3QEUA

The crystal structure of tcr dmf5
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
201
structure length
195
Chain Sequence
KEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVNFGGGKLIFGQGTELSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWACANAFNNSIIPEDTFFPSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TCRs Used in Cancer Gene Therapy Cross-React with MART-1/Melan-A Tumor Antigens via Distinct Mechanisms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords DMF5 alpha chain
total genus 37
structure length 195
sequence length 201
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qeuA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qeuA02
1DLFH 5FO8A 5HGAA 4YPGA 1CF8H 1OCWH 4XAWH 5IV2A 5JA8B 3QIUB 3GSNH 2J8UA 5F6HJ 1YYLH 1SJEA 5J1AB 2EC8A 4M7KL 5CP7B 4F2MB 2ZUXA 4HJ0D 1JHKL 4YHLH 2P42B 4KRPC 3NCYP 4GS7C 4L8BA 4DKEH 4TVSa 1PAMA 2UWEB 1ZA3A 3RZWA 2BNRD 3CIQA 4D0CB 1LDSA 4G80B 3TV3L 1INQA 4P5KB 4G7YH 2VXUH 5DFVC 1TJGH 3VH8A 3FRUB 3MLTA 4NWTH 2GQHA 3NFNA 5CZVH 5HD8D 3SGEH 4PJBF 3UTOA 1PVHA 5CMAB 1N2RB 4ZUVA 5J3HC 1F11A 4GKNB 2OXHA 2ICWI 2WANA 4TYUA 4LEXL 4ENED 3UMTA 3L3IA 3TYGL 3B2VL 1WTGT 4GRWE 4JRXB 1FO0L 2EH8L 1I1AC 4JLRA 5KW9L 5DD1L 3V95A 2DF3A 1J0HA 5IVXB 4ZPTA 1OP9A 1O7VA 1CDGA 1H3WM 1MHHB 1MF2L 1MJJB 2F9BT 4Z7QE 3ESUF 1BEYL 1YNTA 3FTGB 3TIDA 2C1PA 5SV4A 3O4LD 1YEEH 2LV4A 2YD7A 4NM8H 1I7RB 1WISA 1B0RB 1ZHBB 4YHPA 1NC4D 1XF5B 2DQHH 5IK3A 4WHTB 3RI5K 1H3UA 5EO9A 5FCUH 4GG6B 3DVIA 1A64A 5ID0B 4POZC 2CDFB 3BRGC 1JHLL 4Z0XA 2D9CA 5TDPB 3WEXA 2Z0BA 4X6DF 2IH1A 5D1QB 1A6ZA 4GMTL 5DF0A 3PWJA 5IVXA 1BECA 2VXQH 5KANI 4MAYA 3AS3A 4M7ZB 3O3EA 3BKYH 3HI5H 2FIKB 1XF3B 2XA3A 4JN1L 3U46B 1JK8A 5F71A 5ITFB 1A9EA 5MEPB 1Q72H 4XCFH 3MRQB 3EZJB 5DJDB 1LD9B 4X6CE 1FE8L 3VXUB 2EXYC 1HKLH 4Y4KD 3V8CA 1MCPH 3LQAH 1WAAE 2R56L 2JELH 3FO2B 3H9YA 3MMEA 2R1WB 2NY6C 4XMPH 1CD0A 1FZKB 3NFSL 5MENE 4JM2D 4KUCF 3WBDA 3MRMA 1EHXA 1LK3L 3Q3GA 3G04A 5I76B 1JYXA 3WIIH 4M5ZL 2EE6A 2DQDL 4OV6F 3P0VL 2AK4B 5AZEL 3HNSH 4EI5C 1HINH 4D9RE 5KTEL 1EEZA 3V5DB 2VB5A 1UJTA 2F8VA 4JVPA 4P5MB 1CGXA 1JGEA 1FFPB 4HUVA 1YN6A 5FYJU 3Q5YA 4XWOC 1XGUB 3BPLB 1UQSB 1ZLUH 2ZUYA 1J10A 3BVNB 3EYOB 4L3EA 1MAKA 5T5NG 1AY1H 5D2NB 5DUPL 3NZHL 4X9FA 5DUBB 3UJTL 3LV3A 3P77A 3KLHD 1SEBA 1UCBL 4ZO7A 5L88H 4LKCA 3IYLW 4RWYH 4HUKB 3QPQD 5C0BA 1ZK9A 3MRMB 1UC6A 1BQUA 4L9DA 3RWCB 1NGPH 1AD9B 4NQSB 2AJUH 2VZVA 4QOKD 3HC4L 1JGUH 3S36H 5T1DH 3SGDH 1AD0B 1ZVSA 2BNQB 4HKZB 1JGLL 3QFJE 3PP4H 2EZ0C 5J6HA 1KIQB 3ULVL 4M9OA 3VWKD 3MLYH 3MLWL 4QRQB 5C0AD 4HWBH 3F7YA 4XC1L 3VDCA 4WFHE 2GTZA 4JFEA 4TQEL 3RX8A 2VYRE 2FEDC 2OP4L 3VWJD 3K2MC 4JRYA 3K80A 3FT3B 5FUOL 2ED8A 3RAJH 4PG9A 4IMLB 5F1SA 1A6ZB 2PKDA 4XI5C 5EA0L 2I60L 3QJFA 1VENA 3O45A 4D0DA 4K23H 1RURL 2H3NA 1IGCL 4PJHE 4H88H 2ESVE 3NCYS 1NAKH 4M43L 1KEGH 4KFZC 5ALCH 4Y4HB 4AH2B 4JFHE 1CQYA 4R0LC 1WT5A 1JF1A 4HF5H 4UUJA 2R0LH 4PJAB 4G8EB 2C3GA 4U1MA 3QDJA 5FYKL 4R4BA 1UH2A 2YBRA 1Q1JL 1B0WA 4OI8A 2VDPL 1LEGB 1BF8A 1LMKA 3ARFB 1BVKB 3QG6B 5FHBH 4HK0B 1XCQA 1VKXA 1T1YA 1H3PL 3WHXB 4WCYH 1P6FA 3TCLB 4C4KO 4HS8L 3FQRB 4KKLD 4M1DL 3V5HB 4LPTA 1T6WA 4S1RH 3MNWA 3MRJA 4TNVK 5FV1L 1ZA6A 5GRXG 1KLGA 2IC2A 2QHLA 3D0LA 3BAEL 3EOBB 4JGUA 3CSYB 3ARED 2ADFL 5GS2D 3S88H 3VXPB 1N3NA 4KI1A 5HGHA 3RL2A 4BJLA 2SEBB 5E2UH 1F90H 2WLZA 3VFOA 4EN3A 2XWBA 4FQHB 4OCRL 4NT6A 2Y5TA 1OB1A 1A7RH 2DYPB 3BPCB 2P5WD 2OYPA 3HUJF 3L3GB 4HQQL 1ETZB 5DVMA 5EA0H 1FORL 3HLAA 2OL3A 4JFED 3O6LL 2DKMA 3UAJC 4PPTA 1MCRA 4LPYA 1A9BB 1WSST 3NPSC 2UUDH 4DUWA 1P84K 1T89C 2CXKA 4URTB 2R2BA 5LBSL 3RWJB 5J11C 5IM7A 3BVNA 4X83A 4ELMA 2CMRL 4Z7UA 2M26A 3O4OB 4HJJL 5FO8B 2NY7H 1BREA 5TQ2H 5DVOA 1FN4A 5HDQL 4KKCD 3RY5A 3GHEL 4LF3A 4NKOB 4XPTH 2F58L 1QRKA 5E6YA 1EBAA 4PJFB 3MJ6A 3VE0A 3MV8E 3RJDA 4HS3B 3TZVB 4TUJA 2P48B 4KZEH 1LE9B 1KTDB 1RVFL 1Q9KA 4FQIH 1LO4H 4OLUH 5CILH 2IMNA 4JO3L 3CU7A 1D5BB 4NM4H 1MJ8L 3H9SE 1NBZB 4Y0GA 1YMMD 3RGVD 1CXLA 3KPLB 1BFOB 4HIIB 4KKLC 2FEDD 3VWJC 5ILTH 4LPVA 1MFNA 4NPYA 4UNTA 1T20B 2DI9A 3WNOA 1HYSD 2JJVA 3PNWB 4P9HC 2EDYA 1X5JA 3QUKA 3HAEA 1LNUB 5KTEH 5F7FA 1WBXA 5LBSH 3PWJB 1X5KA 3P4MB 4KVCL 1OAKL 1HH9B 4X7TA 1ZGLA 4H0HB 5TDOA 2YPLA 4ZSOE 1ETZA 1T21A 3H3PL 4KV5F 1A7NH 3K81A 4NC2B 4YXHL 1VFMA 4JB9H 2JB6A 1J18A 4DN4H 2LFGA 1FE8H 1UWXK 4UDUB 1BQHG 3MLXH 2YUWA 3F58H 1Q0YL 2OI9C 3QXAA 3O3BA 3U7YH 5BQ7A 4MCYB 4PV8B 1II4E 2ZZUT 3OXRA 4P5TC 4YIQA 3JWNC 4Y4KA 2WZPD 5ICXB 3RFZC 2IANE 1BBDL 5A2FA 1BHGA 3VI3E 1MREL 3LKNB 4U7MA 3VD4A 1RJYA 1QSZA 3EOTH 3PGFH 3BKCH 3QUYA 3CCHB 2NQCA 1KB5L 3IAGC 5CMAA 3GGWA 4H25B 1QSEE 1NANH 2HJLA 2J6EH 2F15A 2ZCKL 1YMME 3KYOB 3MTRA 4NM4L 5DTFB 3MJ7B 4X4ME 4Y4HA 4FQLH 1AQKL 2O5XL 1IQWL 4MDIA 1ED3B 1UVQA 3WFBH 2MHAA 1LDPL 4ZAKC 1I8MA 5M95B 4JKMA 1GGBH 3IDJB 4BQ9A 4L1DA 3P4MA 4GG8A 5HI4D 4LARH 2XQYG 1XIWC 5ADPL 1PYWA 2F58H 2I60H 4XPTL 5D93B 1BMGA 5AYUL 3SY0A 3DETD 1QSFD 3MJ9A 4AL8H 1MNUL 2YD6A 3KHQA 5CSZA 4BFIB 1ZE3C 3ARBB 3S37X 1XIWD 4U3XA 5ENWB 2Z9TA 2X1PA 1I3RB 4YGAB 1NPUA 4ODSH 5D5ME 4XPAL 4F3FB 1KBGH 2MJWA 4IHOB 5IQ9B 1P1ZB 4LHUB 4BSWA 1AI1H 5BRZE 3OKMB 4ZUUA 1JWUB 1FL6B 1R3LA 1MCQA 1R3LB 4LSTL 5F72S 3RUGF 2ZCHL 3BGFB 4L5FH 4LSRL 2AV7B 4O02L 3T08A 1FGVH 2XNAA 3ZDYE 1QLEL 2DBLH 2ZWLT 3CFCL 1AO7E 1C7SA 5HYSB 1NGQH 5IHUH 2X4TA 5ENWA 2XKUA 3ZKND 3UTTD 3CAFA 4NQEA 5EPMA 1D3CA 5LXGL 1RZ8B 3UJTH 4WGWB 1ZHKB 4ONHB 3RX7A 2ATKB 3QUMH 1XGUA 1EVUA 2FIRT 2QQKH 4NQDB 4B0MM 1A7PH 2EEAA 4JE4B 3BEWB 4PJEF 3TVMC 1MLCA 2NLJA 1OVZA 2DQCL 1WFTA 1I8MB 4KDTC 4LAJH 2D7MA 2P24A 3MCLH 1KB5B 4MNQD 3JTSA 4OGZA 3G04B 3Q3GB 1KPUB 2Y6SD 4XP5L 1XZ0A 5L2KB 4FQ2H 5I8EB 3QA3A 3GSXA 3MV7B 1OF2B 1Q1JH 3HZMA 5D5MA 5E2WH 2FX8H 2OR7A 1PEWA 3F7PC 4H25A 2LVCA 4AG4L 1IC7H 4KTYA 3MRQA 3QUYB 1A3RL 1XT5A 1YPZA 2C5DC 1J8HA 4RRPA 3RJQB 1MCSA 1U8MA 1IGCH 4PUBL 5B8CB 2CJUH 4G42B 4MWFA 2AQ1A 4PREA 5JW4M 3TM6A 5BRZD 1CI5A 4A6YH 3ARFA 4RGND 4Z0XB 2WBJA 2YA1A 4GMTH 5D6CB 3PHOB 4M3KB 3THML 4GKZB 5A1AA 5IB3B 4E5XA 5BZWB 2V5TA 1FSKC 2D2OA 4KHXL 4AH2A 4PJXF 5DMGD 3WUZA 5KVFL 2YRLA 5K9QG 3ULSA 3OHXB 3UBXG 15C8H 1K8IA 1RMFH 4O9HL 5DHVB 5D7LB 4FQIL 3WYRA 2ORBL 4WO4B 2H45A 3QCUL 3GJFB 4PLOB 3OKOB 4XCCH 5DD1H 3GSRB 5BV7C 3U83A 3JSSA 4YQXL 5FGCB 5JIPA 1A3LH 1QVOA 4U1SA 1BQLL 4XWOD 3ZKXB 4KK9D 3E2HB 1HHIB 3KJ4B 3V0AC 1FFOB 4K3EL 4Y4FA 4NQXB 4U6VL 2R1XB 3ZT7A 3OB0H 3WV0A 2ZUWA 1HCVA 1UCTA 1YEKL 3HC0B 3UZQA 5C6WH 3HNSL 4U6TA 5HTSA 3K74B 2HA1A 3MA7A 1NDMB 3LB6C 4H5SA 3VMOA 4JM2F 4KUCD 1LK3H 2Q20A 1ZT1A 3VFWA 5CEXB 4UT9L 3O3DB 3P77B 4G6FD 4YEFA 5IMKB 2Y36H 2XY2A 2Z91B 3DVGA 4LGRB 2F5BL 4NN5B 4GAJH 5TFSL 1AQDA 1TPXC 5EULV 5JHDD 4YLQT 3MLRL 4GAYA 4Z7WA 2VZOA 1HILB 4CVZB 1Q72L 4XCFL 1ZS8B 4XPFL 1JUFB 4LVOC 1JPTL 4CJ0A 4GBXA 1TLKA 3BQUD 3MFFA 3P0YL 1WLHA 4TNWK 3ZTJG 5ISZB 3O2WL 4NQCD 3SKUD 1PSKL 4HC1L 4ETQB 3T3PE 5HY9B 2IBGA 3MA7B 4HUXB 3ZSTA 3LHPL 2H32H 5EOTB 3T1FA 4EN3B 1NCBH 1OGAD 4PJ5D 5D96C 4F9PA 5D2LB 2A6IB 5DZOA 1W2KT 2GJ6E 3V6OC 3BPLC 1LD9A 3CCHA 5IROC 3F7VB 1E4XI 5IOPB 4DVBA 2OSLB 3FFCA 3X14B 2VLJA 1FYHB 1HEZB 4X7EC 4PB9L 5C0RL 2VXVH 3IFPA 1NAKL 4IS6A 3UBXI 3KLDA 4TRPH 1MCEA 4Y4KB 4Z7VF 4GT7A 4HIXL 3FB7A 3TN0B 2GEEA 4RGMB 1UB5A 2J12B 4NRZB 1T5WA 1ZHLB 1FZJB 2Q1EA 4HX1A 4LHUD 1H3VA 1W72H 4BSJA 1WTLA 4QRRB 1G9NL 1SJHA 2OP4H 4XBPB 2AXGA 3NH7H 4PR5B 3IU4L 1FRGH 3C87A 3VXSB 2PXYA 4N0RA 4XVUD 3MRIB 3QG7L 4RX4D 5CEZH 4J4PA 4QRRA 4H8WH 1QACA 3V4VH 2DAVA 1I1CA 1KELL 4NUGH 4FP8L 4MZ3A 3SPVA 5JHDE 1I7ZA 2YZ1A 5EIIB 4LSSH 4WJ5B 1DQDH 3V5KA 3CVHA 5GS0C 1J0KA 3MREB 3QFJD 1OARH 4JQVA 5FM5M 2H8PB 1B9ZA 3OKDB 5L9DH 1KACB 1HI6A 2OXGA 4RMVA 1FNEA 3RU8H 1J7VR 3OR6A 3SDDA 4YDIL 3X13A 4U05A 4GRLD 3HPJB 1X5XA 3N85L 2AP2A 1BM3H 3RKDC 4NKMB 2VAAB 4O9HH 1V5JA 4ZUTA 4YC2C 3U9UA 4NO0A 1HQRA 1I3UA 1MLBB 1RJZA 3KPQB 3V2AR 3LEYH 4NOFA 2P24B 4N0UA 3I84A 3SDDD 1ACYH 1MIEH 3BEWA 4U33A 4NZTH 4KU1A 4FZEH 5TF0A 2A9ML 2VE6B 1LO5A 5EIVA 3DMMB 2BVPB 1NFIA 1QSEB 1RIHL 1ZLSH 2VQUA 3IU4H 2HLAA 4QXGL 5HPOA 2B7DT 3RTQA 1BLNA 3QFJB 5HHOB 1MFDL 5F6IC 1M05B 1BGXL 1JGEB 4OIIH 4DGIH 4ZD3L 4OQTL 1SM3H 1UH4A 4Z9KB 3VFMB 2R2HA 1E28B 3TNMA 5IFAL 1L4IA 3QQ3B 3QXVA 1AR1D 1JRHH 4N0UB 1IL1A 3VXOA 2VXVL 1EGJL 1A3RH 4HS6B 2DYPA 4OLYL 3WJJA 1XH3B 3GB7B 1HYRC 4Y1AE 1FVEA 2R9HD 3MBXH 4OFIA 3EGSA 1IM9D 2VXTL 1H8SA 3OPZH 1KCVH 2ITCA 5A16A 4LCUB 2NY5C 3VXPA 1L7TH 3FO9A 2OTPA 3X13B 4DZ8A 2DQHL 4M5YH 3UO1L 2P5ED 1QVOB 4XPGL 2GI7A 2A6DA 4NHUB 3O3EB 4X5WB 4OGXH 2DIJA 2O26U 3MRKA 1UZ8B 5F9JB 1RUKH 1NCTA 4DGYH 5D7LA 1N8ZB 2EYTA 4JM2A 1G7HB 1BVKA 1AKJD 5LXGH 4CUCA 3MRHA 4XH2B 3WFDL 4FA8A 1W8OA 4K8RD 4OFKA 4ESKA 5D7IA 5K33A 4MSWB 3UPRB 4LP4A 4ORZC 3A67L 3ME0A 3P11L 3PHOA 2XACC 5I1DB 2BVYA 4Y1AA 4MQ7B 4CNIA 1DQTA 4I3SL 3D39B 1HHKA 4OF6A 4ZTPL 3QEQD 4OFYD 1CFSA 4OJFH 2E3VA 1P7QA 1Z0MA 4H8WL 2C4FT 1BF2A 5D1QD 4ODSL 3QJHA 3H9SD 3B83A 3H3BC 3ZDYF 5ANME 1OGTA 4GQPH 2XN9B 4J3XA 4HZLA 3PWPD 5ICXA 2VLJB 4GQ9H 4KPHH 5C09D 1FIGH 1G9NH 3QCTL 2JJSC 5AUMA 3SDYH 2GTWA 5KVDL 4U6VH 1I85C 4Y1AD 4P46C 1BPVA 1MRDL 4KQ3H 4PRIE 5D2LA 3KXFE 3QUXA 2W65A 4LCYA 4R4FL 4A6YB 3FQTA 5BW7A 5SV3A 3HZMB 1OY3B 3VGAB 2UZYB 3TO4A 2VR9A 4IMKA 4S1SH 5TQ0H 4CVWA 5I75C 3VD3A 1PX4A 3BE1H 3B9KD 5IBUB 3LKSB 1X7QB 4KI5D 5T3ZH 5MI0B 5IJKA 3TT3H 2P44B 1UWEH 3DOSA 1F3DH 2DIBA 2ZCKH 3MCG1 2JCCF 3B9KC 2ZJSH 8FABA 5D2NA 1GGYA 2ZCLH 4AEHL 5IV2B 1U95B 4NSKB 1NL0L 4M7LL 5E2VL 5D1XA 1QBLH 2BVOA 3OPZL 3LIZH 4M6OL 4NDMB 4ZNEA 4PJIA 4R7DA 3WL9A 1KTLB 2CDEA 2BSED 2AXHA 4AEEA 2AJXH 4U1IA 5K9KB 5GGRB 1IM9A 1JRHI 3EZ8A 1YNLH 1FPTL 3P4NA 4N0FA 3HS0A 4LSUL 3DHMA 3HS0B 1ZHNB 2A6KB 4ZPVB 1WITA 3CFJA 2ZOLB 3DARA 3G6JF 1R3KA 3O41B 5CIPB 1EJOH 4IHOA 4XPHL 5IQ9A 5TPWH 2D03L 4CW1A 3CH1B 4XRCA 1FFOA 1DUZA 3G9AB 4PJ8B 3VFTA 3PWPE 4WI2A 5T1LD 4FQ2L 2DKSA 3ARGD 8CGTA 5I66B 4QY8B 4ZXBC 5H8DA 3SY0B 4LBEA 5IIEB 1EBPA 2IAMC 3O0RH 5MEQA 1G6VK 1NGYB 1P7HL 5L2KE 4P3DA 1S78C 3FL7A 1HOCA 5ID0A 2BOBA 3ZMRA 2ADJA 1G7PB 4UINL 5DDHB 1A7QL 4GS7B 5C9KA 2IAMD 3C60D 1PX3A 1YY8B 2W07A 4FQHA 1XF4B 2VDKH 4RAUA 4UILH 3OX8A 5J13C 2H32B 2V9TA 1S9VB 1UEYA 2WBJB 4G9DB 2FJFB 1FGVL 3HRPA 3QNXA 3HUJA 3KLAA 4YR6B 1AJ7H 4LCWE 5F3BA 4MX7A 3TVMA 4JKKA 4OLZH 1N5AA 2CXGA 1QOKA 3P4LA 3WDJA 1WAAA 1OQXA 3OKKA 5B8CA 3ZTJH 1KGCE 5GS0H 2CO6B 4RGNB 2WWKO 3PWLA 2DQTH 5L2JB 1XGTB 3N1PC 1A6PA 3VMPA 1WCBB 4Y2DC 1QBAA 3QXAB 3RQ3A 3OX8B 4XMKL 5E7BA 4JFOB 4NO3A 3ZYIA 4APQC 4U1KB 1MNUH 2VDRL 3HRZA 5CGMA 4U6XB 5JMRA 3QCVH 2CJUL 4Y2DD 3H6JA 1KLUA 3OBAA 2HTKC 4TRPL 5FM5O 5DD6A 2AEPH 2DQFA 1A1OB 3I2CH 5I73B 1N8ZA 3T0EC 4LSVL 5MEQB 5ICZB 4AG4H 4FG6D 4XAKD 3JV4B 4UIMA 2WBJC 1TDQA 5SWQA 3S88L 2GTZB 5TE4L 3BXNA 1YMHA 1QRNB 2ZNWA 4WW1A 1I3GL 2HFGH 4ERSL 4Z78A 2V2XA 3MCKA 5JW5A 1NDGB 2GFBA 4RMUA 1VGEH 4CAGA 3SGKA 3O9WA 3LEXB 2NY2B 4MJID 2BNQA 4HKZA 4WCYL 3JV6B 2NX5B 3S35X 4RAVA 2BMKA 4IRZL 1KTDA 2VZ3A 1ZEAH 1P4BL 3TWCH 1CD1A 1NBVH 1MAML 1GZQA 4XCNA 4TPRL 4JHWH 4PS4H 1KJVA 4PYHA 4Y2DB 3LV3B 2BRRL 3E6HA 3EYVA 4K3HA 3VFUB 4ZXBD 3EYFA 4Z18A 1RURH 4HT1H 2XXMB 3RTQB 2IF7A 1IAIH 5JTWA 4Z7OE 3IF1B 4XNQB 4P2YA 5JORB 2CKNA 3RAJL 1EO5A 3ALPA 3S4SG 4GKOA 4ZFOA 4DAGH 3KPSB 1IEBA 2DLTA 4XC1H 1UJ3C 1QFWI 4WTZA 2NY6D 5CKGA 3UDWC 5CCKL 1DBKH 5DD3H 3LKSA 1HQRB 3R0NA 1IGMH 1MI5E 1RZIB 4X6CA 5D2LF 1U8PB 1KEML 5ILTL 1TZGL 3MMEB 5FYLD 3C2SA 4I1NB 3BP4B 5IMMA 2GJZB 1IT9H 3MRDB 1E4XH 3HZKB 1ZXQA 3BOVA 3UYRH 1AQKH 1MRCH 2O5XH 3GDBA 3HPLB 3KHOA 4M1GL 3OF6D 5BOZG 4AT6A 5T3XL 4CVXA 2FIKA 3LKNA 2YN5A 3NZHH 5DJYA 3V6OE 5D7IE 3U36B 4U1HA 2P5EB 2JCCE 1DBJL 4N0CD 3NGBB 2A83B 1RK0A 1I7ZB 1N0XL 1U6AH 3S34H 4NNPL 3AMKA 3FT2A 5HHOE 5I30L 3G6JE 5FV2A 2LU4A 1IGML 3HZYA 4LRIA 3K4ZA 3TBVB 3IS1X 1AO7A 3ZE0E 4DTGL 5FK9B 3RWHB 2AABL 3NN8B 4Y2OA 1RZKH 1JNHB 4MAYC 4D0BB 4U1GB 1AE6H 4KXZH 2EDFA 2CLZB 4IDLA 4LK4A 3IDIA 1T5WB 1ZHLA 1TQBC 3NTCH 5TGBA 1NFDF 2EYTB 3LS4L 3MRNB 1N6VA 4JLRB 3NIDE 4YDLC 2EDDA 3CPLB 2CK0L 3MLUL 4MXWH 4OCXL 3ILPA 2NR6C 2NZ9D 1NGZA 3UJJH 3RY4A 4MVBD 4BZ2L 1IGIH 5JOFA 1JI2A 5KAQF 3SDXA 3BUYA 2AJXL 5CZKA 2ITCB 2VITA 2QSCH 4XP5H 4FFVC 2V2WA 3GMQA 3ZSSA 4JO4L 4OLVH 3E6FA 4HWZB 4ZAKD 3WMSA 1LE9A 5HHVL 3G6JA 1GGUA 1FCGA 2FATH 2JB5H 1MCIA 3BH9A 2EDOA 5GS1A 25C8L 5FHBL 3CDGA 3L95A 3QUML 5CJBA 5D7JA 5TE4H 1RFDL 1XGRA 4LF3B 4NKOA 3JBG7 2VLMD 3BYYA 3EFDH 3AAZA 2QJDA 1QD0A 2OS7A 4KVNH 2P8LA 2BX5A 4ODHH 4QRUA 5ACZB 5ACZA 3BE1L 1T4KA 4BZ1H 5EN2A 5FF6A 2W60A 2FL5B 3DVFA 1JFQH 4UIKL 2IADA 3BT2L 1AGCA 5SWSD 1TZGH 1I8LA 5ICYB 5D7KE 1Q9OA 1MRFL 5EC1A 2NY0B 4LASH 4QTIH 3OAUH 2CMRH 4PRIB 1PLGL 2B0SH 4PRAA 3F5WA 2WIIA 4E9LA 4QXWA 3O2VL 2ADGA 3DV6B 5KVGL 3FO2A 3P73B 3RPKA 5JZ7C 4KXZI 1VFBA 1ZLVK 2IGFH 1F2XK 5CHNA 4MNHB 5GGTL 5CBEB 2D7QA 3BP5A 4HIHA 4WU5A 3ZDZE 3GM0A 4P59H 3MRJB 4RMWA 4Z77B 3AMLA 3O6MH 4IRSA 4C58B 3VXRB 1KENH 3WFBL 1IM3A 5E2UL 2RFXA 4JHWL 4YAQA 4JZNA 4HULB 4NGHH 5TDPA 3L3DB 4RWHA 4NQVA 4DEPB 4F80A 3VXQB 2E9IA 1INDH 4ELME 1DLFL 5JOEA 1EH9A 3I50L 3C8KB 3D1MC 5CINL 4PJAA 1G7QB 2X1OA 3A6CL 4JDVA 4X98A 3D2UD 3V0WL 2DL9A 4PTTA 2CD0A 3IDXL 3QUYD 3WO4C 4HHAA 4QOKE 4HDIB 2VC2H 3TN0A 1HWHB 4HH9B 2NR6D 3ZTNH 1KCUL 1TTUA 2OR8A 5K59F 1C5BH 5IT2H 4QRPB 5D7KD 4XMPL 3I2CL 1JMXA 5B3NA 3TO4D 3HPLA 1JYWA 3WLBA 1B4RA 5F1NB 4LLDA 5EOCJ 4MS8C 4YFLI 1F4YL 2NY4B 4YHIA 2RJMA 5I71C 5GSRB 5GZOD 4PRNA 4UTAL 3WIHA 5C09A 1HZHH 1MUJB 4K7PL 1V3KA 5DFVD 5DJ8A 3G6AB 5TF1L 1UH3A 4JKLA 2IPTL 4X4MA 1F3DJ 2YPKB 5GGSY 1FFQA 3EHBC 4WV1C 3TNNB 1D6VL 3PWUA 1EV2E 4JM4L 4KJPC 5KSAD 4OUOA 3T1WA 1NL0H 1IQDB 1MCKA 3JV5A 4GXUM 4RMTA 3FFDA 4HWUA 4OCWH 4NCDA 5FCUL 4OBSA 1NKOA 1Z5LB 2W0KA 3GRWH 3UAJD 1D5MB 5E8OB 4QNPE 3NIGE 3HAEH 1UQSA 1FVDB 3RWIB 2FH6A 4LSDA 4OSUL 5T3ZL 3ROLA 4DVRH 3UZVB 1UCBH 5L88L 1A6AA 1OTUD 1T0PB 4FABH 4WTXA 1WFOA 3AREC 3C08H 3TC9A 1CT8A 4MA1C 1GXEA 4XXDB 4FMFA 4TTDC 2R0ZL 3MSPA 4ZNCD 3FB8B 4OZHE 1M7DB 2ZPKH 4PJ9D 1UB6B 4OD1L 5DJ0B 4I4WB 1EEYB 1YEGH 1DL7H 3MROB 1Z9MA 4HJJH 2DIAA 3NAAH 1DJSA 3IRZA 1NJ9B 5JXED 5GPRA 1DANT 5JPMA 3QDAA 2P5WE 1A9EB 2Z31A 1YMHB 2X4SA 3OB0K 1EERB 1NBYA 5E4IA 3H42H 3K4DA 1INEL 5F7EL 4PJEB 1PFCA 3EO1A 1CFBA 2AJYL 5T5NF 2XZCL 3IGAB 3A67H 1M71A 4AM0B 4HFWA 1ND0B 3T4AA 3QZWB 2AKRA 3NCMA 5IK3B 2X4UB 1KCSH 2NY1D 4IOFC 3MJ8A 4H1LA 4IIQA 4QTHA 1HNFA 4XP9H 3UP1A 4P2RB 3H9SB 2J6EA 5DWUL 4JO1H 1UWGH 4LCWB 3KS0H 2H2PC 4KQ4H 5E2TH 2FJHA 1FIEA 5DZLA 2O93L 3VW3H 1I1AA 2C3XA 3WN5B 4GRWB 4JRXE 2AEWA 1KJ3L 3W0WB 3D6GA 1FNHA 1U8IB 2GCYA 4XXCA 1P7KA 1OAYH 2OJEB 4WRLA 1IFHH 3SKMB 4M03A 1TZIB 4QYOB 1MCOH 3TIEB 2VABA 4ODTL 1J8HB 1F3RB 1L0XA 5E2TL 5BJTB 5KANG 1SBBA 3GJFK 2C9AA 1VSCA 2VLKE 5CJOH 3T2QA 4E42A 3MFGB 3GMLB 4XX1G 4JQXC 5IVXF 4FQPA 3WKMH 5T1KB 3WNPA 4P0DA 4QT5B 3B9AA 3SKOA 1DN2A 4UDUA 3KPSE 4L4VB 5C6PB 5C9JA 1FZOB 5CGYC 4KROB 4K23L 1AFVH 5EC2A 1OT2A 2BVTA 3ARDB 1DEEA 3OGCB 4BSVB 3SBWA 5I8KH 1BJ8A 4KK5D 2OCFD 2P5EE 4ODWA 3QCTH 4PJAF 4PJ7B 4WFHD 1ZGLB 1C8PA 3T3PF 3HTLX 2JJWA 1I9JL 1IKNC 2VWEC 2Q6WA 3MXWL 3TVMD 1SY6L 3OKEB 4ODUB 3SDAB 1S9WB 4QCIA 2WINB 4U0RC 3TV3H 3S8WA 4PBVC 5TDNA 2ENSA 5HSFA 4NPYB 4OM1L 1HSBB 1FQ9C 5DT1H 4B50A 4Z7WF 1FG2A 2FYYA 3ZHLA 5C70A 1JGUL 1JHKH 3H7LA 4OB5L 4Z76B 3RVUC 3O41A 2AQ3A 2VL5B 4U2ZA 3DYPA 1RUQL 2Q7NA 5E8PA 1H15A 4RFOH 1OAUH 3FFCE 2VQTA 3DX9A 3TJEH 5JXEC 1FAIH 4Y4HC 3D9AL 1S7QB 3DO7A 5K59E 3M8OL 3MNVA 4WFED 3CVHH 2X05A 5IGXL 1IM9B 4U1IB 1H3XA 5EZLA 3RDTC 1CFVH 4ZSOB 4K94H 3U4EA 4R7DB 1H5BB 4OB5H 1NCCL 1GAFL 2A74B 4NJAL 1JZ2A 5HGBA 5C8JA 5DEZA 1G0DA 3UTZA 5B39A 1WIUA 4J1UB 3MRPA 1D5IH 1DSFH 1J11A 1GJIA 3IVKB 2EIZA 4RZCB 1VERA 3INUL 4JPWL 1YDPA 3FMGH 3VCLB 1B4JL 3KPSD 3OKLB 4JM4H 3QG7H 3RY6C 4MD5A 2W9EL 5DRZB 4WI5A 2D03H 4MGXA 1R3JB 5I6XC 4YXLL 4JFYB 4P2OC 3PXHA 2BC4B 1EGJA 4JGJA 1B6DA 4P9ML 5FYJH 1NCDH 1I4FA 3R06B 4EBQL 5HHXL 5JOPD 2FJGB 4R9HA 4XC3L 5INDB 4PRHA 2J1KA 3L7FB 4K7FA 3W39A 3QDGA 3L3KA 2BSTA 1CIDA 1RZJL 12E8L 4GRWH 3WKML 1LWRA 3ROLB 1N0LA 3VD7A 1CK0H 3I75A 1ZA6B 4EVNA 3SEPA 3ARQA 1VADB 3HKFA 1LP9A 4K3DH 5DI8A 5KSAA 5D9SA 1B4JH 3DUUA 1R0AH 4I77H 2YD3A 2YRPA 3PL6B 2VQ1A 3KPTA 1NC4B 2XTLA 3H8NA 2E7BA 2K7PA 4JG0L 3OTTA 1OAYL 5SWZD 3CFBA 4MD0B 1VGKB 5CJ8A 4YUEL 1FNLA 2NW2B 3BZFB 2FHBA 3SCMD 1OW0C 4PY8I 4OF5A 1NCCH 4NJAH 3QUMB 4Y4FD 4APQB 4ODXA 3B4NA 2D31A 1Z9LA 3MV01 3L3JB 3QQ9D 1CCZA 2DDQH 3A6OA 1XGPA 1TJHH 2MCG1 5CBAA 3U6RB 4POUB 6FABH 4WU7A 1DDHA 2NXYC 5JHDA 1AC0A 4NNYB 1W8NA 5C0GB 4OQ1A 1F4XH 4L4TB 5AD0A 3CMOH 3K8MA 4PG9B 1WBXB 5IB4B 4UT6L 3SDYL 5F7NC 3MO1A 1MHEA 4Q0XL 4G5ZH 4R6UA 3NGBC 3OJDB 4MMZC 4XP6H 2GJ6A 2X4NB 3LN5B 4G6AD 3BO8B 4UNVA 1WIPA 4LLVA 1RSFA 3BGAA 3V4UH 5KVGH 4UT7H 4Q2ZA 5F9AC 1KN2L 5D71H 5FDYA 2HKHH 4JAMB 1AGBB 1I9JH 4G6AC 3NIFF 4DKEL 4XP6L 1KG0A 4R0LA 1BFVL 2MOVA 1DBAL 1E4JA 2B5IC 4Y5VC 5E5UB 1WUNT 5C0BB 3RTQD 4WHDA 1BWWA 4JCMA 1HHHA 2OZ4A 4YQXH 1U9KA 5KZCB 3G08B 4PJDA 4R7NA 6FABL 5JNYB 5L8JB 5GISH 3PWVB 2IALB 2XPGA 1OP5K 5ERWA 4NWUL 1KGCD 2HT2D 1K3IA 3RWDA 4YHNA 2VUYA 5SWZE 4Z8FH 3WNNA 4YHMH 3QWRA 4XHJC 2CKBL 1RIUL 4JFFB 2AK1H 2EYRA 3QNZB 2IJ0C 5LCVH 1WCQA 3T09A 1CDIA 1SHMA 2JIXD 4H0IA 4GMSL 3RZCC 4UOW0 5I1KH 4YDJA 3F62A 3MOBH 1R0AL 2A9NH 3ES6B 4EUPB 4PIRF 5BZDB 2D3VA 5BS0A 1W0WA 4K9EC 1W0WB 5LQBH 2YK1H 4QHMB 1EMTH 2EDKA 2WBWB 3AU1A 4F37F 5DGRA 1BZ9B 2VIRA 5KVEL 3L5IA 1S7UA 3DXAB 4I0CC 3VXUA 4WI8A 4HIEA 1D6EB 2LQRA 4I8DA 3ILQC 2O5YH 3VGDA 3K1KC 4OCXH 5EZIL 4PUBH 1F4YH 4QHLA 4IBLT 4OIIL 1I8LC 2PYEB 4HGWA 4BUHA 1VEMA 1EZVX 4DCQB 1BBJA 1JNNH 3QDJD 1CWVA 3WUWB 4GW5A 4PJDE 3D3VB 4ONGH 2YA2A 4ORGA 1T1YB 1VKXB 5E6ID 1UEMA 4P57B 4KTDL 2B4CH 4YO0B 4YFEA 5CD5D 5F44A 1GZPA 1NEUA 3DX6A 2R4RL 3BH9B 3D87B 1UA6H 1AGDA 3LKRA 2L0DA 2YHGA 5IBLD 3GKWH 5J6GA 5JO5A 2NXZD 1U8LA 4I3RH 1RULH 4R2GC 1I1FA 3EFFB 3MOQA 1T1WA 3VGHA 3IFPB 4IS6B 4FABL 2F54E 5CILL 1OAUL 4KKNA 4DVRL 3T2NH 1EO8L 1IAOA 1CXFA 1H0DA 2ZSVA 4P59L 4MNQE 5L8KB 3HFMH 3FONA 2ZCHH 4L5FL 4APQD 4S1QL 5F9WB 1KEMH 3FB6B 2VN4A 3HAEG 4X80H 3NFNB 2D9QB 1J05B 4G6FB 4IEFB 3PABA 3EDEA 1RAMA 2GIYA 1KPVA 3D85B 1X4YA 4YXKL 4L3AA 1CDJA 4WGVB 3GSVB 1J1XH 1BAFL 1H8NA 1I7UB 4MJ5B 4ODXB 3KYKL 1SY6H 2AJ3A 1TVDA 1L9MA 3DV4B 3IFNL 4UQ2A 3TBSA 2V5MA 3MYJA 4LLMA 2VRAA 4WW2F 2A77L 1PD6A 3ZL4H 2J88H 4OZFA 4OKDA 4U1HB 3PE9A 2EE2A 4F15C 1YEIH 1QYGL 2E6JA 4X6CF 5I1LA 5I73C 5C0FA 1AQDB 2LVEA 2A73B 2GAZA 1YN6B 4TSAL 1GC1L 4Z95L 2RHEA 4N9GB 3FQUB 2I5YL 5HHQB 4IOSD 3DRTA 2D7TL 5IVOA 3O3DA 5L7XH 5LG1A 3S97C 5KN5B 1CLYH 4N1HB 1S5IL 4YWGL 3JXAA 4OFYA 1K4DB 4OKVB 4WUUB 4YBQD 1VGEL 4QWWD 4PJHF 4U7KA 2HFGL 3IDMA 4GFTB 2HRLA 3E8UH 4ZS6D 5DD0H 5C3LD 2PO6A 5FA4B 1YNKL 3JZ7A 5I71B 3BIKB 4LLQB 2PW2A 2W0LA 5F96H 4FQQB 3QUZB 5DJ2A 4XP1H 2ED7A 1UENA 3QPXL 5CAYB 4PBXA 4HF5L 1IC4H 2K3TA 3C60B 1BIIB 2Q8BL 1OWWA 1A4JA 1TXKA 1C16B 4PGZA 4JFDB 4OAWB 4ZS7L 2ADIB 3OHXA 1NUFA 1YEIL 4LSRH 3MA9L 4QHKJ 3IKCB 1HHJA 3QCVL 1RJLA 2WBJD 4RDQG 3MLPA 4PB0H 4KK6C 2VDRH 4WHTA 1A7NL 2B1HL 4FXGA 1QLFA 1X4XA 4U3HA 1DQJA 1A3QA 1MQKH 4W4OC 2F74A 3QEHA 1EDQA 5C71A 2DQTL 5EFIA 1CU4L 5BVJA 1Z9SA 3MUY1 4DJMA 4KUZL 4JANA 4X6BA 1AGFB 4OCMC 4PLJC 3F12B 3RX5A 2VDMH 5EBWB 4QTIL 1CICC 5AYUH 1XMWA 4M1CC 2WV3A 4M61A 1MCDA 2P49B 1WC7A 1R5WB 3BT2H 1A3LL 3FO0L 3QH3A 3S7GA 3MODL 2H26A 1E6JH 1CGYA 5IB4A 3C08L 3MLZL 4ZOEA 4HKXB 3DLQR 2YD2A 2IG2H 5C0GA 2BNRE 2WQRA 1CG9A 5CWSA 1OGAE 2YXFA 1DQQB 4KMTH 1RFDH 3FO0H 4JRWA 3QHFL 1Q0XH 1QFUH 3MGAA 5L2KA 1CDBA 5FO9B 2EDWA 3DBXB 3S4SB 2P43B 5LGJA 3CSBA 2AJZB 5KJRH 3F7RA 3TF7C 3LH2H 1FSKB 5D1ZB 4LLUA 2OJZL 3C6LB 1CTOA 4ZAKA 4DAGL 4OZHB 4OD2B 4BH7A 4PJ7F 4QYOA 2J8UB 3AM8A 4XBEL 1JHTA 4GRMA 4HKBA 5FOBA 3BPNB 2ATPB 2OJEA 2ICWB 1RUMH 5AEAA 4NO0D 3QSKB 2DB8A 4B5EA 2CLVA 1V7ML 1AGFA 2X4TB 1OSZA 1VPOL 4ODBD 3AGVA 4XI5D 5DRWA 4L8SA 1T04A 1CICA 3LS4H 2I9LB 4NQED 3HUJE 5INDA 3U82B 4XP1L 1YY8A 3U7WH 2V7HA 5KG9A 3WIFB 2VLKD 2IANA 2CDGA 3BIAX 1OL0A 1HH6B 4S1DD 1HHJB 5TH2A 2E6PA 1NMAL 5IW6A 3MUGB 2OJZH 3RNKB 2X4OA 4YPJA 4AM0A 4MD5B 4OAWA 4F57H 4G9FA 3DGGA 1YDPB 4NNPH 3KPNB 3CX2A 3UBXA 5CS7A 5KOMC 3WJLC 1G7MA 3BIKA 3FQXB 4J3OC 4ZFGL 4JREC 4P4RA 4ZSOA 2YR3A 5FYLH 5J11B 3RI5F 1LK2B 5T3ZE 3UX9B 2HG5A 4LSVH 3LKQB 1F97A 3CUPA 1KENL 2MHAB 2NY2D 3BPOC 2GYSA 1K4DA 4OKVA 4FTVE 5DTFA 3TH4T 2BVQB 3AROA 3QIWA 4D9RD 3IU3A 3ZKSD 3FB8A 4KJWC 3KDMB 2XXCB 1P9MC 4JRYD 4NHCL 4HEME 1CT8B 1F3JB 1LO0H 5MENB 4J7RA 4CN6A 4GW4A 4MXVF 3RDTA 3B9DA 1DBKL 4N9GA 1HSBA 3N1MC 3H9HA 5C0FB 4RIRA 4RNRA 4UT7L 3UTSB 1PLGH 2B0SL 2E27L 2BHUA 4QCIB 4DFHA 2APVA 3QI9A 4P99A 1G6RA 5JUEL 1JF6A 2Z35B 5FYKD 1EXUA 3QO1A 4LLMB 5IQ7L 1IVLA 3CSGA 4NZUL 4JJ5A 4W70A 4UT6H 4Z7VB 2NY4D 1BQHB 3WO3B 4O2FA 5DURB 3STLA 3I6KB 4P2OA 3CMOL 3TA3C 1IC4L 3T2NL 1GCFA 3BQUA 1LEIA 2DOCA 3H0TA 3WFDH 4WFGD 3KYNA 3PABB 1M7IA 2DJ4A 1TJHL 2K9UA 3IXTA 3PHSA 3D3VE 4E42B 1HDMB 2XTJE 3X11A 2UZIL 3WNKA 1VEOA 1B3JA 5FDWB 3IDGA 4MA7L 4U6YA 5E9DB 4YC2B 1EAJA 1TQBB 1D9KB 3IETB 2CR3A 1KB5H 2HFTA 2BNQE 35C8L 1ZGLP 4PTUA 1RPQA 4MB5A 1KUMA 2FO4B 1QEWA 1CYGA 3L6FA 4RGMC 1CGSL 3QJHB 1PW3A 1QBML 2R4RH 2I26N 3IB4A 4I18A 3P30H 2APFA 1U93A 2HVJA 1IGIL 3B8YA 4C56B 5MENA 1F3JA 2NW3B 5GGQL 4ETYA 4JRYE 3R1GL 4F9LC 12E8H 1MFAL 5GGSB 2BHYA 2IQ9L 4V2BA 1T22A 3KWWA 3W9EB 3LS5L 4J3UA 4M43H 4PJHA 1AGDB 3LKRB 2OZ4L 4HUWB 1MIMH 5EO0A 1HSAB 4WNQA 4MQXD 3O9WD 3T77B 4L8CA 2ADIA 1KJ2A 2AGJL 4CRPA 1IM3B 5D72H 2ESVA 4KKCC 5FM4A 4GRLB 2EDJA 3L9RA 4FQ1L 4FNLL 3VWKB 5GGRY 4LKXB 4HV8B 4HCRA 4LVEA 3UBXB 2V7NB 1IEAB 1NCAH 3IJHA 4N8VB 1AXTH 1UACH 4EN3D 4AEHH 5C92A 5GSVB 3BJ91 3TJHC 4MJ4A 3EKCA 3RVUD 3QPQC 3VXTB 3TBTB 5T1KD 3DRQB 5IESH 1BD2A 5HHPA 4JZJB 2CKBH 2Y5TB 4JDTH 3DXAE 4JFEE 1MRCL 2IG2L 4L8DB 4OBRA 4UILL 4AYFA 4S10A 2YA0A 2W9LA 1BVLB 4KROC 4CU8A 4GXVH 4MD4A 4KZDH 1S9YA 3WJLA 3P9MB 4ELKB 5ITBH 2R8SL 4G7VL 2FX7L 5K9OB 2ZUTA 2EYRB 4Q58C 3EYUL 4DK6A 1T6VN 2Z93B 1JP5A 2P47B 1A1MA 1QR1A 4YHNB 2WIMA 5E5RB 2ICCA 4OM1H 5D71L 3HE7A 3BP6A 4EI6B 3ARXA 4OZGA 4OLXH 3CXDL 3T77A 4N5UA 1IAII 2O61B 4G43A 4LCIL 3P9WB 1SJXA 2UYLB 4G5ZL 4YBLC 1O0VA 2YUVA 4P46B 1I7TA 4G6MH 3CZFA 1CFQB 4ZS7H 1I8IA 5I9QB 3VMNA 4HK3N 1N59B 2EYSB 1KC5L 4XVJL 3ZE2F 1KXVC 3ZDXE 5HGDB 3UTQB 4LLDB 1CF8L 1U41A 4WEBL 3LDBB 2DLFH 4G8IA 1AP2A 4P5TB 3UEZA 2QQLH 3WFCL 5L2KD 3FN3A 4OGXL 3EO9L 1OSPL 4UU9A 1GGIH 4OCLC 3VGEA 3QDME 5HI3C 5JLZB 3RIFF 5F6IB 2HTLD 4D2NA 1S5IH 2DWDB 4UDTB 1DDHB 5BO1H 4X6DB 3LHPH 4X0KA 4YHOL 5SWZB 4HAFA 2FWOA 1RIUH 4JDVB 4X98B 5FKAB 1XGQB 2D31B 4M7ZC 3STLB 3KPMA 5E00B 5DWUH 4CU6A 1JNJA 4EOWL 2Y07L 4WV1B 4J4PD 1TCRB 1JRHL 1VACB 3X3GL 4XGZB 2BNRB 3WUWA 4X5XA 3MRBA 5J57B 4O58H 2OTUB 3HMXH 4LCCA 1VADA 2XZCH 1WICA 2AK4D 3MGTB 4P9HH 3WNLA 1JPGB 5DJCB 1HYSC 3V5DA 5DFTA 2KUTA 5DRXB 1TVBA 4NRYA 2QSVA 2EDLA 2E9JA 5D1XD 5D7JC 5C0CA 5DS8B 1IE5A 1KN4H 1U8PA 5EUOE 2CO7B 5HYJB 4X7CC 3S3JA 3EJYC 2Q76B 5MI0C 4NKQB 3ZKNC 3P11H 2AEQL 1NGPL 2YUXA 3W5MA 3JWDL 3SCMB 5H35B 4MDJB 3RGVB 2B5IB 3H2WA 2R4SL 3GI9L 3SKNB 4NN7C 2WUCL 1ZTXH 2HJKB 4JQXA 1G0XA 5HBBA 2VLRA 2VDNH 3WDHA 3JWOH 4RFOL 4NNXA 1T7VA 4G3YL 2EKSA 3U4EB 4IDJH 4KK9C 1U2CA 1QZ1A 4U0QB 5KVFH 1VFOA 4L8CB 4JHAH 2BCKB 3T65A 4QF1B 4EZMA 2AJ3B 1Q94B 3DUHA 4P3CH 5J12B 5IB5B 3ARGC 1QQDB 2GK0B 4M5ZH 5C0IA 2NY6B 3WIHH 2MNUA 4LFHD 1A2YA 3LDBC 1X5YA 2NW3A 5T1LB 4P9HL 4X6DA 5GS3A 4PGBA 1NAMB 3BGFC 4IOIB 2G5BB 5I1HL 5DC0A 2AJVH 4GG6F 4UTAH 2BXZA 4ZPTB 1HNGA 3QUYC 1ZVYA 1IBGH 3D2UA 3VXMB 3BXNB 1MIML 5GJTL 1YN7A 1AFVL 4XC3H 4ZQKA 2BSSA 1OAQH 3MRCB 3IFLH 4G6JL 2AV1A 2IH3B 3PGDA 3STZA 1G7LB 1P2CA 1UXSA 2IQ9H 4PTUB 3ECBB 4UQ3B 4YDVA 3A0OA 5I1AB 3KVQA 5F97E 2XQBH 4M8QA 5F3HA 4GKNA 3E2HC 5ETUB 1TZHA 3DURB 5D7LD 2YSSA 3PHQA 1N59A 1W0VB 1JNHA 2A9NL 4NZTL 1J1OH 1U8JA 5FECB 5BOPA 3B3IB 1J0IA 4P46A 5GRVK 3IDXH 5IBLC 3VJ6A 1QLRA 3L1OL 1PBYA 3GSNB 2G2RA 1GAFH 1GGIL 4J6RL 4V1DD 1CFVL 2V17H 4X9GA 4K3JH 4B41A 1INDL 1SYSB 1X3DA 4R26H 3LY6A 4EI5B 1E6OH 3PJSA 4ZFFA 2EH8H 5HPMA 5CD3A 1ZTXL 5B8CC 1U8IA 4BQBA 3I6GA 3HMWL 3QAZC 1VA9A 3S37H 3FN9A 3K0WA 5E6IA 3W39B 4R4ND 5KSBA 4CMMB 4U1LA 2H2SC 4H1LB 1M4KA 2Q76A 4PGEB 2DWEB 4PJGB 5DDHA 3QDHA 3QZWA 1JNLL 1JMZA 3DRQA 1KIRA 2CIIB 3ZYZA 4ACPA 5HVHB 3T04D 4Z5RB 4AL8L 5I0ZA 2X6MA 1OP5H 4RZCA 2X5PA 3IJSA 3WFEH 3U48A 5JQ6L 4UIKH 5D7LE 1CGVA 3CFDA 1E6OL 3SGJA 4F7PB 2DD8H 2X1WL 2PO6B 1S7VB 1KJ2H 2MKLC 5JW4Q 2XFXA 2ZSWB 3AXLA 2Y6SC 3QO0B 1FNGB 3IXAA 5FYLL 4J2XA 1LE5B 2IANB 4UTBH 4NRXA 5L6YL 2DBJA 2GUOB 4LIQE 4XPGH 1ZSDB 2DLEA 1AHWC 2MPAH 4P23D 1L7IH 2DQUL 1UACL 5AAWA 4F3FA 3H9ZA 4PJIB 4HGMA 5D7JD 4HMEA 4M02A 3RBGA 5DJXB 3DIFA 1D5MA 1Y6KR 4NZRL 1NFDB 4YDKL 1K2DA 4RGNC 2WUBH 2R0WH 5I18H 2X42A 4Y4HD 5JW3H 1XR8B 1AC6A 3I85A 1A1OA 3MLRH 3BWAA 1HWGB 4ZD3H 5HHXH 2R1YA 3KYMA 3OZ9H 5JHDB 2VLLB 4MNGB 3S4SA 2OK0H 4N8VG 3V6ZB 4PJ5E 5EC2B 3GI8H 3MRGA 2XTJB 2GJ6D 3TO4B 3MBEB 3BH8A 4CL7A 4HFUL 1WBYA 2A1WL 2FEEI 3IDNA 4P2OB 3GIZH 4OLXL 3RNQB 2W65B 2FDBP 5F1IB 3GO1L 3QIBA 1ZKAA 3TT1H 1JN6B 1RZ7H 1Z0NA 2EXWC 3TIEA 1G6RB 1N0XH 1U6AL 3M1BB 3S34L 2MCPH 3QEUA 5DI8B 4B7LA 2PUQT 1A1NA 4F9LA 1EFXA 1Q0XL 4G3YH 4JHBA 3X12B 2VZTA 1B2WL 1ZT4B 3E3QC 1CXHA 5IF0A 1I1FB 4YDLB 1FAIL 3QIUD 4KI5F 3RVWC 4R4NC 5DEGB 1HXYA 3U1SH 4NGHL 1N6UA 4LOUD 5EZJA 2NY3C 2QHRH 1R3HA 5KBNC 5I1DA 3N0PB 2VXSL 4F7TB 5C0IB 3TJHD 3O6FA 2BVQA 1DE4B 4M00A 4BK4A 3GK8H 2BCKA 1T21B 1KN4L 2IGFL 3VDAA 4MQSB 5I8CB 3WS6C 5C0DB 2E27H 1A4JB 1CLCA 1LNUA 1KIPA 4YE4L 4AY0A 2KH2B 2EIZB 2HH0H 1BBJB 5EU7C 5DJ2B 3VFVA 1N64H 3BQUC 3PUCA 3QQ9C 5DXWA 4R97C 4BYHA 2X4SB 1CGWA 4HIHB 3UTZB 2BNQD 5I8KL 5SWSB 4MNHA 3DYMA 3SKNA 4JKPH 3QQ4B 2OZ4H 2VIRB 4X99B 3ZZ1A 3VI3F 5DSCB 5KSVB 3LS5H 1IC5L 4NOBA 5I1GH 2VLRD 3C5ZB 2DWEA 3O6KH 5DK2A 3Q2CA 2RB8A 1IL1B 1NEZB 3VXOB 1P4LB 4N0YH 1OM3H 1R3HB 1MCOL 3LKOB 1AKJB 4O5LH 2J6EL 4NYLB 3ZE1E 3AS1A 5ID1B 1A6WH 1SQ2N 2W60B 3FZUD 2C4FU 1UM6H 2FATL 4L4VE 4OCSL 1O5DT 5IW3A 1PZ5B 1ZVHA 2J5LB 5HYJE 3KPOA 4OI9A 1CTNA 1U36A 3QHZH 4R90L 1NMCC 1NFIB 4K8RL 5MEOA 2Y23A 1MREH 1JN6A 4JO1L 1JYNA 4Y5XB 3MYZA 1FDLH 4Y5XC 1FGNL 3U7WL 4UNUA 5GS1B 5LGJB 2UZXB 1ODAA 3VRLF 5I1CH 1JV5B 3VXUD 5IVNA 3MLUH 4MXWL 1ACZA 4Q9RL 5ALCL 1P5VA 3MLXL 1J1PL 5C09B 2HFFB 3OB8A 4QOKB 4Y16A 1W0VA 4X0KB 5C0AE 1EHAA 1QSVA 1QHOA 4NC1C 4PBWD 3DXAD 3R8BB 5J1TC 5F7EH 4F15B 2EDRA 3OKNA 3B9VA 3GSQA 4QRPE 5F1OB 3E3QE 4HAGA 3D0LB 2ARJA 1I1YB 5DUML 2Z8RA 1MWAA 4XPAH 5D1ZD 1DZBA 3MLSL 3QDMB 1K2DB 3TZVC 1S5HA 1WT5C 2IAMB 5CEZE 3RVWD 5I19H 3CH8A 4HWBL 5FYJD 5IVXE 5M7QA 1NBQA 1YUHB 5EIIA 3OKYA 3WN5A 3NFPB 3DSNA 5BVJB 1LEGA 5ITBL 3SJVB 4EKXA 4CDGC 3ILQD 4HWEL 2QR0B 3CZFB 1UM5L 5DHYB 4PJBA 1OAZH 3QUZC 4FXGB 4DKAA 1UG9A 2GSGA 1AH1A 3L5XL 15C8L 2EDQA 2EDXA 3C6LD 4QLRA 4OZGB 2XFXB 4P3WA 3QR2A 4R97B 3RWGB 3FQXA 7FABL 2YKLH 4L4JA 2PTTB 4JQIL 2X7LA 5DD3L 3RUGB 2J8UF 4U31A 2YZ8A 3TT1L 1FJ1B 3K8LA 5CBEA 2BERA 3VXUE 1K85A 4A6YL 1KCRH 4YX2L 5TF1H 5A16B 1JPSH 4CMHB 3BZEB 2F5AH 1BZ9A 5IW6B 3PXJA 3E1F1 2F19H 4NQSA 4PJGA 1AD9A 3VGGA 1TVHB 2ICEA 2XTJD 5TPWL 2ICEB 1M7DA 1A7OL 2C1OA 3I6LE 4JPVL 4PRIA 4Z0BL 1MCPL 2V2TA 3DX7A 5C0CB 3B8SA 4XWGH 2BSRA 2P5WB 1T04B 2QSTA 3ALXA 4QRTA 5JXAL 3TBTA 4XVSH 3R1GH 3PL6D 4JB9L 5HGGS 3QPXH 5FYJE 1P6AB 2FBJH 2D7OA 3JWOC 5E2WL 1PDKA 5F7WC 3UCRA 2W0FA 5HPMB 1URLA 2X7LB 1OAKH 3VXSE 3BRFA 4RCAA 3MRBB 3MUJA 4K9EH 4O51B 3VFUA 4M4PA 2PCPB 4S1RL 3MV9E 3RA7H 3REWB 3U0WL 5B38G 1CFNA 1IQDA 4K8RC 4DZBB 2DQUH 1D5ZB 4G8FB 3TNNA 5BVPL 3TYFB 4H5SB 1BZQK 3FHQA 1J87A 3SE4A 1PKQA 4PD4J 1MUJA 2DTML 1OT1A 5I1JL 5IG7A 1BEYH 4QWWC 1LO4L 4OLUL 1BQSA 4KC3B 4Z95H 3SJVA 3HC3H 1NGXA 3P3YA 4KZEL 5C07B 1YYMH 3MCKB 5JOFB 5JW5B 3TZVD 1NLBH 5DQJB 1MSPA 4CKVX 3DYOA 3LN5A 3SE8H 1XEDA 1XF3A 1CDYA 3OKOA 3TFKD 2NY7L 3CVHB 4PJXB 5DQJA 1BZ7B 5HGDA 4HPOL 5I1IH 3KYKH 1P7QD 3IDYB 2E9WA 3ULUL 4DOHE 2CDFA 1E27B 4LMQI 5JOPE 1X6LA 1RV6X 4W6YB 4BFBD 3U6RA 5CBAB 3VFRA 3LMJH 5E4EB 4ZTPH 4LLYB 3L3JA 3REWA 1ONQB 4XBPA 3DX6B 5HD8C 3HE6A 5GS2H 1S3KH 4ONOA 4WUKH 4PJCE 1MHHA 5I1CL 2WLYA 3GMRB 4PJCA 2P7TA 3LKPA 3PL6A 1G7IB 5EUOB 2DTMH 1R5IB 2VDKL 5DJYB 3DWTA 4MMXC 1HEZA 1RUKL 4QHLB 3DX7B 4JDZA 3EAKA 4RQQB 4D9QD 1VFBB 1Y6MR 3NPSB 5EU3B 4OLVL 3ZKXC 2GY7B 4OGAC 4PJGF 3QIWC 1FBIH 4NZDA 2PYEE 3QIWB 2XI9A 1CBVH 4MQXC 1XZ0B 1CDCA 2E8YA 3V0VA 4S2SB 4XX1E 5DS8A 4K3DL 2XYCA 5DSCA 5KSVA 4XNUL 4Y8DC 3VFGL 1BOGA 3OGOE 2DLIA 4NFDA 1GC1H 4ZODA 1X9QA 1RUPH 1NGYA 3BW9B 3NACL 4G6JH 4RA0C 3GIVB 4LBEB 2X41A 3VG0L 1RK1A 5H37H 4ONHA 5E8NB 4XNQA 1S8DB 3NTCL 3WHE0 2PTTA 5C0ND 3EYVB 3VG9C 5JDSB 4JG1L 1F6AA 1KSRA 4QXGH 3WE6B 5DA4A 4PJFE 2J2ZA 3OMZA 5LQBL 5CJQL 2XNAB 4P2CG 3LIZL 4M6OH 1S7QA 1Y6NR 1IGTB 2F54B 2GJJA 4ZO9A 2IPUK 3KWWB 3W9EA 4GMSH 2FWOB 1S9KC 3S6CA 4TUKH 1JGLH 4G9FD 4J3VA 2NX5A 1KPVB 2HP4A 1CICB 3QHFH 4KJQD 4LHUA 4NIKB 3HR5B 4Z7UF 1R5VB 3REVB 1DQMH 2V2XB 2GHWB 4Z8FL 2VXSH 3PWNA 3T0VA 3QXDB 4WI9A 4NWUH 5AYQA 3L6FB 1T7ZA 4XZUB 2AERT 3ZHKA 1TETL 1RULL 4OZHA 1QFOA 4ZFOL 1I1YA 4UINH 1JL8A 2Q6WB 2XIDA 1MI5D 3LVEA 5HVHC 2ZOKA 2QKIB 2JIXB 3VFSA 1VFAB 5E1AB 1IARB 4I48B 5FO9A 5BZWA 4BQ8A 4MCZA 5D96B 2YD5A 4C83A 3V4VL 3KPPB 2OTWB 3V6ZA 3FQTB 4JFOA 4NFBA 4OM0L 4HFUH 3K1DA 2X89A 3CFBB 4MD0A 5F7LB 5FO7B 2ZUUA 3O11B 3VWKC 4HQQH 2HMID 2F8OA 4QO1A 2R56H 4QRSB 3W81A 4S11A 1ORQB 1RZFH 2H26B 1J1PH 4QRRD 5ADOL 3SKMA 2HWZH 4FTVA 5EORL 4RGNE 3P40A 3HE6D 4M48H 4MX7B 4PGDA 2P1YA 1MH5A 4NZJA 1BJ1J 1OCWL 2P8MA 4XAWL 4JFPB 4JO2L 1ZT7A 3HI1A 5DVLA 2VDQL 1QO3B 3C5ZA 4X4YB 5AZ2H 2UVFA 3TWCL 5BQ7B 2OQJB 4G9FE 5DJ6A 3O81A 5TE7H 2V17L 3E8UL 2D7NA 3LQZA 4KHTL 1LO2H 1UWXH 3NCCB 1U3HB 3UPRA 2BC4A 4EDWL 5GGTA 4ERSH 1I75A 4CU7A 5FUZH 3NCEB 2BXYA 5DRNB 3MRHB 4XH2A 3VXQA 5DK3A 5H37G 1DVFD 2J7LA 4YHZL 4XNXL 1YEEL 2CSPA 2GITB 4PJ9A 4YAQB 2RFXB 3BDBA 2EDBA 4JFFE 1SMAA 3CFDB 1UZ8A 5F9JA 3QNZA 2OMNA 1IKFH 1OTTC 3BUTA 2R0LL 3K8KA 3HE7C 2FZ3A 4HUMB 2NTFB 1KCSL 4NQEB 5EPMB 4OZIB 2ZG1A 5HHME 3JTTA 4LFHG 1NCWL 1KJMA 1MHPL 4R4FH 1U3HA 1X5AA 4OT1H 3HG1E 3RNKA 1NCDL 3MUGA 2NPLX 3MACH 3EJYD 3HR6A 4C59B 2F5BH 4P2QE 3P4OA 3DO7B 2CDGB 4GQ9L 4ZDHA 5DJ0A 3F5WB 3IFNH 3WFHA 2HH0L 4WDIB 5E24E 2XY1A 4CMMA 5EO1B 1I9RL 4NN6B 3X12A 1YQVH 2I9LA 5BMFL 1RHHA 2VXUL 5LAXB 3SKJH 5IHZA 2OQJA 5K9KA 1E28A 3O9WB 5GRJL 3C5ZC 2C3WA 3M1BA 3TPKA 4NQUA 1U3JA 4JQVC 2FHFA 1N4XL 7CGTA 4I3SH 3LEYL 3PG2A 2A73A 3QB7C 5CSZB 3TBWA 3D5OF 2DLGA 4TOYH 1T5XA 1XCTB 2FD6H 4ZFFB 4EI5A 3HMWH 5SWQB 4BH7B 4RWYL 5L0QC 4NQDE 1EJ6A 4ELMF 4LNRA 2AI0H 2OTWA 4XP4H 5EU5B 4QRSA 2DQGL 1S7XA 2CRYA 2ID5A 3MJ9L 4JGMA 1DFBH 3T2OA 5H2BB 4FQXC 4K2UH 2B4CC 3GSNA 2J8HA 1QLRB 5HI5C 2R1YB 4TSBL 4PP1D 4OSUH 5L9DL 4ZUTB 1FYTA 4N8CL 1MQ8A 5DFWH 3EDJA 3MRFB 4R8WH 4APQA 1U3HC 4XZUA 1HINL 4FTVD 3ZT5A 2ZUQB 4HKJA 4QGTA 3OR6B 4O4YH 5AUMB 4O2CA 1KCVL 3VGAC 4FZ8H 2QADB 1RJYB 2XA8H 3ZHDA 4LHJB 1QA9A 4Z7QF 4M61B 3DIFB 3CC5A 3U2SB 1K5NA 4Q6IB 4Y8AA 2GCYB 3CK0L 1K6QH 1X5LA 5EO1A 1N5YH 1B90A 4IRSD 3RL1A 2YOCA 4FOMA 4KROD 4LAQL 1LO3H 5GJTH 3QDGB 1BGXH 4EBQH 2Q3ZA 3IU3B 4KJYA 4NZRH 1QFWL 4UUJB 3GJEB 4MSWA 4OZGE 1A4KA 2A6JB 4X7FC 3ARBD 1ZLWK 4BKLA 4XNUH 5IHBA 1U92A 2FRGP 4N1EA 1IC1A 2XTJC 1DP0A 4RGOH 5DRZA 4BQCA 2CUIA 2LAAA 5CJXA 5E08H 4DK3A 3S98A 3D48R 3IGAA 3NIGF 3T0ED 5IVZB 1IFHL 3NMEA 4ORGB 4F7PA 1JZ7A 2MPAL 1OLLA 4LLWB 3L5WA 3VXRA 2FSEB 3RGHA 2G60L 3ZKQD 4Q9CA 3MGOB 5FKPA 1UT9A 2PYEA 3QXUA 4OTXL 2DQEH 2A74A 1H5BA 4MAUH 3S3SA 4JY4A 4K55A 4NJ9H 3P0YH 2DI7A 2VOTA 1RUAL 2C7UA 5ECJE 5C0CE 4N1CA 1CQKA 3HA0A 2AI0L 1S7WB 4X4YA 3ET9F 4X5LA 1MRDH 5BS0B 4Y4FC 2NXZB 3CXHK 4U1LB 1RZFL 1UM4H 3I3EA 3RVTC 3JUZA 5HI3D 2PF6A 3IDUA 3OG4B 5DJCA 1R5IA 3M07A 4GBXB 3OJ2C 2GAZB 3CXDH 2BJML 3GMRA 4PJCB 1T4KB 5E8OA 3C5JB 4IJ3C 4OJFL 2ERJC 4LDLB 3PJSB 4Y7MA 5I1IL 4J3WA 4OD2A 3P9LB 4HD9A 3KPPA 1J5OH 5F93C 4ZS6C 1T83A 4RISH 3W0WD 4ODWB 1I8KA 5SX5H 1CXKA 3LN4A 3KLSA 4XCNB 2R0ZH 4XCCL 1U3HD 1T0NA 1JWMB 4YZFF 5DK0B 5SWZA 1G9NC 2VAAA 1IKFL 4A6YA 3NA9L 4K3JL 1T80A 5T1KA 2AV1B 2IH3A 3PGDB 2YPLD 3STZB 1CG9B 5CWSB 5I1JH 1DVFB 2CKBB 4P49A 1VESA 4OF8A 3U0PB 5ESAA 4YHZH 4M8QB 3QXDA 3SDDB 3RGVC 3S35H 4TNVF 5EBGA 5GRZA 2HN7B 1NANI 3SJVD 3C2AH 5CP3H 2BY0A 1K8DA 3B9KA 1MHEB 1MPAH 2EKJA 3V5HA 1NCAL 1LO2L 2LU7A 4OQTA 5KSBE 4RGOL 1D6VH 2AJSL 2IH1B 5D1QA 5D93C 2VLRE 4HHAB 5D5MF 3FOLB 2Z4QA 2F54A 3HNVH 2DKUA 3T65B 1EGJH 2YBRB 2QV2A 2GY5A 1U58B 5IFAH 4RFNC 1XGPB 4M48L 4FFYH 3BWUC 1JF1B 2VO5A 3QEQE 4JRXD 2AKRB 3C8KA 1MFDH 3TIDB 4QF1A 2MQCA 3CK0H 3L3DA 2YD4A 4F58H 5E2JA 1G9ML 5EUKB 4UT9H 1NC4A 3K46A 1F4WH 2Z8WC 2CH8A 4X9BA 3U36A 3T8XB 4JFEB 2A6DB 4RFEB 1N5AB 4F7MA 2XRAH 3PQYD 4WU5B 4MJIB 4PRID 3V4PL 1MELA 2BSRB 3ARVA 3ISWA 2OSLA 2B1AL 3FFCB 3FQWA 3HUJB 5B4MD 2D4FA 1ZLWH 3SE3C 3P9MA 3QDGD 1RJCA 5TJWK 5EU4A 2V5YA 3QEGH 1ZANL 4ZTOL 3RGVA 1SJVA 3A6CH 3D25A 4HW6A 4WFGE 4WY7H 2C7UB 2P5WA 2K7QA 1J8HE 3SCMC 2FJGA 5JA9A 3CVHL 5D8JL 5IGXH 2E7LC 1D5XB 3VDBA 2H1PL 1HIMH 5DHXB 1DFBL 1J0ZA 4WI6A 1BX2A 3ARFC 3EJZD 5KN5A 4MS8D 4DKFL 3LD8B 3C6LC 5FKPB 3TP4A 3KPSA 5ICYA 3AS2A 5GSVA 3MFFB 1A6UL 4O02H 5IQ7H 1XFPA 2P7TB 1N7MH 1JUFA 4HH8A 1ZS8A 4P2QA 1N6QL 5I66A 4OCWL 5HGBB 2XPGB 3G5ZA 1LO5B 3MOAH 3CH1A 4XRCB 4Y2DA 4JR9H 1SVCP 3WKNA 5EZLB 4HJ0C 1PY9A 5T5FL 3O4LE 2XKNA 3QT2A 5D72L 5HVGB 5DMIH 2DMBA 2H2PD 5J8OA 4PB0L 3WLWD 3E6FB 1KFAL 3A6BH 4PJXE 4BM7A 1UFUA 4XXCC 4PJXA 1HHGB 1MVUA 3U2SA 4NKMA 1U8QB 1NCWH 2UUDK 2IAMA 4C56A 1S5HB 1U93B 2HVJB 1EEQA 2NY3D 4E41B 2CDEB 3PQYE 1LDPH 3MUZ1 2X4QB 4EIZC 2KKQA 5L8LB 1F90L 3SDXF 2PN5A 2AS5M 1F58L 5JW4R 5IW1A 5F7MC 4P5TA 4H8WC 4PY7B 3JV4A 1CFQA 3ARGA 25C8H 3EFFA 3ZE0F 4WI3A 5IB2A 2FX9L 5ALBL 3WCYA 2UYLA 2HYMA 3J7HA 5CGYD 2WSKA 3O2DA 3EO9H 1DEEB 4JO4H 5GJSH 2BVUA 1EAPB 1I8IB 3H3KA 4JVWA 5ISZE 4E0RB 3BQUB 4RSVA 5IWLA 2AXGB 4GKZA 4P23C 4NC0B 2CQVA 2C1PB 1YEJL 4ZOCA 2FBJL 2YD8A 1G6RL 3WHE1 4DUXA 3BESR 1MJJA 3PWLB 4F37K 1QLEH 3CFEB 4M6MH 4GAJL 5TFSH 4XWGL 4G6ML 3MV9D 2DJUA 1OGTB 4KRPD 1MFEH 3QRGH 2MFNA 1X6NA 4Q9BA 5C0BD 1KFAH 4AT6B 4CVXB 3I75B 3CFKA 4HGKC 3ZL4L 1N26A 3LQAC 4XMLL 4JCLA 1NEZG 3H42L 3NIFE 4C55A 4X7DC 1KIUA 1JPSL 1S7SA 4MHHI 3DX8B 1C12B 4MQ7A 4CNIB 4YE4H 2VDOL 1AXSA 4K7PX 1L6ZA 2ADGB 5J3HD 4L8DA 4HIJA 5T1MA 1INQB 4P5KA 1RZIA 1JJUA 4PRAB 1C5DA 1LO0L 3GSWA 3C6SB 1FJ1A 3JTSB 4LDOB 1R3JA 2NTSP 1FL3B 3BHBA 1I1AD 1NLBL 2KL6A 4RFEA 5ISZA 1MLCB 2NLJB 2XG4A 1TETH 4I9WE 5EZOH 1G7HA 3VWKA 4YHYB 2E7MA 5CP7A 1YYML 4F2MA 4L4TD 4F7EA 5SX4I 3B5GA 2HT4D 4MHHG 3CLFH 4V1DE 1E4XL 5IWLC 2MMXA 3MR9B 1IT9L 3PWPA 1IILE 3MODH 4J8RB 2PO6D 5ERWB 1B0GA 2IALA 3HB3D 5IP4A 2XOTA 4QRRE 2VNCA 5IJVA 2GKIA 4KHXH 3VFPB 1C5CL 1YJDL 1CN4A 1ULVA 3BZDA 2VKXA 5HJ3A 3MROA 4JFHD 3KG5A 4KKBC 3EOTL 2OLDA 3TGXA 1HXYB 4NO2A 1FL6A 3TZVA 2H2SD 2VL5A 5JDJA 3LZFH 1WJ3A 3BIBX 5E4EC 4PJFA 4PJIF 5IR1A 1MCJA 2Y25A 4H1LH 3BMVA 4WW2C 4LLVB 1A22B 1HE7A 3LQAL 1BLNB 2UY7A 3F58L 5SX5K 2OR9H 5IM7B 4D9QE 3IXTB 4JHZA 2JE8A 4JFFD 3MRFA 2BVPA 5IT2L 8FABB 1FFRA 4NUJA 1D9KA 2D4DA 5F96L 3N1GC 1KCUH 3H3PH 3RDTD 2FB4H 1EZVY 3S96B 4NNYA 5DA0B 5F7UA 3LN4B 1CBVL 1YNKH 4U2YA 1MAJA 3Q6GL 4WIQA 4JJ5B 1IJ9A 3L3OB 1C08B 2ZOKB 3QHZL 2A0LD 1T66C 2QQNH 4U6XA 2DQCH 5E2VH 4QXTB 4M1DH 5B39G 1SVZA 1U8NB 4LLAA 3AFLA 3MRLB 1YJDH 2KDGA 3VD5A 3BN9D 1WVZA 2FECL 5IW1B 7FABH 4EXPX 3BWAB 3GJFH 1EEUA 4Q7DA 1MJ8H 4UV4L 5CUSH 4N5EC 2XN9A 3OKKB 4E41A 3DUUB 5FB8A 1R5WA 3SOBH 3O6KL 1AKJA 3DMMD 5DEFA 1RVFH 1KJ2L 2Y1VA 4FXLA 1KEGL 1WWWX 4DKDC 1R6VA 3KLAB 4YR6A 5FIEA 3UPCA 5INCA 1LVEA 3BP4A 3B2VH 2RCSH 5IFHL 1VDGA 2IQAB 4NQDD 2VDML 3VWJB 3MRIA 4OZHF 4GOSA 1FCCA 4U4BA 1CU4H 3O2VH 5HHMB 4PRPA 2BVEA 4KTEH 3SDXE 4CDHA 1J1XL 2PR4L 2HVKB 4XVUC 4RMRA 4KJWD 3ULVF 4P2QB 3DTXB 4NBZB 2QADC 4U1GC 4JFDA 5FGRA 2M1KA 3QP3A 4LASL 2DYPD 5MHSE 1FNSL 3RVTD 3UTPE 5JR1H 3S36L 3BD4A 2CLRA 4LPXA 5GS0D 4M7KH 3D69B 3FAWA 5DRNA 3EYFB 5C8JB 3BP7A 5IMOB 1G9EA 3DGGB 3SOBL 1IQWH 3V0VB 2QHRL 1C5DB 1G6RH 3GMMB 3IDMB 5KSBB 3JVGC 4ZFGH 1HIML 4KV5E 5BS0E 4L1HA 1ZEAL 3W2DH 4ZPVA 2A6KA 5KSBF 2WIIB 3WIFA 5DEGA 4R90H 1ZT7B 3HI1B 4J6RH 3OJMB 1EA9C 4HS6A 3PGCA 4EDXA 5E99L 1L0YA 1K5NB 2VLME 4L9LC 2ATPA 3ZO0A 1QA9B 4DUVA 4G8GA 4LIQH 2IADB 5FA3A 2YMXL 3WIIL 2X4PA 3ARBA 3LKPB 2FB4L 3QFJA 5T33L 5I1LB 3QIBB 3EYOA 3MBXL 5F7HA 5SWSE 2AJZA 1Z5LA 1KNOA 5A2IH 1GPOH 4LRNH 3RNQA 4XVSL 2CGRH 4XTRC 5I1GL 1U8NA 4LLUB 1QYGH 1EEZB 2V9QA 4Z0BH 1FO0A 5EZIH 3L3GA 5DC4B 3N9GH 3NABL 2YPKA 2YSSB 5LWYL 1TZHB 2A77H 4LSQH 3NCBB 3EJJX 2F5AL 3S5LG 3D0VB 4L3EE 4QHNA 3B3IA 5FECA 4PFEA 2YK1L 2ENYA 4W6WB 4JEGB 1RIHH 4WI7A 1QFHA 3UTPD 2XKSA 3O8XB 1U8OA 3PHQB 4PJGE 1TNMA 4WEMB 3PL6C 3WJJC 1MPAL 1GGTA 2RQ8A 1P2CB 1UXSB 1P4IH 3U0PA 1WZ1H 3K4AA 1Y18B 4P4KD 2EIBA 2BSSB 4MAYB 3GJFA 4IDJL 3T3ME 2HRPH 3CXHJ 3CNKA 4YIQB 1E4KA 5DHVA 4L4VD 5T3XH 4HDIA 3L5XH 4HWNA 3NA4A 3UYRL 3D39A 3MLZH 3NBNA 4G6KH 1FLTX 1UKSA 2X09A 3DVNA 2H1PH 3TN0C 2XZAH 3P4OB 2FGWL 1AGEB 1YY9C 1HQ4B 3B2UD 4U6HB 1DQJB 3ROOA 1I9EA 4WWKC 4DZBA 4UAOB 5IJVB 4PR5A 1H3GA 1A5FH 1AIFA 3DNKA 2MCPL 1P53A 1EUTA 1WIOA 3JWDH 2HLFC 3PWPB 3HZYB 4HFWB 1J5OL 3ORJA 5C3TA 3O45B 4WWKD 3GM8A 4JZNB 3VA2C 1UA6L 1M1SA 2BDNL 4I5BB 3ARDC 4YBQC 2PTUA 3EO1B 4NN7B 2A0LC 4OGYL 2YPLE 2EEDA 5BMFH 2R69H 3C5SB 3GIZL 4PJIE 4MWFB 4YHKL 5LJYH 2BOCA 1F42A 1RQ5A 4MDJA 1KIRB 3SCMA 1AR1C 3MXWH 1BX2B 4S2SA 2C1OB 5AWNL 2V2TB 1FC1A 1F11B 3SJVE 4HT1L 2L4OA 1XR9A 3FB5A 5CEZD 5FEBA 4Q9RH 4FFYL 4W4NA 5DJ6B 3VH8B 1MHPH 4O2EA 3PP3K 1C12A 3DMMC 2R0KH 1JPGA 1I9IH 3RTQC 5CJOL 2GK2A 1RZJC 4OTXH 2BOCB 3F6IA 5DR5H 3G6DH 1Q9WA 1RZGA 2R2EB 2BVOB 5ALBH 3BSZH 3C09C 4EQ3A 4NP4L 1L7TL 1MI5B 2ZJSL 3VRJA 3GRWA 4I77L 4UQ2B 3TBSB 3RWDB 4UBDC 2JLLA 1OSPH 5DR5L 3GMOA 1K9TA 1XGQA 3G08A 4R7NB 5FKAA 1VACA 4MCZB 2MQ0A 1U58A 3QXTA 3IRPX 3EDFA 5GISL 1CGTA 3FB6A 3IFLL 4V1DB 5BV7B 4UOJA 4R0LB 1LO3L 1YUHA 1CIUA 1X5FA 4OQTH 5KSUA 4PY7A 3GMQB 2NX5E 2R15A 5KVDH 4S0TD 5E7FA 5AAMA 1K8DB 3BUYB 1NFDE 3PDOB 3I6LD 1PY4A 3FN0H 5A2JH 1HHIA 1EHNA 2HKHL 4HCRL 3BO8A 1KLGB 1JNLH 1WEJL 3ULVH 4PGBB 2ITDA 3SN6N 4QKXB 1U8QA 3F65A 3C09B 4LPCA 2W0PA 5IG7B 2HFFA 3ZYJA 1FYTB 1CFSB 4OLZL 4WJ5A 1MY7A 4KDWA 5E6IC 3UYPA 2AQ2A 4M7JL 1U8LB 2X44D 4FHBD 2ZG2A 1AJ7L 4N8CH 3KJ6L 4ONFH 1A6UH 5A43C 1J0YA 1OQOA 1JGVL 5CGTA 3BYTA 1YYLL 1FO0B 2XZQL 3HE7D 4U1JB 3U30B 2EECA 5C07D 4DKFH 3WE6A 5IB3A 4U1KA 1RD6A 2JK5A 3L7EB 3MJ9H 3G9VA 4P2RD 4O51A 1UADC 5KS9F 4J8RA 5D6CA 1KNOB 1MI5A 2NW2A 3VRJB 2Z93A 4IMKC 3RVXD 2DDQL 4D0DB 3C5JA 1RK0B 1FP5A 2HRPL 3HE7B 3GIVA 3MZTA 4KRPB 3QEGL 4JRYB 4HLZH 4PY8J 3BKJH 4LSSL 5FYKE 4HGWB 4TUKL 4EVNB 5H35A 1P4LA 2GSIB 1NEZA 4EDXB 1J1OL 4NFCA 5JQHC 4KJPD 4S0SD 2GJZA 5BZDA 2LU3A 4YGVA 4JZJA 4CBPA 4OZIF 4H26B 1IKNA 4PRHB 5EIQA 5BXFB 1YPZE 2APWA 3T1FB 3D3VD 4OGAD 2NY3B 3FQWB 3BP7B 2XV6B 5FHAH 4N8VA 5EWIL 4XNMB 5JW3L 1SM3L 2FZ3B 1IEBB 4FS0A 4GLRH 2P45B 1J0JA 4NQDA 1T3FB 2P8PA 3VCLA 3QUKB 1FLRH 1NMBL 2XA8L 4R3SA 3IVKA 4WV1A 4CN4A 3V7AE 4OZFH 2A9MH 4TUOA 3VFNB 1UXWA 4LVNB 4I0KA 2ESVB 1ZGLM 3DMMA 3INUH 1GVIA 1AIFB 2JK5B 3L7EA 4M4RA 5HXMA 2WWMD 5DHYA 1P9MA 1NBZA 1HQ4A 3HG1A 2QTEA 1KJ3H 1Z9OA 3FFCD 2B2XH 3DI2B 4MJ2A 4WW2A 3V52H 3NFPA 1G84A 1QO3A 2R2CA 1FAKT 1XF1A 2BMKB 3O2WH 4JPIB 3IAQA 1ZT4A 2FHCA 3N85H 1MH5B 1MFBL 2V2WB 3D9AH 3HCVA 4NKIL 4OF7A 4FFWD 5TQ0L 1RY7B 4OZ4B 3B9KB 5DMYA 2GFBB 3D85D 5FB8B 3SDXB 5JQ6H 3WS6A 1AP2B 5DMGC 3Q6FA 2M2DA 4O2CB 2NY5H 3TYGH 1OTTD 1YC8A 3GSQB 3KJ6H 4ELMB 5FO7A 2R9HC 3BEVB 2Y9RT 1HDMA 3BD5A 2WINA 4PJEE 3VGBA 3OQ3B 1JPFA 3R0MA 2X1QA 4UIMB 5F1KC 4FRWA 4MXQC 4C83B 1JWMA 3QBTB 4MZ2A 2DQFB 2NY1B 5TGBB 1WEJH 5F7YC 1ITBB 2PR4H 1T2JA 4I48A 2RAMA 1ADQA 1DEDA 5DC9B 3NOIA 4BFEA 1M7IB 4G8FA 1OB1B 2XKNB 3BPCA 5I15H 2QKIA 5MEND 3MC0A 1CLZL 4Q0XH 2YEZB 1S7XB 3BISA 2EDEA 4PYGA 4XB7A 3HNTL 4O2FB 2RR3A 2NY0D 3QUXB 4Z7NF 1CL7I 1IEHA 3X3GH 2DL2A 3DROA 3U9PL 3H9HB 2IEPA 4G6KL 4R26L 2P5EA 2FGZA 2UV3A 5GGVY 5FA3B 3IJYA 4KVNL 2D0GA 4ODHL 5FXCH 3RDTB 4JRXA 1WF5A 4I13B 3HR5A 3KPRD 4EUPH 5B22A 4GUPB 4RIRB 3UTSA 3QIWD 3X14A 3PGCB 3WSQH 3W0WA 1CE1L 1JYVA 1D5XA 1FHGA 4MB4A 5L0QB 3L3KB 4GKSA 5J1SC 5LKNA 2A2QT 4DN3L 4LNVA 3KPRB 1F6FB 3GSXB 3MV7A 5EOTA 1J8KA 3VW3L 1YEFH 4JPKH 3Q6GH 3L5HA 3K7UA 3QYCA 5JDSA 5IMOA 1B0GB 1J86A 1KPRA 2DS4A 5GRUL 2G75A 3SDDC 4F7MB 4P3DB 5FGBC 2R0KL 3IS0X 4LKXA 1T7WA 3SGKC 3N9GL 3ZKMD 4YFDB 5FHAL 3VXRE 5EUKA 2GITA 1C1EH 1U8HB 4HBCL 5HI5D 5I74B 5A3ID 2MKWA 1IAMA 3ULUC 4KY1L 3UJIL 2Y36L 3BHBB 3HI6L 3ARSA 2FEEL 5IBUG 4HUWA 5EO0B 3Q1SH 4XBGB 3IFOA 4B7IA 2F19L 3FO9B 4PJ8A 4TVPH 1DUZB 3VFTB 2E7HA 4YXHH 4LSPH 4NCC1 2YUZA 4PJBB 4AQ1B 1V3LA 3GNML 4X7SL 5DVKA 2FR4A 5KOVC 5EBLB 4YX2H 3VA6A 2AV7A 4P3CL 3DX9B 1EEYA 1KLFA 4X6FB 4N68A 1DQLH 3NPZB 2FYYB 2J4WL 3P4NB 4N0FB 5KJRL 4HXAH 1J88A 5I30H 4Q6IA 3QQ3A 4GUPA 1X5ZA 4JFXB 5GZNC 1SEBB 2R1XA 1I3RA 1KCKA 1T7YA 2FO4A 3FT4A 5I6XB 2NXYB 1BFSA 1FN4B 1TTGA 2VDNL 4KGJA 4NDMA 4WW1B 1LP9E 2EIEA 5D1ZA 4OV5B 3O11A 4YHYC 4HKJB 3TH2T 4PJ7A 4OZIE 5DURD 2C4XA 2G2RB 3P0GB 4HKBB 5FOBB 4GRMB 4OCYH 1ES0A 3CFCH 3MRLA 3OGCA 3SDAA 4Y19A 5DK0A 5J89A 2QBWA 4HWEH 1LEIB 2EDNA 1U8JB 4QT5A 1OPGL 5LGHH 2JIXA 3VFSB 5C2BH 3S3PA 5DQDL 1DBML 5F3HB 4LHQB 4Y5XA 1YQVL 2HMIC 2XWBB 4NUJB 3ARGB 1V7NL 4X6EB 4YNYB 3VXRD 3LPGA 3RIAF 1IGJB 3KR3H 4A2MA 4OV5A 4OF0A 4NHCH 3GBML 1CZ8L 3V6BR 4G8GB 3C60C 3ULUD 2H6PA 3BMWA 2VISA 3GMPB 1NAMA 5C0AA 1CS6A 4FQCH<