1U3HB

Crystal structure of mouse tcr 172.10 complexed with mhc class ii i-au molecule at 2.4 a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
111
structure length
111
Chain Sequence
AVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHGLRLIYYSYGAGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGDAGGGYEQYFGPGTRLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell receptor alpha-chain
publication title Structure of an autoimmune T cell receptor complexed with class II peptide-MHC: insights into MHC bias and antigen specificity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 28
structure length 111
sequence length 111
chains with identical sequence F
ec nomenclature
pdb deposition date 2004-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u3hB00
1HINL 4UV4L 1TZIB 5I17B 3QEUA 4LAQH 2JJTC 1KJMA 1NC2D 3ZDYF 3VRJA 5EFIA 2D2OA 3W39B 1RK1A 3V4VL 2OZ4A 2EC8A 4UTAL 3OB0K 2HRPH 3VWJC 1UB6A 5GSRB 3HZVA 3DRTA 5HHXH 3CCHA 3AMLA 2GAZA 4JDZA 2A1WL 4J1UB 1BD2A 1IEBA 2F8XC 3QUYA 4YC2B 1YN7A 2F53B 5D5ME 3E1F1 2C3VB 2PO6B 2A6IB 2NY2D 4KVCH 1H5BA 1MEXL 2XXCB 5JO5B 2OQJA 3KLAB 4NM8L 2XWTA 1QO3B 1RIVH 2OP4L 1XCQB 1A7NL 2R0KL 4OM1H 5D7LE 4N9GA 2R2BA 1CE1L 2I9TB 2EH7H 4OZHE 1JGDB 3OTTA 1F97A 4NSKA 5BRZD 1E4XL 4G8FA 5E8DH 4LLVA 5GGRA 2D31A 3BPCA 2VITA 1D5IH 2X4NB 1QSFD 4NQXA 4XVJL 3QZWG 4NZTL 4JO2H 4OCRL 3CLEH 3ARWA 3WD5H 3QJHA 5J7CC 1YNLH 1A2YA 2WNGA 1P2CB 4QHKI 1T6WA 4XP5H 4N0CD 1AHWB 4P23D 2YD3A 5CP3A 5IMLB 4JO4L 3TZVC 5ICYB 12E8L 2IQ9H 3UROR 4XC3L 3HE6D 2DD8H 2VDPL 4KJYA 4DVRL 4S0SD 5IB4A 1KB5A 4DAGH 4KRPC 2EDHA 5IVOA 4P48A 4EQ2A 1UZ8A 1CI5A 2IBGA 3IFLL 4HW6A 4PS4L 2FB4L 5HPMB 4HUUA 2MOVA 2NXZC 3SDAD 3NH7L 5I74C 1DN0A 1F11A 2KH2B 2W9EL 2MWCA 3KLDA 3VFNB 4AT6A 4EUPB 5LGKA 5HGDA 2XRAH 4GXUN 3C60B 4Y5XC 3P11L 2AI0L 5D1ZB 3KPQA 2IQAA 3QDGA 3K8MA 5DJAA 3D3VD 4JO1L 2XN9B 1A64A 2YD4A 2E7LC 1XF4A 3ARDD 3EFDH 4MXQC 5BZDA 4OSUL 2CKBH 3RVWC 3HI5L 1EH9A 2B1AL 1WQVT 1A4JA 1IM9B 3LEXB 4UNVA 1U6AH 4KQ3H 4ONGH 2ZKHL 4N0YH 3UTSB 2VQUA 4RAUA 1RJCA 5IG7B 1BM3L 2XACC 3CXDH 4QXUL 3KLHC 2XFXA 3KYKH 1MLCA 3O6FD 4G6AD 5TPWH 1AIFB 1I9IH 4HBCH 2NY5H 2CUIA 3QH3B 2VDKL 4ZOEA 2HT3D 1DUZA 3RL1B 5IWLC 2XIDA 3BPOC 4U6HB 1BHGA 4GOSA 5FUZL 4E42B 4Y88A 3WLBA 3GMRB 3T3ME 5SX4I 1AQDA 1FGVH 4L9DA 4YXHL 3O3DA 4WV1C 3DX6A 3R1GL 5HD8D 1M6OB 1H3UA 3WIIH 2DQUH 3KJ4B 2D0HA 3BE1L 5D70H 5T33L 4PRBB 5BVJA 2BHZA 2X4OA 3QCTL 4YHNB 5LBSH 3WIHH 4MNHB 5CJBA 5DJYA 1B4JH 2V9RA 3WYRA 3E2HB 1L9MA 5FYLE 1FGNH 4YPJA 4LSQL 3V7AE 3O11B 5FCSH 4JFFE 2VLLB 3TNMB 2DQHH 1BQUA 1OTUC 2J8UE 5I1DB 4QHNA 3U1SL 5IB5A 1UYWH 1DQDL 2V5TA 4X6EA 4OF5A 1YECH 2AEWA 1BFSA 3T65A 4M7LL 2PW1A 3MR9A 5ISZD 1MCKA 2QQLH 3B9KC 3HZVB 4JPIA 4R4FL 2OTWA 3DRTB 3PWJB 4NHCH 1BWMA 1BD2B 1IEBB 2X4QA 2BSED 3PV6B 3CLFL 3U46A 4L9LA 5DK0A 3QUYB 4XAWH 5DQ9A 1DBMH 1F8TH 3B4NA 2QADD 4QOKE 5HDQL 2DYPA 3ZDZF 1BEYL 2O5XL 2HWZL 1TZGL 2OQJB 4EBQL 1MCSA 1U93A 1AO7E 4S2SB 5CEXA 2JB6A 4O5LH 4WHYH 2IMMA 1XF5A 3CFDA 5D7SH 5DMKB 4HS3B 4R8WH 4G8FB 2CDEA 6FABH 4LASL 4NPYA 2CKNA 5K9OA 1N0LA 1UCBH 4YEEA 4NIKB 1IKNA 2JLLA 1CCZA 4EUPH 1FZMA 2COQA 3G08B 3LRSA 3WFEH 4QYOB 5I73C 1LD9A 3OX8A 3Q3GB 5E56A 3GSQA 4RFNC 4GQPH 1QFUH 1U92A 3MV9B 4ZFGH 5IEKA 2ILLA 3H6JA 3KR3L 3ZKNC 4NQDE 2NW2B 5F7UA 5CBAB 4OIIH 4NWTL 1R0AL 1I3GH 5E9DD 3MJ7A 1SHMA 4LDLB 1TMCB 1KB5B 1NAML 1YYLH 5BO1L 4R7DA 2XXMB 5TDPB 3DMMC 3MRLB 1UZ8B 1UZ6F 1PYWB 1NANH 3QDJD 5LXGL 3IKCA 1S7UA 5IF0B 2AP2A 5T3ZL 3GBML 4PG9A 2WUBH 3PDOA 2C3WA 2XQYK 4JHZA 3VXSE 4JREC 2YSSB 5HGDB 3X14A 4YBLC 4IRZL 4PRPE 3IJHA 3HG1D 2VTFA 1JWMB 3KXFB 3LV3A 2ITCB 3QO1A 2VXSL 3SOBL 1J0YA 4KKAD 2GFBA 3NFPB 3EKCA 1MPAH 5D1QC 1ZGLA 5SX5H 3SGJC 3HI6L 2FEDC 4NUJB 5E8PA 3ARBA 1ORSB 4N0FA 5I75B 5DXWA 1HYRC 3B9EA 2PXYD 4OJFH 3N0PB 3T2PA 4I0PB 5DT1L 4RAUB 2X1QA 4FQ1L 3AAZA 4LSVH 3Q0HA 4B50A 4HIJA 1A6ZA 2V5MA 1EMTH 1MI5B 3GKWL 3TESA 1EFXA 3G5ZB 1ZT1A 3TJHD 4YHPB 3U83A 1IQWL 3MRPB 3GSNA 1BVKA 1TCRA 4L29B 1G1YA 5C6TL 3LQZB 1EHAA 2OYPA 4K8RH 3SGKC 3RKPA 4U1MA 3PWPD 3BPNB 3O3DB 1P69B 1WLHA 3DX6B 1LE5A 1CXHA 3PP3H 4X6BA 1INQB 1J1PL 3FAXA 4LSTH 2V5RA 3GIZL 1JGUL 1JMZA 5ITFA 4X4YA 2FGZA 5IB2B 5KS9E 4H5SB 4OCMC 5DJYB 1L7IH 3KG5A 2QHRL 5IQ7H 3BI9X 2HMIC 2MKLC 4ZXBD 4FTVA 1CFVH 3GO1H 4X98A 1E4WH 4Z7VE 2YPLD 3WHE1 4NN6C 3C09C 4BFBD 4XP1L 1I9JL 2KL6A 1AD9A 4MB3A 2CJUH 5IGXL 1P7QB 4QHNB 3KPNB 3PHQA 4IHOA 5EOTB 5TFSL 5EBGA 4X6EB 3I3BA 4FZ8H 2VAAA 3MR9B 4WFHD 5F7WC 1UM6L 4NQSA 4WWKB 2EKJA 1B0WA 4ZNEA 5T1KA 3KHQA 1E4JA 2OTWB 1PJ9A 1Q1JH 5FYKH 2NQCA 4R3SA 5FO8A 4B53A 3OMZA 3CNKA 2DTSA 4S1RH 2HN7B 3U46B 2F8VA 1MCPH 4LFHD 5IB1B 1JRHL 2VLRE 1Q0YL 3RX5A 4RFEB 5DSCB 1PBYA 4GAFB 2ZCKL 4DN3H 4FFYH 2DYPB 4XMLH 3HNSL 3GFUA 3G6JB 1OAYL 1WC7A 3P30H 5KVDL 2AJXL 1JIBA 1KB5H 4JQVA 4ODWB 4X7FC 1S7TA 5FKPA 3K4AA 4DTGH 4WUUA 1Q9LB 1S7SA 4NPYB 3RA7H 3VI3E 5SV4A 5K9OB 4FQXA 4Y16D 3VFRB 3MBED 5EC1A 3TT3H 1T22A 1FZMB 4RA0C 5E99H 3QG7L 5I66A 3LRSB 5F6IC 2BVYA 3BKJL 1LD9B 4Y2DD 1T1XB 1U92B 2F74B 4N0RA 1ZXQA 4YHKL 1E28A 1YMME 2HVKA 5K59F 3TEUA 3UBXB 3PQYD 1KT2A 1LO5B 5EH1A 4U6XA 3BEWB 4L3EE 3I9GL 1CFSB 5JUEH 2HTLD 2B4CH 1U3HC 4Y8DC 3RY6A 3QI9B 4C55A 4BQBA 3HI1B 3MA7B 4C56D 4IOIA 3S8WA 5JR1H 1KTDA 4G42A 4P2OC 4WO4A 1WV7T 3I6GB 4X80L 1FE8L 3HB3D 1F2QA 5IVXA 1K4CA 1GGUA 1CE6A 1JGLH 4NKMB 2BC4B 4D9QE 3W9EB 1IL1A 1T1YA 4L8DB 4HKXB 2Y9RT 1RHFA 1N5AA 3LPGA 3VH8A 4WI3A 3TT1H 2Q76A 4WUKH 2F5BL 2VZVA 4EIZC 3B9AA 2IPTL 4JG0L 3WN5A 1GAFL 5F96L 1S8DA 3ARBB 5C0RH 3T0VA 2UYLB 4JRXE 3SDCC 3ARUA 1QBAA 1S3KL 4AIXA 1CG9A 1QLRA 3NIGE 3F8UB 1E6OL 4NOBA 3C08H 1EBAA 3HMXA 5KSBA 3W5MA 1OB1B 3U4AA 3HUJA 1WWBX 4PGBA 1FL5A 1JZ2A 1A6ZB 4P2CG 5E7BA 4GMTH 4MGXA 2X05A 3GBNH 3QCUL 35C8L 4G7VH 3IU4H 5HBBA 5DVNA 1BVKB 4U1SA 4FP8H 2AEPH 3GMNB 1EO5A 2YD8A 4PJCF 2XKUA 1QLFA 3BQUD 3RY4A 5FHBH 2D7TH 4FG6D 2PKDA 4MJIA 5GZOC 1Q9KA 2VB5A 3QNYB 4YIQB 2ICWJ 3ILPA 1UA6H 5IMKA 2R1XA 3TC9A 1H3PL 1F90L 4PJ9A 4X4YB 4JRYE 2I07A 1KPUA 2VWEC 4PV9B 1DQQA 3WE6A 1BOYA 4TOYL 1WZLA 3F7RA 4KUCD 4FFVD 5I18H 4S1DD 5TQ2H 4JFOA 4JN2A 4WHTB 1PQZA 2X4TA 4FTVB 2NY4C 4PGJA 3VE0A 5C09B 4PRHA 2X4SA 4M6NH 1J05A 5B38A 5JTWA 2Q20A 1DLFH 4RRPG 3QUXD 1ZLVK 4PRIE 1IGYA 1YY8B 3RDTB 4PLKD 4P4RB 4FS0A 5FHAL 1QFOA 3KPRB 1HSBB 3MSPA 3WJLC 4EN3D 1ODAA 3NCJL 2X1WL 3X17A 1RJLA 2LTQC 1IZKA 3FQXB 4ODUA 3VFMA 2APWA 3FT2B 2VDRH 2JJVA 4OM0L 5MENB 3CPLA 4JPVH 2YA1A 4OGAD 3KGRA 4LCYB 1WC7B 3QEHB 4YDLC 4AEHL 2CSPA 4C4KO 4FN0A 4HWUA 1S7TB 4TNWK 5FKPB 5EU4B 2W0PA 1OHQA 1J1OL 2ATKB 5EUKB 3BDYH 3QT2A 3N85L 4QGYA 1S7SB 1OAXH 2IAMA 4JM2A 1MRFL 3WNKA 2Y36H 4FQXB 4URTB 2Z35A 1WBYB 5EC1B 4DW2H 5DMJB 2K7QA 1S5HA 5AAWA 3MRRB 4KJQC 3KPSD 1I75A 1HQRA 1JI2A 4HWBH 2D7PA 4Z0BL 5IR1A 5F7EH 4Y4KA 1N6QH 15C8L 3EHBC 4XX1G 5FXCH 2ERJB 3SDXA 1CD0A 1CD8A 1KT2B 4S0TD 1C5CL 2BXYA 3VW3L 3A6BH 2IANB 2V7NB 4TVPL 2V9QA 4MDJA 3TO4C 5J9PB 5LCVL 4YBQC 4IOIB 2FJHA 3UJJL 2FR4A 4P2QB 4H88L 3PXHA 1KTDB 1PY9A 1RIHH 2Z31A 4MAYB 1I3RA 4WO4B 1ETZA 5IVXB 2G5BA 1CE6B 5J13C 3EYQC 1M7XA 5BRZE 1T1YB 1A9BA 3REVA 2AGJH 4NBZB 5KSAD 1EK3A 2WLYA 1MH5B 3UJIH 5C07B 3QQ9C 5L6YL 3I84A 5CEZE 2VWEE 3NACL 3LIZH 4PFEA 4E41A 3MGTB 1VKXB 1ADQL 2B1HH 4WW2A 5JW4Q 2PYEE 4X4ZA 4ZPVB 5HVHC 1YEDA 1FO0L 4PGCA 5KSUA 1VFOA 3EGSA 1HSAB 3D5OF 3AS3A 1RUQL 4KJWC 4PJDE 4BFIA 1F58H 4PGBB 3EYFB 5EBWB 1FL5B 1KCUL 4PJXA 1CICB 3QZWB 4BYHA 2PF6A 2P4AB 3JTTA 4ALAL 1QFPA 3B6SA 1ZGLP 4NQED 3UTQB 1IBGL 1VGKB 5F6HI 4M5YH 1U8IA 4ODXA 4X7SL 1QLFB 4YK4B 4PLJC 5JLZB 1HHHA 2XTJB 2VZOA 2F9BT 2OI9B 1FN4B 4A2MA 4GG8A 3ARXA 3EZ8A 3D3VE 3VG0H 4IRJD 1MF2L 4YHZL 1A1OA 1J10A 2A9NL 1H8SA 4FXGB 5IBTH 2FX9L 2R1XB 3VJ6B 2DICA 4X9GA 4PJ9B 2WK2A 1GIGL 2HVJB 3WE6B 5C0BA 4U3HA 1G7IA 3IJSB 4JFOB 4JN2B 5I1GH 3K4ZA 4FQCL 4KJPD 3H9ZA 3OBAA 4LNVA 5D6DA 1WBXB 2MPAH 5C0GB 1IFHH 2ADIA 4HLZG 1PFCA 1J05B 3H42H 1JHKL 3JUYA 2NNAA 5H2BA 1X5ZA 5JIIA 5EU7C 3O9WD 2GSIB 3V52H 2CPCA 4HUVA 2NR6D 5C0JB 1RJLB 1LO3H 1U8LB 3O3EA 1BFVH 3FO1B 1QNZH 4Z9KB 3G6JF 3ZKXC 4F9PC 3MNWB 4OT1L 4ODUB 3TBWA 3MLVL 4LSSH 4OLWH 3QUML 3HNTH 2XA8L 5CSBA 1T03H 5EBMB 3BXNB 5I8EA 3NCEB 4MCZB 1J1XL 4QRPB 4UDTA 1OGAE 1MFAH 3AREC 1LNUA 4BZ1L 3BESR 4X83A 1XF1A 4YHYC 1QUNA 1KLGA 3HZYA 1BGXL 1LK3H 1MREH 3GSXB 4NT6A 2Q7NA 2DQTH 3PGCA 2AJUH 5D7JA 3W5NA 3DURA 1R5IB 3LKSA 1KYOK 4KK6D 3P4NA 4LCWB 2HAZA 1D6VH 4NC1C 2XQBH 5IR1B 1IGIH 2FZ3A 5ADPL 4L4TD 4Y4KB 1X5AA 3VFGL 5F7FA 4LBEB 2FGWH 3SDXB 1DZBA 1N7ML 4ZQKA 1P4BH 3ELAT 1S78C 3JSSA 5EUOE 4ERSL 5T3XH 2BNRE 1KPRA 1Z9MA 4MDJB 4DGVH 2FJHB 5IMMB 5E5MB 2QQNH 3CVHL 5A2LH 4AIZA 3MLWH 3HE7D 1XCTA 2NTSP 3BOVA 1I3RB 1WUNT 4M93B 1ETZB 4WCYH 4XC1H 5AG9A 5GS1A 3NCYP 5AZEL 3BHBB 3FFCE 5DO2C 4XP6L 5F44A 4ZDHA 3STLB 2IALA 4MNQB 3LDBB 4N0UE 4PPTA 1OAQL 1RZJC 2W65A 1YMHA 4PJAE 3QFJD 2FX7H 5EZOL 3FN0H 4MQ7A 1AXTL 5E2UH 4ZYKB 1JPFB 1NJ9A 4IIQA 1P84K 2ITDA 4MXVF 1EO8L 4Z7QF 5T1LB 3S6CA 5F89A 3IGAA 1WTGT 1O7SA 4KMTL 4P4KD 1K9TA 2VZ1A 5FA3B 4LEOA 4K7PH 4ONFH 1MFEL 1T20A 1QEWB 5HHOA 1XGRB 3D69B 5EU7E 1JUFA 3DLQR 4JY6B 2PW2A 3QDJE 1O5DT 3B6SB 5C0FA 4PJHE 1CFBA 2ZSVA 3SE4C 3TJEH 3JWNC 3TO2A 2WW8A 3V7AG 3HHRB 1EGJA 1JTOA 2OR9L 5FFLA 1ES0A 2YEZA 5J12C 5HYFA 1BP3B 1WCQA 3HG1E 3NOIA 2P8MA 5D1XD 1MY5A 5DHVA 1Q8MA 4KK5D 1CLYH 2CRYA 3FQNA 1I8LA 2DLFH 5IHZB 1TQCB 3MV8D 4G6FD 4PJEE 2C3HA 3FJTA 1NUNB 5C08B 2OX5A 3T0XA 1MLBA 1LO4L 4X99A 3EO1A 3SBWC 4YHOH 1XGTB 3U4EB 4XPBH 1QZ1A 1Q9WA 5JDSB 1CGVA 4WY7L 3BWUC 5DURD 5H2BB 1S5IL 1TVDA 4KGJA 5BZWB 2C4FU 4XAKD 1BZ7B 3H9YA 3RWFB 4ZUTA 4NC1E 2CR6A 5D1QD 3DYMA 4MLIA 2VJXA 3ZT5A 1MJUL 3IFOA 2GK0A 3SQBA 2NXYC 1DVFD 2QHLA 5A2FA 5C0CB 4G5ZL 1Y6KR 4BM7A 5IW6B 1WWAX 3VXTA 2DQJH 3PWLA 4O2CA 3O3EB 2I60H 3WFZA 3HFML 4PBVC 1RUPL 4KROC 3O8XD 4LLAA 3ZHDA 5SWSD 3TBWB 1AFVH 3ULSA 4NQCD 2APXA 2E9IA 4PB9L 1IM3A 4PJ5A 1AY1H 4JN1H 1OT1A 2KZ1B 5I8EB 5BMFH 4F37F 5DD1H 2D7QA 3KHOA 4OF7A 4CKVX 3WFDL 4ZS6C 3RI5F 2DKSA 5EORH 4LAQL 4NT6B 1MWAA 1RULH 3CVIH 5F7MC 4F3FA 2BSTB 1RZ7H 1JF5A 4R4BA 1XF3A 5E08H 2HRPL 2Y5TB 4MS8C 3LKSB 5HHXL 1S9XA 1GGIH 2EDYA 2N7AA 3P4NB 1XZ0A 2Z91A 3FHQA 4P5MB 5E2WH 4LEXH 1K4DA 3UYRH 2DQDH 4P46D 3MRKB 4DGYH 3QG6A 4G8GE 3N9GH 4KVCL 4F9LA 3MFFB 4TSCH 4OZIE 1J18A 1JF1A 2X1OA 5ICXA 1RIVL 1M7DB 1U8HB 4XMKH 5LAXA 4OM1L 3K1DA 1Q72H 2Z93A 5IVXF 5GGSA 3RTQD 2X2YA 1DL7H 4FFWD 3ARQA 4PR5A 3FTGA 3PWNA 5GS1B 5E8DL 5F1IB 5DJ0B 4RIRB 5J6HA 4P9HC 4PJ8C 3SCMD 4JO2L 4Z7WE 1FVCB 3WD5L 4R0LC 1YNLL 3CFKB 4XP5L 3CK0H 2VXTH 2RB8A 4PRNA 3CUPB 4OCNC 2EYSB 4MQ7B 2IQ9L 1OT2A 1GCFA 4DGIH 5JA8B 2RJMA 2DD8L 4G9FE 1EJ6A 2GEEA 2RBLA 3B2VH 3IAPA 1NJ9B 1N3NA 4IIQB 3ARGB 4N5EC 5J06A 4DAGL 3I75A 4JQXA 3VFUB 5CSZB 1YPZA 1IAII 3WUWG 3PQYE 5IJKA 2ATPA 4F7TA 5BS0A 4FMKA 1MRDH 5CJOH 3RUGE 5HHOB 3I6LD 1JUFB 1TPXB 3G6AA 2GJ6A 3AUVA 1BWWA 2XRAL 5C0FB 1KSRA 5D2LA 2ZSVB 1W72A 1HWHB 4KXZH 1AXSB 5MEPA 3VWKA 1MJ8L 1I85A 4GBXA 1LP9A 5F7DA 2XT1B 5B8CA 3EFDL 5JHDE 4JM4H 5CJ5A 4QY8B 3CFBB 4AIOA 1D5XB 2CKBL 4GS7C 1U6AL 4KQ3L 4RMRA 1X9QA 4ONGL 4N8VA 3MRFA 1MLBB 4N0YL 4OFDA 3EO1B 5INDB 3MRHA 3QWRA 3CXDL 3SDYH 5CEYB 5KN5A 1IEHA 3KYKL 1Q9WB 5DD3L 1HQ4B 5TPWL 5BVPH 1GOHA 1I9IL 4HBCL 2H1PH 2NY5L 3RNQB 4NQVB 2VQ1A 4OLYH 3QYCA 3T1FB 1MCJA 4M8VA 1CFQB 1YNTB 3DX9A 4A2LA 1GPOH 3PGFH 4OIAA 1PD6A 4RA3A 4OF0A 1IGFH 1HHKB 2FWOA 1OAKH 5F9DC 1FGVL 4ODBD 4Y4HC 4OLUH 1CDUA 1DN2A 4KI1A 4YHLH 5DRZB 1R24A 32C2A 3MRGB 5TF1L 1NGZB 2DQUL 3WIIL 1WSST 5D70L 4E0RA 3PWLB 4O2CB 5C0AA 5LBSL 3WIHL 1ZMYA 3F6IA 1B4JL 4LU5H 2XOTA 3MROB 3U0TA 1FGNL 5IQ9A 1IM3B 3ZTJH 4CN4A 2BJMH 5CP7B 1FAIH 3PL6C 3S4SG 1KBGH 2HFGH 4UOJA 1CL7I 2DQHL 4FQ2H 2ENYA 1UYWL 1FSKB 2AS5M 3NCMA 2WP3T 4R97C 1U3YA 2WUCH 1YECL 4QRQB 3BW9A 4EOWH 2AK4A 4OD2B 2QQLL 5B4MC 5T3ZD 1YN6B 2BY2A 4I2XE 3MCKB 1XZ0B 2Z91B 3R06B 4NHCL 1KGCD 5CZXC 1HNFA 1NDGB 1H3WM 4PJ7A 4A6YA 4XAWL 1CXLA 1SYVB 5TQ0H 4LCIH 1DBML 1F8TL 4QTHB 1OQXA 4X6CB 3UYOD 3OZ9H 3DUHA 3MLXH 5ICXB 2AXGA 4O5LL 3TA3C 4B41A 2Z93B 4PJIB 3O2DH 4RCAA 3C5JB 5D7SL 1TTGA 5IOPB 1T6VN 2P5EB 3P40A 4R8WL 4XVUC 4CADA 3VXQB 6FABL 4ZTPH 2WIMA 4L8SC 1UCBL 3WKNA 1WAAE 2ZNWA 3AU1A 2B7DT 5DD6A 3C6LA 3WFEL 3QWOA 1J86A 3QXUA 4ZO9A 3FZUC 1F4YH 1PGRB 1QFUL 4ONOA 3GSWA 4ZFGL 2AV7A 3CX5J 3RVXD 2VLJD 1LEGA 3IETA 4BSJA 3KPSE 3TFKD 2VC2H 1I3GL 1XFPA 4B7LA 1VEMA 1DEDA 4GRWE 3MJ6A 3TH2T 4GT7A 3I75B 3VI4F 3TBVA 4LIQH 1YPZB 1XR9B 3IB4A 2Y6SC 4NRXA 4WI9A 3AS1A 3VFSB 2O5YH 3TGXA 4LHUG 4YBHA 2EYTB 4F7TB 5BS0B 4MD5A 2D7MA 4LPCA 3FB6A 2MMXA 2IADA 4J3SA 5A2KH 1TLKA 4V1DD 2W60A 3MLUH 3C5SA 5B3NA 4U2ZA 3PABA 5D4QA 2X89D 4QTIH 4NKIH 3T0EA 4HK0A 3ARZA 3UPRA 4WTZG 1F6AB 4OB5H 5ACMA 2EIEA 1LP9B 1MPAL 3L3IA 5IP4A 2VQTA 4NO5A 5T1DH 3RGVB 2W0KA 5FKAB 3K1KC 4GRLD 5HHQA 1I1AB 2D9QB 3ME0A 1MAJA 3C8KA 4JE4B 2UWEE 4RGNB 3IDJA 4ONHB 1U91A 4OJFL 4YFLI 3WFHB 3MRFB 3I6KB 1B0RA 1T0PB 2DLTA 5SWZA 4LSVL 2EDWA 4WI7A 5HI5D 1IILE 3UXFA 1EMTL 3QHZH 1ZA6B 4JY4B 1DE4A 4HKBA 2R8SH 4YPGB 2ZG1A 1W0VB 2YN5A 5F7YC 3ARSA 3QCVH 1NGPH 4M1CD 2O61A 4POUB 3VXOA 4TUJA 1XIWB 2GT9B 5FCUH 1CT8A 3VXMD 4HIIA 4Y1AA 4O2EB 1F6LL 4K8RL 3V5HB 4HS6B 2H9GB 3HZMA 4X4MA 1R24B 1X5IA 1FYTA 3ORJA 4PBXA 1NCDH 1N0XH 4P5TC 1YDPA 4G6KH 3WDIA 2Z8WC 4LSTL 4O51A 5I1KH 1OOAA 1L7IL 5IQ7L 1QA9B 2Q6WB 2BNQA 5E6IA 3ES6A 3GHEH 1F4WH 4YX2H 1CFVL 1K2DB 3GO1L 1E4WL 2FBOJ 3S9DB 4F15B 1FAKT 4NUGH 4YAQA 3UTTE 1MVFA 1LDSA 3U2SA 5BOZG 2CJUL 3T3PE 4IDJH 4JFDE 2VABA 1NBYA 3OF6D 4FZ8L 2V5YA 3BW9B 3RWGA 5DEFA 4Y4FA 1A9EA 1KC5L 2HJLA 2ZUYA 4GLRI 3BUTA 1Q1JL 5FYKL 2EE3A 3SE8H 2NY5C 3DETC 1TNNA 3TN0C 4X6DA 3GUTB 4K71B 1ORQA 4LSPH 2Q7YB 1MCPL 2R23A 4KPHH 4NZRH 4I3RH 1V8HA 2ZCLH 1KB9K 2Y07H 4FFYL 3MGAA 4NO0B 4XMLL 3ULVH 1G9MC 4L4VD 4Y5YB 5GJTH 3MREB 3P30L 3CC5A 2DWDB 5D5MB 1KB5L 2AXGB 3R8BB 4LOUC 2XQYG 3AXLB 4U1JB 2VDLH 2J7LA 2YS4A 4NBXB 5TGBA 4F7PB 1ZE3C 2P8LB 2RFXB 1DTUA 4DTGL 2JCCE 3LVEA 1U8NA 3RA7L 5D7LB 4I9WD 1PG7H 4OZHB 4IRSD 3TT3L 2GCYA 2PO6C 5E99L 3WNPA 1PZ5A 3D2UA 1TITA 4XZUA 1W8OA 5DRXB 2B20A 1UZ6E 3BIKB 4FXKA 3NA9H 4ZD3H 2W9LA 1MRCH 4ZUUA 4RFOH 3L5WB 4GUPB 3MJ8A 1QBBA 1ZA3A 3WJJC 5JUEL 3U7AA 1FNGA 5E8NA 2B4CL 3UCRA 3TBVB 4NJAH 4GW1A 4OI7A 1B6DA 1WT5C 5JR1L 5HGAB 4W4OA 3H9SA 5IIEB 5DDHA 1V7MH 1NEZG 1QSZA 5FO7B 2V6HA 2VMFA 4XPAH 3MRNB 1MFDL 2EE6A 1AHWC 2IADB 1U0QA 3WNNA 4NOFA 2V2TB 1JGLL 1PX3A 1NFDF 5CBEB 2MNUA 2OJEB 1YNKH 3VXRA 3PWUA 3CDFA 3T0EB 1K6QH 4LVNC 1I7RA 1NH6A 1VFAA 1MHPH 2E7CA 4UQ2A 1D5BB 5C0RL 3DXAA 5HHQB 1OWRM 4P2RA 1URLA 1S7VB 1WZ1H 4JFHD 4PY7B 1IT9H 2MJWA 1D9KA 2XPGA 1HI6A 4QRRE 3C60C 1NBQA 5EIQA 3D18A 5D1ZC 1QQDA 3ZYIA 5SWZB 4NYLA 3MV7E 4HV8A 4GMTL 4AMKH 3GBNL 1FZKB 2P42B 4G7VL 5EBLB 2NY3C 3IU4L 5DJXB 3QISA 4G3YH 1X5GA 4Q6IC 4FP8L 1K5NA 2V2WB 2AEPL 1LK2B 1AKJD 2O61B 4Y1AB 5TJWK 1J9CT 3AY4C 5HGHA 1NGXA 3A6OA 5E4EB 5E03A 5FHBL 2D7TL 4TRPH 3JWDC 4PYGA 1NC4B 2VN7A 1HHGA 1YDPB 1YY9C 4MCYB 5HYEA 1ZS8B 4HHAB 4LL9A 4M5ZL 1UA6L 3B9VA 3LHPH 3MODH 2IBZY 2MCG1 4AQOA 4XCYA 3TH4T 4YGAB 3SE9H 3RWEA 3MNZA 3GDBA 3KYOA 3MYJA 5TQ2L 3ES6B 2IBBA 3ARPA 4LKCB 1OCWH 1W0YT 1I8KA 4JCMA 4M6NL 4HJJL 4P3WA 5F1NB 3QIBA 3U2SB 3BRFA 3KJ4C 2VDNH 3FFDA 2VABB 4HCRA 2P8PB 4U1NB 4JFFB 2DS4A 1QRND 3DNKA 4QWWD 4TVPD 1DCLA 5EDXA 2J8UB 5I8CB 5FM5O 4I3SH 1G7JB 4M62H 1FG2A 1YC8A 3E2HC 4OBRA 2HG5A 5ACZA 4RQQA 4XAKE 4NHUB 3TZVB 4X6CF 4MHHG 1ORQB 3VXPA 1UVQA 1UWXH 2O5ZH 2MCPH 4EKXA 3MOBH 2VDRL 4BH8B 4JPVL 1RZKH 1U8QA 1WISA 1YUHA 2G2RB 4NCC1 5E6ZA 4K8RC 4PJIF 5I1CH 2N4IA 3P73A 1CVSC 4QXTA 2HT2C 2NXZB 4OQTH 4DVBA 5AZ2H 3QBTB 4MJ4A 3BDYL 2YMXL 1OAXL 3QUYC 4ELME 2Y36L 4KZDH 3DRQB 1UXSB 2GCYB 4DW2L 1H5BC 2NZIA 4Y19A 4F2MB 2VLKA 3DPBA 1QVOA 3CX5K 2AERT 3ULVF 1N2RB 4HWBL 4CMMB 5F7EL 5HHNB 5JW4N 3GEWB 4MJID 2ED8A 2BMKA 1YPZF 4LCUA 3SJVE 3MUY1 5FF6B 3QUZD 3MJ8B 1ZA3B 1JGEA 4NQDB 3A6BL 4RGMC 3ZKMC 1EVUA 3H9SB 4MB4A 1RIHL 1H0DB 3QIUA 2XWBB 2WM0A 1ZT4A 2QSTA 3IDIB 2AAVA 4LCCA 4EVNB 5C86A 3UTSE 2X1PA 3ZO0A 1LP9F 5KVGL 2UY7A 4AJ0A 5C71A 2AGJL 1LEKB 3VXSB 4LDEB 3QXWA 3A0OA 3UJIL 4WV1B 3P4MA 2I9LB 4PRPB 3U9UB 4YWGH 3C6SA 5AUMB 4ZAKA 3LIZL 3U7YH 3TIDB 4UILH 2B1HL 5T5FH 3OKDB 2W92A 2FNBA 5GZNC 3LEYH 3EOBA 2BVOB 1JV5A 3UAJD 5MERA 2VSDA 2XWJA 5HYJA 5L2KD 2YRZA 1VERA 3B5GA 5HYQB 1Y6MR 1F58L 3RVTD 5ABDE 4IOFD 3ALWA 1NDMA 4XVTH 5BQ7B 1JZ6A 3PXJA 5EN2A 3QEQA 2YUVA 4JHBA 1GYAA 1P53A 3SDDA 3R0NA 2BNUA 2VR9A 5FYLH 1FVEA 3I6LE 3SE3A 2B4CC 4M5YL 4OZ4A 1V3LA 1NGXB 4BSVB 4JM2D 2FO1A 3BGFB 1KNOA 3FQUB 3VG0L 2GUOB 1QBLH 5LGJB 5GS3A 5IBTL 1DQTA 4XCYB 2DLEA 4JZNB 1QG3A 1RFDH 3RWEB 1JHTA 2ZOKB 2AJZB 2W0FA 5I1GL 5D9SB 3VRIB 1BD2E 5KS9B 2MPAL 1IFHL 4GFTB 2D4FA 1J88A 3H3KA 3RZCD 3BPNC 2YPKA 4F37K 4I4WB 3MRCB 1LEIA 3FFDB 4YFDB 2AK1H 1QD0A 5FGCE 3BSZH 3UX9B 4PP1D 3RI5K 3EYOB 2CD0A 3V52L 5DRNA 3CDGA 4YGVB 1FG2B 1T2XA 3WEXB 43CAA 1U41A 4MSWA 5IBUB 4E9LA 1L0XA 4RFNB 4CL7A 4XP4H 2EH8H 4AEIH 1BFVL 1UVQB 1QNZL 3ARFD 3V7MA 2GITB 4LSDA 5ICZA 5FYKE 4OLWL 4LSSL 5D5MF 2X9WA 3HLAA 3HNTL 4WU5B 4E41D 5GSVA 5CIPA 1T03L 3WXWH 3DMMB 3S35X 3OKMA 4EI5A 1U2HA 5IM7B 1MFAL 4WWKC 4QXTB 2DQEH 2Y1VA 4IEFB 4DVBB 1R6VA 1RVFH 4U2YA 4JQIH 4OZHF 1LK3L 1MREL 3T2NH 4AEFA 2DQTL 1NCNA 3EDFA 2AJUL 4YBLB 4UIKH 1EDQA 3TM6A 2Z8RA 3VGBA 2FBJH 2UZIL 3L7EA 3RWDA 3FT4A 3MTRA 3UC0H 4XGZA 1D6VL 4HT1L 1ZLSH 5JZ7C 2XQBL 1MCNA 1IGIL 1NC2A 3MV01 4JZJA 1OY3B 3ULUH 2A6JA 3QDGE 5T1MB 4LCUB 5JOFA 2JJSA 3O6MH 1P4BL 2NW3B 2ICEA 4Z76A 4X6FA 1RJYA 1YMMB 3VA6A 1JZ8A 1IKNC 2PR4H 4GAGH 4M43H 1R3JA 2QQNL 4RSVA 3MLWL 5C0BD 1C8PA 3B43A 4HXAH 4WCYL 4XC1L 5FDWB 4HG4J 3EAKA 3KPOB 5DHYA 3ARVA 3MUHL 2J6EH 5GGUB 2ADFH 2DIBA 1JNHA 5L8LB 1EIBA 4WFED 1NBZB 3C5ZB 5ITBH 1Y18B 3HRPA 2X7LB 1RZFH 3C8DA 5C0DB 3QI9C 4U31A 4LLWA 2FX7L 2X44D 3FN0L 4ZOBA 5E2UL 3O41B 5EPMA 3B3IA 3V0AC 3BGMA 1QSFA 5ECJE 5C0ND 3S97C 4RX4D 1I1YB 1JF6A 3WFBH 3EOBB 4H1LG 3TVMD 2FLRT 5DVKA 4P23A 4JRXB 4BELD 2WBJD 1CVRA 3IU3A 1OF2B 4JFED 4K7PL 4ONFL 2YZ1A 3HE6A 3C09B 5FM8A 4ODHH 3QEQB 3M45A 4M7JL 3U0WH 5K33A 4F7CA 1IGJA 4HIXH 3RL2A 2BNUB 4CU6A 4XBEH 3M1BA 3ARBC 5DJ2A 3TJEL 1FVEB 3CH8A 1F3RB 2IH1B 5J56B 4KTEH 3T3MF 3O0RH 4WFGD 4KHXH 3SDAA 2JELH 5JXED 2NY0D 1CLYL 5DZNA 1LO2H 1KNOB 5EZIH 1LDPH 2DLFL 1IEAA 3RAJH 1WFUA 5KANI 2XV6B 3EDEA 2GTZA 2J8HA 5IVZB 1BQHG 3ARDA 4YHOL 3V4VH 4XPBL 3SGDI 1T7VA 3TCLA 5IKCB 2D0GA 4XHJD 1CF8H 2YBRB 2YPKB 1WITA 2J8UF 1CD9B 1KCKA 2OL3A 4HIEA 5E00A 5CILL 3HAEA 4H26B 5DRNB 3CDGB 4UMGA 3ILQD 1OTSD 3O6FA 5F6IB 4PRIB 4MSWB 2W1NA 2FL5A 1MQ8A 4MA3A 2DQJL 5KOMC 1S7WB 3BZ4B 3L3OA 3BD5A 2I60L 5DJDA 2ZUUA 1MJJA 2YOCA 3BZFB 5IW3A 1OTTC 1R3HA 5I76A 5EIIB 3UZEA 1AFVL 2VLME 1X4XA 3SO5A 4X8XA 4JDTH 5JA9A 5CIPB 1AY1L 4JN1L 3GI8H 1A6VH 5BMFL 1IZJA 3L3KA 5DD1L 1HXYA 3QNXB 3PGDA 4FOMA 3O6LH 3O4OB 4JO4H 5DMGD 5EORL 3DSFH 5BW7A 4AENB 1B88A 1RULL 4K3DH 2YKLH 3CVIL 3U4BH 4Q9QH 3L5XH 2A83B 1Z0MA 3QQNA 1K3IA 1RZ7L 1A22B 3P3YA 4OZGA 5IB3B 2H26B 3OAZH 4KDWA 2X41A 1FJ1B 2FEEI 3CFEA 5J57B 3EZJB 5E08L 5DS8A 4NNPH 4WNQA 3L7EB 4P59H 3TNNA 5E2WL 4M61A 4LEXL 3VFVB 4Z5RA 3C9NA 2BVPA 3F58H 3UYRL 2DQDL 4BH7A 2HFFB 4KI5C 1NC2B 4JZJB 4DGYL 1U8JA 5SWQA 3I3EA 3KNBA 4QGTA 1C16A 3N9GL 5ISZA 5FYJU 1RZIB 2DL9A 1OGTA 1P4IH 4P5KB 5JOFB 1DBKH 4TSCL 3L6FA 4YEFA 3V5KA 3UTPE 4FQXC 3RHWF 4XMKL 1R3JB 1Q72L 2XI9A 4OGXH 1V3JA 4XHQA 4O9HH 1DL7L 1JCKA 3HS0B 4XBPA 2H6PB 1VDGA 3FQTB 2ZSWB 1T04B 5TDNB 3IF1A 5C7XH 3ULUF 2YN3A 4UDUA 1C12B 4P57A 3RY6C 1U8KB 3CK0L 2VXTL 1BM3H 1KULA 5BRZB 5I1JL 1G9EA 1ZHBA 1CDIA 1MFBH 4QF1B 4UNUA 4DGIL 4OKVA 1L0QA 4PRDA 1JMXA 3B2VL 1QSFB 2C1OA 2R1WA 4WO4C 2LAGB 3EOAA 2V9TA 3VCLA 5J11C 4G8EA 1D3CA 1T66D 4XP9H 2M8XA 2PYEB 4EDWL 2UY6A 2HT4C 1IJ9A 3UZVB 1MRDL 5CJOL 4MAUH 2F53D 5E9DA 1MVUB 4PJDB 3WN5C 1IGJB 2HP4A 5D71H 3OKEA 4FTVE 1K85A 2F19H 4XWOD 3U48A 3GRWA 2QR0A 1F13A 1EO7A 1RU9H 5DC4B 3HMWH 5D96C 3BO8A 4LRIA 3V5DA 1OLZA 4JM4L 5I1LB 1BBJA 3I85A 4JDVA 2C4XA 1CICC 5F88A 2AJYH 4FNLH 2BOBA 5KS9F 3D3VB 4ZNEE 2GTZB 1KXQE 5HDBE 3SDYL 4YDLB 4H0GA 1TVHB 1E27A 4PUBH 5J6GA 4YK4C 2CDFA 4Z7VF 5BVPL 2XTJC 2H1PL 3D25B 2BP3A 2OI9C 1NLBH 5DHXB 1SY6H 4OLYL 4S1SH 3DROA 3HNVH 3QNZA 1S7XB 2JK5A 2PXYA 1GPOL 3PGFL 4ZO8A 4WTXA 2OL3B 1IVLA 2VL5B 1IGFL 1BVLA 4PJ9C 1OAKL 1P7HL 3HAEB 1TNMA 4OLUL 4BK5A 3O6FB 4KI5E 1FNEA 1EEQA 4IMLA 5HHME 4YHLL 3IDYC 2OTUA 4WUUE 3DV4B 4MA3B 3GMQB 1PKOA 4HWZA 1MJJB 2Y25A 1OWWA 2EDKA 5CWSA 2DLHA 4LU5L 3T4AA 5IROA 3PWPA 1CXEA 4MD4B 3KVQA 4KAQH 4APQD 2BJML 5DTFA 1FAIL 2R56H 2PYFB 1U8MB 1KBGL 2HFGL 3L3KB 5B3JE 1QSEA 1NQBA 4JLRA 2XNAB 4LNRA 4FQ2L 5EOCH 1HZHH 3OPZL 2RGSA 4YLQT 2WUCL 4R96B 4ZXBA 3VI3F 1BAFH 1F3JB 4EOWL 4KK8D 4J4PD 1CR9H 2YPLA 5MHSD 3QB7C 2FIKA 4IBLT 1NAMH 5HI3D 4WNQB 5F1KC 1PW3A 3TNNB 4M61B 5IVXE 3BJLA 2A6DA 5LXGH 4GBXD 1X6LA 1OP9A 1NGYA 3MLZH 1A7QH 4LCIL 5TQ0L 4EXKA 5CSGA 3ZSTA 1IC1A 3MLTB 4G43B 5HJ3B 3OZ9L 4MQSB 3V6ZA 2R0ZH 2VE6A 3L6FB 3MLXL 4HK3N 2IAMC 5CEZH 3NIDE 1NCWH 1T7YA 5L8JB 1D5ZB 3K2MC 2F8OA 1PG7X 1RZ8B 4PRAB 1HDMB 3D1MC 3O2DL 4HG4K 4LP4A 2NX5D 2AXFB 2BNRB 2QADB 4PV8A 4XBPB 4ZTPL 3QIWA 5KSBE 1MHEA 4Y4KC 1UEYA 2B5IC 4R7NB 4NQTA 1JK8A 3HUJE 3SKUD 4R4NC 3FFCB 1UXWB 3D85A 1CXFA 5I0DA 5E2JA 1G0YR 4P57B 1F4YL 3MLPA 1KIQB 4KRNA 4LSUH 4N0UB 5HI4C 2X1XR 4NRZB 1ZHBB 3NGBB 4ZPTB 1MJ7H 1J8HD 2C3GA 1RUMH 2Z31C 2VC2L 3MBEA 2R1WB 3ET9F 4M93C 2JB5H 3DO3A 3LN4A 1S9VA 2XTJE 3NIGF 4NKDA 4MJIE 4LIQL 3CDCA 3GB7A 4LMQE 4LGPB 3Q6GH 4Y2DA 2O5YL 1KN4H 1KG0A 4QLRA 4K7PY 1KIPA 1QFWM 3LZFH 2EDFA 3MLUL 1HEZB 1VA9A 3OKEB 3S36L 5ID0A 4QTIL 4NKIL 2J12B 4ESKA 4C56A 4GW5A 4DJMA 4I3GA 1HH6B 3QDJB 1SMOA 3ARYA 4OB5L 5HYSA 4PRHE 4PJHB 1CLZH 3UDWA 5DI8B 2YK1H 4OCSH 2HJKB 4L1HA 5FOBA 1BBJB 3U7WH 5ANMA 4V2BA 3HG1B 5F88B 4WEBH 2DWEA 1A47A 4POZC 1T0NB 3O2WH 2KQMA 4YNYA 3ESUF 4G8IA 2BOBB 5ESVA 1HWGB 3G5VA 4LLUB 4Z7UA 5C1MB 3ZE0F 4PJEB 4M9PA 3AREB 1BQSA 1KTLA 3QHZL 2ICWI 2XYCA 3MV9D 3NAAL 5M94B 2EC9T 4BUHA 3VFWB 4YHYB 3T08A 3DROB 3KYNA 3RX7A 2RIKA 2R8SL 1FZJA 2PXYB 3QCVL 3MV11 2H3NA 1NGPL 1TQCC 2E5EA 3MUGA 4YE4H 5FCUL 3NCCB 3OL2A 3VGHA 1G7MA 4N5UA 4IMLB 2Q86A 1EAPB 4KDVA 1NCDL 4G6KL 2XTLA 5D6DC 4CVZA 4NNXB 5I1KL 4WHYG 3KXFD 4PJBA 3BQUA 5LGHH 5CWSB 4XB7A 3PWPB 4I18A 4QHUA 4ETQB 3GHEL 1F4WL 2CIIA 4QHKJ 4YX2L 1JJUA 4KKCC 3MCLH 5C8JB 5JNYB 4NUGL 4EUPG 1AGFA 2G9HA 3SDXE 1OQOA 3F7YB 4IDJL 4X5XA 1J5OL 1CK0H 1QBMH 4DUVA 1AD0A 1GRWA 3E6FA 3GK8H 1IGCH 4ZXBB 4ZUVA 4WJ5A 4I0PD 1IARB 1UADC 4MQXC 1KTKE 7CGTA 3L5HA 1RZGA 3VXUD 1IAOB 4KK9C 2APTA 1G7QB 3UTOA 4XNMA 1MI5D 5TH2B 5DFVC 1XEDA 1M71A 2A6DB 3QUXA 2X4RA 4JGJA 4KPHL 1I7UA 4LSPL 5TDOA 4I3RL 2ZCLL 4Z0XB 3S96B 1MCFA 1NGWB 4HC1A 3UPCA 3OGCB 2Y07L 4PP2A 3ULVL 5D7IA 4EN3A 3V6ZB 5IV2A 3FO9B 5GJTL 1IC7H 5D7JC 4QXGH 1U8OB 3RVUD 2OCFD 5D6CB 3IJYA 4E41E 2VDLL 4OZIB 2CDGB 4P99A 4PV8B 3NFSH 3KWWA 1PG7L 4QNPE 1R3LA 5J12B 4PJXE 4AQ1B 2EO1A 4MZ3A 4DZ8B 1U3ZA 1PEWA 4Z7WB 1P7QD 1VFBA 2GTWA 3NA9L 4MJ5A 4CVXB 4Y16B 4ZD3L 4QCIA 1FYTD 4RFOL 3P0VH 1EXUB 5GS1C 3HZKB 1S9VB 1YJDC 5K9JH 2E6JA 4FQJH 4OF8A 1F4HA 2FH8A 4B5EA 4NJAL 3OKKB 2GSGA 5D7KD 1M7IA 4G9FB 25C8H 5J3HC 3D39D 5DZLA 5ERWA 1I4FA 2D03H 4Y2DB 2X4PB 4PJDF 2NLJA 1V7ML 3PNWB 5H94A 4XPAL 1UB5A 2V2XA 3NZ8B 2D4DA 3PQYB 1KIPB 4OUUA 4IM8A 1EA9C 5C0BE 3PDGA 1YNKL 3ZZ1A 5IW1A 1H3PH 3RUGB 1DDHB 1YQ2A 3QPQD 1K6QL 4BZYA 4IIQC 1NFIA 4W68A 4GXVL 5GJSH 1FP5A 3QA3A 4D8PB 2VUYA 1NKOA 2NXYB 2VH5H 1SYSA 2H2SC 3GM8A 2BHUA 1C7TA 1MHPL 1T21A 5H35B 3NPZB 3OJVC 4OQ1A 5FOBB 1KCLA 3DWTA 3OR7B 2ZP0T 4PB0H 2QSCH 1FVDB 5ANMB 1LE9A 1T0MB 4KROB 1NCBH 1TPXC 1EFQA 1WZ1L 2AQ3A 5JHDB 2HKHH 1RI8A 4G8IB 1IT9L 3TIEA 5KSAA 5ESVB 3G5VB 2YRPA 3DVNB 2X9YA 3MLYH 2WMPA 2A0LD 1J7VR 3GHBH 1GGBH 2HLFC 1N64H 4AMKL 2GK2A 2BVQA 2EDQA 3P4OA 4ZG1A 1OP3H 4G3YL 2AV1A 2VZSA 2F54D 2BOCA 3VGAB 2ADJA 3EYUH 2WQRA 4PLOB 4TRPL 3SY0B 5DR5H 1RZJH 4WFGE 4H1LB 2HFEA 5E0QA 4LLMB 3OG6B 4NQEA 1NCCL 3IRZA 3LHPL 1O7VA 4XWGH 3MODL 1YA5A 3S7GA 4Q2ZA 1WCBA 4M7ZB 3SE9L 2X09A 5LKNA 1KV3A 2FJGA 4ODTH 4X5WB 1A3LH 4QHUB 2CIIB 4DK3A 5HSFA 2P44B 1OCWL 4NM4L 5EO0A 4IRJA 2FHBA 3O6KH 2BVEA 3LS4L 3IS1X 1S7RB 3T77B 4MD0B 2G9HB 5KBNC 2LU3A 2I5YH 1JYXA 2VDNL 1RK0A 2WINB 1NCUA 4LPVA 1R5VA 15C8H 3TWCH 4HJ0C 3ROOB 4I3SL 3OHXA 4M62L 4RMQA 2ZPKH 4GXUM 4R0LB 3EYVB 4JRWA 5AG8A 5K9QG 3VXRD 1TZHA 1ED3B 1W0WA 3DYOA 3BVNA 4JB9H 1UWXK 1Q94B 3MXVH 5GS0C 2M1KA 2P5WD 3QUXB 3HR5A 1I7UB 4R9HA 1JGVH 2O5ZL 1SJHB 1UQSA 2C1PA 4MA1B 2MCPL 4JFYA 4I2XB 2GI7A 3O9WA 3MOBL 1X5FA 3DX7A 3QUKB 3VMOA 2YD6A 1FSKC 3GBLA 4AM0B 1RZKL 1Z9SA 2ENSA 3EO0A 4PP2B 4BKLB 2VIRB 1GL4B 5I1CL 1X3DA 5EUOF 1AGBB 4OF3A 2CXGA 4HH9B 4OQTL 1X4YA 3FMGL 2FHFA 5AZ2L 1DLHB 2SEBA 4U1HA 2GQHA 1TETH 4J3WA 1GZQA 4MNGA 4K55A 1ACYH 4I77H 5E5RB 4KZDL 4UTBH 1IRAY 4HH8A 4Q6YA 1FO0H 5J1AA 4PJGA 4F9LC 5C09D 5HHOE 1ITCA 5GGTA 5KZCD 2APFA 3CDYA 1INDH 4OV5A 1LMKA 4MJ5B 1VEOA 3NIFE 3RDTD 2Q8BH 1FFOA 4GS7B 3VA2C 1A6AA 3U36A 1RQ5A 4ZUWA 3GNMH 1U2CA 3KPSB 2GSGB 2XZZA 5ERWB 1U58B 1I4FB 4GRWB 4YR6A 4L4TA 1CLCA 3SKOA 3H2WA 4CGTA 4NKQB 1WICA 3MJ9A 5MEND 4UT7H 5C3LD 1KEMH 2BZDA 4K9EC 4PJHF 3NMEA 5MEOA 3QIBD 4X8JB 1JZ4A 1NFIB 1NANI 4Y4HB 1I9RH 5A3ID 4JQXC 4U3XA 5HGBA 4XPHH 4RMUA 4ZOCA 1OP5H 5IJKC 4RBPH 2NTFB 4YWGL 1DBBH 3CSGA 4OKDA 1A4KA 1FIGL 4UILL 5JPNA 5T5FL 3B9KA 5J1TC 4H1LH 1CDBA 4PJEF 5AYUH 1KELH 4KWUA 1HK6A 3LEYL 3FO0H 4XCNB 2EKSA 1BOGB 3FRUA 3QFJA 3S88H 3EJZC 2UWEB 2G60H 3VWKC 2X10A 1I85C 4XTRD 3O3UN 4XVTL 5MP6L 4XNZB 4CN1A 4WENB 5L88H 3QR2A 5B8CC 5FYLL 2DLGA 5DJ6B 4X0KB 1BIIB 4R97B 4D94A 5DGQA 4PJ5E 1ULVA 2IAND 2BOCB 5GRUH 4P4KA 2ADJB 1I7TB 3QXTA 5GRWA 3V0VA 2GHWB 3U0PA 4P9HH 4P2QD 4JEGB 5HVWA 3V6OC 4MAYD 2Y5EA 2QKIB 1QBLL 1T1ZB 1QR4A 5F9JA 3D0VA 4JAMA 3AFLA 1RFDL 1VGEH 5ALBH 2P7TA 3RKDD 5JQ6H 2FJGB 2A73A 2P1YA 2VXUH 2WWMD 5D1XA 3DV6B 5DUBB 3O4LD 2NY6C 4ELKB 5C07D 1IQDA 4IRJB 3DJ9A 2W59A 2EXWD 3X13A 2D7OA 4TTGA 3MV8A 4Z6AT 3WS3B 5IMOA 2FO4A 3PHSA 4Q0XH 1V05A 2XKNB 2ZNXA 3B5HA 2IH3A 2AK1L 1TDQA 3NCBB 3BSZL 4KUZH 5T3XD 5ADPH 3LN5A 3UTTB 1IAIH 4JFDB 5CD5C 4OCXH 4TNWF 2AABH 1TZHB 3VD4A 3L1OL 2HTKC 4XP4L 2EH8L 4AEIL 4LSRH 3HR5B 2KUTA 3N1GC 5D1QA 3S5LB 5D72H 4JY5H 3EO0B 4HIHB 1DVFA 3WXWL 4NN5C 4OZIF 5CZKA 2YZ8A 3OB8A 4LLDB 4FABH 1T1WB 1CU4H 2EDEA 3EJJX 2DQEL 5A16B 5EOCJ 1RVFL 3U30C 4JQIL 4GRWH 3O8XA 3RHWK 4U1HB 3GJFB 5HYJD 1MIEH 5SWSA 4NQCA 2L7JA 4MNGB 5C2BH 1RURH 4OLXH 1YPZE 5TF0A 3WXVH 4AH2A 3FONA 4LKXB 2AKRB 4ISVA 1RY7B 1QSVA 2FBJL 2JCCB 3MZGB 1DSFH 4Z7WF 5BS0E 5I16B 3UC0L 3U6RA 1CDJA 1XGQA 3RX8A 3VRLE 1ZLSL 5JORB 2GJ6E 2H8PB 2AXHA 3J8F7 2Z92A 3EDKA 5D2LE 3OXSA 3ULUL 4HUWA 4OV5B 2JJWA 5GIRA 4RMVA 1FFOB 3O6ML 1A6AB 1LP9E 4ZUWB 4OIBA 2I27N 2PR4L 1BLNB 3G5YA 4M43L 3C6LC 2EXYD 2OR9H 3CFJA 3RUGF 3BUYB 3T0DA 4GQ9H 1G0XA 2J6EL 1G7PB 1I3UA 2ADFL 4JR9H 3T0BA 3KDMA 1Z9OA 5FUOH 2AJSH 5ITBL 4QRPD 5E6YA 1CL7H 1BJMA 1RZFL 3HE7B 3RTQA 1ZT7B 5HGBB 3VU2A 4XI5C 4P5TB 2H2PD 3ZTNH 4R2GC 5JPNB 1ZHNA 1P6AB 3SCMA 2EIZB 4I0KA 3WFBL 4DZBA 1XGPA 2YD5A 1DBJH 2NYYC 1MHHA 5I1EL 4HXBH 2CGRH 3QFJB 3PF2A 4C83A 3T0EC 4LCWD 1AGDB 1WBZB 5E1AB 5DEGA 5C0AE 4ODHL 4QRRB 4QT5A 4UZGA 3U0WL 1EEZA 5CZVL 4WU7A 4HIXL 4ORZC 5FB8B 3QDMA 4NRYB 4HSQA 2BY3A 3VFPA 2P45B 3QDHA 1GHFH 5AYQA 4KTEL 4KZEH 3O0RL 4P4KB 4KHXL 4PJFA 4M3KB 2JELL 4QRSA 3G04B 3TN0B 1LO2L 3DVIA 1I8IB 3BEVA 4RISH 5EZIL 1G6RB 4X7TA 1LDPL 1N6VA 1ONQB 3RAJL 1B6UA 3WFDH 2AK4E 3F7VA 3D0VB 4JAMB 4MNQD 1K3ZA 5ESAA 4BZ2H 3OKOB 2A73B 1N26A 1AP2B 3DIFA 4PJ7E 4FFZH 5E4EC 3LMJH 3CMOH 1O0VA 1CF8L 1RHHB 4JO3H 4KUCF 4U7MA 5GGVH 4G6FB 1U3HA 3EDDA 3H3PH 1FYHB 3REWA 3HC0A 3I50H 5CLWA 3GJFH 4P2OA 1QP1A 5T1LD 2V17H 3BD4A 5DFWH 1Q9OB 4RMWA 3ZE1E 5E6IC 2A6KB 3WLWD 5CS7A 3DUUB 4HX1A 5CJXA 3NFNB 1CD1A 1Y0LA 3TH3T 3LKOA 3LS5H 3K8LA 4L5FH 4JDTL 4KKNA 3GI8L 1A6VL 4MMZC 1EEYA 5DRWB 2CLZA 1A1NB 4Y4FC 5JMRA 3DGCR 1JHLH 1ROWA 3O6LL 4J23A 5MEQB 3VDBA 1FV1A 1GSMA 2NY1D 3O3BB 5MI0C 3DSFL 2AVGA 3W11D 1INEH 3OAZK 4K3DL 2YKLL 3U4BL 3UBXI 5C08D 3L5XL 4Q9QL 1ZK9A 1H15A 1ZWIB 3V8CA 4XCEB 3LB6D 4KKBD 3C8HA 4LVNB 1WAAF 4ISVB 4NNPL 2R29H 3B9DA 1VSCA 4P59L 4ELMB 2QBWA 3U6RB 1DUYA 3F58L 1FBIH 4GW4A 1DQLL 2Z92B 1OPGH 4J7RA 2K9UA 5JOPE 5D93C 2R15A 3T0EE 2A74B 5F6HJ 3D0LB 1P4IL 1DBKL 4GRWF 1CLOH 4L3CA 4ZS7H 4L8BA 1FZOB 1A14H 5B38G 3AROA 1MJ8H 3SJVB 5DK2A 4OGXL 4P46B 5EO1A 4O9HL 2AXJA 4TTDC 4X9IA 4QO1A 1DBAH 2NY3B 2X42A 1XH3A 4Q6IB 3P77B 3H3BC 2HRLA 4MVBC 3DHMA 5SWZE 5C7XL 3KDMB 4L8CB 3RWJA 3X3FH 5LWYH 3RTQB 5CKGA 2EDLA 1MFBL 5DD3H 4W4OC 2EDJA 1KUMA 3RQ3A 3SCMB 1G6RH 4Y1AE 3BP7A 2R0LL 2UWEF 1KJ2B 1XGPB 3KPPA 4UBDC 4X4ME 2YC1B 4XP9L 2H32B 2BVTA 5K9KB 1FYTE 1H9VA 4C83B 5FGBA 1G9MH 2VLJA 4O2FA 1NEZA 3IDXH 5DEGB 3MOQA 3FCTB 4MAUL 5TF1H 3T0AA 2ED9A 3P9LB 2V7HA 3ULUC 4WU7B 3W82A 3EFFA 5GPRA 1AR1C 4OCYL 5D71L 2BNQE 2QV2A 3VFPB 3MACH 2F19L 1SM3H 3M17B 3QULA 5CCKH 1RU9L 4U1KA 3GJEA 3OKLB 4WGWB 4F8QA 4LPWA 3HMWL 1D9KC 2AJVH 5IBLD 1DANT 1RMFH 3KPLA 5A43C 4ENEC 2I25N 4V1DA 5IFJA 5TE6H 2AJYL 2X89A 3O45A 4FNLL 4UUJA 3SPVA 4HQQH 4JHWL 5F72S 2WIIA 3QEGH 2DKUA 3QEUB 1KJMB 4E5XA 2OXHA 3AB0B 3VRJB 5EFIB 4PUBL 1RK1B 4X6DE 1UACH 5JIPA 3DIFB 4JGMA 1UB6B 4GRLA 1NLBL 3O3AA 1SY6L 1I1FA 3CCHB 4S1SL 4YDIH 3JVGA 3ZL4H 2GAZB 3HNVL 5FV2A 4JDZB 2LFGA 3BGFC 1F4XH 3T3PF 5CGYC 3ARGD 1N4XH 4NBYB 3REWB 1F45A 4TNVK 1YN7B 5KSVA 1H5BB 4U6YA 2EIDA 5FGCB 2ARWA 1JPTH 2XWTB 2L0DA 4UT6H 5FDYA 1QTYT 4WFFD 4N9GB 2R2BB 3RJDA 4U1LA 5F93C 5CFHA 3VXMA 3LKOB 1LILA 3FB7A 2GW5A 4NSKB 4LLVB 1L0YA 1NMCB 3MUZ1 2D31B 5GGRB 4F7EA 4KAQL 1D7FA 1L6ZA 2VITB 3BPCB 4NNYA 1SEQH 4XNXH 1DR9A 5CINH 2R56L 4NQXB 4RGMB 2IWGA 3QJHB 5C6PB 1A2YB 5EOCL 2FCBA 1HZHL 3RFZC 3FN9A 4JANA 2JCCF 3MPCA 4RMSA 3I02A 2OTPA 3ISWA 1BAFL 4B0MM 2R1YA 1IC5H 4KVNH 1CR9L 4KJYB 5KTEH 3U9PH 3H9SE 1JPGA 1CDYA 4XMPH 5IB4B 4HUKB 2OXGA 4G6JH 4J3OC 1HILA 4ZO6A 2MHAA 4Z18A 3JWDH 3OF6A 4HUUB 4GW4B 4Y8AA 3MLZL 4KHTH 1A7QL 4CNIA 3MRIA 3VXRE 3WL9A 3OR6A 1BBDH 1DN0B 1F11B 2NZ9D 1VADA 3WS6A 1HH9A 2R0ZL 4AT6B 1G84A 4L3CB 1HHIA 4PIRF 5CEZL 1KJ2H 1NCWL 3CH1A 1U42A 3HPJA 3ULUE 2DIAA 3KPQB 2IQAB 2GJZA 3C2SA 3QDGB 2H32H 4YFLF 5DJAB 1NKRA 3RWIA 3DXAE 1XF4B 5EO1B 4P2RE 5F1OB 1K8DA 2N7BA 2HKFH 2AQ2A 5BZDB 4L4VA 4X4XA 3K8KA 2HJFA 1KCSH 1A4JB 5L2JA 1PDKA 3SKNA 43C9A 3H7BA 1EHLH 4LSUL 1T2JA 2XFXB 5HDOA 1F42A 4KQ4L 1MJ7L 1MLCB 1C7SA 5B39A 1RUML 3QIUC 4MMXC 2JB5L 4IRSA 5IUSA 3MRJA 1DUZB 4G9DA 5ADOH 1WZMA 4W6WB 3KPPB 3WLBB 4NJ9H 4XXDA 3Q6GL 3C5ZC 1KN4L 1AQDB 2VKXA 4O2FB 1TVBA 2M2DA 3B2UC 2OZ4H 1HKLH 1ZV5A 3EFFB 4O4YH 4ZAKC 1QSED 5BVJB 3LZFL 2X4OB 4HEME 4CW1A 5F9WC 3GJEB 4RDQF 1GC1H 4RWHA 1PKQA 1CLZL 2ESVA 2YK1L 3KPLB 4OCSL 3CSYA 2EDTA 2MQCA 3ZTJG 3U7WL 2P5ED 4LLYA 4V1DB 1UGNA 3DVFA 4WEBL 3SPVB 3O2WL 1HYSD 1G7LA 4I5BA 5IB5B 1C08A 2WIIB 3SDDC 1NL0H 1P5UA 1PG7W 3BN9D 3BH9A 4LP5A 1VPOH 3SE3C 1HOCA 3T65B 2PW1B 2FATH 4QEGA 4Q9CA 5M7QA 1KC5H 5IK3A 5F9OH 1ZVSA 5EO9A 4JPIB 3O3AB 1FNSH 1FFRA 3KAAA 3LPFA 3ULVD 1FORL 5FYJD 1IC4L 2X4QB 3TPKA 4UI2A 2CIKA 3FQWA 4L9LB 5DK0B 4LPUA 4JFPA 5CP3H 5DQ9B 2HLAA 4YE4L 1G9NC 3CZFA 4P2YA 3QIWD 1U93B 4WVRA 2BCKA 2QTEA 5CEXB 2JB6B 3D85D 1JNLH 1DEEA 4HULB 1XF5B 3CFDB 2LE9A 1AKJA 4JPWH 2X9XA 5LGHL 3PV7A 1A02N 2CDEB 4Y19E 4F7EB 2VLKE 4EDXA 3MCLL 4OFIA 1G0DA 3RGVD 5DEZA 3PWVA 3DECA 2GKIA 4G6MH 1I1AD 3OX8B 4JG1H 2EDNA 3GSQB 1KYOJ 4RGND 3BH8A 1Z0NA 1CK0L 5D8JH 5IEKB 1QBML 2EYRA 1ZHLA 2ZUWA 3GK8L 1IGCL 1P4LA 4ZFFA 4ELMF 1S9KC 2R1YB 3QSKB 4Y2OA 3W0WD 3MJ7B 3IFPA 2R9HD 4R7DB 3IDUA 2FYYA 3GIVA 4EI5C 3G5XA 3IKCB 1QRNA 1S7UB 4JJ5A 4CVWA 5GISH 4OAWA 3MRIB 3WL9B 1MFDH 3O4OC 4PG9B 3PDOB 1XIWD 1VADB 4MA7H 1HH9B 4LLQA 4M8QA 3AM8A 4K3JH 3X14B 5FECA 1IC7L 1HHIB 4QXGL 2VDOH 3IJHB 3CH1B 3KS0H 3ESVF 3HPJB 3LV3B 3M07A 3QO1B 1X5HA 4ZFZA 1JFQH 5EU6A 4OF6A 1YC7A 2QSVA 1J0ZA 2GFBB 3FHAA 3LKNA 3PJSA 1K8DB 1ZGLB 2BSSA 1QPXA 3NFSL 5E8PB 4D0DA 4JZJC 2K3TA 4N0FB 5HYJE 1ADQA 1TQBB 4TN9A 3SKNB 4KFZC 1P84J 3QEQE 2EZ0D 4BFGA 2FECL 3AAZB 4HIJB 1ITBB 4IRSB 3P0VL 4QHLA 2NY2C 1EFXB 1ZT1B 3MRJB 3P9MA 1L4IA 5K9JL 3GSNB 1TCRB 4FQJL 4G80A 25C8L 1T7WA 4UOW1 2D03L 1ZVHA 4U1MB 5HHVH 1LE5B 5FO9A 5TE4H 4X6BB 3QUZA 4M5ZH 1QLEH 4NO0D 4GG6A 4F33A 1EJOH 5ITFB 5GJSL 5DVMA 1RPQA 1FNLA 4BA8A 2VH5L 3GGWA 3ZE0E 1Q0XH 1J12A 2XZQH 3OKNA 4FA8A 4N0CC 4P23C 2B8OT 4X98B 1ZHKA 2ZG2A 1P1ZA 3BIBX 4PB0L 2QSCL 3GSOA 3HE6C 4ZUSA 4HJJH 3MNVA 1AC6A 3L7FA 4KXZI 1NCBL 1AD9B 2HKHL 3PHQB 4IHOB 2EDRA 3IYLW 1YEJH 2VAAB 3FRPA 3MLYL 1L7TH 3GHBL 2CK2A 4KKLC 1CDHA 4NQSB 1GGBL 4NKOA 5DZOA 3SDAC 1ZVSB 1N64L 1C5DA 3PE9A 4JFXA 1VACA 5T1KB 1OP3K 4RNRA 5D2NA 2XZAL 4R3SB 5FO8B 2VDQH 5AD0A 1TJGH 3FQWB 4JFPB 1S9YA 5L2KA 3EYUL 4C4KT 3DVGA 3ARDC 5DR5L 4XCCH 3QUMA 1RZJL 2VXVH 1UENA 5HHMB 4R6UA 4XWGL 3DOSA 4UQ3A 1WF5A 1HCVA 4WUUB 4NZJA 4ODTL 2YMXH 3DTXA 1A3LL 1VCAA 2YA0A 1T22B 3O6KL 5I66B 3O6FC 4G6AC 3TBSA 4KY1H 3BP6A 2I5YL 1G7HA 2HT3C 4OGZA 4KGLA 1NPUA 3BH8B 4W4NA 3UMTA 1E28B 2HVKB 2KZWA 5DC9B 3FN3A 3TWCL 3BZEA 4WI8A 2YA2A 2ZPKL 5I15H 4U6XB 1N59A 5M95B 4QKXB 2DM3A 3RZCA 3BMVA 3IFPB 1A1MA 5HD8C 4F57L 4JB9L 2PETA 5DMIH 3GIVB 3MXVL 1OM3H 5DMYA 1TXKA 4G42B 1JGVL 4JJ5B 4DKEH 4P0DA 4GKZA 3CVHA 1T5XA 3LKQA 1ZOXA 1A6TA 2HA1A 2E6PA 2VOTA 1K4CB 5BW7C 4QRUA 4H0IA 5J11B 3K2UH 3VWJD 5JXAH 5KVGH 4NN7B 3SKJH 1IL1B 3GSNH 1NC4D 4XPTH 1ZEAH 1N5AB 2FSEA 3VH8B 3F12A 3E8UH 5EB9A 4H25A 1QSFE 3ARFA 3ZE2E 2Q76B 4NCDA 4D3CH 1TETL 1J0IA 1I7ZA 3WN5B 2BSSB 3OJ2C 1ACYL 2GY5A 4I77L 1S8DB 3NABH 5KG9A 4WHCA 1MNUH 4BQ9A 1EPFA 2GYSA 3OWEA 4UTBL 3SGDH 1CG9B 1QLRB 4MYWB 4RGOH 5KSBB 5D96B 2ICCA 5FYLD 3BGAA 3HUJB 5E7FA 4WDIA 2YD1A 4DCQA 1A0QH 1INDL 2BY1A 4X9HA 4JFFD 3F7PC 3UTZA 4M1GH 2Q8BL 2QADC 5J8OA 1GZPA 1MFCH 1RV6X 4M02A 2KBGA 3GNML 4U1SB 3BP4A 5DK3A 2X4UA 4F58H 2DMKA 3TZVD 5IEHA 3TCXA 4MJIB 2VAJA 1Q9KB 3PL6A 1MOEA 1KF9B 3QUZB 5DJ8A 3NGBC 5AWNH 2UV3A 4UT7L 1KPVA 1KEML 3ILPB 5IMKB 2G5RA 4X9FA 3IKKA 1NSNH 4KRPD 4XRCA 5CUSH 2MTPA 4Z7NE 2JIXA 2Q1EA 5I6XB 2ICWA 2I07B 1KPUB 3QO0A 1I9RL 1DQQB 1OP5K 4RBPK 1AR2A 4QOKD 4ORGA 3MQIA 2NXZD 3IDYB 4XPHL 4RZCA 1X5LA 1PQZB 2X4TB 1AO7D 1DBBL 3VE0B 5GHWH 4PGDA 4PRHB 3BAEL 2X4SB 3TPUA 3MRDA 5B38B 3GSVA 3L7FB 2C9AA 1CQKA 5AYUL 3HCVA 1KELL 5EZLA 2CMRH 3FO0L 1MAKA 4UINH 4EZMA 1IGYB 3S88L 2W9DH 1GOFA 4WW1A 2G60L 3HPLA 3MRBA 1RIUH 3T8XA 4CUCA 4MXQD 4EXPX 4NKOB 4CBPA 3MOAH 1C5DB 4M00A 1VACB 5L88L 4RX4A 4LRIC 3RVWD 3E6HA 1B2WH 2OJZH 3TVMA 3TA3A 2OR7A 4MZ2A 3ZT7A 4NQDD 5EULV 5GRUL 1X4ZA 2WBJA 3VFMB 5L2KB 4HPYH 4JFEA 3KLHD 3CPLB 4KKAC 4P9HL 3DVGB 1ZANH 3ZYJA 4L8SA 2BSRA 2C7UA 4YO0A 3RNKA 1A3QA 4FQQA 1MAMH 4OZGE 2J5LB 5ALBL 1VGEL 5FAAA 5JQ6L 2PXYC 3VXSD 5FEBA 2IAMB 4JM2B 4QXWA 2VXUL 2Z35B 5JXEA 4D9RD 4PRPD 2UZIH 3TBSB 1S5HB 4JKKA 1Z5LA 3BP6B 4HT1H 4MJ6A 1HQRB 5ISZE 4Q0XL 3TJHC 3GM0A 1CXIA 5DD5H 4KUZL 3U79A 5C9JA 3MYZA 2W07A 2B5IB 2E8YA 4HDIA 5DVLA 5EU5A 1D6EA 1FFPA 3L3GA 3BZEB 1IAIL 2KQNA 4QHMA 4OCXL 5IROC 4BSWA 5CJQL 1A1MB 2AABL 1RUAH 1A5FH 2PNDA 1F2XK 1UKSA 4J8RA 1OTUD 2DRUA 2FR4B 3HMXH 4LSRL 3SKMA 4CDGC 2Z31B 4YJZL 3TBYA 5D72L 4NGHH 4JY5L 4ZO7A 2G5BB 2Y7QA 4R26H 4QRUB 4YXLH 1R3KA 4GAYA 3B9KD 4ZXBC 5C2UB 1A6UH 4K94L 4FABL 3LOWA 4H0HB 1A9BB 1CU4L 3REVB 3OGOE 1FLRH 5A40E 4H25B 1K8IA 1ZSDA 2X70A 1H3GA 1MIEL 3MFGB 2D0FA 5DC0A 4E41B 5C2BL 1F4AA 1RURL 3OXRA 4OLXL 3WXVL 4WW2B 3IXAA 4JCLA 3BP5A 5DJZA 1YEDB 4PGCB 1DSFL 3EO9H 5KSUB 2IFFH 3EGSB 5E9DE 4U1IA 4BFIB 1QFWI 4HUMB 2DDQH 4PJXB 5KOVC 4M7JH 2FJFA 3JTTB 1REIA 2P24A 2R2HA 5CGTA 1DQJA 2DTMH 3BP4B 1NMAH 5FA4A 2X4UB 1U8IB 4ODXB 3RBSA 2R2EA 5JDJA 1HHHB 3LKPA 4XVSH 4GKNA 3ZKND 2N56A 4LRNH 4GG8B 4XNQA 4GQ9L 1A1OB 5KVEH 3MZTA 4Y16C 4JR9L 3MBEC 2VLRD 3ZDXE 3DMMD 5FUOL 2AJSL 1N8ZA 2CKBA 1CL7L 2VSCA 3X12A 5C0BB 5F3BA 4OD3H 1G7IB 1SMAA 5DA4A 5ETUA 4Y2DC 3ZTNL 3Q6FA 2ADIB 2PTUA 4PGDB 5B22A 3TPUB 3MRDB 3Q2CA 3MUJA 3HCVB 5EZLB 1AGCA 1DBJL 1EUTA 2NNAB 2HTLC 2Y72A 4HXBL 4MDIA 2CGRL 2IBZX 5CILH 5HDBF 3HPLB 5I17A 4HUVB 3INUH 2FEDD 4Y89A 1VHPA 3UDWC 3VD3A 4K23H 3MJGX 1XAUA 2FD6H 3W39A 3HB3C 3E6HB 3PWPE 5GSRA 1GHFL 4D0BA 1YMMD 3KYMA 4KZEL 1QSEE 4J1UA 3WIHA 4JFEB 4LK4A 5I1IL 1UCTA 4KI5F 2IPUG 4L3ED 3BWAA 2WAHA 4POYA 2F53A 5I19H 4UDTB 2C3VA 4RISL 2A6IA 3RNKB 4CDHA 1LNUB 5JO5A 2IGFH 1M05A 1KLGB 1QO3A 2YPLE 3HZYB 4BZ2L 4OFKA 4TQEH 4DOHB 3PGCB 5D7JB 2I9TA 3P0YH 1KJVA 3VGAC 2NY0B 1JGDA 4D9QD 1JYNA 1BJ8A 4XPGH 3DURB 4FFZL 3LMJL 3CMOL 5B3JF 5FYKU 3LD8B 4JO3L 1Z5LB 5GGVL 5GRVK 4F7MA 5HXMA 2X4NA 4WFHE 3GJFK 3LQMA 3H3PL 2JTDA 3AVEA 3I50L 3DI2B 2FZ3B 4XT1C 5A2IH 5I8OL 4HDIB 3VGFA 2F58H 2HMID 1P2CA 2V17L 1FFPB 5FYJE 4M7ZC 4JRXD 5IMLA 3BQUC 4ZQKB 4QHMB 5ICYA 1KB9J 1KENH 4FG6C 4I18C 1NAKL 1KPRB 2ARJA 3WO3B 3PIQA 4AIZB 5BCAA 1XCTB 3LS5L 4L5FL 1XGUA 3TBYB 5IT2H 1T7ZA 3D9AH 4N1EA 2YHGA 4ZDHB 5HPMA 4FFVC 4GAYB 4S1DC 3NZHH 4DKDC 2IALB 3NIDF 3VFNA 1JHLL 4EUPA 4M03A 1ZSDB 2W65B 1YMHB 3CFCH 5F7KC 5D1ZA 5I1JH 4LHUD 1INEL 3RY5A 2VUOA 3QUXC 4APQA 2XN9A 4MA1C 4PLKC 3IXAB 5KSBF 4HF5H 1D5MA 2J88H 4MQTB 3QDMD 3HUJF 2OLDA 2ITDB 4JRYD 4EN3C 2R29L 3V6BR 1MUJA 4TULH 3JBG7 4EDWH 5F89B 3IGAB 3H0TA 4U1IB 1IM9A 1FBIL 1JTTA 4LEOB 2F15A 1OPGL 3HN3A 1T20B 1Q38A 2AQ1A 4J4PA 4C56E 3FB5A 2XA3A 2FJFB 2PW2B 3IFNH 5IG7A 3AC0A 1CLOL 2YUWA 4OGAC 4ZS7L 1TCMA 1AIFA 3KS0J 3QH3A 4KDTA 1A14L 4PRID 3TO2B 2QQQA 1FRGL 1OW0C 3RL1A 1ES0B 2YEZB 5GRJH 4U6HA 5ANME 4W6XB 4E42A 2ZUVA 2P8MB 3EOYG 5DHVB 3OKYA 1DBAL 3FQNB 4Z7UE 1U3HD 1M6OA 3LH2H 1MQKL 4PJCA 5IBUG 1IKFL 3O2VH 4K94C 4PRBA 3JXAA 3X3FL 5LWYL 3X12B 2NX5A 4X99B 3JV6A 4P2OD 5ETUB 4MNHA 3QXAA 1KACB 5CGMA 1G6RL 1IGTA 3O11A 1AGCB 2KKQA 3TNMA 5GRZA 3QQ3A 3EUUA 1BX2A 1G9ML 4ZUTB 5I1DA 1A7OH 1J8HA 3IDXL 4P9MH 2LQRA 2GK0B 3IFOB 3V4PH 4PJBE 3SDCD 4DEPC 3VXTB 5BXFA 2OK0L 3MACL 1SBBA 1SM3L 4D0BB 3KYMB 5CCKL 5EA0H 3PWJA 3ULSB 5KSAC 2AJVL 3PV6A 1RMFL 3H9HA 4PJ5B 3BWAB 1JNJA 3SEPA 4WHDA 2DQCH 4XNZC 5TE6L 1CGUA 1M05B 4JM2F 4HQQL 4S2SA 1WIPA 3QEGL 5JW4M 3OPZH 4AK1A 1MWAB 5GRYA 5I8KH 4F3FB 4XNYH 1YJDH 1KJVB 5GZOD 1AH1A 4K7FA 4R4BB 1UACL 5DMKA 1XF3B 4HS3A 1U36A 2ICES 4YDIL 3ZL4L 1S9XB 4F7MB 3SDXF 1F4XL 4C57C 5D7IE 5CEZD 1K4DB 1N4XL 3G08A 3BRGC 4QYOA 3QG6B 5JW3H 2C26A 2ZG3A 2F5AH 2PYED 1P9MA 3Q3GA 2NY4D 4DFIA 1G1CA 3MV9A 3K4DA 2NW2A 1JPTL 1JF1B 1FNFA 3Q1SH 1FNAA 5CBAA 4UT6L 2ARJB 4IRJC 5LAXB 3PIQB 3X3GH 4JPKH 5GGSB 4WEUD 5TDPA 3MRLA 4M9OA 3FTGB 4PR5B 3QPXH 3PWNB 2FLBT 1XGUB 1PYWA 5T5NG 2BXZA 4I0CC 3HTLX 4KKLD 4XNXL 1SEQL 5IF0A 1OL0A 5CINL 5J6HB 4KJPC 5F97E 5C0IA 1TIUA 2YSSA 1EGJH 4WW2F 1JWMA 3KXFA 4U7SA 2ITCA 4PRNB 1FL3A 1I8MA 3DARA 3UEZA 3SGEH 5DHVH 4APQB 3NFPA 1IC5L 4KVNL 3O9WC 1N3NB 1IGMH 3QXDA 4QNPF 1EVTC 3U9PL 1D5MB 5KTEL 2NR6C 4XMPL 4NUJA 4P3CL 4PJXF 1MUJB 3STZA 4G6JL 1ORSA 3JWDL 2ATPB 3H0TB 3N1PC 5DUPH 4KHTL 3BYTA 1NMBH 1BBDL 4I0PA 4ETYA 3FB5B 3G6AB 2GJ6B 4NC2B 2VL4A 3VXUA 3UP1A 4HKZA 2CXKA 5D2LB 3S36H 1W72B 2EC9U 1KJ2L 1MI5A 4KJQD 5MEPB 3F6LA 3VWKB 3G5ZA 4YHPA 4HZLA 4GBXB 5F7DB 3MRPA 4GKSA 4L29A 1X44A 4UOW0 5B8CB 3EHBD 2HKFL 3LQZA 4ZMAT 1KCSL 1T5WA 4PJCB 3TO4D 5E24E 4NWUH 4YBQD 1INQA 4N8VB 3NA4A 1OARH 2NX5B 4KK6C 3MBXL 3JV6B 3MRHB 5KN5B 1EHLL 1OSPH 5F8QC 5IB2A 4H5SA 3QXAB 1OGAD 3NAAH 4UAOC 4YHIA 2VQ1B 3EYQD 4D9LH 5GS0H 3QRGH 1JZ7A 5ADOL 1IGTB 1WK0A 1TJIH 3DX9B 3TYGH 2NMSA 2A9MH 5HVFB 3QQ3B 3NTCH 2NY6B 4NJ9L 1BX2B 1MWAH 2FWOB 3QQ9D 1P7QA 3KPNA 2DM2A 3FOLA 1J8HB 4NQEE 1EZVY 3HE7C 5EOTA 3VG9B 2OZ4L 32C2B 4IDLA 1HKLL 4OLZH 4E0RB 4O4YL 5BXFB 4WWKA 5C0AB 2WZPD 2BERA 2DAVA 3D39A 1XMWA 4R90H 4KJWD 1GC1L 3K7UA 3SO3C 3ECBA 5BV7C 3PP4H 2HN7A 3U0TB 3TP4A 5IQ9B 3H9HB 5IB1A 1UM5H 4RFEA 5DSCA 2BNRD 1YEHH 3RIAF 3G6JA 3FKUS 1J5OH 4LGRB 4OI9A 3WNMA 1NL0L 4ODWA 3FFCD 4PLJD 4GKOA 1VPOL 1YEFH 4NN5B 3GZKA 2EDXA 2AK4B 4FQLH 2FATL 4K7FB 4P4KC 1Q9LA 5F9OL 3ZSSA 1FNSL 3FO2A 4PYHA 3U30B 3VFRA 1J11A 4AG4H 5GGVY 5IVNA 1JWSA 3VMNA 4PJ7B 4A6YB 1N6UA 4K9EH 1T1XA 2F74A 5D1XC 3UBXA 2CH8A 4KK5C 2ZOLA 4MNGE 1LO5A 1JNLL 3BEWA 1CFSA 2F54A 4JPWL 3QI9A 3L95A 3HI1A 3MA7A 4PJGE 4CADB 4CU8A 1NLDH 3I6GA 3AU1B 5DD6B 3C6LB 5C0IB 2NY7H 1W72H 1S9WA 3AMKA 3QWOB 2YRLA 4NKMA 2BC4A 5DWUH 4G6ML 4D9RE 3W9EA 4JG1L 4L8DA 1E4XI 4HKXA 4MB5A 3GSWB 5D8JL 2AV7B 1FL3B 1I8MB 1LEGB 4HWBA 1AQKH 3IETB 2WANA 1SJVA 1FG9C 4LVHB 3QXDB 3L5IA 1X7QA 4L4TE 1DVFC 3ARED 4NO3A 1PVHA 2MQ0A 3STZB 1J87A 2UYLA 4NRXB 1KJ3H 1FFNA 5JHLH 3IAQA 5FV1L 4R2GB 5GISL 4MD5B 1SVZA 2ESVD 3FB6B 1OB1A 2YPVH 3O8XC 3NIFF 4MA7L 2UZXB 4K3JL 2W60B 3VXUB 1QHOA 2WWKT 3C5SB 4HKZB 2VDOL 3HC4H 2O26U 3PABB 4WEMB 4HK0B 1JFQL 2OMNA 4GXVH 1T89A 3KJ6H 4GAJH 2P5WA 3UPRB 4HZLB 4GKSB 2WWKO 3MA9H 3GMNA 3L3IB 4NO5B 3HAEG 1ZGLM 2EEAA 4HGMA 3IDGA 1S78D 3QFJE 4U3CA 3C8KB 3PG2A 4DK6A 3IDJB 4L1DA 1T5WB 1U91B 3B83A 3QNYA 4YIQA 4Z77A 1B0RB 3U82B 5CHNA 5JOEA 3KPTA 5DO2D 5HTSA 4PV9A 4P46C 4I8DA 4M1DL 4MJ2A 4YHIB 4WHTA 5L0QC 1DE4B 4HKBB 4XPFH 2WLZA 5C09A 4OZFA 1SQ2N 2E7HA 5H37G 2XG5A 2C5DC 4BQ8A 3VXOB 4TUJB 1CT8B 4HIIB 4EEEA 3L5JA 4JKMA 9CGTA 3E3QC 3BPLC 3FOLB 4HK3J 5HHVL 1ZLWK 3HZMB 1BPVA 3RTQC 3EBAA 1FYTB 2R39A 4FFWC 1YY8A 4ODSH 3RDTA 4DUWA 1T3FA 5TE4L 4OUOA 4P4RA 1QLEL 5DQDH 4OGYH 3KPRA 3VXNA 1HSBA 5FOJA 1EX0A 4O51B 1EJOL 1NCCH 3M8OH 1FC2D 3SCMC 4BQCA 3D39B 4G8GD 4A6YH 1NCTA 1UM4H 3ECBB 2BNQB 1Q0XL 2XZQL 3MXWH 5E6IB 3MV8E 4NCC2 4YH6A 4YQXH 1ZTXH 3FQXA 4NM4H 3FT2A 3OV6A 2BFVH 1T4KA 5MENA 4OFYD 3LS4H 4YAQB 4XXCA 3ZMRA 4LCYA 4BUGA 3QEHA 1UEMA 1NBYB 3C2AH 1YEJL 2KDGA 3LEVH 5EU4A 3RWGB 5DEFB 3CFIC 1L7TL 2ATKA 4Y4FB 1U8PA