3IFLL

X-ray structure of amyloid beta peptide:antibody (abeta1-7:12a11) complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
218
structure length
218
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYYCFQSSHVPLTFGAGTKLELKGADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 12A11 FAB antibody light chain
publication title Structural correlates of antibodies associated with acute reversal of amyloid beta-related behavioral deficits in a mouse model of Alzheimer disease.
pubmed doi rcsb
source organism Mus musculus
total genus 55
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iflL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iflL01
3WUZA 1KN2H 1HK6A 1QBML 1QTYT 5I8CA 4WW2C 4QRRD 4KRNA 2ZNXA 1E4XI 4HWZA 4X8JA 1J5OL 2J8UE 3QXDB 3LS5H 4X6CA 3ECBA 3LDBB 3PDDA 2GIYA 4WNQB 4X7SH 4YHKL 3TNMB 4F57L 4HIEB 1JP5A 1T3FB 4O9HH 3MMEA 2IADB 5AWNH 1T04B 1EA9C 5GISL 3X14B 3UTTA 2PTUA 4RFEA 2BRQA 3GEWB 2BX5A 2CPCA 5IJKA 2CDGA 3BWAA 1K8DB 5JXAL 2F19H 4ODHH 3KYNB 3DGGB 4LFHD 3J7HA 3FOMB 1PJ9A 4NC2B 4MJIA 4HUMB 4ZFZA 2Q1EA 3EYSH 4G7VH 3VJ6A 3WCYA 1CBVL 3VI3F 2X4UB 3OKNA 3GRWA 5DUPH 4XCYB 1H3UA 1PKOA 4FZEL 1G7HA 3TM6A 3ZMRA 4OAWA 4DGVL 5SV4A 5MI0C 4IIQB 2E9JA 4XPFH 1XGTA 1A6ZA 2ZPKL 4KRPC 4KQ4H 1G7IB 5TQ0L 4J7RA 1JHTA 3F7QA 3C6SA 3B2UC 2Q3AA 2CDFB 3QG6A 5IMMA 3IDMB 1RVFH 4ODWB 4K3EL 5D7JC 2CKBH 3DV6B 4P46C 1MFAL 3QWOB 4WW2B 4X7CC 1BFOA 1RIVH 2P7TA 3C8HA 4Y5YA 1FL5A 5GRUH 1CD1B 5CILH 1G9ML 1SBSL 2DM3A 3KPQA 3K81A 4KKLD 1KCKA 1FH5H 1IGML 1IGIL 2OZ4A 4P2OB 3MLRL 3P30H 1IAII 1LEGB 1NFIB 1OAKH 2X1OA 4LMQI 1YEDA 4WHDA 1DVFB 4Y1AA 3KPOA 4GFTB 5FIEA 5I8EA 5TDNB 2DQHL 4POZD 4C56D 4QXWA 1NSNH 2Q7YA 4I4WA 3VMNA 4DAGH 1I9JH 4YHZL 1BBDH 4QXTA 1R3KB 3D3VB 1IFHL 5FUZH 4PRIA 4I3SH 3BZDA 2E7MA 2MFNA 3CFBB 5TGBB 1CU4L 5DJYA 1KJMA 3TBWA 3MV8B 3B8SA 4JM2A 1QLFA 2FBOJ 3TESA 3VXSB 1OT2A 4KRPB 4QYOB 3U7AA 3O8XD 2E6QA 2KZ1B 4BSWA 3U79A 4OCWL 3C60C 2VDQL 3U2SA 1S9XB 1VEMA 5GS1C 2OTUB 1LGVA 1I1YA 5D7JB 3IDNA 5CSGA 2FSEA 3ARDB 4JPIB 4PGJA 1ORQB 4L3EB 2CKBB 1TJGH 1GOFA 1OTTD 3W2DL 5C0CD 1D5MB 1H0DA 3V6FA 5DWUL 1TFHA 3FN3A 1E4WL 1T5WA 3ME0A 3TJHD 5IKCB 1N6QH 1RJYB 1FCGA 5EU3B 3TN0D 1FZKA 3E3QE 3QIBC 1TIUA 4D2NA 1KTKE 2LQRA 3HUJA 3VXMB 4OI8A 1OAZH 4KK8D 1F90L 2QQLH 3TBSB 4MQXC 3TO4A 4HIJB 5C07E 5J3HC 4LSRL 3D39D 5DK2B 1HSBB 4RGOH 1EEQA 5GGSY 4MNQD 1T0MA 3IU3B 3VXRE 2A6DA 3PABB 4DCQA 1MCFA 2GITA 3QIWA 4NDMA 1UH3A 2FX9H 2GKIA 1IEBB 1NC4D 3S4SB 3ALPA 4M7JH 4I0CC 1FAKT 5KVMC 1OD7A 4UILH 1KLFA 2ICEA 3RU8H 5I1HL 5E4EC 3TBYB 4JVWA 3P2TA 4C55A 4ZO8A 2HA1A 3BDYL 4J4PC 3GZKA 5A3IC 2PYEA 3T77A 1CFTB 1S9WA 4L3AA 1QQDA 1T66C 2N56A 4EI6A 1WV7T 1X9QA 2ZOKA 3SHSA 4AENB 1A1NA 2YK1L 1MCIA 4F7EB 3MOQA 1L9MA 4Y19E 3HMXL 2P5ED 2GHWB 2EC8A 3O3DA 5JHDE 4JHWH 4UV7H 1JGLL 4EUPG 1YN6B 3EOTL 2WBWB 2GK0B 4R90L 5B39G 4MA3A 3ZO0A 4FXGA 5I1CH 4HCRA 4OLVL 1E6OH 1MHCA 1UCBL 3ARTA 2JCCF 3QRGH 3L3JB 2EDXA 4WFFE 5DJAB 1RJZB 1AD9B 4M48H 1ACZA 2X4NA 3QAZB 3VRLF 1YA5A 1NDMA 1OWWA 4CMHB 1N5AB 2HTKD 1QSED 3WJJA 4U2YA 3KPPA 4ONFL 4LPTA 5ISZE 1EVTC 1KLUA 3VXNA 4AIXA 1OF2A 4PRBA 4NFCA 3X11B 1IAOB 4ZAKA 1MI5A 1UYWH 1RK0A 5KSVA 5FKAB 3OKLA 2MTPA 3VXUB 5CMAA 4F7CB 5C0GB 3VFPB 2X1QA 3HFML 4TPRL 3LKNB 5ICZB 3K0WA 3RWCB 4LCUB 5TH2B 4LSUH 2H3NA 4N8PA 1OT1A 5LXGL 4HGWA 2MPAH 4QRPA 4IRJA 3MCLH 3MXWH 3EUUA 1EEZB 4Y4HA 2DLTA 3SKMB 3S37H 3NTCH 2V17L 4PRNB 2HN7B 4BQ6A 3C87A 5F1SA 5IMLA 3V4PL 3MLUL 3UTSD 2CLZA 4DKEH 4MDIB 3PNWB 5F72S 1YMMA 4C83B 1WCBB 4LIQL 4WHCA 3QUXD 1MVUA 4HHAB 5HHQB 4M8QA 4N90E 1TZHA 2EKJA 3MRQB 5GGUB 3ROLB 3H7LA 2X40A 3PGFL 1HQRA 5JNYA 4QRRB 1BWWA 4IMLB 8FABA 2YPVH 3OR6B 4F7TB 3RWFA 2NTSP 2H8PA 1EO7A 4PB9L 2R23B 1SBBA 3AS0A 3WFBL 3STLB 1JHLL 1K2DB 3I2CH 5KSBA 5KANG 1WF5A 4ZUUB 3MUHL 3L95A 2VAAA 5IR1B 2P5WB 3CFKA 5ETUB 4RGMB 4H88L 3AY4C 3TGXA 4POZC 3QHZH 3GBLA 3WFCH 4NBXB 1QRNE 3GGWB 3B9AA 3U82B 4JO1L 3ROOB 4Y4KD 5DJZA 1UH2A 3LIZL 4J2XA 1RUKH 2AABH 1M7IB 1PEZA 1A6AB 2WIMA 1KCUH 1JWMB 3H9HA 2E7LA 2XZZA 1U8MA 4QRQA 1KCSL 1DANT 4IBLT 1RZGA 1OGAD 4BH8B 1PX4A 3LZFH 3O8XC 2VMFA 4R8WL 3AGVA 5KVDL 1T7VA 1YNKH 1H8OA 3K1KC 1XGQA 2X9XA 5DC4B 3L1OL 3F7YA 1YEEL 1CQKA 2WUBL 4XVTL 1AQKL 3LH2L 1OTTC 4PJFA 3HR6A 1I7UA 3T04D 4RMQA 3QUYD 1DQJB 5IM7A 5JUEL 4XZUB 3R4DA 5EU7E 2RCSH 3TJHC 1AD0A 5DQ9A 3D2UA 3TN0C 5D7KD 2AQ3A 1J86A 3TWCH 3F58H 4ODUA 1MVFA 4RA0C 5L88H 5J6GB 3DYPA 4KK8C 3DRTB 3DX6B 1DLHB 4KAQL 5DSCB 4F58L 5L2JA 3FQRB 3BT2L 1KB9K 1N7ML 5KVEL 2RJMA 3BP6B 2VDKL 5C9KA 2WV3A 3MNZA 4FOMA 3I75A 4N9GA 1GGIH 3MNWA 3DSNA 4BZ1H 4H1LG 3FT2B 3P73B 4MAYA 4Y5VB 3EFDL 4QXGH 4P2QE 5TDOA 1A47A 1QFWL 4X5XA 3VA2C 3T1WA 3SDCA 4I48B 5IHLB 4UDTB 1RUQH 4BZYA 1JPSH 3EBAA 2CLRB 3O8XB 4PJEB 1M7DB 4YE4H 1P5VA 4LHUD 1KPVA 4PJ9D 3CX2A 1T5XB 1UGNA 2BCKA 2XTLA 4OCYH 5F89B 5IMOB 3UPCA 4JFXA 5TE6L 1BZ9A 4H20L 5F7HA 1FFOA 3N1GC 5MERB 1V8HA 4S1RH 4GG6A 3RP1A 3LQAH 4PGEB 2P4AB 1A7PL 3LQAC 1IC7L 3IJHA 3EDEA 5D6CB 3TYGH 3DXAA 4LAJH 5FKPB 2XWBB 1Q72H 1P4BH 2DQGH 4G6KL 3TN0B 2C1OA 3LKPA 3KLAA 4XGZB 5HGDA 5KS9F 3OR7A 3T4YB 1NFKA 1U8KA 3EO0A 4PJHF 1TVHA 4XBEL 5C2BH 4Y4FB 4MNQB 5MP6H 5INDA 2LABA 2MOVA 2HTKC 3O2WL 1DUYA 3BD3A 5AYQA 4DUXA 5HHXH 1N2RB 2FO4B 3QQ4B 1NC4B 4H26A 5ESQA 1GGUA 2K9UA 5HYIA 3I84A 1MFDH 2XA8H 5CJOL 4NJ9H 3SGJA 3SE8H 2X5PA 1FL6B 5GIRA 2VXVL 4MYWB 1CFVH 5EPMB 2HVKA 3K7UA 4Q6IB 1XIWC 4FFZH 5DC0A 5F96H 3PUCA 4X98A 5DVLA 4XBPA 4JKPL 2D7PA 5E99H 3BWUC 1BVKA 5T33H 4LVEA 3UTTD 2VYRE 4JKWA 4NM4H 2X4TB 4POYA 3SGDH 3HNVH 2X70B 35C8L 1ZWIA 3P9LB 4LBEA 4PJCF 5F70A 3IXAA 5IFHH 1G7PA 4PJGE 4K94L 4DZBB 2MQ3A 5F9WC 4MJID 4FTVE 1YNTB 2WP3T 3V5KA 4MLIA 2DL9A 4BKLA 5EU6D 1A22B 3KAAA 1G0XA 5DMKA 3VA6A 3V6OE 4E5XA 4NPYB 4YQXH 5FA3A 2FIKA 1QSEB 1DL7L 3WIFB 5KTEL 4HC1H 4HULB 3IS0X 5JR1L 3SKOA 1MJ7L 1JVKA 1T03H 2IQ9H 3UAJD 2AJXL 4R7DB 3L3DB 3O45A 3T2NL 1AIFB 1T6WA 5ALBH 3GNMH 5DGQA 5HYJB 3VWKA 3OSKA 3QEGH 4KUCF 3FN0L 4WUUA 3JWOC 3NZHL 1WCQA 4A6YA 2MCPH 4NKMB 4P3DA 4HWNA 1G84A 3RHWF 4Y4KC 1M6OB 3NAAH 2FX8H 4OLEA 5GS2H 5ILTH 3CFDB 1FZJA 4KDWA 5DJ2B 1LEKB 4HUWB 5B39A 3NGBB 4OTXL 1KIQB 4Y1AD 3ZKND 1ZA6B 3MV9B 4PRAA 1JGUH 2DQFB 3MGOB 3VGDA 1NGQH 1OQOA 3GMRA 5I1JH 4XAKE 1YPZF 2AV1B 5ECJE 1F5WA 4JY6A 2HWZL 3UTSB 4PRID 2CGRL 1CDGA 1DN2A 3LQMA 4UOJA 1BLNB 4R96B 1Q9OB 3QUXB 15C8H 1OARH 3DOSA 4JM2D 25C8H 3WNPA 3ARSA 1FGNL 1EBPA 3MZTA 3RWIB 1U2HA 3QDGA 1RUPL 1IGYA 2FYYB 4KMQA 4WEBL 2IMNA 5IJVA 2VTFA 2VH5L 4MQ7B 1AGDB 3L7FB 3R06A 3QUYC 2XPGA 2YHGA 5KN5A 3NPSB 3TH4T 4F9LA 5C08A 1LEIB 4AG4H 4PJIB 4OKVA 3KXFB 3CDFA 1TVBB 3ZE2F 4M6OH 1L0QA 4M00A 1CVRA 3G6AB 4PLNC 5HJ3A 3SDXA 4LLYB 2MMXA 1KJ2L 4K7PY 4GXVH 1HHGB 4WI9A 1ZGLM 2VWEE 4LPVA 1YC7A 1MUJA 1YY9C 4Y4KB 3GJFH 2I26N 3SBWC 3ARUA 2EKSB 2CIIB 5E94B 3SDAA 4APQD 1CE6B 4HKZA 4QKXB 1RI8A 4MXWH 3PWVA 3O3EA 1X5HA 1FN4A 3QA3B 4N1HB 4JHAH 4NSKB 4ZPTA 2DAVA 1WIPA 1CIUA 1NBVL 4GUPA 1GH7A 2CD0A 3PHSA 4HUKB 1J87A 4M62L 5K33A 1SY6A 3O81A 4PJ9C 1ZLVK 1ZSDA 2VE6A 4OFYA 4NNYA 2GSGB 4YGAB 3TPUB 2EIDA 5EUKA 5E9DA 2XT1B 4DZ8B 2ED8A 5D7LB 4CL7A 4ZPVA 3DYOA 3OKKB 4NO2A 3UPRA 3IRPX 4YO0B 1CDUA 4JFQA 4K55A 3U4EB 3BKCH 2VDNH 5E2WH 3N85L 3QUYB 4P2RE 4HLZG 4KV5F 1EGJL 1PDKA 3J8F7 3S8WA 4JRYA 1F58H 4HS8H 1PG7L 2VXTL 3O6FA 1DSFL 2QL1A 1FG9C 1NCUA 1XR9B 5I15H 4XP1L 1LMKA 4ELMB 1S9VA 1LP9F 5ACLA 5AG9A 5IMKB 3U0PA 1H8NA 2VDLL 3RX5A 3G5XA 4BH7B 4OM0H 3MNVA 5FB8A 3UC0H 4JJ5B 2ITDB 1NFDE 3MLXL 3WIHA 5CLWA 1ORSA 5FM5M 3EFFB 2DQIL 1GGCL 3GSWB 4W4NA 3MLSH 1N3NB 4RGND 4NGHL 4G7YL 5IB4B 1BFTA 1S8DA 3DMMD 5HVWA 3HS0A 1EZVY 4EIZC 3MLPA 3A0OA 4S2SA 4AK1A 3BZFB 1FBIL 3CZFB 4AH2A 2VABB 3O4LD 3NA9L 3Q2CA 1D5XB 4JY4A 1L6XA 4W4OA 1X7QA 5IVXA 1U2CA 4LLWB 1FVCB 5FDWB 3C08L 1JF1B 1JYVA 1TCRA 1UM4L 4G80A 4YDJB 3CJJA 3BYYA 2WSKA 2Q8AL 5IB3A 1JGDB 3KGRA 1LE5B 1KELL 1ZEAL 3V9FA 4JKLA 4NM8L 5D9SB 3IXTA 4LEXH 3GRWH 3CH1B 4QRPD 3VXSE 4IRJD 5I66A 4ZO9A 5DEZA 4Y4HD 1A1MA 4YFDB 5E2TH 1ZLWH 3RDTA 1N5YL 1JI2A 5CP7A 5FF6A 2MQCA 3BQUB 3JWNC 2D03L 3RFZC 3A6CL 3JUYA 2ILLA 5C0BE 3ULVD 4XWOD 1I7TB 1N0LA 4H1LA 4K3GA 5EOTA 3KPRB 5BOZG 3HI5L 4LU5H 4LPWA 3SGKA 1YMMD 5DR5L 2BXYA 2KQMA 2ZUTA 1EGJA 3CFIC 1MEXL 3UAJC 5I8CB 1OTSD 4ETYA 1AC6A 3I50L 4PUBH 1QYGH 4HWZB 3AREC 4X8JB 4X6CB 3RJDA 3ECBB 1MJUL 1H9VA 4NIKB 1MAMH 3MMEB 4BSVA 4JHBA 2RFXA 2FZ3A 3UTTB 3WIIH 4RFEB 2OS7A 3ZKNC 3SN6N 2A74A 3BWAB 5L9DL 2FR4B 3KPMA 1W0YT 1ZA3A 4PIRF 1E4XL 3R0MA 3VFWA 1LQSR 3HE7A 4MJIB 1BF8A 4ZFZB 1TITA 3OKNB 1WAAF 1JZ4A 3PJSA 1G7HB 1WUNT 1QSFE 4OAWB 5DVNA 4JM2C 1B0WA 2HLFD 3MRPA 1XGTB 2H9GA 4UNUA 5IT2H 2EDEA 1A6ZB 4NWTH 5MENA 4KVCL 2UVEA 4R6UA 4ODSL 1YC8A 5IG7A 1JHTB 3QG6B 3C6SB 3HNTH 5IMMB 5SWZE 3B3IA 2BSED 4I2XB 5FYKL 1N64L 2OBGA 5DFTA 1A7RL 1BFOB 2JJVA 2P7TB 5LAXA 4Y5YB 1FL5B 4DGVH 2CUIA 1MREH 2F53E 2G2RA 4JLRA 4P3WA 3KPQB 1RJCA 5AEAA 2XZCL 2ZPKH 4ZSOA 3D2UD 4I9WE 4OI7A 1BAFL 4OD3L 3DBXA 2SEBB 1YEDB 4APQC 4Y1AB 4K3EH 3KPOB 3M07A 5I8EB 3ZHDA 5IUSA 1MFAH 4K8RL 2Q7YB 1FG2A 1KN4L 3OAYK 4I4WB 2X89A 1P7HL 4QXTB 2HFTA 1G9MH 4J6RL 1MWAA 5I1IL 1SBSH 1G9MC 3BSZH 4PRIB 5ACMA 3IB4A 2D0GA 4PJ5E 1QKZL 4MAYD 1IGIH 1IAIL 2KL6A 1KJMB 5DJYB 3TBWB 1CD9B 1INQA 3B4NA 1QUNA 4GBXD 4JM2B 4N8CH 4Y8DC 5CJQL 2GJZA 1F4WL 3KPNA 1QLFB 3PQYA 1JHKH 2BDNL 3ZKQD 2BY2A 4PGZA 3HLAA 4BSWB 5K9QI 1V3JA 2VIRA 5D5ME 4KK5D 3U2SB 3I85A 3PGCA 5IVOA 2NY4D 4YHZH 1I1YB 3QIUA 3IDNB 1IFHH 2FSEB 2DMKA 3O2DA 1LO3H 2XZQL 1P7KA 5AZEL 1VFUA 1H0DB 3V6FB 4NCC2 3DXAD 4HCRH 1F4XL 1T5WB 3SKUD 4G8IA 4LSDA 4Z5RA 1FZKB 3FB6A 5FGCE 3HUJB 4WV1A 5BCAA 3VD4A 3TO4B 1A4KA 4CADB 1AE6L 3VXOA 2E7CA 1A7NL 1ONQA 1MLBA 1T0MB 4Z6AT 2A6DB 4RGNC 1QR4A 4XCCL 3HE6A 2VZOA 1MCWM 4Z9KB 4DCQB 3DMMC 2GITB 3QIWB 4NDMB 2JB5L 1E4WH 3AS2A 1F3DJ 4G43A 2ICEB 1QO3A 1FGVL 3UX9B 3RA7H 1F90H 3K4DA 1JPTL 3T77B 1S9WB 4LSRH 1QQDB 4EI6B 1I1FA 1IMHC 5E2UL 3QJHA 2Q87A 2ZOKB 3NIFE 5BVPH 2VXSL 1A1NB 3RZCD 2QHRL 4XNUH 1BJMA 1H3VA 4MVBD 3SY0A 5C70A 1CGWA 1HWGB 3O3DB 4IRJC 1AHWA 2W38A 4XC3L 1DQQA 4Y4HC 5I1HH 1A7OL 2RB8A 3F62A 4ZODA 3BD4A 4U1NA 4FXGB 3ZHLA 3BDYH 3ULVH 1OM3L 1FYHB 5F21B 4XWOC 1EMTL 4Y7MA 1MHCB 1IM9D 2ATPA 4WI6A 5HHVH 1KCRH 1T89A 2DM2A 2YK1H 3DUUA 4URTB 3CXHK 3OZ9H 1JZ3A 4BA8A 1OTSC 4RGNB 1NDMB 1CGSL 3DVNA 1PFCA 2FHCA 4WGWB 3VG9B 1JGLH 4LQFL 3T65A 1CVSC 3UMTA 4R90H 3VFVA 2R8SL 2ADIA 3KPPB 5TF1L 4OLVH 3DARA 1KLUB 3VXNB 4C56E 2A0LD 1KIUA 4PG2A 2DLHA 3UJTL 4Z7NE 5C71A 4CVUA 1OF2B 4PRBB 5FYLD 4ZAKB 3HZMA 2F58H 1RK0B 4M7ZB 2AEWA 3WFZA 5I6XB 5KSVB 4NC1E 3OKLB 4WUUD 5CMAB 3GI9L 1WTLA 1IC5H 1KXVC 5CKAA 2VNCA 3BZEA 1ZMYA 4NO5A 2H3NB 4HGWB 4QRPB 4IRJB 1VFAA 4MXVF 4Y4HB 3MLWL 4XHQA 4ALAL 5DJCA 1U41A 5H2BA 2BXZA 2DICA 1TJHH 5FYJU 4QTHA 5IMLB 2HLFC 4G8GA 4WO4A 3V4UL 2CLZB 2NW2A 2VL5A 4HS3A 1F3JA 3ZDYE 1JNNL 2IGFL 1YMMB 4PJAA 4D9LL 5C0CE 3WDJA 5JW4N 1MVUB 7FABL 4M8QB 2FD6L 3UP1A 1TZHB 1SVCP 2BFVH 5LXGH 1A5FH 4JFDA 5HDQL 4J3XA 3QDGD 2JJSA 1I85A 1HQRB 4QWWD 4DWHA 4MNGA 5JNYB 2ERJC 5D93C 1GGTA 4GRWH 1DEDA 3MODL 8FABB 2MCG1 2V17H 4JFFE 1WWBX 1PG7W 3RWFB 4PJ7E 3P40A 3THML 2Y4SA 2IG2L 3PWPA 2H8PB 3WFHA 3IU4H 5JW4R 1D5ZA 1Q94A 3V4PH 4WWKA 4ZOAA 3AB0C 3D39E 4X99A 5KSBB 3VGEA 4MNQE 4YFLF 4HK3J 4LIQH 4Q74A 2D7TL 2VAAB 3HN3A 3L95B 2DBLL 5I18L 2IBZX 1QA9B 3CFKB 4BK4A 1CXHA 5CBEA 1TZIA 4GKZA 1EHAA 3IDIA 5DJZB 4GW5A 1HKLH 5D8JL 4JO4L 5J6HA 5F1OB 4PB9H 3H9HB 4TULL 5ITFA 4XC1L 1S7RA 3RHWK 1FNGA 3ZLQC 4QRQB 4GBXC 4M3JA 4Z95H 1R6VA 5BVJA 2AJ3A 4I77L 2W65A 1XCTB 1RZGB 4H88H 1EO5A 3E2HB 4ODXA 2Y5TA 2YR3A 3MOBL 2P5EE 1RJLA 4KK5C 2I9LA 1SJEA 4OFYD 5D6DA 4YGVA 1C8PA 4YXKL 4X4XA 2NY4C 2QV2A 5F7DA 1TETL 3HRPA 3F7YB 3EYUH 5E9DD 5EDXA 5CEZD 5IEKA 4FA8A 2VDMH 3DI3B 3H7BA 1E4JA 2GK2A 2ERJB 4PJFB 2Y5EA 2AW2A 1I7UB 4GRWB 4XPAH 4CUCA 1OAYL 1AXTL 5IM7B 5GJTH 4X0KA 1AD0B 5DQ9B 5DD3L 4ZD3H 5C2UB 3D2UB 2C3HA 4R8WH 5KVDH 1GGBL 3RIAF 3ZE1F 4OZ4A 3QUMA 4ODUB 5DTFA 3P9MA 3MROA 5L2JB 3V0WL 1YEEH 1X4YA 3G9VA 1TDQA 5IQ7L 3JV0A 3LH2H 5KS9A 2VUOA 4BZ2H 1OY3B 4NQCA 4OSUL 3I75B 4N9GB 3FRPG 3MNWB 1YJDL 4JKMA 2BVQA 1LO0L 2UWEE 2F5AL 4MAYB 2PXYA 1KNOA 3SGJC 5TDOB 2EDOA 4X5XB 4AIZA 2CRIA 1B0GA 4MHHI 2DIAA 4KAQH 1BHGA 4QRSA 5FCUL 1NJ9A 3RUGE 4WU7A 5KOMC 1J1XL 5CAYB 1KPVB 2YD7A 3C5ZA 3HAEG 2BCKB 4G6FB 1N7MH 1NQBA 4MQTB 5KVEH 3RZCC 1I7ZA 2VDKH 2Y1VA 4F33A 4JFXB 2NY4B 2ZUQB 1BZ9B 3BPNC 1FFOB 1QBAA 4MVBC 1MAJA 3UTSE 1MCOL 1HHIA 3EFDH 3EGSA 3DGCR 4P5TD 5EOCH 4UQ3A 3IJHB 3ARZA 1QFWH 2P8PA 5SX4H 3DXAB 3CAFA 3GSOA 5FUCE 4MA7H 2C1OB 3LKPB 5DRZA 4XB7A 4Z7UE 3BOVA 4EBQL 4WWID 5HGDB 4Q0XL 4PJCA 3RDTD 3OR7B 1WEJL 2GSIB 3SE9H 3V4VH 1U8KB 2YD3A 1RZKL 3VFOA 5EORH 4OZIE 2E9IA 4NBYB 5TE6H 1DBJL 3EO0B 4XNYL 1TVHB 2IAMA 3U36A 4MS8D 5INDB 1IC7H 1F11A 5I1DA 4RAUA 1DUYB 1JYWA 5ESQB 4H26B 5M94B 4Z7VF 1Z3GL 3DROA 3BE1L 1A7BA 4O58L 4QNPE 1U3JA 1UA6H 5HHNA 1P53A 1CE1H 1I9RL 5FYLH 1IL1A 5GIRB 3OKDA 5KAQF 5DK3A 1UB6A 4WY7L 4XBEH 4X98B 4A6YH 4XBPB 3MREA 5E00A 3BD5A 1BD2E 3M45A 4EUPH 3O2WH 1BVKB 2JB6A 5F44A 1S7WA 4PLJD 4KWUA 1OGAE 2XRAH 5I8KL 1F2XK 5FCSH 4LBEB 1ZWIB 1LK3H 3T3PE 3VH8G 1YDPA 1RSFA 2W9EL 4XVSH 4GS7C 3IXAB 2EDHA 1G7PB 4FZ8H 4XAWH 3QDJA 1CL7I 4DQOH 4WEUD 2VXQL 2XKSA 3HE7D 4OLXH 4P49A 4WDIA 1Z6JT 5T3XL 1YECL 1A7QH 1IGTA 5FHAL 3V5KB 1KCVH 4BKLB 4MD0A 4JPWH 1YPZA 5IWLC 3C9NA 1A6WL 2ZG3A 5DMKB 5MEND 4R97C 4QWWC 3H9SE 2FIKB 5D7KE 4BFGA 3V0VA 4KH2A 4JG0L 1B0RA 1OL0A 5EO0A 2VLRD 1RZ7L 3SKOB 5D7IE 4PBVC 1RQ5A 5D72L 4ELME 3DUSA 3I6LD 3O45B 5C0AA 5GGSA 2PO6D 2YPLD 1XF5A 3P11H 3PHQA 2J1KA 1X6NA 1Q0YL 5DI8A 3KYMA 4OB5L 4WUUB 4WEMB 4G9FD 4A6YB 5GGVL 4P3DB 4L4TA 4EIGB 3ARYA 3RVWD 1DL7H 2BNQA 4OCLC 1FZJB 3W11C 3FFCA 1RPQA 5KTEH 5B39B 5FM4A 3U48A 5I1AB 4PRAB 2AJXH 2QQNL 3HC4L 1CGUA 4TSBL 1S78D 4ZOBA 3SDYL 3T2NH 3GMRB 1TPXC 1OSPL 2EICA 2IPTL 4YIQA 2IWGA 1IAKB 1DN0A 2J2ZA 3FN0H 1SY6H 5F7KC 5JOEA 1KBGL 4YHPA 4IMKC 3T08A 1RU9H 1UWXK 3V6BR 5CEZH 2NMSA 3QDGB 3RQ3A 1HZHL 1IGYB 4R97B 5F71A 2X6MA 1UVQA 5IJVB 5EZIL 2CLVA 4DW2L 2XPGB 3QIUD 3B2VL 2CDEA 4WI2A 5C08B 3G04A 4OKVB 3LKQA 2CGRH 1ZTXH 1XCQA 4B0MM 2VXUL 4OQTL 5JOPD 3LRHA 3WXWL 4M5ZL 5HJ3B 3SDXB 1UM5L 1U58A 1CXFA 1FGNH 5LGHL 2O5ZL 2YD4A 4CDHA 1MUJB 4WEBH 1MRFL 1GPOL 1JCKA 3D85A 3EJYD 1MCEA 2VH5H 4U7KA 1J1PH 3SDAB 2AQ1A 4HKZB 2C3WA 4HQQL 4P5KA 3WIHH 4YZFF 1MQKH 3PWVB 3O3EB 3I6GA 1LP9A 4XMLH 4YHLL 1FN4B 5FYKD 2YPKA 4ZPTB 2B0SH 2IAND 4YR6A 4UIKL 1E28A 1MCHA 3UXFA 3HE6D 1JV5A 2DDQH 4B5EA 4GUPB 1V5JA 3TJEL 4WI5A 4GKOA 2AJYH 3TT1H 3EOBA 3REVA 2VE6B 4WUKH 5JZ7D 4NNYB 5L7XH 4W4OC 5I75C 4WI8A 4R9HA 4F37F 4OLYL 1TQBB 5EUKB 3MRKA 4UT9L 5E9DB 2XKNB 3PXJA 2VISA 4ZPVB 4P5TC 3JVGA 3UPRB 1S7SA 4NO2B 4JFQB 1BGXL 4K8RD 2I5YH 4I5BA 3S96A 1NBVH 3QFDA 5EU6E 2APFA 3GI8L 4JRYB 3HHRB 1FSKB 3O6FB 3TV3L 3RDTC 2YN3A 5DD0L 3B5HA 1GOGA 4JFEA 5D1QA 1S9VB 4H1LH 5JDJA 3DV4A 4KJQD 1P5UA 4I2XE 3U0PB 3G5XB 4HV8A 1M05A 3MNVB 5FB8B 3N85H 1FLRL 3CDCA 1EGJH 9CGTA 1BQLL 5L0QC 1ORSB 4F7MA 2VLKD 1PG7H 4OF7A 5DXWA 2X4RA 5FYJE 4RAVA 1S8DB 1B4JH 4JANA 1N59A 3HS0B 4Y2DA 2EE6A 2VLMD 4S2SB 4XP1H 4AH2B 4NZJA 5E8PA 4JY4B 2QKIA 3RPIA 5DHXB 2VDLH 4EXPX 1X7QB 4RMUA 4FQCL 3QJFA 1JI1A 2J5LC 5IB2A 3CMOL 2C4FU 1TCRB 4G80B 3F7RA 3MLXH 4WRLA 1TZGL 4PLJC 1OTUD 4JDZA 2CR3A 1JRHH 5FUOL 5IB3B 1GGCH 4E42A 1CI5A 3D9AL 4YC2B 1MHPL 1FVDA 3MRFA 3W9DA 1U3HA 4R2GC 1FBIH 3IXTB 4MA1C 3HE7C 4YHIA 4X80L 3TO2A 2CH8A 3K1DA 3SGDI 5LGJA 5I66B 4KI5F 3NA9H 1ZLVH 1A1MB 3RDTB 5HYQA 2AEPH 4GOSA 3FN9A 3D18A 5CP7B 4J8RA 5FF6B 4C59B 3SE3C 2UY6A 2XKUA 1XAUA 3CLFL 3TBVA 3MRMA 2F9BT 3FRPA 4G8GD 4WO4D 3EYOA 1ZV5A 4H1LB 5EOTB 3ZYJA 4PRHA 2Q8AH 1YMHA 1WAAA 4NJAL 1AC0A 2ADJA 2CXKA 5HPMA 1KELH 2YRPA 1CR9L 1B2WL 1ZEAH 3N50A 5JIIA 5IOPA 2IBBA 1U8JA 4RWHA 3ZZ1A 1TMCB 1CFQA 5EUOE 4G3YL 5MEOA 5T3ZL 2NTFA 2PO6C 5I76A 2J4WL 3MO1A 2ED7A 2KBGA 2WK2A 3P3YA 1J11A 1QP1A 3FAWA 3A6CH 3PWPD 4WWKD 4BSVB 4X6DE 5B8CC 3K2UL 3RVWC 1JFQL 2RFXB 2FZ3B 5DR5H 2DJ4A 5JPMA 2BJML 3TH3T 2A74B 1OHQA 1ZLUK 1MEXH 1KB5L 1ZANH 1JIBA 3KPMB 1S78C 2J6EL 1ZA3B 2WWKT 3I50H 1NUNB 4LPYA 2K7PA 3VFWB 2F15A 1JTOA 2AS5M 5F93C 4MA1B 3HE7B 1NAKL 3A67L 2FX7L 1QVOA 3C2SA 3VFRB 3PJSB 4NN5B 4GAGH 2IQAA 1CGYA 3FQWA 3V2AR 1UM6H 4ENED 3SO3C 3MRPB 2H9GB 4DFHA 5MENB 5CEYA 1DQML 2ZCLL 5IG7B 3TFKD 3MRRA 4QXUL 2BVTA 3B3IB 4P4KA 3QIUC 3O2DH 3L5JA 5LQBL 5LGKA 3SGEH 4HT1H 1U8OA 1M71A 5LAXB 3BUTA 2FNBA 1N26A 4PJ8A 5FGRA 3BYTA 5F6HJ 4NT6A 3T0EE 2O5XH 2G2RB 5KAQG 1KGCE 4JLRB 3GMNA 3HC0A 3NCJL 4ZSOB 1FNSL 4JRXA 1NUGA 4C57C 4ODSH 3QG7L 1PZ5A 3DBXB 1L0YA 3VH8A 3EJYC 3BISA 1CDCA 2ICWA 1MLCA 5H94B 1T2QL 3P4OA 5A1AA 4JCMA 5LBSH 3O4LE 2YZ8A 4X4ZA 3N1MC 1A7RH 1YQVH 3H3BC 4KUZL 5FO7A 3SJVE 1FG2B 3HE6C 1NMBL 4NQCD 5CBAA 2A6JA 1MWAB 3S3PA 1V7NH 5T1DL 2OK0L 2GEEA 5JZ7C 1WIUA 1INQB 4OD3H 4Q9CA 4DTGH 3MV7E 2GJZB 1DBML 3KPNB 3PIQA 3PQYB 4HWBL 4LSTL 1OPGL 4JQIL 1BVLA 5SV3A 3HLAB 2NLJA 4ZS7H 4GRLA 1CXEA 3TZVD 3WNLA 3C5ZD 5D2LE 2VIRB 3NIGE 4K8RH 3O6MH 4K8RC 1KN4H 3PGCB 4MMZC 3WSQL 3QIUB 4KQ3L 5DUML 4KVNH 4HZLA 1MCNA 3EYVB 1QKZH 1NCAH 1AHWC 1FPTH 1P7KB 3OL2A 3W5NA 1IAIH 2M2DA 2VZ1A 4WI4A 1CTNA 4IDLA 5AUMA 4OT1H 3H6JA 1BEYH 4G8IB 4KJQC 3FB6B 5I73C 3C8KA 5J8OA 3MC0A 1XMWA 4WV1B 3WS6A 3R1GH 1A4KB 2C1PA 4XMPL 3GDBA 3VXOB 1HXMA 1ONQB 3BKJH 3RIAK 3A6BH 5C09E 4Q58C 3IDJA 3HE6B 5E8EA 5E24E 4NHCH 2NY7L 1YY8A 3QFJE 4UOW0 3G6JE 2AEQH 1HEZA 1UWGH 3G6DL 1ZGLP 2IPKA 3NFNA 1J0JA 4G43B 1QO3B 3MUY1 4PG2C 1AKJA 1B6UA 2APWA 1LO2L 1FE8L 1HI6A 3CK0L 5GXBB 1GHFL 4HLZH 1V3MA 3P4MA 2ZG2A 4OV5A 1OTUC 5FK9A 1I1FB 3QJHB 2WNGA 5E6ZA 4R0LA 4MCZA 2EZ0D 5I8OL 2P47B 5TF0A 5CINH 4OZGE 2A38A 3SY0B 4KUCD 1AHWB 5IEHA 4ZFFA 1DQQB 4FQJL 1I9IL 3BN3B 3HZVB 2QSCL 4P2CG 3QDJD 3SKJH 4Z18A 4L8SA 1E27A 4WO4C 5E2UH 2VXSH 2ATPB 2AQ2A 2QHRH 2EE9A 3IFOA 1S5IH 3CFJA 3DUUB 5F6HI 3T0XA 2VLJA 1IE5A 3OAUL 1D3CA 2JJSC 1I85C 4XC3H 1NUDA 3DVNB 3LN4A 3T65B 2E9WA 1EHXA 3UTZA 3VFVB 4N0UA 1OM3H 4LIQE 2ADIB 2OM5A 4WWKC 3GK8L 2V7NB 3REWA 5ICXA 3G08A 4D0CA 2BOBA 2VDOH 4UAOC 5JXEA 1MNUH 3BVNA 5B3JE 4Z8FL 4ONOA 5HXMA 1C12A 3HZMB 2I25N 3BXNA 2V5SA 5CKGA 3KPSE 5BRZA 4KDVA 3MUZ1 5BO1L 3WDHA 1QFUH 1KEGL 4LQFH 2F54A 1ZHNB 5F7MC 2BNQD 1L7IL 5C0ND 5IGXH 3BZEB 1KN2L 2R2BA 4NO5B 5J12C 2R8SH 2OMNA 2ZJSH 5TF1H 1KYOK 1WBYA 3B43A 4UNVA 1VSCA 3BPLB 3UJTH 4IRSA 5E8NA 5DJCB 1AGFB 5H2BB 5BS0A 3LS5L 3LS4H 1S7XA 4WENB 4X9IA 4ENEC 2BHUA 5ESAA 5FOJA 4QTHB 4G8GB 4WO4B 2NW2B 2VL5B 3T1FA 4HS3B 1NL0H 4O9HL 1EK3A 4V2CB 3TFKC 1LHZA 2XXMB 4QEGA 2EC9T 1EXUA 5CD3A 4HUNB 5D6DC 5DLML 4FNLL 3VGAC 4R7NA 4JFDB 4Q9RH 1CLYH 2G75A 5ALCH 4MNGB 4ALAH 5I9QC 1MCBA 5F1NA 3U0WL 2R4RH 4W6WB 3PWPB 4G7VL 1WITA 3DVFA 4Y16A 3WFHB 1D5ZB 5DQDL 1MSPA 1Q94B 2IFFL 4FQ1H 4WWKB 4KROD 3BP4A 5T3XD 4X99B 3S36L 5ICYA 2IGFH 5ADPL 2FHFA 1T2XA 7FABH 1X5LA 4XPFL 4OGXL 3L6FA 4LPXA 2W9DH 5CBEB 1TZIB 2BHZA 4GKZB 5SWSA 5IBLD 1RVFL 1JF6A 3D85D 3IDIB 3ZDZE 3ZSTA 4GW5B 3TNNA 3WUWG 5J6HB 2CKBL 1NGWA 5E8DL 2OLDA 2UZIH 1RIVL 5ITFB 2R0ZL 1S7RB 2NR6D 5L2KA 3KJ4B 1FNGB 5GRUL 2H45A 5CILL 4DKAA 4QHUA 5BVJB 2DBLH 2AJ3B 3WKML 2W65B 1A2YA 2X9WA 1IZKA 4TVPD 1FH5L 4X4ME 1OGTA 3CVIH 2DI8A 4ODXB 3IAGC 2Y5TB 1A9EA 3BKYH 1RURL 3P30L 3TZVC 4UTBL 2OTPA 5DJXA 2A1WL 3C5ZC 5J4MA 1RJLB 1OAKL 2I9LB 1SJEB 4YGVB 3LY6A 3H9YA 4X4XB 4X6CF 5D8JH 1GAFH 3VGAB 1S3KL 4H0IA 5F7DB 5IEKB 2FEDD 2ZCHL 1NSNL 3TA3C 3IS1X 5A2JH 5F1KC 2G9HA 1I9JL 3RWHA 1BBDL 3JTSA 4WI7A 4WTXA 5E08H 3CVHL 5FUZL 5C6PB 1KEML 1ZT4A 4I3SL 1QNZH 4OFVA 4X0KB 3LKSA 1RY7B 4JRWA 1ZVHA 3P0YH 3ARXA 3L3KA 1MCJA 4LVOB 1EHNA 3P9MB 3MROB 3L7EA 1TETH 2VZVA 5D1QD 4JDVA 1G9EA 3GSQA 1M4KA 3RKPA 5KS9B 2DQEH 4WTZG 2O93L 4NQCB 1AGBA 1OAYH 3FONA 1AXTH 2DQJH 1A3LL 5HGHA 2BVQB 3EO9L 3BH8A 4OGAD 2PXYB 1KNOB 5HD8D 1JWUA 4AIZB 1B0GB 2PUQT 4XP5H 3GFUA 4F2MA 4NQED 2NZ9D 3LVEA 4I3GA 4QRSB 4Z7VA 1MCQA 1NJ9B 4WU7B 3PGDA 3HNSH 1YYMH 3QDME 1GCFA 3WFEH 3C5ZB 5IQ7H 3K80A 1ODAA 2QQLL 3U7YH 4F33B 2DM4A 1YJDH 4RX4D 5EIQA 4RGOL 1T1XA 1YJDC 5A2IH 2F5AH 1HHIB 3EGSB 5HHME 5DF0A 4UQ3B 3OB0K 2VN7A 2P8PB 4F37K 2VKXA 1T1ZA 5I1GH 1OP5H 4M7JL 3GSOB 3F7PC 1CYGA 2Z31A 3EOAA 4L9DA 4UILL 5DRZB 1D6EA 2XN9A 4OCSH 1J1XH 4Z0XA 5KW9H 3BDBA 2DLFH 4PJCB 1HYSD 4WGVB 3VFOB 1TTFA 3IGAA 4H8WL 4U31A 2IAMB 4JPKH 3U36B 4RFOH 1KJ3H 1MCOH 1F11B 5EBWA 5F1IA 5I1DB 4ETQA 1KTLA 4RAUB 5GJSL 3GBNH 4V1DD 3CVHA 1XEDA 1NAMA 1RZFH 3DROB 4FQHA 2NY5H 1RUAL 4OUUA 2PYFA 4P99A 4AZ8A 5HHNB 4UT6L 3QO1A 1IL1B 1WEJH 1CCZA 3DETD 1DBJH 4NHUA 1UB6B 4PJGF 4FMFA 2WP3O 2KH2B 1HCFX 3MREB 5E00B 4NKQB 3QRGL 2ITCB 5F7EL 5C0NC 4HJGA 2R1YA 2JB6B 4MSWA 1S7WB 2W60A 1ED3A 3BE1H 5JLZA 2RR3A 4GLRI 1U8HA 3HUJF 1LDPH 3P0GB 1T83A 1YDPB 3AU1A 5FFLA 2E8YA 3QDJB 1DZBA 1VFOA 4N1CA 5E2JA 3O6KH 4M02A 4WDIB 1PVHA 1IGTB 1PKQA 2YKLH 2ZZUT 1DDHA 3T0BA 1UYWL 4MD0B 5EOCJ 1YPZB 3C9NB 2Y9RT 4HD9A 2YSSA 2X41A 4PGBA 4BUHA 4YHOL 2W9EH 3V0VB 4LSUL 1IKNC 3FO1A 5JTWA 1CL7L 1B0RB 5EO0B 4KGLA 4MXQC 2MPAL 2W9LA 2VXQH 3PP3H 4LL9A 4X5LA 3DUSB 4KROC 2WUCL 4LRNH 4JFPA 5FHAH 4GXUN 5C0AB 5GGSB 4XNQA 1G0DA 1XF5B 4JN2A 5JOFA 3BDXA 3QCUL 5SX5H 5DI8B 2ZCKH 2BP3A 3KYMB 3KVQA 2Q86A 2G60L 2D9QB 4JRXD 1JJUA 1L0XA 1GVIA 2BNQB 3FFCB 4RMSA 3DTXA 5DEFA 5D72H 2A6IA 5D7SH 5JQ6L 1C7TA 2NR6C 3WFDL 3LB6D 3IDYB 5T3ZD 4YIQB 5D96C 3N06B 4TVPH 1DN0B 5J1TC 1Q0YH 1B88A 3ARGA 2K1MA 5KZCD 1T6VN 4EZMA 3BI9X 3Q0HA 3I3DA 4YHPB 5GGVH 3SCMD 4GJTB 2D7NA 4TN9A 3B6SA 4JFHE 3WFCL 4JZNA 2FEDC 1QLEL 3JVGC 1UVQB 2QQNH 1IKFL 2XV6B 1AO7D 1DQLL 2CLVB 1RUKL 4W81A 1OSPH 4WHYG 3WMSA 4PGDA 2B1AH 3FB5A 4L8DA 2CDEB 5TDPA 3G04B 4CU8A 3IETA 3LKQB 3E8UH 3WO4C 1KBGH 1XCQB 3C8DA 4MJ5A 1I3RA 2MNUA 2LE9A 3FT4A 2FJGA 3CX5K 4ZFOA 1U58B 1SJHA 5D1QC 1IT9L 1OP3K 4DN3H 1MELA 2KKQA 5INCA 4U1JA 4XRCA 1V3LA 1YNKL 3D85B 5DJDA 4B7LA 3CDGA 2FIRT 4DW2H 3GMLA 4P5KB 4G9DA 1U0QA 4OGAC 4UTAL 3I6GB 1LP9B 2YPKB 4K23L 3QSKB 4YR6B 1E28B 1JV5B 1WT5A 4OQTH 5D96B 1VDGA 3TH2T 2ZSVA 4YK4C 1VESA 2YZ1A 1UM5H 3HKFA 4LGSB 1RZIA 3EOBB 3REVB 3F58L 3CU1A 3P4NA 4M6NH 4HFWA 3ARFD 4RQQA 3MRKB 3WHXA 1H3WM 3V5DA 5EBLA 2KUTA 3GIZH 2VISB 4L5FH 1HHHA 3EJJX 3FHAA 2R2HA 5C9JA 3NABH 4NZUH 5JHLL 1GGIL 1XF2A 4I5BB 4QOKE 3S96B 3QFDB 1RHHA 3UZVB 5EFIA 3VDAA 5D1XA 2NPLX 3WO4B 2AK4A 3Q5TA 4Q6YA 1NFDF 2WBKA 5SX4I 1UWXH 3WBDA 4OBSA 4NP4H 1RUQL 1Z9MA 1JPFA 1HYSC 4OLYH 3ORJA 3WUWA 3KS0H 3QWQB 4YE4L 4IOFD 4JFEB 4UT9H 5D1QB 2VLRE 3WXVL 2OI9C 3S7GA 2OL3A 4JGMA 3DV4B 3M17A 4J3VA 1Q9KA 4K7PX 4FQIH 4MMXC 3I6LE 4U1GC 4OM1L 4HV8B 1M05B 2YPLE 5I71B 4S1RL 4QHNA 2FBJL 2AK1H 3LQAL 4HFUL 1QPXA 5I1KL 3GI8H 4C4KO 4HGMA 5J1AA 4F7MB 2PW1A 3KLHD 2X4RB 2J8UA 3HAEH 4G9FE 4J3WA 5FXCH 3TV3H 4RAVB 5J11C 1Q72L 4JANB 2DI7A 1N59B 1UZ6E 2DQGL 4Y2DB 4YK4B 5DD0H 2DTMH 4MA8L 5ITBH 3DETC 3ILQD 1PD6A 5E8PB 2QKIB 3RPIB 3P9WB 5GZOD 2FCBA 4NQDD 3QJFB 2MJWA 1RUML 5IB2B 5JXED 2OR9H 1FLRH 5GGTA 4FFVD 1BQLH 4JDZB 5MP6L 5F7UA 2AJZA 5BRZD 3D1MC 4E42B 3MUGA 3EHBD 5HHXL 3IFPA 1FVDB 1Y18A 3MRFB 3W9DB 1J8HE 1KLGA 3SQOH 3ZL4H 2YWZA 4F3FA 1U3HB 1MFDL 2XA8L 4LCWE 4YHIB 1O0VA 3TO2B 3SE8L 1W8NA 5LGJB 4OCXH 1UJ3A 2VQTA 5HYQB 2E7BA 5IHBA 3HPLA 3VE0A 4NRZB 4X83A 1YEIL 3IJSA 3D18B 4J8RB 4FFZL 1WIOA 2V9TA 4WTZA 3TBVB 3MRMB 2OI9B 1JTTA 1FO0A 1TZGH 3EYOB 4PRHB 5FUOH 4AL8H 1YMHB 5E99L 2ADJB 5HPMB 3E0GA 5BJTA 1AH1A 2XTJD 2HRPH 4O2CA 4NM4L 5IOPB 5JOPE 3T0DA 1RV6X 2UUDH 1U8JB 4X80H 5C3LD 3HNVL 4L4VE 1A3RH 3NCMA 2QLVB 5MEOB 2E27L 5IFHL 5J11B 1VKXA 2NTFB 3HAEB 5I76B 3MO1B 4GG6F 4M7LT 4Y16D 3RI5F 5IP4A 1ZT1A 5IFJA 2FATL 1EZVX 4JZJA 5FYKE 1A6UL 4LQ1A 3TLRA 4CJ0A 2IANE 4NCDA 2BVOB 4Q2ZA 3K46A 4GW1A 4PBWD 5JPMB 3IDGA 2JCCE 3MRIA 3V5HA 5T3ZH 4EQ3A 2J4WH 1S5HA 3AMKA 5IESL 4YBLB 2VC2H 5AG8A 1T03L 4ACPA 2IPUG 2XQYG 1QVOB 4I3RL 4K9EH 2P43B 4K9EC 3IFNH 1PSKH 2IQAB 5ALBL 3CSYA 3GNML 3K2UH 3SCMC 3FQWB 2EDYA 3QEGL 3MLVH 3BMWA 4R4FL 3HR5B 3WN5A 4M43H 2R2EA 5FAAA 3MRRB 2J6EH 5GS0L 4P4KB 5DEGA 4U1KA 4LMQE 4NWUL 1NAKH 4NBZB 3A67H 4QCIA 1RMFH 1JGUL 2FX7H 5CZKA 3ULUL 1U8OB 1M71B 1IJ9A 4PJ8B 1GIGL 4NT6B 1UWEH 4DOHE 3K4AA 3GMNB 3A6OA 3HG1E 3HC0B 4P2OD 4JRXB 1DQMH 1CXLA 3WJLC 3S35X 2ZCLH 2VLKE 3MXVL 3VDBA 1PZ5B 1OARL 5C07A 3VH8B 2FWOA 25C8L 2A73A 1DVFD 5GPRA 2ICWB 3WS6C 1CQYA 3VXRA 1MLCB 3P4OB 1ZHBA 5LQBH 1XGPA 1AGEA 4HSQA 4O2FA 4MGXA 3M8OL 5ACZA 1R24A 3RY5A 5FO7B 2QHLA 5EZLA 3LEXA 4ODTH 1J05A 5D5MF 2X7LA 5KZCB 2PR4H 4AG4L 2A6JB 1QR1A 2NY3D 4UZGA 1J0HA 1FNHA 3NCJH 4M6OL 3BJLA 3MV8D 1F6AA 1A9BA 3CNKA 4EN3A 4GXVL 3UO1L 3ARFC 3PIQB 5FEBA 3ARBA 1BVLB 1ZLUH 1NEUA 2NLJB 5EO1A 2DOCA 4GRLB 5IFAH 1AO7B 4Y19A 3TC9A 3NVQA 2JIXA 2NYYD 3D0VA 2LTQC 1NMBH 4TUJA 1C5BH 5JHDA 3ARDD 1GYAA 4HZLB 4UDUA 5E5MA 3U6RA 1LWRA 3G5YA 3X3FL 4Z76A 4GQ9L 1CIDA 4NUJA 5AUMB 1J0YA 4HWBH 4ERSH 4JO3L 4IOFC 4LSTH 4JQIH 4PJXE 2A9NL 4GAJH 4TTDD 2R15A 3VXMD 4N0YL 3IF1A 1OAQH 2R0WH 4NNPH 2C1PB 3WSQH 4K7PH 4U1MA 4KQ3H 4HJ0D 5C0RH 1LVEA 1HXMB 3OXSA 3KLHC 5ANMB 3BKCL 2VDNL 3IDJB 5E8EB 1EEYA 1X5JA 1YY8B 3NIFF 5ISZA 3VD5A 1HEZB 4CN1A 3VFNA 4HS8L 3ILQC 2NY6B 1IZJA 1C5DA 2IPKB 5HSFA 1S9YA 1FYTE 3NFNB 5CFHA 5GZOC 2HMID 1AKJB 4WFEE 5I15L 5JXEC 3ARFB 2VZUA 4XVJL 4OV5B 2B20A 5HHPA 4FFVC 5FK9B 1E6JH 1MF2L 4R0LB 3VWJA 3EHBC 3BW9B 3MA7B 2LTQB 4MCZB 3UC0L 2NY7H 3K2MC 4KKCD 4LAQL 3U0TA 2DKSA 3G6DH 2NX5E 1JRHI 3MLSL 4NRXA 5IEHB 2X44D 4ZFFB 3EYFA 3Q5OA 3MLYH 4IRZH 1HOCA 1T0PB 2DLEA 3CDYA 1FE8H 3CK0H 4U3HA 5KVFL 1GHFH 4L8SB 1E27B 1B9ZA 1CZ8H 2W0FA 3ZT7A 3UTPD 2YD1A 2KQNA 5K9JH 5IBUG 1J0IA 5EWIL 3OB8A 5ENWA 2X10A 5E2VL 5I8OH 2XTJC 1TQCB 4L29A 4Z7NF 5MEQA 2IPUK 3CFJB 2XQYK 2DQCH 2VLJB 5ABDE 4GAYA 4UOW1 1MRCH 2XG5A 4FQJH 3MR9A 1URLA 2B8OT 1I9IH 3LN4B 1T4KA 5I0DA 3UTZB 3LKOA 4LEXL 4N0UB 1XF3A 3GRWL 4Y16C 4DGIH 4PY7A 4J3TA 5E2TL 2P44B 2K7QA 3D87B 3REWB 2I9TA 3RVUD 5ICXB 3G08B 4NQDB 4D0CB 1NDGA 2BOBB 4KJYA 2EYTA 3BVNB 2AI0H 1C12B 1QRNA 3BXNB 3LQZA 3BJ91 5F9OL 2YA2A 4HH8A 1SEBA 4OZHE 3VXUD 2EDFA 1HWHB 5BRZB 3G5VA 4PJHE 1G9NH 4LKCA 1G9NC 1KV3A 2F54B 5D2NC 3ZDYF 5E1HB 4YXLL 2R2BB 2V5TA 4D9QE 5IROA 1WBYB 3GK8H 2QJDA 4PUBL 3DRQA 4IRSB 5E8NB 1UCTA 2QR0A 5BS0B 4IIQC 1S7XB 4WHTA 4LHJB 5ESAB 5BOPA 4GKNA 3ARGD 2OZ4L 3T1FB 4PJ7F 1MAML 5IW1B 1R3LA 4DVBB 3OF6D 2UZYB 2AXHA 1EXUB 5CD3B 5E6YA 3RAJH 2XTJB 1L7IH 1DTUA 3X13A 1QBLH 1Q1JL 5D1ZA 3O41A 4PG9A 3Q1SH 4JREB 2G75B 3RWDA 5IVXF 2FLRT 4PR5A 3EDJA 3RVXD 1WISA 4F80A 5F1NB 4OCMC 3CUPA 2GJJA 1NCTA 4Y16B 3CPLA 1WZMA 5FGBA 3SGEI 1I3GH 2Q8BH 4P2OC 3BP4B 3MACH 5ICYB 5JW5A 1BVZA 4JE4B 2BVYA 2P5WD 4LCCA 2EO1A 1DVFC 5DLMH 3RBSA 5IT2L 3AVEA 4FNLH 4NWTL 3S35H 3L6FB 4NO3A 3VCLA 1UXSA 3HNTL 5SWSB 2B2XH 2LU4A 5D2NB 3TNNB 3KLSA 4HXBL 5KVGH 3U0WH 4P2QA 3CXDH 1NGWB 5I0ZA 2NY3C 5DQDH 3DO7A 2IFFH 4E41E 4K07A 4K7FB 1VB9A 4ZOEA 5L2KB 5LVEA 3S36H 5ADPH 1MREL 1TTUA 4DN4L 3LSOA 1A2YB 4OGXH 1OGTB 4RFNC 1A9EB 2RBLA 4YWGH 5DJXB 3SE4C 2B5IC 2NYYC 3OKOA 1KJVA 3MRCA 5F7NC 3U1SL 1IARB 3RRQA 2DWEB 3ARDC 3RKDD 4DEPC 5E8DH 4H25A 2R0ZH 4HS6A 2G9HB 5BZWA 4G8EA 4NCC1 3RWHB 3JTSB 4ZFGL 1EAPA 4WI3A 3WKMH 3BSZL 1ZT4B 3HMWL 4NKIL 5D1XD 3QHTC 3CSBA 3MFFA 2NY2D 2AK4D 4JN1H 1RURH 2WINA 4TTDC 4UTBH 2A1WH 3L3KB 4AY0A 4N8CL 5CLTA 4NKDA 2UWEF 1F3DH 4Q9QH 1JHKL 2F8OA 1JUFA 1NUFA 2H2SD 1S3KH 4M61A 3FJTA 4HJ0C 5GRVK 4JDVB 1VPOL 3GSQB 4FQLL 2ZCHH 4I0KA 5EA0L 4KI5D 3FL7A 3RUGF 1XFPA 5C0DA 1OLZA 1AGBB 1G1YA 3CVHH 3EJZD 3FONB 1KEMH 1OLLA 2NY3B 1LO3L 3BH8B 3IVKA 4U1HA 2HMIC 1KIRA 1JWUB 5JIHA 3CXHJ 1X5AA 3ZE2E 4F2MB 4HCRL 4XHJD 3CCHA 4Z7VB 4EDWL 4RFNB 3PGDB 1AXIB 3JV5A 2YD8A 1CGTA 5AZ2L 2B5IB 5EBMA 3Q6GH 4YX2H 1BZQK 4Z7UF 2FJHA 1EVUA 4KKCC 1P4IL 4DEPB 1IILE 1A3LH 3EO9H 1T1XB 1F00I 4PJGA 4OZIF 4HF5L 3NIDE 4ISVA 4DGYL 5DJ0A 4HX1A 4FTVA 3T3ME 3U9PH 1T1ZB 4HEME 4GO6B 2Z31B 3EOAB 4PB0H 2J88L 1OW0A 4D9RD 4LSSL 1D6EB 2AGJL 2XN9B 4Z0XB 5JORA 3UTOA 3RA7L 1NEZA 2PCPA 3Q6FA 3V6OA 3T0WA 4CBPA 3HA0A 3IGAB 5E6IA 5DYOA 4Y4FD 1RIUH 5BVPL 3QAZC 1TVDA 3WHE1 5T1LA 4CMHC 1IBGL 4K2UH 4XNUL 5EBWB 2FL5B 5F1IB 5T3XE 4ETQB 1KTLB 4PJDE 3KR3L 4UUJA 4S1QH 3CVHB 4KFZC 4FQHB 3I02A 1WK0A 4OUUB 2PYFB 4S1SL 5TPWH 5DFVD 2IMMA 3PE9A 2EDNA 3RVUC 3QO1B 2YUZA 3D69B 3ULVL 3T3PF 4AIOA 4H8WH 4NHUB 3VFGH 4H8WC 4YXHH 5HHVL 1KCRL 5ID1A 4HW6A 2ARJQ 3VXQA 3ZTNH 4AEEA 1QZ1A 2GJ6E 2IJ0C 5GJSH 3W0WE 1GZQA 4HJGB 2VB5A 5M95B 2R1YB 3OZ9L 3QEHA 1ED3B 1RUAH 5DJ8A 5JLZB 1U8HB 1T0NB 4UT6H 3AU1B 3RWEA 2OQJA 6CGTA 4JFOA 2HJLB 1UC6A 3QEQE 1U8QA 2JF1A 3RTQA 3ARGC 4UT7L 1CLZH 1A02N 1Q0XL 1MH5A 1DBAH 1PKQB 1DDHB 1A0QH 5EC1A 1K3IA 3FRUA 2F58L 1MHHA 5F7EH 5GHWL 3WS3A 2YSSB 4PGBB 1IC5L 3OB0H 3RVXC 2O61B 5F97E 3FO1B 2VKWA 3K74B 2CR6A 1WC7A 5M7QA 1HDMA 3K8KA 4JFPB 1KULA 5IHZA 4XNQB 4OBRA 1TJHL 4JN2B 4KXZI 5HYJD 5JOFB 4RGMC 3DHJA 1CTOA 3OG4B 2Q86B 1WZKA 2WM0A 1FIEA 2BNUA 4YHOH 3GSUB 3BIKB 5C07D 1CL7H 3LN9A 1NMAH 2BFVL 1A5FL 3DTXB 1RULL 3VXRD 1N8ZA 3NZ8A 2ENYA 4NQEE 3LRSA 3RI5K 3MV9D 2VITB 4LLVA 5F88B 2A6IB 2V9RA 5KSAA 2WUCH 3PDOA 4U6VL 1WT5C 1YQ2A 3IU4L 4LARH 2DF3A 1TENA 3QCUH 3ARGB 2ADGA 1SJXA 2XFXA 2ESVE 2G60H 4N1EA 5F3BA 3FOMA 2G5BA 1P7QA 2VDRH 4K3JH 4EN3D 4LP5A 3FQNA 3RKDC 2FB4L 3ARBD 3B6SB 1XGYH 3MFGB 3AXLA 4P2RA 4L3CA 4YHNA 5JQ6H 1TNMA 1PX3A 1HKLL 3WFDH 2JIXD 3FKUS 3L5HA 5I16A 5DVKA 2J8OA 1EEUA 1ZGLA 5JHDD 4Y5XA 4KKLC 3FB5B 4L8DB 5TDPB 3L3GA 3BPOB 1K9TA 3IETB 2Z8WC 3KXFD 3JV4A 2V9QA 1NGYA 1DEEA 4Z95L 1CDYA 4MJ5B 1I3RB 1WBXA 4PYHA 3FT4B 2FJGB 3DUHA 4LVHB 2H2SC 3VG0L 3ZKMD 4FMKA 5F6IB 4Z7WE 3DV6A 1SJHB 4V1DE 2QBWA 3VFUA 5INCB 4JHZA 4U1JB 1QLEH 4KI5C 1NFDA 1IKFH 1DQLH 4WFFD 5GS2D 3UDWA 4RIRA 4ZUTA 4LSPL 4ZO7A 3CDGB 3EYUL 5GS0D 3EJZC 3GMLB 3UBXI 3AAZA 5EU5A 2VDML 4G9DB 1XZ0A 4Y5VC 4B50A 4N5UA 4PJAF 4UI2A 3ULUD 3KPTA 4XPAL 1HNGA 4TUOA 1DCLA 2YUVA 2ZSVB 5GJTL 3QNXA 4HKXA 4PTTA 3GHEL 2IALA 4XHJC 4ZD3L 1IT9H 1RZIB 4NUGL 1GL4B 2JJUA 1MCRA 1I8LC 3P4NB 4HFWB 3H42H 3VD9A 2X4OA 2I07A 5KJRH 5CP3H 1I7RA 4RQQB 5BMFL 5C1MB 2HJKA 5GGTH 2DJSA 3WHXB 3V5DB 4Z7OE 5EBLB 5D7LD 4UTAH 1HHHB 2CIKA 4K23H 4BZ2L 2R2HB 4K3DH 1YUHB 5C9JB 5E7FA 3NPZB 1XF2B 1RHHB 4U1SA 4QYOA 4U1LA 4N5ED 5EFIB 5D1XB 4IJ3B 2NY2B 2AK4B 2RIKA 1UJ3C 5C0BA 2Z93A 1JPFB 5F8QC 3WUWB 1ZAGA 1FO0H 4P46A 4Y4FC 5EIIA 1KXQE 2HVJA 2OL3B 3M17B 2FLBT 1Q9KB 5B22A 1JMXA 2DBJA 2BNRE 4N90D 5JHLH 1R3IH 5CZVL 4QHNB 5KG9A 4DKDC 5BXFA 1HSAA 3MYJB 4Z0BH 5KSUA 5EOCL 3RX7A 5J1AB 2PW1B 2Q3ZA 5F9DC 5DFVC 4U7SA 3U30B 3TBSA 2E5EA 4Q6IC 4HIJA 4MA7L 5HI3D 3WXVH 4QRUA 3BEVA 1OP3H 2YBRB 4G5ZH 3SE9L 4HWUA 1XH3A 3V4VL 2ZG1A 4JZJC 5EORL 5DGRA 3VI4E 4OM1H 1PGRB 3FFDA 3MGAA 5T3ZE 4LOUD 2FBJH 1FL3A 1U6AL 3U7WH 4HFUH 5I1KH 2AJZB 1NGXA 2JLLA 3ELAT 3GUTA 4EKXA 3MUGB 2CQVA 3OKYA 3RX8A 3IFPB 1Y18B 1KLGB 1E4KA 1FDLH 2YUXA 4F3FB 4MA8H 1UFUA 1Z2KA 1UA6L 1DLFL 1EBAA 1QSFA 3C60A 5FO9A 2A9MH 1CE1L 1UJ3B 5FYLL 5GS1A 4CRPA 3HPLB 3VE0B 3IJSB 3BQUD 1J88A 5EUOF 4ORZC 3NCYS 1AO7E 1F8TH 1ADQL 1RUMH 4YDVB 5GRYA 4P57A 4DUWA 1T7WA 4A6YL 1FO0B 3U4BH 5SWZA 3KPRD 4HBCL 3WD5H 2W0PA 1YN6A 4BQBA 4UINH 1PQZA 1MFCH 3BGFC 4O2CB 3O6LL 2XRAL 4X6DF 3QIBA 5D1ZD 1LK3L 4LKXA 3KS0J 2F53A 4XVSL 1BJ1J 4UB0H 1VKXB 4XAWL 1K3ZA 4FZ8L 5FO8A 2WWKO 4PS4H 1YEIH 1HHJA 5AD0A 5J57B 4DQOL 4NFDA 2NY0B 3E3QC 4OLXL 2AJVL 2E3VA 4F7PA 2QQKH 1BOYA 1A7QL 1ZT1B 5IFJB 1KCVL 1KOAA 4JZJB 4JPWL 2X4PA 4HMEA 1Q8MA 5ANME 5DVMA 5DRNA 5I2IA 1SMOA 4Q2ZB 1RZ8A 4CN4A 3NGBC 2J3SA 4ESKA 3W5MA 5E03A 1J9CT 3IDGB 1UEMA 3V5HB 3TP4A 2E27H 4OJFH 4XPTH 1S5HB 3MJ8A 3C09B 3HI6H 4JY5H 4PJ5A 2DJUA 2OSLA 3WL9A 2FATH 3P11L 3OMZA 1YN7A 1O7SA 1A6UH 3AMLA 3QUXC 3RWCA 3CSYB 1HINL 4LVNB 5K9KA 4V2BA 1PY9A 4EN3C 1GGYA 1KC5H 4AMKL 2Z9TA 5D5MA 3ARBC 3WN5B 2I24N 3VGBA 3TT3H 4QGTA 2R2EB 4NQXA 2Z8SA 5IESH 3BGFB 5HY9A 2AV7B 3MRHA 1I1RA 4U1KB 3NPSC 4QCIB 8CGTA 3GHBH 3KYKH 4I3RH 3NH7H 1I3UA 3OKEA 5HHQA 4NN6C 1OAUL 3T0VA 5GGUA 2CJUL 1ADQA 1SY6L 1U91A 3D6GA 3NFPA 4PJBE 1Z0MA 1JN6A 1DQDH 3AM8C 1YYLH 4R4FH 4E9LA 1X4XA 3MGTA 2L0DA 4I13B 1RU9L 3EZJB 4WVRA 5C07B 4Y89A 2FWOB 1KPUA 5CEZL 5GS0H 3T2OA 2A73B 5GS0C 3VXRB 4RMVA 4NWUH 3LRGA 1ZHBB 4TNWF 1LK2A 1XGPB 1AGEB 4XPGH 4O2FB 3ULUH 4Y2OA 1IQWL 1FIGL 5ACZB 3ULUC 1R24B 4X6FA 1YEHH 5EZLB 3X3GH 1GIGH 3GSXA 5DDHA 4NQDE 3LEXB 5D2LF 1J05B 3NIGF 2X7LB 1QR1B 2DMBA 3VXPA 1ZTXL 1XF1A 2ICWJ 4BK5A 3U46A 1NCWL 3ESUF 4KMTL 3D48R 4XMKH 1F6AB 4QRTA 1A9BB 3MXVH 4JQXA 4U6TA 5GS3A 4EN3B 1TNNA 3TIEA 5GSVA 5D70L 2XIDA 3ARBB 3QH3A 2EIEA 3EDDA 5EO1B 3O3AA 4U1IA 5HHOE 3M8OH 3OJMB 4X9GA 4Y19B 2JIXB 3D0VB 5DJ6A 1J1PL 4TUJB 4KKNA 3WIHL 5JHDB 1MQKL 2YA0A 4XX1E 2HTLD 4N5EC 3QPQD 4XMLL 4UDUB 1RIHH 2B0SL 2Q6WA 5E5MB 3K3QA 5DK0A 2DDQL 3G5YB 4NN6B 4Z76B 4FTVD 1B6DA 3UO1H 4LHUG 1R3HA 2AJYL 3TT1L 4PRPE 1FP5A 4BJLA 4WUKL 5HDLA 3UROR 3G6JF 4HXAL 4KK9D 5L7XL 4LRIA 4JDTH 3IF1B 3WLWD 3TO4D 2X1XR 5IB1A 2OJEA 4U1MB 4AEHL 4TQEL 4LSQL 3R8QA 43C9A 3OXSB 4MCYA 5T1LD 1MY7A 1A21A 5EULV 2I5YL 1OD9A 3X3FH 3DRTA 3QIWD 4GQ9H 1EEYB 5ISZB 3GO1H 4C56A 4JO3H 5HI3C 3VFNB 1C5DB 2AXGA 4RAHA 3BP6A 2A9NH 4JM4L 4JB9L 2EEBA 4N0YH 1NGZA 1VFMA 5D2NE 3O11A 2PYED 4LOUC 3P73A 1VADA 5HHPB 4Z78A 5JQHC 3RPKA 1XF4A 1G6RL 5J13C 1F02I 1G6VK 1K4DA 4RNRA 4U4BA 3ETBF 4U0QB 4LGRB 3U0TB 4F15B 4GQPH 1A14L 5IROC 4NRXB 3EYFB 1B4JL 4PGCA 1P6AB 3BQUC 1HOCB 4YBQD 3GKZA 1CT8B 3NN8A 2YD9A 5DT1H 3T2QA 4XVJH 4EOWL 2W0FB 4JFYA 4QLRA 5C0CA 1MF2H 4DK3A 4Z7QE 4AEFA 2MQ0A 5ENWB 2ZUWA 4KI1A 1O7VA 4IM8A 2HAZA 4L29B 4LAQH 5MEQB 1JRHL 3QULA 5B3JF 5D1ZC 4JFFA 1O5DT 4GAYB 4PJ7A 1NBZA 3MR9B 2HFGL 3WDIA 1T4KB 3LKOB 3D39A 5KVFH 5C3TA 1XF3B 2A83A 4MNQA 4PY7B 4M4PA 5FGBC 3BRGC 2A77H 1T1YA 2AEPL 2I9TB 1ACYH 4M5YL 5EWIH 4HJJL 1NDGB 4KJYB 1IEHA 2EYTB 5E2VH 3FO9A 4ZAKD 1MI5D 4PYGA 1QRNB 3LQZB 3QXWA 2BOCA 5EZJB 5IJKC 1SEBB 3D3VE 1EHLL 4RWYL 3CFCL 1D6VL 3G5VB 5J13B 1WBZA 4LKCB 3MV8E 1JNLH 2ICWI 4IS6B 1I4FA 4HKBA 1AJ7H 3GSRA 3PWLA 3MRGA 3DRQB 3HZYA 4C54A 2QR0B 3MLZH 2P5EA 5HYFA 4WHTB 3GSNA 4GKNB 4FS0A 5F9OH 4PLKD 3P9LA 4ZMAT 4L3EE 1R3LB 1W0VA 3UZQA 2XA3A 2D7OA 2R2CA 5H37G 2VR9A 1G6RA 1P7QD 1K4CA 4YXLH 3X13B 2QQQA 5A2FA 4GMTL 5D1ZB 3O41B 5F7WC 2Z4QA 4PG9B 1ZANL 4P0DA 3RWDB 1BP3B 4PR5B 4U0RC 4XPBL 4Y5YC 1B3JA 1MWAL 3CUPB 3VXME 1T7XA 3KJ6H 1KT2A 3CPLB 2OZ4H 4TUKH 3S34L 4GAGL 3S6CA 3GJFK 5IK3A 5JW5B 1UM6L 3H3PL 1HCVA 3MRDA 3V6ZA 2CDGB 4NO3B 4KMLB 3VCLB 4KZEH 1Q1JH 3U9UA 1UXSB 2VDPH 4HWEH 4XP9H 1XIWA 2YMXH 4J3OC 4BUGA 2UWEA 3O2DL 4P2QB 3VJ6B 1HKFA 3DO7B 3BAEL 4HT1L 2AJUH 5A43C 1M6OA 2X4SA 2HH0H 2O5XL 5T5FH 3RUGA 4W6XB 3LSOB 1A6VL 5F3HA 5HDBE 4WFGE 2R29L 4OZFG 4LDEB 1LO4H 1II4E 4I8DA 3OKOB 4RSVA 1KJVB 3MRCB 3QPXL 3UTSA 4HXBH 5ERWA 2HTLC 5LBSL 3QPQC 4O4YH 1YQVL 4H25B 3KYOA 4IOSD 4PP2A 4TTGA 1ITCA 4U0RB 1U3YA 4HS6B 3DPBA 5BZWB 4G8EB 1EAPB 4Z7UA 1IGCH 4DN4H 3SKNA 1V7NL 5D71L 1YEKL 2C4FT 5F7FA 3MFFB 3V7AG 4OZIA 2QADB 2WINB 4KK9C 2BZDA 2EEDA 4DTGL 3L7FA 2CRZA 5C0BD 4NKDB 4YUEL 1GC1L 3WLWC 3TO4C 1JUFB 3U1SH 4ZNCD 5CD5D 4PRDA 4ZS7L 4M61B 2HLAA 5CIPA 3ULSA 3AFLA 5C92A 3BH9A 3O6ML 5DRXA 2R4SL 2EE3A 1VCAA 3QIWC 5CSBA 5C0DB 3O0RL 2RQ8A 4ZFGH 1WGOA 4KVNL 3UBXG 3HMWH 4NKIH 3LHPL 3UYRL 2GTWA 3WEXA 1NCAL 1FPTL 4IOIA 5BZDA 3IVKB 3VXUE 3OHXA 4QF1A 4U1HB 5I19H 1KIRB 3SDCD 2VQUA 4OT1L 1X5XA 3Q3GA 1BEYL 4J12A 4BFIA 1HIML 3QCVH 3CCHB 1BD2A 2GUOA 1VPOH 4FQLH 3DHMA 4M1CD 4G6FD 5EA0H 5EBMB 2Y36H 3R1GL 3CFEA 1OGAA 2FJHB 3NA4A 4KTEL 3BKJL 4PJGB 3A6BL 1AI1H 4ISVB 4LLUA 4YFLI 3IDXL 5DJ0B 4NHCL 4HX1B 1P2CA 3AROA 4FTVB 3MV11 4YBQC 4KRLB 2D7MA 5E95B 2AEQL 4D0BA 1UWGL 1FZOA 3VFTA 4FP8H 2OMBA 4EDWH 1BREA 2DRUA 3S97C 3NFSH 1IRAY 2APXA 5JORB 5AZ2H 4QRRE 2C7UA 2PCPB 3VRJA 1KYOJ 3Q6FB 2JTDA 1MCWW 2BSTA 5CEXA 1VGKA 5E8OA 1P4IH 2ICES 5DYOB 3ZKXC 3H9SA 2E8ZA 5T1LB 4HF5H 4ZYKA 5GGRY 4DGYH 3VG9C 4U49A 5D7IA 5CINL 4UUJB 3WJJC 2VSCA 4ELMA 3BUYA 2P5WE 2ENSA 3QR2A 1N4XH 2J88H 2OXGA 3KNBA 4LSSH 2AGJH 2BERA 3ARWA 4S10A 3C5SA 3GJFA 3SO5A 3V8CA 4X6EA 3SKJL 5L8LB 4ZAKC 4OD1H 2OYPA 2PYEB 4M7ZC 4I9WD 3ZYIA 5I6XC 3FOLA 1CLOL 1HQ4A 5HGAA 4CW1A 2JELL 5ID1B 2OP4L 1IBGH 3B83A 3VXQB 1ZS8A 3KR3H 1GZQB 1S5IL 4Q9BA 2VABA 4LHUA 4NC0B 4GG8A 3QEHB 4PJ9A 5DJ8B 4YEFA 4S1SH 4KK6D 3RWEB 2OQJB 4JFOB 4MA3B 3WNMA 5A3ID 4PJ5D 1U8QB 3DWTA 1ZLSH 3ULVC 4PLKC 3QQ3A 2HRLA 2VDOL 2BHYA 1MH5B 1MNUL 3OGCA 5CHNA 2BMKA 5EC1B 3FRUB 1MHHB 5DMYA 4JFZL 1Z9SA 3ZKXB 3WS3B 2O5YL 3T4AA 4HUUA 2X4NB 2HFFA 5FECA 3VGHA 1QFUL 2YD6A 3DSFL 3DX8A 4N0RA 5IGXL 3IFLH 2D9CA 3SOBH 4HZAA 5HYSG 2ZJSL 2ARJA 1WC7B 1VACA 4UT7H 1HDMB 1AXSA 4XPHH 3VGGA 3NCCB 1Q0XH 5IHZB 2DQUH 3LS4L 5HVHC 1MI5B 1FAIL 3VWKD 3IJYA 2Y7QA 3MOAH 1NL0L 5GHWH 4GLRH 1I1CA 2NY1D 3MBXL 2BNUB 5DD1L 4G6AD 3CLEL 3UDWC 5J7CC 2VOTA 3QQNA 4G6ML 3JZ7A 4Q9RL 2FDBP 1N8ZB 3NZ8B 1CLYL 3LRSB 2E7LC 5ALCL 2CKNA 4PJEE 1EERB 4LLVB 2YXFA 5KSAB 5IBUB 3RY6A 1WVZA 3PDOB 3ABZA 2R4RL 3BP5A 2L7JA 5TJWK 2ADGB 3QT2A 4FQ1L 3E2HC 1UEYA 5LJYH 2FR4A 3LPGA 2EYSA 2XFXB 3QUML 5F3BB 2G5BB 1P7QB 3GM0A 4OLWH 4YDLC 5GQBA 3S37X 2W9DL 3FQNB 3L5XL 1RULH 5BW7A 1LO5A 1K6QL 4XNXL 4D9RE 4PPTA 3AXLB 4P2RB 4L3CB 4YHNB 1CXIA 5EU6A 5F9AC 4U6VH 3UJJH 5FHBL 3RNQA 2RHEA 2Y6SD 5I16B 1ZGLB 4Y5XB 3ZTJG 2UZIL 5C08D 4EEEA 4H5SA 1CFBA 3L3GB 4R26H 3JV4B 3NCEB 1NGYB 1DEEB 4OF5A 1NBYA 5IVZA 3UEZA 1IC4H 5HVHB 1WBXB 4DJMA 2XNAA 4I2XA 3CVIL 5CD5C 2FB4H 3BKYL 4KHXH 4FQXA 1W2KT 4UBDD 3VFUB 1NFDB 2IH3A 1RAMA 3AREA 1GAFL 1H3XA 1H15A 4RIRB 2FO1A 3SDAD 4ZUTB 1WSST 2J8HA 5K9OA 4XXDA 3AAZB 5EU5B 5JW3H 3HPJA 1XZ0B 5GGQH 2DIJA 4MAYC 5T1KA 1U8MB 2HG5A 5DFWH 1TJIH 1WJ3A 4RMTA 4EJ1C 2XYCA 2SEBA 1L4IA 5E08L 4TUOB 3BMVA 3SDCC 1M7XA 4M7LH 4XP4H 1QNZL 1FORL 3VG0H 3IKCA 3QNXB 4HKXB 4PTTB 2IALB 1A3QA 4HEPG 3P0YL 1S7UA 4TNWK 1V7ML 2BVEA 4M1CC 4CGTA 4KY1H 2VN4A 1JF5A 4HPOH 2ZUQC 2X4OB 2I07B 4YDLB 1XGQB 1I7RB 4LSPH 2HJKB 1MCPH 4PV8A 3RVTD 3MCG1 3IKKA 2CIKB 3EIFA 5C0IA 5MI0B 2FGWH 2DQEL 5DMIL 5CWSA 2DQJL 1E4KC 4U1SB 3E6HA 4U1LB 1A6PA 1CDJA 3GHEH 1MFBH 1IGFL 4JVUA 4JRYD 4I18A 1ZT7A 3O6FD 4NUGH 4PTUA 1CXKA 5JW4Q 2VSDA 3QXUA 5C0BB 2Z93B 4XP5L 1QSEE 5BMFH 1E0OB 4P46B 4I0PA 3HNSL 1YYML 2XICA 3WFEL 1UZ6F 5EIIB 2HVJB 1XGRA 1ZHLA 3U7YL 3MNZB 5EUOA 2NW3A 5KG9B 2GT9A 5BXFB 1HSAB 5HYJE 4X9FA 5KSUB 4KGJA 4OZFA 1KFAH 1FLTX 2OCFD 4HH9A 4JFFD 5DS8A 1PBYA 5IHUH 5I1GL 3SDCB 5H35A 3TYFA 1QG3A 4APQA 1YEJH 1PLGL 4CADA 5JA8B 4OCSL 5KW9L 4QRUB 4X6DA 3BEVB 3TBTA 4FN0A 2DLFL 3WKNA 3MV9E 5FOBA 2XQBH 5I30H 1XH3B 4AQ1B 1NKRA 3FFDB 3HI1A 5CZVH 4JPKL 4GG6B 1C1EH 3VW3H 1FL3B 4RFOL 5FM5O 1KJ3L 1BQHG 1HNFA 1Z9OA 2OJZH 4N0CD 1NGXB 3GUTB 2FJFA 4KK6C 3GBNL 2B1HL 1U36A 4J3SA 3OWEA 2XOTA 1RZFL 3FB7A 2NY5L 3UYOD 1T7ZA 4F9PA 4TRPL 3KLAB 1QSFB 3C60B 4U3XA 5FO9B 5GS1B 1P6FA 1FJ1A 2XWJA 5JIPA 3MRBA 4P57B 3UBXA 1X5IA 1TCMA 4N0FA 1U6AH 5SWZB 4PJIE 3KXFE 4HGKC 1KTDA 1PQZB 5L6YH 3QIBB 4TSAL 1JTPA 2V5MA 3MLTA 1DLFH 1LDPL 4F8QA 3T0EA 4LKXB 2A0LC 2F53B 5FO8B 4XCFH 3ZDXE 1HHJB 2HVKB 5AD0B 3O6KL 3VWKC 1ADQH 2W1NA 3RY4A 4F7PB 2LU7A 4HPYL 3ARRA 3QRFM 4WW1A 2YKLL 2NY1C 4HBCH 4JKKA 1MJ8L 3DMMA 4G6AC 1M1SA 2X4PB 3ULUE 5DRNB 5I2IB 3O4LA 1RZ8B 3O6LH 3F12A 1U92A 2CO7B 3SJVA 1T1WA 3CX5J 5E4EB 3QNYA 2A2QT 3MJ8B 1XIWD 4PJ5B 4O5LH 2D3VA 1G7QA 2ADFL 2AJVH 2OSLB 3WL9B 1B90A 4LRNL 3MV7A 5D7LE 1JPGA 1YN7B 2FHBA 4JQXC 4QHKJ 5K9KB 4XTRD 4ZNEE 2ZCKL 1ZOXA 1REIA 3O2VH 5D2LA 5D5MB 4E5XB 3GBML 5GGVY 4PP1D 2WANA 5TE4H 4Q7DA 3IDUA 1EV2E 5FA3B 4NFBA 1CK0L 4NQXB 1T20A 2IFGA 2Y6SC 5HY9B 3MRHB 3I6KA 2PF6A 5J0BA 4F9LC 1MRDH 1BM3L 5D7SL 5C8JA 1FV1A 4P23A 3OKEB 4LGPB 1CG9A 4OIIL 4POUB 2B39A 1EDQA 4TVPL 2Z8RA 1HINH 3VWKB 1MJJA 3UPAA 4CVZA 4KHTH 5FGCB 1U91B 1QLRA 3HMXA 3NFPB 4LP4A 1PYWA 4AMKH 1JN6B 3C2AH 4UBDC 5I74C 2NY1B 3MGTB 5J06A 2H2PD 4LRIC 4NZTH 1KPUB 4OCNC 3SDAC 4OLUL 5C09A 1YEGL 2EDWA 3GMQA 3HC3L 1JK8A 2HT3D 1LK2B 2R69L 1HH6A 3QFJA 4HIXL 4AJ0A 4CVWA 3G6JA 4X6FB 4YDIL 2X89D 1QA9A 2B1AL 3QB7C 4JY6B 3GSXB 1CGXA 1S7TA 1OAUH 5DDHB 2CJUH 2Z35A 3VXPB 3QCTL 4KTDH 1QSZA 3E8UL 1BBJA 4AQOA 3U46B 5EN2A 4P59H 4QRTB 3L9RA 4NC1C 3PQYD 3TIEB 5GSVB 1TQBC 4DN3L 5EZOH 5HYSA 4KU1A 3QH3B 3MQIA 1BD2D 3RVTC 3O3AB 4U1IB 1IQWH 1FIGH 2Y07H 4OZGA 1HE7A 4PJXF 4RZCA 5DJ6B 4Z77A 1XCTA 3R06B 5KN5B 4LLMA 1ES0A 1A6TA 3KG5A 3OX8A 3V0AC 2EDQA 2RGSA 2ZUUA 1FSKC 5FV2A 3O6FC 1L6ZA 4MD4A 2Q6WB 1NCWH 3KPRE 4KMTH 5DK0B 4MNHA 3V52H 4DK6A 4L4JA 1RZJL 1R3HB 5D70H 1J1OL 4FXKA 3BIAX 1H5BA 3BRDA 5I74B 4HG4J 4OFIA 1QHPA 1MY5A 5DD6A 4P48A 1SYVA 1L9NA 4M6NL 3O9WA 3QISA 1P84J 1SM3H 3GIZL 5IB1B 1NCNA 2OJEB 3E1F1 3KDMA 3H9SD 4L5FL 4X6CE 43C9B 3FTGA 3NABL 4MCYB 4NZUL 4NNXA 4XH2A 1AGCA 1KG0A 5IVNA 1T21A 4O2EA 4C56B 3UTTE 2VZSA 1U8LA 4PD4K 1YY9D 1ZSDB 2AXGB 2NNAA 4HXAH 1OQXA 1C08A 4YHYC 4NP4L 4YLQT 2D0HA 4MX7A 3KPSA 1NGZB 2W91A 1KXTB 3O11B 1VADB 4LF3A 4MJIE 4AEHH 4TQEH 4LSQH 4Z78B 3HB3D 3OTTA 4FQIL 4N0CC 5LG1A 3ZE0F 4GBXA 1XF4B 4GMSH 5EIVA 4YC2C 4BM7A 3GJEA 1K4DB 4RNRB 2AK1L 3BGMA 5DHYA 5CGTA 2C3GA 2BSSA 3U83A 1LD9A 4QHKI 5AAWA 4OIAA 5IB5A 4JR9L 4JM4H 4PGCB 4JB9H 2DTML 5ITBL 4MJ2A 2EH8L 1EO8H 3GSNH 3NN8B 5K59E 2XWTA 4KZDH 4JFYB 4MS8C 4HKJA 5FV1L 5C0CB 1QFPA 1LDSA 4NO0A 4OFDA 3SGKC 1G6RH 3VFSA 3VD7A 3DURA 4WTWA 5DHVA 4LNRA 2OR9L 4ZUSA 3V8OA 1OAXL 4LASH 1FRGH 3QULB 4MB5A 2XZAH 1A14H 1L7TL 4JFFB 4PJ7B 2GSIA 5AAMA 1NBZB 1NLBH 4OZHF 3ZL4L 3SQOL 4LDLB 3ALXA 4UV4L 4S0SD 1Y0LA 5HI5D 3D39B 5IQ9A 4MB3A 4EOWH 2A83B 4Y1AE 4FABL 4OCXL 4X9HA 4OLZH 1T1YB 5I1EH 2ZSWA 4YHYB 1EX0A 2QSTA 5IVXB 3TIDA 4F8TA 1NGPL 4P9HL 3FO9B 5T1MA 4A2MA 2BOCB 4JVPA 4AL8L 4PRIE 2YN5A 2YA1A 3EAKA 1WBZB <