E1AB 1I9JL 3RRQA 3ZZSA 2WWMC 3VE0A 4PJEA 4X0KA 3K5SA 3VFMB 3CC5B 1IGJA 3TGXA 4GXFA 1A1MB 1KC5L 3N3EA 3NQIA 3QUXB 2JVUA 3LPPA 5HPMA 4Y19A 3CHXA 2OJEA 3PDOB 1JNJA 3L1OH 3TT1H 2ARWA 4QPEA 3QIUD 4NO0B 5D1QC 1L9SA 1QHOA 4P0DA 1NGQH 4KKPA 4FQQA 5IB2A 1BM3H 4PVLA 2YGNA 4R5TA 2VXTH 2XV6B 1SJXA 4OI9A 3OB8A 2BY1A 1QWUA 2GJPA 1FFOB 3R06A 3BZDA 1T66C 3RUGA 4ACPA 5LG1A 3IFLL 5IROA 1GXEA 1N3NA 2H1PL 3TWCH 1S7XB 2OJ1A 4MXWH 3BZEB 4IKKA 1G7LA 2DMBA 3H85A 4Q4IA 4WJKB 5SX4H 1LJMA 1MHCA 4MX7A 3ARBA 3GXDA 5EU5A 4ZUVA 2CA3A 4ZSOE 1H8NA 2A73A 5EOCJ 2J20A 2DQUL 3MBXL 4JMXA 3NZHH 5DRWB 3G6JA 4F8QA 2E86A 4D0BA 2Q86B 1U8MA 1HZHL 1RUQH 4ZXBD 3GSNL 3Q7JA 5KSUB 2Y36H 4P23D 5D1ZC 3AG4B 5DQ9B 1TZIA 3FTVA 4LCWD 2ADGB 3CQFA 3GB7A 5I5MA 4NOFA 4F2EA 2I9TB 5A43C 5BZDA 4I0PD 2KQMA 1GHFH 2HJFA 4JCWA 1TVHA 2PWDA 3NEXA 1JN6B 3P54A 2R7EB 4S2SB 2IAMA 4NUGH 2YN5A 4NQSA 4RMSA 4IGBC 2WK2A 1EGJH 2SEBA 4JM2D 2G5BB 2OL3A 1OW0A 2UY7B 3F85A 1S9VA 3NJHA 1RFDL 4G6AC 5GGVH 4P5TD 5E2TL 1D5BA 4NM8L 3F7KA 2IJ0C 4LLDA 5I82A 1DBMH 4JG5A 5E9DB 3DV6A 4M7KL 1H5BC 3JTBA 2O6DA 3CVHA 5DEGB 3SDAD 6TAAA 5TDOB 4KX7A 1KB3A 5D72L 4H8QA 3TBYB 2IF7A 1OHZA 5KZCB 3UACA 1U8OB 2EH7L 2MPVA 3MROB 4JN2A 2XWDA 2NY3C 2GC7C 3JSSA 1MREL 5EBLB 1IEAA 2EO9A 3RX7A 1BLIA 1ITBB 2EC9T 3SE9L 1PZDA 4PVNA 2A6JB 1QUPA 1NOAA 1S7SA 3ZIYA 5KN5B 3Q06A 3O6FC 3GM8A 2PO6D 5C0CD 1LWRA 1AKJD 4ZFZB 3PHAA 3BPOB 1YQ2A 2HAZA 4YR6B 2XVKA 1WF5A 1NCWH 1CE1L 4JQXA 5BMFL 2PR9A 1JYWA 3FXIC 3WN5C 3X2QB 4GRMA 3MLWH 5E0QA 4BBWA 3L3OC 4FTVA 4XC3H 3N40P 4JVWA 1MAJA 3A67L 4GAYA 1K8DB 4FLHA 4FYSA 2PNDA 5EZLB 4KQ4L 4LLVA 4NNXB 5DD0L 2B7DT 3OV6A 2WC7A 3MCYA 4K8RC 4LIQE 3MBEB 3MLSL 4NWUH 4EIZC 4GXUN 3SO3C 2F9BT 4M6MH 4A6YH 2XXCB 5HYFA 1YMMA 4XMTA 1DDHB 4JRYB 4N0RA 3L2MA 5ICXA 1AR1C 5GIRB 1OSPL 3OJ2C 1OZTG 1BX2B 2YK1H 1KBGH 3QUZB 1CFTB 1N8OE 4MDRA 4NSKB 1Q72L 4UANA 3VD3A 1N6UA 4JKPL 4PVMA 4ZMWA 3V4PH 5EF1A 4XOEA 2AQQA 3PQYB 3ZKMD 2P8LB 2IAAC 1N0XL 3MRNA 3IN2A 1V05A 2B59B 4HPYL 4W9CC 1AGFB 2A38A 1EFXB 3UC0L 1FZJA 3MLYH 5T1KA 1CL7L 2A4CA 1CBJA 2FZ3A 2ZWNA 3ASWA 4K3DL 4S0SD 4JRFA 3WHE1 3BW9A 4XGZA 3LEYH 5ACMA 4M56A 1IIIA 3QVAA 3U6XA 2ZPKL 3D25A 4LOEA 1P2CA 2XACC 1SOKA 2VR5A 1MVYA 3WY4A 1S7RB 2ZUWA 1G6RA 4QYOB 5HYIA 1LE9A 1SXZA 5F72S 1IGFH 1WCQA 3G5ZA 4JRXA 1T03L 2BOBA 5IB4B 1P4LB 2YGPA 5ITBL 1A7QH 2UXFA 3X3GL 3T4YB 5BOZG 5CJOL 1MCOL 5C0IA 4KRPB 4BD4A 1PZ5A 3VMOA 2BC4A 1BG9A 4YVUA 3T6XA 1CFMA 5F7WC 1IGCL 4DPBX 4KRLB 4ORZC 3L3DB 3DO4A 3QCUL 4ZAKA 3D39B 2YUXA 4GMTL 4U1LA 2H2PC 4N2NA 4PY7A 4XAKD 5D71L 5MERB 3WTWA 1DBJL 4OI7A 4MNQB 3UTSB 1YN7B 4IOIA 2XJKA 1FG9C 1IAOB 1IC7L 3FQ1A 2RR3A 3GBNL 1P5UB 5T5FA 2WINA 2HUEA 4NZUL 4NZ8A 4K5LA 4QF1B 3GMMA 3CXFA 2AHIA 3VI3E 1LM8V 3GTVA 3ZDYB 5INCB 2WWOA 3N1GC 2EEDA 3E6HB 2C9UA 3FYIB 4NN6C 1HWWA 4V1DB 1EO8L 3DVGB 1N9PA 4HF5L 1KNOB 1R5WB 1FHGA 3D8MA 5B1AB 1HVXA 4BUQA 2EDTA 1AH1A 2P80D 2XZAL 4NLAA 2AJUL 3VFNA 3CDZB 5AVRB 4Z1PA 5GJTH 2GSIA 3KPRA 3QNFA 1UWFA 2J57A 4C8XA 3VD1A 2G0LA 1RIUL 1VKXB 4YLCA 1NCNA 2Y1VA 4UF7C 3K72B 3KPTA 4W93A 4XNZB 1I9EA 1KB5B 2X4TA 4MNGB 5IV2B 5BZWA 2X4PA 4M8VA 3DHPA 1ZTXL 3ABLB 2NXYD 1YRKA 4LEBA 2P5EA 3TYGH 5FCUH 5JXEA 3BWUC 3NOIA 4S11A 4OFVA 3UZQA 4RFOH 3QCVL 5FB8A 4AQEB 2P24A 3WNPA 3BP6B 2QGEA 3ES6B 3JWNC 3LSOA 3SDDD 5FHAL 3VG9B 4QRUA 5KBPA 2RALA 3PAYA 1NUFA 2IOMA 1K4DA 4KOCA 4E9RA 3CVIH 3A22A 1R33A 1A22B 5DS2A 2YN3A 3CVHH 3K1DA 1UZ6F 3JTSB 2EDLA 4HLZH 3QJXA 1YC7A 4W9GC 5DZNA 3SBWC 1AOHA 4QRQB 1JE6A 4IBLT 3N9GL 3NMEA 4D9QD 3EJRA 1NC4A 1T7XA 3NT0A 4CVUA 4X7CC 3L95B 2X7LB 1L7TH 2R69A 3EUUA 4MMZA 1TZGL 2GAZA 1FNGB 4YFEA 2H1XA 5E08H 2YPKB 1BJ1H 3B56A 1NUGA 5KOMC 3P73A 4XP5L 4L05A 1E2WA 1YLBB 4O9HL 4NN7B 2DM4A 2ZX7A 2IH3A 4LIQL 4PJ5D 2DEWX 1MW1A 3L3IA 3PHQA 3SQBB 1DUZA 1I82A 1KGJA 3H7LA 1FVCB 3NUKA 1H6UA 1YG9A 4K2UL 3KPMA 1FNFA 3UO1L 2I9LB 4KY2A 5JPNC 3IF1B 5L7XH 1RZFL 1UURA 1G7PA 3PREA 3SPJA 3PE9A 4N28A 5I1EL 1GC1H 1G1OA 1FPTH 1RZPA 4J6RL 3QNXB 5K5YA 3BI9X 1I8AA 1BIIB 3NIFB 4Y5XA 4AW4A 5E8EB 1CD9B 2EVFA 3RI5K 1CLVA 3GDBA 3HMXA 3JQOB 5DS1A 1I3VA 4F1ZA 2UUDK 3HI6H 4DZBA 5I8OL 4HSAC 3MLUL 4PJAA 4YSSA 4GBXD 1PG7W 3VE0B 4PJEB 1EHAA 4X0KB 4N2EA 3QRLA 1IGJB 1JCKA 2FYYA 4AEIL 5I73C 5J06A 3CAFA 4KRMB 5HGHB 4FLOA 1NAMH 4XN1A 5HPMB 2OJEB 2V2WA 1YPZF 1E42A 2HRPL 3AQYA 2WZPD 4WTZA 3ZPDA 2BZ7A 4QRBA 3WFDH 2APBA 4MJ2A 3P3UA 1MLBA 1CCZA 2MQ3A 1UWXK 4Y4KA 1D9KD 3HRZC 4NWTH 2DDQL 4FQQB 1NC2B 3IBOA 3CFCH 4WUUB 4LPUA 5IB2B 3WYRA 3LDBC 5DHMC 1LP9A 2Q1EA 4I8DA 4PV9A 4X7SH 3UX9B 3R06B 3IB4A 1T7YA 5L2KD 2HTLC 1D2PA 1JWSA 2VW6A 1N3NB 2ZUYA 4FABH 2JMRA 2BVEA 1WAAE 2Q3ZA 3QHTC 3ZJAA 2YRZA 2Z8RA 3U79A 1G7LB 1LK3L 1QBML 2FLMA 2QDWA 5DUJA 2WZ0A 4MJHA 4MMXC 3EYUL 4L5FE 4U6VH 1XIWD 4KQ3L 1A3RL 4KZDH 1MHCB 4KTYA 3ARBB 2XWCA 2YEQA 4MX7B 4XPFL 4M4PA 5EU5B 4ZUVB 2Q5BA 2CRZA 3OPZL 2A73B 3PAUA 5DZJA 2WNXA 3S5ZA 4J4PD 4HJ0D 3HW7A 3UH8A 1G6RH 3HG2A 2GFBA 4PLJC 7FABL 4H2CA 3G6JB 3UYPA 4OIAA 4D0BB 3BYTA 4JO5A 3QJZA 1U8MB 3L3JA 5AOKA 3ILQD 4S1DD 4XMPH 1IAKA 5CN1A 3RWJA 1TZIB 3P0GB 3GB7B 2E0PA 4CU7A 1VDGA 5HI4D 5BJTB 3BVNA 4QJ5B 5EG6C 5BZDB 5JIKA 1QEXA 4G8GE 4I0CC 3OXSA 4EOWH 3HBPA 3QQ4A 4BQ8A 2HJFB 2AJXL 1KTBA 1TVHB 2WY3B 4PP1D 3NACH 1WYJA 2DW5A 32C2A 4X83A 3TBTA 5GGSY 3ZLQC 2IAMB 1ZTMA 3MREA 4MHHG 3V4LA 5JHBA 1QPXA 4NQSB 2CA4A 3TIEA 1MRDL 4Y4HA 2SEBB 4HCRA 3CHOA 2OL3B 5AZUA 5T5FH 4N2OA 1FDLL 1S9VB 1RAMA 4TVUA 5GGTA 3QUXD 1C7SA 3ILDA 4JO4L 1D5BB 2H6OA 4HIPA 3NZ8A 4LLDB 3UEZA 1WBYA 1JHLL 5EIVA 3DV6B 1GZQA 1PG7X 2AABL 5CJQH 4F7TA 4NO0D 2X88A 3CVHB 5HYJA 3P02A 4LASH 3D06A 4PCYA 4UIKL 2APVA 4GB9A 3EO9L 2D3VA 1IFGA 3V4UH 4LGSB 4PTTA 1NWPA 3WI9A 4WGVB 2LW3A 1IEAB 4WEMB 3P4LA 1HTYA 3FAWA 1PU0A 5GRVK 3EBGA 4UQ9A 3KYAA 3LQAL 2UV3A 1S7SB 2C9RA 2FRGP 2R4RL 2VMCA 1HAUA 2X12A 1P4IH 2P47B 1MFCL 3CUPA 4XN5A 2B1HH 1SVBA 5L88H 1BD2A 4H26B 1K6QH 2HT2D 4N8VG 3FULA 4K5PA 3KGTA 1N8ZA 2NW2A 3H8NA 5ANHA 1N64L 1Z5HA 4ZMZA 1AY1H 5DMGD 3D0AA 4GRMB 4XC1L 1SQ2N 4MQ7B 4OTXL 4O58H 4RFEA 2QGCA 4FTVB 3QDJE 5DFVD 2YLHA 1X7SA 3RVWC 3S0PA 4GAYB 1G0YR 4X4KA 4LLVB 5AOMA 5A1AA 3T3PB 5C2BL 1O7DE 1AHKA 3K8LA 1BEXA 1PS3A 3CHQA 4QXGL 3FKUS 4R90H 3FL7A 1GYAA 1CXFA 4HV8A 2HXAA 4KVNH 2YAPA 1ACXA 4M9OA 3GYRA 1YMMB 5LCVA 1OIOA 4FNUA 3TJEH 1F6AA 5ICXB 5CAYB 4KV5F 2R69H 1TSHA 4XP6L 3PGFH 1MCSA 5I30L 3EJSA 4YE4H 4W6YB 3Q5OA 3RBGA 1QBAA 4GINA 4K0OA 3QZWA 2JQZA 2VMEA 1JDDA 1K2DA 5C0BD 4NP4H 3S88H 3DGGA 4KWUA 35C8L 4BE6A 2EUVA 1OAZL 3PCYA 4G6JL 1T4KA 2PTTA 3NAAL 3W38A 4L4JA 3MRNB 2X42A 1LL1A 3NJMA 5E9DD 3QJHA 5JMOC 1FZJB 4OY9A 1G6VK 4YUEH 1NMCC 2FZ3B 1JXFA 2WYIA 2NR6D 2ODIA 3HC3L 5KZCD 4JHAL 4XGZB 1AFVH 1TQBB 4KH2A 3D25B 3IRPX 4LO9A 1G6RB 4LSVL 1LE9B 3RDTC 1QSZA 5GS0H 3N06B 4JRXB 4YBHA 3S37H 2BOBB 2BPBA 3FN9A 4MA7H 5DEFA 3CNKA 4PJBF 3KL3A 5C0AE 4HKBA 4OGYH 1G4RA 4GAJH 2WO4A 2X6CA 2Y23A 1OTUC 5C0IB 4W6XB 4L5FL 1PZ5B 3RX9A 1FLRH 2BC4B 3B4NA 2ERJB 4OIFA 3HNSL 2J88H 3HC4L 4OZIE 2ZOOA 1EZLA 3UBXG 2F7IA 3HN8A 3OBAA 4OLEA 2DQIH 1NANH 3GBLA 4ZAKB 2VR8A 3C09C 2GTZA 4U1LB 5EWIH 1LHZA 4PY7B 2QFPA 4AE0A 3MBED 1PJ9A 4Z7WA 3EJTA 4AMKL 3MJ6A 4IOIB 5HDOA 3LOWA 2A77H 1UD8A 2B5IC 3BH9A 3ZHKA 3L1OL 1BAFH 1YN6A 4M93C 4PRHE 3TT1L 1AYOA 1BEYH 5GZNC 2LU3A 4GG8A 4JRYD 3GMMB 5J57B 3BUDA 3RVVD 3BIKA 1C5DA 4QHMA 5JHDE 4AY0A 1UYWH 2H3NA 1BM3L 2VLLA 3QUZD 2VXTL 1N7MH 2WCGA 4LFHG 4YHLH 1SJMA 5ICUA 5AVZB 2FUQA 3A24A 4N1EA 4PLNC 3QP3A 2H0FA 3QT2A 1JZJA 3VFNB 4WDIA 2GSIB 3TWCL 1MFNA 1USQA 3PQYD 4MXWL 1MWAH 3MUHL 1MCQA 2LU5A 3TZVA 2K4AA 2AC0A 1MW0A 1EFXD 3FUJA 2X4TB 5BZWB 2X4PB 3BQUC 2BWDA 5LN4A 3IK2A 4GQ9H 3QULA 2OQJA 3MV8A 2BIOA 4NZTH 5FB8B 4JMNA 3NZHL 2P24B 2DZEA 4GS7C 4Y0GA 2N59A 1EANA 2PCYA 5GGTH 1RUQL 3II1A 4QRUB 3K8KA 1DO5A 1PLBA 2VZSA 2HCZX 1BW8A 1K4DB 1ZSDA 2IGLA 3MUY1 1V3JA 1D6VH 1A3ZA 5MHSD 5E56A 1GS6X 3OF6A 1XHHA 2IWEA 4X4XB 1J1XH 3PL6A 4KRPD 3ECUA 1GHFL 3VM5A 2XN9A 1IBFA 1HDMA 2XIDA 3C87A 5JA9A 3U0TB 4TUOA 5E6UB 1SDDA 4Z3GA 1VACA 3QORA 1MFAH 1NC4B 4MQXD 1EGJL 4ALAH 3KLHC 5IHZB 4MMZB 3D39D 3LNGA 5I6KA 3P73B 5KSBA 2F19H 4MNQD 1SJEA 5GGVL 4RH4A 2IH3B 2WXHA 3PHQB 1DBML 1DUZB 1Z9PA 4NCC2 4NQDA 5ESAA 4BH7A 4HOWA 3AG2B 2FLBT 3W0WA 2AEOA 3ELAT 1PNCA 3IETA 3TH2T 3QEHA 3KPMB 2NLJA 3ZTEA 5IBLC 1G7PB 1NCOA 1CGVA 3K2IA 1W72A 4Q2ZA 2Z7ZA 4V1DD 2NNXA 4NERA 1INQB 1HHKA 4BHUA 1PKQE 2JKTM 2ZOUA 3DPDA 3RWGA 3ZQWA 4IOSA 1NCUA 3ARYA 3KVPA 4DZBB 3GLDA 3OR6A 4F2MA 2CO2A 4AYDC 1Y6MR 3N41F 2FYYB 1NGZB 2ZWSA 3WY3A 5ADOH 5IG7A 4MCZA 3ZW3A 4YGVA 5DMIH 2LTQC 3UMNA 1NCWL 3GSOA 4Z3FA 2E56A 3ELQA 3FB5A 1MLBB 3IJYA 4X9HA 3MLWL 4Y4KB 4KI5D 4OCMC 1PFCA 4XC3L 5IOKA 3ZKXC 5HJBA 1T0OA 3CH1A 5MENA 3M1BA 1BYNA 3KGSA 5F7LB 2XVGA 4RMBA 1HL9A 2K4WA 4OFQA 4PV9B 4NWUL 4Q6IC 3X1FA 2W1NA 5F3FA 3FQUA 1TTGA 1JWSB 3X17A 2CR6A 1KELH 4J3OF 1JXDA 5A2AA 3T8MA 4M6ML 4A6YL 1EHKB 1XR8B 4MZIA 5HY9A 4XVUD 4DN4H 4AGQA 4X9FA 1AHWA 2FE0A 4KKAC 4OJAA 5GS3A 3QI9C 4ADJA 1ZY9A 2AQ3A 3CN1A 2DQHH 1ZT4A 3UAAA 4GYBA 1KBGL 4KMLB 3O2DL 5FYLD 1ETZA 2APWA 1ROWA 1PLAA 2IH1A 4HAGA 4XMWA 4PJ6A 5SWQA 2ZWKA 4V2BA 3P2BA 3V4PL 4WWKC 5KVMC 1JZHA 2XWXA 4G8IA 1KJ3H 3QPKA 1IM9A 2WV3A 4P9HL 3L4TA 1JF1A 1IAKB 5AVVB 3TC9A 3VXUB 5JPMC 4JANA 1PIFA 3RWJB 4ZS7H 3IJ9A 1FSKB 4MA3A 3MLYL 3QFJB 1RZIA 3BVNB 3MOQA 4XHJD 3U4BH 4AUYA 2E7HA 3ARFA 4G6KH 2R2BA 2XYCA 4XPHH 3OXSB 5LDSA 3LEYL 3QQ4B 5ISZA 3IXAA 4WFHE 4NZDA 4DKDC 32C2B 2CKNA 4CC4C 3QWNA 3TBTB 3IGFA 2O5YH 3MREB 1A1NA 3TIEB 4Y4HB 3L16A 2NY7L 2Z7WA 3ARQA 3FUIA 1IGFL 3TJHC 3DXAA 3QO0A 3S48A 3CFEA 3DX1A 1UGKA 3LH9A 5FKAA 5A2JH 4KO9A 4ELDA 4ODUA 1X3DA 2I60H 2IXQA 4KBPA 4U1KA 4D3CH 3SJVE 3N43B 1QFWI 4WIQA 3EF7A 3GK8H 3NZ8B 2VR6A 1WBYB 4JFEB 3VGAB 4PJXA 1QQDA 4AYFB 1GZQB 1O0VA 4F7TB 2QV4A 5AW8B 4AE1A 3FHEA 3FU7B 3KH4A 4MSWA 2D31A 1L5GA 1PW3A 5JHLH 1NC2D 4P04A 4WUUD 1P7QB 4E5XG 2RB8A 4PTTB 1OD9A 4OCWH 1CYGA 3HEIB 5AUMA 3ZE1E 4DEPB 1JXGA 2X1WL 3IGAA 3QUKB 3ZX1A 4YZFE 5C0JB 5DDHB 1NEPA 1U8NB 3CUPB 5E8OB 5C2UB 3TF4A 1U2HA 5HHME 1EAQA 1P6WA 4MD0A 1BD2B 5DFWH 4UINH 3ARBD 6PAZA 1QR1A 3ZYJA 3DYPA 2IDQA 2W38A 3BGAA 1M9SA 1N8ZB 1OGAA 2NW2B 4ZUSA 3KNBA 1AOZA 1DE4A 3B3IA 4RFEB 1J87A 5E1IA 1H3GA 4NQXA 2OTUA 1OOWA 1UB6A 3GO1H 1AQ8A 1KBWA 3A6BH 2D0HA 3BD3A 5L2JA 2GJRA 1N6QH 5HHOA 5TK2A 1F97A 1HCZA 4FMKA 4HV8B 1PCSA 3VYOA 5ECGA 4MFHA 2W8CA 3TYGL 5FCUL 5HHQA 3MNWB 4HHWA 1JG9A 1Q94B 4RFOL 4X6CA 3O3EB 5FWQA 4LGRB 3F5WA 1IGTA 1BV8A 3RJOA 4X9BA 1OCOB 3H3BC 1CLYH 4AGPA 3HHRB 2I24N 2FH8A 2NY5L 1E30A 2E7BA 3N5AA 3QZWB 1AQMA 1K2DB 4DQOH 4PJ7E 1BFOA 4A37A 4FJ6A 4B7LA 3CVIL 1L6PA 3DGGB 1WV7T 4MYPA 1PZ2A 1XF5A 4HIJA 1OL0A 4GFTB 2X9WA 1T4KB 3IJHA 4H1LH 4NFDA 1W72H 1MFVA 3QJHB 2GW5A 2YAMA 4F9PC 1QSFE 5IEKA 1WSST 1MXGA 3DNKA 1ODAA 1EVTC 2Y4SA 1X5YA 5EU7C 1JI2A 1L7TL 3LS4H 1W0WA 3NCYS 5E08L 5DS8A 1JBJA 2HLAA 4I85A 2AEQH 2AQ1A 1PMYA 3TXAA 2DH2A 2R83A 3LPGA 5J4MA 3U36B 4PB0H 5DU7A 1MN4A 5FYKH 2ZCZA 5DEFB 4BFBD 1F1DA 1FZMA 2GVYA 3K5RA 4ZD3H 3ULUH 4EIBA 4EDWH 4N20A 5L7XL 4HKBB 3HBGA 1UOLA 2V17H 1GC1L 4FULA 4H4NA 5F0PB 1FPTL 3KWUA 4X50A 5IGXH 1MFMA 2ZXDA 3QIWC 3HUJE 4QRPE 5FKPA 2Z35A 4P05A 2DQJH 2L7UA 4JHWH 4L1TA 4FTVD 2F18A 3G04A 3SGJC 2APSA 4R2GC 5DA0B 2WPGA 3KPOA 1YC8A 3GS0A 4O2FB 2GTZB 5IBUG 4L9LC 1PVHA 1ZV2A 1KGWA 4AKQA 2CH8A 1WWWX 1RZKC 1B4JH 3HE6D 1QATA 4LDEB 1NAML 1T4WA 4C54A 4Z7WB 3LN4A 3BH9B 5T1MA 3HR6A 3NCYP 1YN6B 4AK1A 4LB8A 1YMMD 3C60C 3WFDL 4GG8B 3E8UH 1X5AA 4P2QE 3BIKB 1C5DB 4HIQA 4NWTL 2NQDA 2H41A 3CFCL 4ENZA 2VLLB 4PD4K 4PJGE 2B3RA 2PTUA 5EU4A 3T09A 4NCDA 3HTLX 1GMIA 4IRJC 4X7SL 2VJ0A 2QKIC 4HA1A 1N67A 4GQRA 1PF3A 1IB5A 4HT1H 4QYAA 5KJ4A 4FABL 4WDIB 5ABDE 2OI9C 2HN7A 1KOAA 1S7UA 4ODTH 1KCUH 4KMTH 2A4EA 4Z0BH 3TZVB 4JQIL 1AP2B 4U6VL 1NBVH 2WZ5A 4WW2A 4KZDL 1YDPA 5BRQA 3I6LD 3JV5A 2KS0A 3ARDC 2HVBA 1PBYA 1E40A 2G2PA 3N1PC 3QULB 3MV8B 1G6RL 3VACA 4NJ9H 4UT6A 4P2RE 1U2YA 4OQTA 4ZMAT 5C08B 2ZOKA 4JAMB 3TA3A 2IFGA 1UTDA 3LQMA 3L3KA 2NSMA 1I9IL 3IKKA 3TASA 1ZSDB 4JRXD 3WD5H 2OZ4H 3S35X 4I2XE 1OLZA 2DOCA 4UNVA 2CLZA 5D2NE 2K45A 4YPGA 4P5MA 1HYRC 2MQCA 3VU2A 3PL6B 4EOWL 4UQ2B 2HX7A 2XN9B 4R5VA 1HDMB 3NACL 5CU9A 5AKSA 4MZRA 2XPGA 2OMYA 4TUOB 3UTPE 5H37H 3VCLA 1SDDB 3QORB 4ZS6D 2OK0H 4Y2NA 3KWTA 4JFDD 3KS0H 3D4CA 1WG3A 1NIAA 2RAMA 5T5FL 2YA2A 2XXMB 4JHVA 4WHDA 5KSBB 4KKCD 5D2LE 4R0LC 1SJEB 3I74A 2V7HB 1KBBA 4QDGA 5ESAB 3W5NA 4NQDB 4BH7B 3BSHA 3UCRA 3W0WB 3WDJA 4PFEA 5CJQL 4UOW1 2NLJB 4BE5A 2BM3A 4PJDA 2OFQA 4HS6B 2W88A 4TUJB 1RPKA 5JOPD 4LASL 2OKMA 4Q2ZB 1W72B 2VXQH 3KLAA 4XP1H 1HHKB 3BH8A 4PQXA 2XC8A 3V4UL 3E9TA 5IESH 3RWGB 1CO1A 4G8EA 3QHFH 4GG6F 1LXMA 3E8VA 2JJWA 4AVIA 1RUPH 1IJ9A 5AWNH 3OR6B 3UIZA 4F2MB 4YXLL 4HK3N 3QC5X 4O02A 3D2TA 5A2LH 4FDWA 4A7GF 2B1HL 2JJTA 1DJZA 2O30A 5GRZA 3PHOA 4DO4A 1XF2A 5L88L 5CGMA 4UOQA 2A74B 4N68A 5IG7B 3DHUA 4MCZB 4YGVB 1NCJA 3F7VA 3GSOB 1DJYA 3GMOA 3WS6C 3BWZA 3FB5B 5JXED 2A3TA 3IJYB 5CZXC 1AY1L 2IDSA 4O58L 1HCYA 4XZUA 3MRGA 2FJSA 2XTJB 1KBKA 2XIIA 3WY1A 3UDWC 4JGUA 5DFTA 2ZP9A 3PJLA 4B9IA 2VH5H 2D7MA 4KO6A 1R46A 1TJMA 4C57C 4KVNL 4XE5B 5HY9B 9PCYA 3NTCH 3ECWA 4HHGA 3TFKC 1XGUA 1AHWB 5F3HA 3TJEL 1MVUA 2OSXA 1KGUA 4YE4L 2JH2A 4JHUA 1NC4D 4L8BA 3BEVA 5CCHE 5C70A 2CHDA 4LCIL 1ETZB 1TMCB 5IQ9B 4NKMA 3D51A 2IH1B 1T1XA 4Z7VE 4NP4L 5SWQB 2FNBA 2PWGA 1FL6A 3F83A 4IHOA 4W9DC 2GK2A 5SX5K 3VJ6A 3S88L 4G8IB 5BNXD 1HSBB 4A2FA 4RQQA 1IM9B 4Q0XH 3KBPA 5GJSH 1G1KA 4BKSC 1ZJBA 1B0RB 2JQAA 4JANB 4PY8I 2XNAA 3FQTA 4MA3B 4YUEL 3SBPA 1DHKA 1W8OA 2ICWI 2PWEA 1BXVA 1S7TB 4YDLB 2R2BB 2B4CH 2GSMB 2DM2A 5CEZH 4K5NA 1AFVL 4XP9H 5I23A 5ISZB 2XG5A 1KXHA 2UZPA 3T2PA 3QJQB 5AENA 2KI6A 1A1NB 3BUPA 2EXTA 3D0VA 3ESOA 4LU5H 1JZGA 5GS0L 3DXAB 2XXFA 3QO0B 4PIRF 3CFEB 4FQCH 3TN0A 1QTPA 4MA7L 5FKAB 3ZL4H 2WIIA 3O0RH 3GRBA 3NRQA 4ODUB 2IXQB 4OGYL 4GAJL 1I8LA 3NH7H 1A5FH 2FJHA 5I6PA 5FA3A 2Z8SA 3VI3F 2PPFA 1KEMH 4HSCX 1J0KA 1FLRL 1SXBA 1AGCA 3TS8A 2K7PA 4PJXB 1QQDB 2J88L 5BV7B 1TZHA 1CD1A 1CQKA 4MSWB 2D31B 2DQIL 4Y4KD 1L5GB 1U4FA 1IC5H 1L9QA 5I71C 4PRAB 5EWIL 5BQDA 3OSVA 2BVYA 1U93B 1MEXH 1WGOA 1AC0A 2IBZX 2GQHA 3FRUA 1Q8MA 5CIPB 5AUMB 4NENA 4FQXC 2A77L 3EDKA 3I9IA 1BAFL 3IGAB 5GXBB 3TU6A 4A7VA 3FONB 1BEYL 2PPAA 2VT0A 5T8IA 4KKZA 4U1JA 3OVUB 3BXNA 3B7RL 5I5IA 4MD0B 3QDAA 4UT6H 1UYWL 4OQTH 1KPUA 1NKGA 4AGLA 1L9PA 1QR1B 1N7ML 1MCJA 1OGAB 4YHLL 2VZ1A 2BWQA 5C0RH 4P57B 3DVFA 3KNBB 1F4XH 4L3EA 1DE4B 5D1ZA 1WIOA 2ZX5A 3CN2A 2JKRM 4RGMB 1MJUH 1G7JA 5E51A 1NJ9A 2OTUB 1UB6B 3HR5A 3BP4A 1MWAL 4XN2A 1UOKA 4OT1L 2HB0A 4FL4C 5L2JB 3VXUD 2YPLA 4LHUA 3HCVA 1GKOA 4JO1H 1AR2A 3QFJD 5IY5B 2DB8A 1PD1A 4NDMA 1FYTE 1A14H 3D09A 4GQ9L 5K69A 1IC0A 4IGBA 4A55A 2GG1A 5EOTA 2HTKC 4NZTL 5ADPH 1A9VA 1JPTH 4GP5B 3L2NA 5MEQA 3F5WB 4WHYH 4B53A 1MHEB 5GGTL 5MEOA 4Y4HD 3MXWH 4RA3A 2CUHA 2IANE 5A3IC 1BFOB 2Q87A 1D6VL 4L1LA 1H5BA 1N70A 3HB3B 1G9MC 1XF5B 1J1XL 2V3EA 2YD9A 5D6DC 3QUMH 1F00I 4ATTA 2B16A 4JFED 2V5RA 2NNFA 3SGKC 3QR0A 5I0VA 3ESMA 3ULVH 4DKFH 5IEKB 2DLTA 1MCWW 3CFBA 4F7CA 2XCMC 3UAEA 1MFAL 1O9ZA 3QIUC 2Y9RT 4HCIA 4AQ8A 3UGUA 4ALAL 5LB1A 2MCG1 4WNSA 3AU0A 3IEAA 1JPEA 1W0WB 4TVPD 5DS8B 1P7QD 3AACA 3AQXA 3MPCA 3O4OC 4B9KC 2HLAB 2F19L 4NM4H 2BSSA 3O6FA 4KZEH 1BZQK 4O02H 4ELKA 4Z6AT 3GC3A 2ZOTA 1Z66A 3FTWA 3BUYB 1JCVA 3UGEA 3D87B 2IGFH 4WENB 2V2XA 4UOZA 4GI8A 1FZMB 4QHPA 2E9JA 5GISH 2FK9A 2PPCA 2CAKA 1SBBA 1BD2D 3FU9A 4KTGA 5J0BA 1PPIA 2EE9A 3HN5A 4XRCA 3M07A 5FFOA 5FGCE 2GK0A 5D5MA 1Q9WA 3MODH 1JZ8A 3ZTNH 3TWYA 2Z35B 3EFFA 4AW7A 1K3ZA 3AS0A 3VRJA 3V0WH 2RMNA 3G04B 3KPOB 5LBSA 1IT9H 4FNQA 1Y18A 2IBGA 4F5CE 4DGVH 1WAAF 2Q7AA 2D4DA 4HUKB 4ZXBC 3LZOA 3TEXA 5ADOL 2IGTA 2JKNA 3JTTA 4P23C 1KFGA 1N2RA 5DMIL 3IGLA 4PM1A 1DFBH 1DQIA 1G5AA 2BS9A 3M46A 2EKSA 4N9GB 4UM8A 2XN1A 2PCPA 2WKOF 5EEYA 2ZAGA 4I0PC 3CFDA 4XNXL 3HAEG 1VJSA 2LLNA 5EU4B 2Q8BH 5FW8A 4GO9A 2JIXB 4OKDA 4GRWH 2ZICA 1ZAGA 3FUEA 1GGCH 2QQNH 1AACA 4JM2C 3R4RA 4NB7A 5TF1L 1KELL 3EH3B 3GSQA 2HN7B 5B3SB 4DN4L 4OZHA 3INUH 5ICZA 1S7UB 1F90H 4EJ1C 5HDBE 3MV9A 4P5TC 4WW2B 3IE9A 1YDPB 5FWRA 5DD1H 3DOSA 2BDNH 1T80A 3SDAC 4HWEH 1OZUA 2ZOKB 4M7LT 3LD8C 1KJ3L 3TA3B 1AO7E 1HX0A 3BAYA 3L3KB 3KYKH 4NC1E 4ZS7L 3PJNA 2Z0BA 5C86A 2BSDA 3FBKA 4FKHA 1J0ZA 4YPGB 3LVTA 4P5MB 1DQTA 3U4BL 4G6KL 2PO6C 3C8HA 4XPHL 4KNQA 3CBJB 2CDEA 1FAKT 2XPGB 4AVJA 1DP0A 2IV9A 2OMYB 2X41A 1KBPA 2O5YL 2WYHA 1H9VA 1U8HB 4RLDA 2ZUXA 1FH5H 2YAEA 3GEWB 3DTDA 4P5RA 4OLWL 5K9QI 2QSTA 3WKPA 1OV8A 2WLHA 3G5VA 1GGUA 2NXZB 4XNBA 4G82A 4QCIA 2I60L 4D3CL 2A9CA 5F6HI 2VDKH 4UM9D 1H3XA 4QGYA 3GK8L 1IC4L 4AQ1C 4U1MA 2AEPH 2DL9A 5E8DL 3BPLC 2QQQA 3LNDA 5BW7C 2HKFH 5BVJA 2GI7A 4PJDB 1QSEE 4RMQA 1HESA 1B3IA 4PJFF 1XSKA 2ILLA 2R51A 1H8OA 3EHBC 3ECQA 3U2SA 3HFMH 4JLRA 5JHLL 2QHLA 3KLAB 5DJDA 1ZGLM 3QJUB 1ZVYA 2O4EA 4IIQC 3RVUD 4G8EB 5DYOA 3VQ2C 2E3VA 4N0UA 1CDUA 3QEQE 4OCWL 1H3UA 2QVIA 2JLPA 2FHFA 1OE2A 1ZLDA 2DQTH 1RHFA 3PWPE 4YXHH 3LV3A 1Z0MA 2LOEA 4O02B 5JYLA 4M1CD 4RMRA 3LCYA 1XF2B 3PHOB 3ZKMC 4UINL 1QMUA 3SE6A 3ZYOA 3KM2A 2ITDA 5ES4B 3F7VB 3GMOB 4J3VA 3Q8EA 4PJ9D 3P4OA 3MV8D 1GSKA 2OBGA 4BGDA 2CIK