3QEUA

The crystal structure of tcr dmf5
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
201
structure length
195
Chain Sequence
KEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVNFGGGKLIFGQGTELSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWACANAFNNSIIPEDTFFPSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DMF5 alpha chain
publication title TCRs Used in Cancer Gene Therapy Cross-React with MART-1/Melan-A Tumor Antigens via Distinct Mechanisms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 195
sequence length 201
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qeuA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qeuA02
1TZGH 4X9IA 4XHQA 3ZKMD 3T0EA 2EDDA 1S7TA 1KIQB 1ZWIB 3OXSB 5KSBB 5I1IH 1SEBB 3KYNA 5F89A 4PJFF 4CVZA 3IU3B 5CZXD 5TF0A 5T1KB 5HSFA 2IPUG 1T1ZA 3TC9A 1AFVH 2HTLD 3K1DA 1CZ8L 5DLML 4P2YA 4G6FB 4N8VB 2Y5TB 4MJIE 4U3XA 4PBWD 2BFVL 5E24E 5EOCL 2HFTA 4IDJH 4H20H 3NAAL 5F1KC 2UUDH 1KTLA 1FO0H 3L3JA 1F4YH 4OZGE 3O9WC 1DBMH 4NDMB 4U1KB 5CHNA 3OB0K 4APQC 1ZT1B 4RMSA 4QF1B 4UNVA 1MNUL 3VD4A 1U93A 1NCTA 4J6RL 2O5YL 4KUZL 5KAQF 4PJ9A 2HJFB 4I18B 5HY9B 4PIRF 2D4DA 4QHMA 4UIMA 1U6AL 5I30L 4PJIB 3HPJA 5EORL 2FECI 1GGBL 4K23H 5C6TH 3TESA 1T1YB 3NBNA 3P3YA 4AIOA 4IS6B 5DFTA 5FYJH 3C09C 3ZHDA 4XPFL 4D0BB 2AXGA 1SVZA 4HS3B 2W60A 3KNBB 3VFGL 4Y5XC 1IM3A 5CJQL 3X3FL 1CXIA 4JFDE 3BJLA 4J3WA 2PO6B 4GKZA 5FYKE 3DSFL 4S1DC 4DEPC 2HTLC 3QUXC 3R06A 5BOZG 4DGVH 4HFWB 4LKXB 3TO4D 3PL6C 4MA1B 4CW1A 3S34L 2WAHA 4W81A 3OAUH 4NKOA 1H5BA 1XH3B 2ICWI 3D2UD 2JCCB 3EFDH 3OGCA 3BRGC 3MGTB 3BUTA 3V95A 2DYPB 1JN6A 3MUGA 4OIIL 4BZ2H 5HHQA 3V6BR 1D5BB 3ROLA 4YHOH 3FT2A 4GSDH 3TJHD 1DDHA 4ZG1A 2PXYD 3BO8B 1SY6H 5GS3A 4KY1L 5GRWA 3LHPL 4FABH 4P2OC 2VN7A 1CLCA 5IW6A 4PV9B 1NGZB 3LEXA 3V4PH 3BDYH 4QXTA 2FATH 1C5DB 3QFJD 2WP3T 3IDXH 3ULUH 5JR1L 2CXKA 4PGEA 3PWLB 1NMCB 4LCUB 5E4IA 2FHCA 1K9TA 4IBLT 4OTXL 1U8JB 2OI9B 3NFNB 4ALAL 2D7MA 3GMQB 1G6RH 3EOYG 1FZMA 1JF5A 1HINL 2Y7QB 5DD0H 3LCYA 1KBGH 3MNWB 4MYWB 3JV6B 1W2KT 5F3HA 4ZFZB 1AGDA 2F54B 1QQDB 4KJWD 3O9WB 1BVKA 2CUIA 1J87A 4XB8A 5IBLC 1P53A 4W6WB 3TO4C 2NNAB 1GHFH 5DQJA 3EOAA 1PJ9A 3JSSA 5KJRL 1TITA 3OKDB 3VMPA 2VL5A 2V6HA 1PDKA 3HZMB 4EBQL 1UVQB 2CKBB 3HUJB 1RIVH 4GAJH 4I3RH 2VAJA 5I73C 3WHE1 2J6EL 1KACB 1QSFD 5MENA 1QBAA 1J05A 1FRGL 3UROR 3LQAH 3MJGX 4JJ5A 5IK3A 3MRGA 2N4IA 4IM8A 2H1PH 3O3DB 4GG6B 1YC7A 2J1KA 2W9EH 3C09B 3QDJD 4HIXL 3EJZD 3GSNA 4HEME 4UQ2B 3UJJH 4Y5XB 2IQ9L 2C5DC 4ODUA 2VLME 1A1MA 4PRNB 3PWPB 3O4LB 3IDYC 2DWEA 4ODWB 4P4KC 3WD5L 5FECA 4GW1A 4Y2DA 2Y5EA 3H9SE 5DWUH 1MCKA 5D2NC 3QUXB 1HOCA 4DEPB 1NCUA 2YD6A 2WBJC 5T3ZL 1LO4L 3HKFA 3PL6B 3BSZH 2DICA 3RPIB 1HDMA 5C0RH 4Z7QF 4GW5A 1UM5H 3MLUL 4KKLD 4RAVB 3SDXE 2VDQH 5ID0A 5L88L 2AJXH 5ABDE 3GSOA 1BREA 4KJYA 1PSKL 5F7YC 3MRCB 5HI5D 3PHSA 1KJ3H 4KJWC 1C5CL 1QYGL 2ICWJ 1TJIL 4PP1D 2CR3A 2UYLA 4ETYA 3MGOA 5IFJB 4K9EL 3TN0D 1BFTA 2EDYA 1B0GA 3G04B 5FA4A 1YY8A 5KG9A 3BGAA 4TPRH 2H2SD 3G5XB 3QEHA 3QWOA 3SGJC 4NQDD 2A77L 4HKXB 4WUUA 1XGQA 1U8MB 2XWBB 2XOTA 2DQCH 5I8OH 4HKJB 3GGWA 5EBMA 5HHPB 4PY7B 2ICEB 3ZYZA 2VIRA 2IBZY 3EYFA 2NY6C 2W0LA 4TOYL 5BVJA 4LSQL 4U7MA 3DX6A 2BY1A 5LGKA 4TUJB 2CRZA 2E6JA 1Z9SA 5INCB 5IG7B 5HVWA 2ATPB 5H2BB 3RP1A 5EIIA 3S4SA 3TFKC 3UYPA 5CIPA 5FGRA 1B88A 3RWDA 3UTPD 3GSQA 4LSUH 3L7FB 1I1YA 3HNVH 2CK0H 1ZHBB 5F8RC 3L5WB 1B2WL 2YK1L 3KLHD 1U36A 5I1KL 1E4WH 3TBYB 4YHZH 5IW1A 4HZAA 1RQ5A 2Z31C 3UTQB 2CLZB 4MNQE 1C08A 4NWTH 4R7DB 3QDMB 1JGDB 4KKLC 4ODVH 5I19L 5ICZB 3KPSD 2F74B 2YPVL 5SWZE 4CMMB 1SQ2N 5HI5C 2DQUL 5I73B 4PP1C 4WEMB 4JQVA 3CFJB 3HZKA 4J3OC 3TN0C 4OGXH 3DETD 2H2SC 4HWZA 2DKMA 1HH6A 3S35H 5AD0A 2G9HA 4R4FL 2DQEH 2VH5H 2FX9H 3OHXB 3BW9A 4GXUM 3QUMA 4LVNC 3WIFB 5JDSB 1CE1H 1KC5H 1NCCL 3IDNA 4WI3A 3K80A 4P4KB 5E03A 1AI1L 4HIHB 4POZD 2ZUQB 1Z9LA 3G5VB 2X7LB 4LLYB 4HQQH 4KQ3L 5JMOC 3ULVE 4Z8FL 5DMGC 2FWOA 4Z76A 1W0WB 1XGTA 2DRUA 1H0DB 3TYGH 4OAWB 1FNFA 4XCYB 7FABH 2H8PB 4YPGB 4HKBA 4FQ2H 1KEMH 4ZYKB 5H8DA 3P40A 3EJJX 2GAZB 1VB9A 3I3EA 1JYVA 4Q6IC 5ADPL 2VDOL 1QBLL 2AJSL 3UXFA 3REVB 1WT5C 2FSEB 1HHHB 3LAFA 1CDBA 1DVFD 5A40E 1NSNH 2NY6B 2MPAL 3B8YA 3TT3H 1IM9A 4DW2L 1FYHB 1GGUA 1KIUA 2HT3D 3EDKA 3OR7A 3GBML 4XCCH 5K9QI 3SDAD 4L3ED 4OFYD 1I3VA 2J12B 1X5GA 4G9FA 4C57C 1ADQL 2HN7B 1INDH 2NXYB 1UZ6E 4OKVB 4K8RC 1CLYL 3E2HC 4POZC 4HKZA 2RQ8A 3KHOA 4WI6A 1T5XA 5LJYH 1RURH 1P2CB 1IL1A 1IEBA 5SWSB 4GUPA 1T0MA 1GIGL 5C0AA 4QRPB 2Z31B 4M1CD 5CZVH 3RWCA 1YEGL 2XZAH 4YXKL 5FOJA 3E8UH 4XP4H 5M94B 3RVXD 3P0VL 1LEGA 1UXWB 5FUCC 4Q97A 2IEPA 2ADGA 4X9HA 3B5HA 1WZKA 2R2HA 3OAYK 4KH2A 4HSQA 3N06B 1NLDL 3MBXH 4Z7OF 3VH8G 4J1UA 5KOVC 3GMOA 1WBYB 1NDMB 2FECL 5J6HB 1FC1A 1JPSL 5CUSH 2AJVL 3Q5OA 4L3AA 1QPXA 1TPXB 3MRRB 3VXMA 5E6ID 1T0NA 3OJMB 5E2UL 3WN5B 3H9ZA 4H8WL 1NEZB 1BPVA 4PJEB 1JHTB 4EI5A 3QZWG 3T09A 1Z5LA 1FVCA 3WSQH 3M07A 3C5SB 3GJFB 3L95A 3G6DH 3O8XD 4YGVA 2IANE 3UDWC 3GMMB 2ATKA 4NQEA 4JY5L 3S3PA 2A9MH 4WFED 4YXHH 1SHMA 2BHUA 5GS0L 5IEKA 1I1RA 1YN7B 4QRSA 5D5MB 1ORSB 2M1KA 1D5XB 1YEDB 1LP9F 2F5BL 3NZHL 3O41A 5F3BB 3BPOC 2I60L 2OR7A 5E7FA 4NZRH 1FVEA 1Y18A 5F7DA 4EIZC 1TVDA 3RVXC 1QTYT 3HNTL 2AP2A 3IFPB 4I77L 1IGCH 2P5WD 4FXKA 4YHML 4Y19E 1L4IA 3DMMA 3PGFL 3WJJC 3BT2L 2YKLH 1MHCA 2XYCA 2LTQB 5DHVA 1GL4B 5AWNH 3WFCL 4YGAB 4UUJB 5J4MA 1G9EA 2NTFB 5AUMA 3C6LA 2ESVA 4FZEH 3K4AA 2XA3A 4HV8B 2R56H 3MLVL 1TTGA 2FB4H 3E2HB 5E6IC 4JN2A 3VXUE 2DS4A 43C9B 5GGRY 2R0KH 3QIBB 3JBG7 4JZOB 4KWUA 2Y06L 3ARFA 2CMRH 4G8GB 5K9KA 2EDXA 1L6ZA 2DLFL 1OSPL 2VAAB 3NACH 5EU4B 3P4NB 2LV4A 3T04D 1QLEL 3MRIA 4W4OA 5EBLB 3V6FB 1A6UH 3ME0A 1YJDH 2YC1A 1VENA 4P5TA 3AAZB 4NO2B 3HE7A 2YD5A 3ARBD 4D9QE 5ISZD 1BQHG 1JI2A 2ZJSH 3DGCR 3DYMA 1IC7H 4IRJB 5BJTB 3O2WL 1QO3B 1MI5A 4ACPA 1JWSA 4PS4H 1JHLH 4OLEA 4J12A 3HC4H 4PJDE 5F7LB 4JM4H 1YZZA 4NHUB 5I1AB 4JO4H 3BESR 3M1BA 1DQDL 3NCFB 3L6FB 1TQBC 5MEOB 1GSMA 3I6GB 3ZKND 4PJCF 3PWUB 4ZAKA 3JTSA 5GJSL 5KTEH 5E8PB 3BZ4A 2J4WH 5HVHC 5E7BA 3CK0H 3CFCH 1CGYA 5E94A 4GAFB 4XBGA 2I07A 3D39A 2ITDA 2BSRA 4D8PA 1MFBL 4G8FA 3Q1SH 1FFRA 5IBTH 4WCYL 3BKYH 5CILL 3BPOB 1QR1A 4ONFL 4BA8A 2IG2H 3EKCA 1H3GA 3QXTA 4HLZG 1DEEB 1QSED 1U92B 3BEWA 3QJFB 1F90L 1PKQA 3MLTB 3ARBC 4WHYG 1E28A 4P59L 1AGBB 2YWYA 4Z0XB 3B9KB 5TGBB 1M6OB 3U0TB 3JZ7A 4Z78A 1IGIH 2BNRB 4AEIL 4NQSB 3IAPA 3MLPA 4OUOA 4UT7H 4XNZC 3AFLA 5ENWA 4LP4A 4DKAA 3QISA 4WTXA 5D7LD 2C1OB 4JQIH 5C3TA 2WINA 1NBYB 3SDDD 1S7SB 2NW3A 4I8DA 5HHMD 4XPTL 2MNUA 5C0GB 2AS5M 2UZIH 5HYJE 3T4AA 4NQVA 3RL2B 3V8CA 3V6OC 2FBJH 3AMLA 4YC2C 4JFHD 1WAAE 1X5ZA 3P30H 5H94A 3KS0J 3T4YA 1ND0B 1P1ZA 1PKOA 3L3GB 3EYOB 4GRWE 3OGOE 1P4IL 4WGWB 4MAYB 4S1SH 2IAMC 2PYEB 3WFDH 1T7YA 5TDNA 4NBXB 4X5WA 2B39A 4BFEA 1J86A 2FH6A 3CD4A 2FX7H 2BVUA 5AG9A 3P9LA 4ZUWB 4RIRB 4QRTB 1CDJA 2A6IB 4AENB 1N2RA 5ETUB 3EZJB 1ZVHA 4LVHB 3RNKB 3T1FA 3MRJB 2YD8A 1JF6A 2VDMH 4MZ2A 1TQCB 4G9DB 1K6QH 2C3HA 3CC5B 3QIWA 1AKJA 1CFVL 3DUHA 3U9UB 4JFOA 3NFPB 5FM8A 3KPNB 1DLHA 4HWNA 1O0VA 3UTTE 1ZGLA 1M71B 4WRLA 2K7QA 2Q76B 3RDTD 1QLFB 4WI5A 4KZDL 1GOFA 1FH5L 4XNQB 4Q6YA 4GQ9H 1CL7H 2VXQL 3ALWA 5E2TL 4Z7VA 4ZUUA 5DD3L 4DQOL 3V0WL 1UC6A 4KVNH 5DQDH 4AEHH 4XPGH 4OKDA 4ZUTB 1KCLA 4MXVF 4LGSB 2HLAA 4MWFB 4PRPB 1JK8B 2W65B 2FL5A 4HJGA 3LB6C 5AZ2L 1M1SA 3JVGA 1G9MH 2CXGA 3CLEH 3SOBL 3ZE2F 1B0WA 1YMMB 1D3CA 4OUUB 1FL5B 3U7YL 4ZFFB 4XNZB 3T0ED 3JV4A 2VOTA 4NT6A 3OXRA 4BJLA 1CT8B 1E4XH 4AIXA 1OAQH 3G6JE 3MJ9A 5EA0L 5BW7A 4HLZH 1UKSA 1RHHA 4MD5B 4PJHE 1JTTA 2GJ6A 4WHYH 3T2PA 4HUVB 2WUBH 5BRZA 3HCVB 3O4OC 1QFOA 4JKPL 4JKMA 3QQ4B 5AAMA 4R4BA 5DS8B 4W68A 4BZ1H 1T2JA 2R1YB 2HJKB 2G2RA 2FEDD 2P43B 1S9VB 4QOKA 5J3HD 1XR9B 2MWCA 4EUPG 1DFBH 5F8QC 3H8NA 1EAJA 3MJ9L 3RDTC 2IAMB 4P9MH 3MRPA 4PJ9D 1GZPB 1EV2E 1JF1B 1DBAH 4FA8A 5DURD 1G7PA 1YMHA 4O2FA 4OD1H 5EU5A 3I85A 1IQWH 4NZTL 3TPUB 4X98A 3BH9B 3FHQA 1YEJH 2GK0B 4I0CC 2WW8A 3QNYA 3BXNA 2AV7A 3WFBL 2VDLH 5D7JB 5T33L 3B9VA 1XF5A 5E8OA 5L7XL 1DQML 1NH6A 1LEKA 5FUOL 1MCNA 3DXAA 5C0CE 3G5YB 4R3SB 3LV3A 1A4KB 4RISH 3SDCA 2NY2D 4PJIF 4U1HA 4C56B 4WI8A 4X7TB 3LOWA 3NA9L 3N9GH 4I0PA 3HRPA 5BZWA 2SEBA 3SQOL 2ENSA 2FEDC 2HA1A 4RZCB 4TSAL 4TULL 4WFGD 1G9NH 4WI2A 1NC4B 3BIKA 3DVIA 3QDGB 5KN5A 4ZO6A 4ONHB 4F57L 1I1FA 3Q0HA 2E27L 5EO9B 1K4CB 4ZUVB 3O6KL 4PJ9C 2R0LL 1CF8H 3X14B 3UC0H 2FJHB 4Q2ZA 1U3HA 5JUEH 1KYOJ 5CP7A 4PYHA 1OARH 3P77A 2QSVA 3IXTB 4U33A 4JFYA 2DQIL 5TDOB 3KXFE 4M7ZC 2DDQH 4UV4H 2ARJB 4NC0B 2D7NA 2EDWA 3BN9D 2JCCF 4NUJA 4PRBA 4F15C 3CZFA 4Q0XH 5F9JA 3DO3A 3CSBA 4PGCB 1A6AB 5DRXB 5D71L 3VGAC 1HN1A 3S96B 1UJ3A 2GT9A 1EIBA 4OZGB 2F58H 4Y5VB 3KLAA 4OLXL 2VYRE 1FAKT 4KKCD 5CBAA 3S5LA 2GIYA 4MSWA 3GBLA 3H3PL 4XP1L 2NY2C 2FNBA 4K3GA 5I1CH 1N5AB 1MAJA 5J56B 2R0WL 1H5BC 1O5DT 3GMPB 1BQSA 2RIKA 4JFFD 2J5LB 1F6FB 1KPVB 5JPNB 4CNIA 2FLBT 1MCPH 1I8LA 1BJ8A 3VI4E 4JKKA 1L7IL 3GRWH 3QEUB 4BSWB 1T0PB 5C6WH 2NY3B 5T3ZD 3NH7H 1Q9OA 3OKLB 5MEND 1BOYA 2GFBB 4X7EC 2BNUA 3S37H 1ZVSA 4EUPH 4Q9QL 1QFWH 5J9PA 1HKLL 4ODBD 1J8HE 3PWJA 2Q87A 5T3XH 3U4BH 1S7TB 1N6VA 1URLA 5F89B 3V4VL 1X5YA 4O58H 1ZLWH 4OLVH 3HB3D 2DLTA 4N8VG 4Z18A 1HWGB 1T1ZB 1KOAA 3HI5L 3R8QA 3HUJF 4P3CH 3TVMC 3N1FC 4FNLH 3Q6GH 5ALBL 3MRKA 4X6DA 1PAMA 1MFEL 4MNGE 1DLFH 4GBXA 2Q7YA 4G6AC 5K33A 5EU6A 5CMAB 3FTGB 4IOSD 4OCWL 2C1PB 2OL3H 2FCBA 3WNPA 3T8XA 1HYSD 3RKDD 2QTEA 1N26A 4X6EB 5I15H 1U93B 5TE4H 1JRHH 1MLBA 2H32A 1BIHA 5JQ6L 3PV6A 3VW3H 2R4SH 4WUUD 5JW3H 1EJOL 4HCRL 4R90L 2ZCHL 3RU8L 4L4TE 4JCMA 1OHQA 1T2QL 4NC1C 1CGUA 1FG2A 4CADA 1JJUA 3WS6C 2AABL 5FM5O 5CD5D 4F15B 1CBVL 2AXGB 5DEFA 2FEEI 2W60B 1AHWA 2R1WB 2PW2B 1IM3B 3GI9L 3OWEA 2X89A 4GKZB 1X5JA 3VGAB 4LNRB 1JPST 1DE4A 1KJMB 3F12B 4Y2DC 1V7NH 4JJHA 2PYFA 1EBAA 3FHAA 2AGJL 4F58L 3R06B 1I8KB 5C0BE 3BKCH 3O45B 4U6HB 1A4JB 2K1MA 4G7VH 3CSYA 1ERNA 5ELIA 5FYJE 3HI1A 3QXUA 1H5BB 5DJZA 4XP9H 5FO7B 1YDPA 4QHKJ 5GRJH 3MLRH 5D1XA 1NKOA 1VHPA 2QKIB 2BY2A 3UTSE 2CDFA 5HGBA 2BC4B 1G7LB 2VABA 3RKDC 2VR9A 1YEFL 5BS0A 4DTGL 4Z7NF 5DDHB 4PTUB 1VCAA 4JFEB 3X13A 1DDHB 2J8UA 4TUOA 1XGYH 3LS5L 3L3HA 1WJ3A 3VXPB 4LNVA 4X7SL 1T6WA 1RZGA 1UA6L 3SPVA 3M17A 1S9KC 3QPXH 1UWEL 2O26U 1A7QL 3FFCE 1I7UB 4QEGA 4D9LH 4FQQB 4QXTB 2Y9RT 4QYOB 3AM8A 4J2XA 5FOBB 1IGTB 4HWEH 4Y4HA 2R23A 4PGEB 4K9EH 5ACMA 2BDNH 2IFGA 5JHLL 3F62A 4HC1A 4PP2A 5CD5C 2PW1A 4TVPD 1DUZA 5GRZA 1D6EB 3TVMB 1FZMB 4HEPG 3SDXB 3D1MC 4IRZH 1ZSDB 3GBNH 5FXCH 4L1HA 1F97A 1XGPA 3SKMB 5F3HB 1SVCP 1AC6A 1OAYL 3BYYA 3MV7E 2AJ3B 1BF2A 4MJIA 3DHJA 4WU5A 2HRLA 4TRPL 3ULUE 4GLRH 5DQJB 3NIDF 1N4XH 2EZ0D 2YPKB 4M9OA 1S7UA 2A83A 5EU3B 2XQBL 1EXUB 2VL5B 4HC1L 3S37X 1LQSR 4PTTA 2H3NB 5T5FH 1A7NL 1TFHA 1Q9LA 1UB6B 1SJHB 1TENA 4LRNH 3OJDB 4G3YH 1GRWA 4JRYA 4JQVC 3D87B 3EJYD 1J05B 2APBA 3IJSB 4L8CA 5IK3B 3MRGB 3IS0X 3JWOC 1AGFA 5E2VL 4GMTL 3DYOA 2DOCA 3IDIA 4G9FD 7CGTA 3GSNB 3OX8B 1KSRA 4JRXB 1PYWB 3MQIA 1N6UA 3ZTJG 5KSAA 1JI1A 4WV1B 3VXQA 5FECB 1HEZA 3D85A 4GW1B 4D3CL 4Y2DB 3ZDXF 3GSRB 1RUKH 2GJZB 3IKCA 3U46A 4I0KA 5HHOA 5D2LE 4LP5A 1NL0H 5C0AD 1KG0A 3ARGA 3RAJH 2O61A 5I1DB 1YEEH 2GK2A 5JIIA 4FTVD 1HDMB 1X7QB 4YWGL 1OM3L 3VXRD 4K3HA 4HWBA 2GSIB 4KZEL 4OQTA 5FYLH 3MOBL 2DQFB 4XAKD 1K4DB 4HK3J 4V2BA 3MACH 3FB6A 4XX1G 1EFXB 3PXHA 1VGKA 1DN2A 2EYTA 3QIUC 3KYKH 5DJAB 4NQCE 3QWOB 3MA7B 4KMTH 4Y5YA 5FYKL 2YPLA 1I4FB 5EULV 5GS0D 3MYJA 2BRQA 1V5JA 2AEPH 3VXMD 4JDZA 3EJYC 4KDWA 4ZUSA 2EH8H 3VMNA 1IAII 2CUHA 2E7LA 1JNJA 3MA9H 32C2B 4WEUD 4EI5D 5EIIB 2NX5E 1AQDA 3RUGE 4PJXE 3WNMA 4MGXA 3ZTNH 3MRBB 1VFBB 5D4QA 1ZAGA 3QR2A 4X6BA 4TUKL 4EVNA 1FIGL 1BZ7A 2ZG1A 1R3IH 2VZUA 4OZHE 3I6KA 1C08B 5CGTA 5DC0A 3QEQE 4CU8A 4ZXBA 1KB5B 1ZT4A 4LPTA 1JFQH 3UBXI 1OPGL 1V3MA 2AEIT 4DFHA 4NNYB 4P23D 2IPKA 4OF6A 2EDLA 3EZ8A 1BBJA 5BZDA 1A1NA 2BOBA 3QDMD 2DKSA 4LLUA 1NFDB 4FQIH 3U7WL 2D9CA 5FUZH 1WGOA 5K59F 2CKBH 5A1AA 2G9HB 3C6LD 4JZNA 3CDFA 2ZCLL 2NR6C 4QNPF 2GW5A 4G8IB 5SWQA 4R26L 1RU9H 5CJ5A 1JGUL 1MRFL 3WFHA 1LD9B 3LEVH 5TDPA 3ARFD 4OFDA 5DUMH 1VPOL 3FB8A 4Z76B 1FORH 2C3GA 3SKOB 1QFWM 5IT2L 4BK5A 4XT1C 1T21B 4Y1AE 1T1WA 3JTTA 4GW4A 4HKBB 2BCKB 3WIHA 4S1RH 3ZTJH 3H3BC 3EO9H 3KWWB 1ES0A 1Q94B 1JYWA 4L8SB 2CQVA 3L7EA 4HIJA 5DEGB 1HSAA 3U83A 3HC3H 3QIUB 1SMAA 4DUVA 2GQHA 4X0KB 4RMTA 3SO3C 2DIAA 1Z2KA 4NN7B 3V2AR 1OF2B 2P47B 4YFDB 3DMMC 3U0WL 4L3CB 4IMLB 5C7XL 1U2CA 1Z3GL 5IEHB 1IM9B 3HG1E 3WIHL 2EDKA 1X4ZA 2BJMH 2I60H 4ZAKD 1AIFB 5C0JB 5F6IC 3VXSA 3HNTH 3IDMA 1G7IA 1CD9B 3RWEA 1CWVA 3JWDL 2HLFC 5F72S 5GGUA 2I9LA 3WO4B 5B38G 3VD3A 3D39D 4XAWH 1AH1A 3QRGL 3OKNA 1P6FA 4UV7H 3BMVA 3IYLW 2FDBP 1S3KH 1NEUA 1YECH 4J23A 1U91A 2GSGA 4W4OC 1VEOA 3DPBA 3BE1H 1LEGB 4GRLB 1W8NA 4P5TC 2ZSVB 5ESAA 3CLFH 3HE7C 1QNZL 2ADGB 3CJJA 5HXMA 1DBBL 2YMXH 4P2QB 3ZDZE 4YUEH 5EUOA 4KTEL 3DUSB 1J1PL 5ITBH 5FFLA 1OSPH 3CSGA 1FZJA 1RUQL 5IFHH 2XN9E 3GZKA 4HG4J 5A2JH 1U3JA 3VXUB 5CSZA 1NEZG 1A14L 2ICWB 3IGAB 4YHPB 3ZT5A 12E8H 1IGJA 4ZAKC 5F21B 3NIFF 4UTBL 4RSVA 1BFOA 1AGCA 1D6VH 3IS1X 4N90E 3LSOA 3ARDB 5IKCA 1S7XB 1VSCA 1Z5LB 1FVCB 3R8BB 5BQ7A 3ALXA 3EOTL 4Y4KA 1VGEH 3BN3B 4WDIA 3RWGA 3WXWH 4NQEB 1LMKA 1UZ8A 1D5IL 1EZVY 3NVQA 5DJ8A 4KKNA 5I9QC 5AAWA 3TBSB 3X11A 3RX5A 4QRSB 2NY7H 4B7IA 2MHAA 3NCMA 4OM1L 25C8H 4P49A 4EDWH 1YPZE 3FOMA 3VXNA 1UYWL 5F7DB 4PJDB 3FAXA 1A7BA 1ED3A 2P7TA 4HMCA 2KL6A 5FA3A 2H45A 3DRQB 4RAUB 4XRCB 3SO3B 1F4WL 3TBVB 5HGGS 4HBCL 2ZUWA 1N5YL 3ULVL 3BVNA 1JPTH 3A6BH 1MHCB 5HJ3B 1OD7A 1G1YA 5IBUB 1HNFA 2VJXA 4MA3B 2ESVB 1TXKA 1LHZA 2W9DL 2XA8H 3QIWD 1AKJD 2VLKA 4K71B 1NC2B 5LGHH 4Y16B 4KRPD 2KDGA 1AQKH 2WBWB 3LKNA 5DD5H 5IROA 1HHGB 3ABZA 2W9LA 1ROWA 3LQZA 4R8WL 1HQ4A 5LGJB 1GC1L 1IAOA 2W1NA 1H8SA 1JPGB 1RZKL 1UM4L 4RFOH 1UXSA 4HXBH 4NHCH 1KB5L 4LCIH 4HG4K 4JN1H 4LF3B 1U8OA 2GHWB 4O4YL 1RK0B 1DCLA 2R1XA 1H3WM 3C60C 3QIBD 4HIIA 4P5TB 3F5WB 4F7EA 1N64H 2VERN 2BVTA 2V2WA 3CFBA 4NN5B 4YXLH 2DBJA 5EN2A 3N1PC 3W2DL 3D9AL 3MUHL 1GOGA 4RMQA 4HXAH 4KI5E 3AROA 1IGML 1MI5B 4DK3A 5IVXF 2X1WL 2YEZB 3ARZA 1PG7L 1H9VA 1EAPB 5IVOA 4NQXB 1IBGH 5IHBA 3QG7H 4IRJD 2B2XL 4YHNB 5I1GL 2GJ6D 4DK6A 3KLDA 4YQXL 1WLHA 4LCWE 1BBDH 3C5JA 3PHOB 3LD8C 3S8WA 3NCEB 5KS9F 5KVGL 3V5DB 1EX0A 3QXWA 5IOPA 2VDPL 5I71B 3QIWC 1RULL 3MBEA 1EMTL 3E6HA 2EE6A 3AVEA 1MFCH 5ICYA 1DQLL 2ED9A 5SX4I 5HYSB 3U30C 3C2AH 4QOKD 4U1NA 4XBGB 5KSVA 2I07B 1HE7A 4OF5A 2FZ3B 3CVIH 3WIIL 4O9HL 1OTSD 1INEH 4KGLA 6FABL 2IANA 2DQTL 4RGNE 3NZ8B 1T03H 4KHTH 2IQAA 2P8PA 5FB8B 3GJFH 4HPOH 5F1NB 3ISWA 4PD4J 2VDRL 3HMXH 3W39A 2EICA 3C5ZA 1Q0YH 4N68A 8CGTA 3QRFM 5DA0B 2HG5A 1ZANL 3OAZH 4FFYH 2GTZA 2A6JB 5JXAL 1S7WB 5A2FA 3JVGC 1I85C 1HI6A 2VQ1B 5I8KL 4Y19A 1NANH 3LKQA 3DX7B 5C07A 5F88A 5EU7C 4BSVA 4EXPX 5JIHA 1CDYA 1K8IB 2WINB 3OKEA 3DXAD 3UTTB 4FHBD 5BW7C 4UT6H 4OBSA 3B8SA 2NW3B 1Q0XL 3GNMH 5KVDH 4KHXL 3HPLB 1I75A 1TZIA 1JV5A 3UBXA 2I5YL 5GISL 3SDCD 3KJ6H 3VJ6B 4NQVB 3GK8H 3TNMB 3HE6B 4P2RE 4K8RH 4LSPH 5J89A 4I0PD 4U3HA 1JZ4A 5H94B 2Z93B 3T4YB 3WXVL 2E6QA 2YSSB 1P1ZB 3C60B 2D7OA 4YE4L 2Q8AL 1YN6A 3HN3A 1ZLUH 2JJUA 4PRHB 5E5MA 4X8XA 1RFDH 3ULSA 3V7AG 2HKHL 1EO7A 1PFCA 4ZS7L 1WISA 1KENH 2R0ZL 3WLWC 3P0GB 2NY1D 2ZP0T 5TDNB 2NY4B 4M6OH 1KV3A 2XPGB 2Q8BL 3DI2B 1ZS8A 1HK6A 5CGYD 5C0EB 2IH1A 3UPAA 1BD2E 1I9IH 1PX3A 3MV8A 1Q9WA 2XZCL 3PGDA 4PG9A 5JIPA 4KGJA 3HAEG 4PD4K 3BYTA 3LD8B 1NAMA 1BVLA 1GGIH 5HDLA 4HK0A 3DROB 3CZJA 3QQ3B 4JM2A 1FV1A 3T2NH 4JFZL 1QZ1A 1X5LA 1OSZB 1FGVH 2KUTA 4JREC 4LCCB 2A6KB 5HI4D 2PN5A 1FZOB 3HNSL 3L9RB 5IB4A 3BOVA 1GPOH 3QG6A 2IFFH 1FYTE 3QCVH 4ZUUB 5GGTH 4GS7C 1NAML 1KPUA 1MAKA 4FRWA 3ZMRA 4GO6B 5DUPH 4EN3D 4JPVH 3RL1A 1SJEB 3O3UN 4S2SA 4YK4C 4RGOH 2FL5B 4ETQA 2EDTA 4OZFA 1CGSH 4PYGA 2NY1C 1EHLL 4OZGF 1U3HC 1FHGA 2FYYA 1FFPA 3Q3GB 3MRQB 4I9WE 4HIEB 1TJHH 4CVUA 4NT6B 2AJZA 4M7KH 4U1LA 2OZ4A 5CGYC 5CZKA 3OXRB 4BUGA 2NXZD 2MQCA 2VQUA 1A0QL 1JNHA 4F7CA 3GSUB 3DV4A 4M43H 4ZPVA 3NN8B 2IH3A 1GVIA 5LBSH 2XNAA 5C9JA 2VLJE 2E5EA 3MRDA 1A6WH 2X1QA 5D7SH 2YUVA 5BRZB 1RZIA 3PP4H 5F7EL 3MZTA 1AXSB 5HD8C 4NM4L 2CDGA 5HYJA 1UJ3C 3P4MA 3MNZA 1ZLWK 1FL6A 3TF7C 3KR3L 1TNMA 2OZ4L 5JHDD 1NGPH 4ZFOA 3QCTH 4J4PA 4NC2B 4NRZB 4K2UL 4FFVD 1LDPL 1R3HA 2CLVA 5L2JA 4XCEB 1A1OB 3S88H 2NLJB 1LNUA 1VACA 3ARRA 3KXFB 3FB5B 2EKSA 1LP9E 3V9FA 1I8LC 4PJ8A 1JZ5A 1QKZH 1MJUH 4R96A 1B6DA 5B3JF 5EU5B 4ELMB 4QRUA 1MELA 4XCNB 5IWLC 2QQNH 3IETA 3HMWL 1X4XA 1YNKH 4HGWA 5DJDA 2VNCA 4PUBH 3BXNB 3CDGB 4ORGB 5TE6H 2R4RL 3QH3A 3RVVC 4NJAH 3TZVB 1V05A 5I66B 4ZFOL 1XF5B 4ELKA 1LK3H 2VZVA 1BLNA 2NXZC 3CFKB 1X5HA 4TNWF 5AYQA 5HGHA 2XZQL 1M05B 4G8EA 4LHJB 2ADFH 4QTIH 1FFOA 3EGSA 3LV3B 5I8CB 1I1AD 1A7RH 1AGEA 1UCTA 3TA3A 4JREB 3GKWH 4GQPH 4PJBA 5C3LD 5TH2B 1JHKH 3HAEH 4GBXC 5BZWB 1HZHL 5T1LD 4H26A 3PDDA 4N0CD 4X80H 4QXGL 4PJ7E 2JB5L 2VLRE 1GJIA 4Q9RH 3HI5H 1M7XA 3ILQC 4BQCA 5KN5B 4YK4B 1IJ9A 2IADA 3EBAA 3NGBC 5TQ0L 1ULVA 5HHXH 4UQ3B 4ERSL 2EC9U 1QA9A 3QHZL 1OGAE 1D5MB 4XMPH 1H8OA 2XTJE 4V1DA 4KMQA 3PJSA 4JPKH 5JXEA 1GGYA 1U3HB 1YEHH 4PREA 3P77B 3MRMA 4LEXH 2ZCKL 4M1GH 4N0RA 3H0TB 1KELH 2AK4D 4Y4HD 5EC1B 2DMBA 4D94A 2VWEC 1ETZA 1NCAL 4U6YA 4HFUL 2YHGA 3G6JA 4NO3B 1DQJA 1P7KA 4MNGB 2BSTA 4X8JB 1AHWC 1AY1H 3CZFB 5TE7L 4PJHA 4LPUA 3ZSSA 1ZV5A 4RX4A 5DMYA 1V3JA 4EQ2A 2BNQE 3BEVB 2Y07L 4JHAH 2BZDA 3KYOA 4AH2B 4MJID 4PJ5B 3S5LB 2PCPA 1EHNA 3DGGB 4MSWB 15C8L 1EDQA 3NMEA 4ONOA 3RY6C 4DKDC 3HZVA 2RAMA 1HH9A 2Z92A 3F6IA 3TH3T 4XVSL 3RZCA 2XY1A 4MA7L 5D1XC 2VUYA 4PGZA 4M62L 5D70H 1UWGL 4P9HL 1MAML 3D69B 1JNNL 2GI7A 4M6AA 4TN9A 1H15A 4JRYD 4WFHD 3V6ZA 3SDXF 5CAYB 1TETL 3LIZL 2BNUB 3WE6A 4E41E 5D96C 5ANME 5DFVD 3WNOA 3MLYH 2R69L 5J9PB 1IC4L 1I3RA 1YEIL 1P7QA 5EZIH 4NCC1 2NY3D 1IT9H 3PWJB 5A2LH 2C9AA 1LO3H 1S5IH 1S9XB 3LH2H 4CDHA 5IMKA 1A3RL 1F4XH 3FQXB 2HT4C 2WIIB 1JL8A 1KLGB 3AM8C 5E5RB 5KSAD 3U7AA 1WTGT 4F7TA 3DX9B 4N0YH 4Y4HC 3D85D 4ISVB 2OR9L 4JFDD 4ZDHA 3U4EA 43CAB 5JOFA 5FYKD 3VG9B 1I8IB 3MRKB 4PRIE 4X6DB 4LSVL 2YN5A 1WUNT 1YY9D 1OTTD 5C08E 1JYXA 1AP2B 1MRDL 4YDJB 4GBXB 2ARJQ 1CIUA 2R15A 4GRMB 4F3FA 5EU6B 5FO9A 3OR6A 5T3XE 1YYLH 5C0DB 4JG1H 3WS3B 4WJ5A 3JUYA 3T8XB 5BVPH 3TT1L 1FBIH 1A6TA 3ESUF 1MCWW 3QO0A 2DQGH 3NGBB 4K7FB 2DTML 3H7LA 4WVRA 1J7VR 2MMXA 4OGZA 3T0WA 4DN4H 1J1XH 4OLYL 3FFCB 4KKBD 3MR9B 4XBEH 1AO7A 1WCQA 1C5BL 2A6DA 1A3LH 3MV9E 3KPRA 3KPLB 1WFTA 5GS2D 3BQUA 1KJ2B 1CFTA 5DFVC 5F7KC 5MP6H 5IFAH 2YXFA 4Z77A 2X2YA 1OOAA 4NQUA 4XNMA 3SKUD 3GIZL 4BK4A 1AHWB 2FJFB 2J8HA 1A7NH 1REIA 4F2MA 5ESVA 5DI8A 1JWUB 1KB9J 3MV7B 5ITFB 1AD9A 5KSAC 2W38A 1U58A 3BP6A 5IHLB 1DE4B 4Y4FB 2PYFB 4P5MA 4J7RA 4JDTH 1KN2L 2VZ1A 3L3DB 3BP5B 3U2SB 3ARGC 3D25A 3BKML 2R29H 4NBZB 3RFZC 1NUGA 1CS6A 1YY9C 2DM2A 4ZXBD 5DJZB 2XQYK 3IFNL 3VRLF 1MHPH 1NCWL 2VXVH 2X4PA 4I3SL 4JFXA 5D1XB 3ULVF 2CDFB 4XWOC 2IPTL 4NYLB 5BS0B 5GGSY 2OJEB 2YUXA 1MWAB 4OZIE 1E6OL 1MJ7H 4NO5A 5CEZE 2PUQT 2PTTA 2AJUL 2P5EE 3LZFL 4LQFL 4YZFE 4HS6A 1SBSH 4Y5YC 2D03H 3FQWA 2CO6B 5HVGB 1FFNA 1J8HA 5D8JH 4KRMB 3FQUB 3N1QC 5HPMB 3EHBD 4HUWB 2UVFA 2E7LC 5M7QA 2LAAA 1NGXA 1W0VA 4L8BB 1IE5A 2PW1B 5F1IB 2AVGA 3LPFA 1DUZB 3H9SD 3LN4A 4ONGH 3D0LB 2UZYB 4KJQD 2DD8H 1CGWA 3MGAA 1XGPB 1NFDF 1DN0A 3NTCH 1A47A 2VXTL 1BZQK 1KIRB 3BAEH 5LWYH 2UY6A 1FN4A 3CVHL 4UI2A 3MRHB 1UZ6F 1LO0H 2KKQA 2V7HA 4HJJH 4OIBA 1G7HB 3Q48A 4ZXBC 1NMAH 3KYMB 3BKJH 3MJ8A 4XHJD 4QTHB 5KSBE 3WHXA 1BOGA 2VDKH 5GZOC 2FJGA 2NY5L 4R7NB 4ZQKB 4AEFA 5CFHA 4PLKC 1RZJL 3PF2A 4IRSA 3GHBH 2CH8A 4FFZH 4LASH 1KN4L 3OBAA 3W81A 1RJYA 1AGFB 2NX5B 2R8SL 2OXGA 1MVFA 2VQTA 4L4TA 3IDIB 1TZGL 3BZFB 2QQLH 3FT4B 1FO0A 5I8EA 2CIKB 5I1IL 5DA4A 1EGJA 3PDOA 5KVMC 1OWRM 3INUL 2W91A 2YA0A 5GPRA 1RZ8A 3EHBC 1AFVL 1MIMH 3BDXA 5HHOB 3CFDB 1TJGH 4IIQA 3ARGB 4JEGB 2HVKA 3RWFA 4HWUA 3C9NA 4MJ6B 5E2WH 2ZUVA 3VFWA 3PQYE 3FZUD 4MNQD 4IDJL 4H20L 3W0WA 3I3DA 3T3ME 1FO0L 1F4YL 4LHUA 2HWZH 3ZSTA 5IIEA 2JJTA 1DBML 2WP3O 3DIFB 3QEGH 4JY4A 5FK9A 4AIZB 1DL7H 1JYNA 4NO0A 1JPFA 5SWZD 3UTSA 4LGRB 1YUHA 3JWDC 4E42B 1J88A 5F7FA 3GKZA 1ZHLB 4PLJD 4WWID 1IGYA 1CD1A 1U8IA 5HI3C 4Y5YB 4MQXD 2XKNB 3PWNA 4NRXB 3JUZA 4YBQD 3M45A 3PIQB 4K23L 4ZMAT 4DCQB 5C6TL 4KK9C 5FYLE 3PABB 3S4SG 2R9HC 4ZUSB 1CXHA 5FKAB 5FYJL 4OBRA 1CIDA 1OB1B 2CLRB 1J0YA 1UACH 3G6AA 1AQDB 2NZ9C 2DQDH 1FNEA 3UTOA 4JFPA 1QRNB 3F6LA 2P44B 4X6BB 2JB6A 1P5VA 3QDHA 1CDUA 1N6QH 4DKEH 3MXWH 5A3IC 2DAVA 1DQQB 4BFBD 1SY6A 3V0AC 1R3LB 3WKMH 4DGVL 4LIQH 4WNQA 3I6KB 2RHEA 1WFOA 3OAUL 2Z4QA 3AS2A 1ZT4B 3GSWA 5E70A 1EEZA 1NAKH 4MHHI 3EFDL 1LE9B 1U8QB 2JIXA 1E6JH 4ZOAA 4X4ME 3MJ6A 4XI5C 1M7IB 2IPKB 4BZ2L 1BBJB 4YHOL 3UZQA 4GSDL 2Z9TA 3HRZA 4RFNC 1SY6L 5FHBH 4YDIH 4LARH 3MO1A 5DJ0A 1X44A 4FABL 3S36H 3VFVB 4YBQC 3V4PL 2OTUA 3BDYL 3VCLA 2FATL 4QHUB 3IDXL 3OKKA 3ULUL 1MLCA 3LKPA 2Z8SA 5DGQA 1Q9KA 2F54E 3HR6A 3FFDA 5C0IA 1RZFH 4PJDF 4N9OB 3VFTA 4I4WB 4HT1H 4Z7WA 3GSNH 5E9DB 2PKDA 1G6RL 1BZ9A 1LEIA 1OW0A 2YD7A 4JLRB 1NGYA 5DD0L 5GGVH 4Y4KC 1KBGL 1T83A 3JTTB 2AV1B 4DKFH 3N0PB 5GIRA 4LDEB 1BFSA 1GHFL 4HIJB 2CDEA 5C9KA 4GG6E 1HILA 4JAMB 3TP4A 3VFOA 4UOW1 3MFGB 2V5RA 5FCUH 5A16A 1RIVL 4GAJL 5D7KE 4YAQA 9CGTA 3PWPE 1D5IH 3O4LE 4NSKA 4I3RL 4NQCA 4UBDC 4WO4A 2ORBH 3LQAL 3STLB 5BV7B 4X5XB 2H1PL 3UMTA 2W9EL 3LKRA 5GGVY 3D2UA 3VXSB 3UJJL 3MBED 2NY0D 4E5XB 4PRDA 3MJ7A 5B4MC 2JELH 1AD0B 4P5KB 2GITA 1ZLSH 4HX1A 1R5WA 1CR9H 5IROC 4UILH 5DWUL 5ESQA 4X6CA 1V8HA 2PXYA 3QFDB 5DJ6A 5T5NF 2IAND 3L1OH 4H88H 3BSZL 5CIPH 1D5ZA 1RMFH 3NCCB 4LLVA 5C0RL 3QUZA 1T7XA 4ZSOA 1KTRL 1UM5L 2GSGB 4XX1E 3QI9C 2VDQL 3C5ZD 3QFJA 4OZHA 5ID1A 2AJXL 2X4OB 2OK0H 3QP3A 5D7IA 3TIEA 4CN6A 1KJ3L 4OCRH 1JMZA 4A6YA 4KRLB 3R1GH 3NIGE 1WAAF 1A3QA 5EUOB 4WEBH 3G5ZA 4RFNB 4Y19D 3GJFK 1Y6NR 3CMOH 4GRWF 4TPRL 4Z7NE 8FABB 4MXQD 4LSRH 4XMLH 1IVLA 2DQCL 4IJ3C 3OAZK 5I8OL 4J3VA 4H25A 3UPCA 5CSZB 1QBMH 4WW1A 5B8CB 4GFTB 2Y4SA 3P11H 3TCLA 3JWOH 5I18H 1IGJB 3UJTH 4MXWH 1RK1A 1IGMH 5IB3B 5ICXA 1AGCB 1NGQH 3QUMH 2K3TA 4OB5H 3MBEC 2NY0C 2HRPH 4PJFA 4JFQA 4LSUL 4Y4KB 4J3SA 1JGEA 2CK0L 3HNVL 5FKPA 3W11C 1MFNA 1X9QA 4WDIB 1QSFA 1N8ZA 2DL2A 3UP1A 5CCKH 3KVQA 1E4WL 4TVPH 3X11B 4Y1AA 4YHZL 2F53B 3O3EA 4OD2B 2B7DT 3QDJA 4M5YH 4LLQA 4NWTL 1S8DA 4D9QD 4ODXB 4ODVL 1ED3B 2P7TB 5D1ZA 5FGBA 1E4KA 3U36B 1DQLH 3T0AA 2FO4B 3WEXA 3IDJA 1ZLUK 1S7RA 3O6LH 4CN1A 4W6XB 1B0RA 5D2NE 2I9TA 4OGXL 4IMKA 3S35L 3VRIA 1E4JA 2DQEL 2VH5L 2FX9L 1KUMA 3O11A 5CSGA 2HKFH 3WL9A 3SE8H 2VLLA 1CE1L 1KC5L 2OJZH 5JXAH 4JCLA 1S5HB 5DUBA 4BZYA 4XP5H 4M8QB 5C86A 4RGNB 4HQQL 3G6JF 4NQDA 3TYGL 3VGEA 1NBQA 4LLWA 2IALA 7FABL 3QI9B 4TNVF 4FQ2L 4IOFD 1KEML 4M7LH 4N8CH 1CK0H 3QCUH 2QQKH 4F7EB 4LRIA 4EDXB 4BKLB 4K3DH 5F9DC 2HFFB 2J88H 1KNOB 4EI6A 3QZWB 1CYGA 2WZPD 4J8RA 1NFIA 3BRFA 3K8KA 3K4DA 5L2KB 1A9BA 1RJLB 1NSNL 4POUB 5I17A 5C0FA 3TT3L 5CJBA 3MREA 2XN9A 3HA0A 5SWSE 1F42A 4XCCL 4QRPE 2WBKA 2VITB 4P2RB 4ZO9A 3D6GA 5EOTA 4N1EA 4YHIA 2A74B 1BVZA 5HYJD 3IU4H 1INDL 5ICYB 4H0GA 1P9MA 2DJUA 4JM2C 2H9GB 3E3QC 3MOAH 3C6SA 3U4AA 1I7ZB 1K5NA 1RURL 1AR1D 4OV5A 4L4VE 1T3FB 5CZVL 4J4PD 4HDIA 1VFAB 2XZAL 3FO2A 3CXHJ 5CEYA 3B6SB 2IQAB 3E8UL 4XP4L 2XRAH 1D9KB 2UWEB 2VN4A 4IOFC 4AG4H 2HG5B 4XH2A 2X4NA 1DJSA 4OSUH 2KZWA 2V5MA 2DJSA 1KCRH 1R3KB 4MQTB 4PY8J 5DMJB 1HI6B 1YNTA 2X10A 2WQRA 1XIWC 3MBXL 1KJVA 4ZNEA 2YD9A 4PJEE 1DZBA 4KVCL 4YX2H 3GI8H 2DLHA 1Z0MA 3TBWA 4G80B 2DJ4A 5C07B 5F88B 3GEWB 2EIZA 5LKNA 3BDBA 3O6MH 4NCC2 5CUSL 5IP4A 1WCBA 4JVUA 5GS1B 2VR4A 3OKEB 4N0FB 3PNWA 1PG7X 4C59B 3GDBA 1F6AA 4DZ8A 5EBGA 4JGMA 4MD4A 5GGRA 1TZIB 5DHVH 5EFIA 1OCWH 5FM4A 5D5ME 3TA3D 2R39A 2YRLA 3BP4B 3PV7A 1UEYA 3UTTD 1FYTB 3P9MA 4KKAC 1RIUH 3WSQL 3VFSA 2L4OA 4QCIA 2DBLH 2DIJA 4LBEA 1MSPA 5IMOA 3G6DL 1UQSA 2BSED 4FXLA 3VFNA 1AR1C 2A9ML 4OFPA 3HE6D 2YRPA 4YXHL 4RNRA 1ZEAH 3VGDA 5E5MB 3FO0H 1I9RH 4PLNC 4BFIA 4J4PC 3SDAA 2P8LB 4NZRL 1GAFH 5F9OH 3T77A 3EYQC 4XVTH 4PJ8C 4QRRB 3KR3H 4LLDB 1ZS8B 1I7TA 1IGCL 2QADC 1HHJB 5DZOA 3RPKA 1MOEA 4N5ED 3RWJA 5DK3A 2YBRB 3QBTB 3WYRA 1K3ZA 3CXHK 3LKOA 2AKRA 2YKLL 3MV8B 3D48R 3TM6A 3VI4F 5F7NC 1QFUH 5AWNL 4G8GE 5FDWB 4TQEH 4OD3H 2BXYA 4FZEL 4JZJA 4U1IA 3L3IA 4I2XE 2R56L 1M7DA 4HK0B 1LK2A 2FB4L 4JM2B 5J12C 1RVFH 4YHLH 5DTFB 3TA3C 5CWSA 2EDJA 2R0KL 3O3BB 5HDBE 3RA7H 5TQ2H 3M8OH 2VRAA 2CMRL 1JZ3A 5DRNB 5K9QG 4QRQB 3THMH 5I16A 3NACL 4RBPH 1HQRB 3RZCD 1FCGA 5I6XC 1A6UL 2BP3A 2O5XH 2Z35B 1DANU 1YJDL 4HLJA 3SJVB 1B4RA 1CFBA 3V0VA 2RBLA 2AI0H 5IUSA 5DYOB 4S2SB 1KT2B 2QBWA 5EZLA 2ZJSL 3VH8A 1IC7L 1JGLH 4I5BB 5DHXB 1XIWB 5JXEC 4L3EE 2IGFH 1UCBH 3PG2A 4PS4L 1CFQA 4XZUA 1JHLL 1NBZB 4G43A 3HC4L 2AJZB 2OTWB 1K2DA 2EDOA 4JM4L 3ZE1E 5C92A 1Q72H 4JO4L 4ODSH 5L9DH 2V2XB 2HT2D 4N5EC 3H7BB 2CIIA 1PQZA 5C9JB 5I1LA 2EYRB 1FVDA 3WFEH 3GIVA 4MB4A 2GCYA 3GFUA 3QUKB 5C0CD 4P9HC 4U0RC 5KTEL 5DK2B 4JVPA 1ITCA 5E2JA 5AG8A 3ARTA 4D9RD 2J4WL 5IF0B 3T2OA 3P4MB 3ARED 2XTLA 3CK0L 3NIFE 2P5WA 3CFCL 4PJ7B 3SGDI 2VLRB 1YQVH 5E00A 3QXVA 1FNHA 5EPMB 4FMFA 2KBGA 2BNRE 3Q1SL 5JDJA 5IBTL 3DX8B 4TTDC 4XVUD 3BKYL 3TJEH 1ZGLP 4FG6C 1R3HB 3VWKD 5L2JB 3RZCC 5J6GA 1Y6KR 1H3PH 1NCDH 1VACB 2IG2L 3QXAA 4PJ8B 5HYQA 1XF4A 4R96B 1MH5B 2QADB 5IESH 3VFUB 1QLRB 1LE5A 3BQUD 4F9LA 4HGWB 4PRAA 5BXFA 4GKSA 1IGIL 2MCPH 4UT7L 1ORQB 1U8PB 4RRPG 1XCTA 3H9HA 4FQ1H 4AL8H 5JO5B 4JQIL 5DMIH 2X4RA 1BLNB 3REWA 1F3JA 3TWCH 5F6HJ 5HGHB 1PG7W 2JK5A 4FQHB 3SKNA 4WFEE 2A0LD 5C09B 5INDA 1VKXA 2UZIL 1I8MB 1AGEB 1RUPH 2WV3A 1BGXH 5DFWH 2PYEE 4PJBB 3BX7C 1P6AB 1WBZB 2FBJL 4IEFB 4S10A 4YHKH 4DFIA 3V7AE 3A6OA 1A9EA 4XWGH 3P30L 3GMLB 3NCJH 4H26B 3TV3H 1R24A 1B4JH 1Z6JT 2LVCA 5LAXB 5HHVH 1BQHA 2G60H 4OI9A 4PJGB 4S1SL 5C8JB 2YUZA 3I75B 3WFDL 1H3UA 4LSVH 4V1DB 3T65A 5DRZA 3PJSB 2JE8A 4C58B 2EXWC 4PREB 3RGVB 2AJYL 3ULUF 3MLSH 5CEXA 1HYRC 1MCSA 1XR8B 2ZOLA 4JKLA 4PLOB 2FX7L 3LS4H 3HTLX 2BMKA 1J8HD 5AZEH 4K3JH 3MLZH 3D3VE 1ETZB 5JMRA 4EUPB 1BAFH 2C4FT 1RY7B 4Z7UE 2BVPA 4KK6C 4RGMC 4U0RB 2VDML 1GH7A 2AXFA 4M8VA 1K6QL 3S5LG 3VFMA 3VGGA 1QVOA 2A73A 6CGTA 3KYOB 2H6PA 3QA3B 4WY7H 3ILPB 4XXCC 2X4UA 4PRPE 1H3XA 4HJ0D 4IOIB 4LLMA 4KROB 4YDLC 5GHWH 5ADOH 5F1OB 1FFQA 5HYIA 1YMME 5E8EA 1RJZA 3HZVB 5D7LA 2Z92B 1EJ6A 4GQ9L 1CL7L 3OSKA 1BMGA 5D2LF 5FAAA 3SDDA 4KVNL 5D6DA 4EKXA 1QBBA 4IHOA 2B4CC 5DQDL 5HGAA 4OIAA 4IRSD 4XPGL 4AEHL 3V6ZB 3T0XA 1LP9A 3BKMH 1G9ML 3WE6B 3CLEL 3I6LE 1K8DA 1FNGB 2V9TA 4L4TD 1P7QB 4YIQA 3BWUC 2QL1A 3FOLA 2X4TA 3KPQB 5IR1A 4UZGA 5D9SA 1X5KA 3KDMA 1E4XL 1FZKA 1OAQL 5GXBB 2Z91A 2N56A 1VA9A 5IB1A 1VESA 4ZDHB 1FQ9C 2WUBL 4XGZA 2HJLA 1N3NA 4WU7A 2NY5C 1F8TH 2XIDA 3MUJA 4XBPA 5C0BD 4BZ1L 4G6JH 3VWJB 1OAZH 3ARYA 3OR6B 2H2PD 4NNXB 3V4UL 4LHUD 2X40A 4R97C 3RUGF 1WFUA 4BFGA 1DFBL 4PJXF 3RNQB 5DJ2A 3EO1B 4NO0D 5CJXC 2ERJC 1EH9A 2M2DA 3FB7A 1INQB 3UTSD 3ARQA 5L6YH 4P9ML 4QLRA 4E0RB 1OD9A 3ORJA 1DBAL 4CUCA 2Y36H 4D0CA 1FIEA 4UAOC 5EO0B 4XPAH 4OD1L 1OGAA 1AO7B 3FQRA 4IRSC 3IXAB 1IQWL 2X4SB 2A6DB 5HHME 3KPRB 1HHIB 1YEJL 1U2HA 4U49A 1VADB 1PVHA 1WZ1H 3DECA 2VDLL 4N0UB 1U8HA 4U6VH 4R2GB 3B43A 3RHWF 4YDVB 3RTQA 4AM0A 2ADIA 1RZJH 3SE3A 4CGTA 3IJYB 1AXIB 5F7HA 4HW6A 3O6FB 3QDGE 4UNTA 5B22A 1CLZH 4PJCA 2BNQA 4RISL 4YO0A 5DQ9A 3MV7D 4PFEA 2BHZA 3MRNB 3NPSC 1FLRH 3CXDH 3EIFA 3ZE0E 4H5SA 3N9GL 4JO1H 1R3JA 2JIXD 3INUH 5E08H 3ARSA 1MCOH 1T04A 1G9NL 2JJTC 2MJWA 4B7LA 4G6MH 4FQXC 3GO1H 1RUMH 2OX5A 4E9LA 2C7UB 2PTTB 4OFIA 1ZTXH 35C8H 4A2LA 1CF8L 3UC0L 4MDJB 5JUEL 5CBEA 1OARL 4NCDA 4DOHE 1U3ZA 3V52H 3IKKA 3LN9A 3VD5A 4E41A 3FQWB 3HFMH 5ANMA 2XKSA 3MNVA 2XWTA 3QNZB 1EEYA 2DDQL 1NDGB 2E8ZA 4GXVH 4UV4L 4UINH 1BF8A 5E1AB 1NGXB 1TVBB 4L9DA 5F70A 3F7RA 4EEEA 4Q0XL 3PQYB 5GSRA 4MVBD 3E6FA 3RRQA 3DURA 2NW2A 2F58L 3ECBA 4P46A 4PRIA 1OT2A 3CU7A 5C08A 4M6NH 5I1CL 2ERJB 5IB5B 5JNYB 1IFHH 3I50H 3ZKMC 1XZ0B 1NKRA 1T5WA 1FSKB 4JY6A 4H1LA 5EG6C 1NFKA 3MJ8B 5DD6B 3WNNA 1I7RA 1MCPL 5CZXC 3EO0A 4RCAA 3FCTB 3GRWL 3FMGH 4TTGA 4NQCD 4LKCA 4OCNC 4ZOEA 3N1MC 4QY8B 3NH7L 3OL2A 2H32H 4WO4D 3S37L 5B3JE 1B9ZA 3B9EA 1QFWL 4U3CA 4ZFGH 1NGWA 3MV9A 1CICB 3ZDZF 5D93C 5T3XL 4UU9A 3U4BL 1NUNB 2OL3A 4NKQB 3PDOB 4O58L 1A6VH 4OLVL 5DMKA 4R6UA 1KJ2H 2NX5D 5EH1A 4M5ZH 4HK3N 4OZ4A 3F7YA 4J3XA 1MCIA 1QEWA 2V2TB 3PWVB 1V3LA 4NKMB 1FP5A 4P3CL 1JUFA 4HD9A 4R4ND 4FNLL 3Q6GL 4OF8A 1OW0C 2HVKB 4QHLB 3NPSB 3QUZD 1DLFL 1MCWM 1T83C 3VDCA 1K85A 1SYVA 3LQAC 2BY3A 2E3VA 1ONQA 3QEQD 2OL3L 3OB8A 1EPFA 4ZO7A 1I3UA 5FK9B 4FQXB 5IM7B 3Q2CA 2EIEA 4LMQE 2XG5A 1ZLVH 5I15L 3IDGA 5TE4L 4PGDB 1JRHL 3O3AB 5ECJE 5ACZB 5C1MB 5D1QD 3VW3L 2H26A 2R4SL 1IGYB 2J6EA 1U8IB 5JW3L 5DT1H 3FRUA 1CXFA 5LXGH 1YPZF 4LK4A 1E27B 1MWAH 3VXOA 4APQB 4WO4C 3IJHB 1YEKH 4U1SB 4JPIA 4OGYH 2IBBA 2ILLA 1C16A 4JFFA 3U48A 2HFGH 1AJ7H 4JFPB 4O51A 2JB6B 3U0PA 1TCMA 1CFSA 3TJHC 1V7NL 2UV3A 4WTZG 2PXYC 1L0QA 3EYVB 5I76B 4F7PB 4Y1AD 5F71A 4JFEE 1F11A 4WNQB 3FN9A 3BKCL 3KPPA 5FGCE 4G7VL 2X70A 1XGUA 1BECA 4FXGA 3P0YH 4NP4H 3B9DA 4S11A 4XP9L 4BH7A 2Z4QB 1IC5H 2ZSWA 3GMRA 5D1ZD 3UX9B 1EEZB 1PBYA 3MLRL 5GRJL 1V7MH 3QXDA 1YQ2A 3B3IB 3QULA 1T20B 2BSSA 2WWMD 4RMWA 2HFEA 3U79A 2NPLX 1ZWIA 1L9MA 3OXSA 5DK0B 5KSBA 1SEBA 2XKUA 3C2SA 2EE9A 5BMFH 1XGYL 3FT3B 5HDQH 4YFLI 3IU3A 1BX2A 3BUYB 4LIQE 4XC1H 1FL3B 5H37G 1QD0A 2E7HA 3HG1D 3QPXL 5D93B 4DZBB 4D9LL 2OTUB 4KI5F 1FG9C 4X5LA 4HWEL 3LEYH 4Z9KB 2BDNL 5ILTH 5MERB 2DN7A 3RVWD 1TIUA 4K3EH 4NDMA 1BZ9B 4P2OB 2CRYA 3FO9B 2E9IA 4IRZL 5DR5H 4QF1A 3GBNL 1HSBB 3EYSH 2RR3A 4OV6F 1MCFA 3DV6A 1MCEA 5MENE 3WHE0 3VFPA 4PJIA 3QHFH 4MD0B 1N4XL 2CDEB 3EJZC 4JHWH 1BJ1H 2PETA 4HWBH 3VXTB 4NM8H 1T1YA 5D1ZC 5FGBC 4JRXE 4IS6A 4HZLB 5T5FL 5EBWB 5A16B 5TPWH 2QEJA 3O2VL 3STZB 4D0BA 1QUNA 2FRGP 4LRNL 4HS3A 4G3YL 3KNBA 1TNNA 2YD3A 3TO4B 2XN9D 1F13A 2PO6A 1ZKAA 4IMKC 4M1DH 4KAQH 1MCHA 3D2UB 2VXUH 4UB0H 1HIMH 4F8QA 4LKXA 3K46A 4KMLB 4P2CG 3LKSB 2YRZA 4RWYH 1R5WB 4MQ7A 4N90D 3JV0A 4PJAB 3K0WA 2D9QB 2WUCH 1RUKL 2JCCA 2PXYB 3T08A 4F33B 4OLWH 3MGTA 1NL0L 3WDIA 4X6FB 2DYPA 3B2VH 3G9VA 1L7TH 4KUCF 3RAJL 4LU5H 1D5ZB 4XNYH 5JW5B 3BD5A 2B5IC 1YEEL 1D5BA 5F96H 4LLVB 1JZ2A 5I2IA 2JJSA 4MMXC 1MHHA 3S3JA 4WUUE 5EZJA 5FYLL 5ID1B 3IDYB 1CVRA 5D7IB 3SCMD 3TIEB 3CU1A 3SE9H 4A6YB 2FR4B 3GB7B 3ZL4H 4LRIC 3VRLE 5D2NB 4XNUH 3MACL 1X3DA 2WBJB 1EEQA 4PV9A 2AAVA 5IQ9B 1C5DA 4EQ3A 4X9BA 3KYKL 3PWLA 2KPNA 1WZLA 4HHAB 1NANI 4KMTL 3RBGA 1S78D 2UY7A 1MCBA 4U1MB 1I3GH 2VE6B 1U8JA 5TFSH 2P45B 3OG6B 3KLHC 2AEPL 1R5IB 2Y7QA 4YR6B 2EH8L 4RA3A 3MNWA 1ADQA 2X9WA 3JV6A 4ZFZA 2UWEF 3PGCA 3MA9L 4YBHA 2VISB 3CX2A 2HH0H 2F54A 1QQDA 2MKWA 4PJFB 3ZTNL 5H37H 3RWHB 1P9MC 4JFQB 1JGEB 4L4JA 5FKPB 2V5TA 4PG2A 3OKDA 1R3IL 1UVQA 3CH1B 2CKBA 1AR2A 5MEQB 3HUJA 1NFDE 3SDYH 3DETC 5HGDB 4GKNB 2IBZX 4NOFA 1S8DB 2EIDA 3KJ4C 1JFQL 4AZ8A 5SV4A 1BQLH 4KI5D 3O3DA 5JOPE 1S7RB 3H3KA 4HPYH 4D0DA 4UQ2A 4Y5XA 5B21A 1B0RB 4PRNA 5B38B 4FQIL 3PWPA 4ZS6D 4ZPTA 3O4LA 4H0HB 5FUZL 2I9TB 4TVPE 1LO5A 4FTVA 1W72B 2CKBL 4NFCA 3X12A 1BM3H 3VXRA 1RSFA 2E7MA 3RGHA 4RDQG 4LCWD 5MHSE 2FIKB 3PL6A 1J0JA 1RU9L 5CS7A 3RPIA 5BV7H 2EYSB 4L4VB 4UT9H 4YNYB 3TN0B 1C12B 3LEVL 3IF1B 4KVCH 4DN3H 3PHQB 1DR9A 3MRCA 5DUML 4NQDB 1FORL 1J0KA 3OKYA 4QXWA 3BH8A 5IFJA 1OP3H 1DVFC 4LVNB 5C71A 3G04A 4A2MA 3C87A 4S1RL 1C7SA 3G5XA 4URTB 3U1SH 3EO9L 3F7VB 2HT3C 4HKXA 3MROA 4LEOA 4LOUD 3VD9A 1U8MA 2XWBA 3BP7B 4KI1A 3SY0B 3SDAC 1HHKA 1HCFX 4HKJA 4QHNB 2YZ8A 2QJDA 2NCMA 3BZEB 2ICEA 3HC3L 4RBPK 4M00A 4G9FE 3QPQD 5INCA 3LN5B 2ATPA 1G6VK 4WWKD 4DGIH 5K9JH 3UAJD 4M1CC 1GOHA 1XF2A 3L7FA 2ZPKH 4Q6IB 4ZS6C 2BJML 1ZHBA 5C0AE 3PP3H 2YS4A 4O2CB 2P24B 4YHIB 3KPSB 3TBYA 4JZJC 1BJMA 4M7JH 4YBLC 3S35X 3UTQA 4P23A 2CLZA 3TO2A 1MFDH 4R7DA 5B3NA 3EFFB 3QDMA 3RWIB 1K5NB 4XAWL 4P2QE 2DQHH 3FONB 5CLWA 5ICZA 4OV5B 1L9NA 4UV7L 2LABA 3IB4A 4XPHL 2V17H 3R4DA 4CMMA 1S3KL 4XTRD 4NRYA 5BOPA 3FO2B 1YECL 1ZK9A 3OG4B 1FAIH 3BE1L 3ES6B 4NKIH 1KIPB 3CLFL 4M93C 2YMXL 3UO1H 2VXSH 5JPMB 4LOUC 4YUEL 3MODH 3GUTA 3WIFA 5JDSA 5ITBL 3QJHA 1WC7A 4LAQH 4PJ7F 4UMGA 4HIHA 3TBWB 1BD2D 5IFHL 3I9GH 5LCVH 2EIZB 3O8XC 4I2XB 4JPWH 3G5VA 2X7LA 3Q5YA 2B20A 3UBXG 4XXDB 4EOWH 5MI0C 4NQEE 4HH9B 1W0WA 3UAJC 1H0DA 4OAWA 5EFIB 4XCYA 1MJ8H 2H8PA 4YPGA 12E8L 2X09A 1D6VL 2GAZA 5DF0A 4MCYA 3DRTB 3TIDB 4QCIB 4LBEB 1VGEL 4CL7A 5IMOB 1DVFB 5DXWA 4TNVK 3WXWL 3A67H 4NZUH 3SGJA 3QUYD 1BFVH 2NY7L 1KGCE 25C8L 2FSEA 3LMJH 1HHHA 4L3EB 3SDAB 4DGYH 4EDWL 4HS8H 3OKMB 4MMZC 1Q8MA 1CG9B 2ESVE 2LFGA 3R0NA 4GAYB 3CFEB 1I7TB 3TH2T 3HC0B 3WDHA 1MCRA 3DBXB 4I9WD 4F9LC 2HN7A 1JPTL 3A6BL 3SGKA 3UPRB 5J7CC 4TYUA 5BO1H 1P2CA 2VLJD 3RIFK 1ZHNB 1JNLH 2XA8L 4F8TA 1UGNA 4PJGF 4U1IB 2Z31A 3CIQA 5LGHL 1AQKL 5T1DH 1MCQA 5DD5L 1S9WB 1UXWA 4CDGC 4RFOL 5I1EH 4HXBL 1EHAA 4NHCL 1MI5E 4LCIL 2WM0A 2J7LA 4JN1L 5I75C 4KDVA 5L8KB 1BEYH 1LO2H 4OZFG 2EIBA 5E6IB 2DIBA 4M93B 1FJ1A 5KW9H 4XCFH 5J6HA 3ZKNC 1N64L 4HF5H 4YXLL 3BISA 3L3OB 1A7OH 5I0DA 4HXAL 1NBVH 2OSLB 1IAIH 4HUKB 3MRRA 2I27N 1TZHB 3CSPA 1J11A 2X9XA 3WN5A 4MNHA 4AT6B 1HXMB 3O8XB 4G42B 1NEZA 1IBGL 1JHTA 3QG7L 1MPAH 5MI0B 4NPYB 1G7MA 1PQZB 4KPHH 3UTZB 2EDNA 4WW2F 2QR0A 4CMHC 1FVDB 3KGRA 3C5SA 1BBDL 3GIVB 2GCYB 3HMXA 4QKXB 4FQCH 1OP9A 2AJYH 1JGVH 3V7MA 1YN7A 2FHBA 1ORSA 3ALPA 1MFCL 5CKGA 1YEDA 2P5WB 5CP3H 5F3BA 1G9MC 2A1WH 3MRFB 4S0TD 3C2AL 5E00B 4W70A 3AXLB 1TQBB 3CVIL 5HPOA 2PR4H 2XFXB 1INEL 1NMBH 1PX4A 1N7ML 3IFPA 3BGMA 4FFWD 1T03L 2VLRD 4KHTL 1GZQA 4HPOL 5HVHB 1Q1JH 3HAEB 3HMXL 3SDDC 3EOBB 5D6DC 4U2ZA 1Q0YL 3BPCA 4P0DA 1S7VA 1OGAD 2XTJD 4UUJA 4FFYL 1OP5H 4OF0A 3D3VB 2NTFA 2AXJA 4MJ5B 4JO2H 1LE5B 5BXFB 5IHUH 4GKSB 4KU1A 4Z7UB 4PGJA 5JQHC 1EVTC 3OQ3B 5D6CA 4L8DA 43C9A 1G0YR 1FDLH 4OZIF 3H9HB 3QIBA 4K7PH 4GMSH 4JZOA 3RTQD 1CLOH 2P48B 1F3JB 4G8GA 3DTXA 4UT6L 3ARBB 5L0QC 2JK5B 3GNML 5KVDL 4YPJA 4YZFF 2VAAA 4MCZB 4KDTC 5EU4A 5ISZB 3SKNB 4FQPA 1VKXB 4PRHE 2FBOJ 4FOMA 5EBLA 2BNQD 4DVBB 3RQ3A 3KJ6L 3GK8L 4NO2A 3EYUH 3G08B 4U6XB 4AQOA 5KZCD 4K8RL 4LSPL 1FNAA 1T22B 4IRJA 5BJTA 3TCXA 3KPMA 1MY7A 1R24B 3X3GH 1XT5A 2P8MA 1RFDL 3DI3B 4NHUA 4W6YB 3HR5B 3FQNB 3JV5A 1KENL 1A7PH 4KC3B 5M95B 4FN0A 4K7PY 1MUJB 4YC2B 4M6OL 4QGTA 5FM5M 3GSVB 5MEOA 3WJLA 3IFLH 1A6ZB 4F7MB 3I6GA 4P4RA 5CEXB 4E41D 2VC2H 3PWUA 4O02H 4TVSa 2XTJC 5DVLA 3V4UH 4NUGH 5DJXB 5E8PA 2BMKB 2DMKA 3AU1B 1I9IL 4BM7A 1WEJH 5KSBF 3MYZA 2BRRH 4KV5E 5J1AA 5GGTA 3MMEA 4LPXA 1CE6A 2FGWH 2UUDK 3JXAA 4XPBH 5A2KH 4HMEA 4I13B 1GGIL 1QVOB 3OKOB 1QSEB 2MCG1 2R2EB 4P46D 4PRID 3IFOB 3T2NL 3OTTA 5C08D 1FGVL 4LLMB 2RJMA 5T3XD 1F2XK 1DEEA 3QJFA 3T0EC 4MDIB 3N1GC 4DWHA 3VE0B 1GPOL 1AGBA 2IFFL 4Z0XA 3B9KA 3K3QA 3QCVL 3FAWA 1M6OA 5GGTL 5EU7E 5I74C 1T66D 5B39B 2BNRA 1KLUB 4NQSA 5GSVB 5DUPL 5HHMB 4GJTB 4IHOB 5JORB 4JPVL 5HGAB 3DYPA 3BD3A 3ZDYE 3ESVF 4RGOL 2C1OA 3UZVB 5KVEH 2GJ6E 2D2OA 1CGSL 4X4YB 5BRZE 1NBYA 4Y7MA 1S7SA 3T3MF 2ZUSA 3MV9D 1J18A 4YIQB 4Q9CA 5C0GA 3TGXA 4WUKH 1TJHL 4M7KL 4RMUA 3WDJA 5D9SB 2APFA 2GTWB 2ENYA 5J3HC 3RL2A 4P3DB 3KDMB 2ADJB 2ZUYA 5CGMA 1WF5A 4M43L 2ZZUT 4QOKE 5L0QB 5LBSL 2Z91B 3OZ9H 1IAKB 4S1QH 5IB1B 1A6WL 4LMQI 5D7SL 5GRXG 4D2NA 1ND0A 2CGRH 3VU2A 4MA8H 1IEAA 1N3NB 2Z8RA 3L3GA 3PP4L 1WIOA 4AK1A 3Q6FB 4MAYA 2Q3ZA 2C3VA 2PYEA 3CPLB 2M8XA 4ELME 3FO1B 1KTDB 4ESKA 3BIBX 4HGKC 4AYFA 1FE8H 4CVXB 1WQVT 1NGPL 3UYRH 1A5FH 3QCTL 5H35B 3O4OB 3QSKB 4PGBB 4ZUWA 1IKFH 4DOHB 1EEUA 4QRTA 2A6IA 4AENA 3S88L 2XI9A 5ETUA 4LFHG 5ACLA 3L5JA 4D0CB 1BIIB 3RNKA 1MJUL 1QKZL 3QO1B 5IB2B 3MRJA 5EWIH 2P5ED 1KPRB 2YD1A 2QQNL 1OLLA 4WHTB 4G9DA 1YNKL 5F7WC 4I48B 1ZLVK 4OLZH 3CC5A 3RDTB 2QSCH 3U9UA 1MIEH 3NFPA 4PUBL 3RY4A 2EO9A 2HVJB 5TE6L 3QQNA 1P84J 5IVXA 4NJAL 1M71A 2HAZA 1OQXA 5DVMA 1SM3H 1U8HB 5AYUH 3I3BA 1LK3L 1TVHA 2Q76A 4EN3A 1B90A 4HUMB 4XNQA 4OLUH 2IPUK 1JZ8A 2ADFL 1G7JB 3LRSB 1TCRB 4QTIL 2JLLA 2ZOKB 2ITCB 1ZMYA 3HS0B 1A7RL 5EUKA 3GKWL 1VEPA 2MKLC 3GSXB 5KS9A 5DQ9B 1MQKH 1JHKL 1KF9B 4ZUTA 3T0EB 2IWGA 4MWFA 1BJ1J 1JK8A 4H5SB 3KYNB 1J0IA 3G9AB 1RZ7H 4R9HA 4CVZB 5I74B 1MF2H 2DQJH 4U1JA 5E8DH 1UJTA 4X80L 1T04B 1J5OH 4ZFFA 1OTUD 4Q9RL 3BN9C 1KYOK 5HHXL 5I1JL 1CT8A 4XMPL 5T1KD 4JPKL 4HCRA 1YEHL 2Y25A 4MD5A 4BYHA 1RUAH 4HUVA 4LEXL 2QV2A 1GGTA 3HCVA 4G6FD 1KTLB 4GG6F 3L3JB 4KKCC 4M1GL 5JHDA 1KELL 5CHNB 3QQ4A 5DS8A 4PJ5E 5SX4H 2R1YA 2Q7NA 2HJKA 4XNXH 1H3VA 4PJ9B 4QHMB 4UIMB 1AY1L 4Z0BH 2YWZA 3QAZC 3HPJB 1IAIM 3KPTA 5GSRB 5GZND 4LL9A 5D72H 4JHAL 4O2EA 4G5ZH 4M7ZB 5EIVA 4DAGH 4OM0H 4YFEA 3KPOA 2HTKD 4M48H 1QSZA 3PQYD 4GAGH 2IMMA 5DO2D 4MAUH 3TPUA 3BH9A 4H1LB 4OJFH 3F8UB 4JO3H 2OCFD 2ZUXA 1QG3A 3HB3C 5D70L 4K9EC 2OTPA 4UTAH 2BHYA 5D7JA 5CEZH 5TF1H 1I1AA 4LPCA 1KFAH 1F4AA 2NY2B 1DSFH 2PO6D 2PTVA 5CJ8A 4CW1B 2OYPA 4BSJA 3MLYL 4LVOC 2D7TH 4NKOB 2APTA 3G5YA 5EZIL 5FYLD 3NIGF 4X6DE 1IT9L 4R3SA 4PB0H 1A4KA 5T1LA 3ZHLA 3OGCB 3MLXH 1LO3L 1S5IL 1ZHKA 3LH2L 3RHWK 3KG5A 1JN6B 3MUGB 1F4XL 5EU6E 5HHQB 1HYSC 4OCSH 4N0YL 2ZKHH 3ROLB 4C56A 1KEGH 3FT2B 4X7TA 4OZ4B 1QEWB 3GHEH 5CINH 5FGCB 1MJJA 3ZKQD 4RZCA 2DYPD 1JUFB 2FX8H 2GY5A 2CPCA 4N9GA 5A43C 5IW6B 2DM3A 3LEXB 4ONHA 3I02A 4S0SD 3VGFA 2AK4A 1SYVB 5EO9A 4ZUVA 1YYLL 2V9QA 4JG1L 2FJHA 5GGSA 5JZ7D 3MCKA 5BVPL 4XP6H 1MFAH 4B53A 1FBIL 3IXTA 4OCYH 3AGVA 2VWEE 5DO2C 5TDOA 4JANA 2DQGL 3IDGB 4CAGA 1KCSH 4PJAF 1GXEA 2ARJA 1I9JH 4DN4L 1J1XL 1ODAA 2WIMA 1QP1A 2FIRT 2FHFA 2LU7A 3DARA 2LU4A 2B4CH 1AGDB 2BVOA 4XBEL 4M02A 5A2IH 1YNLH 4LVEA 1A3LL 3GJEA 1DBKH 1BVKB 1PZUB 4PGCA 1A6AA 2PO6C 5DRXA 3S96A 4Y2OA 3EOAB 5C0ND 4OZGA 4X7FC 4Y5VA 5IFAL 5MP6L 2IMNA 4CU7A 2F54D 1MCCA 4JFFB 3O9WD 5L8JB 3IVKA 3O2VH 1UG9A 5I1HH 1N5AA 5E4EC 4TSCH 5MENB 4P48A 5BS0E 3O0RH 4JJ5B 1MCLA 4JDTL 5JPNA 5EOQH 1PW3A 3C08H 2R29L 3KPPB 3QEUA 4BSWA 1XGUB 3OKLA 1CU4H 1WWAX 4H0IA 4K94H 2ZSWB 1MHPL 4ODUB 1A1MB 2VXVL 2DWEB 2RCSH 2O93L 3QULB 2FO1A 5J8OA 4JFDA 1HOCB 5JW4R 2GY7B 2HFEB 1YYMH 1U0QA 4WFFE 3TBTA 5D7KD 1MJ7L 3PWPD 1MVUA 3O4LD 4YHYC 1BX2B 1WVZA 4GW5B 4LVOB 1NMCC 3MCLH 4S1DD 3NA4A 3QUXD 3VG0H 1SBSL 5ID0B 3GSOB 2D03L 4KJYB 3PL6D 2OI9C 5IQ7H 1BQUA 1F3DJ 5D8JL 2UYLB 3MGOB 1FNSH 1B0GB 2EZ0C 1N0LA 5C0NC 5FA4B 1YY8B 3ZZ1A 5KG9B 5CMAA 3FTGA 3QEHB 2C1PA 4ONGL 1EGJH 3OPZH 3T0BA 4WUUB 1XGQB 4YDKH 2DD8L 5IJKA 1JP5A 5FIEA 2X41A 3GGWB 4X4ZA 4X6EA 4WI9A 5EBMB 2Q20A 4PG2C 2VIRB 1UADC 3EYFB 3NTCL 3TPKA 4UDUA 5BVJB 3DX6B 3DV6B 3BAEL 4JRYE 3S3SA 5LWYL 3FN0H 2I25N 4WFHE 4P2OD 3VFPB 1LO0L 3S4SB 4NJ9H 1N0XH 5F97E 5CIPB 4HJJL 4G7YH 3RWDB 1OP3K 3GSQB 1LVEA 1NMAL 1QFPA 2E9JA 3BKJL 1I1YB 2VDKL 5FEBA 4YH6A 2XWJA 2R1WA 2PW2A 3GHBL 4LSDA 5IW1B 4FFZL 1H3TA 4LASL 1NUDA 5HHOE 3H42H 4LNRA 3OMZA 5JW4Q 2XXMB 3F12A 1KJMA 4KK8D 5IVZA 2QQLL 1CVSC 2BERA 2OQJA 5IBLD 3BRDA 1I8KA 1GYAA 4PJEF 3O45A 4H8WC 4U6HA 1A4JA 4MQ7B 3KLSA 5E4EB 3HZKB 5FO7A 4X83A 4ENED 1MIML 2QKIA 4WIQA 1DBJH 1TJGL 3PP3K 4HWZB 5AD0B 1HH6B 2BC4A 1G7LA 5DD1H 3B5GA 1RV6X 3BW9B 5GS0C 5I2IB 3QUMB 5DDHA 5E2WL 1MHHB 4PTUA 5D5MF 4Z5RA 4JFEA 5C70A 3IRPX 5EZJB 2YPLE 3GMNA 3IDNB 3VXPA 1DQTA 3MSPA 5C6PB 3A6CH 2HWZL 4MLSA 3QEGL 4YEEA 4U7SA 1UWXH 4JGUA 1DL7L 4EI5C 1I7UA 4GKOA 4FQQA 5GGQH 1X6LA 2FWOB 4QYOA 2FD6H 3H9SA 3AY4A 4YHYB 2FGZA 5FOBA 4P4KD 1IGTA 1XGTB 2C4XA 2JTDA 4OF3A 4JR9H 2BX5A 4HH8A 3K81A 4M03A 2WBJD 1QRNE 2BVEA 3RVUD 1D6EA 5KBNC 3TVMA 3NABH 4NWUH 4HUNB 3SDXA 5HVFB 4C4KT 2VZ3A 1ZSDA 5T1MA 4MX7A 3SKMA 2AJ3A 2Y6SD 3PGCB 4KK8C 1UACL 4GG8A 3QNXA 1PZ5A 2DQDL 4ODTH 4P23C 2XACC 1WSST 2YPKA 1CI5A 5EU3A 1N6QL 4DKEL 1EXUA 3MXWL 4ENEC 2H3NA 3WKML 4LIQL 3OR7B 2D0HA 1UB6A 1SJHA 3C6LC 4G9FB 3OJDA 1OAKH 3STBA 4X9FA 2NY6D 3IJSA 1NAKL 5HDBF 1MEXH 3WS6A 1E6JL 3SN6N 4HKZB 5KAQG 1UM6H 1T5XB 1IL1B 1IEBB 3OX8A 2G75A 4HAFA 4D0DB 4GUPB 4JRXA 4XPHH 1PYWA 3TFKD 1T0MB 2NTSP 3ARFC 4JG0H 2NXYD 3EW3B 5C0AB 2MQ0A 3RWCB 1AE6H 1I9EA 5E9DE 4ZPTB 4WV1A 5FHBL 3VMOA 4C54A 1LO5B 4FTVB 4YDIL 3X12B 4PBXA 2ZUQC 4LARL 3GSRA 3VXRB 2GJZA 3ZLQC 5SWSD 3S36L 4MNQA 1T7VA 4QRPD 2Z31D 2OR8A 3RVUC 5I1DA 5IJVA 2R2HB 1X7QA 3LVEA 1RZFL 5SWZA 1U95A 2GSIA 4U7KA 4HT1L 3ZE1F 1CCZA 2Y6SC 3GSNL 4J1UB 5KVFH 1XCQA 3GMOB 2DQFA 1K4DA 3BH8B 4L4VD 5GGVL 3AB0C 1EFXA 4DKFL 1SYSA 5DJAA 3VXMB 1T0NB 3C8DA 3N85H 3MA7A 3R0MA 4XVJH 3MROB 4LEOB 1I4FA 3DNKA 1HHKB 4EI5B 3VXSE 5FCUL 4X99A 4UIKH 5J0BA 3L95B 4YGVB 2CJUH 4A6YH 2ATKB 32C2A 3FRPG 3LQMA 2BXZA 3V8OA 5DMGD 5IEKB 2XY2A 3MCG1 2OMNA 2NXYC 2ORBL 3MRBA 1VFBA 1XF2B 3SGKC 3O41B 1A8JH 2BVQA 1FVEB 1Y18B 2F15A 3LPGA 2W59A 1F6LL 4N5UA 5E6YA 1IILE 1QFHA 2K9UA 2JELL 4P23B 2R2BA 4FXKB 1ZLSL 3TO2B 4LDOB 1CR9L 4UILL 3DMMB 5C2UB 3SEPA 5DEZA 5E99H 1KB5A 3QWQB 2F8VA 2AEQH 4HUXA 5EUOE 3DVFA 5DHVB 3L1OL 4H88L 4NNYA 4NRYB 4Q9BA 1RMFL 5AUMB 5F6IB 3C6LB 4N1HB 3WNLA 1NFDA 4OI7A 4QT5A 2OK0L 4JN2B 4OCRL 3R1GL 5IVNA 4WEBL 3MZGB 3ARFB 3GUTB 4G8IA 4K8RD 1C7TA 3QJHB 1SEQH 5K9KB 1WC7B 1TPXC 2AK1H 3CMOL 3EDJA 3MRIB 1LD9A 4LSRL 3WN5C 1EFQA 1T7ZA 4XMLL 2UVEA 2L7UA 2MOVA 2YC1B 4RFEA 4M6MH 4MHHG 1OP5K 3HE7B 4G8GD 1QBML 3SKOA 2DWDA 3P11L 1T21A 1W72H 1QHOA 3JWOL 5I18L 2F53E 3UJTL 4MXWL 2BCKA 3RI5K 4ZTOH 3SGEI 4UOJA 1JWSB 1NGQL 3QUML 5FHAH 3KWWA 4MCYB 1Q94A 4OB5L 4L8SA 3F7QA 2HRPL 3RY5A 3AB0B 2AQ1A 5DEGA 3M1BB 3QIUA 4Z7UF 4XMKH 4Z95H 4X0KA 5AEAA 5CCKL 5IMLA 4TVPL 5J11C 4ZAKB 3JTSB 1OF2A 4M5YL 3BZ4B 5SX5H 4L3CA 4IMLA 1OAUH 5IEHA 3GM8A 2DL9A 5FGSA 4KRPC 2LTQC 2VLKE 1P4BH 5E94B 2VSCA 1AIFA 4U05A 5C0JA 3D39B 2ITDB 2BSRB 3O6LL 4D8PB 5I9QB 1N7MH 3PXJA