1U3HB

Crystal structure of mouse tcr 172.10 complexed with mhc class ii i-au molecule at 2.4 a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
111
structure length
111
Chain Sequence
b'AVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHGLRLIYYSYGAGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGDAGGGYEQYFGPGTRLTVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell receptor alpha-chain
publication title Structure of an autoimmune T cell receptor complexed with class II peptide-MHC: insights into MHC bias and antigen specificity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 28
structure length 111
sequence length 111
chains with identical sequence F
ec nomenclature
pdb deposition date 2004-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u3hB00
2MCG1 5JOFB 2APVA 2NW3A 1CVSC 4HJJL 2P5ED 5FO7A 3O8XC 1S78C 1C1EH 3MREA 4G43B 4I0PB 1VADB 2J88H 1IQDB 3W0WD 3PV7A 4XMKH 1N0XH 1FH5H 2HLFD 1JWSA 4QTIL 5IFJA 4L8CB 2OR7A 1A14H 4S1SH 5E08L 2VH5H 1HQRB 3QJFA 3S37L 1UACL 3BUYB 3CSBA 4L4TE 1FNGA 4FFYL 1ZS8B 2CO7B 2VZ1A 1U9KA 4AENB 4J4PA 2Q20A 5C0AE 2QQQA 3G6JB 3C8KB 4GLRI 5DHVA 3NIGF 1IGYB 5ITFB 4YXLL 4KTEH 3O2VL 5LCVL 1FIGH 1J86A 4P5TA 2XTJB 1TQCC 5D5ME 5GS1C 2IBZY 4P2OD 3QNYB 4P9MH 5T33L 5M94B 4R7DB 4WTWA 1NL0H 1UM6L 3O45A 1NBVL 2J6EL 4KXZI 4OKVA 3GMRA 5FYKH 4Z7OE 3SKOA 3CSGA 4LLQB 2N4IA 3X13B 3T77A 4N8VG 2DQUH 2OTPA 3GJFB 4QEGA 3EHBC 4DGVH 1MHHB 3GRWH 2FBJL 3D3VB 1QSFA 4Y4FD 5GGUA 4WRLA 2ZSVA 5EN2B 2AJSH 3PIQA 4NQEA 1HEZB 3MLRL 4OTXL 3KPRA 4TPRH 2FGWL 3H9SD 2AV7A 5E4EC 3LPGA 2VLRA 3EOAA 3MRGA 3ORJA 1YEKL 5BO1L 2Q6WB 3HE6C 2E7LA 4N8VB 3GSUB 1J8HB 4ONOA 4JDTH 4PJGF 2E8YA 4K7FA 3BESR 3UZVB 5I1JL 5F70A 1T2XA 3I3DA 3KPQB 4ENEC 1IAKB 1OHQA 1LEIB 2Z92A 3QI9D 3EIFA 3BKML 4YDLC 4X4XA 4OI8A 2FNBA 4MQTB 3QUXB 5CIPH 4GKZB 5FB8B 2UWEA 4IRJB 1ZLSH 2Y5TB 4LVHB 3BPOB 5LXGH 1WVZA 3QZWA 4U1NB 4HXBH 1IM3A 3QH3B 5EU4B 3F5WB 5E94B 1MI5E 3DGCR 2VDOL 4QWWD 1C16A 2H26A 5GRUL 1S5IL 4FABH 1W0VB 3SCMA 4FQXD 3HC0B 3IJHB 4F7TB 3RZCB 2XA8H 4WHYH 5KVMC 3O3DB 3IU3B 3L3KA 4JFEB 4X6CF 1AJ7H 1IZKA 3WYRA 4GOSA 1A7QL 3HZMB 2CR3A 3INUL 1XF3A 3D85D 4R90H 1G7JB 4AY0A 4H8WL 4OLXL 4ISVB 3NCJL 1I7ZA 1WF5A 3MJ8B 4NBYB 1MAKA 3ZDXE 5DGQA 4LCCA 5C0RL 1V7ML 2VZVA 3PP4L 3IAGC 5CUSL 3UJJH 1AR1C 1OAQL 1KV3A 3E6FB 4D0DA 4U3XA 2VC2L 4WHTA 3NAAL 2AXFA 2BC4A 1MQ8A 4NNPL 4Z95L 1QKZH 3MYJB 5M95B 4LNRB 5LGHL 1MCWW 4HX1A 1CR9L 3PNWA 2NW2B 1XIWD 3V5KA 1NBZB 2AEWA 3CVIH 5DURD 3GSQB 3SE4C 4CVUA 3PWUB 4DOHB 2FJGB 3QUZA 1MAMH 2XQBL 2A6DB 3EYSL 3U9PH 2R0ZL 1L9NA 1QFUL 4MHHI 4E41B 1E4XI 1H3PH 2E7MA 4TQEL 1RUKL 1A2YB 5H2BB 5F88B 5HHMB 3EO0A 1PD6A 4NO2B 4BKLB 3EO9H 1I1AD 2CK0L 5HPMB 2VOTA 1ZLUK 2LE9A 2AAVA 3MRCB 4XP5L 2HLAA 1VFAB 1SVZA 3KVQA 2BOCA 4XPBH 3K2UL 3IXAA 3GGWB 2F8OA 4BA8A 2CKBA 4PJEF 4EBQL 5B38A 1UVQB 3MXWH 3PF2A 1D5XB 1FL3B 1RHFA 3QDAA 3QJHB 1P7HL 3L3DA 4O5LL 1QO3A 3WN5A 2ZWLT 3GIVA 5DJXB 1U8IA 2YSSA 2F58H 3UEZA 1QFWH 2YA1A 1J05A 3I75B 5IW1A 1HIML 5AZEL 4CAGA 5SV4A 2AGJH 4KI5C 2HP4A 3V6BR 1BREA 3H0TB 4O58L 2X4RA 5I74B 2O5ZL 1AHWA 5C08E 1FC1A 5DZNA 4X8JA 2FEEL 5DSCA 2CK2A 4EOWL 1KCKA 3V6ZA 1I85C 3DROA 1GGBH 4I8DA 5IG7B 2P45B 5FUCE 4CW1A 1FJ1B 4L9LC 2NPLX 2MHAB 2VR9A 3U2SA 5DEZA 5E8NB 2ZUYA 2JKXA 3DBXB 1RURH 3KPOB 5K9JL 4JPIB 1P9MC 3JUZA 5D2LB 2P44B 3QXVA 3MODL 3U7YH 1BFSA 2EH7L 2VIRA 3VCLA 4XCEA 5C2BL 2CUIA 3QXDA 2BCKA 4M1CD 3SDCB 1YPZF 3WJJC 5J1AB 3DX6B 3ET9F 5IEHA 3UTQA 1AGFA 5EU3A 2RGSA 2ZKHL 1CE1L 2G9HB 4NM4H 2P5WE 1GOHA 3FQWA 3RZWA 2NCMA 4LAQH 5DA0B 2GFBB 4RQQB 2OP4H 3GI8H 4BSWB 2X1XR 3KLAB 1LNUA 2ZUSA 5JLZB 3QQ9C 5EU6D 4JFZH 4ODXB 2UYLA 1K4DB 4MX7A 4PJFE 4FHBD 2FSEA 3WMSA 4DK6A 2FYYB 1MRDH 5KVFH 2XWJA 1TPXC 3EDEA 4JM2D 1V3KA 4DN3H 2VR4A 2VMFA 5C09D 1RJYA 3MJ7A 5C0CD 2EDJA 3QEGH 1YNLL 2NY3D 4LVNB 5I1IH 2DOCA 3KJ4C 4GMSH 5T1KA 4JO1H 5F1NA 1T4KA 1INDL 4NBZB 5C0BD 4GKSA 1T1XB 4OFPA 4P3DA 4GW5A 4R4BB 3SGKC 4KKBD 5F7NC 4L8DB 1OT2A 4MZ2A 4LOUD 4ZFZB 3QDME 4JPVL 4M43L 5C6WH 3W82A 2BSRA 4GG6E 1I9RH 3BD4A 4HS3A 1RQ5A 1J0IA 1KUMA 4TSCH 3C2AL 3IDGB 3V4VL 1G9MC 2Q86A 1DLHB 2N7AA 2W65B 2NYYC 4KHXH 4OCWH 4D9QE 1WZ1L 2Q3AA 4K3HA 3QBTB 1RU9L 4NCDA 5TQ0H 1RJZA 5C0FB 3MLXL 4HK0A 2ICWI 4N1EA 1OD7A 2EIZB 2Y07L 4QHMB 2KQMA 3LN9A 3MA7B 5L2JA 4PJCB 3UBXG 4NO0A 4OIBA 2VE6B 1IKFH 3T8XB 1IM9B 4ELMA 1FZMA 1B2WL 4JDZA 2XN9B 1BIIA 3CCHA 5FO8A 3KDMA 1RZGA 4QYOB 5I9QB 3V7MA 5HSFA 3NCYS 3MLYL 4S1DC 5L7XL 1IC1A 1DUYB 2GJ6A 4QTIH 5GGSA 1CE6A 1H3TA 4ZXBB 2AEQL 5E08H 5EO9A 1FZJA 4NN7B 3WIIH 3QULB 1UACH 4XTRC 1IGJB 1TVBB 5D7SH 3TO4D 1D5IL 3UBXB 4FFYH 3O3BA 4H88L 4YWGL 3MLPA 4R2GB 3O6FA 3DO7A 4JFYA 2R2HA 4PP1C 1NAML 2YWYA 4LLWA 5D4QA 2DQCH 4G9FE 3GSWA 4M7LH 4MDJA 5F7UA 5IOPB 4PRNA 1T80A 3QWRD 1MY7A 1J7VR 2DKSA 4OLWH 1U8NB 1DBML 4J12A 3P0VH 4YAQA 1NBVH 2J6EH 4IOIB 4WEUD 1AGBA 5KOMC 4HIHB 1NAMA 2V5MA 3KG5A 4WWKD 4I18B 2YXMA 3BW9A 3PP3K 4P99A 4RMUA 1UGNA 2OXHA 4RISL 4WW2C 1HHIB 1EUTA 4M5YL 4OFIA 4FFZL 3CIQA 3CXHK 4PJAA 1EFXB 5HGAB 5KSVB 2NY7L 3CFBA 1T04B 4KJQC 5DK0A 1T7VA 4JREC 4P2CG 3PDDA 2ZCLH 4J4PD 2EDHA 1F3DH 5BO1H 3TZVC 2V2WB 1UM4L 5T1MA 3GBML 1GH7A 5HPOA 2X4SA 4JM4H 4X5LA 3PHQB 5I1JH 3SDYL 3ARFC 4IS6B 1N2RB 3RJQB 1FVCA 3I50H 4L3EB 4P5TD 5EZOH 1LEGA 3NZ8B 4NNXA 5C8JA 3RL1B 3RNQB 1E6JH 4O51A 1G7IB 1EEUA 1BBJB 5AG8A 5C9JB 4HJ0D 2W60B 5J13B 4GKOA 3IS0X 5IMMA 5CEXA 4WY7L 2V7NB 2VDOH 2F5BH 4PJIB 5SWSA 5T3ZL 5GRUH 1QSFD 5TDOA 5IT2H 2FECI 4ZPVB 3K3QA 2N7BA 2ARJB 1WAAF 3AS2A 3WLWC 1H0DA 5TH2B 5AUMA 3F8UB 4EN3A 4JAMA 2VLRD 4OLUL 5IVXF 3INUH 4XZUB 4DKEH 3SE8H 1HSBB 1CDJA 4PY7B 4CMMA 5D1QC 5BQ7B 2GITB 2H45A 4WWID 1HHJA 4HIJB 3F62A 1QA9B 1WFNA 3I6GA 4PLNC 4U1MA 5ISZA 3KYOA 4XPHH 3IDUA 3QEUB 1U6AL 3PP4H 5D9SB 4CMHB 2B4CC 5CBAB 1Q9WB 1OAQH 5E8OA 1RIUL 5J6HB 2EEAA 4V1DB 5DTFA 1GGUA 3QCUL 3BZDA 5B21A 4HFWA 4XP1L 3VFNA 4LIQE 5FKPB 1CICC 3IDIA 1QBLL 2A9ML 2JJSC 2OJEB 4KVNH 4PJDE 4Z95H 4YHNA 1OARH 1ZWIB 1NCBH 1SEBB 4HKZB 3VXRB 2W38A 1LP9A 3RY4A 4G6AC 1A9EA 2WBJB 1HWGB 3A6OA 4TVPE 4GRMA 2G5BA 3SY0B 3SCMD 1C7TA 1JGVL 4LKXB 3ES6A 4KQ4L 1B0RB 4S1RH 5IB3A 3QXAA 4MCZA 3TV3H 2DD8H 2BMKB 3PQYA 1I3RB 1F3JB 3EYSH 4QY8A 5DA4A 3DXAE 1ZLUH 1DBKL 1IEAA 1LO2H 4ORZC 3LN5B 1XCQB 1D9KA 3QHTC 5H35B 4C4KO 5CZVL 3HMXL 5BRZA 2Z31B 2OQJA 1GSMA 3MNWB 2DDQL 1U92A 2YMXL 2IPTL 5I8OL 2ED8A 1M7IA 4KK8D 4XBEL 1YECH 3K2UH 5DS8B 5FK9A 1I1RA 4ZFFA 5E6IC 5KN5B 5I18L 3RGHA 4O5LH 4PTTB 2R0KH 3CX5J 4YC2C 1X3DA 4ZO7A 3B9KC 4ZOBA 2R23B 4KUZL 5DI8B 5JORB 3LSOB 2YOCA 5D5MF 1HIMH 4LRIA 1UH4A 1AXIB 1ED3A 3BGAA 2H1PH 3HE7B 1JIBA 3HI5H 2D7QA 3O2WL 3UTZB 3TBWA 4Z7OF 2O5ZH 5JW4M 1YMHB 1VERA 4NSKB 2L7UA 5J11B 2ADGB 3QUZD 3SJVB 1OCWL 3IDXH 4UINL 3LVEA 1HKFA 5HGGS 3ARBC 1MEXL 3L6FB 3BWAB 4F33B 1YYMH 4XCCH 5JOFA 3DVNB 5TPWH 3B2UC 4J3TA 1DANU 2NQCA 2V2XB 3P30H 4G43A 2JK5B 1VADA 4GBXB 2YUXA 3IVKB 2EH7H 3O6KH 4NJ9L 5CS7A 1AGCA 5H37H 4L8CA 4DFIA 4UNUA 4HH8A 3T0EB 2NZIA 5KG9A 1HQRA 2CDEB 1FRGL 3MX0A 3BUYA 3FQTB 1IQWH 2ZKHH 2QSTA 4PV8B 3U30C 1IGTB 3JXAA 3TBSB 4HIIB 5HYQB 1ZS8A 4AENA 3ECBB 4Q9BA 3C8KA 1IGYA 5ITFA 5JXEA 1J8KA 5FYJL 1UCTA 2HFGH 3GJFK 3QNYA 1LO0H 5D6DC 4R7DA 3OKDA 5KSAB 3W39B 2YRLA 3NFNB 1AH1A 4LCYB 4OF7A 1A5FL 5L0QC 3X13A 4L1HA 4P5KB 1QR4A 1OAZL 4PP2B 2NY1C 3LEVH 2XY1A 2IANE 1MHHA 4WNQA 1INDH 3NH7H 1AIFB 5I1AB 2X1WL 3E3QE 3V4PL 1H8SA 1CFQB 3VXMD 5FYKE 5EN2A 4RMSA 4W68A 1HEZA 1Q72H 2P1YA 1HYSC 3LB6D 4M43H 4U6XA 2GEEA 3K1KC 1JGEA 4R0LB 5GS3A 4NDMB 5K33A 4FQ1L 1FYHB 4D0BA 4XBGA 5IROA 5KSBB 1YNTB 2Q6WA 4P5MB 2FD6H 4Q74A 3V4VH 1F2QA 4XCFH 2C1PB 3KPQA 15C8L 1WZ1H 3TP4A 3RPIB 1HHGB 4UB0L 1RZ7L 1JBJA 3CSPA 1YUHA 3MLXH 3QUXA 4PJHE 4GKZA 5FB8A 2CKNA 2XRAL 4IRJA 3X3GL 5FO9B 1BECA 2Y5TA 1CYGA 1NBYA 2X6MA 3QH3A 5EU4A 3MLVH 5T1KD 3BDBA 2QJDA 3U83A 2NXYC 3ZKMC 3JWNC 4U1SB 4X0KB 3SKNB 3S35L 4QXGH 4KRLB 4ZUSA 3HC0A 3V95A 1JFQH 3L5XL 3MLYH 5IJVA 3IJHA 1F4YH 4TRPH 3ARWA 5AEAA 4F7TA 5JQHC 5L7XH 3RZCA 4FTVB 3IF1A 1NCAH 1TQBB 1YQVL 2AEQH 4JFEA 1J87A 5CINL 2EDXA 2C1OB 1QPXA 4N8PA 4TUJB 3HZMA 4AEIH 3MV7E 5D72L 2O93L 1D5IH 1G7JA 2IAMC 4U7KA 2JCCE 4H88H 4UTAL 4MJ2A 5IBTH 3MJ8A 4Z7UE 3FKUS 4OCNC 5E2UH 1BLNB 3M07A 2DJ4A 3OKMB 4EEEA 1F13A 4DUWA 3VXSB 5HHXL 1OTTD 3E6FA 1E0OB 4GRLD 2AJUL 1N5YL 3BRGC 4LDOB 2MCPL 2JB6B 1J1PH 1JUFB 2YUVA 4LCWB 3PP3H 4KK9D 5DD5L 3PHOB 5BS0E 3FONB 4PRIB 3MYJA 2DQIH 4RA0C 4LNRA 3BT2L 1JGDB 1O7SA 5GGQH 5HI3D 2UV3A 1AI1L 2NW2A 1FSKB 1NBZA 1CGYA 1RMFL 3GSQA 1KXVC 2AW2A 3EYFA 2A6DA 43C9B 3VXPB 5BVPL 5DEFB 1WK0A 5CKGA 2ZJSL 3N85H 3P4OB 4E41A 5H2BA 5IJKA 5F88A 5DHYA 2BY3A 4NO2A 4X6DE 1MCQA 4BKLA 3O6FD 5HGBB 1CVRA 4HKJB 4KKNA 4G7VL 3MRCA 5B3NA 1YYLL 2B4CH 3C9NA 2VERN 3QWOA 5T5NG 3B6SB 5L88L 1U91B 1UWGH 2APXA 4LPWA 4LARL 3H9HA 3GGWA 4R4FH 3Q0HA 4OLZL 1UVQA 4WEMB 1D5XA 4ONFL 3B9EA 4KJYB 3DUSA 2X70B 4JO4L 5DJXA 1KELH 3B5TA 4C83B 5CGTA 2BVYA 3I75A 3NIDE 3QO1B 4PJFF 4NT6A 1O7VA 3HUJE 1ZV5A 3H0TA 2VLKB 2ZCKL 1NFDB 4Z5RB 1VHPA 4NC0B 5EIIB 4JVUA 5DQ9B 4LPTA 1L6ZA 4HWZB 2HKHL 1ZXQA 3MRJB 2DQEL 5FCUH 2EDWA 2V6HA 5FUZL 1P4LA 1OWRM 2GCYB 2KL6A 3SQOH 5IG7A 4Y5XC 1QR1B 1FJ1A 5KS9F 4OLUH 1JNLH 1BJ1J 5E8NA 2VR5A 3DBXA 3OZ9H 1EGJA 1BQHG 3KPOA 4OCSL 5FUOH 4ZSOE 5D2LA 4YBLC 3JWOL 3JTSA 2CDFA 3MLWL 5DJ8B 2W9EL 1IBGL 3STBA 3SDCA 5EU7C 5J1AA 3DX6A 1R6VA 1RIUH 1PSKL 2G9HA 3DURB 3RUGE 4G8FB 3GEWB 2ZNWA 3GM0A 4ESKA 2GFBA 3QDMD 4XC1H 4RQQA 1EDQA 1CG9B 4BSWA 3TA3C 3KLAA 1BQHB 4B5EA 5JLZA 1WBYB 4QRRE 2GKIA 4ODXA 2ZSWB 1K4DA 4KQ4H 2FYYA 3QPXH 1ZSDB 1J18A 1JF5A 3C5ZB 3C87A 4EN3D 2FZ3A 3IKKA 5IMLB 4L3AA 1OGAE 5F9AC 5CZVH 4OZHE 4BH7B 3HMXH 1NFIB 4OT1L 3RY6A 1T1XA 1S7VB 1R3KA 3UTSE 3SOBL 2YMXH 2IPTH 4MXWL 4XI5C 4N90D 5ISZD 1UKSA 4L8DA 4YHLL 3ARYA 5B39G 4ZFZA 2OTUB 5I18H 2D0FA 1UQSB 5IQ9B 3WLBB 1I7TB 4CN1A 3ZLQC 4Y5YC 4ODTL 4KUZH 3IDGA 4F2MA 2M26A 2D7NA 2F54E 5HDLA 4CNIB 1DLHA 2W65A 5C86A 1MIMH 1YNKH 2F8VA 1TVDA 2XACC 3CFIC 5EU5B 3GI9H 4KHTL 4K2UH 3STZB 5C0FA 3ULVC 3DTXB 4XCYB 2EIZA 1OCWH 4QHMA 3MA7A 4PJCA 5B39B 4G9FD 1WUNT 3N1PC 2W0KA 1ZVHA 1MEXH 4DJMA 3T8XA 4MJ6A 3TIEA 2E5EA 3N9GL 3QFJB 1D9KD 4OUUB 2GI7A 1O0VA 2XN9A 1JE6A 5BRZD 1S7RB 4P4KA 2CRYA 3VW3L 2XICA 1U3HB 5EOTB 3A6CL 1N6QL 4NJ9H 5E8PB 4JFOB 4LLUB 2OZ4H 2AXHA 5MI0C 4YHOL 5F71A 3EOTL 1WEJL 2DM4A 4D3CH 5GJSL 3BE1H 3QULA 1LILA 1FRGH 3GKWL 3SKJH 1IGJA 1TVBA 3Q3GA 3WO4C 4LHQB 4OJFL 3KPMA 3UBXA 4ELKB 5H94B 3P4LA 5A3IC 4AG4L 3UYPA 2R4SL 3BN9D 3U82B 3GJFH 5TDPB 2YUWA 3TO2A 5DUBA 1BVLA 4XNQB 2CIKA 1KENL 5IOPA 1EMTL 3GB7B 2D03L 2PETA 1U8NA 3NGBB 1CTOA 1MCWM 1A5FH 4IOIA 3NCBB 1K3IA 4HIHA 1K3ZA 4EI5B 2A1WH 3PWLB 1OAZH 3FT3B 4TUKH 2LAAA 3OKLB 4LASL 4CJ0A 4I18A 2Q7YA 3KLSA 4KRPB 4NN5C 4NQEE 3C5JB 4KTDL 3HA0A 3V4PH 1D3CA 1MREL 1HHIA 3QHZL 4QO1A 5EBWB 5FKAB 3FN0L 3WFZA 5ILTL 4RGNE 4MNHA 1EFXA 7FABL 5KSVA 1T04A 5JHDB 1UZ6E 3DARA 1IVLA 2V7HB 1KYOK 1NGQH 4JDVB 3QP3A 4S1QL 4TNVF 2YD3A 3PL6B 3PHQA 4QRUA 4YR6B 3ESVF 1P84K 1RUAH 1N2RA 3QNZA 4IS6A 4L3EA 4F37K 3NZ8A 5KSUB 2WUCL 3RL1A 1A6WL 2IH1B 3L3HB 4PJ9C 3DMMB 1G7IA 5C9JA 4IRZL 2NY0C 2W60A 2GSIA 1BFVH 1F45A 1ZHKB 4M8QB 4QT5B 5D7LE 2E7CA 1F6LL 2V7NA 5FYJD 2PN5A 4U0RB 5IF0B 5TGBB 4YHPB 5ICYB 3S35H 4ODSL 2MFNA 4ZPVA 1I1YB 1YJDL 2ARJA 3LQAL 2ZPKL 1AXSB 3F7YB 2EDNA 4FXLA 5TH2A 1A1MB 2WW8A 2B39A 1NCWL 4JHWH 3HC4H 3VD9A 3HR6A 4HPOL 4LBEB 3LKQB 4XZUA 4NUJB 1HSBA 2GITA 2KUTA 3ZT7A 3WKMH 4HIJA 4Q6IC 5I1GH 1AO7B 3LKOB 1QA9A 3OB8A 3B5GA 4EDWH 2IBBA 4GXUN 4UQ2B 3MV8E 3QEUA 5CBAA 3KR3H 4X6EB 4OAWB 4C4KT 2AQ3A 2NXZB 3RTQD 2AJYL 2Z4QA 4V1DA 2NY1B 1QLFB 2BVEA 2Q8BL 5FKPA 2OJEA 4DKFH 4P48A 3VFUB 8CGTA 1SEBA 4HKZA 4Q2ZB 3VXRA 1NGPL 5JMRA 1DE4B 2WBJA 5IR1B 1R5VB 3SY0A 4R4ND 5JR1L 1AI1H 4LKXA 1CLOL 4OV5B 1B0RA 5IIEB 4WW1B 3RZCD 5IHUL 4JQIH 5EUOB 4K9EC 1I3RA 1F3JA 2YZ8A 5BVPH 4FOMA 4MB5A 5MERA 5FEBA 2A73B 3EFFB 2K7PA 3LN5A 1G0YR 4YEFA 1B0GB 1XF2B 5H35A 5SX5K 2OCFD 3MBEB 2Z31A 3G5ZB 4Q9QH 4BUHA 1MF2L 3MNWA 2ORBL 3GMOB 4FQPA 1WLHA 1A4KB 3H42H 1T1ZB 4K3GA 3AB0B 3UC0L 2AV1A 5DS8A 1JZ5A 2ATPA 2YBRB 4G8EB 3V0VA 4NWUL 5FYKU 5KN5A 5MEQB 4OLZH 4AL8L 4ONFH 3VE0B 1OPGL 4PTTA 25C8H 4TOYL 2K3TA 4FZEL 2DYPD 4XHJD 1QSEB 5LWYL 5DI8A 5JORA 4OGXH 2OI9C 3HE7A 3VWKB 2E9BA 4YFLI 3V6OA 3T0AA 5EPMA 4NSKA 4G7YL 2HKHH 5HJ3B 3U48A 4Y1AE 2ADGA 4OZFG 3LKNB 3SJVA 3QXTA 5FUZH 1Y6MR 3BGFC 3RVVC 3O81A 4OIAA 4XH2B 3L6FA 1JPGB 4F33A 3TCXA 5D1ZC 4E41D 3ZKND 3DVNA 3JV4B 2EXWD 2EYRA 1QRKA 2FEEI 4ODBD 4O02H 2V2XA 2I5YH 4NOBA 2JK5A 4GBXA 1PG7L 5B4MD 4FNLL 3IVKA 1IBGH 2VDLL 4OLYL 4HEME 2CDEA 4OZFB 1EFQA 5D2NC 4UV4H 3FQTA 4PV8A 4YXHH 3EYOB 1WBXB 4H26B 4HIIA 3TBSA 1JRHH 5HYQA 2A2QT 1NMCC 5JA9A 4DGYL 1G6RH 3G5XB 4XNZC 3FMGH 3MV01 3SE4A 4RGMB 2W91A 4RAHA 5EZLB 2HJKB 1IGFL 4K3EL 5HHOB 4WU5A 3D69B 4WO4C 1KLUB 3JVGA 5KSAA 3W39A 3NFNA 1I7UB 4HJGB 1S7SB 2EDLA 4M48L 2ITCB 4D94A 2BY2A 4P5KA 3EOYG 1OW0C 3DJ9A 2HVKB 4OFVA 4PP2A 4KZDH 3K8KA 1I9EA 2CXKA 1S9WA 1FG2B 5I1AA 1G7LB 1Q0XL 4HQQL 3KPLB 4UAOC 5EUKA 4JGUA 4MXWH 5I2IB 3BMVA 4Z78B 3GHEL 1GZPB 4XMPH 3SDCD 4YHLH 1J0YA 1DBBH 1YDPB 1PLGH 1BGXH 2JCCF 2H41A 1SJXA 4U1LA 5DJ0B 5CSZB 4Z7UF 1UYWH 4JPKL 4NDMA 3FJTA 3D18B 5J9PB 1YNTA 1KTKE 4WVRA 2NY6D 1KG0A 3LAFA 5KTEH 2C1PA 1IKNC 5ID1A 3K80A 5CBEB 3ZDZE 3M8OL 1HHGA 2XKSA 5ANMB 4IRSC 1MRCH 3GK8L 4QOKE 4L9LA 2DM2A 3T04D 1HQ4B 2RCSH 5F7EL 4JPWH 4F7EB 3PDOB 3RIAK 1U58B 2LVCA 4FQIL 3SDXB 1P9MA 2V5RA 4YNYB 4YPGB 1HI6A 5FO9A 3UPRB 1REIA 2HFTA 3W2DL 3BJLA 2Q8AL 2OK0L 3I3EA 1JF1A 1JGLH 1ULVA 1ZE3C 1NLDL 2GJ6E 4N1HB 3SKNA 1WJ3A 3VW3H 4IBLT 4KMQA 1N6QH 4X7SL 3VGBA 3GSNB 4QRPB 4FTVA 3CU1A 2HTLC 4X6DF 4WCYL 4CGTA 3UP1A 4JO3H 1WEJH 3V4UL 4IIQB 4TUJA 1ZEAL 1MCEA 2RJMA 2QHRH 3UX9B 3DYOA 2R0WL 4PG2A 5AAMA 2HT2C 1AY1H 1RIHL 2HWZL 4GH7B 3U0WL 1XGPA 2R4SH 3V5DB 4HLJA 4U2YA 3IDYB 3IJYB 4M7ZB 2AJ3A 3IFNH 4PGJA 3IFPB 3NIDF 3QWQB 1W0YT 3VXSA 2AXGB 4M4RA 4Y19E 3HUJF 3LKRA 2NR6C 1LD9A 5FXCH 4JRWA 4FFWD 2JB6A 3G5YB 2HA1A 3RVWD 1H3UA 3FQNB 4NM8H 1JZ8A 5DFTA 3MV11 2VLMD 2XN9D 3RX5A 3C60C 4P4KD 3VGEA 3FO0L 1TCRB 2Z0BA 4LASH 4S11A 2VZOA 3CFDA 1ZLWK 1DQTA 1MHEB 2Y6SC 4JN2B 1DVFC 43C9A 5JW5A 3VXPA 5I1KH 1OAYL 4O4YH 5DEFA 3WFHA 4U1GB 4LCUB 4DTGH 3KXFA 1A1NB 4J3OC 5ENWB 1A1OB 4R2GD 5HGBA 2D4DA 3DUHA 4HKJA 3RVXC 5I76B 3FB7B 1M6OB 3S3JA 1DZBA 2UZYB 3B6SA 3RUGF 3LEXA 3FZUC 4RAUA 2BFVL 3P4NB 4HWNA 2WUCH 3QPQD 3L3JA 3U6RB 3HI6L 4KJYA 2GY7B 4P3WA 2R29L 1MHCB 5L2KE 4Y5VB 2IBZX 4IRZH 5F3BB 1OAUL 3A0OA 3ARDC 3QO1A 4M02A 3V52L 1W8NA 4HXAL 5E2JA 3VDCA 2JB5L 3SO3C 2VLKA 3BOVA 1NFDA 4I77L 4Z5RA 4ZDHB 5EIIA 1RZKL 4K9EH 4N1CA 5DQ9A 3S4SG 3OKKA 4BK4A 4ODSH 4HWZA 4FG6C 3LH2L 5DFVD 1QBML 2B1AH 3BDXA 5J1SC 4JY4B 2ZPKH 3I84A 5HVHC 1U8PA 1NCWH 4OZHF 1EFXD 1CN4A 2HMIC 1UXWB 4YXKL 1JHLL 3RGVC 2FH6A 4PY8I 5T3ZE 2FHCA 3QIWB 5J7CC 4NQDE 5A2KH 1ITBB 5A1AA 5FFLA 5F9JB 3MSPA 4I1NB 4LSTL 4HUWA 4PJBB 3WIHL 2FJFB 2E9IA 3QUYC 4S0SD 4GJTB 3GO1H 5JDJA 5DJ8A 4L3ED 1BQLL 3MRBB 3S4SB 5J12C 1DDHB 1OL0A 1YEJL 4NZDA 1JHTA 1YEHL 3DURA 2Q8BH 2WZPD 1S78D 4PRPB 3AUVA 1KCRH 1FGNL 1DQDH 4BZ2H 2VDPH 1CG9A 2BRQA 5TE7L 2IEPA 1BQHA 2YD1A 3HRPA 1WBYA 5JR1H 2X9WA 2UVFA 4G8IB 2ZP0T 3MLUH 1CLOH 1S3KL 1RJLB 2ZSWA 1PKQE 1R3JA 3O4LD 3RVUC 1IT9H 1DFBL 4U4BA 1ZSDA 2Z8WC 5ALBL 5IHUH 3C5ZA 5SX5H 3BIAX 4EIZC 2DAVA 1P4BH 3KPSE 1UT9A 3KS0J 4WJ5B 3MYZA 1QBAA 5EB9A 5IMLA 3BPCA 4JLRB 2C4FT 1NFKA 3ARFA 1K2DA 1NFIA 5DD3L 2X4NB 2ORBH 1QLEL 3BKYL 4U2ZA 5DVKA 3VGAB 3UC0H 2BY1A 3HCVB 2MKWA 5IQ9A 4V1DD 4AL8H 3WLBA 3BX7C 5DJCA 3H3BC 1I7TA 4FZEH 1MJ8H 3QNXB 4RNRB 1GRWA 2HFEB 5F1SA 3QCVH 3VXRD 4YHML 1HINH 2WBJD 4G8GE 1F4WL 3ARXA 3L5HA 2UVEA 4OQTH 5EU5A 3KYAA 3STZA 4DAGL 4G7YH 5IB4B 3DTXA 4YIQA 1BIHA 4XCYA 2FRGP 5B39A 4PJ5E 3RQ3A 3QISA 2XTLA 5D1QA 3MRMB 4NNYB 2P24A 4HIXH 1B88A 5IB5B 3QFJA 4OUUA 3AM8C 2I9TA 4ENED 4BQBA 2N56A 1S7RA 2H32H 5ESVA 1UA6L 1D5MB 3LOWA 1U3HA 3HHRB 2NY5L 5EOTA 1PG7H 2XY2A 1UZ6F 4GKNA 3WFEL 4LLUA 1CK0H 4L4VE 5E5UB 2DB8A 3MRDA 4PFEA 3X11B 1MCPH 3G6JE 4ELKA 4N68A 5I8CB 1HNFA 3RBGA 4DGYH 1FC2D 1ORSA 4NRYB 3TFKD 5TDPA 3MJ9L 2XTJE 4LP5A 1TTUA 4GG8A 4N0UB 4RGOH 1GZQB 5E9DB 4XNQA 5MHSD 5DWUL 1OAKH 3SJVD 3GB7A 1EAPB 2VDNL 1P6FA 1F3RB 1FFQA 35C8H 4OSUH 3QEQB 1ZGLB 1RY7B 1UG9A 4EI5A 3D3VE 3MJ9A 3GZKA 3FT3A 4UUJB 3OKLA 4PLJC 5F6IC 4F8QA 1A4JB 4GBXD 3C5JA 1BHGA 1QACA 4HQQH 3WE6B 3UPAA 3Q1SL 5EBWA 1X5GA 5FKAA 3B9KA 1FLRL 1GL4B 3RU8H 1VCAA 5HGHB 2VB5A 3BJ91 3HI1B 3AMKA 1MIEL 1PX4A 4JPKH 1J8HE 3T1FB 2V7HA 2DQTH 3D0LB 5HHNB 4JDVA 3S7GA 2ILLA 4GRWH 3TGXA 3CD4A 1FO0H 3PL6A 3BQUC 5KANG 5CJQH 3BGFB 4YR6A 1A6PA 2BNRE 4NFDA 5KSUA 5F9WB 2BVOB 3GK8H 1QTYT 2IH1A 4HPYL 4QCIB 2VITB 5KSAD 5F7EH 5GRJH 5EZIL 4M1DL 3DMMA 3GBNL 5F72S 3OG4B 3WBDA 3B43A 3UTPD 4FQIH 2A74A 1NEZA 3LD8B 4LNVA 1ZHKA 4M8QA 5I15L 4QT5A 3QDGE 1FYTE 2C3XA 5BZDB 4Z7VA 4MAYC 1GAFL 1J1OL 4L3CA 5IF0A 1NLDH 4YHPA 5ICYA 3NA9L 2BJML 3OKEB 3SQBA 1I1YA 4JZJC 4OZGB 2DLTA 2JLLA 4Z77B 1A1MA 1E4WL 4P2QE 4WCYH 3NVQA 2JELL 4KI5D 1CU4H 1CGUA 1PW3A 2W9DH 1ZEAH 3OG6B 4LBEA 3LKQA 1KBGL 4NUJA 2OYPA 4R97C 2FWOA 5I8EA 1AO7A 3ALWA 3LKOA 3NTCH 2YK1L 2IADB 2WBKA 3NFPB 4UQ2A 4JFDE 1T21A 2L4OA 4JO2H 4OAWA 2YPKB 4XNXL 1QLFA 4DCQB 3O3UN 4LLYA 5CP3A 3VFUA 5EO0B 2VDMH 3MOBL 1ZLWH 1YN6B 2X4PB 4Q2ZA 5ETUA 2I24N 1OTUC 5IR1A 1R5VA 1TVHB 3FO0H 4Y4KC 1T03L 1RFDH 3IRZA 4K8RD 4OB5H 4OV5A 1SMOA 2P49B 3ZT5A 5IIEA 4FTVD 3PXJA 1T0MB 5EUOA 5D93B 1SM3L 2DTMH 4ONHB 1A6VL 2P8MB 2PO6C 5IFAH 3CMOL 5IBUG 1C5CH 4LLMB 1B0GA 3HTLX 2DQHL 5IBLC 3MBEA 5I6XC 2WK2A 3G5ZA 3MOAH 2ESVE 3GMOA 4MVBC 1A4KA 4LRNH 5IK3B 1BVZA 2IQ9L 5CWSB 3MRLB 1SY6L 4K7PL 1QOKA 3PG2A 4WEBL 2YBRA 4G8EA 5D8JH 2ATKB 2XQYK 4CU6A 2HKFL 1VACB 1MFDH 5D70H 3HI6H 4JKMA 2R29H 5EU7E 4Y16C 5E7BA 1QSEA 4L1DA 1OAUH 2DQGH 3V52H 2D31B 5IBUB 1CLZH 3VWKA 1S5HB 1SY6A 2FB4H 2P5EB 2JB5H 1HXMB 4I9WE 3HAEG 5I30L 4I77H 3BO8A 3W0WB 4GS7C 3U0PB 5HJ3A 2YN3A 3R8BB 1QBMH 3B5HA 3LKNA 1EHLL 5DJ2B 3V9FA 1MRFL 1FGVH 4XH2A 3KGRA 4NRXB 3SDAB 1KN2L 1JPGA 4YXKH 3CFCH 3KXFD 2NYYD 3JV4A 5D7JB 5M7QA 2PF6A 4PJ8C 2FIKA 5LQBL 3HRZB 1LK3L 3BAEL 1HDMB 4NN6B 5L9DH 3MA9L 4LSTH 3WIHH 1RZFH 3I9GH 2HH0H 3HAEB 3W5NA 3BP6A 5EOCL 2BOBB 3IAQA 3W11D 1YEJH 1HXYB 1MJJB 3CPLB 4OZFA 2WWKT 3QUMH 3EYOA 1QBBA 1WBXA 3ZDZF 4FQJL 2NLJB 1ZA6B 1CFNB 3C2SA 5A2LH 3G5XA 5EZLA 2HJKA 2OJZL 5SWQB 2VLKD 2ZG3A 4HBQA 5LJYH 2GT9A 5HHOA 4APQC 5SWZE 3BPNB 3D69A 4XTRD 1PQZA 4Y2OA 1DFBH 1KLUA 1A7PL 2WUBL 1I7UA 4AM0B 3CNKA 2ITCA 3D39D 4JRXB 5F6HI 3G04B 4OZ4B 3DOSA 4JCMA 2DLIA 5F9OH 1FG2A 2VZSA 4WW2F 1G7LA 4BM7A 3CJJA 5I2IA 4QHKJ 1E27B 3BKYH 5HI5D 4C56E 3HG1B 1YDPA 1FNAA 4LVOC 2UY6A 3T4YB 5MP6H 4OCRH 4HAGA 1Z0NA 1A7RL 5CSZA 4K3DL 4NKIL 2BNUB 3D18A 5J9PA 1MNUH 2EKSA 3NN8A 4QHKI 2QQKH 4G42B 3ULUL 5CJXC 2EE2A 1F4WH 5KVDL 5CBEA 2X1OA 4YLQT 2OR8A 4ALAL 3T4AB 5ANMA 1DBJL 4KJQD 4ZG1A 2PTUA 3TJHD 1HQ4A 2Y06H 4X9IA 3C5ZD 4F7EA 3PDOA 3G08B 3HS0B 4ZUWB 1U58A 2FR4A 4YPGA 4YNYA 4UOW0 3UPRA 1WFOA 3UTTE 3ARFD 4L8SC 2E7BA 2BHZA 4XGZA 1CGVA 4GQ9H 1RUQH 3QCTL 2XFXB 2CDGA 5CILH 3ILQC 4M7KH 3VG9C 3GSNA 4QRPA 3WFEH 3VU2A 5GS0L 2X05A 3GNML 3UBXI 3K4ZA 3ARRA 4X6CB 5JO5B 1EO8H 3N1MC 1GIGH 4IIQA 3E6HA 1CL7L 3MO1B 1U8MB 3U4EB 4JFQB 3PWPA 5E7FA 3WLWD 3V5DA 5FM5M 1IC7L 1OWWA 3IJYA 1DBAH 1E4KC 4LP4A 3H8NA 4LFHG 2LTQB 5DURB 5JOPE 3CXDL 5DWUH 4WUKH 2BDNL 2KPNA 1SMAA 1OOAA 3JWDL 5BV7B 5IGXL 5D1QD 3G5YA 3W5MA 3FQNA 1BM3L 3DSNA 3QFJD 2M1KA 1G7MB 3MBXH 1NSNL 4X4MA 3ULSB 3S9DB 4HCRL 2WAHA 2X4TB 1TCRA 3RWJB 1I1AB 2I27N 1TNMA 1NUDA 1CZ8H 5EBMA 1MHEA 5I17B 1KB5B 4Y5YA 2DIAA 3AREC 2AP2A 4R8WL 1LQSR 2FHFA 1C5BL 2FLRT 4LCUA 3OR7B 1MIEH 4G6AD 2DLFH 4HK3N 4R7NB 2AK4B 1A1NA 5DO2C 2XIDA 5ENWA 3EW3B 4WV1C 1A1OA 3REVB 1FL5B 4NHUB 1NCDL 2K7QA 3FB7A 3DIFB 5I76A 3RKDC 1M6OA 1DLFL 4U1JB 4MD5B 5IP4A 3UAJD 3X3FL 1OF2B 2DF3A 4PJEB 3PWVB 1E4XL 4Z7WA 3P4NA 3ZO0A 5E24E 2YR3A 4LQFL 4M5ZL 4HPYH 4XPGL 3U6RA 3T08A 1R3IL 3S37X 1ZANH 2DTSA 1MHCA 2VXUL 3GBNH 2X4UB 4M1DH 4Y5VA 4FS0A 3QG6B 4YFDB 5I15H 1I1FB 4PJIE 4HGKC 5DXWA 3JWDC 4F7PB 1C8PA 1K6QH 5E2TL 4OGZA 1GAFH 1J1OH 5F7FA 3WD5L 2F53E 3O4OB 2EXYC 4QRSA 4AIXA 3NA9H 3PGCB 3ZE2E 5TJWK 3WFBH 4MNQB 5LKNA 4JY4A 3B9KD 1ORQB 3F7QA 3MV9E 3QDJA 5C3LD 1UXWA 2KQNA 2Y36H 3MCG1 4HUVB 4YX2L 4N0FB 1BP3B 1MCJA 4JG0L 3QIWA 3C6LB 3NACH 2X1QA 5F9JA 4UIKL 4PJBA 4F58L 2FJFA 4JVWA 4ZFGH 4PS4L 1YPZB 1QD0A 1WGOA 1KEML 3MRBA 3S4SA 2QQNH 1DDHA 5EBGA 5K9OB 1KIQB 5GGRY 3B2UD 3DMMD 4JM2B 3E1F1 4XAWL 2YD9A 5ADOL 3HFML 2HAZA 5JZ7C 1LE9B 2B5IB 1XGTB 4XMLL 4ZAKB 1KIPB 1ACYL 4RAVB 4XRCA 4B50A 4PGCA 2H3NB 5C0BB 3FRUA 4K71C 5EO1B 3VRJB 1T03H 4KV5E 2AQ2A 2VZUA 1EJOH 3ZYIA 5DRWA 1VA9A 3MRPB 3UTOA 2BHUA 1SM3H 1WWCA 1HOCB 2FIRT 4WJ5A 3TVMC 4JLRA 3VGDA 1KCSH 2NMSA 4FQCL 3MLTA 2NY2C 2DQHH 2DWEA 4KAQL 3CK0L 3W9DA 2CUHA 1WBZB 4UMGA 4TSBL 1GYAA 5DUPL 1JWMA 3NFSH 1MCRA 4K7PH 3G6JF 1KCVL 1UC6A 3HCVA 5D7IE 3R1GL 1B9ZA 5FUCC 4Y4HB 4D0CA 2NXZD 1FCCA 1RSFA 4M61B 1CFVL 2NY1D 2R69L 3MXVH 4DN4H 3HMWL 3QNXA 4P46C 4RNRA 2AK1H 5ELIA 3U0TB 2HFEA 4L4VD 5D2NE 2V2TB 3KJ6H 2OL3B 5GZOC 1FAIH 5DYOB 5I30H 1HYSD 4OM0H 1UH3A 5DMIH 2P8LB 4KZEH 3Q6GL 2WM0A 1EHLH 1KJ2H 1MRFH 1QLRB 4PJXB 2CD0A 5DMYA 1CF8L 4S2SB 1KN2H 2LU3A 3MRMA 4JRYA 4NNYA 3IDMB 2A6KB 4OD1L 2XV6B 1A6UL 3TO4B 3LZFH 3PGDA 3WS6A 2AI0L 3MBED 5LQBH 3T65B 1D5MA 4ODVL 3DUUB 3T0EE 2R2EB 3U9UB 2ZCHL 1AGDA 3CC5A 2XZCH 1MFCH 2COQA 5TFSL 4J2XA 2QKIB 3T1WA 1MJ7L 3X11A 1DSFL 1QSED 3AAZB 5E8EB 5GSVB 5I8CA 4KMTH 4FQJH 2NW3B 1J1XL 2EZ0D 3QRFM 4DGIL 4NRYA 4E5XB 1JGUL 3VWKD 3CLEL 3BIKA 5JIHA 1E4JA 3MZTA 2P46B 4WWKB 5C0EB 1XF4B 1GZQA 1PG7W 5E9DA 3TN0C 1R5IB 1N8ZB 3L3OB 4I4WB 4XP4L 1EAPA 5IFJB 5K9KA 1HH9B 1QZ1A 1A7PH 2DICA 3EFDL 3OXSB 1RPQA 2Y1VA 3QJFB 1FHGA 2BNRD 4GLRH 3QEQA 1NGWB 4MD4B 5ADPH 1ZGLA 1FNGB 1TCMA 1YMME 4ZNCD 3OPZH 1TTFA 4UUJA 3KPPB 2YPLA 3BPLB 3BKJH 4KPHL 5JW4Q 1A4JA 2C3HA 5DHVB 4WI7A 4L8BB 4KXZH 1DUZB 5D96B 1PVHA 3IETB 4IM8A 2PXYC 3ETBF 5HGHA 2FO4A 3HI1A 1L4IA 1BEYL 5KSBE 5KAQF 1JNJA 4GFTB 3SKOB 3CVHH 5ID0B 3D0LA 4NWTH 3T77B 2VN4A 4P2QD 1RK0B 3EZ8A 4RX4A 1DTUA 3ULUH 4D9RE 1JPSL 3F7VA 3H7BB 5KVDH 1Z9LA 4WFGE 4ALAH 3P40A 5GGUB 4NCC2 1CDHA 1BD2E 2BVOA 3DPBA 4CN6A 5J6GA 4QCIA 2VITA 4GRWE 4LLDB 2VLLB 5DDHB 4P3CH 4Y7MA 2B7DT 5EWIL 3UJTH 1XF1A 4ERSL 2A77L 5BZDA 4RMQA 5AZ2L 4GAJH 3IYLW 4MWFB 2VXSL 4KFZC 1X4ZA 2FDBP 3WHE1 3F65A 1TJHH 3P9WB 3OKEA 1QNZH 1AD9B 1T2JA 5IFHH 2Q87A 3UYRH 4JHAH 2Z92B 4Z77A 5GS0H 5CLWA 3WFCL 3I2CL 3T3PE 3AU1B 5AYUL 3TH4T 5IVXB 1LDPL 4P9HL 5IVNA 4ZOCA 5KOVC 4HGMA 1J12A 1AE6L 3L1OL 4KH2A 1IM3B 4M93B 5DVNA 2HJFA 2R0LH 1ZGLP 2IADA 3O9WB 2I26N 3QIUB 4HBCL 4MAUH 2ZUTA 3UPCA 5TE4L 1B6UA 5HYSG 2OR9H 4LCWE 2YPKA 3JWDH 5IGXH 5KVGH 5HGDA 4PRIE 4HWBH 4MA1B 4PB0H 5HDOA 3UO1L 5I75B 1YN6A 2DBLL 2X4PA 1NSNH 2E27L 2DI9A 1A3LL 4HCRH 1TVHA 4ZO9A 4YHYB 1I7ZB 4JKLA 3TJEH 1NC2B 1A7NL 4FN0A 5DRZB 4QRPD 3O6LL 4XVUC 3WKNA 3HC3L 1T0MA 1MLBA 2X4OB 4I9WD 3HZYB 2ICCA 3SEPA 4ONHA 2P8MA 3ZHDA 5HYSB 1C5BH 4HGWA 3LS4H 1VPOL 2IFFL 2AXFB 2ADFL 3PWPD 5F97E 1NCDH 5IK3A 4HX1B 4NKOA 3KNBA 3MRLA 4L4TB 2XT1B 1EH9A 1E4XH 4LQFH 4I3RH 1VACA 3SGJC 4XPGH 2FJHA 2ID5A 4XNMB 1Z5LA 2VXUH 3GUTA 3HNVL 5F7DB 1T89C 2PYEE 4ODHH 4ZQKB 5D5MB 2D31A 5JDSB 4K7PY 2BRRL 4YK4C 3ABZA 3EO0B 1S8DB 4U31A 1S5HA 2ENYA 1HXMA 9CGTA 1JZ6A 2FO1A 5JW4N 1UWXK 4N5EC 5TF1L 1T6VN 3W0WA 1H5BC 3U0PA 3OTTA 1FZKB 1MWAA 2IQAB 3AGVA 3H3PL 5DJ2A 2CKBB 2APBA 5HD8C 1TIUA 2XKNA 2IGFL 1NAKL 1CLYL 3QQ4A 2UY7A 3DRQA 4NRXA 5F1OB 3SDAA 4LSSL 4X7EC 4X7DC 1DQLH 4JKWA 5FV1L 5D7JA 3GIVB 1F8TL 1U2CA 2BP3A 1P6AB 4KK6C 3DYPA 1J05B 3HRZA 1HDMA 5IW1B 3OR6B 1Q8MA 2H8PB 4EQ3A 5JPMB 3ULVD 4UIKH 1P1ZB 3U36B 4BELD 1QPPA 4XXCC 1SEQH 3E8UL 5FGRA 1CGTA 3HAEA 3ROOA 5IM7A 3KYKL 3P4MB 2BOBA 4NZTL 5DSCB 1FNSL 1Z3GL 1M4KA 3CPLA 3P9LB 1IGCL 3C60A 1UZ8A 4JQXA 4CW1B 5ADOH 4UILL 1U3JA 3NA4A 1ZA6A 1CFNA 1OSZA 5CHNA 3TPUB 1EIBA 2GW5A 1ACYH 4DEPC 1Y6NR 3WL9A 1NANI 1CLCA 5ICXB 5DGRA 2XG5A 2VIRB 4XX1E 3VXMB 5EFIB 1RD6A 1MI5B 12E8H 3QDJD 1I8MA 3NOIA 4AM0A 2EEDA 2D7TL 1AGFB 5A3ID 4G6KH 1L9MA 4X9FA 4KY1H 5KW9L 4JRXA 3QIWD 3G04A 2PTVA 3MC0A 4OZ4A 3D6GA 2D2OA 4P2OC 4EUPG 4AK1A 1OP3K 3CK0H 2J7LA 3JV6B 3CXHJ 2W9LA 1HE7A 2O5YH 3UTTD 1E27A 3VFPB 2UYLB 3HG1A 4LHUG 3MNZA 2AJVH 2MOVA 4KDTA 2XWJB 3T4YA 5AWNL 4NRZB 3LN4A 5DK3A 3Q5YA 4WI2A 2CH8A 4H0HB 2QQLL 4Y4FC 1W8OA 2EC8A 4PJGA 2GJZA 3FHQA 5T1KB 1OM3H 4EXPX 4IMKA 1BWMA 2R9HC 1XGUA 1OY3B 4AEHL 4EUPB 3T4AA 1DL7L 2B2XH 2PTTB 4P3DB 4QRTB 5DJYB 4ZNEA 3P11L 1NPUA 1QFOA 4JN1L 4OZIE 3G08A 1XGYL 4ZUWA 3IGAB 3SPVA 1R24A 2G60H 1KACB 4XPAH 3BFOA 5HHQA 3QI9C 3LDBC 1IEHA 5T1DH 5I73B 2Q86B 2XFXA 4N0YL 1G0DA 6FABL 3MTRA 5I71C 2NY0D 4HKBB 2ZCHH 4V2BA 4OLEA 4X6CA 4J6RH 2V17H 2QSVA 4GRLB 1RV6X 4YGAB 1MJ7H 4DQOL 5BV7L 1DSFH 3U4EA 4FQXC 4JFQA 4ELMB 3E3QC 3PABA 4MA3B 4F37F 4YO0A 1MHPH 3OX8A 3OF6A 1SJHB 2O26U 3U79A 4U7MA 3L5WB 4J7RA 4YHIB 4PJIF 4XP4H 5DVOA 3KLHD 1ZLVK 1CE6B 2VAAA 1KB5L 3I85A 3I02B 5EO9B 2NY2B 4JRYD 2BXYA 4F9PC 2KKQA 3ZE2F 1G7MA 3DO3A 2CJUH 3O6FB 2X4TA 1OTSD 3HNTL 1KTLB 5FGCB 1KN4H 3HR5B 2BX5A 4RIRB 5I17A 3FOLA 1KB5A 4P2RE 5I1HL 5DQJB 5JHDE 3NBNA 4XVTH 3TC9A 5GRZA 1BEYH 1VGKB 3OR7A 4R7NA 3MCLH 2AK4A 1XIWC 3D0VB 1HKLH 1PJ9A 3MV9D 1FL5A 4W4OC 3ZE0E 4NHUA 1T2QH 2KH2B 3DIFA 1G7PA 1XCTB 4MD5A 1P53A 3G6AA 1I9IL 1OF2A 3S6CA 2P5WB 3BW9B 1XGQA 4O9HH 5E9DD 4C58B 4PJEA 3PWVA 2VLJE 3QYCA 4XVJH 1FE8L 4ZTPH 4UOW1 5BCAA 3QEQD 3CFBB 5IESL 3WDJA 3QG6A 4KV5F 4AZ8A 1I1FA 2GQHA 2J8UE 2HJLB 2Y9RT 3O0RL 5FDYA 3VMOA 4MCYA 1FNLA 4F7PA 5A16A 2YPLD 4UQ3B 5T1MB 4NO5A 1A47A 2VXSH 2X4SB 3TYGH 1U3YA 4Z0XB 3CAFA 3PGCA 1OAXL 4MNQA 4GT7A 1FVCB 1LEGB 2EDDA 3QRGH 1ORQA 2W0FB 4X5WB 5C6TH 4HUVA 5KS9B 3I2CH 4ZD3L 2BVPA 4Z0BL 2ERJB 4P9HH 1SYSA 3C6LA 1AO7E 4HH9B 5GGVH 1AE6H 2O5XH 4NPYB 2EICA 4RWYH 1I3VA 4RX4D 1CXIA 1TZGL 3QDMB 5EA0H 5D7IF 5I16B 4GMTL 4WFHD 4MNGE 3RVVD 2X4QB 2X09A 5HHVH 4HBCH 1YPZA 5EH1A 4AIZA 1R3HA 4RFOH 5D1ZD 4J1UA 1RZ8B 3JSSA 5TE4H 1H0DB 1H3VA 3DSFL 5K9OA 3K4AA 4XWGL 3T2OA 4WI3A 4DFHA 2BNQA 4ONGL 1LE9A 4KQ3L 3VFWB 1XGTA 4UNVA 1DR9A 3HN3A 4ZAKA 1INQA 3VWJB 2GYSA 2DBLH 1KIPA 4M1CC 4RAVA 3FFCE 3HLAB 2H3NA 3VRJA 5EO1A 1HHJB 1IGML 2F74B 1LO4L 3TCLB 5EUOE 4ZS7L 4U1MB 3D25A 3O6LH 4KKCD 1UJTA 3CLFL 3HC3H 4WUUD 2NX5E 3BEVB 5E8OB 1AQKL 4BH8A 4KMLB 5DTFB 1HOCA 4IJ3C 2MQCA 4UNTA 4OCYL 2W1NA 4JFHD 4WTXA 1Q1JL 2ADFH 4HKXB 1KGCE 1WIUA 3VG0L 3A67H 1WBZA 4WO4D 2OL3L 3ZTJH 1A3QA 3S35X 1MFEH 1T7YA 1MPAH 4I13B 3GSRB 1OP9A 4YQXH 5IB3B 3QXAB 2NY3C 3ZKXB 1L7IL 3ZE1E 1EXUB 1Z6JT 4Y4HA 4M61A 2AJXL 1P2CA 3IAPA 4G9FB 1IAIM 3EO1A 2DI7A 1G9NC 4XAKE 1UWXH 3RWIB 5E2WL 3U0TA 4KKBC 1CT8B 5ESQA 5DF0A 2V2TA 4PTUB 1D9KB 4ODWB 1A22B 2OL3A 4JZJA 1AFVH 4NYLB 4LOUC 3WEXB 5BRZB 5DYOA 2OQJB 2R2BB 4N5UA 1M7IB 2VDKH 4MGXA 4XVSH 3WNPA 1NKRA 2H2PC 3OB0K 4ZFFB 3Q2CA 1EPFA 3D48R 1QLRA 1GGIH 1KEGH 2IGFH 1NAKH 4DKAA 1CLYH 3MUJA 3VFGL 4U3CA 4S2SA 2FATL 4POUB 4LSSH 5DD0L 1ZAGA 3IDMA 2A6KA 3GHBL 4LMQE 1ND0B 1YQ2A 5DLML 1QFHA 3P2TA 4PYHA 4IRSD 1ERNA 3NMEA 3G9AB 2H6PB 4YE4L 3ZL4H 4KGJA 5KSBF 4LPXA 3U9UA 3TBWB 2NY4B 3KYKH 3PGFL 1FNSH 3NCMA 4MXQC 4XPFH 5BMFL 1M71A 4I5BB 1IGCH 3OAZK 3AAZA 5E8EA 5GSVA 2JE8A 3E2HB 1KFAH 4ZYKB 4UTBL 4UT9L 4XNYL 1IJ9A 4E5XA 1X5HA 3P9MA 1T0NB 3WUWG 3HB3D 4GRWF 2HTLD 4S10A 4WWKA 1YZZA 2ZOLA 5C0EA 1XF4A 1F11B 4H1LA 1R5IA 1N8ZA 1WWBX 3L3OA 3CMGA 2PO6A 4I4WA 3RIAF 1AGCB 2ZUQC 1HH9A 3FCTB 1LDSA 1EHXA 3SDAD 2HT2D 5KG9B 3OXSA 1KTDB 3RY5A 2D7TH 1OP3H 1NGWA 4MD4A 5D7JD 5KW9H 4OIIL 3BZEA 2GK2A 3UDWC 4OGYL 4R96B 3KPPA 1WT5C 5T3XL 4M6OL 4CADB 3IFOA 3BZFB 1KIUA 3WUWB 4L8BA 5CEZL 4G5ZL 1DUZA 5IVZB 3IETA 4P59L 3ZDYE 1CCZA 1JHKH 1E6OH 3OKDB 3C60D 2PNDA 3FO2B 4HF5L 2J12B 4TTGA 4PB9L 4V2CB 5ID0A 3D9AL 2YZ1A 1WC7B 3RFZC 1RK0A 4F7CB 2C9AA 1V05A 4ZFOB 2Y6SD 3K0WA 4WNQB 1CDBA 3H7BA 1SJEB 4NUGL 1QRNE 4TTDC 2HRPH 1NC4B 1FBIL 3SDXE 3RWFA 2BXZA 4J4PC 4LLDA 2VLLA 4PPTA 4JN1H 5DDHA 2R4RH 4R26H 2D7OA 3RVXD 2YC1B 4U6XB 1XGYH 3ULUE 4JRXD 1V8HA 2UZXB 1YC7A 1JGEB 4PGBB 5FYLD 4D0BB 1AC0A 4P5TC 4XBGB 1YEDA 3FZUD 5D7KD 3DHJA 4JFFE 4ZOEA 1UJ3C 4MWFA 2FX7H 4ORGB 3DXAB 4FZ8L 3BSZL 1WAAA 1AD9A 4KROC 1GGCL 4G80B 3HG1D 3WFDL 3C08L 1W72B 5E6ZA 5AG9A 1YUHB 1RULL 3TT3L 1TJGH 3AU1A 5IVXA 2I9LB 2IPUG 3RTQB 3SDDC 1YEIL 4U6VH 3L3IB 1NBYB 1L0XA 4FG6D 4HULB 2IWGA 1CL7I 4GW1B 5B8CB 2AERT 3O9WA 3QIUA 1N3NB 2HMID 4JR9H 1Q9OB 4RGNC 1X5FA 4ZUSB 1JYVA 1WCBA 3N50A 5IJVB 1ZGLM 3IF1B 5GGVY 5DJAA 2E7LC 5D1XB 3UMTA 1CGSL 3UZEA 3MUZ1 2CRIA 4X4ME 5GISH 2VN7A 3LHPL 3WNLA 5KVEH 2OLDA 1JNHB 1JV5A 3VXNB 1N6VA 4PLKC 1NC2A 5SX4I 4A2LA 3QAZC 5DRZA 5F89A 2X41A 2J4WH 2X4OA 3WUZA 3HZYA 3NPSC 3MGTB 5HYSA 1MFAL 3AVEA 3BXNB 2WWMC 3OXRB 3SCMC 2PR4L 4RBPK 2DYPB 4K3JL 1UWEL 4HDIB 4POZD 5FIEA 3OF6D 2V9RA 1I9IH 4L4TA 5CJ5A 2R1WB 3JUYA 5C0AA 3EYFB 3RDTB 3RKPA 1FE8H 2CKBL 4L8SA 4XNMA 1IAII 1MFBL 4H0IA 4QGTA 5FOBB 5JUEH 4LCCC 5F7DA 1FORH 3BUTA 4KK8C 4MYWB 4ZQKA 5IESH 5D5MA 5JDSA 5DHYB 1S8DA 2IC2A 3BP4B 3MRHB 4OD2A 1GGTA 3FAWA 1J9CT 1OQXA 4Q9RH 4HS8L 4PREB 3C9NB 3QWOB 4KC3B 4WFFE 3TF7C 1FZKA 3HKFA 4H8WC 4XT1C 3H9HB 4OI9A 2IQAA 4LFHD 5MENE 2IANB 3BHBA 5C0JB 2LFGA 5C07E 5C7XL 4ZD3H 2AK4D 3DUSB 1YY8B 4Z0BH 1YEFL 5I1EL 3CZFB 1BF8A 3TWCL 4NT6B 4FQ2L 3OR6A 2H8PA 4KUCF 1TZGH 3QUZC 5JPMA 3NZHL 1P1ZA 4GMTH 3RJDA 3U36A 1CDIA 1I8LC 5CCKL 1B6DA 3P4MA 2AVGA 5K93A 1PZUB 4I3GA 1G9NH 4Y88A 4KKLD 4L5FH 4PRPE 1P4LB 3P9LA 4XWGH 3S5LG 2R8SH 2AABH 4LU5H 4ONGH 4KQ3H 2A83B 3TPUA 3DETD 4ZPTA 3CSYA 3GIZL 4OZIF 4BQ9A 5E6YA 3AREA 3WN5C 5ICXA 3JTSB 2CDFB 4MNQD 3VXMA 4WHYG 1IAOA 5EFIA 5BJTB 1MI5A 4Y2DC 1ZT4B 1MUJB 1J0ZA 4ZTOL 4M7JL 3DX9B 2CXGA 1BZQK 1I8KA 2K1MA 1AQKH 1N64L 2JJTA 2YKLL 4FQLH 5CIPB 5F96L 5GGTL 3C6LD 1NJ9A 3S5LB 4BZ1H 5D71H 2XI9A 4HC1H 2NY6B 4NZJA 3VG0H 3JV6A 2J5LB 1B3JA 3RIFK 3VFPA 4MMXC 4LSQL 3WSQL 4MJIE 5E99L 2JCCB 2LABA 3FO1A 1KYOJ 4NRZA 3S34H 2JJVA 1A3RL 1IEBB 2AJXH 2R1YA 2EYTB 3FOMB 3AS1A 5GGTA 1GPOL 4PLJD 2BNQD 4HT1L 1EEZB 4I2XE 4NQCE 3P0YL 4H25A 4ZAKD 2FZ3B 1P84J 3QIBC 3OB0H 3S36H 1K8IB 1VGEL 4KU1A 1Y0LB 4G6ML 4U1HB 3RWEA 1R3KB 4EUPA 4FMFA 1JCKA 1MCOL 2CGRL 2PTTA 5DJYA 4QRTA 2EDTA 5BS0B 3QA3B 3AMLA 4LHUA 4TULH 3IGAA 5FECB 3U1SL 2QADC 4H0GA 2ZUXA 1NCCH 5DLMH 1BBDL 2MNUA 4F2MB 4YE4H 3SGDI 3F12B 3L5IA 3BDYL 1BQUA 1PY4A 4HKBA 4X6DB 5EOQL 4Y4HD 3PGFH 1F4AA 3ZE0F 3PJSB 4E0RB 4PGDB 1MJUH 4MAYD 5BMFH 4NHCH 4GRLA 2CR6A 3VI3E 4MJ6B 2DIBA 3TIEB 1BQSA 4UT9H 4XNYH 3SGEI 4HJJH 4MA3A 4N0UE 3VXUE 2G2RB 4P4KB 3MUY1 1SJHA 3CFEB 4IHOB 3L5WA 4OLVL 5DHVH 5DVMA 3ISWA 4YHIA 2J8UF 3C09C 3I02A 3S37H 4KVCL 2UUDK 5C08A 3Q3GB 5HDBE 3IU4L 4OIIH 1K4CB 3KPMB 4ETQB 2H2SD 2W59A 4F57L 2AEIT 1KTLA 2DLEA 1OTTC 3FRPG 3HR5A 5E70A 4Q0XL 4YXLH 3TO2B 5DUBB 1BVLB 4G5ZH 3O2VH 4RIRA 3U4AA 3LS5L 4Y8AA 5LCVH 2CIKB 4U6HA 4URTB 2UZIL 5DQJA 5T33H 1VGKA 1UM6H 5HI3C 1OTUD 3N1QC 2DS4A 3FQUB 2R1XB 3D0VA 4WFEE 2Q7NA 3QHFL 3ZSTA 1CD9B 3WNMA 4DW2L 1BZ7A 3FAXA 1XCTA 1BZ9B 1PG7X 1QSVA 2Q7YB 5DHXB 4BFEA 2P5WA 3MLSL 2FBJH 3R06B 3I6LE 1AP2B 2PO6D 4LDEB 1ONQB 3MLRH 4MNHB 4BQCA 4OTXH 2FGWH 2EC9U 1NUNB 4PJFA 1IC4L 2HJLA 5KANI 5L8LB 1AQDB 1YEKH 2VXTL 4UQ3A 4HWEL 1T1YB 4OZGE 4MLIA 1JF6A 4Z0XA 3OGCB 4FZ8H 1F4HA 3MACL 3VFVB 3OGOE 4QRUB 1GGCH 1RZJL 3QNZB 1IRAY 2DBJA 3WFDH 3ELAT 4OZHB 1IC5L 2W0FA 3BKMH 5FGBA 4X5WA 2H9GA 4ZO6A 1RULH 3UTSB 5KS9A 3G9VA 3VFTB 2GAZB 5HYJD 4HH9A 4ZOAA 3O8XB 2GSIB 4M6AA 4NPYA 2MQ0A 5T3XD 3QDMA 3V8OA 1ZMYA 5I16A 1Q9LB 3ZE1F 3ZKQD 5CEZD 2EDEA 1T7WA 2X4QA 1S5IH 2EEBA 3G6DL 4DZBB 1RZ8A 2P7TA 5T1LA 3O4LB 4HHAB 1KGCD 1NMBL 4PRHD 1D6EA 1EO5A 1ADQL 1YEGL 4F9LA 3HPJA 3N0PB 1A7QH 5GZNC 1X4XA 3VFWA 4WI8A 2YD8A 2G75B 3VWJA 4Z7QE 4A6YA 5BW7A 3HLAA 4H8WH 1EVUA 4YHKL 4OLXH 4XC3L 1TQCB 5GS1B 3NCJH 2F74A 3TCLA 4M1GL 1KULA 1JPTL 3L9RB 5C0RH 1KCUL 2YHGA 1HWHB 1ADQA 1V7MH 4RBPH 4XXDB 1LHZA 3EAKA 5CUSH 1LO3L 3BEVA 1IL1A 1G7QA 3NCCB 2Z4QB 1MFAH 2VC2H 4M6ML 5BZWA 3NAAH 5GRXG 4NNPH 4APQD 4RRPG 4HKXA 4P23C 4OF0A 2DQFB 5DT1L 5LGHH 3O9WD 3QIUD 4X7TB 1CR9H 4EN3C 5DC4B 2E6QA 3GSRA 5E4EB 2L7JA 1EXUA 3P73A 2XQBH 3D5OF 1X44A 2CKBH 4G9FA 5MERB 1IZJA 3HE6B 2R0ZH 1QFUH 3RWIA 2P5EE 1CT8A 1DEEB 4TQEH 1RUKH 4PTUA 4ODWA 5J8OA 4NYLA 2P4AB 3WEXA 3U4BL 2R2BA 4QHUB 2CK0H 1NC2D 4YDLB 4XP5H 3CDGB 5H8DA 2C5DC 2AV1B 4HV8B 1WQVT 3TBYB 4OF5A 5D6CA 2ATPB 4NQTA 3V0VB 4EBQH 3EDKA 1ND0A 3GMLB 5HTSA 1YEFH 4QLRA 4KGLA 3TWCH 5AZEH 4LSUL 2H6PA 3F58L 3ZDYF 4P4RB 3NZHH 4L4TD 1MY5A 4O58H 4GSDL 5CCKH 3HNSL 5EPMB 5C0AD 5IEKB 4M3KB 4EOWH 8FABB 6CGTA 4QKXB 4I5BA 1QHPA 4ZYKA 3SKMB 4RFNC 1KJ3L 2EYRB 5IKCB 2Z9TA 3MRQB 1T0NA 3SDXF 1U41A 1CXEA 5K9JH 3MODH 3ULUF 2VABB 1F11A 4KK5D 3EBAA 3U46A 5A40E 3KPNA 5C2BH 1Z0MA 3H9SE 3FCTA 4ZTOH 4M7JH 1KTDA 1P7KA 3BN9C 3VMNA 1VFMA 5CD3A 3CFKA 4W4NA 1CE1H 2YKLH 2ARJQ 5DD6B 2VO5A 4R96A 4LGRB 5C92A 3ILPB 3WJLA 5CD5C 2X89A 5F7YC 4CADA 3BZFA 3WUWA 4ZFOL 4M4PA 4WU5B 5IVZA 4LIQL 4RA3A 4UV7L 4NFBA 4QTHA 4GAYA 4OGAD 2MPAL 1F58L 3FO2A 3V6FB 5DMJB 4I0PC 4MA7L 4JY6B 4TVPL 5C0GA 3L7FA 3MV8B 1HHHA 3O2DL 4FFVC 1WC7A 1M7DA 1AKJD 1YNLH 1H8OA 4KJPC 4LSPL 4CRPA 4F7CA 1H5BA 4TSAL 4ZFOA 2D0GA 1JN6A 4HLZH 1S9WB 4BFIB 3SHSA 4ZNEE 3ARED 1SJEA 5EUKB 2HYMA 1MCOH 1NC4A 1MI5D 2EECA 2E8ZA 3ZTNL 1W72L 4JPVH 2YC1A 4U1LB 3O2DA 4ODUB 5JXEC 4PGBA 3ZDXF 5HVWA 4NP4L 2OTWB 2XTJC 1ZVSA 1BBDH 3C2AH 1KG0B 4ORGA 3DXAA 2VZTA 1F6AA 2PW1B 4X80L 5ID1B 4OM1L 1FDLL 4NZUL 4G80A 2A9NL 1RU9H 5FHBL 2HG5B 2EH8L 1W72A 2VXVL 4PR5A 1GC1L 4L9LB 4JKPL 3BRDA 5DZOA 3IT8D 4CVWA 5HYFA 1DP0A 1MVUA 2I9LA 2Y07H 1EUUA 5FDWB 1MCDA 3B8YA 3RTQA 2KDGA 4XP6L 4J8RA 5IB2A 1U8OB 2WINB 1HI6B 3L3IA 4NKMA 3RA7L 2EXYD 3X17A 4LVEA 1YY9D 1G6VK 1B2WH 4GW1A 4LEXL 1JF1B 3RL2B 1DQJB 5B8CA 1N3NA 2CLRA 2OX5A 4OFYA 1VFUA 1Q9OA 1RUPL 1ES0A 3SKUD 5KZCD 2CO6B 1QYGL 2UUDH 2ZUUA 3ARSA 5IROC 4LHUD 5D1XA 4H20L 5I0DA 4IEFB 4LPVA 2CRMA 4KVCH 3VGHA 2YD6A 4Y1AB 1JNHA 3OJMB 4YWGH 3VXNA 4KJWC 2GJJA 1XGPB 1NAMH 3QUXC 3RX8A 3AY4A 2BSED 1TPXB 4Q0XH 1BMGA 4IRJC 4LVHC 1A7OL 3BPOC 2AJ3B 1B90A 5C9KA 1ETZA 4ZS6C 4XMKL 1FH5L 4E9LA 3LKRB 3MGTA 3QIBB 1LD9B 3KJ4B 5HYIA 1A14L 1DBMH 3BXNA 3OXRA 2DYPA 3ME0A 4JHZA 4PGEB 4HDIA 3RZCC 4Q6YA 4XWOC 2FLBT 1G1CA 2R1WA 3BWUC 4KWUA 2EE6A 3CFDB 4KTEL 2XWBA 4RISH 4FA8A 5E8DL 2IF7A 4M5YH 3RDTA 3T2PA 4FQQA 3VGGA 5JW5B 2NY2D 4FFZH 3MCKB 4KKAC 3WFHB 4P9ML 5DJDB 5FOBA 5C08D 3CFJB 1NL0L 3WO3B 1W0WB 1A0QL 2NY7H 3KXFB 5FYKL 1WTLA 1H3XA 3BP4A 3MRHA 4HWEH 1UM4H 4QHLB 3GBMH 3BKCL 4M7LT 3UJIL 4DGVL 1ZA3B 4PREA 1DCLA 4UT6L 3LEXB 3SDYH 3EDFA 5I1DB 4OV6F 4P46D 4RAUB 2IANA 5C0JA 2AJSL 1LO5B 3L3JB 1YY8A 4TPRL 3CZFA 4NZRL 2QSQA 5TE6L 5EU6E 3S3PA 4CBPA 1KXQE 3OAUL 3KWWA 1EGJL 4WY7H 3GRWA 2P5WD 4YH6A 5T3ZH 4JDTL 1JJUA 1VSCA 3OKKB 3ZKNC 2EXWC 5C09E 3QG7L 3MPCA 5C0CE 5E2VL 1U8PB 1YN7B 3SBWC 2V5YA 1YEGH 3D39B 1Z9SA 4PV9B 2X7LB 4EDXB 4Y0GA 5C0BE 2A83A 5GS2D 1ZLSL 3H6JA 2ADJB 4HG4J 4XC3H 4HUWB 3VXOA 4M1GH 4GG6F 1JPTH 1KCUH 4FABL 5BJTA 4K94L 1ZT4A 1MUJA 1U6AH 1FVEA 3DX9A 1JHTB 3OJ2C 2XA8L 1JWUB 3TH2T 5I74C 5CIPA 3BZ4B 3QCUH 4XP1H 1N0LA 3S5LA 4YDKL 1QBLH 2A9MH 2GHWB 2GTWA 4R90L 4WW2B 5DT1H 4JJ5B 4JHBA 3BRFA 5C0ND 1PDKA 3S98A 1JGVH 3PDGA 2BHYA 1T83A 1NQBA 5T1LD 1R3JB 2JCCA 1BX2A 4JREB 4Z7UA 4D9QD 1IEBA 3FOMA 4HD9A 2EYTA 1FAKT 3UJJL 5JOEA 2XXMB 3TZVB 5TQ2L 1EEZA 3D2UB 1DBKH 3VWJD 4JE4B 3BPCB 3SDCC 3KS0H 1K8IA 3ARFB 4Y19B 1K2DB 1QKZL 1OB1B 1Y0LA 4U1HA 1UCBL 2PXYD 1JYXA 4LK4A 2DDQH 3TIDB 5HY9B 5I8OH 5BS0A 3IXTA 3QA3A 1GVIA 4PJXE 4XBEH 5HDBF 3CVIL 1LK2B 3JWOC 4JY5L 4PJ7E 5FECA 1MAML 5DJCB 1A6ZB 1H3PL 4RMVA 3MFFB 5E0QA 3T0XA 1KB9K 4PBVC 4WI5A 3F12A 3EO9L 4JEGB 1I3UA 3OJVC 2NTSP 3O2WH 4N0CC 4X6DA 2X1PA 4LVNC 4X6FA 4XPBL 3LPFA 1PEWA 5EC2B 3VD4A 3PJSA 4NQSB 4YIQB 2BVUA 4E0RA 4PGDA 4UINH 3MXWL 3MMEB 5F7HA 5D1QB 2P24B 5JTWA 2I9TB 2F58L 1QFWL 3RX7A 2G2RA 5HVFB 3GJEB 3CFEA 2AGJL 5ESVB 4IHOA 4WFED 4K7PX 4F7MB 1IGIL 5GGSY 1URLA 4GKNB 4QF1B 4OF3A 3HUJA 1SJVA 1CICB 5ACLA 5ICZB 1RK1B 1HK6A 3FB8B 2J8OA 4OZGF 3MRDB 4I48B 4UU9B 3ALPA 1K4CA 2FEDC 4ETQA 1KPVB 4NKDB 1ORSB 3S96B 3ZSSA 1J10A 2PKDA 3VFMB 3F7RA 1RURL 3FO9B 5GHWL 4NQDB 2NY4D 4GG8B 5EZJB 5FYJH 5B3JE 3U7YL 2CLZA 2RQ8A 4ZSOA 1U0QA 2BSTA 5I9QC 3T0VA 3FQUA 2FH8A 2R1XA 4MA7H 1KCLA 4Z18A 1LEKB 4RMTA 4NM4L 4ZXBC 1QSFE 4LAQL 4XVUD 1CTNA 4TSAH 2Z93A 7CGTA 1HCVA 3RUGA 1ZHNB 1BZ9A 2I07A 3BVNB 2OP4L 4NN7C 5E6IB 3R06A 3WDHA 4HS6B 3FRPA 3DNKA 4YHZL 1AP2A 1ONQA 3KPRE 3PUCA 4JFZL 1IILE 4YC2B 4GW4B 4R2GC 4Z7QF 3B9KB 3DLQR 3ZTNH 2VLRE 4QRRA 1MRDL 3GM8A 5KVFL 1NEZG 3K74B 5GSRA 3SE9L 2QBWA 4DN3L 1PKQB 3TNMB 5CGYC 4FQ1H 4NP4H 1AQDA 2W07A 1GOGA 3QEGL 3QPQC 3VD5A 4AH2B 1T1YA 5I1IL 2X89D 1X4YA 1JZ2A 4GMSL 4QHNB 3KPSB 4JO1L 3L3GB 1OT1A 3OGCA 4X80H 1EBAA 5HHPA 4Z8FL 3VFVA 1FDLH 4NZUH 1OGAA 15C8H 1N7ML 2A9NH 3ARBB 4UB0H 1S9XB 1RZ7H 2EH8H 4PJDF 4WIQA 4OZHA 4F3FB 2UWEE 4WU7A 3UTSA 4I18C 1U8QB 3VFTA 2GAZA 2A74B 2XRAH 1HILA 1NEZB 2MKLC 3O8XA 5DZLA 3X3GH 4MJ5A 4N5ED 1CFSA 3RA7H 2ADIB 5DFVC 1CS6A 4S0TD 4Z7VB 1Q9LA 4LEXH 5HD8D 3MRKA 4MLSA 4L3CB 2VJXA 3EKCA 4OCWL 1RUPH 4DZBA 1NC4D 3L5XH 3O4LA 4HHAA 4U49A 3U30B 2I25N 2F54A 2YWZA 3QXUA 5TQ0L 1F4XL 3CUPB 4TVPD 1YQVH 1A6TB 5CINH 4L4JA 1UB6A 5E00A 5D72H 2G75A 1IKFL 3UXFA 1CD0A 2ZG1A 1GOFA 2JJUA 2FWOB 4UTAH 5I8EB 3DXAD 4PJ5B 3BGMB 3DX7B 4BJLA 5GS1A 4LPYA 2AJZA 3IDNA 3L9RA 5J13C 1A7OH 4XXDA 5L0QB 1INEL 1T21B 3MOQA 1WV7T 5HHXH 3QFDB 2AJUH 3WV0A 1N5YH 2MCPH 3WIIL 4LLYB 4LKCB 5DD5H 5D7SL 1U8LB 4L4VB 4P49A 2DQFA 5ETUB 2X5PA 3BT2H 4X7TA 4OFYD 1XFPA 3PE9A 1G9EA 1SBBA 1RMFH 2WBWB 2DQCL 4QXWA 1XAUA 1S9VB 5E8DH 5HI4C 5D1XD 4M7LL 2A0LC 4JJHA 2XYCA 3OMZA 2YD5A 1S7XB 3HE6A 4ZUVB 1YJDC 1UJ3A 3LQAC 2ZJSH 4OLWL 4HIEA 4C59B 3P0VL 1A0QH 1DEEA 1EHNA 4OBRA 4CMHC 2DL2A 4RRPA 1FNFA 4QHUA 2VQUA 3CDYA 3BKCH 4G7VH 3UJIH 1YYLH 5ACMA 5L88H 3CDGA 3LPWA 5T5FL 1A64A 4GAFB 4HV8A 4LARH 4UT6H 5EORL 3TBYA 3SDDA 3WS3B 1KPRB 2LU4A 4Q7DA 2WBJC 1EK3A 3X12B 3GMLA 2J6EA 2R9HD 4JO4H 2EKJA 2NXYB 1N59B 1K8DB 4PBXA 4NZRH 5TE6H 1Y6KR 4DVRL 2ZCLL 4P4RA 3OAUH 5FHAL 1EGJH 2ZCKH 3CGTA 4JM4L 3BO8B 5IEKA 1PX3A 2DQEH 3RDTD 8FABA 3I50L 4MDIB 1C08A 3QG7H 2Z31C 3CH1B 3EDJA 5EZOL 1CQYA 2IAMB 5E2VH 1OP5K 5F1KC 1E6JL 3B8SA 4KRNA 2BNRB 3SKMA 5IKCA 5KBNC 1N4XL 2FIKB 3MRQA 1CDGA 4OCSH 2IBGA 3JBG7 3VXME 2VQ1B 3JWOH 2VABA 1MFNA 5D7LA 2F5BL 4G6JL 3MLWH 3QDGB 1FYTB 3QUKB 3BP6B 5IT2L 5KAQG 4HAFA 2W9EH 2IAND 3RHWK 4K94H 3WNNA 1AC6A 3TFKC 3HE7C 5DUML 1T7ZA 5FGSA 3GSOB 1PSKH 5FYKD 3V6OC 2EDRA 5DD6A 1WWAX 4IDLA 4YDKH 1GCFA 5J11C 3ILPA 1XR8B 4P2QB 3SE8L 4DKEL 1D6VL 3NABL 4PJHF 2GT9B 1F42A 2XZAL 4LSRL 5DC9B 5GPRA 4RSVA 4MQ7A 1PQZB 5CKAA 4XPHL 3V6FA 4JY6A 4Z7NE 4GBXC 5TQ2H 3MV8A 4JFDB 5IQ7L 5E1AB 4KVNL 1KIRB 3T0EC 4XNUL 1OARL 4OT1H 4BFIA 2KBGA 2ED9A 1NCBL 1UCBH 2OS7A 2MJWA 3VXTB 3SOBH 4M9OA 4U1IB 2YEZB 4S1RL 4JY5H 1PGRB 4R6UA 1WFUA 3TV3L 2DD8L 4HEPG 4N9GB 2MSPA 4ODUA 3GMNB 3ARPA 4JQVC 1I8LA 2OTWA 3NN8B 2EKSB 4ODTH 1LO2L 2D7PA 3JVGC 5KSAC 2PW1A 5J3HC 3MV7D 4WI6A 3ZYOA 1I85A 2HG5A 5DRNB 4Y5XB 5CEYB 3OKYA 4K8RL 4KHTH 1YECL 5J56B 1U8KB 4NC1C 2ESVB 5FDWA 1JYWA 4ELME 2FR4B 1U8OA 4YBLB 2LVEA 2WINA 2WLZA 5TDNB 2R0KL 3N9GH 2HT4D 4UDTB 4XGZB 3RL2A 1DQJA 4Y2DA 3WJJA 3WIFB 2VL5B 1IFHL 2H1PL 4R0LC 2CDGB 5BS0D 3HI5L 1IGIH 3A6CH 2X2YA 3C6SB 4YHOH 3EOTH 3O41A 4UBDD 3IDXL 5GJSH 3E6HB 5DEGB 1F6FB 3GKWH 3TA3B 2Q1EA 4Y1AA 5FGCE 3FTGB 4OJFH 1S7QB 1YYML 4XCCL 1CXHA 2Z91A 3PWPB 4AG4H 5TPWL 4MB3A 2ZOKB 2CLVB 4HW6A 3BH8B 3P30L 5GHWH 2GSGB 4B41A 5DMGC 1KENH 1BPVA 3O6KL 2O61A 1EMTH 3WDIA 3EYVB 2D03H 3EUUA 3QIBA 1JK8A 2DIJA 4Z76B 3TBTB 4K8RC 4L9DA 1FV1B 1IQWL 4PGEA 1G9ML 5DMKA 1T6WA 4EKXA 3VFRB 4JM2F 1Y18A 3SGKA 1TQBC 2VDRL 3GBLA 4KTDH 5I8KL 4YHZH 3GMMB 4PJAE 3TYFB 1MREH 3QHZH 5EBMB 4PG2C 4UI2A 4Y5YB 4DK3A 3FN0H 3REWB 5ILTH 3MCKA 4IOSD 5IWLC 1MCCA 2HFGL 1EZVY 5DJDA 1LO0L 7FABH 3CFJA 4YDIL 5SWZB 1W0WA 3SE9H 5CJBA 1G6RB 4ETYA 4QHLA 1XGRA 4S1QH 3LEVL 1ZA3A 3SE3C 4Z8FH 2IALB 3NH7L 3VMPA 1UENA 5I1DA 3OWEA 5KS9E 1N7MH 4Z7WB 1A6WH 1LO5A 1Q72L 1FSKC 1EBPA 5FM5O 1V7NL 4C56B 5IMKB 2D9CA 3AS0A 5SWSE 2H2PD 4JG1L 2E6JA 1JMXA 1I9JL 1J0KA 2FD6L 2ICWJ 5E1HB 4KI1A 5MI0B 3GKZA 4XCFL 2DMKA 4QRSB 1YJDH 3M17A 3LQAH 4GUPB 3VFSB 3WO4B 5JIKA 4WTZG 4RDQF 1F4XH 4D2NA 1YN7A 3QDJB 4QRRD 2VZ3A 3IJSB 3S97C 5J06A 3D39A 2AKRA 4PV9A 2X7LA 2F8XC 4EDXA 4HPOH 4QOKA 2A6IB 4PJXF 5JPNB 5E95B 3BH9A 3W11C 2ADJA 5CP7B 3MLVL 2P8PA 4N90E 4PJ7F 5ISZE 4MXQD 2BK8A 2HRLA 2BERA 3O11B 3UTTB 1OGAD 4NCC1 3DI3B 4QXGL 1T5XB 3OV6A 3ZYZA 1JFQL 2A6JA 1INEH 4JGMA 1F4YL 4TRPL 3UTSD 3O6ML 2HN7B 1NCAL 1JWUA 2AJYH 3A6BL 3BZ4A 1G0XA 4GQPH 3O8XD 5IHZA 4LEOB 4LF3A 1LP9E 4NN5B 1CDUA 4AEIL 4WW2A 1EX0A 3TPKA 1J0HA 4JJ5A 4MSWB 1NGPH 4XRCB 4PGCB 3FRUB 4ZMAT 5IBTL 3BN3B 3PQYE 2D4FA 3VXQA 3RPKA 5E2UL 2F54D 5DRWB 5GRYA 5F7WC 5DJ6A 3BEWB 4QXUL 1RZKC 3TZVA 3D2UA 3NIFE 4HUXB 4CVXA 4M00A 3OSKA 5BRZE 1ZT1A 5HI5C 4I0KA 2EIBA 1J1PL 1WZMA 3ZT6A 1RAMA 2XKUA 1FPTL 4Y19A 4D8PB 3MLTB 3WHXB 1OB1A 4EZMA 2DWEB 1MF2H 2BSSA 3W9DB 2DQIL 3TIDA 3O3AB 5HY9A 5GGQL 3V7AE 1JWMB 5T5FH 4PJ9B 4HK3J 3P0GB 5EORH 1LK2A 5HBBA 2NY0B 2EDFA 4NWUH 3ARUA 5FA3B 1HN1A 1H15B 2VSCA 4BFBD 3LIZL 4D0CB 3EHBD 3NCYP 2C3VA 1OPGH 1JZ7A 4TOYH 3K7UA 1KSRA 1R0AL 3N85L 4O2FA 5LWYH 1A6ZA 2MMXA 5B3JF 4WHDA 3MFFA 4TTDD 2YXFA 5AYQA 3TJHC 4DVRH 3C5ZC 3IRPX 5FHAH 1OP5H 2R15A 2B4CL 4G6FD 1UWGL 4DZ8A 5EC2A 4NQSA 3H2WA 3HZVB 1FFOB 2OSLB 4R4FL 1QUNA 3HE6D