3QEUA

The crystal structure of tcr dmf5
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
201
structure length
195
Chain Sequence
KEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVNFGGGKLIFGQGTELSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWACANAFNNSIIPEDTFFPSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TCRs Used in Cancer Gene Therapy Cross-React with MART-1/Melan-A Tumor Antigens via Distinct Mechanisms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords DMF5 alpha chain
total genus 37
structure length 195
sequence length 201
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qeuA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qeuA02
4G9FE 2H9GA 3HPJA 4AIZA 5ID1A 4NYLB 5EPMB 3MLWH 5I9QB 3DMMC 4GRMB 4KTDH 4MVBD 1BJ1J 4Q6IB 3BKML 3QPXH 3QHFH 5DFVC 2X5PA 4OIBA 1FO0L 3ZE0E 1YQ2A 2XQBL 3VJ6A 2VR4A 3I75B 1PZ5A 4R7DA 1G7LA 4Z7VF 1QLRB 1RZGB 4QWWD 4WO4A 1X5AA 1FDLL 2APXA 2Z31B 4JY4B 5DHVA 3MRJB 4S0SD 1GZPB 1YYML 4PJGA 4N9OB 1OM3L 4HIHA 5EDXA 2NY1C 2VLRE 3KPRE 3L6FA 4KKAC 1XFPA 2XZCL 4NWUL 4YPJA 4K94L 1KXQE 2ARJA 2DM4A 1AY1L 3NIFE 2HWZH 1Q0XL 4HX1B 2NR6D 2RCSH 3HAEG 5EOCH 1N5AB 5TDPB 1CLZH 4J3VA 2ZUQC 1FGNL 2PR4L 5KVGL 3ROOA 1SJVA 4YQXL 4JRYD 3ILQC 4X7TA 1MOEA 3TH3T 4BM7A 5DJCA 4P9ML 5FAAA 3ARFB 3G5YA 2F9BT 5I1JH 1NKOA 2F5BH 2R2HB 3DXAB 3HS0B 4JVUA 4QF1A 2IH3B 3NCFB 1Z5LB 1YUHA 3OAZK 4Z95H 3G5VA 4LPWA 1R0AL 5DMJB 4PJDE 2BOBA 2YPLA 1IAKA 1S7WB 4FP8H 4RSVA 2QQNL 3QWRD 3RWEA 3G5XB 4ORGA 3TBYB 3LRSA 3DMMD 2PW1A 5E2UH 1C16B 1QA9B 4HDIB 5EB9A 2OLDA 4L3EA 3MRKB 4KJPD 1QHPA 1IJ9A 1NGXB 4ZO9A 1BEYH 4XZUA 1A7PH 3NA9H 4LKXB 4YX2H 3V0WH 1F58H 2ADGA 2GW5A 3BZFB 5D2LB 3EYSL 3MLRL 3UJTH 1V05A 1EAJA 3DRTB 1S9VB 3MRRB 1MIMH 3DXAE 2F54D 2NX5A 3MOAH 1CXFA 4MSWB 1KJVB 1DBAH 5SWSE 3SJVE 3UAJC 4Q97A 3S5LA 4OLZH 1BQSA 1VPOL 2VE6B 3PGFH 5DJAB 4K7FB 2DD8L 4S11A 1OB1A 3MRNB 4ZFFB 1BOGB 1WQVT 1KFAH 4NNXB 2C1OA 3D39B 2A77H 3PDGA 5I71B 5E7FA 4ZUSA 3NFSL 4KHTH 3ZKMC 1YMHB 2P5EA 3VDBA 4NUJA 1I3RA 4AY0A 5IHUL 2AEWA 4U7MA 3NGBB 4BZ2H 1DBJL 2NTFA 4JQXA 3VA6A 4W4OA 2WAHA 4Y16C 2BSSA 5EORL 1BF2A 2VIRA 5I18H 2R1XB 3GSNL 3TA3D 4DTGH 1KTLB 4EBQH 1VDGA 3ARDB 5J6HB 5SX5K 1II4E 5C0DA 3MRGA 5A16B 1A1OB 1SYSB 1HKLH 1IGCL 2DLGA 1TPXC 3P9MB 2DTSA 4XHJC 3QUMB 3ZL4L 1CFVH 3VXRA 4J8RB 3OQ3B 3WLBA 1NGQL 1R24A 3V79C 1RSFA 3HMXL 1CD1B 3TN0A 4XC1H 1I3RB 3BJ91 4PTUB 1YNLH 2YN5A 3ARGA 4IRJC 3S8WA 1TJGL 5T3ZH 3CFKB 4I48B 1N8ZA 2L7JA 2LAGB 4I3SH 1NGYA 4R26H 4JPIB 3JWOC 5I30L 3M17A 5C0BE 3WMSA 4P4RB 1QZ1A 4XVTH 1J05A 1RZ7L 4NZRL 1WFOA 5C0AA 1U58A 2B1AL 5EU6E 3GIZL 4QOKD 4RGMC 3C6LD 5FECB 4QHKJ 2JB5H 5ANMA 2H2SC 1CGXA 2CLVA 4N8CL 3H3KA 5GS0D 1N4XL 5MEPA 4G6KL 4NBXB 5LVEA 4A2MA 3H0TB 5CGYD 3VFUA 1JNNH 2BERA 2DQDL 1S7XA 4LOUD 2AS5M 1H5BB 3KPLB 4K94H 3FRUB 4KJWC 2BXZA 4G5ZH 3FO1A 3MR9A 4GQPH 1NUGA 1Q0XH 5H35B 5IB4A 3V0WL 3FB7B 3WCYA 3PL6D 3QJHA 3TM6A 1A9EA 3LRSB 4NZUL 5FHAL 1NGYB 4LRIC 1RUMH 5DGQA 1M7IA 1U3HD 2R2EB 4JREB 1I8KA 1DBKL 1PKQA 4RX4D 3KXFA 4JFFB 4UINH 2V2XB 3HRZB 1CYGA 4NHCH 5JORA 3MJ6A 4L8BB 1K6QH 2YPKA 3VFSA 5DK2A 3VD5A 3ZKXB 3CXHJ 2VC2H 3DV4A 2GFBB 2YPVL 2FEEL 3O8XA 5F9OH 3M45A 2JJVA 2FO4A 1G1CA 2OK0H 3I9GH 4WCYL 3EDDA 5IJKA 3OKLA 4LLVB 4YHNA 3T0EC 4HGWA 3VXRE 2JK5B 2FWOB 5SV4A 1OGTB 3DUHA 1OLLA 3SDDC 3U9UB 1WZMA 4GMSH 4P5TA 5F1SA 3IDMB 2BHZA 2FJHB 5GGRB 4MYWB 2ZNWA 1G6RA 5L6YH 5GS2D 2EECA 2VDQH 2YN3A 3PP3K 5CJQL 4FFYH 5BV7H 2FO1A 1MAMH 4NT6B 4NKOA 5HHME 4NKDB 1D3CA 4P5KA 1MLCA 5DRWA 4TOYH 5F1IB 2VR5A 4M1CD 1OAKL 1FV1B 1X3DA 4Y1AA 2ICES 5JR1L 1OPGH 3Q5TA 1J5OL 1VACA 4IRSA 1M05B 4F7MB 4PFEA 5T1MB 3MLUL 5GZNC 1E28A 4XPHH 5FOJA 1J1OL 4P46D 1AO7B 5EZLB 4CDHA 4RIRA 1YNTA 2BHUA 5BRZB 4I3GA 5SX5H 4O2FA 5IQ7L 2W07A 3LKRB 2P45B 2ZOLA 5DDHA 4DVBA 2Y72A 5TDNB 3FJTA 2ATKB 2PF6A 2F8OA 1A8JH 2W65B 3RDTA 1LK2B 5JA8B 1A6UH 4NQTA 4WEUD 3VRLF 2DLFL 5J89A 5E03A 3G6JF 1HE7A 3BP4A 4FA8A 5LXGH 3UPRA 1QBMH 3SE4A 5DHYB 2IJ0C 1UB5B 3SDCB 4Y19A 3WJLA 1KPRA 5EORH 3BZ4A 1KGCE 2YEZB 5FYLH 4WFHE 3RDTB 4JN1H 4U1KA 43C9B 5B21A 4PRDB 4Y5VB 1JNNL 2DQDH 5FKAB 5FB8A 1UM6H 3QQ9D 4UT9L 4QOKA 4YBHA 2BNRD 3CDFA 3WXWH 4LKXA 3WUWG 2WUCH 3DIFB 1TIUA 5EZOL 3IS1X 3N06B 1KEGL 2C9AA 2YUWA 3ILQD 4OI8A 2HKHH 3NFPB 3STZA 3FO2A 5C0JA 3QFJD 1FZKB 1T20A 3BUYA 2ILLA 3GUTB 3DMMA 4LCCA 2P7TA 2WW8A 4YXLH 3T3PF 4WW1A 4DGYL 3DVNB 5MEQA 4PJFA 5J8OA 3QNYA 1WBYB 3RKDC 4P2RB 5J1AB 2P5WA 2EE9A 1KT2B 4TVPE 2A74B 4KQ4H 4TPRH 5GJSL 1J12A 1UH2A 4LK4A 4Y4HB 1KV3A 2D0FA 4OM1H 4NO0B 1LE5B 1KENL 2APTA 1I9RL 1RV6X 2EDYA 3OG6B 2G9HA 3S4SG 1XCTB 2IPKB 1BWMA 1TJGH 1MJ8L 4IMLB 4JM2B 3VXUB 1NCCH 4O02L 5CP3H 4F7TA 4YHZL 5DGRA 4POZC 5JLZA 1C5CH 4QNPE 2A2QT 1GHFH 3KHOA 4WNQB 2X09A 3M8OL 2AEQH 5INCA 1KJ3H 4JDVB 3WFBL 1B4JL 3F7YA 4EN3C 4OI7A 5LCVH 2Q86B 4EUPG 5I0ZA 4LAQH 3UTTD 2FSEA 1LVEA 1ZTXL 4K3EL 1MWAL 3B43A 1CLCA 3RVVC 1U8KB 4UV7H 5TDOB 5IQ9B 2FDBP 3SDAC 3S5LG 3QI9A 5D1ZC 1MQ8A 4EN3D 1CGVA 1T5WA 5J6GB 5T3XD 3ZDZF 4KK6C 4PR5B 1OOAA 3CZFB 4PGEB 1W0YT 3SBWC 1NFDE 3L3JA 5T5FH 3WIHH 4LMQE 3ZT6A 2R1XA 4Z7NE 1WBZB 1GCFA 1MVUB 4DFHA 1DQML 3O3DA 1QOKA 4MXVE 4AIZB 1I4FB 3P4MA 2O5YL 1IGFH 4IJ3C 5FYLL 4GW1B 4LSTH 3UJTL 5GS2H 3BRGC 4M4RA 2HJLA 3N9GL 2Y06L 2B5IB 2OTWB 2B5IC 3MUY1 1E4KA 2I9LB 3B5GA 2VC2L 2AJYH 3I75A 3C5SA 3MRPB 4XAKE 1D7FA 4PV9A 3CIQA 4XX1G 1OD9A 2GHWB 4HXAH 1AGEB 4CU6A 4YBLB 3CVIL 5F9OL 4WO4D 4ZNCD 5GJSH 1JWMA 5IHBA 1X5YA 2Q1EA 3LB6C 5AWNH 1YDPB 5IVZB 3DURB 2P24B 3HG1E 4C83B 3VG0H 1NC4D 4GS7B 2I60L 4H88L 1R3JB 1MCPH 1G84A 5IEKB 4OB5H 3ARBC 5ADPH 1KYOK 4D3CH 5I1GH 4XBPB 1BQLH 4ZSOE 1OARL 2HVJB 2R2BA 3DURA 4LVEA 1U42A 2GTZA 4L4VA 1WZ1L 3OF6A 1T4KA 3KPTA 1FYHB 5C0CA 1IM9A 1JPGB 4PRPE 5AUMB 1T0PB 4L5FH 4QTHB 1J1XH 3BP6B 2CIKB 5F7LB 4G3YL 2WWMD 3ARDC 5T3XH 5IB5A 4KI1A 2CLRA 4W70A 1AGDA 5C3LD 3VD9A 1J0HA 1C5CL 3BFOA 5GRWA 1QYGH 1W72L 3GJFB 3ESVF 5GGQH 4U1GB 3MLVL 2VUOA 3QBTB 4U1GC 3UTSB 3I2CL 3WKML 4GRWE 2F19H 1U8QA 3IETA 3FQRB 4ODWA 4PRAB 5IVOA 2R56L 1F5WA 3NTCL 3FONB 3IDXH 3HMXA 3HZVA 1CIDA 2DMCA 3AU1A 4HWBA 4WHDA 3MLSL 3WDHA 1IBGH 4ZMAT 4NM8L 1JI1A 1YYLL 5C92A 5C09B 3UCRA 1F6AA 4PRHA 5B38B 1GGIL 3OAUH 3O2WH 5D2NC 1YNKL 1ZVYA 5CIPA 5GSVA 4ZAKC 3QUXA 5FKPB 4G7YH 2Y7QA 3ZMRA 4JY6A 4PBWD 4KZEH 4WWKB 2FATL 4FQHB 4CN1A 4I0PC 3PQYB 4OSUH 5H8DA 3IDYB 4NKIL 4P2QE 3SGKC 4H25A 2BY1A 5C0RH 3S6CA 2HWZL 2IBBA 3QFJE 1IFHH 1GYAA 4X9GA 3WHXB 2WBKA 2R29L 5J3HD 3L3HA 5H37H 3LKSB 1HHKB 1P4IH 5DYOA 1EXUA 1MSPA 2HT3D 3CVHB 4CN4A 1VESA 1BIHA 3LPWA 4LHUB 5ABDE 1OAQL 1LE5A 4CAGA 2APWA 3MV9D 4EJ1C 1HXYA 4LHQB 1HCVA 3S3SA 1QBLL 2APFA 5C0BB 1H3UA 1XR8B 3VXUA 1UZ6E 2X4UA 5D70L 1I4FA 3P4MB 4MXVF 3RIAF 2WINA 5TE6L 3VWKD 4YNYB 1FFOB 4ZFOA 2XG5A 3G04B 4G8GE 4JFHD 5JMOC 1JP5A 5DZLA 5FIEA 3BN9D 5DMKB 1KPRB 3QDGE 3FFDA 4JQIH 3TH4T 3DECA 5LAXA 3GSQB 3MYZA 4U6HA 2E3VA 5L8JB 3UBXG 4WUUB 3C08H 3D39D 4HIXL 4XNQB 5FB8B 4ODHL 4EOWL 3LD8B 2XY2A 3WUWB 5DVOA 1GOFA 2V5TA 1CVSC 1KPUB 4U6VL 4UTBL 3MZGB 1G7LB 5DI8B 1FG9C 2CDEB 3QHZH 2GK0A 5JQ6H 1FNGA 1A3QA 3O4OC 1DL7L 5J13B 4NQCD 3LQZB 2BMKA 5C0BA 4HGMA 2OXHA 2X9WA 1LDPL 3W39B 4HKBB 4JQVA 4NYLA 2GSGA 4QRTA 1INDL 4U1MB 2H41A 1G9ML 2EYSA 2DLHA 2ESVB 4NN7C 2O5ZH 5GS1C 4C54A 4JKKA 3C60D 4BQ8A 4OAWB 4WHYG 4FQXA 1CZ8L 4MNQB 1KELH 2OSLB 2ORBH 2W59A 4YXKH 3FT4A 1UG9A 3DYOA 1I7RA 4NP4H 4PJ5D 3UPAA 2XY1A 3SO3C 3KWWB 4JFXA 3RDTC 3SO3B 4KK8D 1A7OL 3WE6B 3O9WA 2PYEA 4X80L 2FATH 3C60B 3QISA 4OIIH 4XPFL 3SE4C 5K9JH 4QT5B 1AI1H 1RPQA 1W72B 1X4ZA 4PPTA 1TVBB 1WUNT 4KK5D 4ETYA 1T2XA 4JFFE 3ZKSD 5ALBL 1BM3L 1EX0A 2O61B 1OF2B 1JTTA 3HZVB 1FO0H 3CX2A 4X4YB 1A14H 3OJVC 5EOQH 5EZIL 3GHBH 5CEZH 3G6JA 3ORJA 4L8DA 3P0YH 3RNQB 3GI9H 4R3SB 1NBYA 3D1MC 3N85H 5ANMB 3TCXA 4HC1L 3MLVH 1AE6L 2Z4QB 4TSCH 3QYCA 5JUEH 5JPNA 1T1YA 4PGCB 5E5MB 3U9UA 1G1YA 3S34H 3QFJB 2VABA 1WITA 5I66B 3BWUC 3MV11 5CJ8A 3CC5B 3X3FL 4YDLB 1BP3B 3S37L 3VRLE 4AJ0A 2NXZB 4PRPD 4CVXB 1JIBA 3DX8B 2XWTA 3PP4L 4Q2ZA 4NCDA 1MCOL 5CCKH 3BD3A 1NQBA 3BYTA 1HZHH 3NIGE 3DOSA 1I1CA 4MCYA 4NOFA 1O7VA 1DVFA 4M00A 5HHMB 1S8DA 3KXFB 1RZFL 2UZYB 5DQJB 4MWFB 1VGEH 3PL6A 2HH0H 1INDH 3NIDE 5DURD 2AV7B 3JV5A 4O4YH 5DSCB 2R1YB 1LE9B 4DQOH 2XZQH 5HHMD 1V3JA 1QFUH 1SEQH 3UYRL 4XNQA 4UQ2A 1ND0A 2JLLA 5K33A 5I1AA 1QFWH 3CX5K 4X6DA 4LSSL 5MP6H 2HG5A 1ZSDA 1HH9B 4L4TA 3V6FB 1BEYL 4NQXA 2I5YL 2YRPA 3OR7A 3EDJA 4L29B 2D7QA 1S7UA 3LMJL 1I7ZB 4OFIA 3PABB 1FVDB 1J8HE 4YHLH 3KHQA 4PJ7F 1A6TB 3H7BB 3JWDH 2F58L 1F4XL 1EV2E 1T0MB 2AGJH 1ZE3C 2OX5A 3THMH 1RZJC 4K7PH 5D7IF 4M61A 1CWVA 3T08A 1CG9B 2ENSA 5GRZA 4Z0BL 4JY5L 1ERNA 3NH7L 4HWBH 3QG6B 5D72L 2QSQA 3OR6A 1ZVHA 4RMSA 4XPFH 4A2LA 5FM5M 4KK6D 3RBSA 4U1IB 1NEUA 4P4KB 1F2QA 1OSZB 2P43B 3KNBB 3LH2L 4R8WH 5E6YA 3ZDYE 4B7LA 1YEIH 1ONQA 3FL7A 1NCBL 4X4ZA 1LD9A 1Q9KB 5GIRA 1R5IB 1IEAA 2NY4C 2MCPH 1N6QH 1CD9B 4QO1A 4R97B 3AM8A 4X99A 4GQ9H 5BV7B 5FXCH 3PWPE 3DGGA 3MV8E 5HI4D 5DFWH 1MJJA 3H3PL 3QUMH 3WXVL 1T22B 4TUKL 2FGZA 3MLSH 5KAQG 3LPFA 3O6FD 4H1LH 2AQ3A 4P23C 5M7QA 2W9EH 2WBWB 3VFPB 2O61A 3VXTB 3RTQB 4Q9QL 5GGRY 4G8GD 5EA0L 5GRJH 4MJIE 1RZKC 1F4YH 1CGSL 3CVHL 4M7LT 1DN0A 1WVZA 2IBGA 3QHFL 3WFDL 5K9OA 4KWUA 2DQGL 1NBYB 5AAWA 3NAAH 4WW1B 3I02B 3MRFB 4ZD3H 4KV5E 3K4ZA 4ZUTB 4KMTH 2XWBB 3MV7A 1VGEL 4HJGA 1RZ8B 1CZ8H 3ZDXE 2OS7A 3OKDA 4NQVB 1XIWD 4XBEH 5F7DA 2ID5A 1V8HA 3TIEB 2UYLB 4UT7L 4CVXA 1VKXB 1EO5A 3VU2A 5GRYA 1FNFA 3FB6A 3LS4H 4XCFL 1UVQA 3VGAC 4L1DA 2V2TB 4UQ3A 2F53E 3OZ9L 1T1XA 2HLAA 3VW3H 1LNUB 5LBSH 1RUPH 3W39A 5MI0C 4PRNA 2AW2A 3BP5A 5DEGB 3L3DB 3S35X 4M5ZL 2DL9A 2PCPB 2YC1B 4NQDE 1UZ6F 4S1RL 3RHWK 5DVKA 1OTTC 3QG7L 1ADQL 3C2AH 4JO2L 4PJ5E 1DDHB 1I1RA 1UXWA 3AREB 5E8EA 3Q3GB 4ALAL 4HIJA 2RR3A 2R1YA 4QRPD 4Z0BH 2HLFD 2VOTA 4TSCL 5D1XD 4WFFD 3QIWB 3TFKC 1ZGLB 3ROLB 4LHUD 1C1EH 2ZSVB 4U6VH 2LE9A 3SGKA 3IB4A 4IDJH 1AR1D 3VXUD 4IS6B 4XVJH 3VMNA 4OD2B 1N2RB 5FK9A 4TQEL 4S0TD 4OQTL 3QO1A 2R23B 4DJMA 4Z78A 2P4AB 3BP4B 1JNJA 4XCCL 1S7VA 4HZAA 4TNVF 4MDIB 4PTTA 3CH8A 3W2DL 5HVFB 4K2UH 1NCBH 3WJJA 2XZAL 4GSDL 4KI5D 3BDXA 4YBQC 3TN0D 3LKRA 4HKXA 1R5VA 4LBEA 2Q76B 4W68A 1EMTH 2L0DA 4N8CH 2ZKHL 4KUCF 4I3RH 3LKQB 4LLMA 4I8DA 2OR7A 4JDZB 4J2XA 3ZYIA 4F3FA 1QSFB 5C1MB 4LCCB 1JPSL 1LHZA 4MA8L 1NCDH 1NPUA 3FN0L 1FRGL 5DQ9A 1MFCH 7FABL 4L9LA 2BSRB 3MUGB 4H20H 1PBYA 1AKJD 3C6SA 4YHIA 5CAYB 4YLQT 3DROB 2X4OA 5F71A 4LSSH 5MP6L 4HJ0D 4WHCA 4XC3H 3GKZA 1G7PA 3CD4A 3X3GH 4QYOA 3RUGB 4FS0A 4RMVA 1CDJA 5DJ8A 4JQVC 3HI6H 2OL3A 1IM9B 1HQRB 3D5OF 3GMLB 4WY7L 5K9OB 3C9NA 2PO6B 3HAEB 5HHXH 3V6OA 3UTSE 1FPTL 5IWLA 3U0PB 1QSFE 4YDJB 3REVB 5JW3H 1U3YA 5I8OH 4NWTH 3OB0K 2BNQD 5ERWA 3FQXB 1MCEA 2PTUA 5FOBA 4XVUC 2HTKD 3WHXA 1JWUA 2XRAH 1BLNA 1YQVL 1AFVH 4XWOC 5IMLB 1M7IB 1R5IA 1EFXA 5JW4R 1FGNH 2NXZD 3TEUA 3MFFB 3BQUA 4YBQD 4MA1B 4RGNB 3RIFK 2OBGA 1F11B 4NSKB 1RZFH 3DV4B 3TNNA 3GGWB 5KVDH 1ZK9A 3U79A 4XWOD 3BX7C 3MRQA 2VLRB 2ZNXA 3U0TA 4OI9A 1IGML 1IAOA 1KF9B 2YA2A 3HE6B 4PUBL 4FZEH 1A64A 3RX8A 5T3ZE 1H3PL 1G7IB 5HI5C 5C0CE 5HHOD 2F54B 1NLBH 2AJVL 2ZUWA 2M2DA 4K9EL 9CGTA 1MHCA 1MRFH 3G9VA 5HDBE 4JHAH 3G6DH 3UC0L 3QXDB 1H3GA 1JBJA 3EDEA 1GGTA 3GBLA 5J12C 4PGEA 4NGHH 2VL4A 3QUZB 1ZT1B 5I1HH 1SBSL 3RNKB 1S7QB 1YEDA 2J5LB 1FRGH 3AS3A 3JTSB 5T33H 3NIDF 1A3LL 4ZFOL 4HZLB 4J12A 1A6ZB 4LCWB 2WWKO 3D2UD 2B2XH 1IGJA 1NC2B 2IBZY 1MLBB 3RVWD 3R0MA 4UUJB 1T66D 3D3VB 4PJ9A 3EDFA 1D5BA 3O6LH 1E6OH 2Y5TB 2W0LA 1P5UA 1GH7A 5CINH 4MA7L 3WNKA 1R5VB 5BZWA 1KLUA 2IEPA 1JK8B 5SWZB 3PV7A 1CFNB 4PJEF 2NY7L 1B3JA 4H8WH 4OBRA 5DO2C 3OAZH 3WNMA 2XTJC 4PJ5A 1KTRL 5FO7A 4BH7A 2O93L 4JZJB 4AL8H 1IC5H 4JG1H 2NY1B 3N85L 2CPCA 4LLYA 5HYQB 1OD7A 1FG2B 4Z7VA 1AGCA 4L8CA 3WDJA 4N0YH 4XVJL 4I48A 5I8EA 2VZUA 5DO2D 5EOCL 5FUZL 2XN9D 3A6CH 1W8NA 1CVRA 4XVSL 1EEYB 2ICCA 4AIOA 2YWYA 4FMKA 2DQHH 2B39A 5KG9B 5F89B 1AKJB 1RUQH 2VLRD 3M1BA 5BVJA 3GHEL 1AXSA 4ZAKD 5KVEH 4JO1H 2B20A 4XCEA 1G0XA 1TZHA 1FYTD 3BHBB 3ZL4H 4AG4H 4NPYB 2I9TB 1EFQA 3DX9B 4YHZH 2BNRB 3KPSB 4XCYB 5ANME 5D93B 3OGCA 5IROA 1RJZB 3QI9B 2D4FA 5IV2A 4PUBH 2RQ8A 1IGIH 2CRIA 1GJIA 1PGRB 4J3WA 3U1SL 2W0FB 6FABL 5T5NG 4NQEB 5BRZD 3STBA 5E6ZA 1INEL 5DD3H 1IAKB 1S7WA 5EO9A 1G7JB 3QEQE 3SPVB 1ZT7B 3WFHA 2EO9A 3AUVA 4HWUA 5IW6A 1MUJB 2AP2A 4ZFZB 3RVUD 4YXKL 3TF7C 1LO3H 3C6LC 4JFDE 4MDIA 5D8JH 4KKBD 4RGMB 1NGPL 3TNNB 2BXYA 2FIRT 1DVFD 1QR1B 1J1XL 1T6VN 2XKNA 4X8JA 1KEGH 3AMKA 3VH8G 2ADJA 4DN3L 3TT3H 1OTTD 3UPCA 5HVHB 5HVHC 4KI5F 5DR5L 4C56A 1MPAL 2X1QA 2Z91A 5FCUL 4Z0XB 2NX5B 5I1DA 1BWWA 1KG0B 4LCYB 2NLJB 5T33L 4O58H 4GXUN 3EZ8A 1FNEB 4A6YH 5KSAB 3B9VA 5LGJB 5IGXL 3OX8B 2MQCA 3BZDA 5EN2A 4Z6AT 1QRKA 2YSSA 3T1FA 4Z7QF 1OCWL 5FGCE 4UIMA 1MF2H 4M8QA 3BXNA 3L9RA 2C3XA 3TBYA 1YPZB 1AD0A 1FJ1B 1BD2D 1GGBH 3CZFA 2IQAB 1HYSD 1W0VA 2XTJE 4R4FL 4O51A 1OP5H 3SCMB 4UTAL 2VIRB 4FXLA 2E5EA 5JIKA 1RQ5A 4DZ8B 1BX2A 4DTGL 4Y16B 3CFCL 4OD2A 4G6AC 1MCKA 1U95A 4GBXA 1N59B 2C3GA 5CILL 4LIQH 4F7PA 3C5ZD 3SGDH 2PXYA 5L2JA 5IVXA 3HFML 4MB4A 5A3ID 4V1DB 4J4PA 4DVBB 2R29H 5GGTA 1Q94A 3QIWA 2EDKA 5F7WC 1AGDB 4XNMB 1P2CB 3Q1SH 1ZWIB 2A6IA 4O2EA 5DVLA 5EN2B 3S3JA 2GT9A 4Y2DB 3HLAA 4HWEL 4QXGH 2R9HD 4MS8C 4DKEH 4WFHD 5T1MA 1PLGH 3OF6D 3OB8A 2GEEA 3D9AH 5FK9B 1HOCA 3ULVD 1FORH 1YEJH 2LTQB 1KB5A 1NFIB 3CH1B 3LQZA 4X0KB 3BQUB 1K3IA 1QVOB 4XCCH 4DFIA 1UA6L 1I8IA 2DQJH 2I5YH 2X89A 1U8JB 5GSVB 3X14B 3WNLA 3SKMA 1LO2H 5D7JD 2FB4L 1LMKA 3UYPA 1WIPA 2V7NB 2AERT 1ORQA 1EFXD 2V17H 1FO0B 2WBJC 1FPTH 3SOBH 1JPFA 3BQUD 3I2CH 3WKMH 5ESVB 2AJYL 4KHXH 3DLQR 4U2ZA 4Y8DC 1LO4H 1UFUA 1JGUH 1G6VK 2IMMA 3PWVA 4N5EC 1OW0C 1KIQB 5TGBA 3IKCB 4I77H 5CLTA 1ONQB 5F88B 3G5VB 5FHAH 3G9AB 4TSBH 4FQLH 3H9HB 4BH8A 1NGPH 1VKXA 2MJWA 3SGEI 4AK1A 3TN0C 1ZKAA 3KPQA 4JZJA 1A1NB 1T21A 3FO9A 2VDOH 3FAWA 4ERSH 3VFPA 4G9DB 5F6IB 3JV4A 1LO0L 3ARBA 5IW1A 5F7YC 4U7KA 1DQJA 2FZ3B 3KDMB 1TVHA 5EC2A 2VLJD 4LKCB 5EG6C 4FFYL 3L7EB 5B8CB 3T2QA 2IGFL 5JO5B 4MS8D 5EU7E 4YHML 3ARQA 3CK0L 1YYMH 5AZ2L 5ITBL 3AB0C 2A0LC 4U49A 4XMKL 3FMGH 3IU4H 1KPVB 1ZEAH 2VXUL 4LIQL 3TO4B 3V6BR 4HD9A 2PO6D 4N90D 1H8NA 1AQKH 5HDOA 4HZLA 4R4FH 4UTAH 2FGWL 4EOWH 3EYOA 5CFHA 4IMKC 4LHUA 4QGYA 1T2QH 2AXGA 4QRPA 5JXEC 4CVWA 5HSFA 5JQ6L 4ZNEA 2ARJQ 1J0IA 5HYQA 4IBLT 4CMHB 2DBLH 4UAOB 3HNSH 1WIOA 5EPMA 2EXWD 2VDRL 1OP3K 3K80A 3PIQA 4NQSA 4LCUB 3ZT5A 4S2SB 1FVDA 1EO7A 4I0PB 4PJIA 5T1LB 5MHSD 4HIJB 4MX7A 2BDNL 1XIWA 1OCWH 1EMTL 4PJ8D 4WTZG 5HHQA 1JMZA 3MRGB 5A16A 2PCPA 3NBNA 2XXCB 3CU7A 5F3HB 5IJVA 1FAIH 4PR5A 1MCCA 2YBRA 3VFNA 4BSVA 5B39A 4L4TD 4OCSH 5FYKE 5C07D 1KN2L 1S9KC 4JFOB 3V4VH 1BJ1H 1YEGH 5KSBE 4Z7NF 2DB8A 3MMEB 3X13A 4I5BA 4WI3A 1MIML 2OTWA 2HMID 2P24A 1NBVH 2G60H 5J12B 4NHUB 2NTSP 5I8KH 1KCLA 1Y0LB 1HHHB 1JUFA 5CZKA 4S2SA 5J06A 5MEND 1ZMYA 1DQQB 4KRMB 4K8RC 4WEBL 3MUHL 1RK0B 2YMXH 4M62H 1NFDA 3GSXB 3U46B 1QFWL 2AJZB 5J4MA 2ZJSL 1P69B 2Y07H 4ZFOB 3H0TA 2X4RB 2DKSA 4F9PA 1BM3H 1ULVA 5IBUB 4EI5B 3X17A 2AJUL 4XMKH 2YA1A 3LSOB 1ACYH 4M6MH 2QQNH 5T5NF 1S9YB 3P30L 2I24N 3TV3H 1RIUH 3GBMH 3CDGB 5EC1B 4Q2ZB 4WI6A 2EICA 4Z77A 3T1FB 1EBPA 1BIIA 4X4YA 4LGPB 3MV8D 4CNIA 1MCWM 2VLKB 5D6DA 4Z7WE 3X11A 1SYVA 3D0VA 4XVSH 3MJ7B 4KAQL 1I8IB 4YGAB 3GSNA 3EJJX 4J3UA 4JRXD 1QFWM 4KKNA 1YEIL 3CFBA 3UTPE 4ZUVB 3LPGA 3S5LB 1R6VA 2OQJB 3LKNB 2H2SD 2OTUA 4H5SA 1IAII 1WJ3A 3HI5L 3ZT7A 5EUKA 2FL5A 3STZB 3GMMB 5JOEA 3T4YB 5I1IL 5FHBL 2EDJA 2PO6A 4OF6A 5F7NC 1BD2A 3MRCB 1P7HL 1CDGA 4ODXB 1WWCA 4W81A 3QXDA 3QWQB 3UTQA 3GSVA 2YPLB 2FWOA 1IT9L 3QNYB 3CPLA 5D7IA 5IROC 5I8CB 3L5WB 4MJ6A 2V17L 3W11C 4EQ3A 1HHJB 4TSAH 3FN9A 2A6DA 2PW1B 4KQ3H 3ZZ1A 4OV6F 3MRCA 1MFBL 3B2UD 1SBSH 4W6WB 4QT5A 4OV5B 4ZO7A 1NEZA 2CK0H 1NAKH 1UWGH 1YECL 3FTGA 3KLAB 5E8PA 2QSTA 3VWKB 1LK3H 1R5WA 3BJLA 3RWCA 3CU1A 2N7BA 2X4TA 4G5ZL 3OG4B 5IFJB 4OLUL 4WFEE 1CQYA 3GGWA 3BXNB 3L9RB 3PJSB 1BZQK 3FAXA 1NEZB 4KKAD 2JIXA 5IIEA 1A9BB 1NGZB 4PJ8A 1T2QL 1YN6B 3EYUH 4Z8FL 2FJFB 5DEFB 1UZ8B 1HOCB 1YEEH 4CJ1A 2J4WH 3TBSB 5DWUL 2EIDA 1A5FL 1RURL 1PY9A 1MCJA 4ZUUA 1EJ6A 1RZ7H 5CJ5A 4RAUB 3HMWH 2CR3A 4OKVA 4C4KO 5CEZE 5CJOH 1MCDA 3ARSA 1RUPL 3BDBA 3NCCB 5DJZB 2R23A 3FTGB 4GMSL 3ARVA 2CJUL 4RRPG 2JJSC 4PJBA 4FFVC 4Q6IA 3BKYH 1JGVL 1EZVX 4PV8B 1GIGL 1FFNB 2V2WA 4NJAH 4YWGL 5F1NB 1UM5L 1JN6A 1I3UA 4HFWA 4JPKH 5F1IA 4M6ML 3EOBB 1VENA 2ESVA 3DETC 4JANA 4GBXC 5B4MD 5IB1A 3BN9C 5FYJU 1D6VH 1EGJA 3MA7A 4AEIH 3HNSL 3SE9L 3U48A 1R24B 1LEGA 3LSOA 4UV4L 2ZUSA 1HYSC 3VXRD 3I6KB 4MMXC 4ENEC 4P2CG 4R2GD 3O0RH 2X89D 2NW2A 5EU6A 3SE8H 4HX1A 5EO9B 4X83A 1C7SA 5J11B 3VMOA 4FTVB 4NRXA 1WTGT 1MFDH 1I85C 1LNUA 1YPZE 4KFZC 4FXGA 2AEPL 1FFNA 5BS0B 1F4HA 5C6PB 4ELMA 4XWGH 4P2QA 3CK0H 3PIQB 1AP2A 4ZTPH 3FO0L 1BZ9B 4NFCA 5LWYL 2VZ3A 4TYUA 5DA0B 2IFFL 5LQBH 3LH2H 4PJAE 2R0LH 1KIPB 5EZOH 2H3NA 4K7FA 4G6JL 4G8GB 1ZT4B 4P5MA 1SMOA 3RGVD 1T83C 5HPMB 4YDKL 4TVSa 1TCRB 1ZLVK 4PJHE 3TBWA 4HK0B 1JRHL 4GMTL 4JCMA 3C5JA 2D9CA 1MCWW 1ZA3A 4BFIA 3I6GB 3DSFH 4AMKH 4PRHD 3R8QA 4HCRH 4UOW0 1R0AH 2WWKT 3VXQB 5KS9E 2NY2B 4M3JA 2D2OA 4LVNB 2HLAB 1KNOB 4H0IA 3GSNH 1RK1A 3OKLB 1RUAH 5C2UB 1ZGLM 3QUXC 4P2OD 4NZTL 3Q5OA 5CJOL 4YHOL 2J6EA 1OPGL 3VI3E 1U3ZA 2BSED 2Z9TA 1S78C 5KSAD 3T1WA 1X5IA 3F5WB 1U8MB 32C2A 5C9JB 5F9WC 2QBWA 3VXRB 5LJYH 4J8RA 3A6OA 1CLYH 3IXTB 5E2TL 1SJHB 1CFTA 4GKOA 1IKNC 5BV7C 1U8LA 1ZS8B 1J88A 3RNKA 2IQ9L 1TTFA 3ULUH 4WV1A 3VFRB 5IUSA 1BHGA 1QSEA 1KTLA 1A6AB 2FHFA 3IXAA 4NNXA 3C8KA 1BX2B 3P40A 4XCNA 3SCMC 3MNVB 2YUVA 1Q38A 1DUZB 4GLRI 4QHKI 2BVUA 3RWJA 1S5IH 1R3IL 4PJ9D 1FL6B 3NZ8A 3O3BB 3NFNB 4TSBL 3MCKA 4OZGA 4U1SA 2JJTA 2NY3D 2GJ6D 5D7JA 5GSRB 2Y07L 3UTZA 4NN6C 5MEPB 4MNGB 4IRZL 3BGMA 4JEGB 5EC1A 2IAMD 3KR3L 4ZXBC 4X6CF 5IVXE 4GW1A 2EIZA 1C5DB 3INUL 5DHVB 2QQKH 4KXZH 5JOPD 1FC1A 3MNZB 3H9SE 4G7VL 2VXQL 2ZCLH 3NMEA 5FA4B 2GT9B 2VDPL 2NY5C 3MRPA 4LPYA 4NQCA 3LB6D 4Z95L 2ICWJ 5BS0E 5CEXA 4E0RB 3MNWA 2XN9A 1HWHB 4RDQG 4LEOB 3LKPA 2VITA 1MJ8H 1EHAA 4YDIH 1QKZL 4XRCA 4XPHL 5L88L 1UQSA 4YE4L 5KSUB 1CIUA 4FZ8L 2YZ1A 3C6SB 5MI0B 1G7HA 2VDKL 1L4IA 5D7LD 1HSBB 3T0EB 4HUNB 5KVFL 3O2VH 2XICA 3X3FH 3BE1H 4K8RL 4GKZA 1KB9K 2EE2A 3IDIB 2OM5A 1MWAH 3EOBA 2AJSL 4R3SA 5IJKC 4ZS6C 2ZKHH 5D2NE 3CC5A 2FRGP 4ZPTA 2LVCA 2FHBA 4KC3B 2N7AA 5IV2B 5IMLA 3KS0J 1GC1C 3LKQA 4QF1B 4R4NC 3FFCB 5FOBB 4JFDA 3FO9B 4DAGH 3RGHA 1N0XL 4RA0C 4D94A 5GZOC 2NW2B 3I84A 4OGAD 3IFOA 5KOVC 5IFJA 3CUPB 3NVQA 2GYSA 4BH8B 3HCVB 1U92B 1D9KC 1N5YH 3IF1A 3FQWB 3ILPA 3P0GB 3C2SA 3D25A 4X8XA 5TQ0L 2B2XL 2BY3A 3VFWA 4FG6C 4POYA 1WT5A 4PV8A 1N26A 1AXIB 2V5RA 3TWCH 1M71B 5EULV 1GOGA 3HCVA 5DA4A 1P1ZB 1I1FB 4HXBL 1BFVH 1A6WL 5C0IB 4NQDB 3V4VL 4DN4L 4OCXL 1CI5A 4U1JA 5BCAA 4PJCF 4PJBB 4RRPA 2J88H 1RZGA 4WO4B 4U1LB 5AD0B 3U30B 4JY6B 2Y6SC 3QCVH 5C2BH 1T1XB 3C60C 3ZKQD 3QUZD 3L3KA 3BPNB 1L6XA 3V8CA 3MCG1 2W0PA 4QHMA 1RUAL 1CDUA 2EH8H 4M6NL 4YNYA 4TUJB 5FV2A 4R90H 3RY4A 4S1QH 4G9FA 4AH2A 3HNTL 4LQFH 1TENA 2YPKB 4HIIA 4LHJB 4M7LH 4PJBE 3DBXA 1OSPH 1LK2A 4QRSA 2P5EE 1A7QL 3VRJB 1OTSD 2CKBL 4ZOBA 3MBEB 1TZHB 1FE8H 4PLJD 4TUJA 1X7QA 2XT1B 1NL0L 5A1AA 1MH5B 3CFDA 1YNLL 2P5WE 5J6HA 4YPGA 4IIQC 4AEHH 4Y4FB 5FCSH 1GAFL 4POZD 1WBXA 2N1KA 3S88H 4LCCC 1FSKC 1T03H 1DLHB 1AO7A 5EZLA 3L5XH 5D1QD 3TJEL 3B6SA 1UENA 2VDNH 4Z7UF 3U7YL 3DNKA 3BVNB 1H0DA 3GHEH 4G42A 4MVBC 3S37X 3TBTB 4ISVB 5C09E 1NSNL 3WD5H 2X4SB 1NCUA 5C08A 3T0BA 2A83A 3F12A 4MD0B 4P3CH 4Z7WB 1CBVH 1RZIA 1XR8A 1AKJA 3KYMA 1GPOL 2AQ1A 4XWGL 3SKMB 2WLYA 3I6GA 1VA9A 3LKPB 3O4LA 5DRNA 1CF8H 3FT2B 3VXSA 3MODL 1QRNB 5GGQL 4Z7WF 3ULSB 2GKIA 1JYVA 5DMGD 5DRXB 4FABH 1DLFL 3GSXA 5GS0L 1PLGL 3F7PC 4MD5B 1G9MH 4DOHE 4PRIE 1QPXA 3WXWL 4GG6E 3K1KC 3KPNB 2YK1L 3ZTNH 4EI5A 3QXTA 1HI6A 2ATPA 3OV6A 3TBVA 5ADOH 3SPVA 1MFEH 1JF1A 3RZCD 3QEHA 1S9YA 3ECBB 2NY6B 4HMCA 5DK0B 4KJPC 2V9QA 1FH5L 5DT1H 3SBWA 1A0QH 3V5KA 1CXKA 1KULA 3ZHLA 3I3EA 4UAOC 4X6BA 1XMWA 2H1PL 4ONFH 4OLWL 4X80H 3QI9D 3TVMD 3O3DB 4KHXL 3AU1B 3IFLH 1MCRA 5FV1L 3KPPB 4OCNC 4P23A 2R0KH 2FECI 1IQWH 5KSUA 1T7ZA 4HK3J 5IG7A 1N64L 3MJGX 5BS0D 4B0MM 4IOFD 3GFUA 2LQRA 2LVEA 1HXMA 5ICZB 2B4CC 2ADFL 5DSCA 1ZLUH 3L1OH 1RIVL 5DURB 4J6RL 3B9KD 2IBZX 2R15A 2PKDA 1MIEH 5DJ0B 1AIFA 3LDBB 4PJIE 4CADA 1BD2E 3AAZA 2F5BL 2Q86A 4DGVH 2YKLH 3UXFA 1CL7L 4LPUA 1FL3A 3QT2A 3K46A 5DK0A 4I0CC 2UZIL 5GGUA 2J6EH 1BJMA 4J7RA 3K4DA 3BUTA 4RAHA 4X6CE 2I60H 4H88H 4DUWA 5CCKL 3GBNL 3C08L 4ELKA 4UIKL 3ARED 4L3CB 1LDPH 2EC9T 2MMXA 4Q0XL 1KCUL 2APBA 5J56B 4WRLA 1SJXA 1FSKB 3QUYD 2D4DA 3UC0H 1P7QB 2CSPA 2A1WH 4RNRA 3MBXL 4KQ3L 1MI5D 2RGSA 4JCLA 3RZCB 3ARGB 3EOYG 3MOQA 3O2DA 5CJXA 2QHRL 4RZCA 2YRLA 5D7KE 1DLHA 4P9HC 1HIML 1HSAB 3QI9C 4U3CA 4Y4FD 5D1ZA 5DRZB 3CSYA 4XNMA 1K8IA 2DBLL 3B2VL 2Y06H 5C08B 3AY4A 3WIHA 1QNZH 4M9OA 1WBZA 1YMMA 5BJTA 2YWZA 3B5TA 2O5YH 2PUQT 4WV1C 1YEKL 4TNVK 2EH8L 4M6NH 1WICA 4OLXH 3L7EA 4NO5B 3OR7B 5DHVH 4I9WE 3H3BC 2E27L 3SCMA 1BVLA 1YMME 3MYJB 1S7SA 5IB1B 3OJ2C 4TUOA 3BUYB 2PXYC 4KQ4L 3QCTH 3FQXA 1A3RL 5F1NA 3TT1H 1LDSA 4TTDD 4WHYH 3KJ4B 3DUSA 3OJDA 5JOFA 4ERSL 1T2JA 4HIEB 1LGVA 1GZPA 4LQ1A 3N1MC 4TNWF 5I75C 4WENB 5I1GL 1CXHA 1D5XB 1G6RH 4R4ND 4JDZA 4XGZA 2YD2A 3Q5YA 3P0YL 4ELMF 2FL5B 3WO3B 5HYFA 3O9WD 3RWDA 2VDPH 3L1OL 4URTB 3OKMA 1P4BH 2XQYK 2GQHA 1C16A 3Q6GH 1Q9LA 3TA3C 4I3SL 4GMTH 4JO1L 4HWBL 2F53D 3B2UC 3L95A 3UJIL 1T03L 1O0VA 3NZHL 3MV8A 4M62L 4I0KA 2MTPA 4O2CA 1J8HD 4JFDB 1AP2B 4XT1C 4HQQL 1T04B 3DVIA 3U83A 5EWIH 3DBXB 2BNQB 5KVEL 1P84J 3OAYK 3ALXA 2FB4H 5BS0A 3CUPA 4PJ7A 4EVNB 4GH7B 5CSZB 3IDGB 3TJHD 5GRJL 3TO4A 2YHGA 2V7NA 2RHEA 4QRRB 3DHMA 3LN5B 4R97C 4OFYD 5DD5L 5E5UB 1QYGL 1W72H 4Y5YB 5F7DB 5FDWB 1IEAB 2HTLC 2J2ZA 1OAXH 5I1DB 3CPLB 5D7IB 5SWSB 3SJVB 4NNYA 1QFUL 3S3PA 3JTTA 2V2TA 4P4KC 3FT3B 4WHTB 4HS6B 2HFGH 2IH3A 2R9HC 3WEXB 5J13C 3MLYH 4APQC 2LV4A 3HR5B 1CFBA 4MQXD 2YD5A 1VADA 3IFOB 4LLUB 4NQDA 5DZNA 1BVKA 2V5YA 3IS0X 4UIMB 3RVTD 3WO4C 1I1YA 4F2MA 2OL3H 3AXLB 1JUFB 5JORB 2UUDH 3FT3A 3RDTD 1VCAA 2XNAA 5C07A 1EVTC 3KLHD 4LU5H 3D69A 1P84K 2B8OT 4EDXB 2EH7L 4LCYA 3TWCL 3TO2B 3E2HB 1LEKB 3FB6B 4YHLL 3HPLA 1U95B 4GBXB 4WWKA 1ROWA 1EK3A 2EYRA 3ESUF 4NC2B 1AR1C 4OSUL 5GS3A 3T0VA 5AWNL 3ZKXC 4DVRH 2ZUQB 4LFHG 3QHTC 2AGJL 1AD9A 1W2KT 3BO8A 4PRIA 3S7GA 4TVPD 3IJYA 4NOBA 4JPWH 1UB6B 2BC4B 3IDMA 3IFPB 1AQKL 4M7ZB 4OZFG 2NY4B 3ZHDA 4ZDHB 5I74C 3VFGL 3GSOA 5TDNA 4Z77B 3LN4A 2XV6B 4QKXB 3VJ6B 3D6GA 5B3NA 2FLRT 3ZLQC 5L2KA 4MJID 1MRDH 2D3VA 3Q6GL 3DPBA 2Z92B 4S10A 4PG9A 5JR1H 1JJUA 1TETL 3FKUS 3K8MA 3RWJB 3WDIA 3MJ7A 3QRFM 2EXYC 5ITFA 3D3VD 1J8HB 4H8WC 3MGTB 3DROA 3ETBF 3EZJB 4CW1B 4ZQKA 3F58L 3QNXB 1P2CA 4M61B 3N1PC 2GSIA 4MNGA 1UM4H 4P9MH 1DDHA 5TF0A 2JCCB 3KYKH 4PJGE 3BE1L 5HGAA 2ZG1A 4OZGB 4D0CA 3U0WL 4M1GL 4PYHA 3MLTB 4HWEH 3SN6N 1XGYL 1CFNA 2LFGA 3EAKA 3KPSA 1A6VH 3FQRA 4ODWB 1MCSA 2OJEB 1BIIB 3HE7A 1NGWA 3W0WD 3WFZA 1W8OA 5TH2B 3RJDA 2CIIA 1CD1A 1QRND 1L7TL 3KVQA 4EI6A 1X5XA 4PB9H 2YD4A 1LO4L 3S96B 5FECA 3ARBB 1G0DA 2V5MA 5EZJB 1U8PA 2VJXA 2CRYA 1KCSH 3CFEB 3QIUD 2PYED 4P4RA 3HAEH 1SYVB 3D0VB 3C5JB 5DVMA 3EGSA 3G5ZA 1MQKH 4P2OC 5EO0A 5I0DA 1L9NA 2ITDB 3MGOA 3SDYH 4F9PC 1VFUA 3QQ4B 2ADJB 3PWUB 2DI8A 2HKHL 1A4JA 3CFEA 4H20L 1TFHA 3VXOB 5I1LA 5KSAC 1EO8H 4RBPK 3RVVD 3E3QC 4IOIB 2DKUA 4WI7A 5CZXD 4KK9C 4WFGD 4DGYH 1HSAA 1A7QH 3ARFD 5D1ZB 5DRZA 2AJSH 1TTGA 4MJ2A 5JTWA 4OCYL 3EYOB 4X7FC 1P53A 1ZLSH 1C5BL 4KXZI 5E9DA 1VGKB 3V5KB 3QUZA 1ZT1A 2CDGB 4NQEA 3Q1SL 4IRSC 2F58H 1ZOXA 3BP5B 1A7RH 1U8LB 1ZS8A 2G2RA 4EN3B 1CGWA 2P47B 4OJFH 5D1ZD 2VN4A 2F54A 2EIBA 2NX5D 4JY5H 4LSVH 3HRZA 1PX3A 1TQBC 1D5ZB 4MSWA 5D7SL 1F6LL 4LSRH 4UBDD 2XZAH 4NRYA 1HXMB 5ICZA 3S35L 4LSDA 4QHUA 5FYJL 4HCRA 4BZ1H 4F7CB 3AGVA 3O6FC 4K3EH 4FXKA 3S88L 1AHWB 1KLGA 1ZHKB 1JRHH 3SDXF 4P2RE 3V0VA 1KB5L 5KSVB 4WO4C 4RFOH 3AM8C 5KVMC 3MRIB 1F58L 2YD3A 4PREB 1QSED 3QUML 2A6DB 2P5ED 3H3PH 5A2IH 4OM0H 2FH8A 1DQMH 5TFSL 5E1AA 4F33A 1ZSDB 3V6FA 2BRQA 5MERB 5KSBA 5CZVH 1AXTH 3VG9C 4S1SH 1JWMB 1GRWA 4UIKH 5T5FL 1HXYB 3IAPA 4K9EH 5EUOA 2GJ6A 1F8TH 3HZYA 4PP1C 4HKBA 3GB7A 3M17B 3BSZH 4FFZH 5GRXG 1ZLVH 4HFWB 3JZ7A 1KLFA 3PGFL 1A9BA 4PJ8B 4OF0A 4ZTPL 2Z31A 2EDLA 1U9KA 1CDBA 3VI4F 3O41A 2HKFH 3BW9B 3HFMH 4NDMA 5IOPB 1K8DA 2F5AL 3TBSA 5D7LB 2AXJA 4WEMB 4MJ5B 2A6IB 5CSBA 2BVOB 5T1KD 3KYOA 5DD6B 2IMNA 5F6HJ 2MOVA 3BESR 1MRCH 3GHBL 5CEZL 3MUGA 1DBKH 1XZ0A 4F9LC 3JTSA 1FGVL 3MACL 1DFBH 3GSRB 2OK0L 2V6HA 1YEKH 1ETZA 4O02H 2R0KL 3TFKD 5AEAA 4MB5A 3OMZA 5DJ6B 5ADPL 5IW6B 3ULSA 4K8RD 5FUZH 5EOCJ 3WO4B 3TJEH 1UEYA 5FDWA 2V9RA 5E08H 1EH9A 4X98B 3B9KB 2ED7A 4ZFGH 4X4XA 4X4ME 2OL3B 3AB0B 5D7LE 5FM8A 1FFOA 1JGEB 2WBJA 4R96B 4KTYA 4WU5A 1IGTB 5IK3A 3BD5A 2BVPA 1EUTA 2BNQA 2HH0L 4JHAL 4PJXA 5EU4B 1T1WB 3SDAA 4F2MB 5E99L 2AJVH 4PRHE 1WBYA 4DQOL 4GRLD 5D5MB 2IG2L 4M9PA 3SY0A 3L95B 4HS3B 4MD4A 3GBNH 2H32B 4IS6A 2QSVA 4FQLL 4JZJC 5K59F 1YY9C 1FFPA 5ESAA 5IHZA 3NACL 4WJ5B 5F96H 5IMMB 2NY2D 3QIBA 2C5DC 5EO1A 4MCYB 2VLMD 1BD2B 1MHPL 3EFDH 1HN1A 4NKDA 2AEIT 4PLJC 3WJJC 1BZ7A 2HT3C 2ZOKA 4GG6B 1A2YB 1KN2H 1L0XA 4I2XE 5CZVL 4K7PL 3WNOA 1KIRA 2IH1A 1Z9OA 4H1LG 1EJOH 1MCPL 3O3EB 4LASL 4APQB 1BQHB 5E4IA 5AYUH 2XQBH 4J23A 2J8HA 4RAVA 4H25B 3O11B 4QWWC 3PWUA 4YDLC 4OCLC 4KJQC 5I2IB 1T89A 5DJ0A 4Y2DA 4R2GC 1QRNE 4Y4FA 1F45A 3ARYA 5ESQB 3WYRA 4JJHA 1JGLL 3MRHB 4RWYH 5AZEH 3VXPA 1FGVH 5DQ9B 1KJ2A 4U4BA 1NH6A 2IAMA 1FNLA 3E8UL 4P0DA 4JFEE 3C5ZB 4PD4K 3M1BB 4MLIA 4B7IA 1U8IA 2WIIA 4XNYL 4F33B 5DTFB 3UO1H 4CVUA 3BKJH 5BV7L 4PIRF 4P46A 3WV0A 3BIAX 3EKCA 4ZNEE 2DQUH 1AD0B 2Z91B 1PW3A 1EERB 3GMQA 2X10A 1FIGL 1MRCL 3U4AA 4OCRL 4G80B 4PJAB 5EBGA 2FX9H 4K3DL 5E4EB 3C87A 3T0DA 4XH2A 2BVOA 5J11C 1MNUH 1MCNA 3U1SH 4S1SL 5HGAB 1YMMB 3CSPA 4JM2F 1NBZA 2JB5L 5BJTB 3TYFB 1EUUA 4BZYA 1IGIL 2ED8A 1HH6B 4J3SA 1IGYB 4ZUSB 1ZANL 1DBMH 4DKDC 3PWNA 4ONOA 5HHPA 3DYPA 1AQDA 3BIKA 3TCLB 2VNCA 3RPIB 2ZUTA 1RHFA 4NSKA 2GFBA 4JDTH 4HQQH 2Q3ZA 3MO1A 1DVFB 1VERA 4FQ2L 4HPOL 4KROD 1MFCL 1S7TA 3O8XC 3O6MH 2G5BB 1QFHA 5E2JA 5HGDB 4BK4A 3ULUE 3BAEH 5C0DB 1U8PB 2D7PA 4I1NB 4P2RA 1S78D 5J1AA 5I75B 4LPVA 5D8JL 3D87B 5F9WB 1A1MB 3TO4D 4HUUB 1MHCB 1UYWL 3SDDA 2YUZA 4NBYB 2ITDA 1DQJB 4KJYA 1NUNB 4ALAH 1AC0A 1LO2L 4L9LC 3VMPA 4F8QA 4QRPB 1S7UB 3QCTL 1C08A 3TIEA 1JV5B 3OKKA 4GW4B 4KGLA 4FABL 4LCWA 4M43L 3W9DA 3QXAA 4LEXH 4P2YA 5BZDA 1WAAA 5CILH 4HG4J 3QCVL 5C2BL 1RFDH 3BKJL 4YHYB 4UBDC 1KFAL 1JMXA 5LKNA 5DD0H 1AGBB 3QHZL 2FYYB 4C56D 4MAUH 4NUGL 4P2OA 1QSZA 3OKEA 1PQZB 4NFBA 1TJIL 2ERJC 4Y0GA 3FFCE 5TGBB 4QTIH 3UPRB 3P3YA 1KB5H 1BLNB 3PF2A 1BQHA 3MV9E 4JO3H 3OKNA 3IVKA 4EUPA 2NXYC 5EU7C 3HKFA 3U7WH 4FFWC 3GMPB 2HFFB 2Z93B 3KPQB 4IRJD 4XP5H 2HT2C 2LTQC 1MVUA 4LGSB 4MAYC 6CGTA 1SEBA 3DGGB 5FF6A 1Q9WA 4XAWH 4FQQA 1Y18A 4QEGA 4MWFA 1QR4A 3VFOB 4XCNB 5I17A 5L2KD 3R8BB 4P99A 2WIIB 4UDTA 1RULL 3GMQB 3WUZA 4FQXC 4MMZC 3WKNA 1YEFH 2AKRA 2VXTH 1Q9OB 5FYJE 3MBEA 2GI7A 1CN4A 1A1OA 4JRYB 3FCTA 3KWWA 2I07A 3HLAB 3TZVD 1U93B 2QKIA 5E2TH 2EDFA 2BVPB 4OZGE 4PGZA 3BO8B 3MX0A 5EU5A 3WFEH 4U05A 2IQ9H 5BRZE 4UMGA 1J1PH 3BOVA 4JHBA 4N0CD 4FTVA 3NA4A 2ARJB 3JV4B 1PKQE 2W0FA 2CXKA 1CICC 4E41A 1N4XH 3SDCA 4N0FA 3HE7D 1B6DA 4YIQB 4NO5A 5FM5O 5I15H 1QRNA 3WLWC 4OF8A 3CVIH 4AQ1B 4YHIB 2GIYA 4PJ9C 3EO1B 3DX9A 1I8LC 3OXSB 1FCGA 5FKAA 4PJFF 4G7YL 4EI5D 5FFLA 4NKMA 5F3BB 3EO0B 3JWDC 4YDJA 3REVA 3LMJH 3DARA 2I25N 4JVWA 3BH8A 4CBPA 5JHLL 3C9NB 3HAEA 2LU4A 5DZOA 3SY0B 1NCWH 2VTFA 4YJZL 2HTLD 4LSQH 1K8DB 4G6JH 4XXDB 4XGZB 2QADB 3QEUA 2NLJA 4YBLC 1CFVL 2BVEA 2OJZL 1H5BC 3T8XB 1OLZA 1ZEAL 3PP3H 1U3HA 5IP4A 1JFQH 2XKNB 2CLVB 3A6BL 1QKZH 1WZ1H 1SVCP 1I8MB 1I1AD 1DBML 3S4SB 3VFVB 1A3RH 5IMKB 4MB3A 2HFEB 1CE6B 1RMFH 2XXMB 2XFXB 3QIUB 4EDWH 3CVHA 4HLJA 2X4OB 4N9GB 5E2WH 2CXGA 4RAVB 2XG4A 1PX4A 5DFTA 3U2SB 1UVQB 2FEEI 1PDKA 5JPNB 3AXLA 1M71A 1I8MA 3ISWA 4NPYA 1ZHBB 5F8QC 1E4KC 1YEFL 3WFCL 5IM7A 1IRAY 2Q76A 5CGYC 2JIXD 4UILL 4AENA 1RJZA 4RFEA 5EBWB 1Q72H 3T0WA 3WEXA 1E6OL 1MAKA 3HNVH 2XA3A 4LRNH 4YFLI 3BGFB 3P73B 3QIBD 3ME0A 4RMTA 3DVGB 1HHGA 5CBAB 1CLOH 4WI2A 4HUKB 1MFAL 1V7NL 4UINL 1DEEB 1JPST 2EXYD 5IIEB 1J1PL 4XPAL 2VZ1A 3VFOA 2ZSVA 1FVCB 5IGXH 3TT3L 5ECJE 1QPPA 1HILA 1T3FA 3QDJD 3KJ6H 2A38A 2PETA 3GMOB 3QIBC 3H9SA 2NY1D 4NCC1 5HXMA 1B4RA 4JGMA 2FX8H 3GMMA 5F7MC 3MACH 3BEWB 2X4RA 3QG7H 1IAOB 4PJIB 5T1LA 4U1SB 3O3UN 2R1WA 4XCFH 2NY6D 4Y5YC 2PN5A 4WVRA 4LSVL 1A7OH 4LDOB 5D70H 4LEXL 4NN5C 5HY9B 1FNSH 5E8DH 3TN0B 3VW3L 4M7JH 3WS6A 3PWJA 3PV6A 3D48R 1OW0A 2IPUK 3RUGE 3R1GH 3BWAB 4MJIA 4DKFH 3GIVA 3TC9A 1FZJA 4FNLL 4G43B 5C0CD 1WC7B 4XP1H 4TRPL 3VXUE 3SKNA 2D31B 4JB9L 2PYFB 3V4PL 1XGUA 2EDXA 4XXCC 5EOQL 4LNVA 1K5NA 5BVJB 1E4JA 4GW4A 1A6ZA 4GRWB 5GZND 3QIUC 2IAND 4HV8A 4N0RA 1CS6A 4Q9QH 4BKLA 4XX1E 4N0UA 2GCYA 5F44A 3SGJC 1OQOA 3FQTA 2KUTA 4GRWF 2A1WL 3L3IA 2X4NA 1T4KB 3MUJA 5B8CC 4Y19B 1JF5A 2ICWA 1Y6KR 3T0AA 4PJXE 3ZE2F 3HE6D 4BA8A 2AABH 5I8CA 1UWGL 1IT9H 2GAZB 4ZXBA 2AXFA 5HYSB 1A6UL 3ES6B 1Q1JL 4HT1H 3T0EE 3KR3H 5JZ7C 12E8L 4XNXL 4DAGL 3ZE2E 4DEPB 1NCDL 5H2BA 5L0QB 1I8KB 1RHHB 3BKCH 3U6RB 1KELL 1XF5B 2SEBA 4G6AD 4K55A 1A4JB 2W9LA 4R4BA 5L9DL 1HI6B 3TBVB 1HK6A 4ZSOB 3Q6FA 5F96L 4NC1C 4Y88A 4GKNA 3QWRA 4WGWB 5HYSA 1X6LA 4XI5D 4D9LL 4XVUD 1AGBA 2P8LB 1BOYA 5EIQA 4YK4B 4YXLL 2DQIL 4POUB 3KYNB 5CUSL 3TNMB 4X6BB 5KW9L 5TQ2L 5FUCE 4FQQB 4K3JH 3X11B 4X6CA 3FB5B 4JM2C 4IDLA 4M1GH 3MTRA 4PJDB 5ESVA 2JELH 1P4IL 2DD8H 3QCUL 5D5MF 1A02N 4MX7B 3WIIH 3W0WB 2HFFA 4OCXH 3E8UH 1REIA 3LQAH 4Z7OF 3U0TB 2FJHA 5DVNA 5GGRA 3GMRB 3K2UH 4Y16D 1WEJL 5I1EH 3HZKB 3NCBB 5KJRH 32C2B 4U6XA 4O9HH 3GI9L 5I18L 4DZBA 1NMCC 3HI6L 3K4AA 1UJTA 1C8PA 1FH5H 2F74B 3DXAA 4Y7MA 1UJ3B 4Y1AE 3QUXD 3LV3A 1VHPA 3RZWA 3DO7A 3D69B 3PGCA 2CQVA 1S8DB 5HVGB 2PTTB 3FQWA 2Q6WA 3JWOL 1HHHA 3GSUA 2V2XA 3S36H 4Y5XA 3EOAA 4EXPX 2DQFA 3F5WA 1OAUL 4MA8H 3BEWA 1OB1B 4IOFC 4DCQA 5D71H 4X7SH 3QRGL 3NACH 4E41D 2DI7A 4H0GA 3U2SA 2FGWH 5I2IA 1CT8A 2DI9A 3PV6B 1XGQB 4DGIH 2R4SH 3GSOB 1RJYA 1HH9A 4L4TB 5KVDL 5T3XL 5ISZA 5IB2B 3STLA 3D3VE 3ARGC 1X5KA 2XWJB 4DEPC 1ACZA 2WQRA 3HG1D 2WIMA 3O9WC 1FZOA 3MJ8B 3V2AR 3GIVB 1Q0YL 4YGVA 3L3OB 4MJ5A 2VAAB 2ZUUA 4ZPVA 1CF8L 1B0GA 1A7BA 1E6JL 3QP3A 1NDGA 3JUZA 3ALWA 4NQEE 4Y5VA 4NM8H 4HEME 2BVQA 1PYWB 4WU7B 1F4YL 3KPSD 3OXRA 1UGNA 5DS8A 4Z76B 5I6XC 3OAUL 1RZKH 5A2JH 2X70A 1VEMA 5I1HL 5HHXL 1AO7D 3REWA 2J3SA 1J86A 3CDGA 4KKLD 4XP4H 1WWWX 2AJXH 3BGFC 3IDXL 4MJ4A 5T1KA 2KPNA 3OL2A 1FBIH 1JNHA 4HUMB 4TSAL 5FO8B 2YMXL 4XNZC 5GRUH 4HBQA 4WU5B 1R3IH 1T66C 4N8VA 1FZMA 1J9CT 3WUWA 4UNVA 2D9QB 3BZ4B 4LIQE 5IESL 3OZ9H 1W72A 4M8QB 2AI0L 3SE3A 3MNVA 3SDCC 3SDDD 3SDXA 3KPOB 4TRPH 5FO8A 1OARH 1DQQA 2NY2C 1DVFC 4OUUB 2LU3A 4OZHB 4RFEB 3TV3L 1WTLA 4JFFD 1YA5A 5DJCB 3PL6C 5GS0C 4K7PX 4TTGA 3IDGA 4YE4H 4F15B 4M1CC 2AK4B 2WUBL 1I1FA 3BPCA 1RZJH 1G7MA 4OCWH 2O5XH 5SWZE 1BJ8A 4PJ7E 5L8LB 3T4AA 2A9ML 4XBGB 3EO9L 4KY1H 4JFXB 4NO3B 2WANA 4GS7C 2ZWLT 3PABA 2IH1B 4UDUA 1GGIH 1H5BA 4FQ2H 1SEBB 3NZHH 2FIKA 2VXTL 3IYLW 5E8NA 4DZBB 5T1DH 4MA1C 2B4CH 3BZEA 3U6RA 2NXYB 1U3HC 4Y89A 3NGBC 1EPFA 4F7PB 4UB0L 3NTCH 3MOBH 3NFNA 4LCUA 2VL5A 2X4PB 4Q9RL 1Z2KA 2A9NH 4BFIB 2VQ1B 4XHQA 3JV0A 4PJGF 5A2LH 3DO3A 1S5IL 3LY6A 2RIKA 4OKDA 4IRZH 3MBXH 1MFBH 3IDIA 1Z9LA 3WS3A 1TITA 2FHCA 1U2CA 1YJDC 3FO1B 5ID0B 1I75A 3MCLL 3D39E 2OL3L 2NX5E 3L5HA 2HJKA 4Z5RA 4A6YA 3GJFK 2VXSH 1KC5H 2E8YA 4M6OL 5GISL 2ZSWA 2FD6L 1G9MC 3QCUH 5E5RB 1EAPA 4QRRE 4N0FB 5H2BB 4OV5A 1VEPA 2XA8H 3IDUA 3U82B 3MMEA 4N1EA 2F8VA 4PLOB 4C59B 1U58B 1OM3H 1CDHA 1YY9D 4NO2A 2EYTB 3I50L 3OJMB 3TPUA 4PGBB 4G6FD 2ENYA 3D0LB 3QUYB 3F7VB 1MWAA 3LV3B 3C8KB 5GGVH 4JFED 1LP9E 5IR1A 4TVPL 4YDIL 3GEWB 3X12B 2OXGA 1NDGB 4X5LA 1TJHL 1R3LB 2MFNA 5IFAH 2AJZA 1VFBB 4FMFA 5F9DC 5KBNC 1S7XB 1MF2L 1KTDB 1IZJA 4JE4B 1IL1B 2E9IA 2ZUVA 3H9HA 3RA7H 2AV7A 3U30C 1P4LA 3WSQL 4GT7A 1GGBL 4P9HL 4V1DE 2HJKB 1RZJL 4GKSB 1F4AA 2CR6A 1CXEA 5CD5C 5KZCB 1JYWA 4F8TA 1L0YA 5CSGA 1GSMA 1EEUA 1XGQA 2DL2A 1CTNA 1UM5H 2D03L 3F62A 3IDJB 5GIRB 3V0VB 5MENB 5E08L 4KROB 3EO9H 4YO0B 1M7DB 5FHBH 5EZIH 5D93C 2GUOA 1JGVH 5EFIB 1RUML 1UXSA 3AY4C 4KGJA 1A1MA 3AS1A 2CIIB 1HQ4B 1WZLA 1BFOB 2VISA 5CD5D 5A3IC 5EOTB 1I7TA 1FYTE 4PRBB 2QR0A 3HPJB 2OMBA 4X9HA 1FORL 3HI1A 2VDML 2CKBA 4LP5A 1TZGL 5KSBB 5MHSE 1YEHH 2Q8BL 5TE7H 1J05B 4PJHA 3TVMB 2P46B 1EEYA 5SWSD 3SJVD 1JV5A 2RB8A 4HUXA 3GO1L 3PXJA 3P9WB 2G75A 1NCAL 2Z31C 2UZXB 3GJEB 3RZCC 2AV1A 4OZHF 3VWJB 3UZEA 4PGDB 4ZXBB 3SHSA 2VLJB 5MENE 5B8CA 3LHPH 2ZPKH 2QADD 3B9EA 3MRDB 2HN7B 1FDLH 4Q9CA 1KXVC 3HUJF 4NJ9H 2H8PB 1A4KB 1FLTX 2VB5A 1YN7A 25C8H 3QB7C 4F9LA 1FYTB 1MFDL 3ARFA 3FQUA 4JFDD 1A1NA 2C4FU 3CLFH 1DTUA 1JGLH 3B8SA 1UCBL 3SO5A 1YMHA 2P5EB 4KZDL 1XGPA 5A40E 1IQDB 4HPOH 1CDCA 4AEHL 3D2UB 3ET9F 3QDGD 1LP9B 4N5ED 2WNGA 1D6EB 1I9RH 3V8OA 2VE6A 3VFNB 3G08A 3HG1A 3N50A 4LFHD 5DRXA 5LQBL 1H3XA 1TJHH 4JM2A 2VLJE 5HDQL 2DM2A 3Q48A 2BOCB 1E4XL 2JIXB 1BZ7B 2ZOKB 4R90L 5F1KC 3CXDH 3E6HA 5D7KD 2XWTB 3H9SD 3U9PL 1OSPL 2A74A 1FNSL 5E8DL 1BQLL 5JHDE 4FNLH 4JZNA 1AGEA 4NCC2 4YHKL 1B0WA 1KLUB 4NQUA 1B2WL 5EBMB 4X0KA 5HVWA 3L3HB 5DS8B 5IBLD 1BQHG 1IGMH 2BP3A 2CRZA 3BMWA 4RDQF 4EUPH 4HV8B 3BZFA 5D2LA 3ARGD 3EBAA 1NGQH 1K3ZA 1M1SA 4LLWA 4NZTH 3UYRH 3AREC 3FB8B 1MEXL 3MLRH 5K9QI 5K93A 3EW3B 2OSLA 4Y5XC 4V1DA 4PJAA 3HUJA 5DJDA 4BELD 4LPTA 4JO3L 5E95B 3RGVC 1FVEB 3ARRA 3Q2CA 4X5XA 5E70A 4DUXA 1K4DA 1RJLB 4LLWB 4LVOC 2P5WB 4G8EA 1CK0L 5IWLC 3IKCA 4K71C 1G7QA 4U3XA 1T89C 1IC7L 3WN5C 43CAA 5IQ9A 4F15C 3O41B 4FTVD 2VLKD 4LLMB 3MLTA 4Y4FC 1Y6NR 5GGTL 2NY3C 1ZA6B 4G8IA 4E9LA 4X5XB 4HH9B 4RMUA 2FJGA 2UUDK 1KCUH 2VLLA 5C0FA 3IU4L 2A83B 3F12B 4JGUA 4Z7WA 3UBXB 5CUSH 1KPUA 1XZ0B 2H1PH 4XHJD 4L4JA 3QEGL 1F97A 1RD6A 1Q8MA 4TNWK 3MRQB 1ZA6A 4G8IB 3M07A 1HQRA 1RIHH 4QGTA 2JELL 4L3EE 2Y6SD 4OTXH 3WL9A 5ILTH 4HWZB 2HKFL 1J8HA 4HUVA 5ADOL 2R69L 2XTLA 1YEGL 2IF7A 3E3QE 2M8XA 2X70B 5E00B 5JHDB 1OP5K 3LS5L 4MXWH 2P7TB 5DUMH 4WWID 2MNUA 1AGFB 3ZTJH 4NKIH 3DX6B 1QEWA 3TESA 5GZOD 4KRPC 2KZWA 4GRMA 3SQBA 2WQ8A 3B9DA 3ULUC 4HF5H 4XXDA 4HUVB 3HA0A 4UU9A 3CDYA 4Y4HD 2YXFA 2UY6A 1ED3B 3EYVA 3JWOH 4ONGL 3RVXC 3IF1B 5EU4A 3VI4E 3P30H 4FG6D 4BSWB 4E42B 1H3WM 1SM3H 5IVZA 4UZGA 4L3EB 1MCIA 4YAQA 4JRXA 3PNWB 1TQCB 1L6ZA 3IJSB 3VFMA 5CIPB 1ZLUK 4YFDB 4P9HH 3TIDA 3ZE1F 1ZVSB 2EDTA 1HHJA 3RL2B 4RFOL 4HWZA 1QQDB 4HWNA 4LLVA 4K94C 4YHNB 3LQMA 1URLA 3MRLB 3KPRA 4PJXB 1GZQA 5SWQB 4PRAA 2CKBH 2CLZB 4F7CA 1IAMA 3QNZB 5ENWA 1B9ZA 4O2CB 2BNUB 4U3HA 3GZKA 3T4YA 5AUMA 3V52H 2YPLE 5C7XH 5CLWA 3HR5A 1I3VA 1NBVL 4JFPB 2AK1H 1MHEB 3JV6B 3CSYB 5IB5B 4MXQC 3L3GA 3L5WA 4MJ6B 4KAQH 1PG7W 4F7EB 3D9AL 4HLZG 1JGDB 1M05A 4F7MA 1UKTA 5DLMH 5C0NC 3JWNC 3G6JE 4KJYB 3WFEL 4JN1L 4R7NA 4OZFA 4OLYH 2Y23A 5DEZA 1JZ3A 4R9HA 1IFHL 1QBBA 5EUOB 2GJ6B 3CXDL 3N0PB 1WT5C 3HC4L 1K2DB 2MHAA 4TUOB 4L8SC 4PRHB 3I9GL 2AJUH 2EKSB 5B38A 1J7VR 1BBDL 5J57B 4GAGH 3IRZA 5E6IA 5MERA 1DUZA 1LK3L 1QLRA 1SVZA 2YPVH 1WC7A 4AIXA 2DQCH 3LKOA 4NWUH 1NAMH 5BZWB 4BSJA 4UT7H 1FV1A 4Y1AB 3C5SB 1X5LA 4FQHA 4PJBF 5H37G 1LO5B 4MQSB 2E7MA 4YFEA 2C4XA 3EJZD 5E2VL 5D7SH 4CJ0A 2H32H 4ODVL 5KS9B 5F6HI 2DLIA 1I7UB 4PV9B 4PS4H 2GTWA 1KLGB 2NY5L 1ZHKA 1RZIB 1QBLH 3WLBB 5C9JA 4OM1L 1P5VA 4JQIL 5A2FA 2C3WA 5EWIL 1MEXH 1T22A 2Z8RA 3P11L 1TLKA 4EIGB 5DJXB 1JRHI 5C6TL 3HE7B 5BQ7B 3MRIA 4PREA 4BZ2L 1GGUA 4OCWL 2P42B 3ES6A 1EGJL 4GUPA 4EEEA 5F89A 4PJCA 2ZCKH 4ENED 2A9MH 4MA3B 2ZZUT 3C6LA 5CEYA 1ZXQA 3RL1B 2HFGL 2FR4A 4D9QE 4ORZC 3RI5F 1I9IL 4AQOA 5C08D 2ATPB 2ED9A 1IILE 2YD6A 1TVHB 5EC2B 5D7JB 5GSRA 5C0CB 4ZQKB 2GTWB 1HDMA 1YY8B 1GGCH 3QDGA 3TGXA 3PG2A 4EI6B 3IDJA 5MENA 5I1LB 3MR9B 3RWFA 1MCLA 2GY7B 4UT6L 5JLZB 5K9KA 1LP9A 3V6ZB 1YJDH 4OZGF 2E7LA 3WIFB 3QPXL 3BKMH 1CLOL 1UM6L 1UM4L 1F4WL 1CK0H 5J9PB 5C09D 1OP9A 2Y36L 3MRRA 3NOIA 5H94B 3LOWA 4BQ9A 4EDXA 3GK8H 2E9WA 3VXSB 3VGDA 2CKBB 4S1DC 1FYTA 5SWQA 1EHLH 1AR2A 5D1QC 4QHLA 3LQAC 4WY7H 1SY6H 2DN7A 1QQDA 3A67L 3ALPA 2BNRE 2XZQL 4DVRL 5L7XL 3UAJD 3QO0B 1N3NA 3L5IA 4X4XB 4MXWL 1SBBA 4CVZA 2ADGB 3BP7A 3I50H 1KC5L 1N7ML 4ZUUB 2B0SH 1AC6A 4ZUWB 4EXKA 3QIWC 2MKLC 3V5HA 1GIGH 3UTPD 4GRLA 4KK9D 2EEBA 1DZBA 2PR4H 4GAGL 1S9WB 1XCTA 3D18A 3GMNB 2D31A 1ZA3B 4R0LB 2J7LA 2HYMA 3GKWL 4JREC 1FHGA 1UEMA 2NY3B 4W6YB 5D2LE 5HGHB 1J18A 1E4XI 1T80A 1IAIM 3P4OB 3KPPA 4I18B 4U2YA 4QHNA 3SKUD 4D3CL 1B4JH 2IAMB 3TO2A 3MRMB 3VWKA 1N6UA 4H1LA 5DC4B 2DQUL 2YKLL 2VQ1A 1OVZA 3K7UA 4NKQB 1ZV5A 1YC8A 3T77B 1MRDL 2FSEB 5DK3A 4WWKD 4QXTB 5CEZD 4GG6A 4L29A 3MRMA 3KLDA 5ISZD 5HI5D 3RPKA 5C7XL 2J12B 5I16A 4ZDHA 4GXVH 4OZ4B 5FDYA 4NN5B 4OKVB 4NC0B 3RBGA 3O3EA 1Q72L 3D39A 2VKWA 1JHLL 1UB6A 5BOZG 4LEOA 5TPWH 1MJ7L 4QRUB 5AG8A 1T6WA 4LRNL 3LIZH 4U1KB 1FLRH 2KDGA 2EYTA 3SOBL 3JSSA 1DBBH 1I85A 1ADQA 4PB9L 2KH2B 5E00A 3QQ3B 4M93C 3F65A 1DP0A 2R0LL 4LSTL 4V2BA 1L7TH 2GSGB 3RUGA 4OLYL 3ULUF 4HKZB 2FX7L 1T1ZB 4L8DB 1IGFL 3GO1H 2IQAA 3QULA 1EHXA 4CDGC 1LO0H 1U8JA 1H3VA 2JB6A 2VKXA 4O00A 5KW9H 4QXTA 3P77B 1ZHLB 4XCEB 5CGTA 5CJXC 1C12A 3GUTA 4P2QD 4JY4A 4JM4L 4OUUA 1Q9LB 1AO7E 3MYJA 2D7NA 3LEYH 2IPTH 4Z9KB 3MJ9A 3TZVC 4U1NB 5FYKL 2YOCA 3SKOB 4OD3L 4PJHF 3W11D 2VXVL 3VH8B 1X5HA 4CGTA 1I1AB 2J8UA 2NY5H 3BPCB 4P4KA 1DSFH 3MQIA 1XGPB 4QCIA 4HIEA 5K9KB 4IHOA 2EC9U 2L4OA 4OB5L 3UDWA 2IPUG 5HI4C 3OKDB 4NQVA 5CSZA 1DANU 1U3HB 5F72S 2F53B 3FHAA 4ELME 4M7KH 1ACYL 3QJHB 4ZOAA 4R26L 3UEZA 3MPCA 1MUJA 2I9TA 4CU8A 1OF2A 2DYPD 1E28B 5AAMA 4IEFB 3MV8B 2AV1B 2X4QB 2ZJSH 3ZHKA 4LL9A 3HTLX 4K8RH 1G7MB 1XIWC 1RU9L 3L3KB 3U7WL 4NBZB 3O2VL 4HF5L 1C1EL 3UTTA 4L5FL 4U6XB 3WXVH 1I3GL 3AAZB 1J1OH 1D5XA 4HJJL 1DQLL 3FFCA 1LO3L 3ARBD 4JKPH 2Z35B 4ZFZA 2DS4A 1D9KB 2HN7A 4YHKH 4JLRB 2W0KA 4M6AA 2JK5A 1F00I 2Y25A 3ARZA 1A7NL 1XF4A 3MXVL 2BCKA 3I02A 2F74A 2X1XR 1OL0A 2CUHA 4OLVL 3B2VH 4JKLA 5CJBA 3VG9B 3ZE0F 1IC4L 4JR9H 4APQD 3DYMA 2IANB 3MLYL 2OR9H 5D7JC 1DN0B 4P3DA 3O0RL 4U1IA 1FVEA 1SJEB 1QLEL 3V52L 3D3VA 5I76B 5CIPH 1JHKL 5K59E 5D2NB 1MFAH 3IXTA 4JHZA 3BPNC 4I2XA 4ZO8A 3Q0HA 4PS4L 2HT4D 3C8HA 4MNGE 2EO1A 3RRQA 5ITFB 5I76A 4WW2C 4CADB 5DMKA 2ZCHH 3CMOL 2NYYD 4KI5C 1P7QD 2WM0A 4P46B 1QACA 1T5WB 2EC8A 2ARWA 5ALBH 4LMQI 1S7RB 3RTQA 2AJ3B 3QH3B 5I1JL 2DQHL 3W9EA 4ONGH 3BISA 4M7KL 1R3LA 3FO0H 3CNKA 2DM7A 4CMMB 4FQ1L 1Z0MA 4N5UA 3MLPA 5IG7B 1CU4H 4TULH 1QSFA 1MJUH 5ITBH 3NIFF 5C0GA 5DWUH 3MGTA 3V6ZA 1IGYA 1S9XA 2FH6A 2EDOA 3K81A 2QADC 1P9MA 1YC7A 8FABB 1AQDB 3BIKB 3BIBX 3TCLA 5A2KH 5C0BD 2VUYA 4YQXH 2CLRB 3JBG7 3HMXH 5CP7A 3LZFH 1T7YA 4CRPA 4MD5A 5ICXB 3DX8A 5T3ZL 3IDNA 4Z7VE 4Z7UB 5GGUB 3MUZ1 3GK8L 4I5BB 3KPNA 1JVKA 3L3JB 1EGJH 4KDTC 3W81A 4XPGL 3BDYL 2YRZA 2R8SL 3AC0A 4JZOB 1F6AB 3HNVL 4PJEA 1KBGL 3RY6A 5AYQA 4C55A 4FFWD 3SDXB 2HT4C 4N68A 1UKQA 3QFJA 1CBVL 2VZTA 1AIFB 1V3KA 2CDFA 4M48H 3QEQD 3DMMB 1DBBL 2DMKA 4D0CB 1O7SA 2P8MA 3QQNA 3RWHB 4ESKA 1WZKA 1ITCA 4J1UA 2EIEA 4P49A 3J7HA 3RI5K 5IHUH 4ODSH 1T1WA 5GJTL 4U0RC 3RQ3A 1C12B 4XNUH 5HHOA 5B22A 1C7TA 2CIKA 1A21A 4ZS7H 4YZFE 3MRHA 2BK8A 4RISL 3QO1B 35C8H 2VDOL 4CUCA 1NL0H 2BCKB 2E6QA 4X6EB 3HC4H 1I1AA 4N8VB 1I7ZA 5EBLB 1M6OA 2E9JA 3N9GH 4XNZB 3GSWA 3ARXA 5TFSH 3K8LA 2AXHA 4LNRA 5IF0A 2D7OA 2NR6C 5E6IB 2VO5A 3TIDB 4ODUB 1INQB 1FJ1A 5CINL 4QRQA 1F4XH 4RFNC 4M6OH 1JTOA 1E4WH 4JKPL 2WZPD 2VXQH 2ZCLL 1QHOA 2Q3AA 4RWYL 1F11A 4QRUA 2OTUB 4LSUH 2YC1A 3GDBA 4QRRD 4JPKL 3WSQH 1NGZA 1A6PA 1P7KA 3JWDL 1NUDA 2OMNA 4QY8B 5E6ID 1RU9H 3PL6B 4F57H 2EZ0C 3QWOA 4EZMA 1FNAA 1SHMA 2VDNL 1KG0A 1PG7L 3UTTB 3DGCR 5GPRA 5I1KL 3PHQA 1EEQA 1KB5B 1NFIA 3CH1A 3NABL 1MI5B 1MLCB 4X6EA 5JXED 1UWEL 3IU3B 3FOLB 5E2UL 4WFGE 4O4YL 4HHAA 1JL8A 1MRFL 3GB7B 2VZVA 4IHOB 2JB6B 4KUZH 3T04D 2H9GB 1PJ9A 1K8IB 1JZ2A 3ELAT 1H3PH 4RCAA 5DJ8B 1JN6B 3GNML 4WDIA 2X42A 3DUSB 4WI9A 4AH2B 5CD3B 4OAWA 5CEXB 4E0RA 4LLQA 3QQ3A 4RGOH 2DDQL 3GJEA 1JZ4A 3OKOA 4P48A 1NCAH 4OZIF 3O6FA 1N59A 5DC9B 5C6WH 1EEZB 5JMRA 2DQTH 2J1KA 1RI8A 2MPAH 4KU1A 3CDCA 5LWYH 4Y5YA 2NW3A 1GGCL 4F3FB 5JNYB 5CMAA 1ETZB 5T1KB 1X9QA 7CGTA 2V9TA 4KMTL 1KSRA 1ZHLA 3VXNA 1AFVL 2W1NA 1F02I 4XMLH 3FQNA 3T0XA 1UCBH 5C8JA 3KPMA 1SMAA 1TVBA 3VGGA 1F8TL 4X6CB 3E1F1 3SDYL 4WNQA 3PWPA 1I9EA 5BMFL 3HZYB 3NAAL 1D5MB 3PQYA 3B8YA 3DVFA 1UADC 3ARUA 5CBEB 8CGTA 4L3ED 2VN7A 3T3MF 3WIIL 4PLNC 3TVMA 4CMMA 3LZFL 3P11H 3VWJD 5DD0L 1VADB 4LLUA 2EKJA 4JM4H 4WW2B 1NCNA 4CKVX 1A4KA 3O8XB 5FUOL 3VH8A 3GSQA 4QTIL 2NPLX 1S9XB 4PJFB 1BFSA 3KJ4C 3KPOA 1AI1L 3GJFH 4LCWE 5HTSA 5IVXF 2DWDB 3C5ZC 1IQDA 1MJUL 4MNQE 5BXFB 5JW4M 5ILTL 3VXMB 4S1RH 5J1TC 4LPCA 3BN3B 4F80A 2VERN 2C26A 4R4BB 4C4KT 4F37K 5TE6H 4RGNE 1MLBA 3RHWF 5DQDL 3EHBC 3RU8L 3MFGB 3W9DB 4Y5XB 4ZUTA 2DKMA 3EO1A 4U31A 4KVNH 4GLRH 4ZD3L 4Y4KA 2QR0B 2PTTA 1XCQB 3B4NA 4L4TE 2G2RB 5FYKD 4WUUE 2Y7QB 3MV7D 4JN2A 5I9QC 1SYSA 3EOTH 3RZCA 4J4PC 5HGBA 5F3HA 5IJVB 3O6LL 3L5XL 2FYYA 5HI3D 1V3MA 4OT1H 1Y6MR 5DD5H 2DMBA 2NZIA 4RZCB 3NN8A 3MLWL 5TDOA 5LXGL 4X8JB 2HG5B 5KZCD 1U2HA 1HHIA 3BP7B 3GMRA 4JFYB 1RZKL 4M48L 1KJ2H 1JI2A 3VXSE 2ZG3A 1G9EA 5JW5B 4M02A 4YIQA 1ZANH 1D9KD 3OHXB 2D0HA 4JFYA 1XGTA 1FL6A 3NZ8B 5HGGS 1K6QL 5I17B 1BVLB 4JDTL 4JR9L 4UUJA 2IADA 1ORSB 2X1OA 1WWAX 1FC2D 3ZSTA 2DOCA 2DJUA 4QHNB 1T5XB 1TNNA 3HMWL 3VI3F 2CGRL 3VFUB 3QFDB 3IRPX 3NCYS 3P9MA 3FCTB 2PYEB 1FO0A 3DRTA 1UKSA<