3QEUA

The crystal structure of tcr dmf5
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
201
structure length
195
Chain Sequence
KEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVNFGGGKLIFGQGTELSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWACANAFNNSIIPEDTFFPSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DMF5 alpha chain
publication title TCRs Used in Cancer Gene Therapy Cross-React with MART-1/Melan-A Tumor Antigens via Distinct Mechanisms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 195
sequence length 201
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qeuA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qeuA02
4LIQL 5E2TH 1LE9A 5HBBA 5CJXA 3O9WB 5E8NA 5EG6C 2NPLX 5C0IA 1KJ2A 4ELKA 2N1KA 4L8DB 2DI9A 4N5UA 2C3VB 1YQ2A 1F00I 2F5BL 1Y0LA 3UTSE 2OL3L 5DS8A 5T1DH 5HYSA 3SDAC 4JY6A 1N3NA 2HRPL 2NY3D 4H20L 5IEHA 1I7UB 5F7YC 3RPIA 1A02N 4G9FD 5AAMA 4EZMA 1LO5A 3G6JB 3RWIA 3V6OA 4KHTL 2UWEF 1A6AA 1T04A 2CMRH 4HUKB 5IMMB 1T22A 1CE6B 2AABH 2FL5A 4JO4L 5IVXE 5F96H 4MD4A 4LNRA 3VXSA 1I1AC 4NM8H 3ULSA 4JPIB 1S7UA 4KKLD 2BY2A 2ZUQC 2D7PA 2XY1A 1IKFH 3K3QA 3RHWK 1J1OL 2HMID 4WFHE 3G5XA 1NC2D 1XH3A 1MHHB 4BH8B 3ES6A 1KJ3H 3QHZH 4NN5B 5EZLA 3SDCA 3SKMA 3C08H 1BM3H 1JNNH 3HC4H 4Z76B 3PQYE 2FR4B 2OR9L 4K7PY 2X89D 1G9ML 1MI5E 3GKZA 5EOCL 2CRIA 1RUAH 3BD5A 5AYUL 3KJ6L 5LVEA 1OQOA 4U1MA 5GHWL 3C8KA 2HT4C 3WDIA 4P46B 1YMHB 5F8RC 4ALAH 4M6OL 3WKNA 5C0EB 5IBLD 4DCQA 3PGFH 5DTFB 1I8KB 4IRZL 3HZMA 5IBTH 5A3ID 3FKUS 4OM1L 5FKAB 2XZCL 3NZHH 5DVOA 1PX3A 3TVMA 3STLB 4JCLA 5HYJA 3JV6B 5T5FH 3UBXG 4R4ND 1XGTA 1JPTH 3N1PC 4JFPB 3UYPA 4HX1A 2HFFA 4G8EA 4QHNB 2I60L 5TE6H 1Z9SA 4M5ZL 5T1KB 4YIQA 5J7CC 1BFOB 1WZ1H 5FYJU 1PZ5A 1MFBL 3ULVF 4OLVH 4XPTL 2H2PC 4E5XA 3FO2A 2IAMD 4E0RB 1P7QA 1RZJC 3RY4A 3HE6A 5I1LA 5E99L 4MA7L 3VA6A 3VJ6B 5J13C 4C56E 5DD1L 2R0WH 2FYYB 2EDEA 4D0BB 1FFOA 1WAAA 1HKLH 4TOYH 5F9JB 4HS3B 3K1DA 1IAIH 5TF1L 5EU4B 5IJVA 4G6MH 2L4OA 1NCDH 1NGWA 5KW9H 2GSIA 4YXHL 4NZTH 3MRMA 5DHXB 4NCDA 1EO7A 3RU8L 3OKKB 5KG9A 4PTUB 4HLZH 1TNMA 3MUZ1 4QYOA 5FEBA 5FECA 1R3KA 2ARJQ 1I1YB 3QCTL 3UYOD 4LVOB 5DRWA 4L8CB 2IG2H 5TE7H 1G9NL 3LKRA 1SMAA 3EHBC 3QXAB 4C4KT 3FJTA 3MRNA 4NO5B 3FN0H 1A6PA 1IC5H 5LQBH 1RZ8B 4JO1H 5DQJB 3LQAH 2AXFA 2NW2B 1VEPA 3AREA 4MS8C 3PL6C 2DQJH 1JPSL 1E6OL 2EZ0C 4KU1A 4GQPH 4BQ9A 5I1JL 5CBEA 3WIHH 2C7UB 2VQ1A 3C2AH 1R3LA 4KY1L 3ZKMD 2FLBT 1AC6A 1CD1A 3FQUA 5GSRB 1E4JA 3UCRA 5L2KE 3ALXA 5GGSA 2EDOA 4PRBB 1A7QH 4YBLB 3D87B 4LHUB 3ECBB 4EI5D 4FQXD 5MP6H 4NWUH 4NFCA 3SOBL 5I1CL 3MOQA 3ARRA 5GGTA 1KIRA 3LQZB 4EDWL 3X3FH 3HZYB 5I8EA 4YUEL 5BRZE 1UJTA 3BYYA 1RVFH 3KLAA 3S3PA 4FFZL 1S9YB 1RU9H 3TCLB 4RAVA 4R90H 4ZS7L 4PYHA 1MHEB 1U91A 3VG0H 5MENE 4BFIA 1KUMA 3UROR 3FFDB 3ULUH 2JB5H 4LNVA 5JOPD 3FZUD 4WWKB 3LDBB 1N7MH 3O45A 5C0NC 1GC1L 1DQDH 3GIVB 1J12A 3CMOL 2VL5A 4U6YA 3QNZA 5LCVL 1WBZA 3OGOE 5I1KH 4Y2DA 3A67L 4JB9L 4JFDA 5EPMA 2V5RA 5B8CC 3RZCA 2XNAB 2DQIL 1BJ1J 1H8NA 3NAAL 2D0GA 4BH7A 5HYEA 4Q9QH 5MEQB 3I6LD 5KVDH 3UPRA 4ODXA 1RQ5A 3O6FA 3K2MC 1EFXA 5I9QB 2I07A 1NMBH 4NKMB 4X4YA 5L2JB 5E00B 4MAYD 3U79A 5ENWB 2NW3B 3RDTC 4JN1H 4F8TA 1S7TA 1N5YH 5IB1B 2CRMA 4OFIA 2VZTA 4MD5B 5I75B 2VNCA 1G9EA 1U3JA 4KTDL 4I0PC 1ZT1B 2E7LC 2DM2A 3MLUL 4KV5E 1QBMH 3G6JE 2EDNA 3I50L 4LSSL 5ERWA 3RA7H 5I17A 1JI2A 2YD2A 3IXAA 4PJ8B 3TN0B 1YYMH 2FLRT 4MQXD 3BHBA 4R3SB 5BMFH 1R0AH 3CXHJ 1Q9WA 4K94L 4ZUWA 1WTLA 4NKOA 2R1WA 1C8PA 4IOSD 5DVKA 3T1FA 3D39B 3QULB 1KEMH 3VWKA 5JR1L 5IB4A 5IT2L 5HPMB 3FTGB 1DL7H 1TNNA 2R8SL 1TVHB 3D0LB 1RMFH 1T0MA 2J12B 3BDXA 2MKLC 2VITA 4X6DF 4JZNB 5I8CB 3RY5A 3IAPA 3CCHA 3LEVH 3QJHB 5SWQA 3U82B 4ELMB 4WV1C 2HKHL 5FA3A 1OWRM 3Q6FA 5LXGL 1OSZA 2EDDA 1T89C 3VXNA 2D03H 3EO0A 2J5LB 4YFDB 1SMOA 3FAXA 4KVCL 4P0DA 4LMQE 4C57C 1S8DB 3RNQB 5KJRL 2MSPA 4U6XA 2B8OT 2DIBA 2EDQA 4U1IA 1HYSC 1MLBB 1CFVL 1UH4A 2HTKC 2EIBA 4OTXL 3AXLA 3TIDB 5HHXL 3GBLA 3U0PA 2EDKA 4N8VB 1U8KA 3S98A 2BCKB 4MJ4A 4QTHA 4IBLT 2X05A 3T77A 1KCVH 4PRAA 3TNNB 4XPHH 4QRPD 4O51B 2MWCA 2E7CA 2FX8H 2O61A 3S9DB 2C1OB 3VWJD 3F7VB 5F3BA 3MOAH 1DBMH 1MCFA 5K9JL 2OTWA 1F4WL 3GKWL 4JR9L 2ATKA 2VDKH 5AD0B 3PNWA 3PG2A 2HRLA 2Z91A 1NLDH 1NGYA 4R8WH 3HPLB 4OB5L 1N59B 3PWUA 1NSNL 4H1LA 2XN9D 1I1RA 1CDYA 2VH5H 4W4NA 4PREA 1BMGA 4NUJA 3PP4L 5DJDA 1FBIH 3CVHH 7FABH 4FFVC 1A7OH 4R0LA 1A5FH 5C07B 4JJHA 3EDEA 2EXWD 2FRGP 2IPTL 1FJ1B 3GSQA 4OD3L 4HULB 1VERA 4V1DB 3BUYB 1GPOL 1QLEL 1YEGL 2A83A 3EO1A 4Z7UF 1QFWI 3VGGA 5FUZH 1J0JA 4NQEB 1MCOH 4I18C 3LD8B 4G3YH 1E27A 2OBGA 3OMZA 4NUGH 4PJ5D 4U1KB 5JW4M 1LP9A 4XAWH 5BXFB 5DEFB 4GT7A 4LLWB 4W70A 2OL3H 5CMAA 4Z7QF 5ID0A 1SYSB 3LAFA 4PTTB 4H20H 2G9HB 1CLZH 3RIAK 1FNFA 3TA3B 4M7ZC 4XZUB 5DUML 5FKPA 4HXBL 4WW2F 5LGJA 4PLJC 4ODHL 3GMMB 2ZSWB 3FQRA 5DJ2B 1A9EA 1KB9J 4LEXL 4YXLL 3BP5A 4P9HC 3TBYB 1ACYL 1FNEA 4JO4H 3WJJA 2WLZA 2DLIA 5CS7A 4MNQA 3MV7B 2YD9A 3HB3D 4JDVB 4UT7H 1M7DB 2FZ3A 3EZ8A 2NY2B 2BVOB 2OR7A 2Q3ZA 2NR6C 2R2HB 2XWTB 2EDJA 5HDQH 1J1OH 3UTTD 4Y2OA 1CD0A 2DDQL 1UZ8A 2MKWA 4QHUA 3JWNC 5IK3B 4D0DA 1QLRB 3TPUA 1OPGL 1CD9B 4G8IB 5DD6B 2ZOLB 2O93L 4Y5XB 4R2GB 5EOCJ 1AQDB 2EH7H 1U8NA 3L7EA 2H8PB 3P9LA 5DLML 1NFIA 3RTQB 1MRFH 2JK5A 2NY0B 3PGCA 4D3CL 2DWDA 5IFAH 2DJUA 3CUPA 2F19L 3V9FA 2FIKA 4K55A 1OB1A 3KGRA 3KJ6H 5AYUH 3RL1A 3NCMA 5C0JB 5FYKL 5GHWH 4POZC 5HVWA 5J9PA 4OCYL 3C6LA 2P8MB 2DLGA 4NDMB 2OJEB 4PLOB 2NY4C 4B7LA 1MNUH 4OSUL 4G8FB 1NANI 1RHFA 5KSAA 2XZCH 5F97E 3L5WB 3L3KB 4F3FA 2P46B 4UOW1 5B3NA 1J0ZA 1YN6A 3FRPG 4Z78A 3MLTA 4ZD3L 4QRUA 5I1AA 3SJVD 2Q6WA 2WBJB 2A1WL 1REIA 1RURH 1L7IH 2DQHL 5D5MB 5IP4A 3L3JA 4P23A 2GAZA 4KUCD 4IRSC 4FQ1L 4DGVL 2ZKHL 4OFDA 2VUOA 4U1SA 3UJIL 4UAOC 5DC4B 3FT3B 1BLNB 3JTTB 4WGWB 3U9UB 1FAKT 5DXWA 1HSBA 3O3EB 1ZLUH 4U7SA 4AQ1B 2EIDA 6FABL 3GIZH 3HHRB 4GAGL 5TF1H 2R0LL 1X3DA 4KTEL 3L5JA 5TDPB 2HWZL 4QHLA 5L9DH 3DHMA 3WN5A 4Y5VB 1T21B 4PGEB 3SDAD 5B38B 5IEKB 4LLAA 4DFIA 2BSED 1IZJA 2MHAB 2A6DA 4XNXL 2CR3A 1S7XA 3MOBL 1HIML 1I3RB 3BWAA 5IR1A 1WZKA 3AU1A 5SWSB 2QQNH 1CGSL 5D1ZA 3FONB 4J1UA 5J6GB 4QXUH 3D39E 2BVPB 1ZSDA 4Y1AD 4OFVA 1HILA 3LEXA 5H35B 5MEOB 5KVEL 4OJFL 3CVHB 1WIOA 4M1CC 2ZNWA 1E6OH 1ZHBB 3WE6B 3QXTA 2Z93A 4PFEA 5AG9A 1I1AD 1KJ2L 5EN2A 3RWHB 2ZNXA 3GZKA 3PABA 4P2QD 1JYVA 4ELME 4NO2B 5JXEA 4P5TA 2L7UA 2BNRD 3LIZL 1BAFH 1KT2A 4EOWH 5IW1A 1RY7B 4G6FB 4MVBC 2QR0A 2QKIA 5E6IA 1QNZL 4HFUH 1NGPL 4UIKL 1AGDA 4R7NB 5I1CH 1VKXA 1UVQA 3HC0A 1L6ZA 3DPBA 4M6ML 1SJHB 4GUPB 4Q0XH 4NN5C 4RGNB 3CFEA 2HT4D 4YUEH 3VXRD 2Y1VA 4ODUB 4HCRH 1BD2A 2G2RB 4DTGH 1RZFL 5I16A 5DMKB 5HVGB 1PG7X 1BZQK 2A9NL 4X6BA 4KAQL 3CPLA 3KR3L 1OY3B 3R4DA 3MROA 4EN3C 3FB7B 3L3OA 3QUML 4HJGB 4PRNA 5ID1A 2AK1L 5JQ6L 4HWBL 1PG7L 5JPNA 5C07E 4IOIB 3FQNB 3E1F1 2VDLL 3RGVC 4YK4C 3EJYC 3RUGF 3NIFF 5F3HA 1GC1H 1QBAA 3THMH 2H2PD 1UKSA 4ODSL 3Q5TA 1FFNA 4V1DE 3CMOH 4ZNEA 5LCVH 4HXAH 3D18A 1E4KA 1I9RL 3JTSA 4NQEE 1MFCL 2DQIH 5BZDB 4WO4A 1FPTL 2W9DL 5TGBA 3P77B 3B6SB 4LCWA 2R15A 2CH8A 4EEEA 3OKDA 4YPGA 2BFVH 1UB5A 4Z7VA 5BVJB 3DWTA 3VRLF 2HTLC 3QH3B 3CFIC 3O3UN 4J8RB 4Z95L 3OKOB 1YEJL 2G5BB 5JOFA 1AD9A 5KAQG 3GRWA 3O2VL 1YMMD 3RQ3A 4KK8C 5JO5A 4KTDH 5IESH 1HSAA 1P2CA 1AGBA 1W0VA 3KYAA 4NQUA 3EHBD 4GXUM 4DVBB 1WSST 3QRFM 3F5WA 3RWJA 2YMXH 2IADA 3K2UL 2ZCHL 5MERB 5B39B 4MCYB 4NRZB 4GS7B 4A6YH 4MS8D 3PL6D 2X4QA 3MV7E 4H8WL 4HIEB 1YN7B 4OLYL 2R56L 1W8NA 3LEYL 1AO7D 1DANT 4PJAB 5D1XA 1G1CA 4Y7MA 4D94A 1T20B 4HK0A 1MCEA 1T7VA 2F54B 2JB6A 3QEQD 1KELL 1X44A 4MWFA 5JR1H 4XP1L 1BZ7A 3ETBF 3VFSB 2B7DT 3F58H 4KUCF 4OLEA 5HDBE 4HUNB 4JFHE 5TH2B 2HKHH 4MB3A 2HJFA 2UYLA 2ADJA 3KYMB 3QWQB 5JW4R 1DBKH 2EE6A 5DT1L 2DQGL 4YBLC 4OCXL 1JP5A 3GMRA 5F6HI 4KVCH 4HWUA 5DZLA 2Y72A 4NKDA 1AP2B 4H88L 5ANMA 1CFVH 3QZWG 3CH8A 1JGVL 4NGHH 5JHDD 1DVFA 3TIEA 1IZKA 1EEYA 2P47B 4GKZA 3SCMB 3VD7A 1U8LB 4IDLA 4KC3B 3S5LG 4O4YH 3WD5L 4X7SL 3QO1A 5C1MB 3DROB 1P69B 3EYSL 4M6AA 4M8QB 4TUOB 1S9XA 5D5ME 4QY8A 5IM7A 1HHKA 1YEEH 5K9JH 1F4WH 2ZUSA 5H37H 5C0ND 3GKWH 1B3JA 2IMNA 3KPSA 4JGMA 3KWWB 4KH2A 4YBHA 4YHNA 3SKOA 5JW3L 4MXQC 1FIGL 4MB4A 3LS4H 4XCFH 1ZT7B 4OB5H 5EZIL 3IETA 5E9DB 5GGTL 4JY5L 1AGFB 2NNAB 4UV7L 1YEIH 3PP4H 1RJZB 5DSCA 5C6PB 5DF0A 2YD7A 4P2RD 3U83A 2NY6B 3HKFA 3LDBC 3DX8A 3FOLA 4PJDA 2P5WD 1P53A 3ZTNH 2ADIA 4X7DC 3SKNA 2IPTH 3PDGA 1NPUA 2B0SH 3QPQC 4L9DA 4BKLA 5GRUL 1HH6B 5FGSA 4UOJA 4HWNA 1P7KA 1EHAA 1AQKL 3HI5H 3MBEB 1TPXB 3GB7A 3NPSB 2CLZB 3TH3T 3D48R 3L3HA 2J6EA 3KYNB 3RDTD 5FO7A 4FQIH 3NH7H 3U2SB 1JGLH 2VLRB 3QYCA 2EYRB 4I0PD 3FFCD 5SWSE 3MJ6A 3EUUA 5I9QC 4LSUL 4X7TA 1YPZB 1CTOA 3LH2H 5KZCB 2C3GA 5T5NG 5DQ9B 3Q1SL 2E3VA 4JDZA 4M03A 1T1XB 5KVGL 3IDXL 4P9ML 1N6QL 4QO1A 2AI0L 1I7RA 4M7KH 4HXBH 2P44B 3QNXB 3ARBA 4HFWB 1HQ4B 3BGFC 1QR1B 4ODHH 2YPLB 1A7NL 4PJ8C 3PWPA 2ITDA 3OJVC 3UTSD 4FABL 2NY7L 4ZOEA 3OAYH 3T08A 1X5JA 3HLAA 3LRSB 2N56A 4JFEB 4JVWA 3BZEB 1ACYH 1ED3A 4HGWA 1UKTA 3BUTA 5AWNL 5IW6B 4LSTH 1OAXL 2CD0A 4QRQA 3GSNL 3A6BL 3K0WA 4F58H 1Z9OA 3OAYK 3OQ3B 3U0TA 2CGRL 2OMNA 4GG6B 3T8XA 1CK0L 3ZDXF 2YD3A 4PLNC 1OW0C 2E7MA 3MCKA 5DD0L 2HFEB 1XGYH 4QXGH 5CHNA 4RGNE 3EDJA 1MFDL 3H3PL 2X10A 3QSKB 4ONHB 1OPGH 3SDYL 3W9EB 5L6YH 1EBAA 1RZKL 3OHXA 1FYTD 1PQZB 2DYPD 2PYED 4X9FA 3FT4B 4K8RL 4KRLB 2APTA 4LCCB 3FB8A 3VA2C 5B21A 5HYQA 2VE6A 3N0PB 3QDMB 3FQXB 2BVQB 2V5SA 1M4KA 1HYSD 4ZUSA 3QZWB 5C9JA 2HTKD 1DQML 4WWID 4GW5B 4R7DB 3HUJF 1M7IB 4ORZC 5CZXC 2J5LC 3TBVA 4Q6IC 2CIIA 4A6YB 1CE1H 2B2XH 3S5LB 4Y19A 4KXZI 2X7LB 4YDJB 3X13B 4PJEA 4CNIB 5CJOL 3HI1B 4OSUH 2WSKA 4KJQC 1MCWM 2DMBA 4LK4A 3LQMA 3DXAA 1F45A 3LQAC 2HVJA 4X6CB 43C9A 1ZVHA 4JM2A 2VLLB 1ADQA 2A1WH 4FFVD 1U3HB 3QA3A 3DX6A 3V4PL 1KJVB 1EK3A 4X98A 2AK4A 1DLHB 4FQ1H 3RL2B 2C5DC 4P4KC 3REVA 4DAGL 2QSCH 2ZKHH 4NQCB 4KK5C 5EWIL 4I2XA 3QDJA 3CDYA 4MHHI 1IGIH 3WO3B 1WBXB 3F6LA 5GZND 3WFZA 4HZAA 4PGDA 5FYJE 4MA8L 4GAGH 1NLBH 2R0LH 1X5FA 1RJYA 4KTEH 3AMLA 3MLZL 2XPGA 3UYRH 4Y16B 1V3LA 4PJXA 4UDUB 1TENA 4N9OB 3D25A 4Y5YB 3T3PF 1P6FA 1F4YL 1BQHA 4Q9CA 2GEEA 1XGRA 1S7WA 4K71B 4ZYKB 4Z7NE 3MOBH 3O8XC 4PJAE 5JORA 5DEGA 5JXAL 3KYKL 4PLJD 1QFUH 2X4UA 4HKJB 5HSFA 1MFEL 4JHAL 1NJ9B 5DC9B 2ZCKH 3ULUC 3FB5A 2DAVA 3EO9L 1EXUB 5T1MA 2R4RL 3BGMA 3RWGA 4U0RC 3ZZ1A 5KVEH 1KFAL 1EGJA 2P24B 4GRMA 5ECJE 1ZHKA 2AGJH 2V2XB 4WGVB 1HHIB 3U48A 2J8UB 3QIWB 4J12A 1GCFA 4PJHA 1KJ2H 3INUL 3L7FA 2DQEH 2NR6D 8FABB 1OAKH 3U30C 2YOCA 1F97A 4M7LT 1II4E 2RCSL 3T0WA 1VFBB 3U7WL 2PYFA 1AXTL 3X17A 1KJMA 2NY5H 2W9LA 5JMRA 3D3VD 1ZKAA 1QNZH 2CKBL 2NY2C 3LN9A 4HF5L 1NCNA 1UEYA 3NCCB 4UIKH 4KZDH 4M00A 5K33A 4AM0A 4E42B 2FJHA 1FL3B 3O3BA 4LLYA 1H8SA 1YC7A 5CBAA 1Q38A 5FK9A 1WQVT 1RZIA 4Y5XC 2DOCA 4R2GC 4POZD 5ISZD 1G6VK 3FCTB 4GBXB 2CK0H 4YQXH 1PAMA 3NFSH 2KBGA 4IOFC 4IIQB 3RTQC 1KYOK 5EBMB 1OL0A 2NY4D 1RZFH 3H42H 3K7UA 1X4YA 2XQBL 1BQUA 1WITA 3V4UL 4WU7B 4MCZB 5E9DE 2D0FA 3ARDB 4G43A 3IDMB 2P1YA 3P30L 4AY0A 3WNNA 1MCIA 4HWBH 3RWCB 4WVRA 5ALBH 3FQTB 4OD2B 1W72A 3DX9B 2Q76B 4AG4H 1EERB 1MUJA 3DYOA 4OGAC 2GJ6B 4IRSD 3X12B 4OZHA 3IFNH 4KI5E 3ZL4L 2FECI 4FXGA 4J3WA 4PLKC 5KAQF 2VXTL 2OTUB 1RHHA 3QUZB 4JN2A 1UADC 1R3JB 3VFVA 2CRZA 1J10A 1I9RH 3C60C 3HG1B 1CWVA 1IAKB 4ZPVB 5A1AA 4L9LA 1Q1JH 4ZAKA 2JE8A 1A6VL 3DYPA 4LVHC 2VLRE 3ZT6A 1G84A 1GGCL 4AEFA 1YPZE 2YBRA 4PGJA 2FD6H 3QG7H 4P2CG 4O5LL 4GKNB 4P3WA 3CH1B 2W59A 4EI6A 1YEJH 1FNGA 2BNQD 2K1MA 4FNLL 5HHNB 5MEPA 3T0BA 5TPWL 2G75B 2PUQT 2AERT 2Z4QB 5C0CD 4UZGA 2YPLE 4GG8A 5JW5B 3PWVA 4NJ9H 3WXVH 5EOTA 4GJTB 2IC2A 4DK6A 5IQ9B 1JRHL 4P5MA 3K2UH 1T1ZB 3E3QE 4WJ5A 2XKSA 4JFEE 2GJJA 1K2DA 1OLLA 4M1CD 5KS9B 4H8WH 5GJTL 3I3BA 5FHAL 5GRVL 2R56H 2NXZB 3QUYB 3KPRB 5IG7A 4GG6E 1KLGA 3OAUL 3G9AB 3SDDC 3TBWA 4IRJA 5KSBA 3IS1X 4MGXA 2O5ZH 5EA0H 3DV6B 1KELH 4JY4A 4KJWC 4LVEA 4NT6B 4MVBD 1T5XB 4B50A 3MNVA 1CICC 5LKNA 3MYJB 3MMEB 3GK8H 2IMMA 3QDME 4KGJA 1OD7A 3W0WB 3MRRA 1R3HB 3IJYB 3L1OL 1KV3A 2RBLA 3ZKSD 4DEPB 5D7JB 4NO0A 4IS6B 1BWWA 2AV1B 3O3AB 5IMKB 3NCYP 1HXYB 2CDGB 3GHEL 3ARVA 1INDL 4GSDH 4AT6A 5ADOL 3OL2A 3S88L 3WFEL 2E6QA 4RWYH 1PW3A 3NABL 1JWUA 4BSWA 5K9KA 4KPHL 3M8OH 1G7QB 1QSED 4X6CE 2MCPL 4AIZA 1QRNB 1GOGA 4QRTA 4EN3D 3MUY1 2EKJA 1LE9B 5E8NB 3ZE1E 4L8BA 3QCVL 4JO3L 3RGVD 5ALCL 4ELKB 3EJYD 4QNPF 1RZ7L 4GXVH 1FIGH 4NQCE 4XAKE 1CFQA 2EE2A 4OAWA 5EZIH 1JWSA 1Y0LB 3AM8A 5GGTH 1MJUH 5DS8B 3W9DA 3OF6D 5HYSB 4JY6B 1N3NB 5IHZA 3BPCB 5CZVL 1B90A 1YEKL 5IEHB 4OI8A 5FYLH 5T1KD 3MZGB 1QFOA 5J4MA 2YD1A 4TULL 3ROOB 1XF5A 3RPIB 1A3QA 5CP7A 1LO5B 1AXSA 5BW7A 3LKPB 2X4TA 3RWIB 5GRUH 4TSAL 3SGEH 1A6AB 1MH5A 1T04B 1GL4B 3MRFA 5IVNA 4TVPH 2HTLD 2FL5B 1UM4H 5EU5A 3HZVA 4LVNB 5FOBA 3FT2A 4HIXL 4LNRB 4MD4B 3VXSB 4I4WA 3H3KA 5E4EC 3QIUC 1OAUH 5EIIA 4KK8D 2QQKH 4PP1C 1X5AA 3ULSB 1S7UB 4LSUH 4WTZA 4XX1G 4EIGB 2OXGA 3OGCA 3G5XB 3SQBA 5IROC 5J12C 1XH3B 1XF4A 4TVSa 4PGCA 3ES6B 3VH8A 1AJ7L 2D9QB 3BKJL 4LPVA 5EZLB 3HMXL 3SDCB 2GK2A 2DKSA 1Q9LA 5KTEL 2WP3O 5FO9A 5BV7H 3F12B 2J8UE 3R1GL 4O9HL 5IWLA 4OGXL 1NL0H 3RZWA 3BRDA 4FABH 3OB8A 4YGAB 2NY7H 4OF0A 4AENA 4U1MB 3DJ9A 3C8KB 3K8MA 3LVEA 4Q9RL 1NEZA 3EBAA 4DCQB 4Z0BH 2HJLA 2BSRA 4WI7A 3HZMB 1HEZA 3FO0L 1JE6A 1CK0H 3DRQA 1INEL 5ELIA 4FQCL 5DK0A 3C8DA 1OF2B 5HYJB 1MFDH 3H3PH 1JHKL 5EBWA 1XGTB 3ARFA 4HX1B 4LHUD 3VXUA 2HFFB 1GAFH 4G8EB 4ONGL 1ZT4A 4JFOA 4M7JL 1PZ5B 1IM9A 3FO2B 5D6DC 1P7QB 5IGXH 5HGDA 3C5SA 3HE6B 5I1LB 3EFFA 4UV4L 2PXYA 4F15B 1FFOB 2V9RA 1IE5A 2Z8VC 3PQYA 4YHMH 5CJOH 3L3DA 1NGWB 2GJ6E 2GSIB 3MV9D 3NCFB 3MRMB 1E4XI 4YR6A 3BYTA 1DE4B 1NCTA 5F9OL 3MV11 4MXQD 3SCMC 1BJ1H 5T3ZE 5KG9B 4I5BA 3KS0J 3N1QC 3HG1E 4QYOB 5GGSY 3U4EA 5FECB 1R3KB 4B7IA 3C5ZA 3MRLA 4KV5F 5DD5H 4G6JL 4QLRA 5DRWB 1FNSL 3V4PH 2PW1A 3P11H 1NBVL 3BD3A 1CLYH 3I85A 3QPQD 4RIRA 4DAGH 3MRNB 5C09A 1A0QL 4QHKJ 5FCUH 2AXFB 3AREB 3I3EA 3W82A 1MEXH 1MJ7H 1RJLA 3OB0K 4J3OC 1QFWL 2X4OA 5HVHB 1E28A 1X5LA 2QQLL 5CBEB 2VQ1B 4KI5C 1WCBB 5BO1L 3MLZH 4L4VD 3FQWB 1TJGH 1CD1B 4GW1B 4LSPL 5C0BA 3FQUB 3UBXI 4Z8FL 1HWHB 3NPSC 2CR6A 4L3EB 4H1LH 5M7QA 1EDQA 5GGSB 4EBQL 2A6IA 5TJWK 4LCIH 1ORQA 4OFYD 3S35L 3SPVA 5KS9E 1HN1A 1QO3A 3CXHK 4LDEB 4O2EA 1BF8A 3OR7A 3PP3H 3KPRE 1M1SA 3T0AA 3CZJA 1GIGL 2O5XL 3TWCL 4OKDA 4NP4L 4BFBD 1XCTA 4JHAH 4LPXA 1QEWA 2C4XA 5FXCH 3EO9H 1IEBA 5E95B 5TFSL 1BZ9A 1KIRB 2R4RH 4PG2C 4K3EL 2IEPA 5I8EB 3QBTB 2P5EA 4JVUA 1GC1C 3KLAB 3STZA 5DGRA 5D1QC 1H5BA 1YNLH 2VAJA 4UTAL 1S9KC 2H3NA 3W0WE 4RAVB 4HC1A 4JG0H 4OM0L 5L88L 1DBAH 1U91B 2EIZA 1LWRA 2AVGA 3UP1A 5T3XH 3WS6A 3BAEH 5ETUA 2RCSH 1JYXA 2ZG1A 4BFIB 2I24N 3CXDL 4ZTPH 3IDJA 1AXTH 1D5IH 4UINL 3MUJA 3BI9X 4JVPA 1QYGL 1IAOA 3O45B 1AFVL 3RI5K 2JJSA 5GXBB 3QEGL 2VL5B 4U6YB 1TZHA 3QNZB 3UTQA 5L2KA 1QRNE 1MIML 1WBZB 1ZANL 3F65A 4NNXA 4Y2DB 5CZXD 2AW2A 4JFDB 4M3KB 5EPMB 1U8IA 3RZCB 4LCCC 5F7UA 4KRPD 5BV7B 3BP7A 4LHJB 3ZHLA 4BH7B 3UPRB 5I8OH 1PLGH 4KJQD 2XQBH 1F90H 1EFXB 2I07B 3N50A 5GRWA 4X4YB 4QXTA 5DHYA 3P30H 3Q6GH 1IAII 2JJUA 3ARTA 4ZFZA 4U1GC 1S7TB 1DSFH 3FB6A 2DQUL 4LP4A 1BWMA 5E8PA 3P0VL 4P4KD 5ERWB 1TQBB 5I17B 1SJEA 4I0CC 4J3VA 3IXAB 1PG7W 4KK5D 1QLFA 4JE4B 4U49A 3BHBB 4FFYH 1NBZA 1Q9WB 3VXSE 1A6VH 1YQVH 4ZUWB 5GRXG 1HDMA 3JUZA 2GSGA 3SO5A 2R1WB 1RUKL 1LEIA 2VR5A 3SEPA 4V1DD 3NCJL 3T1FB 2JJWA 3VWKB 1GZQA 4O5LH 5IB4B 1N6UA 3DGGB 1T2QL 1XIWC 1MQKL 4PJBA 4HT1L 1T0MB 5TPWH 5B3JE 1R5VA 3O8XD 3SKUD 1NCCH 3CCHB 5SWQB 4MQ7A 2EDWA 1Z5LA 3D0VB 3CU7A 4Y16C 2I9TA 5FA3B 3Q6FB 3ULUD 3UZVB 3NCYS 1OSZB 4NYLA 4Y5YC 5FO8A 3VXNB 1NC2A 4LQFH 3EO0B 3RVWC 2ZUUA 4K71C 2DN7A 5CGTA 4PJ7A 2QADB 1P9MA 5GJTH 2LABA 4U6XB 3RBGA 1OGTA 3G6JA 2IQ9H 3VGEA 4NBYB 1CQYA 3ZLQC 3JVGA 3U0PB 1U8KB 5HYJE 4JG1L 1CE6A 4QTHB 3U36A 3T77B 3TC9A 1F3JA 2O61B 3MV7D 1P1ZA 3QIWC 5F3BB 4HWEL 2WLYA 1V7ML 4GKSA 4PJFB 2ZCLL 2NY2D 2OTWB 4JPIA 5CIPA 2ATKB 3PNWB 4Z18A 3ZKND 1NUNB 1NGYB 2A6KA 2YK1H 5J56B 3PWUB 4H1LB 3OKEA 5C86A 2MQ3A 4PREB 2CLRA 4NUJB 4R2GD 5DJDB 1WAAE 4EIZC 5TF0A 3WO4B 4R0LB 1EGJL 3GHEH 4TYUA 4P2YA 4JFHD 2WUBL 4IOFD 3PHQB 3RTQD 1CTNA 3GSQB 5TQ2H 1M71A 1A6ZA 4KPHH 4NCC1 2FX9H 1CLOL 2A83B 3EO1B 4P46A 3VXMA 1I3GH 4IM8A 5DTFA 3TYFA 5GGVL 4IIQC 1VA9A 4FQLH 4EQ2A 1TVBA 1LO0L 3BO8A 1E27B 4KRNA 5ALCH 5I76A 1TFHA 3RVUC 4OGAD 2VYRE 1LP9B 3I9GH 3AROA 4PLKD 4O58H 2FATL 4KDTA 3FOMB 5I66A 5CMAB 1VADA 5ID0B 2Z35A 4IHOA 3C60D 1CGTA 3QRGL 4QHNA 1NFDF 1OSPL 2QSQA 3S3SA 1C5DA 3QFJA 5LGJB 5FKPB 4KQ4H 2JLLA 3E6FA 4KGLA 1J1PL 4URTB 4GRWH 3WV0A 3ABZA 3LN4A 3FQRB 4TSBL 4TSAH 4XPFH 3VJ6A 1A9EB 4L3EE 1UFUA 1U8PA 1XCQA 2XXMB 3BP5B 1FNEB 1JUFB 1QG3A 4MNQB 1K85A 4MAUL 2FZ3B 2BX5A 4J6RH 3V0WL 4FQJL 2AEPL 4TNWF 4PB9H 4U05A 1UZ8B 4PTUA 1A2YB 4QHUB 1RZJL 4D0DB 3TPUB 5EUOA 4PYGA 1IRAY 5FYLE 2PNDA 2EKSB 1U8NB 3QR2A 5DUPL 1ZE3C 3L7EB 3R1GH 3LMJH 1NFIB 1D9KB 2JK5B 3PGCB 5BJTA 2JCCA 2DWDB 3BPNC 4OGXH 3SDDD 3GSXA 2GI7A 2FIKB 4TVPE 1VEMA 1B2WL 3TYGH 3J8F7 5L8LB 1CDHA 1DN2A 4KJWD 5KBNC 3BDYH 4ZFOA 3FHAA 5J9PB 5DD3H 1CICD 3C6LB 2NXZC 3GRWH 3QUYC 4MJIA 4L1HA 4NWTL 3VFUA 4HPOL 5KSAB 4F3FB 1WICA 4FQCH 1QSFD 2F58L 1ODAA 3MGTA 1YN6B 4Z78B 3MLTB 1TJHL 1KACB 1LO4H 4JFDE 4QRUB 1AHWA 2Q6WB 4K3HA 1NH6A 2J8HA 3L3JB 4P23B 1CS6A 3DSNA 4U0QB 3B9AA 4TQEL 4OIAA 3WYRA 4DEPC 2HN7A 2YN5A 1BPVA 3UO1H 3NCBB 3V8OA 4M6NH 1I3VA 4U1SB 1X4XA 3HZYA 2QSVA 3PV7A 1HSBB 4S2SA 2VR4A 3V52H 2XZAH 4DQOH 5DJYA 1Z3GH 1GRWA 2ORBH 1MHEA 3ULUF 4LGSB 2GK0B 2HLFC 5GRJL 4XPAH 3WN5B 3UBXA 5CJXC 5CGMA 1DLFL 5HYFA 4ORGA 1FL5A 1PSKL 5GS1B 3WLBA 5DHVA 2A6DB 5DJZA 1FNSH 1S7XB 1F4HA 4YHLL 3BWAB 5IR1B 3AU1B 3GIVA 1WISA 3QO0B 4M48L 2WBKA 1V3JA 5D1ZB 3VGDA 4LGPB 1GGIH 3SE9H 5A40E 5C8JA 4HUVA 1A0QH 3KXFB 4H25A 1KCKA 1ZSDB 2ZJSL 3H2WA 4YHOL 4ZDHA 2H1PL 2NY5C 1HILB 3LEXB 2X1PA 2R69L 4KKBC 3CFCH 1IILE 1QHPA 2Z8RA 4MSWB 3VI4E 2Z93B 3QIUD 1OAQL 5EN2B 1NGQL 1K8IA 4PP1D 3V6OC 5D96C 5BO1H 5LWYH 1PD6A 3O0RH 4LSPH 1ZLSL 3QWOA 5F21B 4Z8FH 3G08B 1KT2B 5LGHL 4EBQH 2ADFL 2OI9C 4LVNC 5ENWA 2QR0B 2QKIB 4NRXA 1MJJB 4DGYL 3S35H 5C2BH 4MD5A 4KZEH 4Z7OE 1LDPH 4DOHB 2GUOB 2WMPA 4AL8H 5J6HA 1AGDB 1GIGH 3F7YA 4PJCF 3TH2T 3C5JA 1NKOA 1VKXB 1UVQB 1Z0MA 4AZ8A 4JO2L 2W60A 4WHTA 5D71L 4HLJA 4WI2A 1JHTA 3SDCC 3CFEB 1ZA6A 3TJEL 5LGKA 2J6EH 3QDGB 1EJOH 5TQ0L 4PJFE 5FF6B 3DUSA 4EKXA 5I16B 4PJ9C 1E6JH 3ARXA 5CLWA 2F54D 3D39A 2D0HA 4X6BB 2R2EA 3BVNA 1I1CA 3NIDE 1FFPA 2HH0H 3CPLB 3IDGA 4DW2L 1IFHH 4QTIL 1NMCC 1DCLA 2Y36L 3MROB 3L3OB 4PRNB 5ID1B 1PY4A 4QRPA 3VWJA 5I8CA 1AFVH 3TVMC 5F3HB 1IC1A 2Q7YA 2X09A 4FZ8L 1FFNB 3EJZC 3DUUA 5HXMA 2OXHA 1KBGL 3D18B 1SEQL 2Q3AA 3LY6A 1E4WH 3WIIH 1S8DA 1RUPL 3HNSL 3T4YA 3SE3A 5TGBB 3Q2CA 3P4LA 3T0VA 4ZFGL 4LCWB 4KRMB 1WFOA 4TUJA 1LP9E 3OKDB 3HE6C 4YPGB 1YEHL 5D2LA 5T3XE 1NANH 1UB5B 4Y4FB 4Z7VB 3RIFK 4F15C 4IMKA 2BCKA 3SCMD 4H8WC 4X6FA 4O51A 5HHOA 3D85D 5JOFB 3ZYOA 5D70L 3AUVA 3NOIA 1CFTA 1HSAB 1P4BL 1CXIA 3P0VH 1IGML 4PJ5A 2XQYG 3WNMA 1IQDA 1N59A 5E9DD 3RWJB 2J1KA 3VE0A 2IADB 5E1HB 3P4NB 4NBZB 2W38A 1SEBB 5C07A 4MNQE 2X4QB 2LVEA 2X41A 4RQQA 2GCYA 3VU2A 3PWLB 4XWGL 1MWAA 4WHDA 1J88A 1RUKH 5DJAB 5D1XB 4UTBH 1WWBX 2FEDC 2R4SH 1JF6A 3BUYA 4HK0B 2JB6B 2ZPKL 4MX7A 1F4AA 4MWFB 3MBXH 1TTGA 1BZ7B 2M1KA 3DVNA 1PKQA 1A4JA 1ADQH 2VLRD 3GMPA 3QQ3A 5C6TH 4DKFH 1UACL 1U8JB 3RIAF 2Q20A 2W0LA 1I85A 1JGUL 1NCAL 1FLRL 1IGYA 4CVWA 5DEFA 2D7MA 2HJFB 4LLWA 2UYLB 4ISVB 2ADJB 5GGRA 1OM3L 3ZTJG 5CD5D 3JWOH 4PTTA 3ZYJA 1N0LA 3GMRB 1YDPB 3O2WL 1MVFA 4FP8H 5TDOA 4XP4H 5D1QD 4NKDB 4WEMB 1T03H 3GMMA 1U58A 2ZSWA 4OQTA 5ANMB 5ICYA 3D1MC 4GRLC 1QTYT 2G60H 1OAZL 4UU9B 4LPWA 4XMLH 1ZAGA 2F9BT 1DVFB 5AAWA 3VXQA 3OZ9L 2PO6D 4HPYL 5C0GA 4JFED 3TIEB 1EEYB 3FAWA 4GKZB 3NN8A 1CBVH 4FN0A 5MHSE 1S9XB 4QY8B 5IM7B 1HHKB 3CX2A 5D7SL 4JPWL 4RBPK 1I8LC 2RFXA 3H9SB 1T7ZA 1XT5A 3SKOB 4YHNB 1TLKA 3BESR 4GO6B 5IMLA 3I02A 1B4RA 4WUKH 1CDCA 1QLRA 3IETB 1N0XH 5BOZG 4CADA 1EEZB 1RJCA 3I6KA 2EYSA 3GI9H 4P9HL 3R8BB 1EGJH 3DX8B 3HN3A 4PJDB 4XXCC 1Z9LA 3WKML 4MDIB 2ADIB 4MA1B 3SKNB 2MQ0A 2B4CH 4PJGF 4BKLB 3RVXC 4BZ1L 4AEHL 4HC1L 1M7XA 2Y5TB 1P7KB 5T1LA 3ARZA 4RCAA 2MFNA 2XWJB 4LAQL 3RZCC 2VXQL 2NMSA 3GB7B 1K6QH 3L3HB 5D7LD 3HE7B 4F37K 1LO0H 1R5WA 3O6FC 5ADPL 1V7NH 2ADGA 3EFDH 3L3KA 4X7TB 1JBJA 2XXCB 1NUGA 4KROB 2BRRL 3KXFE 2FECL 1XR8B 4Z7NF 4JDZB 4RGOL 3CLFL 4PJAF 5D5MA 3SDAA 1OSPH 3QXDA 3ARBB 1J1PH 2N4IA 2ARJA 3CMGA 3PWPB 4XAKD 2ITDB 4HKZA 2WM0A 1OLZA 2IFFH 3QEHB 3HLAB 4G8GD 1ED3B 4HGWB 1XIWD 1I9JL 1XGUB 3O3EA 4QRQB 4ERSH 1ZMYA 4DOHE 1J1XL 1W72H 3U0TB 4AIXA 3V0WH 3T8XB 3VWKC 4Y5VA 3MCKB 1EH9A 1DQJA 1HNGA 4P2QA 2R0KH 5CHNB 4JDTH 2BNRA 5I0ZA 5IEKA 1RIVL 3OHXB 3QDGE 4NSKA 3RVWD 1VFMA 1OQXA 5EO0A 5HYQB 3OKYA 1I3RA 3PDOB 3D2UA 5SWSA 2DI8A 4X7EC 1KEGL 5C9JB 1CF8L 2Z8SA 3MNWA 3KDMA 5JA8B 3BZDA 1JCKA 1B2WH 2H32A 35C8H 2C1PA 3TBVB 4PP2A 4Y88A 2CIIB 4LCUB 4Y19B 5DO2C 3QAZB 1UM5H 3QIWD 3FHQA 4PJEB 2WWMD 2AJ3A 4HPOH 3OPZL 3SE8L 1A21A 2CLVA 4NO2A 3DXAB 4XNUL 1NAKL 3BSZL 4ZNEE 2F58H 4JKWA 1T6WA 1UCBL 2HVJB 3MTRA 43C9B 1MREH 1WBYA 2DLFH 3MJGX 4JM2B 3MPCA 2KDGA 4L3CA 4M9OA 4RMSA 1FZJA 4KI5F 3QA3B 1VACA 4Y4HA 4LDOB 3DX6B 4LCWE 1T5WA 4X98B 4G5ZH 1PJ9A 4L1DA 2CQVA 3GNML 4TQEH 5IBUB 4KVNH 3DMMA 3REVB 5LAXA 2C3XA 4B5EA 3LSOA 1NMAL 4Z7VE 2LU7A 3IFOA 3PIQA 4LAJH 4XCEB 4S1RH 4F7EA 5C9KA 3TV3H 4I2XB 3QDJB 3FN9A 3WO4C 2LAGB 2BMKA 4FQPA 4R0LC 1HK6A 4ODUA 4PGDB 3JSSA 2VKWA 1LMKA 1RJYB 5IHBA 1JZ2A 3RVUD 5JW4Q 5AZEL 2XPGB 3I75A 2X9YA 3CX5J 4PJXB 4MZ3A 4M1DH 1CFSB 2D7TH 3FRPA 4N0RA 2B1HH 3D25B 3GBNL 4QT5A 1CXEA 3RBSA 1BQHB 4YDKL 3AY4A 3FQNA 1MCPL 1XGRB 1S7WB 1FHGA 3HUJA 8CGTA 3WFBH 4YHLH 4LL9A 2GJ6D 4YHPA 5F7HA 1MCQA 1YMMA 1S5IL 5DEGB 1FQ9C 5JORB 1EZVY 3LOWA 2F53D 2X4UB 3R0NA 5E8DL 3UTPE 4UB0L 3DX7B 3FB5B 2AJVL 2V5MA 4N9GA 4WFGD 3J7HA 3BGMB 4WU5A 1RIHH 1UENA 2YKLL 4HDIA 3RWGB 4BQCA 5BZDA 1EMTH 2YZ8A 3O6ML 4GRMB 3Q5OA 4GG6F 1ZHKB 3P77A 5DYOA 4FQHA 1KLUA 1FG9C 4HIHA 4PJHB 3PL6A 2DQDH 3NPZB 4OZGB 5DJ0A 2VQTA 4YGVA 1AO7A 5FYKD 5BVJA 4OV6F 4J8RA 4K7PX 2H2SC 1T1WB 4LBEA 4JM4L 4XC1H 1KJMB 2PW2A 3CFKA 1H9VA 5DMIL 3G6AB 4DVRL 3SGKA 4B53A 4CMHC 3S37X 1MVUB 2AXJA 5ANME 4K7PL 5I30L 4AM0B 1C5CL 2FJHB 4ETQA 1MAJA 3O3BB 5CILH 3NACL 5FM5O 5CBAB 5D71H 1MRCL 5FK9B 1F8TL 1RZIB 2EDLA 2PN5A 3V4VH 1X4ZA 4ZS6C 3TJEH 4LARH 2ITCB 4LKXB 3S6CA 1YECL 2NXZD 2UZIL 3QUYD 4S1DD 1PVHA 1L9MA 1JPFA 2FCBA 3SE4C 3H9SE 4X6CF 3WSQH 2DIAA 5A2FA 1MJ8L 4JKLA 1KC5H 3QCUL 2V2WB 1A7BA 3OBAA 4G43B 3Q5YA 4DW2H 1FDLL 4QTIH 5JHDA 1OTUC 3U0WL 2A73A 5JIKA 1H3PH 4YBQD 4PJDE 1W72B 4HIIA 5KSAC 1NBYA 3W0WD 4RMWA 1MUJB 1MCNA 1R3IL 4MXVE 4OZHB 3T04D 3M17A 1BVLA 4POUB 4EUPB 4M1GH 2A77H 5A2LH 2AS5M 1DUZA 4JN2B 1KBGH 1X5IA 3VFVB 1P7HL 1IKNC 3BX7C 1L6XA 2EYTA 2MTPA 4L9LB 2GFBA 4JFFA 4ZAKB 1KPUA 4I3GA 4P2RA 5B8CA 4KXZH 2AEQH 2GKIA 2P5WA 3UZEA 3GI8L 1YEHH 1YNTA 1B6UA 1L7TH 2YBRB 5E2WH 2HLFD 1IC4L 4YX2H 4GKOA 3OWEA 1U8LA 3L95A 4EI6B 5E2TL 3DROA 1D5ZA 2OM5A 1FNGB 3MA9L 2VN4A 3EAKA 5MEPB 4PR5A 5INDA 3LCYA 2CXKA 2FEEL 1BIHA 3KWWA 3QUKA 4HWZA 1BFSA 2X5PA 3PWPE 5EOTB 1VGEH 1UA6H 2BP3A 4P5MB 1BQLH 2DRUA 5T1DL 2NTFA 4WJ5B 4YO0A 1XZ0B 2P8LB 4D9LL 2J7LA 1RJZA 3NTCH 2DTMH 1F3DJ 4KKBD 2QV2A 2IQAA 3OG6B 4XWGH 5D1ZC 5IG7B 1KLGB 2PKDA 3WJLC 4NJAH 3TBWB 4IRJB 3KVQA 2CMRL 4QOKA 3MBEA 4JY4B 3UTOA 3DETC 2AABL 1BFVL 4N0UA 2APFA 1AIFB 3MNVB 1TMCB 5F96L 3VXSD 1GHFL 3MLSL 4P57A 2AJSH 4KKCC 3C9NB 3B5HA 5CEXB 4LLDA 1UACH 4NM8L 5LJYH 2VR9A 4NN6B 1SJXA 3MRRB 4FMKA 1FLRH 1YPZA 4P5TC 2JJVA 4NO0B 5DJ6B 1OM3H 3QHZL 3IDYC 1T1XA 4WV1A 4OUUB 3SDCD 3W11C 3C08L 1BM3L 1JNNL 5E6IC 5BS0A 3HC4L 3UTZA 4Y19E 4XI5D 4PJEE 4AT6B 3QNXA 1FYTA 2DYPA 1QQDA 2YPLA 4GAJL 4RX4A 5C08D 4PJ9D 5KVFH 4I3SH 1X5HA 1OAZH 3DXAE 3FMGL 4XH2A 1JWUB 5K9KB 1SBSL 1ZOXA 4BK5A 3LN5A 1JNLL 4AIZB 4H26A 1YEFH 4ALAL 2EXYC 1H3VA 4GLRI 4QRTB 3PGFL 1KENL 4PS4H 2ZSVB 1CGUA 1KG0A 4L8BB 5IBTL 4O2FA 5D7SH 2LFGA 3NZHL 3TVMD 4O2CA 2ID5A 1HXMA 2HFEA 3EJZD 1CFQB 5T5FL 1JWSB 2EC8A 3ALWA 4GAYA 3QDJE 4R26H 4HG4J 5IHZB 2Y4SA 1A6UH 5IB2A 5TE6L 1M05B 3CC5A 4R97B 3WKMH 1WZ1L 1ZV5A 3QDMA 4OLVL 1XF5B 3RPKA 3DIFA 3KS0H 5CP7B 1P7QD 5DURD 3QZWA 4BZ1H 4HC1H 2X4TB 3HE6D 4OCNC 1M7IA 1MH5B 3BZ4B 4PJXE 1E4KC 2EDYA 3MRFB 3QIBC 1GSMA 1D6VH 2R0WL 2VXQH 3U9PH 4ODVH 2VWEE 5EU5B 4WO4C 4CDGC 3S5LA 3HZVB 4TOYL 1MF2H 5FOBB 3FT2B 4YDJA 5L8JB 4G6AC 3OR6A 1IAIL 4I4WB 4G6ML 4CNIA 1GH7A 1NCDL 5FUCE 5KW9L 4NZTL 2GYSA 4TSCH 1DP0A 4PG9A 3AC0A 3OGCB 4U1NA 1EUTA 2BRRH 4L8SC 1XF4B 5KS9F 1D5XB 5DC0A 2ARWA 3VH8B 1JPST 2EEBA 2F15A 4AJ0A 1Q9LB 1U3HA 5FO9B 2IG2L 5TE7L 4PJHE 3HAEH 4OZGE 1GJIA 4N0YH 3FN0L 5ILTL 1PFCA 2FEDD 2X1OA 1C1EH 1IC5L 2ZUYA 4AENB 1OHQA 5LQBL 4I13B 4K7FA 4Q2ZA 3LQAL 3W39A 1NEZB 1I9JH 4IDJH 4XB8A 4B41A 2HJLB 3TO4A 2BSRB 3QQ9C 3RJQB 5J11B 1HEZB 5D1XC 3QHFH 1VCAA 4PUBH 3VMOA 3L9RB 3DRQB 4OF6A 2R0ZH 1QR4A 5DK0B 1KOAA 1EVTC 2V9QA 1A7QL 5EBWB 3PUCA 5M95B 3ARFB 1ZK9A 4UDTA 3QWRA 1HWGB 3VXUB 1CL7I 2UWEB 2YUZA 4YFLI 3VG9C 4H0HB 3DNKA 4LSDA 5MP6L 1ZT4B 4JFOB 4NWUL 1IM9B 1BX2A 3E8UH 3D3VA 3HZKA 4G6KH 3UPCA 1NAMA 1KEGH 2FGWH 2DICA 4GRLD 3O41A 4MB5A 3TT1H 5CINL 5HGDB 2DLEA 3C5SB 4MXWH 3EFFB 4HK3N 3X3FL 2PXYB 1F02I 5EC2A 5FYLD 2BHUA 1U42A 1CT8A 1RVFL 2J8UA 5ISZA 1RU9L 5I71B 3CDGA 3L3DB 5F7WC 4R90L 4FQ2H 4OZHE 4YR6B 1DVFC 1A6TA 4OCWH 3WFCL 1ZLWH 4NZUH 2JIXA 3U4EB 1EVUA 2JB5L 5CEZH 3C5ZB 3AAZA 4HQQH 1N7ML 4GMSH 4P5KB 3EIFA 2PW1B 5ITFA 4OZFG 4OKVA 4XCCH 3O2DA 4RIRB 4XBEL 4OQTL 5F1SA 1HH9A 3S36H 5C09B 1KXQE 4WUUA 3ARWA 1QFPA 4OLWH 5I1KL 1SM3H 1CXKA 4JFDD 3RZCD 1NFKA 1RJLB 4GQ9H 4JFYA 2V7HA 4XVSH 1KCLA 1TXKA 1JVKA 1A64A 2QLVB 2X4OB 4TRPL 1E28B 4Q9QL 3C09B 5KVDL 4XBGB 2I9LA 3O6FD 4DN4L 1ACZA 1EFXD 2BY1A 5CIPH 5AZEH 4UUJA 4JRXD 4F7CA 5HGHA 1NMBL 5B4MC 1YJDH 5C0BB 1UM6H 1G7IA 3ARDA 3IDMA 2C3WA 5FM5M 2YPVH 4P4RA 3ARGA 2A6IB 3GBNH 1FGVH 4JN1L 4G7YL 2ZG3A 1KIQB 3L6FA 4PBXA 3SPVB 4YDKH 1MCPH 4I77H 1ZLVH 1QO3B 3ARUA 3OR7B 1QOKA 2BNQA 3AVEA 2BXZA 2FBJL 3A6OA 1QBML 4JFXA 1F42A 4KROC 3KPNB 3RA7L 1XCTB 2VLKD 5C0CA 1QEWB 1YYML 1IEBB 2Y6SC 1BZ9B 1R3JA 3OX8A 3HG1A 1CFNA 2XA3A 1JFQL 3IXTA 4LKCA 1R0AL 2P5EB 3KLDA 3STZB 3ARBC 1H5BB 3VI3E 4S1SL 3MREA 2H3NB 4LU5H 3QUXC 3TFKC 3H9HA 5EBLB 3TBTA 3VWKD 1KEML 1AH1A 4XPGH 4JPVL 4QHMA 5ETUB 2XIDA 4RAUA 2E9IA 4M43L 4BUHA 1DL7L 3NMEA 3GMNA 1EA9C 3N06B 1AC0A 4LRNH 3IDJB 1RMFL 5DGQA 1IAOB 2VQUA 4I9WE 4TNVF 1TQCC 1U2HA 1FNAA 4WHYG 2QJDA 3LEVL 2BC4A 4U1JA 3T0XA 1JZ6A 3DVIA 1TZHB 1WAAF 1MRCH 1Y6MR 4NNXB 2D03L 1P5UA 1U8IB 1F58H 4XVJH 4DFHA 3IJHA 3BP7B 5DO2D 1UWEL 1YECH 3AB0B 1SHMA 3KPRA 5ICZA 2CO6B 32C2A 4ODTL 4Q7DA 2A9MH 4RISH 4QXTB 5DHYB 3GJFA 4ZFZB 3U0WH 2GT9A 1IGTA 4YFLF 3B2VH 3MOAL 3FB6B 4OZIF 3MO1A 3BP4B 2VDKL 2YC1A 3QHTC 5HDLA 4JLRA 1OTSC 5E8PB 2AJYL 3RGVA 1F5WA 5D7JA 3ZDYE 4R8WL 3CK0H 4KMQA 2XZQH 1SJEB 3ROLA 1KPVB 4JM2C 1QLFB 3O3AA 4XGZA 1AY1H 5IMKA 4KJPC 3CVHL 7FABL 1A7OL 1NBZB 1A5FL 3IGAA 2VDNL 4FS0A 4GAFB 4R4FL 4U1HA 4OBRA 1HDMB 2NY3B 2GSGB 4XB7A 5CKGA 4NQXA 1CDBA 3A6CH 1LEIB 2WV3A 1B0GA 2KL6A 1IMHC 3JWOC 3CFDA 3IB4A 4X9GA 5E56A 4AEIH 1IC4H 1E4XH 3UJJH 3G04A 1QRNA 1GZQB 4XMKH 5ICXA 5FUZL 4PJBB 4FTVA 1J5OL 3MA9H 2VIRB 3MLXH 1AI1L 1MCOL 1U8OA 4XTRC 2C4FU 4G3YL 2Y25A 4NUGL 1R5VB 3U6RA 5T3XD 2YSSA 4MQ7B 4XAWL 1Z5LB 1R5IA 1DQTA 2RJMA 1OT2A 2I9TB 4MZ2A 5GRYA 5IMOA 4NYLB 5FO8B 2RAMA 1N64L 3VXPA 4P2OA 4UNUA 4D9LH 5I74B 3BPCA 1KXVC 1NC2B 3MJ8A 4PJ7B 3BN9C 1CLZL 3B3IA 1C16A 1S9VA 5FUCC 1MCHA 1NKRA 3ROOA 3X11A 1IGJB 5CD3A 1OGTB 3LKPA 1FIEA 4PJIA 2MOVA 2CRYA 4ZG1A 4U3CA 1Q8MA 1RD6A 3VFPA 4OI7A 3MRIA 2FX7H 3OKMA 5CJ5A 1BFVH 3U36B 1F3JB 3HTLX 2H2SD 1YNKL 3VXUE 3BEVA 2UWEE 1P1ZB 1GHFH 3MLSH 2B4CC 4UT7L 1PKOA 4GKSB 5JDSB 5D2NB 5D7KE 5CIPB 5HDQL 4LQ1A 5EO1B 2Y5EA 2ATPA 2A6KB 4X4ZA 2E8YA 3OKEB 2FSEA 5KANI 4UQ3A 2CLRB 2HJKA 7CGTA 4ZS6D 2XRAH 3F12A 4NN7C 2EH7L 1GYAA 3WEXA 5D7IA 1MRFL 2KQMA 4GAJH 5IFAL 2AJZB 3EDDA 1M71B 3FMGH 1KULA 1A6ZB 1NGZA 1SBSH 2L7JA 2IAND 1JNLH 1J05A 1IBGH 2XA8H 3CVIH 2YA1A 3HNVH 4NRYA 1OTUD 3QISA 3VXMB 1KENH 3TYFB 3PXHA 2BVEA 1TVBB 3BO8B 3BPOC 5DRNA 3K1KC 1MNUL 4QRRA 5I76B 5KSAD 3M1BA 3PWJA 2HFTA 5IFHL 4RFOL 3WHXA 5DVLA 5C09E 4D0CA 3MV9A 1OF2A 3W2DL 5I66B 1CU4H 2K9UA 4S10A 1VADB 2Z35B 4IHOB 5MHSD 1CDUA 4XVUC 1RURL 5H8DA 1L7IL 1JGDB 3VFGH 1C5DB 3BW9A 3QFJB 5FM8A 1ZWIA 3E6FB 1GZPA 3TBSA 2YN3A 4DUVA 3LN4B 3EYUL 4JQIH 2IWGA 5C0BE 3WUZA 5SV4A 3WXWH 4RFNB 3VFMA 5DWUH 1WUNT 3ULVE 1U8PB 4WFFE 1XCQB 3UZQA 4L9LC 3P4MA 4U3HA 4ZAKC 3TESA 3GIZL 5BS0D 1U36A 1J86A 1VFUA 2HT2C 2ICEB 3WUWG 1DE4A 4RWHA 5L9DL 4CAGA 1DEEA 4L4VA 3S4SG 5EUOB 3UMTA 1V8HA 4OGYL 3QXVA 2IPKA 2P5EE 1JMXA 4OI9A 3CD4A 5IV2B 4Z7UB 3VDCA 1UGNA 2QQNL 5D1ZD 1NDGA 4QXUL 5BJTB 2JCCB 5ILTH 4J4PD 2BNUA 3GSXB 2YUWA 4HAGA 5C71A 3MJ9L 3DETD 3DV4A 4ZFOB 1EBPA 2Y07H 4KJYA 1H3XA 5D72H 1KCSL 4MJIB 4KKCD 1WCBA 1ZVYA 1TJIL 2B1AL 3NIDF 3VFUB 4C58B 1GGYA 2WIIA 1RK1A 3FQWA 5FGCB 4GW1A 4P5TD 3SBWA 3MGTB 1BAFL 4EOWL 1NEUA 4L3EA 1KLFA 4XRCA 2C3HA 4X80H 4JRYA 4X99B 1UXSA 1AHWB 1WEJH 4M5YH 3KPPB 5E6ID 5BCAA 4LLUA 5ESAA 5IUSA 3IKCA 4HFUL 1SY6A 4OIIH 4NN6C 1CXLA 5EU6A 1PGRB 4M93C 1MWAH 3QJFA 2DL2A 2HN7B 4HH8A 3BT2H 3CIQA 5ACZA 5CINH 4Q0XL 1F3RB 4CDHA 1IEHA 2ZUXA 1J0HA 2EXYD 4M7LH 4S2SB 4HCRL 2LU3A 2WINA 1LP9F 1BD2D 1GGBH 2NTSP 3EDFA 4DTGL 5DJYB 3GMOA 4LP5A 3RI5F 5I1HL 2D7NA 3IDIA 3WFCH 3GO1L 3EYQD 5BZWA 4YHZH 3UBXB 5JNYB 5L7XH 1A8JH 5J3HC 1JGEA 3HR6A 3UEZA 3GSVA 2JKXA 4ORGB 1FL5B 1I7TA 3QPXH 4ZO6A 5DHVB 3WLBB 5DJZB 1JZ8A 3WIHA 4X0KA 3THML 3K81A 2GJZA 4XBEH 4OQTH 3AM8C 5C8JB 4HUVB 4HXAL 3B9KA 1ZGLM 5FB8B 4H25B 4ZDHB 5FUOL 1ITCA 3QIBD 1BBJA 4PJBE 4J7RA 5ESQA 2PETA 4WO4D 4LPTA 4TRPH 2DKMA 1OAYH 4PD4K 4NOBA 4DN4H 5HI5C 1K8IB 2BFVL 4HKXA 1FAIH 3QWOB 3S4SB 5CEZE 3V7AG 2R9HC 4NO3A 4G7YH 4NRXB 3LKOA 4PJ7E 1FRGL 5IESL 1AD0A 1C08A 2FBJH 1VGKA 5J6HB 3BP6A 3MGAA 3F7YB 3C5JB 5IOPA 3O8XA 4WHTB 2W60B 2YMXL 1QVOB 1T66C 4DKEH 1WIPA 1JHTB 1H0DB 1ZA6B 1JFQH 4V2CB 5HGBB 2EICA 4HMEA 4A6YL 4LSVL 5HGAA 3GSOA 3DUSB 3QQ9D 4S1SH 5D2NE 4GW4A 3JWDL 4LPUA 5D1XD 4BJLA 1NCUA 1YEDA 4XP9L 1C7SA 1QSVA 3UTPD 5CSZA 2R2EB 3BVNB 5IVZA 1FFPB 4JPVH 3W5NA 3IDGB 4M43H 3MX0A 2XFXA 3DGGA 2J4WH 5F1IA 1KNOA 1EHNA 3F58L 4WNQA 3IDUA 1T0PB 5J11C 3IAQA 4U2YA 1S9WA 4QRPB 3VWJB 3LRHA 3OJ2C 5HI4C 2Q7YB 4JZOA 3D0VA 5I1DB 1DFBH 5TE4H 3DUUB 1DBKL 1MRDH 1RK0A 1LO3H 1MFAL 3VXME 4TN9A 3B4NA 3T4YB 2NY1C 1UWEH 1G0XA 4TUJB 3K8KA 4NM4L 4ODTH 5CJQL 4NGHL 1DVFD 5D2LB 1UJ3B 2PXYC 1WWAX 4YZFE 2FB4H 3QI9A 2FO4A 4X6FB 5HHOB 4O4YL 4PJCA 1CIUA 1Y6KR 1L9NA 1B6DA 1MPAL 4PJFA 1YEEL 3QFJE 1CFTB 3KPSD 5IB5A 1MCDA 2AJYH 2F74B 1TCRB 4WI4A 4ZUVB 4XBPA 4PJ5B 4XCFL 3LS4L 4UT9H 1IQDB 4JHWH 3VE0B 5DMJB 5GGRY 1LEKA 3C5ZC 5I73B 1YEIL 2H32H 2CXGA 15C8H 2BSTA 1N26A 2ICWJ 2VDNH 4S0TD 4RQQB 2GCYB 2R1XA 3P4OA 4R4FH 3ZTNL 3PHQA 1J7VR 1EO8H 1J0YA 1MWAB 2B0SL 4KDVA 2YD4A 2YRLA 3WNOA 5B4MD 4MX7B 3HI5L 3DO3A 4U6HA 3N9GL 1MCSA 5EUOE 3DVNB 1PKQB 1A4JB 1J5OH 4CVUA 1DQLH 1AI1H 4FQIL 2X70A 3NH7L 3C09C 3D69A 3QQ3B 3GMPB 1JGLL 2EDXA 4Z7UE 3MACH 3HPJA 2ERJC 2JCCE 4KROD 1IGYB 4CW1A 3BQUC 3LH2L 3S34L 3PWNA 2DTSA 3FOMA 5GGRB 1A1OA 1N64H 2Y6SD 3RY6A 2VDRH 4GRWF 1A3RL 1VPOH 2DD8H 5DRZA 1A4KA 4MJIE 1F13A 5TDOB 5F1KC 4M7KL 3VRIB 5I1EH 1PYWA 3ARBD 4AIOA 4Z7QE 1U58B 5FGCE 5ICYB 3QUXD 1QBBA 1XEDA 4KWUA 3TFKD 3VXQB 5C0GB 5F1NA 1MLCB 3SDDA 5J0BA 3KLHC 1ZTXH 5J1TC 4DZ8A 3NN8B 1FL6B 1YNKH 4LSTL 1JUFA 1UQSA 3I2CH 5E2VH 4NPYA 1TIUA 2ZUTA 1CGYA 5EIQA 4F58L 5JOPE 4PY8J 1CICA 3VFTB 1DEDA 5D8JH 2Z31A 2RFXB 3WS6C 3WFHB 5IMLB 1XGYL 3I02B 1A2YA 2ICWA 3P0YH 4QXGL 1G6RB 2W91A 1MCRA 5JW4N 5T3ZL 1OGAA 2MMXA 4CADB 1QSFA 5L6YL 4HS8H 3I6KB 2EYSB 1F2QA 2EKSA 1ULVA 5KSUA 4X4XA 2H41A 2JJSC 1SQ2N 4KUZL 4ZXBC 1D9KA 3QEUA 3WNLA 4F57L 3I6LE 5JPMB 3P9MB 5T1LB 4RNRA 1HNFA 2APBA 1CE1L 2PTVA 3DBXB 2B2XL 3OKNA 4Y19D 3ORJA 5FYJH 1JHLL 1R5WB 1UXWA 2K3TA 2ADGB 5IFHH 4MLIA 1OTSD 4RFOH 2EDFA 3UJTH 1U95A 2WIMA 4DKAA 2AV7B 3W2DH 5E8EA 1NC4A 5EUKA 4KJPD 4P3DB 3MLRH 4LF3A 3SDAB 5EULV 4FOMA 2AK4D 3QXDB 2H9GA 3BN3B 1B4JH 1XMWA 2LTQB 2QSCL 5D6CA 2ARJB 4YWGH 3EYUH 5K9QI 3QFDA 4HKZB 3C2SA 4G42A 1TETL 3CX5K 4LLQA 1IGIL 2J8OA 4OCRH 4Y1AB 4OCSL 4XTRD 1NLBL 1N5AA 4WI9A 1JNJA 1DR9A 2GK0A 5L0QC 3UYRL 2VABA 3TGXA 4B0MM 4K9EL 1DQJB 4EDXA 4P2QB 2ZUQB 3O9WC 3F62A 5F9AC 2BNRB 1D5BA 4OGYH 5IROA 5D9SA 5GS1A 2VZSA 4K07A 4NSKB 3RFZC 5H94B 3BN9D 5GGQH 2VLJD 1UWXK 5EO0B 5AYQA 2FHFA 3D2UB 4E41A 3QO0A 3DVFA 5SX5H 3TLRA 1QFUL 2PCPA 3LHPL 3MNWB 3KDMB 2ZCKL 3V5KA 5E5MA 3KXFA 2H32B 3MJ9H 2C1PB 5F7FA 2BDNH 4WIQA 4PP2B 3U4BL 5SX5K 1P9MC 2EC9U 2AGJL 5DJ8A 5C0RH 3SO3B 1VFOA 1QRKA 4MSWA 1KCSH 4G80B 4QRPE 4OV5A 1V3KA 2AJ3B 2DQTH 1TJIH 2B1AH 2DQEL 3JVGC 4HK3J 4HUWA 1OAKL 4KQ3H 2CLVB 4D8PB 5FCSH 4QEGA 1P84J 3G08A 1F6AB 1WBYB 5IIEA 4L3CB 1MJJA 2RR3A 2NY5L 1FZJB 4PRPD 1CGVA 2SEBA 1VACB 2GUOA 4Y4HB 1QFHA 1T5WB 4ZUTA 4KZDL 1YJDC 3DMMB 5GJSL 5LAXB 1JTOA 3LSOB 5D2LE 4R4BA 4MMXC 3D9AH 3IFOB 3PIQB 4O00A 4F7EB 5F89A 5BVPL 1WLHA 5HHOE 2BMKB 3QDGA 2CK0L 4YQXL 3GMQA 4KKNA 3NFSL 2EDHA 4MYWB 5FF6A 5CZKA 3VFRB 3H42L 5C70A 5I1HH 4PJ5E 1O0VA 2QQQA 2K7QA 2OQJA 3I75B 3GO1H 4PGBA 1XGQA 4P46C 1LQSR 5CSGA 2YXMA 1HHHA 1SVCP 4QT5B 4NCC2 4X9HA 2N7AA 1G7PA 1FNHA 4XVUD 4DWHA 5ALBL 1AE6H 4LASL 3HUJB 3LPFA 4AG4L 4YHPB 2E7HA 1YMMB 2OZ4A 3IFNL 1IEAA 2LQRA 5FA4B 4F2MA 1FGNH 2E27H 3EOTH 4XP5H 4N9GB 5DK3A 4ZNCD 3NIFE 5FUOH 4WU5B 1CQKA 1PKQE 4HDIB 3O6LL 4O02L 5I1IH 1Q1JL 1U92A 3MJ7A 4ZAKD 3ILPB 5EIVA 4YEFA 1ES0A 4HUXB 4PIRF 5DYOB 3DGCR 1KLUB 4FQHB 4HIHB 3PL6B 5CP3H 2D7QA 3MV8A 1KTLA 2HT2D 5DJ0B 4K3JL 4YGVB 4HGKC 5JLZB 2NX5D 2AJUH 2FD6L 1AO7B 2DM7A 3QG7L 4Y4FA 4RFNC 1XR9A 3QG6A 5JOEA 2YA0A 3QEQB 4LBEB 3CFKB 2PW2B 1VSCA 1FRGH 5GSVA 1T2XA 1A9BA 4MA3A 4N1CA 1RZGA 4NJ9L 3WXVL 3T65A 4ETQB 3ZKMC 1WGOA 4CJ0A 2VERN 5H2BA 4FHBD 1FE8H 1HQRA 3P4NA 2X40A 4NFDA 3NCEB 3GUTA 3VGBA 1ZGLP 4PJEF 3H9YA 1SEBA 4LVOC 4ONFL 4LSVH 4PPTA 1U41A 1U8HA 2EZ0D 1RIUH 4CU8A 3PWLA 3PDDA 3JWDH 1JPFB 5DJAA 1W8OA 5JMOC 1I7ZB 3BDBA 4XP9H 3NIGE 2O5ZL 5D1QA 1I4FA 3LPWA 4JM2F 5EA0L 3FO9B 1UZ6F 3DYMA 3I3DA 5DUBA 5JHDB 1IC7H 3CLEH 2PO6A 4FFWC 4R96B 2A73B 4FQQB 4LRIC 1U8JA 3GK8L 1FO0B 4HIIB 1NBYB 4YHKH 2EEAA 1YA5A 4M4RA 4NO0D 2BXYA 3MRDB 4ISVA 3M17B 1BVLB 1MAKA 3NFNB 2BSSA 4L5FH 2VAAA 5CCKL 1DUZB 1K3IA 4L4TD 1AHWC 4GXUN 3WL9A 1MFAH 3HR5A 4OLZL 1YDPA 2EYTB 2GFBB 4JFFB 1KPUB 5B22A 2HLAB 4JFZH 4GSDL 5DRXB 1RAMA 4P2RB 5B8CB 2FH8A 2ILLA 1K8DA 5K93A 4RWYL 4NM4H 4UU9A 4YDVB 2P5WB 5CJQH 1CDGA 1YNTB 4MQSB 3M8OL 1GOFA 3BKCH 4E9LA 1T80A 4UI2A 3L95B 1GOHA 5J3HD 5F7DA 1D5ZB 4HG4K 3S97C 3O6KL 1MPAH 4PR5B 4M62H 5INDB 3H9SA 1BVKA 3QUKB 4HWZB 2BVUA 4GXVL 1NAMH 4I0PB 1IQWH 3EDKA 3GBMH 1MJUL 4KKAC 2NTFB 5J89A 4YO0B 2XG5A 1OD9A 1EEZA 2WUCH 4U2ZA 4WWKC 4PJHF 1VESA 4Y1AE 4U7KA 5FYLL 2WWKT 1EAPA 3MRJA 4EVNA 2H26A 4MDIA 2IQAB 3ZKQD 4XHJC 5HI5D 2VSDA 5M94B 1KIUA 2Y5TA 4AQOA 3JUYA 2XWJA 4P2QE 2GQHA 1WFTA 2YPKA 4QOKB 4TVPL 1LO2H 3N9GH 1XF2A 1UM4L 4N0UB 2BNRE 4G7VH 3HE7A 3B9VA 1ZXQA 2R9HD 5IB3A 1FSKB 5C7XL 4P57B 4G8GA 1HZHL 1OAUL 4LLDB 1XIWA 5C3TA 3JV4A 2QQKL 3G9VA 5F1OB 1BEYH 3EOBB 4Z7WA 4CMMA 1JZ7A 4YXKH 4P59L 1QHOA 3S34H 2AAVA 2Q86A 5GGUB 1T66D 4M8VA 1XR8A 1CN4A 4WV1B 5I75C 1JZ4A 3G6DL 5BS0B 3UTZB 5JZ7C 5DFWH 1A3RH 5BV7L 3MLVH 3KG5A 2EDTA 1FYTB 1TTFA 2DYPB 2PYEB 1QQDB 1NL0L 3TN0C 1IGFH 4XH2B 5LBSH 3LN5B 3QEHA 1FZMA 4H26B 1XGUA 4I48A 1MOEA 4Z0BL 4C4KO 4OZHF 2XV6B 1KG0B 1KGCE 4O2FB 1WT5A 4X8JA 2EIEA 3ARQA 3HAEG 3WIFA 5E4IA 3OJDB 4O2CB 5HI4D 4PB0H 1MHPL 1RUQH 1HXMB 1ZEAH 4LSRH 4GAYB 5T3ZH 2F5AH 3VXUD 1U6AL 5A2JH 1GAFL 5C0FA 1KB5B 5IB2B 1K4CB 3CC5B 4CJ1A 5FM4A 4H0GA 4N0FA 3PDOA 2NY1D 1IM9D 5C3LD 4KUZH 3DIFB 3PE9A 4WFHD 3CSYA 4UT6H 1X6LA 5IGXL 4F57H 1O5DT 3CZFA 1FZKA 3BKYL 2PXYD 2Z8WC 4XWOC 2DQCL 4LCUA 3HA0A 3PQYD 3SE3C 3HUJE 3OR6B 4LDLB 4YHML 3RVTC 3V79C 3QT2A 2DBJA 1JHLH 5I19H 2W0FA 4IEFB 1YMME 1MI5D 4PG9B 3IKKA 4I18B 4W4OC 4IMKC 4U1NB 3TF7C 1QFWM 1FCGA 3IDNA 4GMTH 3ZT7A 4OIBA 5CJ8A 2CDEB 5SX4I 1IGCH 1J8HA 2BVYA 5DD5L 3IRZA 5KSBF 4X6EB 3P11L 3T3MF 2ICCA 1R24A 2IPUG 1A6WH 4J3UA 1CLYL 4OQ1A 5E2UH 1BF2A 2X42A 2PR4H 3MRGA 1AO7E 4XCEA 2XTJB 5IJKA 1Q9KA 2F53A 5FCUL 1TETH 4K7FB 4Q2ZB 3VI3F 3QEQE 3W39B 3GJFH 1MEXL 1MJ7L 5HHVL 1OWWA 4OCSH 1Q0XL 4XVTH 4D9RE 4K23H 3TO4B 4XXDA 4OF5A 4WY7H 12E8H 1F6FB 1NCBH 3GJFK 1TJGL 3KLSA 1C12A 3BQUD 4K9EH 3ARPA 1CFSA 4C56D 1ZHNA 4WFFD 2Q1EA 3FO1A 5L8KB 4LCIL 4NNPH 2X1WL 4NC2B 3LD8C 4UDTB 3K4AA 2COQA 4RZCA 3RNKA 5BOPA 1Y6NR 2CK2A 1I85C 1U93A 2E9WA 3MRQA 1NCWH 1W2KT 1DDHA 1BX2B 3HZKB 3D3VB 3BH8A 4BQ8A 1NAMB 1WCQA 1HHGB 2DJ4A 3LHPH 2E6PA 3O41B 4BQ6A 4MJ5B 3DX7A 1RULH 2Y7QA 3I6GA 5JHDE 5I18L 3KLHD 4JQVC 1LD9A 5EC2B 3U4BH 2P5ED 3TA3C 1YC8A 1CT8B 4YJZL 2EE3A 5ISZB 1YNLL 1C5BH 3CDGB 4OZGA 4JG0L 3HFMH 1DBAL 1S7QA 3RAJH 1A6TB 2NY4B 3KPQA 4L29B 5T3XL 2GTZA 3BAEL 3UC0H 1T1WA 2JIXB 4LLVA 4ZTPL 1D5IL 3AAZB 3IFLH 5J1SC 3G6AA 4JFFE 3EYVA 2H6PA 4YNYA 1J11A 3V0AC 4F7TA 4P2RE 3ZDYF 4U1LA 1MVUA 3MRKA 4BZ2L 5ITFB 2DWEA 4OKVB 4ZXBD 2P5WE 3MNZA 5GJSH 5KVMC 1HH9B 4WUUB 5C0DA 3VXTA 5L2KD 2XY2A 4S1QH 3HMWH 5BVPH 1IM3B 3ZYIA 4JEGB 4APQA 2ITCA 3MCLL 4LKXA 4JFYB 2V7HB 4EJ1C 3HCVA 3X14A 4GLRH 1A22B 2NY0C 1DBBH 2UVFA 2I9LB 5I8OL 1PLGL 3ESUF 1F90L 4UUJB 4F7CB 5HGHB 4LFHD 5I8KL 2V2WA 1P4IL 2C9AA 1G7IB 3MC0A 2OS7A 4JFQA 4PRHA 4QWWC 4DN3L 3EYFA 1N2RB 3Q6GL 4P4RB 3ARGB 2V6HA 5BRZD 4QHKI 4KK9C 2YHGA 1DSFL 4HJ0C 3L6FB 1MHCA 4LASH 1OTTC 2BNQB 4PRDB 1UYWH 3WFDH 4JFXB 1K5NA 4U6TA 3V5DA 3ESVF 2MNUA 4RFEA 1FYHB 5C0CB 2P8PA 4EUPA 5MEND 1S3KL 4QOKE 3CFJA 2WBJC 3OX8B 4N0UE 5A2IH 1CFNB 3O6LH 4O02H 4FFYL 3IXTB 4LKCB 5C0AA 4AK1A 1YQVL 3KPMA 2LTQC 3MREB 2VC2H 3SQOL 3MUGA 4NQVA 4K3JH 4QRSA 2B20A 3BPLB 3H9HB 3TBTB 2VKXA 2WAHA 4MD0A 3VXOA 4QHMB 5IVXF 4RAUB 3U1SH 5JQHC 3GMNB 3BRGC 4J3TA 3O9WD 3PJSA 5BS0E 2VB5A 3ARSA 1BJ8A 5HPOA 1GGTA 1FYTE 2PYEE 2UUDH 1NCCL 2BC4B 3S7GA 2NZ9C 4U1JB 4Y5VC 5FOJA 5EZOH 2MPAL 5CEZD 4Q9BA 1XZ0A 2P8LA 3W5MA 2UUDK 2XKNB 4LQFL 3QUMA 1Q9OA 4ONFH 2VN7A 4HWBA 3IJHB 1EHLL 5ESVA 5HY9B 3VW3H 3VGFA 4LHUG 1OCWH 2IQ9L 4U4BA 2E9BA 5GPRA 5ICZB 2R1YA 5F70A 32C2B 3DO7A 1CXFA 2IH3A 5C08A 4PJ9A 5BQ7A 4YLQT 3GJFB 1AIFA 3KAAA 1QSEB 3VRJA 2GT9B 3SO3C 1IGTB 3MXVH 1GVIA 3C9NA 5CEXA 2XI9A 3HNTH 3MO1B 3TH4T 4EN3B 3CSBA 1CL7H 5EU3A 1HYRC 1UH3A 2YC1B 2EEDA 4JLRB 25C8H 1FORH 5T33H 5F7NC 3RGVB 3O4LA 4AYFA 2OSLA 2YK1L 1CI5A 4YK4B 3CSGA 5DJ6A 4N8CL 5HHQA 3UDWA 3ROLB 2W9EH 5CCKH 1OARL 4OUUA 4XGZB 3B5GA 4XNMA 4OLZH 4FXLA 5DMGC 3DSFH 3IGAB 4Y4HC 4OZ4A 3L5XH 4F33B 1LEGB 2W0KA 4U1HB 1ZGLA 3DMMC 4NQXB 2O5YL 5TQ2L 3LB6C 1B0GB 4RGNC 4Y4KA 3CFDB 2FX9L 2C4FT 5E5RB 3G04B 2LE9A 4P46D 5HYIA 3K80A 5ICXB 3VXMD 4H5SA 1I3GL 5K9OA 2AKRA 4FTVB 2ZSVA 4FQLL 1U8OB 5IW3A 3O6KH 4XMPH 1SY6H 3U6RB 2NLJA 1YY8A 2YSSB 3I9GL 4C55A 1R5IB 3P3YA 2OK0H 4O58L 2XTJE 5IMOB 1QBLL 3VXPB 1Q0YL 4NQDA 4P2OB 2UY6A 4QNPE 1D3CA 1X5YA 3AY4C 3R06A 3MJ8B 2VZ1A 1M05A 3B3IB 1UEMA 2VDOL 1C16B 1S9VB 2P43B 3QFJD 5IHUH 4KQ4L 3X11B 5CD3B 2CUMA 4PJIB 5J1AA 4HS6A 1JRHI 5HD8C 4XPFL 1I1FA 4OZIA 1AKJA 3BZ4A 3VFPB 4TNWK 4HD9A 3MRIB 5F8QC 3OKMB 4QKXB 1GXEA 3BEVB 2E8ZA 5C7XH 3CDFA 1HZHH 5DVNA 5JHLL 4J6RL 4DGIH 3D3VE 3BXNA 2OZ4L 1ZS8A 3MFFB 4PB9L 4IJ3B 2ATPB 2IALA 4P59H 3SDXA 1D5XA 4HKBB 3SN6N 2PTTA 1A1NB 3ZYZA 2FSEB 4UQ3B 3GSRB 1MCCA 2HJKB 3G6DH 3SGKC 2OJZL 2V17H 5ISZE 3WEXB 5CJBA 5D7IB 3LMJL 2X44D 4WTWA 1AR1C 1N4XH 3H6JA 2ESVA 1T83A 5DR5L 5K59E 1NGZB 4ZQKB 1Q72H 3TYGL 3GSWA 3LS5L 4HLZG 1J05B 4GRLA 3BDYL 4GS7C 2W07A 4NRYB 1MY7A 1XFPA 1QACA 5DD3L 4FFWD 1OOAA 1Q94A 4MJID 3GRWL 5DRNB 4U6VL 4QRRB 4XPBH 4M61A 4FZEH 3M1BB 3PWJB 1BVZA 3L9RA 1FVEA 3WHXB 1MHPH 1T0NA 1ONQA 4WUUE 4D0CB 3MV9B 1I8LA 3L3IA 3O81A 4N8VG 1LO4L 1U6AH 1NBQA 2UWEA 5IHLB 3IAGC 1D5MA 3G5ZA 3HI6H 3BW9B 1ZWIB 4HEME 5SWZA 2D31A 1L0YA 1GZPB 4XXCA 3TBSB 5DA4A 1FG2A 2QEJA 3TO2A 3UO1L 4PJBF 4M6NL 3BKYH 5GS0L 4M3JA 3VFMB 4KDWA 3P4MB 2DQCH 1WFUA 3BE1H 3V52L 4N8PA 5FGBC 2ENYA 2XZAL 4DQOL 2JELL 1KTRL 2XG4A 2BNQE 1Z3GL 4OLUH 3T0EA 2ORBL 2KUTA 3VD9A 5FIEA 4XPAL 5C0CE 3AS1A 1A1MA 3IFPB 1DEEB 2QHRH 4L4VB 4JRXA 4PJ7F 4KKAD 2DLHA 3KPTA 4NZJA 2IPKB 4WWKD 2AXGB 2NCMA 3G6JF 3VFWA 1A14H 3GSNA 4K3GA 4P5KA 2DBLL 1KIPA 2WNGA 4XHJD 1OP9A 4V2BA 1NDGB 4WW1A 1GGIL 3SE9L 3OB0H 4OT1H 1P4LB 2J3SA 2BNUB 4JPKH 3BGFB 2VLKA 2XKUA 2NY6C 3DV4B 5HHVH 3CFCL 3Q48A 4KJYB 2I5YH 3U46A 1Q0XH 4XBGA 3R8QA 1FC2D 1I8MB 1H3GA 2WIIB 1RK1B 3S35X 5LWYL 3MODH 3G5YA 3O0RL 5DJCB 2AEWA 3MBEC 1TPXC 1NFDB 3GHBL 4RRPG 4PRIA 1SJVA 4XRCB 2AJXH 4WI3A 4JRYB 1FSKC 4NHCL 1UXSB 1KIQA 5C2BL 4KZEL 2BHZA 5JZ7D 5IF0A 1T3FA 4LLUB 5ESAB 3IKCB 1LDPL 4KMTH 5EU6B 4AL8L 3KPNA 4FG6C 3QJFB 4PJ8D 3TN0D 2VDPL 5ACZB 2LU4A 1T7XA 5INCA 5I18H 2HT3C 1QSEE 5EORH 4WENB 3V5HA 2J6EL 1EJOL 2WINB 2V2TA 5FHBL 4Q6IB 3O3DA 1I9IH 4KRPB 3ELAT 3QQ4A 3GMOB 4F9PA 5HHPA 4PV8A 1E6JL 3D39D 5EBLA 4YZFF 1FZOA 3IDIB 3E3QC 2HH0L 2ZOKA 5BZWB 1IFHL 3TZVA 1CCZA 1JGEB 2X4SA 5A43C 3GSVB 4K2UH 1I7TB 2QL1A 1LGVA 1B0RA 2A74A 4BZ2H 4ZO8A 4X0KB 2GJZB 2X9XA 4QCIA 3OV6A 1L4IA 3B9KB 4P4KB 3E6HA 2X9WA 1BBJB 1E4WL 5ESQB 3L5IA 4FTVE 4XWOD 3WIIL 3MCLH 2UY7A 3G5VA 2KPNA 5EU7E 4X83A 1EV2E 2AP2A 3RVTD 4JGJA 2ED8A 5J06A 5EUOF 4ZOAA 1NQBA 5I8KH 4HKXB 1J0KA 3LV3A 1P4IH 1JZ3A 1NGXA 4XNYH 4DN3H 5HHOD 3MRPA