3IFLL

X-ray structure of amyloid beta peptide:antibody (abeta1-7:12a11) complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
218
structure length
218
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYYCFQSSHVPLTFGAGTKLELKGADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 12A11 FAB antibody light chain
publication title Structural correlates of antibodies associated with acute reversal of amyloid beta-related behavioral deficits in a mouse model of Alzheimer disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 55
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iflL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iflL01
1KB5H 4OF7A 2QKIA 2EXWD 3IJSA 1BAFL 1T2XA 3PF2A 4Y1AA 2YZ1A 1J12A 4MXVF 2P4AB 4NNYA 2XRAL 5C0ND 1FDLH 5ALCL 1XF5A 4GKZA 5HY9A 1G6RB 1XIWC 5F7FA 4DFHA 3CLFH 4TULH 2W38A 1ORSA 3NZHH 4HWEL 4PLOB 1CU4L 2QQKH 5DUPH 3MGTA 4YXLL 1AGEA 2XY1A 5DD0H 4MJ6B 1D5XB 4QHNA 3IFPB 1N5AA 1YMME 2CJUL 3INUH 3T2NL 2IPKB 1VFOA 1JWSA 1PZUB 2VZUA 1A4JB 4HEPG 4OGAD 3PP4H 4WW1B 4RFEB 4ALAH 3JTSB 5HHQA 5AZ2L 3K46A 1LEGB 3LIZH 1JPGA 1SEQL 2F53B 4JB9L 3LEXB 3T3PE 2VLMD 3PWPD 1YPZF 4N0UA 3B9KA 1CBVH 1AXIB 4YGVB 2HKHH 4NC2B 1JBJA 2XXMB 2AJVL 5D6CA 3VH8G 5JW4R 3ISWA 2ADGA 2I25N 2VOTA 3CXHJ 1T1ZA 2CIIB 5C8JB 3PWVB 1HINL 4PJDB 1K8IB 3OZ9H 5D2NA 1YYLL 3C5ZD 4JFXB 5DRNB 4PJFB 4OQTL 4PR5B 3JVGA 3VFTB 1EA9C 2W9DL 3SCMC 3IT8D 1R3HB 4B41A 3WN5A 4EOWH 5IB2A 3SHSA 2P44B 4PGJA 2R69L 2HN7B 1RHHB 1OOAA 1UJ3B 3PDGA 3JV0A 3BJ91 5HPOA 2V17H 3QXVA 5J11B 5A2KH 2R23B 3LB6C 3MMEA 1OARL 1R3JA 2WNGA 2X1QA 3MLYH 3U7YH 4JZJB 5IJKC 4NQEA 4W6WB 1VEPA 3IGAA 3ULSB 4D8PB 4NFDA 3CVIH 3BKMH 1DUYB 3KR3H 1DDHB 4H1LG 3O6LL 1BZ7A 3CXDL 4MWFB 3BQUC 4HLZG 5KVGH 1HHGB 5FDWB 1WEJL 3D85B 3GRWL 4LU5L 3B9DA 1KLUA 4HZLA 5GGVY 4LPUA 4Q7DA 4YUEH 5I74C 2F5AH 2NY5C 4GT7A 1F97A 4P2QE 5T1LA 3MR9B 3QIWD 3B2UD 4YEFA 4E41D 4EDWL 4CU6A 3REWB 1D9KC 3QCUH 1XF2A 5JDSA 3QEGH 2RR3A 5J13C 1QQDB 5FYKH 4RFNC 4HD9A 4WJ5B 1JHLH 5B4MC 5BZDB 1N0LA 1U3HA 3KJ4C 3BZ4A 4P4RB 1P7KB 3J8F7 4HQQH 1P4IL 4U1LA 3AY4C 3RIAK 3SE3C 3S34L 5L6YH 2VKXA 5JOFB 3OKMA 3P4OB 3O45A 3HPLB 3SDDD 2Q8AL 4UQ2B 3ZT7A 2YRLA 3LKNA 5CJOL 4XPAH 1BEYL 4XP5H 4HUXB 3RWCA 1MFCL 4KI5C 2BMKA 5GISH 2OBGA 3HZVA 4DQOH 3HZKB 5EA0L 4UDTA 2CQVA 4J4PD 4H25A 3AS0A 5F88A 1KYOK 1CF8H 1DANT 3PQYD 4PJBB 2VLJA 4OCYH 3U4EA 1WC7A 1UZ6E 1XH3A 2KH2B 2Z93A 4P2OC 3C5JB 5BRZD 2XZQH 5D1ZB 1LEKB 2XWJB 2DTMH 3EGSA 3H7BB 2O5YL 1QBLL 4I18C 2YEZB 3MFFA 4U1NB 4ZD3L 2JE8A 3TBSA 4PJ5B 3BD4A 5I1DB 1D5ZB 2FD6L 4HUKB 5ETUB 1YC8A 5C0FA 4FG6D 4LHUA 4K2UL 4BQ9A 1FORL 5FAAA 1CDIA 1MCOH 3ULVD 3W2DL 4J1UA 2WWMC 1NC4B 1NGWA 3MCG1 3MXWH 5DA0B 2NTFB 2R1YB 4LSVH 4JHBA 2NY0C 1CE6A 2ENSA 4MZ3A 4MQXC 4HC1H 4ZXBC 4KK8C 3UYRH 5JIKA 4PJEB 1INDL 2IALB 4M9OA 4X5WB 4TUJB 4HULB 1CE1L 4D3CH 5AYQA 3QPXL 4L3CA 3TN0A 4C56D 1JK8B 3HUJE 3I9GH 1KNOA 2P5ED 4GLRI 5JR1H 5E6IA 4OQTA 5CD3B 2HG5B 1HNFA 4N0YL 5KSBA 1JF6A 4CU8A 2ICWA 5EU6A 4EI5A 5FFLA 4HIJB 2D7MA 4K7PL 2D9QB 3KPRE 5KJRH 3QEQE 3BPCB 2ZUXA 4G8GB 2VZTA 1FRGH 1MREH 4PJ7B 5DVLA 5C6TH 1BMGA 5GSRA 3U0WL 4NZJA 4Z7NE 4QCIB 2CDGB 5DQ9B 4BZ2H 1RUAL 2JK5A 2BOBB 4XMKL 5T1MA 5DTFA 2BZDA 4JFOB 1UCBH 3BMVA 3GFUA 3S7GA 4DEPB 4L8DA 1KG0A 4GKNB 1U95A 4ZQKA 2QSCL 1FO0L 1QBBA 4Z7UB 7CGTA 2B1AH 1KJ3L 3BD3A 4JO3H 4PJ9D 1AO7E 2HTLD 1I7RA 5E8PA 5F1KC 1S9XA 2IAMA 4I0KA 3OXRA 5T1DL 2DQCH 3RWEB 5T3ZD 1F6AB 3GRWA 3LN4B 2XWTA 4MXVE 3QJFB 2X70B 4P3WA 2N7AA 5IB1B 3HS0B 1WBYB 4HX1A 4NGHH 3PL6A 1C5BL 4M1GH 3CFCH 4X6FB 3P77B 5C6WH 1OCWH 3VRLF 1N6QH 2HAZA 2IQAA 4L8BA 4OUUB 4DN4H 1CXIA 1TVHA 1VFAA 1HOCB 3CZFA 5CP7A 1T03H 1S9VB 3AB0B 4CADB 1BZ9A 5LWYL 4GKOA 1MH5A 4M93B 1EXUB 2VDQH 1A3RL 2PW1B 5JOPD 1JPFB 3UPRA 2AJZB 1UXSA 2APBA 3GI8L 1TZIB 3GSXB 2Y06L 4PTUA 3TIEA 3T65A 4U2ZA 1W0YT 4ERSH 4J6RH 1G7QA 1RZ8A 2EXYD 2FJHB 5L8KB 1RMFL 3DETC 1UJ3C 3VFNA 3Q6GL 5D7LA 1AR1C 2NQCA 5J11C 1ZGLB 5F97E 4NT6B 1RY7B 4ODSL 1MAMH 2UZIL 2JB5L 4XVSL 5DZNA 5C0GB 4WHDA 4JZJC 3S4SB 3KJ6H 4RWYL 5DLML 2X41A 4ZUTB 4RISH 3U46B 3ZL4H 3MLRL 4EQ2A 4IS6A 2VL5B 4U3HA 2PTTA 2FSEB 1YMMB 4NJAH 2X40A 3VDCA 5E8DH 1N3NB 3FQUB 3X11B 1MQ8A 1E0OB 4HEME 1L7TH 1MFBL 4ZUUA 3NZ8A 5J4MA 1UEMA 4WW2F 1I8MA 4LCWB 5CAYB 1IZJA 5ADPH 5MENA 4OCXL 1GZPA 1JTOA 4LCCA 2J8UE 1OGTA 1JV5A 4BQBA 4W81A 1NANI 3GM8A 4X8XA 3FMGL 4IMKC 4LSTL 1EUTA 5E8OA 3QUXC 1IE5A 3RTQD 5J57B 3BUYA 4M6MH 1U6AL 3HFMH 2VQUA 3O41B 4DGYL 4Z7WB 3VXUE 5FKPA 5DC0A 5EU4A 5F7DA 3L5IA 4AEHH 1JN6B 2IPTL 3S5LA 3ARVA 2P8MA 4NO0D 2IQ9H 3HNVH 1U93A 4EUPH 5HYJE 1FPTL 5IHBA 4LP4A 2AV7A 4LLDA 1UYWH 1L9MA 3RY6A 2D7TL 5D1XA 4YWGL 3WFHA 4JY6B 2ERJB 3KPQB 5KSAC 2P49B 5CBAA 1ZMYA 4MAYB 1IGCH 5EUOF 1G9NH 3F58L 2DIAA 4BSWA 3VD4A 3UTSA 3TC9A 3CMGA 1U8KB 3ZKNC 2AJUH 1RPQA 1T2QL 1OL0A 1UZ8B 4M5ZL 3P9LB 4R7DA 1IGJA 3TCXA 1KF9B 3GMNA 3QDJE 2QQQA 2BSSA 1D5BB 5D1ZC 3WEXA 3MLVL 4TVPL 1T2JA 1DBKH 2H26A 4QOKE 3KS0J 2V7HA 3H3PH 4M8QA 4XH2B 1K8DB 5IB4B 4S1QL 4P2QB 3WDJA 4NNXB 3ZHDA 2PTVA 3K2UH 3FQRA 1F4XL 1YYMH 4WCYH 4P2RE 2MQ0A 3MFGB 5DMKA 3TVMD 4K8RH 4NZDA 4X5XA 5D6DA 1LD9B 2QHRH 3M1BA 2JCCF 5D1QD 3TPKA 1NFIA 1QLEH 4YHNA 2I60H 2MSPA 1NGZA 3JV4A 3LOWA 3OQ3B 4N0CD 2MPAH 2BHYA 4A6YH 1RULL 4JO2L 1A9EA 1J9CT 1ZSDA 5DQJB 2VLRA 4Y1AD 4QXUH 1QR4A 5GS3A 4WU5B 3W9EA 5B3JF 2A77L 3MRGB 1JUFA 4HKXB 4NO2A 4NWUH 1IAIM 1A1OA 2B20A 2DQJL 2P47B 3NFSH 1BFOA 1T5WA 2ITCA 3H9ZA 3P11H 2HJLA 1HYRC 2QR0B 4X99B 5F21B 4B5EA 1EGJA 1BFSA 1CGVA 1DEEB 2AV1B 1K2DB 1CDJA 4FXGA 1GZQB 1QBMH 5K9JL 4DOHE 1MELA 4JDVB 2JJUA 3ARFB 1G7LB 2ITDB 2DQIH 4G6KH 5C0BA 2J4WL 3QNXB 3WFCH 4OZHA 3TO4B 1VPOL 5I1KH 1EH9A 4K7FB 3L3KB 4XNYL 3PE9A 4OV5B 4ZYKA 2LQRA 4DEPC 3F12A 4ZG1A 1YNTA 5I8EB 2J8HA 5IHUH 4U1IB 4C54A 5HYFA 1OAYH 1FZJB 3O6MH 1G7IA 5B8CC 3RY5A 3IAGC 5D2NE 4X80L 1V3KA 2FEEI 1HSAA 4KK5D 4UDUB 3F65A 1MCLA 4S1SL 3SGJA 5KZCB 5LAXA 1NUFA 4ODWB 1U8NB 4HGWA 4OLEA 2LAAA 2DD8L 5JMRA 4QEGA 2YUVA 2OSLA 4ONFH 4ZUVB 2AEPL 3GSNH 4B7IA 2OMBA 4LCIL 1FVEB 4M1CD 3WHXA 2FZ3A 2EC9T 3ULUD 5DC9B 2DWDA 4NQED 1MI5E 4HAFA 5AG9A 1EFXA 1CQKA 2YD3A 2AXHA 1IKFL 3AB0C 3GO1L 3PABB 5CZKA 3KPMA 2VDKH 4M93C 3HUJB 5IFAL 3U1SH 5EOQL 5EO1A 5DD3L 2BVPA 2WLZA 2HFEA 4PJ8B 4CGTA 1NUGA 4U05A 2MKLC 1F4HA 1A7PH 3AFLA 4UB0L 3GSUB 3A0OA 3EYOB 3VXNB 4UU9B 2Z35A 1F8TH 5C3LD 3PUCA 3KPRB 3QEQB 4LARL 1LP9A 3L3IB 4UV4H 1KJVA 5T1LD 1OP5H 4MCYA 3R0NA 1RIHL 4JO4H 1EAPA 1CDCA 4CVZA 1MRDH 2ZCHL 3NN8A 3MRQB 2VDOL 5CGYD 5F9AC 1DQQA 5E9DE 3RP1A 1TJIL 2AKRA 3SOBL 1PKQA 4JRYA 3CMOL 3IDUA 3V6OC 1GC1L 5CEZH 4DZ8A 4KGJA 3PGCB 4X8JB 4X7SL 5FOBB 1AO7B 3IDGA 2R1WB 5BQ7A 1FV1A 3OR7A 4RNRB 4ISVB 1Q0XL 2WBJA 1ND0B 1ROWA 2OJZH 4YNYB 4CVUA 5GS2D 4QXTA 1F6FB 4JHZA 4K23H 2BVOB 2X4PB 4M62L 3OMZA 1I9JL 2H1PL 3SKNA 5E4IA 3O9WA 4IOIA 4JPVH 4MD5A 4HWNA 5FECB 4PRPA 5HTSA 3KPSE 1CL7I 1CXLA 3VCLA 2PNDA 5INCB 4FQ2L 2FL5A 5GHWH 4O51B 4LLUB 4KU1A 3TYGH 5H8DA 5MEOB 4GRWF 2EDYA 1HZHL 3SKOB 3ZLQC 1B4JL 4ONHA 3BIBX 3F62A 1KPVA 4X4XB 5BW7A 1QEWB 4X0KA 5FA4A 1BQHB 3BAEL 4DUWA 4LEXH 1WGOA 1GGCH 3G5XB 3D69A 1YPZB 4JN2B 2ERJC 2O5ZL 3EDKA 4MA1B 3EFDH 1TCMA 1DBAL 3CDGA 1S9WB 3BW9A 2FEEL 4XGZA 3BSZL 4MAYC 5EN2A 1CICA 2XN9D 5DUBA 3KLHD 5IW1B 3VFWA 3C6LB 5F7WC 4YBLB 4GKSB 4CAGA 1UADC 3CFJA 4LHUD 1UFUA 3S5LG 4NKMB 3W9DA 2ZZUT 5HDOA 5KVFL 4HK0B 3D25B 1A47A 4K3EL 5D71L 2ADFL 1MCRA 1P4BL 2GUOA 3MRLA 4HS6B 1BWMA 4F7TA 1Q9KB 3P0YH 1OHQA 1LK2B 1W0WA 3TBVA 1QRNE 2GFBB 4X7TA 5DRXA 5C08E 3VXRD 1DP0A 1UWGH 4MSWA 1F02I 3LS4L 4ELMF 2YMXL 3TN0D 4JM2D 4XPTL 2IANE 1A6PA 5EUOE 2NY5H 1E4WL 1LNUB 5AAWA 3CU1A 1QSEA 1MSPA 1GYAA 5E6ID 1LHZA 4E5XB 1U8HA 4NOBA 1QSFA 2I9LA 4BELD 1DUZA 3RX5A 4ZTPH 3BH9B 2ZPKL 4EI5D 3MRRA 3RHWK 3Q1SL 3VXUB 4KUCF 1A6UL 4XC3L 2QBWA 5HHPA 3L3GB 5HDLA 1TZGL 3CH8A 2D4FA 5BMFL 2OLDA 5T5FL 5HYJB 2FR4B 4AT6A 1CLOL 1RVFL 3I6KB 4RBPH 4HMCA 4M6NL 3NIDF 4OCWL 3VW3L 1I1FB 2WUCH 4L5FL 3RQ3A 1JI1A 3OXSB 4MB5A 3S36H 1A21A 3U6RB 3E2HB 1L7IH 5T1KA 2V7NA 1U8IB 5EZJA 2PTUA 1PX4A 3O6KL 3SE4A 3ARFC 3ZDZE 5BCAA 3M8OL 2PO6A 2IAMD 5IIEB 1VDGA 2AXFA 4N5UA 1YECH 1LO4H 1CL7L 1JGDB 2HVKB 3TO4C 3MLWH 3S35L 3D9AH 4IDLA 5B3JE 5CKAA 5DJYA 4L9LB 1LDPH 5TPWL 3LRGA 4YFLI 2XQBH 3PL6D 4PV9B 4WFHE 2VC2H 4P46A 4F2MB 3FRUA 3C9NA 3IDXL 3SO3C 4JFZL 4ZDHA 1MPAL 3W0WD 5C09A 2GK2A 4APQD 2C4XA 4OCLC 1IKNC 2GSIA 4P2RB 4R90H 4CKVX 3GZKA 5BVJB 4ONGL 4UT9L 4WTXA 3UJTL 3D0LA 4MJIA 3BOVA 1JPTL 1YN6A 2ZKHH 1ZTXH 5DFVD 3WFDL 1RZ7L 4KTEH 4P48A 3NCJH 3ZE1F 5D7LD 4Z7VA 4ZNEA 3GSVB 2ADJB 3PWNB 4R7NA 5D7SH 4AM0A 3D1MC 4X4MA 4G5ZH 4J12A 1BJ1J 1RZJL 2L7JA 3QIUB 4BA8A 1KLGB 2XT1B 3QQ3A 1A1NA 1QRKA 4YK4B 4PB9H 4XNZB 3VFOB 1D6EB 5ICXB 4HK3N 1CZ8H 4AL8H 3DROA 2OJEA 1FAKT 4P23D 3O3BB 5E5RB 1JPSH 1AGEB 4DOHB 3KPPA 1KCUL 4XMLH 4P5MA 5E00B 3VG9C 3G5YA 2FWOA 1G7MA 1JWSB 1N4XH 4RFOH 5JXAH 3GMMB 4L8SA 3UMTA 5GGRY 5C0JB 1AKJB 1S7SA 1WTGT 5AAMA 4ZSOA 1Q9WA 3VXSD 5MENE 1MQKL 3UJJH 4UBDD 1RUQL 1QFPA 4XBGA 1CD1A 3VRJB 3P0VL 3RVVC 5FM4A 4O2CB 4BQCA 2X4TA 3EJZC 4PJXF 4Y0GA 4PPTA 1NUDA 5FUZH 1DBJH 4PP2A 2C1PA 1IFHL 2P24A 4TQEH 1IQDA 4XCNA 4FQXD 4F7PB 5I1JL 4POYA 4XAKD 5EBLB 3ZE0F 4MLSA 3PNWA 2YKLL 5I8CB 4ZMAT 1KEML 2DWEA 1FGVL 2JKXA 4YDJB 3V5DB 5AYUH 4X6BA 1XEDA 4O4YH 4LIQH 4HPOL 1Y18A 4OLWH 2VXUH 3C2AH 5J1TC 4Y4HD 4EDXB 4LDOB 3UTSD 4HGMA 4HJ0C 2ATKA 1MI5B 1TZHB 5FB8B 1WT5A 3MRBB 5LG1A 3X12B 4Z77A 3WL9A 1ORQB 3CVHB 3RFZC 4HIHB 1B4RA 4JHAL 1PJ9A 1FDLL 5CSBA 1U8QA 5ISZE 2Y25A 2P5WA 4G8IA 3MUZ1 4TULL 5AUMA 3NZHL 4W6YB 2DL9A 3QDMD 2QQKL 5DUPL 5KSUB 1KUMA 4MA1C 1W0VB 4X7CC 5DD0L 3TO2A 4LPVA 3WNMA 3INUL 2UVFA 5DZLA 4O2FA 1CGYA 5ACLA 4J3VA 3CFBA 1WFNA 4G8FB 1JNHA 4FQQA 3C6LC 4CL7A 4YBLC 5E9DB 3PP4L 3MRNB 4XXCA 4ALAL 4P4KA 1MCEA 2VZSA 4X7FC 3WKMH 1XF2B 1IGTA 3LIZL 1I1AA 4HPYH 1S7XA 3O8XB 5F9JB 1MCIA 3KLSA 3QPQC 1U8JA 2HKHL 2CDFB 3QDGD 5BS0D 3JV5A 1T7YA 1FL3B 1FYHB 1K5NA 2VLRE 5C2BH 2QADB 4LGPB 2Z8RA 1X44A 5C0CA 5EDXA 2VR5A 4YDIH 1BX2A 4ZO7A 1KIRB 3KPSB 4NN6C 4WNQA 3QXUA 2DLEA 3GSRA 2E6JA 5DMGD 1QLRA 1M7IA 2GQHA 5C0BD 1FL5B 1CTNA 2WW8A 1MCJA 4EN3A 2L4OA 2A73B 4WW2B 4YPJA 2V17L 4BSVA 5CIPB 5KVEH 3KPOB 3VGFA 3MLYL 3C60D 4XVUC 4JDZB 3EO1A 2QSQA 4U7MA 3AC0A 3U7YL 5GS1B 1JWMB 3VGDA 5INDA 3T1FA 1XZ0A 4ELME 5E6ZA 3SGEH 2Z93B 3BKML 1PX3A 3KR3L 2L0DA 1S7TA 5D7JA 4OV6F 3E2HC 3TLRA 5CJBA 1ZXQA 1KSRA 1WBXB 1DEDA 4PJIA 4LCUB 4NQSA 5DK0B 2KPNA 2NXYB 2UWEF 4ODHH 4FTVD 5FO9A 1YY8A 2B5IB 3ULVF 3CSPA 1JHKH 3DV6B 4YUEL 5GSVA 3FO0H 4DVRL 2VR4A 2F5AL 5FM5M 3DRTA 1RZKH 5DEZA 3B6SB 2UVEA 3BH8B 3QCUL 2EH7H 4FFZL 4XWOD 43C9A 3NIDE 4K94C 1QRNB 2XIDA 3QEGL 1AXSB 3FAWA 3L7FA 4W4OA 1H3WM 4JFFA 5C08B 5FYKL 3G9VA 3MROA 3PG2A 1EFXD 2YD4A 4CNIA 1JHLL 1DLHB 4IJ3C 1F00I 3RWIA 5IWLC 2GAZA 2IANB 3D87B 5EUOB 1VACB 4HQQL 4U6HB 2NW3A 1PY9A 4JGUA 4YHMH 4L3CB 3TH4T 3C09B 4OKVA 5L6YL 3SDAD 1NCWH 5F3BA 1EHXA 4G6AC 4N8CH 3CX2A 3BUTA 1MWAB 5IEKA 3EDDA 4XPAL 4XP5L 3NGBB 5H37G 3CSYA 5ID0A 1BD2D 1U92B 1QO3A 5GISL 3MRJA 2HVJB 5L2KD 4AENB 1B6DA 1CG9A 5DA4A 4YAQA 3L3HA 1CF8L 1U91A 5GSRB 3STZB 4JRYD 4QT5A 3OKLB 4XNZC 1XGQB 4PJHA 1B88A 2P42B 4HWBH 4OCYL 3LCYA 3F5WB 2J8OA 4XNXL 1KB5A 2JCCB 2D7QA 3ARDC 4LKXA 1A7OH 1PKQE 5I2IA 1HEZA 2AJ3A 2XZQL 5EU5B 4P3CH 4ZO6A 3ES6A 2DJUA 3KNBA 2DTML 3ZE1E 1J11A 2WBJD 3QA3A 1EVUA 3UZEA 5J06A 4YXKH 4TVPD 3VDAA 2VSDA 3B2VH 2CMRL 1G9MH 1MRFH 4F3FB 3UEZA 3WIIH 3O9WD 3CZJA 2Y36H 3DBXB 5IBLC 1MCOL 1ZLSH 3IVKB 1EK3A 4IHOB 5JOEA 2I9TB 3T4AA 3RZCA 4RZCA 4L8BB 4KKAD 2YD1A 1UB5A 4Z78B 4J23A 1TVHB 3VA6A 2F54E 3DX7A 1H3GA 4LSVL 4HH8A 3ARZA 3BP5A 5SWZA 4JVUA 4HC1L 5DJZA 3UYRL 4IRJD 2J5LB 4JFDA 4EI6B 1WZMA 4PGDB 4PRID 3BIAX 3VFVB 4QHKJ 4D3CL 4FN0A 4LBEA 4QHLB 3L3OB 1KV3A 1EO7A 5C9JA 3MBED 4YHIA 2VUYA 3HE7C 5J12B 5JR1L 1EEQA 3LKSA 3BP7A 4PJXE 4UIMB 1ZT4B 2EDQA 1DE4A 4TPRH 1T83A 1CN4A 3WE6B 1FVDB 3D5OF 5KJRL 2F74B 4H26B 1WCBA 1UQSB 2NY4C 3S98A 2VQTA 2YSSB 3ZE0E 1FRGL 5C6TL 2OX5A 2VDNL 3QUZB 4BZ2L 2VO5A 4YE4H 1VFMA 3E1F1 3MYZA 3HMWH 4OM0L 5HJ3A 3VFPA 1IM9A 1K4DB 1WWWX 2Z31A 4C59B 3UTQA 1KT2B 4L4TA 1OGTB 4M7LH 1NAMA 2B1AL 3L6FB 3QJHA 4JEGB 1HIML 1QFWH 3DIFA 1QSED 4N9OB 4JO3L 1KBGH 3QQ9D 1J0HA 1TNNA 4W4NA 3RX8A 3GMRA 1G7JA 1B0GB 2DQCL 3JZ7A 3F7YA 4F7MA 5E8OB 1TQCC 4P57B 5A2JH 5IVOA 5GJSH 3IKCA 4N9GB 4RSVA 1S3KH 2R29L 2RCSH 3S35X 4ZNCD 3DUUB 3O8XC 1HE7A 4HV8A 2XA3A 4MA8H 3VD3A 4NGHL 4M1GL 1WSST 1OCWL 5FKPB 4B0MM 1N6QL 4QO1A 1DVFB 1S9KC 4NO5A 1NSNH 5CHNB 2NMSA 5ECJE 2QADC 4ZFFB 4Y4FD 1T03L 5EZIH 1S7RA 5JQ6H 1QG3A 5IV2B 3DPBA 4U0RB 4F7EB 2VDQL 5C0AA 3NCYP 5BV7B 5T1KD 3IFLH 5LGKA 1T21A 3VFMA 3N50A 4EVNA 1H8OA 1WFOA 2NY2C 4PGBA 2AI0H 5DD1H 5E03A 2PO6D 4ERSL 4J6RL 5GGSY 4HIEA 3LQMA 2CUIA 4ZPTB 5E08H 1U2CA 2PXYB 4WW2C 4Z6AT 2BERA 3FJTA 4PD4K 3RWHB 4J7RA 1HQRB 4OF6A 4WEUD 4HUWA 3VXOA 1V3MA 5ISZB 1I4FB 5HPMB 3KJ6L 3D6GA 4WFEE 4RRPG 3GBNH 4MVBC 4RISL 3ZL4L 3L95A 3SBWA 1WZLA 2JLLA 4XVTH 2A6DA 3MPCA 3BZEB 5C09D 4ZTOH 4NJAL 5E8DL 1BVLA 1L7TL 4U1GC 5HHME 1CFSA 4GUPA 1NGQL 4Q6IA 2NXYC 5E1AA 2EIDA 2XV6B 3B4NA 4MJID 3PQYE 4YFLF 4GRWB 3MYJA 2XKNB 3F7PC 2X9YA 4C83A 1NDMB 1OP5K 1ZHKB 2BNQA 3QIBB 1YY9C 5IEHB 1P6AB 3C2SA 1YMHA 4JPIB 5F3HA 2Q7YB 3FHQA 4MQ7A 1A6TA 2YWZA 4M6ML 5B22A 4HIIB 2AJSL 4LPWA 3QRGH 3VFSA 1YEIH 2ICCA 2J3SA 4X9BA 3R8BB 3FOMA 5BJTA 4M7ZB 2W0FB 4AEHL 4HKJA 3V9FA 1MNUL 3MJ8B 1AP2B 3GMOA 4PRDA 3HNVL 5I1GH 2A1WH 2UWEE 5EU3A 5TE7H 1NCUA 4TUOB 3ULVE 3OKYA 1MCCA 3DVGA 3LH2H 1M1SA 1QA9B 2DIJA 1JHTA 2GK0B 3SQBA 4FQHB 4P0DA 3G6AA 3AS2A 4HC1A 4PRHE 3DX9B 1AQDB 3MLUH 3NGBC 3QISA 1MCSA 1IGCL 4MNQA 1G9NL 1H8SA 3O3DA 1KENL 1AHWB 2DLGA 4P2YA 2ICEB 2AJUL 4ELMB 3DX8A 4ZSOE 5FCUH 1QD0A 2P5EE 3RJDA 4M6AA 3LVEA 1F3DJ 1FFRA 3QAZB 2AS5M 3PIQB 5CS7A 3F12B 3SGKA 1BIHA 2BCKA 1P9MC 4WI7A 4ZFGH 3RNQB 4GQPH 1BVZA 1DBKL 3MRKA 2VYRE 3H0TA 4IOFD 4O58H 3H3PL 1BIIB 4UTAH 1N59A 3GSWA 4IDJH 4C58B 5GZNC 4G43A 4UQ3A 3K2UL 1YYML 5FGCE 2FECI 3DO7B 1HSAB 2X4SA 4UOJA 2MQ3A 4K8RL 2CIKA 1FZOB 3ARGB 2QHRL 5DRWB 3ULUF 3P40A 1Y0LB 3JTTA 4I3RH 1FFNA 5EOCH 3VWJA 4KMLB 1QLEL 1I8KB 2NLJA 4F80A 3HC4H 2GSGB 4RAVA 2OP4H 4JQIH 4DGIH 1CGTA 5DVMA 4QF1B 4WUUA 4A6YL 2FZ3B 3DX6B 2DM4A 1RUKH 4QXUL 5DHVB 1CT8B 4HG4K 4FP8H 3M17B 2YA0A 3UYPA 3UCRA 4JKMA 3T0ED 1J5OH 4NWUL 4Y4KA 1CDHA 2CKBB 5DFWH 4EZMA 1PKOA 2P5WD 3DV4B 1T04A 3CK0H 4LLVB 1JZ6A 3NFSL 1UXWA 5I1IH 2A74A 3P11L 1CLYH 2MNUA 4XVJH 4R8WH 1HDMB 1AGDA 3H3BC 2EZ0C 4JO1H 1J87A 5TH2A 4NFCA 3P9MB 1U3ZA 1QBML 5ADOH 4LCYA 3HNTH 1E28B 2PW2A 3TBTA 4XNMB 4KK6C 4UTBL 4P4KD 1ZVSA 2DQIL 1G7PA 4KQ4H 1UENA 2GIYA 4G6KL 4IOSD 4CVZB 4OF8A 5JOPE 3P9WB 3BP6A 3JV6B 3WFCL 2O93L 1KCKA 1S8DB 5I1KL 1O0VA 1OGAB 2AKRB 3VG0H 4RBPK 4D0BA 3QUZC 1ZA3B 4PRBB 2G2RB 3AREA 3FFDB 4KVCH 1MCPH 4PP1C 1T1YA 4BFIA 5M95B 5DYOB 1VKXA 4YBHA 3T3MF 2FHBA 5HHOA 3CFDA 4FFVC 5IHUL 1X4XA 3KLDA 1KCSH 4ACPA 3FQTB 3KVQA 1OAYL 3OJDB 5DEGA 3U36A 1AD0B 4OZFB 4WEBH 3MJGX 4JQXA 5HI3C 3V5KB 1H3UA 5E99H 3O2WH 4L9DA 3PV6A 1LO2H 5CZXD 2F54B 1X9QA 5ESQA 3U30B 4YBQC 3E3QE 3ROOB 2GI7A 3SDCA 1IAKB 1T5XB 1YQVH 4ONFL 3QUYA 3MA7B 3FT2A 3Q48A 5E2UH 1PEWA 3RX7A 3GSNL 1DVFC 2VWEE 5HGAA 3OKDB 3LSOB 1PQZA 5DF0A 3EHBD 2EDHA 3UTTD 1TNMA 2IMNA 43CAA 3L5JA 2VE6B 1BQUA 1IJ9A 2VDKL 4JQVC 4U0RC 4GBXA 1VSCA 4H1LH 3U1SL 4YIQB 5BV7C 1RHFA 3CGTA 2IBGA 3NIFF 5B39B 3DJ9A 4PJXB 1I8LA 2NY1B 4HLZH 3VXMA 4KJYA 3CDGB 1A7PL 4EUPA 4CU7A 3OKNA 2GTWB 3GKWH 3ZKXB 1F8TL 5DUBB 4PRNA 1T20A 3FO9B 5KAQF 1T3FA 4DVBB 2PXYC 4UV4L 4NKOB 4Y5XA 5EULV 1EO8H 4JO4L 1T1XA 4HIXH 3UPCA 1CD8A 3RGHA 4XCYA 5CCKH 5BXFA 3MRLB 4I1NB 4KJQD 4PFEA 4JM2F 1XCTA 2EYSA 4MB4A 3QCTH 1RFDH 3FO2A 3Q2CA 5F44A 3B9VA 4OB5H 2XOTA 2D7NA 1NGYB 2YBRA 3QHZL 4OZGA 1UA6L 3V5HB 1A2YA 5SX4H 4F9LA 2J6EL 1TDQA 2OJZL 4D9QD 2OTUA 5F96H 2V5SA 4K23L 1U8HB 1I7ZB 3QIBC 3W5MA 2DMKA 4JPVL 4LSUH 1RJYA 2FIKA 1IMHC 4N1HB 5GS0C 5HHPB 3OR6A 5GHWL 3MODH 4TNWF 4M7ZC 3DTXB 4QY8A 3TYGL 2NCMA 4OIIH 3TIDA 3TBWB 5D72H 4O02H 5JUEH 3VMPA 4ODTH 3L7EA 4A6YA 1NGXA 5FGRA 4BKLA 2K3TA 4M4PA 3HCVA 3TYFB 2IC2A 5HYSA 4N90E 2LV4A 2HT2D 4LEXL 3Q3GA 4KKLD 1GGCL 3QG6B 1T7VA 1P6FA 3EFDL 4JFHD 1D3CA 2ZSWA 1B90A 2AXFB 4OAWA 3SDDB 3X3GH 2DI7A 3NFNA 5MP6H 3OSKA 2J88H 2JB6B 5DJYB 4KJPD 2NY7H 2CXGA 4AG4H 2F5BH 3X3FH 4P46B 5TDOB 2DMBA 2H8PA 1EAJA 1U8MB 3OBAA 5JO5A 3TA3B 5HVFB 3FB6B 2JIXA 3P0YL 2Q76A 3S88H 1NAKH 5IFJB 4U1JA 1OTSC 3PQYB 4OTXL 3LKQB 4MD4B 1HH6B 1XF3A 1KPRA 4U1SA 3W81A 2X4QB 4AIZA 4LSRH 5CEYA 5SWZE 4XZUA 4LLMB 2NY5L 3OGCA 4OD1H 4G3YH 3WD5H 4IRSB 4RCAA 3ARGC 4MX7A 1M05A 1IAMA 1A6AB 2MFNA 4K94H 4U49A 4ZTPL 3CFEB 1A22B 2DLFH 4NHUA 4X9FA 4QRRA 2CKNA 2XNAB 2IF7A 2UWEB 1YZZA 2R0ZH 4I5BB 3TFKC 4HJGA 3AMLA 3C8KB 2R1XA 5DO2C 3SJVA 1KULA 3OGOE 4KPHH 1C12B 5IMKA 4NRYA 3GSNA 4PRHB 2WUCL 1AY1H 5ACMA 3CCHB 2BDNH 1IM9D 5CD5D 5D2LB 3S36L 3G6JA 1J8HA 1L7IL 3U9PH 2BSTA 4JCLA 1TCRA 4NN5B 1YNLL 4YDVA 3SDXF 2A6KA 3HG1D 1JTPA 2G75A 2PYFB 1MCNA 2K7QA 2EC8A 4L4TE 1KPUA 2P5EB 1IGMH 4OGYH 1YECL 1LO4L 1YC7A 4TTDD 1ZVHA 4PJAF 1TETH 5E4EB 3D9AL 4LOUC 5HGHA 3BPNB 1LDPL 3IJYA 4P5TA 3RZWA 2XQBL 4N68A 4LLYB 2VC2L 1I8IB 2EXWC 2OR9H 4RGNE 4BJLA 2VAAB 1MAJA 4XBEL 3O0RH 4JAMA 3IDNA 3ILPB 5C0NC 2YOCA 5IMLA 4PTTB 5FYKD 1WVZA 5J6GB 2VDLH 3DMMB 3DVNA 1E27A 5EFIA 5FGCB 4R90L 5C0AD 1S7WB 1LO5A 2L7UA 4DUXA 1FYTE 4IIQB 1MFEH 1ZWIA 5EPMB 4NQDA 3M07A 2ZKHL 1ZTXL 2VSCA 5ANMA 4KTEL 1AIFB 2D9CA 1Y18B 1CVRA 1HXMB 3NCJL 4OGAC 3IF1B 2E9BA 4GAYA 4JKPH 4N0RA 1H15A 4JKWA 5D7SL 2NR6D 4G5ZL 3MV9A 3T3ME 1OSZA 4XPGL 3WLBA 4Y2OA 4PGEB 3LKPB 1NEUA 5TQ2H 1P84K 4DKFH 1ZE3C 1TXKA 4PB9L 1ADQL 2LTQC 5EUKA 4NKDB 2M26A 3ILQD 4AL8L 2I27N 1RZGB 1JPSL 1NLDH 4L3EA 4KJWC 5FUCE 4XPHH 4XMLL 1N7MH 3C5ZC 4JZNA 2ZUQB 4Q2ZA 4YHOH 3REVA 4PRAB 1NMAH 3EYFA 3ZKXC 1N4XL 4RFOL 5JXAL 4WFGD 3RVXD 4WENB 5DRZA 3VWKD 2DLHA 5CKGA 5KBNC 2FJFA 1U8OA 2DB8A 5CSGA 3I6LE 3UJJL 3OKOA 5IHZB 4N5ED 4YPGA 1IGTB 3CVHH 1D7FA 4RQQA 4GG6F 3IU4H 4G8EA 1JPST 2YD5A 4MXWH 1NJ9B 4MCZA 1HHJA 2BNQE 5ESAA 1UB6B 1WAAA 3QQ4B 3FQWA 4I77H 5FUZL 4KZEH 1CDYA 1L4IA 5FM8A 5IJKA 1MVUA 1OT1A 1ACZA 1BZQK 3NIFE 4TQEL 1OB1A 1XCQB 4G6MH 1F11A 2XWBB 5I1LA 1HILB 1DTUA 1DLFH 3SGEI 4F57H 1CFQB 3HE6A 1BX2B 1N64H 3LRSA 4D9RD 5IKCA 3ZHLA 1XGYH 4DN3H 4OM1H 3BQUA 5AYUL 1U8PA 3RVTD 4GMTH 5IVXA 4LIQL 5ID1A 3VXRE 4LFHD 4OLWL 2VXUL 3C2AL 3GMQA 1Q94B 3EYSL 4YHPB 2UY7A 1D9KA 2PETA 5LGHH 3U7AA 4MNQE 4QRPA 5EOTB 4R0LB 2HFFB 3MV7D 2Q3ZA 5KN5A 2X44D 1QKZH 2RB8A 2H6PB 3AU1A 2H2PD 1V3LA 2N4IA 5SWQB 4NO0B 4I8DA 4NQXA 2G5BA 3IDJB 1FN4B 3RVUC 1LE5B 3GIVA 3AY4A 3SE3A 4PGCB 3SDDC 3K1DA 5CIPH 4AEIH 3VFRA 3DRTB 3F7VA 3MUY1 4MNGE 2YPLA 3WKML 2LVCA 1X7QB 2E7MA 43C9B 5I66A 5FA3A 4J4PC 2BVYA 4HS8H 4NNPH 5AEAA 5DDHA 4J3OC 4JGMA 3RIFK 5HYSG 4LLWB 3QDAA 2PYEE 4WUUE 3X17A 5FHBL 4LRIC 2ZCKH 3DXAE 2IADB 3JWOC 4P2OA 3IRZA 2VITA 3QUKA 3HR6A 2QQLL 4KI1A 5CGTA 3MRHB 4JZOA 4HUVB 4PG9A 4X4YA 4HUUA 4HS3B 4CVWA 4I18A 3K8LA 1MIEH 1R5VA 1KGCE 4U4BA 1TTFA 1NEZG 3PWJB 3TVMB 4NQTA 4PY7B 3JSSA 3FQNB 4FG6C 4JN1H 4WGVB 5KVEL 1T89C 3L3HB 3ULVC 1AFVL 5DGRA 3THMH 4DK6A 3ARED 4ZFZA 2WIIB 5ENWA 2GJ6E 5HHOD 3HC3H 2Z4QA 5I2IB 1OAXH 3AAZB 1NC2B 4ZXBA 3VFUA 3FT4A 4LKCA 1MLBA 4CMHB 2CO7B 4NN5C 3BEVB 4TSCL 3TPUB 2HJFA 1YJDC 4NUJA 4ODHL 3S3SA 1X4YA 1JHKL 4X98B 3FO0L 5HGBB 3SDYH 2UYLA 1RZKL 3BPNC 3HI1A 3CC5A 1R24A 3ZTNH 1S7VB 2EH7L 3VFGH 2YZ8A 2Y23A 3QUYD 3KXFD 3SGDI 5HI5D 3QG7H 3VXSE 5L88H 3NA9H 5BOPA 1G6RA 2W92A 1K6QH 3DMMC 1MFNA 5FOJA 5CZVL 2XFXB 4GBXD 1NL0H 4WFFE 3SDXE 2MCG1 3CFKB 1VESA 5TQ0H 1I7UB 4YHML 3BKCH 1CK0L 4IIQC 4MJ6A 1D5XA 3IFPA 4YHIB 1A7NH 2OQJB 3VE0B 4N8CL 4LVNB 4PJAE 1A4JA 4Y19E 1J1PH 3HC0B 1TQBC 2A6JB 1QFWI 2HTLC 4WW1A 4RFEA 3JTSA 4KMQA 1WBZB 1DBBH 1H0DB 2UZYB 1LEGA 1LK3H 2F53A 3LEXA 1CGUA 1IEAB 3N9GH 1FL6B 1MFAH 2AABH 2KZ1B 4UOW1 2A0LD 4YGVA 1F58H 3UZVB 1RZFH 4QTIH 1KFAH 2A38A 4PUBH 1MRCL 3O4LD 2CIIA 3DVFA 4RGMC 5C8JA 3PWVA 3EOTH 5HJ3B 3V0VB 1A7OL 4FABH 4PJDA 1K8IA 1OT2A 2SEBB 4P3CL 4JFXA 5DRNA 4PJFA 5T3XD 4OT1H 4L4TB 3UTQB 3VFTA 1R3HA 4YXKL 1OF2B 1ZLUH 1EZVY 5GGRB 3W39B 3B2VL 3DI3B 1G9ML 1MRFL 2DQEL 2Y5TB 3WIIL 1A1MB 5EIIB 1DBMH 2A6IB 2E7HA 2EXYC 5HI4D 2HN7A 1RHHA 2Y36L 3QDME 4RGNB 1UJ3A 2DQTH 2H3NB 3HPJB 1U3JA 5I15L 4K8RD 3BISA 2R23A 3TM6A 1ZLSL 4P3DB 5F7EH 1KACB 5BO1H 2P45B 1T6WA 2IH1B 4JZJA 1QYGH 2YRPA 3BT2H 3ULSA 4D8PA 1ODAA 1DUYA 4KV5F 1FYTB 1DDHA 4X9HA 1BBJB 3FT3B 4WO4B 1SEBB 2NZ9C 4KKCD 4MJ5B 2V5RA 2YN3A 4MWFA 3EAKA 1HHGA 2CRIA 1HHHB 3D85A 5DD6B 5BS0E 1FSKB 5FDWA 3LZFH 5JQHC 4GG6E 2VWEC 1JRHH 2XTJE 3MR9A 4MLIA 5DVKA 3HZMA 4IMKA 3RDTB 3REWA 1GSMA 2EDDA 1CFVH 4TPRL 4UI2A 4F7CB 3WNOA 4ETQB 1QQDA 3K8MA 4WJ5A 2ZUTA 5BZDA 2JIXD 4POZD 3LQZB 4P4RA 1P7KA 4QRTB 4ODBD 3NBNA 2EH8H 1TPXB 3HMWL 2WBWB 2FCBA 4GUPB 1V7NL 3S36X 3BFOA 4NWTH 3TZVD 5I9QB 3EOAB 3WMSA 5ITFB 1K3ZA 5JOFA 2O5XH 3P4OA 2GTZB 3HPLA 4M7LL 4UQ2A 1QFWL 1KBGL 4HUXA 2BNQB 5KSAA 4YR6B 3VA2C 2XN9B 3PHQB 4CBPA 1DQJA 3U48A 5GJSL 5E2TH 1S3KL 1LVEA 1MJJB 1IGIL 3HZKA 4P2CG 4Z0XB 4FTVE 4MA8L 2VDRH 3H2WA 1SBBA 2CK0H 4M7LT 2A2QT 4PJBA 2BVEA 4PRDB 1NSNL 4QRRE 5GGVH 3S3JA 5EZIL 1L0XA 3C5JA 1NCTA 1JGLH 5D1ZA 1J8HD 2H32B 5EO9B 2XWJA 1XFPA 4S1DD 3VXRB 3IFLL 4U0QB 4I2XE 1CCZA 5HBBA 2CSPA 1R3IH 3VGHA 2YEZA 4JM2B 4U1NA 1IGFH 3IJHB 2X4RB 5EU7E 2AI0L 4LDEB 5DD1L 4PJ5A 3TVMC 1G7HB 4OSUH 4WI5A 5I1DA 3U7WH 1D5ZA 5HVGB 5E08L 2LFGA 5ETUA 5EBMB 4V2CB 3DO3A 1J1XL 4P5TD 2AJXH 4N0CC 5GZOD 4AH2B 2WAHA 3QDHA 1BOYA 1NC4A 3GBNL 5A16B 2NTFA 2R1YA 2P7TB 3BPOB 1PVHA 4NUGH 1MCDA 1EGJH 1BD2E 3BO8B 4WUKH 3LQAC 5K93A 1IC7H 4ZTOL 5L2KE 4PJEA 2IALA 3B43A 4X5WA 4TUJA 3GDBA 4PYGA 4HWBA 5TGBB 4G43B 3OAYH 4MNGB 2C3GA 2CLVB 1JK8A 3WSQH 3MNZB 5C86A 3WBDA 5L0QB 1JIBA 2HG5A 1TFHA 5DHYB 3N1MC 1M7DB 3MRCA 4Q9RL 1IBGL 3ARBD 4HIJA 1V05A 3STBA 1FBIH 3MV9D 2PYEB 4WUUB 4TVPE 2YWYA 3BPCA 2P43B 1S5IH 3DXAB 4G8GA 3QRGL 1HXYB 1D6VH 1YEIL 3QQNA 1VGEH 3ZDYE 4QCIA 2CDGA 2VLLB 5DQ9A 3DHMA 5IESL 4OFVA 2BOBA 4GAJH 4KHTH 2ZOKB 4JFOA 5IM7B 1CGWA 2A1WL 5TE7L 4GKNA 4OI8A 3W0WB 2AJYL 3LH2L 4APQB 3V7MA 4L3ED 2VXTH 4GSDH 4Z7UA 4GLRH 1B9ZA 2ZUWA 2ZUUA 3MLUL 3WN5C 3RWEA 5DVNA 3RKDD 1F6AA 1MJ7H 4KK5C 3LN4A 3VXPB 2DI9A 5DHVH 1X6LA 4PRIE 3MNVB 3QJFA 2X70A 2AEIT 1Z9MA 2GJ6B 5ALBH 5FCUL 2WBKA 3JWNC 2CKBH 3P77A 3KHOA 5IVZB 4OUUA 4H0HB 1VKXB 1GXEA 3ULUC 1HOCA 4WU7B 4ZFGL 1S9VA 4CADA 1URLA 1REIA 1RUMH 5IT2H 4LP5A 3HNSH 1EXUA 2RFXB 4MXQD 3HE6D 2XTLA 3R1GH 2PW1A 2EO9A 4O58L 4P23B 1JPFA 3STLB 3T04D 4UTAL 1WQVT 3IFNH 2AJZA 3LEYH 4IDJL 5TE4H 2Q6WB 5C70A 5ESVB 1TZIA 3GSXA 4OFPA 2CUHA 4H8WH 3UJIL 2FJHA 5A3ID 5EOCL 3ABZA 5SWSE 4TNVF 4Y2DD 3HC4L 3VXSB 1CI5A 1ZGLA 4NT6A 2X42A 1D9KD 3B9EA 4JQIL 5C0GA 5F7NC 4DGIL 4H88H 3BESR 3FFCD 5CGYC 1CFTB 3S4SA 3MJ9L 1YUHB 3LHPH 4QRPD 5CBEB 5JDJA 1RUKL 3SDXB 3U46A 4FP8L 3WXVH 4FZ8H 3SKJH 5B4MD 2VL5A 1JNNH 4HMEA 1RIVH 1J5OL 3V6OA 1YMMA 3ARUA 1N3NA 3FQUA 3D3VE 3X11A 3CK0L 4PJAB 5I1IL 4Y19B 4FQXB 5EH1A 4YFDB 2UV3A 2VN4A 1PYWA 2FBJH 4LCWA 4PBWD 2AK1H 4JO1L 5EZOL 3ZMRA 3IXTB 1KELH 4KK9C 1U3YA 3BP4B 5SX4I 5ADOL 2YN5A 3HNTL 4JY4B 2ZUYA 3EZJB 4GXVH 2YPLD 4GAGL 2VMFA 4KQ4L 4LSDA 2KQMA 4KI5D 4Y4HB 2VTFA 3O41A 3VG0L 1FHGA 4Z7WA 4F33B 4IRZH 4KVCL 1MCPL 1JN6A 1H3XA 3P30H 1JJUA 1H5BB 5I1CH 1TPXC 2LE9A 5EO0B 5ILTH 5DK2B 4RX4A 1TIUA 2P1YA 4P2OD 3MRFB 5I9QC 1RJLB 1KCSL 1NANH 3LRHA 2WQRA 3ESUF 3QDMB 4HDIA 4NKQB 4WEBL 3KPQA 4U6XB 5DJXB 4MAYA 2GT9A 5E99L 3O2WL 2OXGA 3KLHC 1FO0B 2XA8H 1LO2L 1F2QA 1U8KA 3ROLB 4X6EB 1YQVL 3I2CH 3D39D 1CDBA 3P9LA 3QFJD 5E2UL 4FQJH 4XMPH 4NRZB 1XGPB 3MOAH 4RDQG 3EUUA 5H2BA 1UH3A 5DZOA 3QDGB 5BS0B 1VGKB 2NY0D 1D5BA 5I6XC 4MQXD 5E2JA 2XG5A 4OGXH 4KK8D 4ZXBD 5HYSB 4GG6B 4XH2A 5IB4A 1CIUA 1K8DA 4P2QA 2XTJB 3OG4B 5E2WH 1CWVA 4NNXA 3S96B 2VISB 1S7QB 4JM2C 2LU3A 1UACH 3G5ZB 3UDWC 3RPIB 3GKWL 5GGSB 4HG4J 2R2EB 4WHYG 3ZKQD 1LD9A 1E6JH 1EO8L 5LCVH 3TNNB 4L1HA 4HIXL 4YDLC 5C3TA 5MERB 3OAZH 3S97C 5DQJA 5CCKL 4U1HB 1NEZB 3WIHL 4WU5A 3MRGA 4QXWA 4QYOB 4HKXA 3QCTL 1RFDL 3C60B 4I48B 5J8OA 4K3HA 2C3WA 4OB5L 3AS1A 4MS8D 2VABB 3V4PH 1Z9LA 2QR0A 4X99A 4OLUH 2W91A 1JMXA 4TYUA 1DEEA 2AV1A 1K2DA 5I71C 1GZQA 1PZ5B 2E27L 3B8SA 5F96L 1UM6H 4FTVB 3ARFA 2IAMC 1G7LA 3A6BL 3CX5K 2ITDA 5H37H 1JGVH 3ZKMD 3QNXA 1KXQE 4LSUL 3DWTA 4Z5RB 3TO4A 4K7FA 5DJ8B 4S0SD 3MODL 4Z0BH 3R0MA 4OIIL 4OV5A 3JWOH 5D72L 3QI9D 4O02L 4ZOAA 2YXFA 5JUEL 4OFDA 4I2XB 1NGPL 4DK3A 5I8EA 4APQC 1IKNA 4U1IA 5JW5B 1HHIB 3HTLX 1A0QH 2MKWA 3AM8A 1FZJA 4LVOB 2A6KB 4Z95H 2R0LH 2R56H 3SDAB 3G08B 4NM4H 2Q20A 4Q0XL 1KPUB 2AVGA 3MRDB 4UDUA 3X3GL 4JFQB 4OJFL 2PCPB 4ODWA 1U8NA 1A3QA 2IH3B 3ULVH 2J88L 1YEEH 3IFOB 1ZVYA 4ZUVA 1BD2B 2F5BL 4AG4L 4HT1H 3X3FL 1GPOH 5L2KB 5FO7B 3S88L 1NAKL 3PABA 1XIWB 2JJSC 3DVNB 3HUJA 1WLHA 4P23C 3HAEB 2Q8BL 4PJ8A 3PGDB 3RL1B 2CK2A 4LSRL 4Z7WF 3GSUA 3DURB 3EYOA 3VXNA 4UU9A 2APWA 4OD1L 4G3YL 3WD5L 3HB3D 3QEQA 3L3IA 1S7UB 2ADIB 5T33H 4K94L 4KGLA 1QBAA 2E7LC 4UBDC 2DLFL 1OSZB 3ECBA 4U6YB 3MRQA 4DFIA 1N6VA 2FYYB 1BFTA 2R0ZL 2CLZB 4NCC2 5EUKB 4KPHL 2EE3A 3WIFB 4FQXC 4MAUH 1BOGB 3PGCA 1AY1L 4X8JA 1ZHLB 5FOBA 1AO7A 2BDNL 2R1WA 2AEQH 2ED9A 2WQ8A 4ISVA 4RNRA 2GY5A 4IRJB 2FO4B 3EYFB 5DJ0B 1ND0A 3KYMB 4YNYA 3WS3B 2R2HB 4PRIB 1I9EA 3SCMB 2ZJSH 3RY6C 4OZIF 4U7KA 2BVOA 2X4PA 1J0IA 1KXTB 4WIQA 3S4SG 1I1RA 3MBEB 3G5VB 3OKOB 1IGML 5FECA 5MEPB 4Y4HC 1J05B 1TETL 4YFEA 3WXWH 1F45A 5INCA 5A2LH 4O51A 5CILL 4M5YH 4GRMB 4UT6H 3WNPA 4X6DA 3VMOA 5MEOA 2LAGB 2OR9L 3SKOA 1H5BC 3ARPA 3O0RL 3EZ8A 4D9LH 5F6IC 3BHBB 4X4XA 1QEWA 1EBAA 2VDLL 5HSFA 1BQHA 2PR4H 5D1ZD 4AYFA 3UO1H 3G5XA 2NX5E 1YPZA 4JN2A 3BQUB 1BREA 1S9WA 5SWSB 1MFEL 1V7MH 1U8LA 3HLAA 5C92A 4PJ5D 3JXAA 3GMQB 3C6LA 3EOBB 2B7DT 1ZANH 5GRJH 4GKSA 4LPCA 3BGFB 4NKMA 3OWEA 4HK0A 2FX9L 3D25A 2M1KA 3D3VB 5J13B 1MCFA 1IQWH 1NC4D 2EEDA 4HS6A 5TQ2L 1Q9KA 4DKFL 1NPUA 1LK2A 3KJ4B 3D0VB 2GFBA 2P46B 1I9RH 4PY8I 4NQXB 4Y4FB 5JPMB 2NW2A 1NLDL 4UILH 4FMKA 4XPHL 1N7ML 4K71C 1ZLWH 1KN4H 4YHOL 5FXCH 4PJEE 1LNUA 1NMAL 3E0GA 1BWWA 3UBXB 1NCDH 4E5XA 4ZO8A 3BH9A 5DMGC 3VXUA 2CGRH 3CVHL 4HCRA 5F8RC 4FHBD 3IU4L 3KDMB 4JFHE 3L3GA 4MXWL 4OI9A 4HFWB 5E94B 1I7TB 5GRUH 3HI6H 5HYJA 2FR4A 4I77L 4R4BB 4KZEL 3C60C 3I6KA 4FQIH 4Z8FH 5MHSD 1ES0B 4G6ML 4M4RA 1AR2A 4G8GE 4M03A 1DLFL 3OXSA 5GRXG 3U6RA 1N64L 3N1GC 1ZLUK 3UTPD 1XGYL 1SJHB 4X4YB 1IL1B 4OM1L 3ARTA 5IIEA 4GMTL 3DOSA 2ED7A 2QSVA 2E6PA 5E1HB 5JXEA 3LN5B 1JGDA 2HVKA 3VRIB 4OLXH 4L9LA 2RJMA 3A6CH 5LGHL 4PV9A 2ESVD 2IJ0C 4F2MA 4KHXH 3DRQB 3VJ6B 3C8DA 2LU7A 3OX8B 3U2SA 5CJ8A 5IWLA 3ELAT 2I5YH 5B38G 3BDYH 4P2RA 3OV6A 1VADB 3QNYB 5BVJA 4UT7H 4LVOC 5HHNB 3FCTB 4KUZH 4FFWD 3SDAC 3I02B 1T22B 4UAOC 4MZ2A 2X89D 4QLRA 2R0WH 3HI1B 3GSVA 2ADJA 4XT1C 1OVZA 3PWNA 3H9HB 5IR1B 1YEKH 2EYRB 3QH3B 1ZGLM 3AXLB 4HS8L 4NNPL 3QIUA 1OD7A 4Y16D 1KLGA 2EE9A 2V5TA 3NCCB 2HFGH 3VFOA 1D6EA 1CIDA 5ICXA 1YMMD 3S6CA 4JG1H 3NAAL 3SKMB 4Z76B 3O3BA 4G7VH 2NY6D 3MO1A 3MLXL 4JFED 4BK4A 5KANI 15C8L 4KZDH 3V6OE 1NBZB 3O2VH 3MRMB 5E00A 2CD0A 4X6DF 3GMMA 1F3JB 1KN2H 1VA9A 3B5TA 5C0JA 1AKJA 4LCWE 2VXSH 3B5HA 1MIEL 3O9WC 3TV3H 1EX0A 1OAQL 4QRUB 4Z18A 1BFVH 32C2B 3VRJA 4O2CA 4MQTB 4JN1L 2DF3A 3ZT6A 3H9SE 1A6ZB 4V1DD 3THML 2F8XC 4KKAC 2OTWB 4F7PA 1N8ZB 3LKRB 5GIRB 3R06B 4RX4D 4BZYA 4Z7WE 2WM0A 5HVWA 5I76B 1OAXL 5EBLA 2CDEB 3T0EB 4IRJC 5I8CA 4XXDB 1MLCA 1U58B 2IG2H 1CDGA 4YDJA 3V5DA 2XYCA 4QRQB 4JJ5B 1FFOB 3MBEC 5D8JH 2VN7A 2B4CH 4N0FB 3MOBL 5FYJD 3SDYL 4EDXA 1MI5A 1JRHI 3ARXA 1TZHA 3ZTNL 1CLCA 5K9OB 5FB8A 4GJTB 3MRBA 3X12A 1C7TA 4JKKA 2EECA 1ORQA 3CVHA 3QG7L 4HIHA 4ENED 3S9DB 5L88L 2HJKB 3NA9L 1OM3H 3ALPA 1K6QL 1NAMH 3V6FB 1T1WA 4YHLH 1NL0L 2DYPD 4OZIE 2EEAA 3MGOB 5KSUA 3OAYK 5CWSB 5ICYB 2D03L 4P2QD 1W0VA 2R2BB 1ONQA 5HXMA 1A7NL 2D0GA 2AW2A 4G8FA 3QQ9C 5E9DA 3HZMB 3MRNA 3BGFC 1JNLH 1GAFH 1DBBL 3CXHK 5TFSH 3QUXB 4D9RE 1LK3L 4U1KB 4Q97A 3N9GL 4I9WE 3O8XA 1MFAL 2AABL 5F9JA 1BQHG 2DM2A 5J89A 2RAMA 2BRQA 2CDFA 2NXZD 4S2SB 1A3LH 4QTIL 1KFAL 4PUBL 3SO5A 5EBWB 1OW0C 2IFFL 1FL3A 3QEHB 3UTTB 4WV1B 4TOYH 5GXBB 4Y4FC 3EOTL 4LQFL 5SX5H 1N26A 4JCMA 2F19H 4IMLB 4FABL 2OR7A 4OT1L 5JLZA 3WJLC 2R8SH 3MV7E 1KIRA 3KPSA 2FLRT 3A67H 3FB7B 3D2UB 4ZAKD 5IMOB 5KSAB 3SE4C 2WANA 3PWLB 1DBML 1DQJB 1FL5A 2RIKA 5FGBC 1XGTB 4BH7A 3V4UL 2A73A 4G9DB 4WW2A 3KYNB 5CIPA 4X6CF 1EMTH 2LABA 3KPOA 4YH6A 1JWUB 1ZT7A 4HJJH 5F7EL 5BO1L 1G0YR 4KVNH 25C8L 4JDZA 1F13A 3VD7A 5GS1A 1JWMA 4KTDH 4E0RB 1QYGL 4M1DH 3W5NA 2CRMA 3KLAB 3O2DH 2NX5B 4NSKB 5J56B 4KXZH 1PG7W 1EEZB 4G7YH 5C0RH 4QXGL 2Z92B 1PG7H 4JRXD 1WBXA 2H9GA 4LCUA 1GC1C 3WNKA 5SV4A 1CU4H 5DK0A 1H3TA 5FV1L 4NCC1 3LZFL 1BJ1H 2W9EL 2BVQB 3DV6A 1BQLH 3T2NH 1PSKH 2FGZA 1JRHL 5KZCD 5DD5H 5HD8C 3QT2A 4LSPL 2V5MA 3B6SA 3BH8A 3SY0B 1CFVL 6CGTA 1QRNA 1AXSA 4JB9H 5C08A 3H42L 4ZOEA 4IBLT 3MV8D 1DLHA 2H32H 1WCQA 2IANA 5EUOA 1VACA 2LVEA 1MHCB 3W11D 2EH8L 3EO0B 5JIHA 4U6HA 3ZE2E 2JJWA 3K1KC 4PJ8D 4MJ2A 3QCVH 4NWTL 3O3EB 1YYLH 2VH5H 4OF0A 2DS4A 1WZ1H 5DSCB 1MWAA 5D93B 5IF0B 3KPRD 4L8SC 3MRCB 1UG9A 1DQTA 2YRZA 1KEGH 3MNWB 4ZS6C 1P4LB 1U92A 1EJOH 4YHYC 2HVJA 5E2TL 4AENA 2ZWLT 4KKBD 1KIPB 4X5LA 2VDRL 5FYLD 3STZA 2CK0L 4Y5VB 3OKLA 1O7SA 1XGQA 1OARH 3E6FA 4L4VE 1ITCA 2W9LA 4XP1H 3F5WA 2HT4D 2JCCA 1YNKH 5GGVL 1P9MA 1IC4H 4G9FE 1AO7D 5EU5A 1JGLL 3IDYB 3KXFE 1F90H 2YPKB 3B83A 1UWXH 5DMIH 4F3FA 2HLFD 1CD9B 5B8CB 1A9BA 1IGFL 4I4WB 2Y72A 2GHWB 4LNRB 4OSUL 3U7WL 1FNGB 1KLFA 3C08L 3DBXA 4CUCA 3DECA 2PN5A 1B0RB 1T0NB 3IVKA 4Q6YA 4IHOA 1R3KB 1F6LL 2AJXL 3V79C 2I9TA 3U4BH 2C5DC 3VGBA 4XCEB 1MY5A 1PY4A 4Z78A 5J7CC 4LNVA 4WWKD 3IAQA 4NUGL 1EGJL 3T0EC 4UNUA 5E70A 4X6DE 4NPYB 5AD0B 4EI6A 4J3XA 4PGDA 4JFYB 1P4IH 1SBSH 1MCBA 3VFVA 2VR9A 4QHLA 3L3OA 1UCTA 3FN0H 3WSQL 4O2EB 2N56A 2Y9RT 4JJHA 1YPZE 3IETB 4UIMA 4PBVC 5FUOH 1ZT4A 3HG1B 4OBRA 3GSOB 4PB0H 5I19H 5T3XE 5E0QA 2E5EA 2HT3D 3OAZK 1FBIL 3WE6A 1FVDA 5ICZB 1IVLA 2F74A 4H26A 3FOLA 1UQSA 4W6XB 1XF4B 3O6FD 3T1WA 2X4UB 2YSSA 3K3QA 1S5IL 5DMYA 1VGEL 5DJDB 3QPQD 3QUZA 1SHMA 1KTLB 2YD9A 1LEIB 4GAJL 2UZXB 4KHTL 4JM4H 5AWNL 4HXBH 2VZ3A 1PYWB 1K4DA 1KXVC 5A40E 3WHE0 1JGEB 4GSDL 3X13B 1KT2A 4F7CA 3L6FA 1JYNA 1TENA 2ATPB 2I24N 3Q6FB 2VRAA 3V95A 1B0GA 2C4FU 4WVRA 1OD9A 3H9SB 3VXUD 4P57A 4JVWA 4N9GA 5CZXC 3IXAB 5F72S 4EKXA 3G9AB 2C7UB 3DUUA 5ALBL 3CAFA 1AD9B 5JMOC 2CKBL 4BM7A 2AERT 2IWGA 4Q9QH 5KTEH 1T0PB 1DVFA 2BNRA 3EHBC 4MHHG 4XVUD 3RUGF 1SYSB 5CHNA 4WV1C 3MBXH 4ZFFA 1RUML 1X5GA 3BIKB 4X9IA 5IT2L 4JQVA 5IV2A 4F7EA 3HNSL 2EDBA 4LMQE 1C1EL 1JF5A 1OLZA 3R1GL 5JW3H 2O61B 2IGFH 3IFNL 3LEYL 5TE4L 4HDIB 3KYKH 3MXVH 3PDOB 2GT9B 4H8WL 4F37F 5JXED 4EXPX 2YXMA 4ZPTA 3BD5A 1J8KA 2PXYA 3VWKB 4GW4B 3RWHA 3QDJD 5GRVK 1J7VR 1HCVA 1PBYA 1HQRA 1MHHB 2YC1B 1IEBB 4H88L 5ISZA 1I4FA 4EBQL 5HPMA 2YA2A 2EEBA 4OZIB 1R5WB 4QOKD 3WXVL 1JP5A 3ZO0A 4FZ8L 4KJQC 5H2BB 1Z0NA 5I75B 4GXUN 2ARJQ 3BZEA 4FMFA 1JNNL 1RIVL 2ZNWA 2DM3A 4O5LH 5IW6B 4NQVA 3GMLB 1G84A 4XNUH 2FBJL 2AK1L 1P7QB 4PLJD 3GB7B 3GBMH 2Y1VA 1KELL 1R5IB 2XKNA 2B1HH 1NDMA 5LQBH 4X6CE 4OGZA 3X14B 1ZHKA 4GXVL 3QIBA 2OK0H 3BN9D 5IEHA 1T66D 4JPIA 2Q7YA 5DR5H 3GMPA 3WO4B 4HIIA 1VENA 3QIUD 2GJJA 1C5BH 4IRZL 2W0FA 2UUDH 4UUJB 3P30L 3K2MC 4HW6A 2OCFD 1TVBB 3MJ8A 3QHFH 1AP2A 5I1CL 3MV7B 4EQ3A 5ILTL 4PLKD 2AXGB 2JJTA 2RGSA 4TUOA 3EDJA 1QA9A 4PIRF 4KROD 2GK0A 4FQHA 2HT2C 4M3KB 4MGXA 4KKLC 5D93C 1A3RH 5E24E 3DX9A 5B38B 1AQDA 2PF6A 1ITBB 4XCFH 2EIZB 3WHE1 4QWWD 4WI9A 2BY3A 2XA8L 5IB3B 2HYMA 1AHWA 1QOKA 2ICEA 4J3UA 4ELMA 1C16B 3GNMH 4KJPC 3B9KD 3I2CL 3FB8B 4FXKB 4Y5VC 1ZHBB 4ODSH 4M48H 2CH8A 4FQJL 4XMPL 4ZPVB 4OQ1A 3MOAL 3SO3B 2Z9TA 3PIQA 4CDHA 4DCQB 1QUNA 3MLRH 3IDYC 3RNQA 3K74B 4OGXL 1XGUB 4S10A 2Q86B 2B0SL 3BXNB 1BIIA 2YUWA 5E2WL 5IG7B 3TJHD 4DKAA 1UACL 1KOAA 1AI1L 2GEEA 4OCXH 1Q9LB 1T0MB 3DO7A 5DJAB 5DJ2B 1FZOA 3ARGA 5DRWA 5TDNB 3FMGH 1S9YB 1Y0LA 4M61B 1MI5D 1I8KA 4C4KT 1E6JL 1H8NA 2GSGA 5IBUB 5LCVL 4XP9H 4L3AA 3H7LA 1X4ZA 2IPUK 4QF1A 5GGQL 4JFPB 5F7UA 3DX6A 3E6HB 2NNAB 4HF5L 1QHOA 5DHVA 1CT8A 3HI5H 2IBZX 3NCEB 3M17A 5ERWB 5HYQB 4DGYH 2V6HA 2CKBA 2IPTH 3DV4A 4LLVA 3NPZB 1M6OB 1BVKA 3V4PL 4OLUL 1HDMA 1ZLWK 1JVKA 4DKDC 4B50A 3GIZH 3VG9B 4D0DB 3P9MA 1K85A 2F58H 2E7BA 3LAFA 1E28A 3QXAB 4XNMA 1UM6L 5E9DD 1C7SA 3VRLE 1JGVL 2R0KH 3ECBB 4L4VB 3JV6A 1S8DA 5C6PB 3BE1L 2GW5A 5D5MF 3RWJB 1OGAA 1OTUD 4UNTA 8FABB 4Z0BL 4G9FB 1ZA3A 1U3HD 2G2RA 3MOQA 3FFDA 3KWWB 4PRBA 4JPKL 5DYOA 3KXFB 1I1YB 4R4NC 4NN7B 5KANG 2QADD 2EDLA 4PS4L 2X9WA 4JG0H 2BFVH 1A4KB 3MLVH 4TVPH 3FQTA 3OJDA 5FKAB 4PLNC 1AD0A 4OZFA 5JW4Q 3KPSD 3FL7A 4MYWB 4Z95L 2R0LL 5I1HH 3V5KA 2R56L 4NM4L 3UAJD 4P9HL 1BP3B 3GHBH 3T77B 2V2WB 2F54A 3ULVL 1YEEL 2ZP0T 3RWFB 3VMNA 3QULB 3ROOA 5ACZB 1BF2A 1IAKA 1T5XA 1G1CA 2NR6C 5GRVL 3MA7A 3LPGA 1GPOL 4X6DB 3GK8H 3LSOA 3OKDA 4XAWH 6FABH 1M71B 2VLJD 1RULH 4NZUH 1RSFA 1YQ2A 1KJMB 2VE6A 1RU9H 5C07E 3ETBF 5KS9F 3F6LA 3ILQC 4ZOCA 3TT1H 4QHUB 4YIQA 2AEWA 5L8LB 5I8OL 5B39A 4PJXA 3FAXA 4OD2A 5D7KE 3C5ZA 2GTWA 4ZS7H 1U8LB 3HLAB 4QGYA 1UC6A 4ZOBA 3ARRA 4HAGA 2HLAB 1IGYB 3RVXC 3FO9A 4DVBA 4URTB 5K9JH 3VWKC 4NKOA 4RMRA 5T5NF 1NCCH 2AAVA 4GOSA 1SYVB 4K7PX 1H3VA 4OCSH 4N5EC 3RUGE 2J4WH 1HK6A 1AC6A 3ALXA 5C08D 2HFTA 1XR9B 3T2PA 3RPKA 5I75C 2MWCA 2DQUH 3MUGB 3FB5B 3B8YA 1C5DB 1XGRB 4P59L 1CGSH 1UM4H 1NGYA 4MAUL 4Q58C 3OHXB 2NW2B 5AZEH 4OFKA 2IBBA 2EDNA 2AEQL 4BZ1H 1PW3A 3V5HA 3RKPA 2ZJSL 4XP4L 3S8WA 4NN6B 1I7ZA 5EU6D 3RVTC 4X80H 3LN9A 5FGSA 1MEXL 1YN7B 2C3VB 3QB7C 3VU2A 3L3DB 1OAUH 3WO4C 3WXWL 3LD8B 2BNUB 1TTGA 2YUXA 4M5YL 3DTXA 2AEPH 2XZZA 1GOHA 1WIUA 3TBWA 1AE6H 5JHDE 3IDMB 4OLVH 5F9OH 4D9LL 3J7HA 3QFDB 1V5JA 1X5ZA 2H2PC 3GO1H 3TYFA 5GJTH 1C5CH 1KJ2B 5IFAH 2JCCE 2E8ZA 3UO1L 3QG6A 1YEFH 5A43C 3BGAA 4E9LA 1VFBB 1FC2D 3TZVB 1V7ML 3RWGB 1YEHH 3SDDA 2AK4E 4WFHD 4CJ0A 1T4KB 1ZANL 5GRJL 2F15A 1PLGH 1IC1A 2JB6A 1I85C 2FO1A 3B9AA 2I07B 4BQ6A 5T5NG 5TDOA 4J4PA 4QGTA 1U8MA 1P2CB 1IQWL 4N8VG 3TA3A 3HRZB 3NA4A 5GQBA 3FB6A 4CMMB 3SOBH 2F9BT 5IFJA 3U2SB 4IJ3B 4I3SH 4LDLB 3PQYA 3LKQA 2R4RL 1DQLH 1HH6A 1I9RL 1N2RB 4MD4A 4LRIA 2QHLA 4U1MB 4X6CB 3QSKB 2KUTA 4YHZH 4X7SH 2X4QA 4ODVH 3BMWA 4WHTB 4LLMA 1KN4L 2EZ0D 1AGFB 1Q0XH 2C4FT 2HRPH 3KPTA 3LEVH 4IRSA 3SPVB 1NCDL 1QFUL 5HGGS 5I0DA 1A6AA 2H1PH 3QUMB 2CPCA 2CGRL 3CFEA 5EWIL 1GJIA 4AQOA 2XNAA 4OZ4B 1T89A 2UWEA 5GRUL 4I5BA 4L4JA 3HI6L 3U0TB 5KOMC 4BH8A 3QUZD 3C8KA 4FQIL 4Z8FL 1FVCB 1C12A 1MJ8L 5SX5K 4PRHA 2APXA 5DT1H 3SN6N 3MO1B 3T3PF 3ARDB 3CCHA 3U9UA 5D2LA 3HHRB 3P4NB 5MEND 1XMWA 1HCFX 4NC1C 3NCBB 5F6HI 3Q5YA 1P1ZA 3TF7C 4JQXC 1Q9OB 2PYFA 12E8H 2YK1L 2P5EA 5CMAB 4HUNB 3WYRA 4MD0B 4OCMC 3CUPA 1HHKB 4OLXL 1F5WA 1G6RH 5JW4N 2ICWJ 3UTZB 3A6CL 2E8YA 4LLYA 4LLAA 3ZYZA 4PREB 1I8IA 3I3BA 5FV2A 4A2MA 4KHXL 4NN7C 5HI5C 2VAAA 3FZUD 3ILPA 2R39A 4PTTA 2QQNL 3DVIA 5J6GA 3DMMA 2I5YL 4H0GA 3T2OA 3BDYL 2BNRE 4GBXC 2GITB 3MRPB 1MLCB 1KCLA 1WJ3A 3QR2A 1S7WA 3MV01 3NABH 5D1XD 1I3RB 5ITBH 4KUZL 1FE8H 4IIQA 5E6YA 5EPMA 4KDVA 3HE7B 1AIFA 1BJ8A 2N1KA 3MV11 1HXMA 2R0WL 3IF1A 1IAOB 3PHOB 4PJGF 1LO0H 4WTZA 2ZPKH 1E4KC 1KB5L 4P9MH 4PGEA 2ARWA 5ISZD 2NY4B 3LKPA 1QSZA 1TZGH 2A0LC 4KH2A 1OAZH 2XZCH 2G9HB 2FIRT 4NKDA 4OZFG 5CJQH 1T1WB 3CLFL 4JG1L 4M6NH 5E7FA 5A1AA 3L3JB 4G7VL 1WIPA 1RZGA 4TVSa 2NTSP 2OL3B 5B3NA 4KZDL 1ONQB 4F8QA 5FO8B 1IT9H 3O2VL 3I75B 4PRAA 2GY7B 4HLJA 1QVOB 3L5WB 3DYPA 5M94B 1KN2L 4AEFA 5J9PB 2VXSL 3UXFA 3RA7H 2BC4A 3KHQA 1A8JH 4NZTH 1EDQA 3QIBD 4GRWE 5IHZA 1LILA 1TQCB 1BFVL 1U9KA 5HI4C 4YJZL 2D7PA 2K7PA 1I1CA 3WLWD 1NJ9A 4L29B 2VLRD 4Y2DB 5KS9E 1CBVL 1UB6A 1ACYH 5TPWH 3QQ4A 4U3XA 1ZK9A 3FFCB 5B39G 4LGRB 1ZKAA 4TNWK 1XCQA 2XWBA 3IDXH 1KCRH 1J1OH 1HILA 2WP3O 1MPAH 1Z6JT 4RRPA 3OZ9L 4KXZI 1CFQA 3P4MA 2CUMA 3EYQC 2P8PB 5JLZB 1P7HL 2IG2L 4NC0B 4KKCC 5D70H 2DKMA 4I0PB 1UWXK 3RAJH 1ULVA 4OCRH 1UKTA 4ONGH 4EOWL 2NY2B 2X1WL 3C87A 5D8JL 3WFEH 2B4CL 3L5HA 3UX9B 4H5SB 4YHPA 1Q94A 4BH7B 1GOGA 3LD8C 1BHGA 5HHVH 1IM3B 1OPGH 5C07B 4YGAB 1ZT7B 5LGJB 3FONB 3VXQB 5EOTA 4R0LA 4YO0B 2HFFA 2H2SD 2DLIA 3IU3B 3CVIL 4NP4H 3RGVB 1OM3L 2H6PA 2X4OB 2CR3A 3JWDC 1NAML 4POZC 5K9QG 4MQSB 3WS6C 4CN6A 1FFPB 4NQCE 4Y8DC 5SWQA 4NO0A 4U1GB 2H9GB 3U0PB 3OKEB 5KVGL 4UZGA 3IDJA 1FN4A 3TZVC 1LE5A 5DUMH 5DEFB 3P73B 2EYTB 1MUJB 1QSVA 4PGCA 1KTDB 1NLBH 3RUGB 4WHYH 3QO1A 3ARGD 2P8LB 2ZG1A 1JNLL 1GAFL 5D2LF 1X7QA 4L1DA 4XWGH 5IBTH 5KG9B 3FN3A 3ZYOA 4LLWA 4EEEA 3D39B 3QFJB 1A3LL 2B2XH 1E4XH 5BZWB 4NRXB 2A83B 4TOYL 2IADA 2F19L 3QNZB 3MLZH 1FLRH 1ED3B 2Y5EA 4S1DC 3MRHA 2IBZY 4HUVA 1MCWW 1KEMH 4HS3A 5IK3B 3QEUB 1RK0B 4WI8A 2VLKE 1Z0MA 1TMCB 3V4VH 3PWJA 3TVMA 1GCFA 5C71A 3MREB 4HPOH 4PY7A 4DQOL 5I16B 4Y7MA 2FJGB 3FQNA 5JHDB 3PXJA 1Z9SA 1EMTL 3PHSA 5IHLB 1I3UA 4HJJL 3MJ7B 4KVNL 3E6FB 4TSAH 4KTDL 2WIIA 4ESKA 4M1DL 1R0AH 3BEWB 3EO9H 3O2DL 1OGAE 3FO1B 4JHAH 1GGTA 2BVUA 5M7QA 4G7YL 4QHMB 5C0RL 2V9TA 3RWDB 3AAZA 1NC2A 2YD6A 3PWUB 5IB5B 2WIMA 2AK4B 3VI3F 1PG7L 5J3HD 3OL2A 3BEVA 3S37H 1WUNT 3TPUA 2P48B 1GGUA 3GGWB 1A9BB 2EKJA 5F70A 1BQLL 3N1PC 4X98A 3PGFH 5DS8B 1PSKL 5HGBA 4HH9B 4PRPD 3MC0A 5DD5L 4JFEE 2F54D 3I50H 4D94A 1TLKA 2VQ1B 1MFDH 3ARBC 1S7VA 1YDPB 4JKLA 3I6GB 4TTGA 2OR8A 3QYCA 2GKIA 1V8HA 1ETZB 1WITA 5E8NB 3MX0A 1CFNA 3MXWL 5F9WB 5L8JB 5EC2B 1Q0YH 2VDMH 3MRIA 4AJ0A 2XFXA 2VLME 3MUJA 3QI9B 1WF5A 3PWPE 2GJZB 4QTHB 3CFKA 1I7UA 1D5IH 1EVTC 1FJ1B 1T7XA 3BYYA 2NY1D 3QCVL 4V1DE 3LPWA 4KJWD 4HHAB 2VH5L 3N06B 3I9GL 1PFCA 1CICD 2OQJA 3VE0A 5KW9H 3GSQB 1WZ1L 3HC0A 3Q5OA 5F1SA 5C0DA 2A6JA 3K4DA 3U82B 1KEGL 1WBZA 3QBTB 1HN1A 4MA3B 4XI5D 3RKDC 1H0DA 1CXKA 1EJOL 3BJLA 3SGDH 4RAUB 1G9EA 3JBG7 3QWOB 2J8UF 3FOLB 5CFHA 3Q5TA 1IEAA 3MACH 1FL6A 5HGDB 2ZOLB 1MREL 4LHJB 2UUDK 3DUSB 5FYJE 2W60B 4XP1L 1F4YH 2X5PA 3WFBH 1UCBL 1NCAH 2YR3A 1YNKL 4K7PY 3T8XB 1HSBB 3V0VA 5IOPB 1J10A 1IC4L 5D9SB 1QR1B 2SEBA 3K81A 4A2LA 4MXQC 3HE6C 1KYOJ 1F90L 1OF2A 4WTZG 5GGRA 3W39A 3MZGB 3LKOB 4PJGE 5DMIL 3KPNB 2Y5TA 1QSFD 1A1MA 5EIIA 1J88A 2F8VA 2A6IA 2MHAB 3DGGB 4DVRH 1QPPA 5A3IC 3GI9H 2H3NA 3GEWB 3HPJA 4Y2DC 2BSRB 3CFCL 4P3DA 4KRPD 3U4BL 4FFZH 2BNRB 2IH1A 4DN4L 1JGUH 4E41E 2V2TB 3AUVA 1FYTA 1OQXA 1BBJA 2EC9U 1D5MB 3OJVC 5KOVC 2C3XA 3FT3A 4WO4A 1SEBA 2WWKO 3BGMA 4I0PC 4MJ5A 1SBSL 5D5MB 4G80B 1HHHA 5DD6A 4DZBB 3RVUD 3FN0L 3PP3H 3UC0H 1TTUA 4WGWB 1UM5H 2AP2A 5FUOL 4WFED 3RDTA 5HYIA 4KTYA 4PB0L 5I19L 3B3IB 1MAML 2BOCB 5EIVA 5E56A 4NZRH 4P46D 4ETQA 1LGVA 2IPUG 2OXHA 3TA3D 5HHMD 3RGVC 4XNQB 3LQZA 1HQ4A 4QRTA 3DYOA 4PJCF 1CR9H 4JM4L 4NQVB 4XNXH 4NQUA 1O5DT 4R3SB 4HXBL 4M02A 3UP1A 5L7XH 1BF8A 2FB4H 3O2DA 5ADPL 3KYOB 3EOAA 2CRZA 5ITFA 2XQYG 2GTZA 1W72B 2J12B 4YEEA 4JRWA 4IRSD 2RBLA 5BRZE 2CMRH 5KS9B 2VXQH 4YR6A 2XN9A 1UWEH 3PHQA 1K4CB 5IVNA 4JRXE 2BXYA 3GMPB 1MJJA 4GRLB 1HWGB 4RIRB 2XPGB 1NDGB 4Z0XA 3HFML 3EYVB 4Q9QL 2HTKC 5KTEL 3BDXA 2J1KA 2E9IA 3MBXL 2IQ9L 4QHKI 2XKSA 1FZKA 4PRHD 4X9GA 1WICA 3G6DH 2R9HC 3TGXA 1OY3B 2HKFH 5F7KC 2DICA 4N8VB 3O81A 2EDXA 5CJXC 2H32A 4WDIB 5EO9A 3EJYD 1UYWL 5JW3L 3VXRA 2IGFL 1AGBB 1SY6H 3MV8E 4JM2A 5D2LE 3KYKL 3IJHA 3MXVL 2X4RA 4GFTB 3UDWA 4YHKH 3CIQA 4WWID 1S5HB 1G7HA 3NMEA 4FOMA 2VZ1A 5I17B 4J2XA 5EBMA 4C56E 3DUHA 1M4KA 4DW2H 3T0BA 1JI2A 2EDRA 4MA7H 4AH2A 4NQCB 3HZYB 4XB8A 5IROC 3WUWB 5A16A 3QZWB 1YEDB 1EEUA 2P7TA 3VGGA 4BUGA 1X5XA 3BO8A 4XTRD 2VDNH 3DMMD 1HI6B 4O5LL 4MS8C 1QACA 4OM0H 5TGBA 2R4SH 4XNUL 4MNGA 5FYLE 2GYSA 2CLVA 3DNKA 2BK8A 3GBML 3MNZA 4AZ8A 1C8PA 4WCYL 1HKLH 4TSBH 2C1OB 2B1HL 1Z3GH 5JA9A 1HIMH 5LQBL 5DHYA 1M7DA 4F9PC 1NBYB 2OK0L 4GS7B 2I60L 3ZKMC 2FEDD 5DR5L 2MPAL 2YD2A 2PYEA 2R29H 1J86A 1SJEB 1OWRM 5HHXH 3DXAA 5IQ9B 4NM8H 1N0XH 2Y7QB 5F9WC 1HXYA 1JMZA 2EIBA 3V2AR 5T3ZE 2WINB 1LDSA 2ESVB 2VLLA 5FF6B 3VI3E 3P2TA 2ZOKA 3QHFL 3QI9C 5IM7A 2XZAH 1BVKB 1I75A 3SE9H 3W0WA 3TNMB 1NMCB 4APQA 1RURH 2VLKB 4FQ1H 1RJZB 5KVDH 3NOIA 1FCCA 4XCFL 3SEPA 1KIQB 5IFHH 3O3UN 4J8RB 3C6SB 3VXPA 1J0JA 4HBCH 1W8NA 3MNVA 3V6ZB 3ZT5A 1I1AD 1DN0B 2GJ6A 3GNML 1GOFA 3ZTJG 1T6VN 4LAQH 2G60H 4KKNA 5J0BA 2D2OA 4M48L 5IVZA 2OMNA 4X4ZA 2ID5A 5IJVB 3U79A 5F89A 3QHTC 4WU7A 4Y16B 5LBSH 5C0CD 2JJSA 3PJSB 2RFXA 4P23A 3STLA 2Q6WA 2NZ9D 2NY6B 3O6ML 1NGQH 2NPLX 5ESVA 4JFEB 5EZLB 5IGXH 1JZ7A 2CXKA 4M43H 2FH8A 3HB3C 5E2VH 1MOEA 5DFTA 4EN3D 2HP4A 4P5KB 3VXSA 2Y4SA 1X5JA 3TBYB 4XP9L 2E7LA 3ORJA 3RI5F 1CFTA 5CBEA 1YUHA 2ED8A 3SDXA 1WV7T 3PWPB 1QP1A 1X5KA 4LHQB 3HI5L 1I9IH 2AJSH 3Q0HA 3ESVF 4YQXH 4V1DB 4FZEH 5CINH 4ORGB 2LTQB 1OAKH 5D7JD 4Z7QF 4FNLH 1SQ2N 1F42A 1JZ4A 4PJAA 1MNUH 4Y19A 4FQXA 4MMXC 1FG2B 4OD2B 2FECL 3C5ZB 3IXTA 3GIZL 1CXEA 4KQ3H 4HBQA 3BP4A 4C57C 3T4YB 2F58L 4JY4A 4E42A 4O00A 4PV8B 2NYYD 4HUMB 1MAKA 3RRQA 4C55A 5MEQA 4GQ9H 2R0KL 2BP3A 1MRDL 4Y4HA 4L8CB 4ZO9A 1KENH 2Z8WC 2EDTA 4JFFD 1JF1B 4Y88A 4F33A 1RZKC 4DTGH 2BXZA 4Y8AA 5CEZL 1H5BA 5EO0A 3P4LA 5DK2A 2D31B 35C8H 5I8KH 4PJGB 5T3XH 1FC1A 4FFYH 4JG0L 5KSBF 3MRFA 2BFVL 1RJLA 2Y6SD 1PG7X 4JDTH 1IEHA 2DYPB 4G42B 3UBXI 2X10A 2ZCLH 3QDMA 4DGVH 5I1HL 4U6XA 5DJXA 1OP3H 3GM0A 1FO0A 4ODXB 3V8CA 4GRLC 2DOCA 2Z91B 3DGCR 3KPLB 3GHBL 3ROLA 3QIWB 2E7CA 1NKOA 4E41B 3NFPB 5EIQA 1QFOA 4X6EA 4MDIB 1EEYA 4PJCE 3ZDZF 4NRZA 4HWZB 1XGPA 3GK8L 4XAWL 6FABL 4HSQA 4N90D 3MCKB 4NZUL 1OQOA 2DTSA 3GJFB 5C0EB 1RU9L 3QDGA 2NXZB 1VGKA 4FQCH 5BS0A 1NC2D 3TT1L 4GG6A 2X7LB 4Y1AE 4GG8B 1MHPH 3S96A 2FHFA 2VISA 1ERNA 1S7QA 2YHGA 3G5ZA<