3QEUA

The crystal structure of tcr dmf5
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
201
structure length
195
Chain Sequence
KEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVNFGGGKLIFGQGTELSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWACANAFNNSIIPEDTFFPSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords DMF5 alpha chain
publication title TCRs Used in Cancer Gene Therapy Cross-React with MART-1/Melan-A Tumor Antigens via Distinct Mechanisms.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 195
sequence length 201
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qeuA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qeuA02
5DLML 3ZSTA 3MJ7B 1ZLSL 5H37G 1NH6A 1RI8A 2EYTA 1F4YL 2HFGL 1NC2B 2AJ3B 4FNLH 3ZT7A 5L2KB 3GM0A 2O5YH 1SMOA 3KPOA 2HAZA 1FNSL 3C6SA 1CGSH 2BNUA 4NDMA 3L7EA 4HC1H 4P5KB 5BW7A 3KXFA 1WCBA 4DEPB 1FPTL 4OIIL 5EORH 1IAIM 2JJWA 2YSSB 5ERWB 5IFJA 3ARFD 1TZIB 4TVSa 2D4FA 5IW1B 5I2IB 3WJLC 1DBBL 4ZAKB 4WHYH 4DCQB 2VMFA 2EDXA 3UCRA 5IHUL 2VXQL 5BO1H 5C71A 5BXFB 3QDJB 5GGVH 2E8YA 3MODH 5GHWH 4HG4J 1LO2H 4OFPA 1YN7A 1KPUB 1CGXA 4OD3H 4F7TB 2Q86B 2X41A 3B83A 3EOBA 3HE7C 3UZQA 3ZE1E 3U7YH 4H1LA 3ARYA 4GW4A 5JOFA 2V6HA 2H6PA 4MQXC 4MVBD 5JW5B 1C5BL 1LEKB 4J12A 5TQ0H 4X4XB 1OPGL 3VI4E 4OFKA 2PXYC 4EI5B 5HYEA 1XGRB 2X4RA 3BKYL 4JG1H 1KB5L 4JCMA 2R23A 4XPBH 4IRZL 2GSIA 4CNIB 2X6MA 3LVEA 1IRAY 3L3JB 4PRPD 3NH7H 3FZUC 3RAJL 1OQOA 3V9FA 4S1RH 3U30C 1PX3A 3QRGL 5CSZA 5GGTL 1BVKB 2VKWA 4NPYB 5ITFB 4FQHB 3V6OA 3O9WA 4PJ8C 4KKBD 4YAQB 4EN3A 4DKEL 3EAKA 5GGSA 4MX7A 2FLBT 2MJWA 4C54A 5T5NF 2P8MA 2VLRB 1QLEL 4XHQA 2AAVA 4LCUB 5DK2A 4PJBE 2X4PA 4TQEL 5LGJA 4W6WB 1QHOA 2P48B 4RNRB 3C5JB 1AE6L 4PJ5A 1U8PB 4JO2H 4P2OB 1IBGL 4M5ZL 3GJEA 1RUPL 1FNHA 1FZOA 3FO2B 2LU3A 4L4VD 4RMSA 1IAMA 4RMQA 1Z9OA 4WIQA 3WS3B 4KWUA 1MELA 2FH6A 3ZTJH 4I2XE 3QO0A 2XTJE 5B4MD 5EIVA 2M1KA 1MEXH 2QSTA 3ARBB 2XG4A 3BO8B 4P2QB 3LQZB 4PV9A 4L9LB 5K59F 3LRSB 3GZKA 3E6FA 3FRPA 4PRAA 4UMGA 3V6ZA 3RGVC 3QXAA 3OJDB 1ZWIA 2EE2A 5I8CB 3OB0H 3HMWL 2P24B 4QTHB 4C58B 3FAWA 4JPWH 4MWFA 2DMKA 2HRPL 2A9ML 4U31A 4OCRL 2HG5A 5I16B 5GGQL 5IVZA 2VJXA 1P6FA 3HZMB 5TPWL 3T4YA 3RUGB 3VE0A 4Y5XB 5D1ZD 4JQVA 4OZFH 4G8GD 2PUQT 4CDHA 3BGAA 4E0RB 1Q1JH 1D5XB 3TGXA 2XWTA 3S37H 3NMEA 4S0SD 5CBEB 1RZFH 1CXEA 5IR1A 2G2RA 4HBCL 5J12B 2LFGA 4YQXH 1NFDB 3FB6B 3F5WB 2YC1A 4AEEA 2Z9TA 1G1YA 4N8CH 5HD8D 5F7DA 4B5EA 5J6GA 1UXSA 4CADB 4I3GA 1OD7A 1CU4L 5BOZG 2I26N 5HI5C 1SHMA 3KLSA 4ELMF 4N0YH 2Q87A 4DFHA 5IQ7L 3Q6FA 3GIZL 3AS2A 4JFFD 3QR2A 2ICWJ 1U36A 1UWEH 3X14A 2BNQA 4GSDL 3VRLF 4QRQA 3TZVB 3PXJA 3U9PL 5DHVA 5CJXC 1CLYL 1MCFA 4G7YL 15C8L 2X4NB 2ADJA 2Z92B 2DS4A 3DOSA 3PIQA 5HDLA 1IC4L 1CGVA 5HDBE 4M8QA 3KPPB 1IE5A 4KVNL 1ES0B 1LEIA 1ZHBB 5IUSA 2VDOH 4AH2B 1TETH 1BBJB 4FQXA 4OFDA 3LZFL 2UV3A 3IYLW 1G7QB 2QQNH 2ZSWB 1LP9E 2B1HH 2FNBA 3Q1SH 4KKNA 1AGFA 4JFYA 3EBAA 1U95B 4PJ7B 5GGUB 3HPLA 5E2VL 5HDOA 4P23A 4PRPE 2PTTA 1BFSA 1GJIA 3VXNA 4RGNB 3RVVC 4JO1L 4GG6E 1D7FA 2GJ6A 1TZGH 1QFWH 5EN2A 3RZWA 4NZTL 2VZUA 1ZTXL 2FJHA 4MA8L 4I8DA 4P49A 1T22A 2GTWB 5J06A 3S97C 2BERA 3V5KA 3HAEG 1X5YA 4NT6B 1T66C 3DX9A 3LAFA 4OLWH 4FP8H 1KJ3H 2AK4D 4GW1B 4KK6D 1KJMB 2PYEB 4PGCB 4G80A 4L4VE 1EXUA 3DGCR 1AIFA 1H3WM 1HQ4B 3F58H 3TNNB 3TYFB 4NYLB 4YK4C 1QBLL 1CTNA 2DQCL 4CVXA 5CD5D 3I6KB 2BFVH 3FO0H 1WICA 1P7HL 4XPFH 3QUZC 2YRPA 1A6VL 1G7JB 2DQHH 3MRLA 3ARVA 4DGYH 5DSCA 2X4QA 3SQBA 1T03L 4BSVA 3GSXA 1FHGA 3N85H 2Z93B 2IAMA 4PJAA 5DMGD 4ZUSA 3RZCC 4L8SC 3IDYC 4MQ7A 5JTWA 4OZIE 1IZJA 1MJ7L 5KSAA 4YWGH 2KPNA 4OCWH 1K5NB 2FHBA 1CDJA 1AFVL 2AV7A 1S7UA 4G8GE 5D1XA 4LHQB 1H0DA 5DYOB 5CP7B 1NMAH 2XA8L 3DNKA 4K71C 1MHCA 4Y4FD 1FNGA 1DQDH 4XVTH 2DL9A 4UINL 2GHWB 5FHAH 4TTDD 5HDQL 4WV1C 5D7SL 4JN1L 1PZ5A 2WQ8A 5F9AC 3FT4B 1CG9B 2R0WH 2JKXA 2DI7A 4ZXBB 5HVWA 3D39B 4O58L 1QSFB 1R3LB 4ODUA 1CDBA 4AENA 4JFFE 5CEXA 1N7MH 1NCBH 3KYKL 1UC6A 3MRFA 1GGCL 4JHBA 4HMDA 3TO2A 4BA8A 2BJML 4ZSOE 1TVBA 4F7MA 1IEBA 3G5YA 5FUOL 4OJFL 4LCCA 3OXRA 1W72H 2NW2B 1P1ZB 3LKRB 2X42A 4CL7A 1OL0A 3HMXL 3GBLA 3GK8H 3HE7D 1IGIL 3BKCL 3CMOL 1MWAB 3NN8A 3JV4B 1WITA 2UY6A 3OJ2C 4H8WC 4MQXD 1SJHA 2QADC 1EEZB 4WGVB 3N06B 4JKWA 5HY9A 1AP2A 1FZMB 2PXYD 5T1LD 3VU2A 4XNZB 5BZDB 2PO6D 3L9RB 5F88B 4P5MB 5DVOA 4JFPA 5EWIH 1VSCA 1ZANL 1NBYB 4YXKL 1CD1B 2E9BA 1P2CB 2IF7A 3BEVA 3HRPA 2OJZL 1DN0A 3QUXC 5BV7L 1ZT1A 4PJ8D 3MGOB 3RBSA 5EZOL 3CVIH 1QKZH 4GMTL 2DKSA 5E7BA 4U7MA 3TBTA 1JWMA 3BXNA 1EERB 3HR5B 5BJTA 2FO4B 5C3TA 2IPKA 4NQUA 5IIEA 2ITDA 1EAPA 2FGWL 1EO8L 3D3VD 5LAXB 2Q6WA 3BP4A 2NTFA 4MGXA 4G7VL 4OZHF 5DUML 4BKLA 4EXPX 3T4AA 1FFPA 4PRHD 2ZUXA 2BRQA 1E4KA 2NY0C 1U58B 1T6WA 2HRLA 4ZQKB 3U7WL 3MRCB 3TCLA 3NAAL 2AK4E 4GRWH 2BXYA 3IB4A 3INUL 4KY1H 5ESVB 3TM6A 1Z0NA 4Z0XB 6FABL 1RVFL 4GXUN 3MA9L 4OBSA 2XKNB 4ODWA 3TA3C 5I1IH 4AG4H 1KCUH 1JHKH 2GCYA 5B39B 1C1EH 4JY5H 4M6MH 4MA1B 1X5KA 1ZKAA 3RGVD 1XCTB 4D0CA 4RMTA 1NEUA 5EOCJ 3O4OB 1ZHLB 2VZTA 2OXGA 1QBMH 1L0YA 1QOKA 3BMVA 4XVJH 2JJVA 2VIRB 1AGCA 4BFIB 5JHLL 2HVJA 1N5YH 2OS7A 3PHQA 1IM9B 2A74A 3KPSA 3V7AE 1WIOA 3MRGA 4PTUA 1CZ8H 5CGYD 4L8BB 3WBDA 1T1YB 4WFHD 4OZGE 1ZE3C 5AAWA 3P0VH 2WUBL 4LOUC 1QLRB 4P46A 3MYJA 3OQ3B 1M7XA 4R9HA 1CE1H 1LVEA 1T6VN 2C1PB 2UUDK 5TGBB 2IBZY 1YMMA 3C6LA 3VWKA 4LSTH 3NFPA 2XRAH 4OQ1A 5MEPA 3QO1A 4X6DF 1VFBA 2NXZC 3QZWG 3PWLB 4HS3B 4UQ3B 3N1QC 3UTTB 1O7VA 3BZDA 3DX6B 5KVDL 2D0GA 3MJ8B 5DRNB 3WLBB 4WI7A 1RK0B 2VQ1A 3HZKA 5C0EA 4LRIA 1D5ZB 1RZ7L 4XNQA 4YHIA 5CGMA 1MCPH 2G5BB 3ARGC 1P4BL 4QGYA 5T1MA 5DDHB 1OAYH 4UTBL 4JQIH 5GRWA 3WIHA 1MJ8L 3TBYB 1D5IH 2R2HA 4OCSH 3L3GB 3KWWA 2FB4H 2YPVH 4NUGL 1X7QB 3EJZC 4PV8A 5C0BA 3KYAA 4MJ5B 2VLMD 5ECJE 1NUNB 4Q9RH 2B4CC 2Q20A 3DVNA 5JPMA 2Z4QB 5K9JL 1BJ1J 2MCPH 2AJUL 2ED7A 3O0RL 1JNNH 2DQGH 2H26A 1QO3A 1U92A 4LLAA 3GRWH 4AMKL 2O61B 1ADQA 1PQZB 3PABA 2ZP0T 2HLFD 2B2XH 2EDTA 1NC4A 1U3HA 2L7JA 3EO9H 5A16B 4Z7OE 2XQYK 3CLEH 1RMFH 3GHEL 1N8ZB 1RK1A 2KBGA 5FCUH 3VXMB 2AS5M 1RZGB 2AXFA 3RWFB 3KG5A 4D9LH 5DJYB 4LQFH 5CSGA 1DCLA 3OGCB 5D7IB 4XWGL 5GGRA 3CDFA 1ACYL 2GSGA 3D3VE 3L5WB 4GRLB 1I9JH 2J8UF 4PLOB 4GUPB 3PHOA 5JXAH 3NIGE 4WW2C 4PJXB 4PRHE 3UJJL 1I9IH 4S2SA 3K8MA 2OX5A 5GS0L 1T66D 1SVCP 1IEAB 1NMBL 1CDIA 1D9KC 3BX7C 5B38A 2MNUA 2XWBB 1T5WA 2EDNA 4B53A 3D1MC 5F9OL 4G6ML 5GGSY 2N7AA 4M7ZB 2P8LB 3C5ZB 3P0YL 4ZOBA 1PSKH 3BEWA 1EEYB 1NFKA 4KI5D 4WCYH 5E8PA 4KVCL 5DZNA 2XI9A 4HJJL 1J1XH 2XY1A 3MV7B 4R97C 3GMQA 3LEXA 4EUPA 2WINB 3ES6A 1KB9J 1JGUH 3NBNA 2I07B 4ELKA 4X5WA 4JRXA 2WUCL 4PJ9B 3O81A 1H5BC 1HYRC 4JPVL 5J0BA 4Y5YC 3BKJH 4IIQA 4H8WH 4ZUWA 3QHFH 3UBXA 5AAMA 3MNZA 4TUKL 5E6ZA 2Z8VC 2AKRA 5IT2H 5J4MA 3HI6H 3QJFA 4Z5RB 2GITB 5I9QB 1XGUB 5F93C 4D0BA 3JVGA 1O0VA 2FSEB 1RZIB 1INEH 3GI9H 5MENB 1FG9C 5D96C 1TENA 2VZ3A 4WFHE 4Y4KC 3OZ9H 3C60A 1TZHA 4YHYC 4U6HB 3UO1H 1EEUA 1DBJH 2R4SH 5J6HA 5K9QI 1ZA3B 3GKZA 4QRTA 3KYNA 3OB8A 5F7LB 3KPRD 1T3FB 2DBLH 3J8F7 4JM2F 5F3BA 3MXVH 1NEZA 3RWHB 1MFAH 1DE4A 2VXUH 5FV1L 4PGEA 3DUSB 3B5GA 4U1LA 4WENB 4Y89A 5DUBB 2IFFL 3GJFH 3TCXA 2AJZA 5K9OB 1FQ9C 2HN7B 2X7LA 4QXWA 4Y16B 4YHKH 3VCLB 3LIZL 3WDHA 2MPAH 2A6JA 4JPKL 4YUEH 4QHKI 2OL3H 4X9GA 2QHRH 4HIXL 1CIDA 4Z18A 3LS4H 3QUKB 1CICC 3RL1A 5D2NA 3AS3A 43CAB 2QADD 1NSNH 3SKJH 4YDJA 5I1LA 3Q6GL 4EEEA 5HPOA 3C09B 2EH7L 3M17B 4ZTOH 4LEOA 5JXEA 2P44B 1T1WB 3HPJA 3VH8A 4IRSA 3CLFL 5FKAA 1IFHH 4IRJC 2VLKA 3QRFM 3QXDA 4XMPH 4KZEL 1AR1C 3MLUH 3W39A 3BAEH 1GOHA 5GIRA 2OK0L 3D85A 2XWJA 4O9HL 4DKFL 1Y0LA 2NY3C 2NTSP 1FZJB 4M7JH 4U1MA 3TYGH 4XCCL 5TDPB 1DBKH 3WFEH 3MV8E 2X1QA 3G04B 4QKXB 2RCSH 3RVTD 3VDAA 5DA0B 5EB9A 1GZPA 5DR5L 3CUPB 4PLJD 3I3BA 3MLSH 5DK0B 3OGOE 5TE7L 2GTZB 3Q3GA 2WWMC 3DO3A 4WEMB 3D0LA 3SDYH 4GAGH 4KI5E 5HHNA 3U0PB 3FFCD 4RFEA 5ADOH 3T1WA 1CYGA 4I0PC 2EH8L 1IKNA 4CU8A 3QUMA 5AUMA 1KF9B 4LSPL 5ICZA 4FMFA 5SV3A 2AXJA 1QD0A 3ZDXE 3ZE0E 5E2UH 1HXMB 3RDTB 4KK5C 5IMOA 1LP9F 4POZD 2J6EH 5F88A 3TPUA 2C1OB 5CINL 3NABL 5KJRL 4M6AA 4ZYKA 2BX5A 4H5SA 2B4CH 3WKMH 1U3YA 1D6VH 1ZHKB 3MRKA 3IDJA 3W81A 1T2XA 1NDGA 2ICES 1WWBX 4DAGL 3L95B 2VXVL 4Z76A 4L4TA 4F7CA 1YPZF 4NZJA 3V8CA 4GBXC 2XYCA 5IVOA 3UZEA 2OLDA 2DKUA 2R2BB 5DMKA 2EC9U 4HXBL 2F9BT 2PNDA 5DQJB 5EU4A 4LOUD 5KSBA 3F6LA 3I3EA 4FMKA 2E27L 3U6RB 2FX7L 3GI8L 4MXVE 4NM4L 3P9WB 1QQDA 1J86A 4LPWA 3KPRE 1UKQA 4RQQB 4P4KB 5BV7B 1TJIL 1FDLH 5JO5A 1A6ZB 2EIZA 1QEWB 1EJOH 1QLFB 4MDIA 4MAUH 1B0GB 3MRRA 4NQCA 3SHSA 1MLBA 2VISA 4JZNA 4ISVB 43C9B 2Q8AH 1LO3H 4ZO7A 1DUZA 3JZ7A 1TLKA 5EU3B 2BMKA 1K6QH 2AEQL 5CEZL 5CIPB 4KQ3H 3Q5OA 1ADQL 5D2LB 1KT2B 4WUUD 4HUXA 4H88L 3MLZL 3UYOD 3LKSB 4J3OC 4NOBA 4QOKE 2YEZB 2NX5B 2PKDA 2RR3A 3ARSA 5EBMA 4Q0XH 2QTEA 3DRQA 1FVCA 4JJ5B 4FZ8L 4NBYB 4WFGD 3RPIA 2CLRA 4OZIF 4NHCH 4QCIB 3UPCA 1Y6MR 4MAYA 5J9PA 2BNRA 1ZLSH 3I50L 2QKIA 1J7VR 3L5XL 5ISZA 5KVFH 1H3GA 3VW3H 4HHAA 3O2WH 4OAWB 1JPGB 5J57B 5FKPA 1R5VA 4NRYB 4HKJA 4QRSB 2DLHA 4PY7A 5C0JB 2QHLA 4PJHF 4LHUA 4UIMA 4YFLF 4J4PA 4X6CB 2VDLH 5LGKA 4MDJA 4AT6B 3EYFA 4OIIH 3UTTA 4JFZL 1HIMH 1QACA 4GKNA 1X5HA 5CD3A 5HYSA 4LEXH 3EDFA 4XMKL 5F9DC 1G9NL 4IDLA 3OKNA 3DMMC 2ZCHH 3OKLA 2WSKA 4OD2A 1XGPA 3SDDB 1RD6A 2FWOA 2FL5B 2ZSVA 2OP4H 4POYA 4HWBA 1WEJH 1CDUA 1UZ8B 1GCFA 3DX7A 1UB6B 1QRKA 3JWDL 5I19H 1CT8A 5IM7B 2JELL 4N8VB 3TT3L 5B3JE 2P5ED 4NRXA 4M3KB 4TOYH 1SYVB 3EFDL 3SKNA 3FFCE 5HHOD 3IFPB 1E28B 2Q76A 2UZIH 4NCDA 1DR9A 5BW7C 3BKYH 4TSCL 1YN6B 4R8WH 5DRWB 1GZQB 2YD3A 4PB0H 3WIFA 3RAJH 3QRGH 5GGTH 3QEUA 3MA7B 3A67H 4RMWA 2VSCA 4S11A 1DN2A 1ORSA 2NY7L 2DJSA 2OTUA 1Z9LA 4ZS6C 1BFVH 1D3CA 1WGOA 3T8XA 4U1JB 4BYHA 1HSBB 3VXPA 4RCAA 3BD4A 4P5TA 4Y4KD 5GISL 2OSLB 4KQ4L 4X80L 3MNVB 2NYYC 3DSFL 1IBGH 4M5ZH 4BQ6A 2IAND 2HVKA 4PJCE 2AQ3A 4NC0B 5ELIA 3VFOA 3BWUC 4O2CA 3L7FA 4QT5B 5F8QC 4KJYA 4UI2A 4E41D 1A6AA 2VAAB 3D6GA 1OM3H 3W9EA 5F9JB 4HMEA 4KJQD 3QIBB 4UDTA 3REWA 1YJDC 4OUUA 3T0AA 3VFNB 3C5ZA 4GT7A 3O9WC 4EN3C 3I02A 3U0TB 4F80A 1PBYA 3CFEA 3PL6B 1OSZA 3QBTB 1V8HA 1FCCA 4FTVA 1C7TA 4DGVL 4EIZC 4WUUE 3HG1A 7FABL 4OCRH 2XNAB 5B8CB 3MUZ1 1CICD 5CUSH 5TPWH 1I8KB 1CWVA 3QI9B 1B2WH 2PW1B 4U7SA 4KK9D 1TXKA 1UYWH 4X6EA 4WFGE 5IFAH 2A73B 4FS0A 5HHPB 5C0DB 4YR6B 3QIWA 4ELMA 1OP3K 1FORH 1WZ1H 5DC9B 1S7SA 1F6AA 3ROLA 3F7VB 5FAAA 3S4SG 2NY1C 2ZPKL 2J8UB 3ILPB 5C9JB 1CU4H 3T1FA 3FT3B 1H9VA 4UIKH 5IQ7H 1FL5A 1DVFC 2ID5A 1WV7T 4GSDH 2NY3D 3IDGA 4LLQA 4LLWA 3HZVB 5C08B 3U9PH 1KLGB 1KPRB 1U8KB 3FFDB 3P11H 4KDTA 4UAOC 1H3PH 4JY6B 4K3EL 4JQVC 1PG7W 1QFHA 5TE4L 4TNVK 2D03L 3GMNA 2JE8A 3BPCA 4G8FA 1GGBL 5FO8B 3QNYA 2WWMD 3QDMB 1MI5B 1F42A 5GGRY 2P5EE 2FECI 2P46B 3QPXL 3O8XA 4KKCC 5HHOE 2QQLH 1AO7B 3GIVB 3O41A 3O3BA 4G42B 2YMXH 1N59A 4HT1L 5ICYB 5E2VH 1XH3A 3CDGA 4KK5D 5DF0A 3EYUH 3MRMB 3AVEA 4Q6IA 4AEHL 1NGZB 2JJUA 3KYMB 1KOAA 1G7MB 1RUQL 1FJ1B 5F97E 1EV2E 3IF1B 4NZTH 2DQFA 3U2SB 4WU7B 2GUOB 1ZTXH 4FQQA 3QIUA 4HWEL 4NKIL 2D7QA 3QWOB 4JY4B 4OT1L 2CMRL 3VFPA 4JM2B 2VLJD 2VXSL 3GHBL 4Z7OF 1EH9A 2OTPA 4QTIL 1ZHNA 5DT1L 4AQOA 5EBGA 3F7YA 4MJIA 4FQXC 4NO0D 4YDVB 4XXDA 1WBYB 2AEIT 3LQAC 1P5UA 1IAKB 4KMTL 4Z95H 1RUMH 2D9QB 4H0HB 3KJ4B 2IANE 4LMQI 3UBXI 4XAKD 4H20L 3ET9F 1ZT4A 2Z8WC 4DUXA 2DIAA 3GM8A 5M7QA 1VGEL 4NKOA 3NIGF 4YC2B 4F7PB 5J1AB 5F7MC 2B7DT 4P23C 1KNOB 2Z31C 3G6JB 2DQCH 2Q1EA 4L9DA 3BPLB 25C8H 2CGRL 1K2DB 2F58H 4J3UA 4OFVA 3MJ9L 3V0WH 3IFNL 3ULUC 1TJHH 1PYWA 1G7LA 2P5WB 2YPLA 4LCIL 5E8EA 1I8MB 1UXWB 2C4FT 5DMIH 4LLYA 3CXHJ 1A14L 5FGCE 2W0KA 4I3RL 3O4LD 1WZMA 3HHRB 4WEBL 3B2UD 1MJ7H 1RJLB 3PWPA 2B8OT 3EGSA 3RKDD 4WO4B 3HAEB 5A3ID 3IXAA 3OX8B 1UM6H 1CR9H 3D9AH 4N68A 3ESVF 1FVDB 1L7IH 1DDHB 3QA3A 1WZLA 4JFDB 2FH8A 4UINH 2FJGB 1PAMA 5CP3H 3TVMA 2HJKA 4NQEB 1YY8A 3QQNA 3V79C 3AROA 1EVUA 4O58H 3MRQA 3SY0A 3D18A 3NOIA 3IT8D 4K23H 4N1CA 4H1LH 3PV6B 3FO9B 3MRHA 2EDDA 1NCAH 2EDFA 2BY0A 1G0DA 2YUZA 3X17A 5KSAC 3K80A 3QH3A 1FSKB 4RAUB 5IMMB 3OKOA 2HFTA 3QWRD 3DX8A 4WUKL 2PETA 3JV6B 2CUMA 5D1XC 1BF8A 2EO9A 3VWJD 2YD5A 4EBQL 1FV1B 4U0RB 1C12B 1FYTB 4GLRH 2A6IB 1YJDH 4R7NA 2ITCB 3CMOH 3F65A 4DW2H 5I17B 5D7JB 1CGYA 1JL8A 3HI1A 2IPTL 5BOPA 4U6YB 2APFA 2BVEA 1E4XI 1JHLH 1INQA 2V2WA 4QRPB 1A6WH 1FO0A 5ID1A 2NY4B 5DJDA 5EC2A 3BW9B 5KSUA 4EDWH 2J5LB 3WFBL 1XAUA 1YEHL 2DQUL 4G8IB 3IFLH 2AABH 4LCCC 2ADGA 4X8XA 4Z7WE 3MFGB 3O6LL 2WW8A 4OZHA 4FFYL 4RSVA 2HJFA 5EZOH 3VRIB 3QXVA 2W92A 3G9AB 1MCWM 4HSQA 3MGTA 1BF2A 2HKHL 1I1AA 2ZUSA 3MFFB 2FGWH 1BFOB 1JZ8A 2VLJE 1R3HB 4R4FH 4DZ8B 2OQJB 4ZFFB 4DVBB 1JTOA 2HTKC 2A38A 5IMKB 2NYYD 4P9ML 1MCBA 3V5DA 2DI8A 2C9AA 3S5LA 3ULVF 4XAKE 1JPSH 1XF4B 3BPNC 5F96H 5DD3L 5DQDH 4UB0H 5I76B 4D0DB 1KTKE 1L6ZA 5ADPL 2UWEB 4XPAH 1HH9A 2CLVA 1IC7L 5IG7B 5HHQB 1FC1A 1I8IB 2FD6H 3IU3A 3RNQA 4FFVC 1S7VA 4MLIA 3IS0X 4IOFD 3REVA 1UWGH 4KI5F 2RGSA 3VFUB 1DLFL 3HE6A 3QWQB 1DP0A 2VDQL 3P77A 4NKMA 2W60A 4Z7NE 3LKNA 3O4LE 4PJ5D 4UQ2A 4U49A 2IH1B 2A83B 5GJSL 1E4KC 4RMVA 5E00B 5EOTB 3BVNA 4LRNH 5ALBL 1F3DH 3ZDXF 2Y23A 5HGHA 1FZKB 4KRMB 1KPVB 1NGXB 3G5VB 4ZPTB 2YD6A 5I1CL 5IMLB 1W0WB 3JV5A 4X6DA 5DHVH 2OMBA 1YEIL 5FOBA 5IBLD 4FXKA 1OTSC 4HQQL 2CRIA 2VLLA 4JANA 5KS9E 2NY1D 3DV4A 5I74B 5J11B 3D2UA 1ORQA 1IQWL 3I75B 4PB9L 5F7FA 3WIIH 2K3TA 4GO6B 3QQ9C 3SE3A 1LDPH 1DVFD 3RP1A 3H9HB 3EHBC 1GOFA 1RU9L 1XCQB 5EZJA 5KANG 3VFRA 1F00I 1QRNB 2PYFB 3LQAH 2P8PA 4YXHL 3SDAA 9CGTA 1P4BH 3S3PA 3OKEB 3CFDA 1DLHA 4OGAC 2X4UA 4HH8A 4NRZB 4O2FA 4UTBH 3FOMB 5CJOL 3WEXB 4M61A 4WI9A 3SE9L 1U8JA 1AY1L 1MJ8H 35C8L 1MCHA 3GSWB 1MFCH 2WP3O 4GKSB 4GKOA 1OLLA 4P46C 3GBML 3S36L 1GPOH 1M7DB 1AHWA 4ODTL 4MB4A 4P2CG 3ULUH 4HUVA 3FL7A 1CS6A 3C6LC 3VWKC 5CGTA 1MNUH 3NFNB 5D71L 3DURA 2W0FA 4MNGB 5JQ6H 3FB5A 1YDPB 4OGYH 3O0RH 5C70A 1FN4A 3RI5F 3HC3L 4AMKH 1UA6H 3P3YA 2BNQD 4YIQA 1CL7I 3QZWB 4X83A 4LRIC 1U8HB 5L7XH 3MRJB 3MV9D 4M1DL 2XG5A 3ZLQC 4L9LC 2DM2A 1OB1B 2L4OA 4QRRB 1S7TA 2F54B 4HUWA 1KXQE 1LK3L 3U79A 5DEGB 4C83B 4RISH 5HVGB 3P9LB 1OD9A 1MHEB 4WI3A 3QULB 5E6IB 1NUGA 1GOGA 4TUOA 1KB9K 3QDGA 5TFSL 5F71A 1MAKA 4KAQH 1XZ0A 1HQRA 3TN0D 2FIRT 1K8DB 4IOIB 4OKVB 5F9OH 3ROOB 3UAJC 1G7IB 4G6MH 3B5TA 1M6OA 3QFJD 5IP4A 2Z31D 3MX0A 2VITB 4KKLC 1KULA 4KVCH 1U3HC 2C5DC 2GJ6D 2MMXA 4XPGH 2D31A 4WHYG 3ULUD 5IOPB 4NUJB 5IVXE 5EU6D 4LKCA 3UJIH 5DHYA 4YPJA 5B3JF 4NCC1 1F4HA 4N0FA 3K0WA 4HMCA 1N4XH 4ZS7H 5E4EC 1T7XA 3LKOA 4HCRH 4PJ5E 3ZHDA 2DQEL 5DJ0B 3MV01 1HKLL 2KZ1B 4MA7L 3MBEA 2R69H 5HYQA 4ODHL 2BCKB 3MLYH 4XBEH 2DD8L 4PJBA 1D5BB 4UU9A 3LN4A 2XQBL 4JG0H 1RJYA 3K2UL 1U8QB 1VGKB 5SWQB 3CXDL 3RVUD 4JRYB 5IEHA 4S1SH 2XIDA 1C5CL 1J10A 4JR9L 4EJ1C 2DQJL 4M43L 3O6FB 5TQ2L 3UTSD 4I2XA 4APQB 3S9DB 3RTQB 3QNXB 5IROA 2R1YA 3U4EA 3K46A 5IK3B 3HUJF 4IIQC 1MHHB 2KDGA 3GSNA 1A1MB 1U8MB 4QF1B 2E3VA 3NCJL 2HKFH 2DQIL 2F15A 2IFFH 2ICWA 4KRNA 4M5YH 3WNOA 5C0IA 2R0ZL 4MJ2A 1JWSB 5D7KD 4G9FD 2YUVA 3VFMA 3ZTJG 3JVGC 4DN3L 1RUKL 2C4XA 4LIQL 4XCEB 3C60C 3HC4H 3IVKA 2QLVB 3NZHH 3FJTA 1BIHA 1XFPA 3KPQA 4L3CB 4MLSA 5C09B 3BT2L 5I1HL 3T2PA 2IQAA 1XF2A 4PBWD 4U0QB 3BN3B 4Q74A 1REIA 1YEGH 4JDTH 3B4NA 2HFEA 1NCDH 4BH7A 4XMLH 5C07D 5JR1H 5MEOB 3EOAB 2R56L 3U4AA 1FL6B 3OPZH 1EPFA 3CLFH 3STLA 2Y36H 3MV9E 3BH8B 2EIDA 3OR6A 1A3LH 2ZNXA 3GMMB 1E6OL 2C3VB 2BVOB 3PDGA 3U0WL 4F2MB 4RAVB 4P9HL 4OZFG 5GRJL 2Q7YB 4KZEH 2BOBB 2X4SA 4O2EB 5DQ9B 1FFQA 3B9VA 3SCMB 3QEHB 1NGYB 1IGYB 5INDB 5DTFB 4MHHG 4N9GB 2YD7A 3EFFA 1ED3A 2Y7QB 1R3JB 3ARFA 3K2MC 2HMIC 5D5MF 5D2NC 1MCNA 1Y18B 4FQLH 3MCG1 5EOQL 1J0ZA 3L3HB 4Y1AA 1NBVL 3C5SB 3FB8B 4UT7L 5D70L 3ALXA 1BIIB 4K94L 1OGTB 3C9NB 3NACL 1MH5A 5JXEC 4HS8H 2H9GA 4R26H 1D5MB 4KUCF 3JV0A 1CDGA 2RIKA 3QFJE 4IRSC 1YEFL 2BVYA 4PJIB 1F3DJ 4GW5B 4EI6A 2YRLA 4Y19B 1BX2A 3DV6B 1LE5B 1W8OA 1LP9A 2GJ6E 1NC2D 3QHZL 5CZVH 3B43A 3ULUE 4LSPH 5EU6E 1IAOB 1PEZA 4YHOL 1T5XA 5HHVH 4GAJL 1Q9LB 4PRPA 1RUAH 4UDUB 4MNQB 3TIDB 2CDEB 2JCCB 1CVSC 2R29L 2DMCA 1YPZA 2FYYA 4GG6A 5JOPD 4DJMA 2BP3A 1HHKA 3FAXA 4OUOA 2FRGP 4ZAKD 2YWYA 1A9BA 1KELL 2ZOLB 3IJYA 3K4AA 3ZYOA 1AGBB 2MHAB 3QDJD 3QJHA 4HXBH 1KXTB 3VGGA 5D93C 1FAIH 1P7QB 4UUJB 3IDMA 4D94A 2ZUYA 3SGKA 1KIRA 1IKNC 3WIHH 2FX7H 3L3OA 1ND0B 4Y5VA 1B4RA 4ONGL 3UTSE 4K7FA 4YGVA 2O26U 3F12B 1ZSDA 5C0AB 4EI5D 3EHBD 5KVMC 4PP2B 4K3DH 1V3MA 4XPHH 3NA9L 5BMFH 5SWZB 4U1IB 3HFMH 3QDHA 3WHXB 4AEFA 1DBAL 2AEQH 3DUUB 5D7KE 4G9FE 4R2GB 4UOW0 1T2QH 4XNYL 3MLZH 2VLRD 3G5ZA 4OZIA 2VL5A 4FG6C 4GH7B 1MAMH 4P46D 4ODSL 4XVUD 3GNML 3CSYB 5IFHH 3B6SA 3VWKD 1KIPB 3ZDYE 2ARJB 2ADIA 1IGTA 5D1ZA 4G8GA 4B41A 1A6TB 5DUPL 4NN6C 5SWSB 4I18A 1N6QL 4R0LB 4ODVH 4D8PB 5GS1B 1J9CT 4N0CD 5JHDB 4XCFL 1KCSH 5C07E 4JKPH 1LD9A 4PJHA 2J4WL 5JW4Q 1H15A 3ARBD 3I85A 4P2QD 2JB6B 4MB5A 3UPRA 5FECA 4XWOD 4M1GH 2G75A 4ZUVB 4J2XA 4NSKA 5T1DH 4OGXH 2IPUK 1AQDB 5EZIL 3CU7A 4G5ZL 4MA1C 5E08H 4JFFA 3NFSH 3NGBC 4S0TD 4EDXA 4EUPH 1QSEB 1HHHB 1BOGA 4JVPA 5FM5M 4ZSOA 1CIUA 5HVHB 4CN1A 1PG7L 4U6VH 2LU7A 2NQCA 3MO1B 4MAYC 4XNMA 3RWGA 3MRDA 1J0IA 2D7NA 4I48A 5FDWA 2FATL 5FFLA 1BQLL 1XR8A 4KKLD 4LCYA 4JLRB 4NZRL 3TT3H 3W2DL 1NC4D 1SYSB 1I7TB 1YY9D 3WE6A 2GAZA 4M9OA 1J87A 4ONHA 3V6BR 5L2JB 2DWEA 1D6EA 2E9WA 4CMMA 5F7YC 3IJSB 4J4PC 5L2KE 5JMRA 3LV3A 3V52L 2AVGA 3L1OL 2AJSH 4PRNA 2XPGB 3TZVD 3O6ML 2P43B 1AXTL 3IDNB 4MXQC 4M02A 2VDNH 5JOPE 3MR9B 4XCYA 4LPCA 4N5EC 2C26A 4G6AC 2W65A 5CJBA 3HS0B 1AXSB 2UVFA 2BVQA 4NQSB 3QSKB 4P2RB 1LE9A 1I7UA 5DJ8B 2GKIA 3GSNL 1OF2A 5CZKA 4U1NA 3QDJE 1UJ3B 1S78C 3P0GB 1DQJB 1SVZA 5GISH 4KQ4H 4X6FB 1VFOA 4HIJB 1BLNB 5C0GB 1NGWB 3LN5B 3F6IA 4TULH 2AK4A 5F89A 5EUOB 5ITBH 5IVNA 4CMHC 1QVOB 5DJCA 1U42A 2I9LB 2BSRB 3CVHL 2MFNA 4E5XB 2VWEE 3DECA 3X13B 5H35B 2NNAA 4QHNA 5DRXB 4HBQA 4OKVA 1KTLA 3QQ3B 3DVGB 4RFOH 1WFTA 4I9WE 1JYXA 1HSAB 3UC0L 1RZJC 5FA3A 1JN6B 1TJGH 1I75A 5CZXC 2QQKL 3MJGX 4RGND 1UH4A 2KQNA 4YHZH 1RFDL 1S9WA 1KCVL 3LD8B 4DVRL 4KZDL 4JHWH 3EOTH 4JGMA 4DGVH 2A6DB 3FRUB 1C16A 4MCZA 2VLRE 4P5TC 3DXAB 1YEDB 2KH2B 4KK8C 3WSQL 4JB9L 1N5AB 4NQVA 5EA0L 1MCEA 1AGDB 2P7TA 4HD9A 4Q2ZA 4M7KH 2AXHA 5JUEH 4E42B 2AXGA 1BVLB 1N64L 2HJLB 2VXTH 3CK0H 3PWVB 4I13B 5EC1B 3WCYA 5FYKD 2PYED 4GKZA 4OZGA 3BZFA 3CFKB 4M7ZC 4Y4FA 1X44A 3C5ZC 1HXYB 1HHJA 3PGCA 1E4XH 3K81A 4P2QE 5KVEH 1CLCA 1Q94B 3VXRB 3LKQB 5GS3A 1YQ2A 1BZ7A 5KS9F 2WBJB 1IAII 4UV7L 5D72L 1MQ8A 4ALAL 4RGMB 2DTSA 3QUYB 2OR9L 1A6UL 3FT2B 4K3EH 3QUMH 3T3PF 4ZFGL 1DTUA 2W1NA 5BRZA 2DOCA 1CLZH 2QSQA 1YQVL 2VRAA 3Q48A 3PNWB 4J1UB 4QXGH 3VFWB 1TVHB 2ESVA 1YEKH 2D03H 1FC2D 1XT5A 3RUGE 3QYCA 1G6RB 3QIWC 1MRFH 2BOCA 1P69B 5EULV 4JAMA 5I1AB 4D3CL 3RWCA 1P7KA 2FO1A 2CLZA 4B7LA 1ZLUK 1NFDE 4XCEA 1BOYA 4FNLL 2HT3D 4YDKH 1PKQB 2O5YL 3QPXH 3IFOA 3VMNA 1C7SA 3S4SB 1Q72H 3BIAX 1CGSL 3GGWA 5KSVA 2PXYA 4HC1L 5T1LA 4QO1A 4Q9CA 1WK0A 1VACB 2PO6A 3D39D 5C7XH 2YD9A 2H32A 4KDTC 1VESA 3EKCA 2LE9A 1HHGA 5DC0A 1K3ZA 1S9VA 4PGZA 1OCWH 3ULSB 1S8DB 4YNYB 4PJ8A 1OTTC 3EYOB 3ARUA 4RA0C 5BO1L 1VADB 4DKAA 1JRHH 5GGVL 1A4KA 4NKIH 2BHZA 3MODL 5GHWL 1EBPA 5JDSA 1LO2L 4OT1H 5E94B 2CMRH 5ESQB 4Y16C 2Z8RA 3WO3B 5C0CB 4OD3L 4Z8FH 4F9LA 3D3VA 3QCUH 4U2YA 5LCVH 1KFAH 2OR7A 3CPLA 2Q8BH 3U7YL 3HUJB 1EFXB 5D8JL 5E1HB 5FK9B 1ZLWK 4XGZA 3VFVA 4YLQT 1F02I 3LH2L 3VXSB 4ZDHB 2FCBA 3E6HA 3O8XC 5K93A 4H20H 5TQ0L 3S6CA 1UM5H 3LQMA 1VGEH 3CH1A 3D25B 4JG1L 2V2TA 1KV3A 2CDFA 2EKSA 3UMTA 1XF5A 3IRZA 5FV2A 1LO5A 3NH7L 4Y7MA 3SDCB 1WBXB 1J0KA 1GAFH 4S1RL 4LP5A 1IQDB 2CGRH 3L5JA 3GSVB 4PJ7E 2WLYA 5EUKA 4LMQE 1HYSC 4BFBD 2Z91A 4RGNE 3QIUC 3RGVA 1LO4H 1N3NB 1A14H 5K33A 1M71B 4PGBB 2E6PA 1RJZA 3JTSA 3B9KB 2NXYB 2IADB 2V5YA 3E3QC 5GSVB 1L9MA 4JO2L 1PKOA 5AYUL 1QR1A 1I3VA 5IB3B 3PGFL 4M6NH 2E5EA 3T0DA 1P5VA 2VUOA 1UQSB 4PY8I 2W38A 4QXTA 3FQUB 5C0FB 1YUHB 5FYKE 3N9GH 1MEXL 2PYEE 2G5RA 1T1ZB 3EYSH 4NQCD 4ZFOA 4LL9A 5C0ND 5E8OA 4MXWL 4PREA 1IM3B 4HWBH 3BH9B 5GRYA 1J1OH 1CL7H 4NO3A 4LKXB 4RBPH 1J8HB 1AD9A 1RULH 4JPWL 4YO0A 4U1KB 2CIKA 5C8JB 3C2AH 3X11A 4MD5A 3HTLX 3NIDE 2W07A 4G43B 3WNNA 5CJXA 3OAYH 2C3WA 5C3LD 5D2NE 4XX1G 1Q1JL 4EBQH 3S37L 5JORB 1IM9D 1RZFL 2F74B 4HAFA 5BS0B 5HYFA 3U82B 2IMNA 1GGIH 1RZJH 4JPIA 4K3HA 3QT2A 4MD0A 4N8CL 5FYJD 3TVMC 1GGUA 2IPTH 3TESA 2GJJA 3H0TB 3HRZA 4MJ4A 3O3UN 2O5ZH 1X5ZA 4HS6B 4H26A 2R0LH 1FBIL 3OMZA 4LCWB 1A4JA 3CZFB 4LHUD 3WXVH 1JV5A 1F4AA 2C3XA 1UWEL 2EDEA 3LPGA 3D39E 3UTTD 4TVPH 3WFBH 1LNUA 2DQUH 1ZT7A 4PJEF 4LFHG 3O6LH 4FFYH 5IQ9B 5I75B 1I1YB 4XVSH 2CIIA 2HKHH 2EDBA 2A1WH 1EHAA 1LDSA 3T77B 4LPVA 4MMZC 1S78D 2VDOL 2W9DH 1DEEB 3MV8A 1TETL 4EVNA 2DJ4A 2ZG3A 1R5WA 1J5OH 3H3BC 5DVLA 1KBGL 2R9HC 4JZJA 4QWWC 2UUDH 2B1HL 2LVCA 3W5MA 3Q1SL 4B0MM 5GSRB 4NN5B 2WWKT 3O3AA 3RHWK 1TTGA 5ADPH 1G7PA 3T65A 3C8KA 4NZUL 3CFJB 4X99B 3R06A 4WHDA 3VRJB 5CZXD 1WBZA 1TZGL 1A7NL 1QFWL 4TYUA 3B3IA 5I6XB 1E27B 1I1AC 5INCA 2VDQH 3KPMB 3VXMD 5TE6H 4ZOAA 2VSDA 3M1BA 2WIIA 4P5TD 1NFIA 4MS8D 5GJSH 3RL2A 4QHUB 2XFXB 5GGVY 1RQ5A 4TVPD 3ARRA 1P9MA 4C57C 5ALBH 4OLWL 3RWEA 4FP8L 1KJ3L 1U91A 4PJFB 4P9HC 5LXGH 1RIUL 1T20B 3BKMH 4HGWB 4WHTB 3BESR 5H2BA 5H94B 3DYMA 1Q0YH 5GZOD 5TDOA 3C5ZD 2BFVL 1F58H 4HIIA 4YZFE 2A6KA 4JREC 4XPFL 4M03A 2ZCLL 4Z7QF 3S3SA 2PN5A 1V05A 1IQWH 4W81A 4LGPB 4PB9H 4HXAH 4QRUB 3KPRA 4DGYL 4FTVD 5T3XH 3HE6C 1PY4A 1QA9A 3N85L 5HI3D 1G0XA 4PGDA 4RZCB 3PF2A 3HLAA 4PJ9D 2D3VA 2HH0L 2I9LA 4HPOH 2GK2A 1X5FA 2X9WA 5ID0A 3WFCL 3D0VA 4L8DA 1JNLH 4OCWL 3FN3A 2J88L 4MQSB 3IAGC 3BI9X 2VB5A 3G5XA 4I4WA 4OLYL 3SE9H 2ICCA 1AY1H 35C8H 5D7LB 4AEIL 5FO9A 1NAMA 3BUYA 1KSRA 1U2CA 1NMAL 4JN2B 4J6RH 4OFYA 1A1NA 5CAYB 4XI5D 3NCYS 4QOKA 5ACZB 3HC0A 3CVHB 2B1AL 5KG9A 2APBA 1WLHA 1DQDL 3W11C 5MEND 4L5FH 5FO7A 3VDCA 5FHAL 5FYJE 4R7DA 3SKOB 5D71H 4XB7A 1CDYA 4MSWA 2C7UB 2SEBB 1CCZA 1K4DA 2CK2A 3HC3H 2HLAA 3KHQA 1N0XH 2NY5C 1N7ML 4WWKB 1NCBL 5DRZA 3PWJA 3VXTB 3ZDYF 5I8KH 3CCHB 4K9EL 1RZ8A 3SDAC 3UTTE 1A2YB 4CN6A 4JDVB 1Q9OB 1SEBA 1VENA 2WV3A 4PG9B 1ZEAH 3WUWB 3OF6D 4ODXA 1ONQB 5IWLA 1W72L 2FX9L 2MTPA 4KXZI 2H3NA 1CFTA 1RIHH 1Q94A 3PL6C 3S35H 4Y16D 5T3XD 2GQHA 4WHCA 1YMHA 4ZNCD 5BVPL 1AHWC 3DUHA 1SBSH 3IDXH 1ETZA 5TFSH 5H8DA 1SBBA 3C8DA 1JGEA 4OCYH 4BZ1H 2JLLA 5FDYA 2FEEL 2FR4A 2HFFB 4O51B 5FM4A 1IGJB 4YPGA 5TH2A 1MCKA 2ZUQB 4PFEA 5EWIL 4LLMA 3MMEA 4PR5A 5F3HB 3FFCA 4R4BB 3VA6A 1FE8H 1HOCB 4CVZA 1QKZL 4K8RD 1R24A 5C0RL 4S1DD 3NCMA 3U46A 5I71C 1FL3B 3VXME 1KJ2B 2F8VA 3RNKB 3BP5A 4OD1H 1K8IA 3MRPA 5D7IE 1HKLH 1U8LB 1S9XA 3R0NA 4MA7H 1QUNA 4G3YH 5F1OB 3TH3T 4TVPE 4X4YB 5CWSB 3MREA 4NHUB 3T0EB 2NZ9C 4PJXE 4YNYA 3RQ3A 2XQBH 3AREB 4KY1L 1T04A 1B0RA 3CFIC 3TLRA 4U1HB 4YDLB 1WIUA 1U93A 1MREH 4ERSL 1W2KT 3GSOA 4TUJB 2NY6B 2FZ3A 1TQBC 1KIQA 4NWUH 3HUJA 3BGMA 3VGAC 4AG4L 1KCUL 1HDMA 2DQJH 2V5RA 3RA7H 3ZKXC 1C1EL 4JY5L 4M6ML 5E5UB 5CEYA 2YA1A 4L4VB 2D7TL 2ZOKA 4X5XA 2Y5EA 3X12A 3L3IA 4L29A 4OZ4B 2YBRB 3FQWB 1QBML 2ICEA 2BK8A 3PWPD 3NCJH 2UYLA 3MBEC 2H8PA 3O2VL 3RDTD 4EKXA 3QG7H 1B9ZA 2E7HA 1FH5H 4XBPA 2IALA 3IKCB 1N5YL 3NZ8B 3TT1L 2C3GA 4HKXB 1FO0H 1DQQA 1Z9MA 1CZ8L 4WUUA 1HHIA 5KTEL 4LLDA 1XF3B 3PJSB 1M71A 3VD4A 3P0VL 3KPLA 1MCDA 3IETA 3BIKB 1CE1L 2JIXB 5MENE 3QEQA 4WNQA 1RY7B 2DLTA 5I1HH 2XRAL 3SQOH 2XN9B 3EYVA 2XTJC 3KJ4C 1I85A 4PJDF 4HK0A 3MROB 1ZMYA 3HNVH 2ATKB 4P4KD 5DXWA 1WVZA 2ZG1A 2Y25A 1FGVL 4YHPA 1JK8B 1QNZH 1KC5H 2IBZX 4RRPG 4ORGA 3IAPA 3FQTA 1OAYL 1MFBH 4P9HH 3D69A 4JQIL 2AGJH 5D5MA 4MZ3A 3L6FA 4ZODA 4WEUD 1D5IL 4OCSL 5F6IC 3SDXB 3U9UA 1KTDB 4YJZL 4HGMA 4BZYA 1IGCL 2MKWA 2YPVL 5IJVB 2AV1B 1KG0B 2EO1A 5EO1B 5GS2H 3P4OA 1CFSA 5F70A 2NX5D 3ZL4L 5TDNA 2UVEA 4HWZB 2NR6C 4ZO9A 3FCTA 3G6AA 1YECL 5ICXA 3MRBB 1I7ZB 1JNNL 2DQGL 4C4KT 4P4RA 3L3KB 4N0UB 1BFTA 5IB4B 2F74A 2IH3A 1R5IB 3ECBB 4GAYB 1JPTH 4JFQA 2P5EA 1CN4A 3K1DA 3RUGF 3EO9L 3O11A 1DUYB 1RMFL 1A1OA 4HUUA 5HHOA 3G08A 3CC5A 1L4IA 1NCCL 4KKAD 5FCUL 1LK2A 1WQVT 3MCKA 4D9LL 3KYOB 1J0HA 4LQFL 2BVPB 4YHOH 1NFDF 4FQ1H 4HFWB 4OZFB 5MP6H 1YC8A 3FO1B 3S96B 3MNWB 2BSTB 5HGBB 3ARFC 3DWTA 1I9JL 4U1GC 3GSRB 1EGJH 1JWUB 3NPZB 1I9IL 5L0QC 2LTQB 5FGSA 3HI5H 2YWZA 2NY5H 3LKPA 5F7NC 4U6XA 1LEGA 3MLTA 2VNCA 3SDDD 1PSKL 5CKAA 5CILL 4HJ0D 1J1XL 3I6GB 4MVBC 3ZSSA 2IANA 1T0NB 4KMQA 1NAML 1JGUL 3GMRA 5ACMA 4KFZC 3FOLA 1GIGH 1UG9A 4MNHB 5LGHL 1CFQA 4LLVA 1NCUA 3GDBA 3KLAA 1OGAB 5CCKH 4AK1A 3BKJL 4HEME 4H8WL 4KKBC 3PWPE 1T0MB 4X6BB 4NP4H 3QHFL 1DBAH 4UV4H 3WNPA 1IAIH 5IV2B 2EDOA 4UOW1 4TSBH 4AIZB 5IT2L 3W5NA 3HI6L 3NCEB 5GXBB 2CDGB 1Z6JT 3EO0B 1U8NA 1WC7A 1Q9WB 4PJ7F 4XNYH 3GI9L 4HKZB 5C86A 2I25N 2Z35A 1KN2H 2L0DA 5EBLA 2EIBA 1HINH 4QY8B 3BWAB 3OZ9L 1L0QA 3OKKA 3W11D 3N0PB 4FN0A 3SGKC 3RVWD 3CMGA 4CW1A 5CBAA 1HH6A 1DBJL 3D2UD 4Y5VC 4PJEB 5I66B 2BDNH 3ZE2E 5DUPH 3SBWC 5FF6A 1AH1A 2P42B 2DBLL 3ARTA 4FZEH 2GK0B 5B4MC 3HZYB 1MFAL 4BELD 2R2EB 2VXUL 2CSPA 4JDZA 5DO2D 2I24N 4Y8DC 3QIBD 4DUVA 3S88H 3T0XA 4NN7C 4OCLC 3V0VA 2G9HA 1FNEB 3DRTB 4MD4B 2OZ4A 3GB7B 4YHKL 5ETUB 4G5ZH 5JW4R 5DEFB 5DI8B 1S5IH 4YUEL 3PL6D 2OL3L 1VFUA 4URTB 5AYQA 5D6CB 5E8NA 5D2LE 3U83A 1MFDH 1DQLH 3LS4L 3VXQB 4Z0BH 1JNJA 5D1ZC 4WI8A 2Q7NA 1PG7H 1NSNL 2NX5E 4HDIA 3SKJL 5IB5A 4I18C 1AGEB 1H8NA 3QI9D 5CJQH 1X9QA 2DLIA 3MBXH 1U8IB 1X4YA 4OV5A 2G60H 5HD8C 4CRPA 4PTTA 2IC2A 1NLBL 1IFHL 4BH8A 1SJXA 1V5JA 5FYKU 4XMPL 3MLUL 2D7OA 1CFBA 3BAEL 1VFAB 1MCOH 5EZLA 1F2XK 4X98A 5DJ2A 1NJ9B 2YPKA 4M7JL 3VXOB 1BAFH 2IWGA 4XP4H 2HWZL 1YNLH 1BQHA 4R96A 1DBKL 3WFEL 4A6YB 3U30B 3QDGD 2YA0A 4V1DB 2RCSL 2MKLC 2NZ9D 3FQRA 3MLSL 4S1QH 5I73B 1PY9A 2OI9C 3MV11 3BP7A 5EDXA 1U8OA 4GRMB 4JZOB 3SPVB 4JFOB 4U1SB 4U6TA 3SDYL 4GAGL 1OP3H 1AKJB 1Q0XH 4HZLB 4NO0A 4G9DA 5ADOL 2V2XB 4PRHB 3MLVH 4LSRH 1RSFA 2HT4D 1MI5D 3QDMD 3UPAA 5IW3A 3OSKA 2QSCH 4X4ZA 4ETQB 3WN5B 4O5LL 4Z77A 1MUJB 5E2TH 5BQ7B 2E6JA 1OAKH 2VDPL 3WMSA 3OR7A 2ZUUA 2DYPB 5E2UL 2Y1VA 1W72B 3FRPG 1E4WH 5HYJA 3ABZA 4UILH 3MBED 1F13A 2QQKH 3P4MB 1XR9B 3WKML 1D6VL 3STZB 3WD5H 1KCVH 5MERA 4KZDH 5LVEA 4OI8A 4NFDA 3LDBC 4I5BA 4JFEB 3RWJB 1JNHB 4JM2D 3RJQB 1CD8A 4PRIB 4UTAH 2Y06L 3MPCA 4KK6C 2Y6SD 1CDCA 1IL1B 1A9EB 4HLZH 1FDLL 4ZUUB 4QYOA 5BVJA 1EJOL 1G9EA 4MAUL 4YXLL 4IMKA 4ENEC 5KS9A 5D1QB 2VR4A 2Q8AL 3D87B 2J2ZA 1XEDA 2WAHA 5F1KC 1LO3L 1MJUH 2CXKA 3H42L 2IQ9L 5K9KB 4B50A 5DWUL 1K6QL 4YBLC 4PRBB 1JHTA 4YZFF 1SJEB 4LNRB 2P5WD 2CJUL 2E9IA 5DMGC 3BHBB 3OG4B 5D72H 5DJZB 4XH2A 4Q97A 4GRWB 3GSUB 4LARH 1FVEB 5AG9A 2ATPA 4ZFGH 4JFXA 3MOAH 3QWRA 5DD6A 4G8EA 4WW1B 3V5HB 4Q0XL 4ZUTA 3QCVH 1OP5K 5EBWB 3TO4B 4QHLA 3VWJA 1FFNA 4LVNB 2VDRL 4WJ5B 3IKCA 4NHCL 4Y2DB 4WO4D 5KW9H 1V7MH 1ZGLA 2J7LA 2JB5H 3UXFA 3VD3A 2Y5TA 4Y4FC 5KVFL 4WDIB 3VW3L 4D3CH 1T4KB 2ZZUT 3UTZA 3O2WL 4TTDC 5C2UB 4F15B 3JBG7 1OP9A 4JFDD 4BK4A 1AD0B 3BGFC 1JJUA 4L8CB 4G6KH 2J8UE 4AM0A 4Z78B 4NQED 5IHZB 4FQIH 5EFIB 4U7KA 3EJJX 1ACZA 2VDLL 4FXGB 1HI6B 3A6BL 3DGGB 5I1EH 1GSMA 1HIML 4RIRA 1HEZB 3AC0A 2VABB 4OKDA 3U1SH 1VKXA 5T1KB 3Q5TA 4S10A 5CS7A 5DZLA 4LEXL 1WFOA 2YHGA 2ADFH 4Y1AD 3QDGE 5CP3A 1MRDL 1N2RA 2ZCHL 5DS8B 2JJSA 2OP4L 1WEJL 3KAAA 5J7CC 2YS4A 1UKTA 3MUY1 1H8OA 1UB5A 4NOFA 5I19L 4ZPVA 1RV6X 3IJHA 1JF1A 5D8JH 1CFNB 3SKMB 4WU5B 3IGAB 4TOYL 3LH2H 5JPNB 3BSZH 3GMLB 4IMLA 5EO1A 5D7JD 4L4JA 5ESAA 3QDME 1MI5E 1FRGH 1JGLH 2ARWA 3TBVB 4LLUA 2UZIL 2YK1H 2APVA 2PO6C 4R8WL 5FYJU 4Y88A 3AXLB 4PB0L 1AO7E 1NGPL 4QRPD 3OAUH 3RWDB 5C9KA 3FONB 4X9HA 2BY2A 4QHMA 4IDJL 1CE6B 3A67L 3BIBX 1JFQH 3JWOC 1HNGA 5IVXA 1WJ3A 2R1XB 3QUZB 2YXFA 4DK3A 1XGQA 4X7TB 3UTQA 1DUYA 3AMKA 3ARDB 1BFVL 4PJDB 4F9LC 3IDIB 5EIIA 3CX2A 4NWTL 4NKDB 4N1HB 4Z7VB 2V7HA 3SEPA 3RZCB 1NBZB 4L8SB 3H7LA 2OMNA 3IDYB 3MNWA 4K9EC 4YHMH 5AYUH 2OZ4L 3PGFH 3PDOB 1C5DB 3E2HC 3LMJH 2NW3B 1J1PH 1OM3L 4QLRA 5D7IF 1I3RB 1B4JL 3AAZB 1F90H 3VGDA 4NO2A 4K71B 4PJXF 3TBSB 3BZ4A 4AIXA 1S7WA 1JGDA 5F9WB 4MXWH 3G6JE 2VDMH 5A2FA 4TRPL 3PWUA 3OXSB 4WV1B 5E9DB 4MCYA 5EO9B 1DVFA 2YKLH 1RHHB 2P5WE 3B9AA 1MHPL 1ZS8B 1BWWA 4CAGA 5IEKB 4KXZH 1YEJH 5CUSL 3DROA 2IBBA 4LBEB 1S7XB 1B2WL 3QNZA 1BZQK 4NO5B 4HUKB 1UYWL 4KI1A 4JHAL 2IBGA 5CGYC 2AJXH 5IHBA 1L0XA 5IFAL 3DVIA 2BY1A 2D0HA 1FORL 1WZ1L 1P4LA 3TH2T 5FA4A 5EOCH 1FIGH 1ZA6B 3PWNB 3RX7A 5DFVD 1Z5LA 2ERJC 1A7PH 1NDMB 1EDQA 4FXLA 4JFDE 5IB2B 1FBIH 2YXMA 4XBGB 4P57B 4UIKL 2QADB 1HCVA 4NQEE 1R3KA 1GC1H 4PY8J 1UVQB 5HGDA 3P11L 3MV9A 1S9YA 3U36A 1H3PL 1INDH 3RX5A 5CMAB 1QRND 5CJ5A 3KPNA 3BYYA 2RFXA 1F8TL 3KNBA 3QUXB 4Y1AE 1JUFB 4LF3B 4F7EB 3GMOB 3OKDB 2GY5A 5ANMB 2X4OA 2FEDD 3H9SB 1KN4L 2FIKB 4HIHA 4HV8B 3BFOA 2QJDA 3CDYA 4LDOB 2EYSA 1EMTH 3PQYB 4KTEL 1N0LA 5DC4B 2V9RA 1KBGH 5HJ3B 1BBDH 2NY0B 4KV5E 3WNMA 2QQLL 3TN0A 3LSOB 3DETD 3RU8H 3GJFB 3TNMB 2YMXL 1VB9A 3QFJA 3TJEH 2Z31A 2HLFC 4NZUH 4CJ0A 4QRPE 3R1GH 3EYUL 1YPZE 3H7BB 2OL3B 2ZUVA 2XKSA 1BQUA 1BZ9A 3OHXB 1A7NH 4IS6B 5EU6A 4H25B 3TBWB 3SJVB 3TA3B 1C08A 4HIEA 1QSZA 4K07A 3ULVC 1TIUA 1BJ1H 2QR0A 3PV7A 5AD0A 2DLFH 2VC2L 5HPMA 4LVHC 4F3FB 4JZJC 1RUML 3M07A 4Z95L 1JPFA 1T7YA 4YEFA 3O45B 4X0KA 1UENA 3PGDA 1RIUH 5IKCB 4P59H 3W0WA 3VFSA 4JO4L 2GT9A 4KI5C 1X6LA 2E7BA 1MLCA 4ETYA 4NNXB 4ENED 25C8L 2F58L 5KN5B 3KS0J 2XICA 2ZCLH 3V0WL 4JFOA 2UWEE 2VO5A 4NZDA 4QNPF 4PJCB 1TJHL 1TNMA 4F33B 4M7LH 1T1XB 3UTSA 5DMIL 1MJJA 2M8XA 2GJZB 4C56B 3WFHB 2NXZB 2VERN 2HH0H 5DJ6B 5FM8A 3QFDA 4OI9A 3O3DA 4V2CB 4XCNA 3WFCH 1S5HB 1X6NA 3X3FH 1I4FA 2J88H 1P9MC 4F8QA 3VI3E 4LSQH 1GHFH 2QEJA 4OLYH 3ARGB 4G9FA 4AEIH 1UM6L 1NANI 1CR9L 4UNTA 2H32H 5MI0C 3D9AL 3P9MA 1S7RB 2BSSA 4XRCA 4HUMB 3FB7B 1OWRM 4X7EC 1L7IL 3DBXA 3QQ4B 2B1AH 1IGMH 1S7QB 4PJHE 4JRYD 2B0SH 3JWOH 4HCRA 3L3DB 1MIMH 5E24E 4WFFD 1JP5A 3FTGA 3VFGL 4PLNC 5FB8B 2ZUWA 1IC1A 2FHCA 4K23L 5C07A 3U4BH 4APQD 3RTQD 4ZFZB 2OTWB 1NCAL 1X5IA 4K9EH 4X8JA 3ZE2F 4HH9A 3VFTB 3P73A 4NNYA 5BRZD 3RWIB 3P4NA 5D1QA 1QZ1A 5A2LH 4IHOB 4OQTA 4XPTL 1QRNE 2X70A 5ENWB 1Z0MA 2FX9H 2ESVD 3AU1A 5AZ2H 3QG6A 2DICA 3B9EA 4YX2H 3WFDL 1YJDL 3EDJA 32C2B 3TEUA 5I15H 3KDMA 5BVPH 4UBDC 4L1DA 3WYRA 4DW2L 5JNYB 1BEYH 4R4ND 2H45A 4XHJC 2EZ0C 1OAQH 3B5HA 5B38G 3QEGL 4XP6H 2DWDB 1BD2B 2F53B 4WW2B 3O3EB 5FGBC 5D2LF 5C09D 1JHLL 3VXUA 1PLGH 1FAKT 1A6WL 1D9KB 5BZWB 1BECA 2CKBA 4MNGE 1TCRA 4Y2DA 4K2UH 4EUPG 2W9LA 1NKRA 4EDWL 2B20A 2V7NB 3MJ7A 2A77H 3IFLL 2AABL 4RBPK 4R97B 3KLHC 2F8OA 5IWLC 1NC2A 2VE6B 2BC4B 2AJ3A 5JOEA 5L2KA 5F7EL 5C0RH 5HVFB 2MOVA 4QRRE 4NIKB 2F54E 3MLPA 3BQUB 3OAYK 1F3JB 1H5BB 2WBJC 1KLFA 4HKBB 4NQDB 4P5KA 4R4FL 2QQQA 3SCMD 3UBXG 2X4TB 4Y5YB 1CLOH 2YSSA 5ERWA 2NLJB 3FQXB 3WDJA 12E8L 3RVTC 5EPMB 1TZIA 3RVXC 5I2IA 5IW1A 4UT9H 4KJPC 4ZAKA 4PLJC 1JPSL 4DCQA 4X6CF 5F96L 1A0QH 5BXFA 3QDJA 5DQDL 4UB0L 1I7RB 2CQVA 5AG8A 5E8DL 3K7UA 4XPAL 1FFOB 4A2LA 3IU4H 1KPUA 4D9QD 4ERSH 4F7TA 2Q86A 1I1RA 1WAAF 4PBXA 3H3PH 4Y4KB 1J05B 3GMPB 1I3UA 4KUZL 2FD6L 3TIEB 2HT2D 4HJGB 2FJFB 4GG8B 4KRPB 2DAVA 4WTXA 4Y19D 1NEZG 3DIFB 1UWGL 2D7TH 1BREA 5JW5A 1LEKA 4X4XA 4E41B 1AI1H 4EI5A 4LK4A 1XGRA 5CHNB 5TF0A 3VJ6B 1TNNA 1QFUH 2AI0H 4POZC 2GFBB 4DZBB 8FABB 4CNIA 1I1CA 2W59A 1JF5A 2B5IB 3L3JA 3O2VH 4MNQD 3MUGB 3OKMB 4RX4D 3VGBA 1IILE 1QTYT 1FNAA 4LRNL 4P2YA 2VN4A 1BVKA 3TT1H 4NPYA 1TMCB 4W70A 5F6HJ 5ITFA 4FQHA 4YAQA 3V7MA 1TQCB 4MQTB 5KTEH 3PP3K 3RX8A 5D9SB 2VLRA 3MC0A 4LCUA 2EXWC 3E1F1 4K55A 3WO4C 4O4YL 1KB5B 4RNRA 3C5JA 3V6FB 4JRYE 1P7QD 1U8PA 1CICB 1ZVSB 3HCVB 3QB7C 4GMSH 4P2OA 4WFFE 3WIIL 3FO2A 3ULVH 3H8NA 1LDPL 3EYQD 3WS3A 3VH8G 3ZHLA 5L8LB 1K4CB 5C0AD 3LQAL 1FGVH 2PR4L 3ARBA 3BO8A 4P2QA 5L8JB 2X9YA 3A0OA 3LQZA 4L9LA 5BRZE 1ZVHA 3LRSA 5JQHC 4IRJB 5DJAB 1MFCL 2ESVE 1HILB 3OJDA 5I8CA 3CH8A 2P24A 4KGJA 4QTHA 1IGCH 5FUCC 4PJGB 4R2GD 1XGTB 1BJMA 2H2PD 2IG2H 2NY3B 1GPOL 3ULUL 1MNUL 3ZL4H 5F1NB 5I16A 4LQ1A 1OW0A 1FG2B 3HZMA 5JQ6L 1I85C 3RUGA 1F97A 1YECH 4Y5XA 4OGYL 3D5OF 3JUYA 4ODBD 5B22A 5C09E 4E0RA 1D5XA 1UA6L 5I1DB 2JK5B 4X9BA 3CZJA 5CBEA 4PJAF 1I1FB 5IB1B 5JHDD 5L7XL 1NFDA 3FB6A 4LGRB 3F5WA 3UYRH 5JLZB 1DL7H 5IW6B 1NCCH 4CADA 4I0PB 4PYHA 3WL9B 1F4WH 3BZEB 3W9DB 1KLUB 4RISL 1L9NA 3O6KL 5C6PB 3MQIA 4UOJA 1YYMH 3ULVD 1G7HB 1MQKH 1MCRA 5FYLD 5DJXB 1K3IA 3MV8D 5HGAB 3P30H 2DQDL 2VUYA 3TZVA 1QSED 1DANT 4AL8H 4KAQL 2JJTA 4Z7WB 5HHXH 2RAMA 2X4NA 2Z92A 4J8RB 4XT1C 2VLJB 5CILH 1T21B 4GBXB 4HEPG 4NFCA 3KPPA 5KZCD 1ES0A 1E0OB 1ZHBA 4D9QE 3HB3D 4AH2A 4XPGL 3JTTB 1NAMH 1QSVA 4PJIE 1BBJA 4NM8H 4HX1B 1GGTA 2VYRE 2EDLA 3GSQB 5EU5B 3UJIL 1G7QA 2ZSWA 4Y19E 4MJ6B 4BSWB 4MHHI 5LGHH 4DUWA 1M05B 3MRNB 2LAAA 2PW2B 1N4XL 3CFBB 4ZS7L 3B9DA 2HA1A 4HCRL 2QSVA 1U95A 4PJ7A 5GGUA 4YHNB 3QAZC 4EXKA 2R69L 4MNQE 3LEVL 2JCCE 3MLYL 4XBEL 4KU1A 1OT1A 4M8VA 4JQXA 4JG0L 1F6LL 1QP1A 2DTMH 5EO0B 1FLTX 2CPCA 3O4LB 1F11B 4OSUH 5GJTL 4S1SL 2BVUA 2GTWA 4M93C 4OQTL 1RURH 2EE6A 1DFBH 4Y4HB 5MEQB 1FLRH 1JPST 3BP6B 4NT6A 4GW1A 1KJMA 3FHQA 4KJQC 2PYEA 4PGCA 3PUCA 3MUJA 1HQ4A 4LAQH 4OI7A 3TNNA 1ZV5A 3TYFA 1NLDH 4NYLA 5C0AE 3BDYH 2HKFL 4Z7UB 2R4RL 3I6KA 4FFWD 4M5YL 4LHUG 2XKUA 1YNTB 4OLEA 4KTDH 4P3DB 4WI6A 3UYPA 5SWZE 2CKBL 4MA3B 4TTGA 1G7JA 5KVGH 1G6RH 4NQXB 1W0VB 4OFYD 4CU7A 3G6JF 1X5XA 4QOKD 1UFUA 3GUTB 3EUUA 5HYSG 1Q9KB 5FXCH 3HC4L 4L3EB 2Z93A 3NZHL 4UBDD 2EYRB 3DXAD 3EO1B 2I9TB 3TFKC 1T0PB 2K7PA 4XHJD 2EZ0D 5IF0B 1OSPH 1WFNA 7CGTA 1T80A 1EHXA 4KK9C 1MVUB 1K5NA 2UZYB 1YEGL 1WWAX 4JDTL 4P3WA 1NCDL 4W6YB 4XMLL 3DMMB 5JR1L 2DDQH 1A7OL 1LILA 2YUWA 5DYOA 5CP7A 3OPZL 2EYTB 5JHDE 1NLBH 2Y36L 1A3LL 1X4ZA 3LB6C 2AJVL 3KLHD 3AB0B 5DGRA 5E95B 3KPOB 5T5NG 4G6JL 3C6SB 4HW6A 3FT4A 2BNUB 1CG9A 4M48H 4PBVC 3PP4H 3VXRD 4ZXBA 3D39A 4BQ8A 4NDMB 1QSFA 3L7EB 1R3LA 1X5GA 3KXFB 1WCBB 3ULVE 4QEGA 5FHBL 2WBJD 2HWZH 5I30L 2LU4A 5FYLE 5IFJB 2BHYA 3WDIA 5IGXH 4KHTH 3QUYD 4FQLL 1FYHB 1QSEE 3VG0H 3WFZA 3WJJA 3NTCH 3RVXD 4IJ3C 1IARB 4KJPD 4HS8L 4R26L 2NW2A 2E9JA 1YN7B 1P1ZA 3LKRA 4NKQB 1BJ8A 3EOBB 4LDEB 3C2SA 4LSVH 4H1LB 1MWAA 4GW4B 4UZGA 4GQPH 5JOFB 2H6PB 3JV4A 5CZVL 4O5LH 5J13C 4P99A 3GKWL 1EEZA 3S36X 1NMCC 2VDPH 5HHVL 2I5YH 2X4RB 2R23B 1FZMA 1RUAL 2GSIB 4KV5F 2N4IA 5BZDA 1KCRH 3L9RA 5HBBA 4P5MA 3NVQA 4BZ2H 4OLVH 3HNSL 1NBYA 1IC5H 5CSZB 1CD1A 1P2CA 2DMBA 3VDBA 3O9WB 4GOSA 4EN3B 5GGSB 4MX7B 1S3KH 3MGOA 2P8MB 5DK2B 3HR5A 3LEYH 2FO4A 2X4PB 4D9RD 4YHLL 5LGJB 2EXWD 3T08A 5C0CD 2L7UA 1FAIL 4PJ5B 5LAXA 3WHE0 4ONFH 2Y06H 3WIHL 3S35X 2EXYC 3GJEB 1FZOB 3FMGH 1W8NA 1ZLUH 3VXSD 2QL1A 1U58A 4POUB 4ZQKA 1LHZA 3MRCA 1LO0H 1T2JA 3QO0B 4OF8A 5FGRA 2E6QA 4K3DL 5ESVA 4YXLH 4XPHL 2F19H 4Z0XA 4PV9B 5BMFL 3SDCD 1I9EA 3HFML 3H42H 3E6FB 4LU5L 2E8ZA 2IQ9H 2XKNA 4PRAB 5DWUH 2XZZA 3BN9D 1URLA 4JKMA 1CXFA 3V6ZB 3QXAB 1ZWIB 3WKNA 3C08L 2CJUH 5B39A 1Q38A 1T2QL 2UWEF 1XCTA 3B2UC 3MOQA 4FABL 4MWFB 1MAML 4O02H 3R0MA 3B9KD 1ZHLA 2NXYD 2HG5B 5IFHL 1I3GH 3RKDC 3QEQD 3UZVB 4UAOB 2AP2A 3DXAE 5IVZB 5A3IC 1ZLWH 2VIRA 1ZGLP 3T4YB 4BFIA 3VE0B 1MVFA 2VDRH 5E7FA 2YD4A 2XQYG 4ODVL 1IM9A 2XWTB 1KCSL 5IR1B 3K74B 2G2RB 3VI3F 2FECL 2DB8A 3KJ6H 4JKPL 4IMKC 4L8BA 1U41A 1T1YA 2YC1B 1QLRA 5F7DB 4D2NA 5J6GB 1UXSB 4FQCH 4LASL 1KB5A 2E7CA 4M1GL 2C1PA 5TGBA 5T1DL 4OGXL 5J56B 1OY3B 5F8RC 4HG4K 5E08L 3NFSL 3Q6FB 3PWLA 1BMGA 3A6BH 3VXRE 4HS3A 1J8HD 3DTXB 4UQ3A 3IDUA 3X14B 2BNQB 3DX6A 4QRQB 3MJ8A 5DRNA 3WLBA 4RFNC 4KUCD 5DHVB 1RK0A 4U4BA 4KH2A 1D5ZA 1IGFH 4U6VL 3VWJC 1MRDH 2G5BA 2ADJB 1NPUA 5DDHA 2EKJA 3LHPH 4JVWA 1TPXB 3PIQB 3TBYA 4M8QB 5JIIA 5BS0D 3IXTB 3L3GA 2Q3ZA 1LEIB 4YH6A 4LPYA 1YEEH 4ORZC 3PHSA 4FQXB 1X7QA 4MJ5A 4XC1H 1PKQE 1AGFB 4JFYB 2Z4QA 4LCWD 2R15A 5L6YL 1NGPH 2AJSL 3HPLB 4P23B 3VG9C 2C4FU 4IDJH 2D4DA 5JIHA 4OF5A 2PTTB 2O61A 2D2OA 1PQZA 3VXNB 2VDNL 3WNKA 1CXKA 2GJ6B 5FYKL 2JJSC 1OAUH 2V17H 5EN2B 5A16A 1JZ4A 2K9UA 2DIJA 4R90H 1N8ZA 4LIQE 5SX5K 3VXMA 1RZGA 2FJHB 3RWFA 4NWTH 4J3WA 5DJYA 1T22B 5E1AB 2VDKH 3OGCA 1EIBA 5D7IA 4D9RE 5F72S 3V5KB 5C0CE 4KDWA 4EIGB 4IM8A 3L5WA 1NANH 4GRLA 3CNKA 2OZ4H 4KDVA 1H8SA 1CD0A 1C8PA 4GUPA 3HUJE 4TULL 4PJXA 4XTRD 5ITBL 3DX9B 2C3HA 4P48A 4LSDA 3VXSE 4G80B 1IEAA 1EXUB 1B4JH 1AIFB 2XWBA 4RFOL 2P8LA 1JBJA 4CVXB 1EEYA 1TJGL 3V4UH 3MV7A 3DLQR 4TRPH 4IOFC 4YHZL 1CGTA 2WINA 3MRLB 4JHWL 1BHGA 4P0DA 2I07A 1K9TA 2X4QB 3EOTL 5DSCB 4BSVB 3GSXB 4PJ9A 1MHPH 4FQ2H 2E7LC 4BSWA 2IAMB 4PJAB 4ZUSB 4M7KL 4MQ7B 5FUCE 5JUEL 5KSAB 2CD0A 4HWNA 4M3JA 4U3HA 1JYWA 3TFKD 4WWID 3QEQE 2VXTL 3CK0L 3K4DA 5L88H 1CXLA 4JM4H 2AV7B 4JHAH 2V5TA 1S7UB 2XACC 1RPQA 5D1XB 4JRWA 1H0DB 4Z5RA 1UACH 2GITA 5HTSA 1XGUA 5IBLC 1XGYH 2FSEA 1RZIA 1MHCB 5MENA 1FNGB 1JYVA 4Q6YA 1E4XL 1UH3A 3RY6A 5KVEL 4NFBA 4BUHA 4U6HA 3LB6D 3P40A 1PZ5B 3SO3C 2EEAA 4Y4HA 2EC8A 5IESH 5D5ME 1ZA3A 4ODUB 4AENB 1T3FA 3HNTH 5CEXB 1J8HE 2N7BA 3RWHA 5KSBF 3MRFB 3QUML 3TO2B 3DUSA 5E2JA 1CLZL 1XIWB 1F8TH 3OF6A 1TVBB 4F7MB 1IEBB 1JYNA 2X89D 3G5YB 1U6AL 3B8SA 4LCCB 4LDLB 4QXGL 5DUBA 2APXA 3OXRB 1YEKL 5K9OA 1KENH 2HN7A 1KN4H 4Y16A 5E2WL 3VCLA 1MRFL 1OARH 4L1HA 2NY2C 2N1KA 3OAZK 5BS0E 4KTEH 1WIPA 3NN8B 2UY7A 4I77H 3S5LG 1OTUD 1FIEA 4YDKL 3QUKA 1FGNL 2VTFA 1SJHB 1Q72L 5JW4M 1I9RH 43CAA 5C7XL 5HY9B 1AP2B 3BPNB 3VMOA 1EX0A 4JGUA 4LCWE 3M17A 4JFPB 4G6FB 1T1WA 4WWKD 1OCWL 1R6VA 3BEVB 6CGTA 1DN0B 1AJ7H 1ZT1B 1JRHL 3DI3B 3TBTB 1JWMB 1TFHA 4WTZA 3BXNB 4DTGH 4Z8FL 5BJTB 3QCUL 2IPKB 5IIEB 2ITDB 5LCVL 5GPRA 1KFAL 1EAPB 2Q8BL 1KEGH 2Q6WB 3BP4B 2NTFB 1FZJA 2VC2H 2WWKO 4BKLB 1TITA 4R3SB 3T4AB 1FFPB 4TSAL 4DN4H 5TDPA 4YFDB 1MPAH 3TN0C 3BRDA 2EXYD 5E4IA 4LGSB 3G04A 1UM5L 3TCLB 2FBJH 1KCKA 1MAJA 1DBML 4PS4L 3L5HA 4JO4H 4GS7C 3UDWA 3CUPA 2GY7B 5DK0A 4PD4J 4PG2A 1GAFL 1PG7X 4M1CD 2GTZA 5HYJD 5IBTH 3SGDI 2VQUA 3DHMA 3U0PA 3IKKA 2LAGB 4ODWB 2RHEA 2VR9A 1LO4L 2GCYB 2VZOA 3ZKQD 5JMOC 4D0CB 5FYJL 2XXMB 4PJIF 4N90D 4IOSD 4KROC 1HXMA 3RDTA 5J8OA 2IGFH 1AGCB 1OAXH 4M6NL 2C1OA 3ELAT 3V2AR 2HVJB 3MLXH 3HMXA 3PHQB 2A74B 3KPSB 1ZHKA 5LBSH 1RIVL 3MRGB 4PTUB 3T0ED 1Z3GH 4PJFE 3RVUC 3L95A 3N9GL 2JCCF 5I73C 3ARED 1QFPA 3EYSL 4HPYH 4N5UA 4P46B 2R2BA 3MYJB 5DQJA 3HA0A 3I2CH 2NY6D 1YMMB 3C6LB 4HWBL 4U3XA 3U6RA 3NFPB 3VFGH 3VWKB 1J1OL 1CL7L 5MEPB 3KVQA 4ZTPL 3QO1B 3CGTA 3CSPA 1VFBB 3WN5C 1RULL 1EUTA 4FQJL 3C2AL 4RQQA 4P4KA 3NPSC 1A6ZA 5I1JH 1QEWA 1QLFA 2W9EH 5C0EB 2VQ1B 3HZKB 4K7PL 1B0GA 2DF3A 4Q7DA 43C9A 4ISVA 2WANA 4XNQB 4YHIB 4XPTH 4DOHB 4O00A 5T1MB 2ZNWA 4RMRA 5EU3A 3T2NL 3WFDH 5CIPA 5EG6C 1GGIL 2R2HB 5D2LA 1RAMA 1KT2A 1RZJL 2YZ8A 5D7LE 3KWWB 3LKSA 3QEGH 2YEZA 2NX5A 2O5ZL 4PV8B 5C0BB 2JIXD 4OLXH 2R0LL 4X7FC 4BQCA 3WXVL 4JJ5A 2QV2A 3DVNB 5JPMB 2XN9D 1R0AH 2H26B 4DQOH 1QO3B 1U92B 4QCIA 1B3JA 4TVPL 1LGVA 3PABB 5C2BH 3I6LD 1XF1A 4NNPH 5D1QC 1NC4B 1U3HB 4AQ1B 4JEGB 4OAWA 2EDWA 1JPGA 5F7EH 1RK1B 4NRYA 4XVSL 2CKNA 4QRSA 2AXFB 1KJVB 3T0WA 5C0JA 2A1WL 1MFEH 1WZKA 5GGRB 4X6CA 2VR5A 4PIRF 2W9DL 4AT6A 2GSGB 3DTXA 4PP1C 2CXGA 5E4EB 1J5OL 12E8H 3PHOB 3N1MC 3MLRL 4S2SB 1WAAA 2J1KA 2CO7B 3MCLL 5T33H 3TO4C 5HXMA 1VEOA 5B38B 1T5WB 4LVNC 5TF1H 4Y2DC 3BPOC 3SDDA 2FL5A 5E8DH 4CJ1A 3BEWB 4ESKA 3VGHA 1UZ8A 1UB6A 1CFVH 5E8PB 5IM7A 4N8VA 3VD7A 5HYJE 3IXTA 4KUZH 3GMQB 3HKFA 3LEXB 4EUPB 3ES6B 4NC1C 4F15C 1SYVA 4ELKB 4X5WB 4JRXB 1VFMA 3IFPA 2J8HA 3ARZA 1E28A 5TE6L 2ED8A 4RWHA 3H9ZA 2ZWLT 4DEPC 1YN6A 4N90E 5DRWA 4PGJA 1LMKA 1GZQA 3A6CH 4IIQB 2OJEB 4CKVX 1OVZA 4M62L 4OCMC 4ZUWB 2PTVA 4ZD3L 3MA7A 3UBXB 3MNZB 4ZAKC 3EDEA 2VH5H 5LXGL 2AKRB 3QJFB 3BKML 4J23A 4D0BB 5E03A 1UM4H 3T0EE 1Q0YL 4O4YH 4U1JA 1F58L 1HSBA 2ZUTA 5E1AA 3C60B 1TZHB 4LSSL 2OSLA 3MNVA 8CGTA 1EGJA 5J6HB 4HXAL 2VWEC 5T3XL 4QRTB 3KYNB 3T3PE 3QXWA 2DN7A 1LWRA 1SM3L 4EI5C 4QT5A 4HPOL 5F3BB 3WUWG 2DIBA 2VAAA 1NEZB 2WNGA 4LVOB 5F9JA 3F7RA 1DE4B 2BXZA 1JNLL 2PR4H 3QIBA 4PGEB 1OGAD 1QPPA 1VPOL 4U1LB 3CIQA 3VFNA 4KJWC 5EUOF 3TH4T 4F57H 3U0TA 2AJZB 2X7LB 3MZTA 4HLZG 1JZ5A 3AS1A 3PL6A 4J6RL 4WI4A 1CF8L 4MYWB 3RKPA 2A6JB 3ARDC 2ORBH 2NY2D 4XVUC 4J3SA 4RMUA 4L5FL 2XNAA 5B8CA 4K8RL 1EJ6A 4P2OC 3RL1B 3FN0L 5D2NB 1I8KA 3QI9A 4YDJB 5I1LB 4N0CC 2PW1A 3ZDZF 3MTRA 1N0XL 2XN9E 3ILQC 4X4ME 4OB5H 2A73A 4LEOB 5I8KL 5HHPA 5C0DA 4YR6A 3ARBC 2EDHA 3HPJB 3VH8B 4IRSB 4A6YH 3I6LE 4W4OA 5FKAB 1ZEAL 3F7VA 4XWOC 4NBXB 5F9WC 2J8UA 2VLKB 3ILPA 5C9JA 2V9TA 2X9XA 3QXDB 3K1KC 3W39B 5GIRB 1MRCH 1RIHL 3FT3A 3O6KH 3UP1A 3D85B 3S35L 1BGXH 4K7PY 2XWJB 4NGHH 1Y0LB 3DVFA 1ROWA 1CXIA 1JVKA 1SBSL 4U1MB 2DQDH 4CUCA 3IDXL 4C4KO 3SDXE 3HZVA 3RY5A 2H1PL 5C08A 1OW0C 1KLGA 1KPRA 1U8KA 3FFDA 2CRZA 3SO5A 1HZHH 1O7SA 4JY6A 4XNXH 4Y5XC 4OCYL 4BZ1L 1XIWA 3BYTA 5I18L 1EZVY 1GZPB 1U3ZA 3CDCA 5E5RB 2BRRH 4OFIA 3Q3GB 5J12C 4OM0H 1YY9C 4ZMAT 3D0LB 4N0UE 3S37X 5HHNB 5D93B 5FO8A 4KHXH 3QDMA 1MI5A 1FE8L 3TWCH 4RFEB 2CUHA 3QUMB 5AUMB 5AWNH 1EHLL 4TPRH 1UJTA 5ICZB 2Y4SA 1AO7A 5FUZH 3K4ZA 4NBZB 3GIVA 1R3IL 4G42A 3ESUF 5ICYA 4OD1L 3TZVC 5IMOB 1JZ3A 3RGHA 4KROD 4I0CC 3TPUB 5HI4C 2JJTC 3LEVH 4G3YL 3MRMA 4ZYKB 3FZUD 5JA9A 4H5SB 2AEWA 1NGZA 3KYMA 3MRKB 5KOMC 4V1DD 1A5FH 1G7MA 3BE1H 1FJ1A 3IDJB 1NDGB 3IF1A 3ZZ1A 5CKGA 3U2SA 4WU7A 3W0WD 4Z76B 2GUOA 4L4TB 4F7CB 3QWOA 1CTOA 4JY4A 5GJTH 4JM2A 1MREL 1A3RH 5DMKB 1HWGB 4OQTH 5EU4B 5KSBB 4NWUL 1UCBL 4BUGA 1AKJD 1II4E 3RA7L 4OF7A 4YDVA 4A2MA 1WBYA 5FM5O 4R3SA 1IAKA 1IT9L 1QQDB 3KR3H 3DYOA 4NN6B 4RA3A 5JO5B 2EIZB 4F7PA 5J1AA 4MDIB 1KNOA 2DYPD 5CJ8A 3S34H 4NQCB 3MRRB 3EDDA 1HNFA 3G6JA 1MLBB 2VISB 3QG7L 1UZ6E 4JZNB 1FH5L 3P4LA 1OGAE 4RGNC 2R4RH 5C6WH 3OL2A 1K2DA 1DUZB 2BY3A 1FO0L 4JQXC 1PD6A 2CKBH 4F9PA 1H3VA 2BMKB 4CBPA 2P5WA 5LG1A 1I8MA 1UXWA 3OWEA 4HUXB 1A7RH 3AM8A 3NGBB 4JFED 4XP5H