2GC4C

Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
total genus 25
structure length 105
sequence length 105
chains with identical sequence G, K, O
ec nomenclature
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2gc4C00
3X2QB 4Q8BA 1DYZA 2QDWA 1L9QA 3FU8A 5B7MA 1AQ8A 1RZPA 3X1BA 1AG0A 1A4AA 2B3IA 4X4KA 1RCYA 3FSZA 5B7EA 4AZUA 1SF5A 5I5IA 1NIFA 2VW7A 2YARA 2FQGA 1OCZB 3AG4B 1JXFA 1OV8A 1PNDA 2YAMA 2FWLB 1E67A 2GSMB 3ABKB 3OD3A 1BYPA 3FSWA 1V10A 1AANA 2RACA 4GP5B 3NSYA 3KW7A 1J9RA 3UAAA 4YSQA 2FNWA 2HX9A 3PAUA 2YXWA 1JXDA 2BZCA 2Q9OA 4KO5A 3RYMA 1KYAA 4DP2X 4YSSA 1JVOA 2BP0B 3PLYA 2UXVA 1M9WA 3QJUB 5I6NA 1OCRB 1ZDSA 2UX7A 1NWOA 2I7SA 4YSDA 3WNJA 1NIAA 2X88A 1GS6X 2EIMB 2QT6A 4A67A 2P80D 3UACA 3MX0B 1NPNA 2H3XC 2WO3B 2CALA 9PCYA 5AFAA 2A3TA 2E86A 3CG8A 1JERA 2PP8A 5TK4A 3H4FA 3T71A 1CURA 3BVDB 1PZCA 3EH3B 4A2EA 1ADWA 1JVLA 4HZ1A 4YL4A 5B1AB 3V9CA 3H4HA 4UANA 3T9WA 1JZGA 1PY0A 3OMIB 4KNSA 4A2GA 5I26A 1L9RA 1HAUA 2VN3A 4RH4A 4DPBX 1GR7A 5I5JA 1AZNA 2QDVA 5EHFA 1BQRA 1JOIA 1BEXA 4BWWA 2Y69B 3PCYA 2XYBA 4DP9X 2CBPA 1AZRA 4N4YB 5D4JA 1OF0A 3V9EA 2TSAA 2ZONA 1L9TA 4DPAX 1OE1A 3HEIB 3SQRA 4YSAA 3AG2B 1AS7A 2BZ7A 4GY4A 1FFTB 2UXTA 1GY2A 1GW0A 2JFCA 3PAVA 1WAEA 4CSZA 1J9QA 1AACA 1A4BA 1T5KA 3EF4A 1AZCA 1AZBA 5D4IA 1XMEB 1ILSA 1CC3A 1PCSA 4Q89A 3U25A 3WNIA 4QLWA 1M57B 4KNTA 2W88A 2UXGA 1TU2A 3ZIYA 2EILB 2XLLA 2XVBA 2XU9A 1L9PA 5I6LA 4BXVA 4GYBA 4YSPA 4YVNA 3IN0A 4JHVA 4E9WA 1PAZA 1NICA 3AG3B 4BDVA 1AIZA 1AG6A 1PLCA 1B3IA 4CSPA 1AOZA 1KDIA 1SHXA 2IWEA 3ASNB 1KCWA 1M56B 2N0MA 4A66A 2VW4A 3TBBA 3S8FB 1IUZA 4E9TA 2P80A 3DIVA 3PAZA 1PZBA 1JZEA 3AG1B 3D12B 3H56A 4HAKA 5F7AA 4BWUA 3IBOA 3EH4B 1V55B 1SNRA 1J5CA 1ILUA 1NWPA 3ERXA 2PPCA 2DYSB 4G7SB 6PAZA 3JT2A 4QKTA 3PXLA 3CDZA 1JZHA 5B3SB 3NT0A 4GP4B 4AKPA 4FA7B 3FU9A 4UAHA 3ASOB 2J56A 2HX8A 3NJIA 4DP1X 4YSCA 1MZZA 1AS6A 3ABMB 2AZAA 1UATA 2BW4A 2IAAC 3QQXA 3GXUB 4WKXA 3ZX1A 3DTUB 2OV0A 2XV0A 5B1JC 4DP6X 2IWFA 3UAEA 2DWTA 4HCGA 4AI7A 3FYIB 2PP9A 5PCYA 5ANHA 2I7OA 2XX0A 4GP8B 3WKPA 1SDDA 2YAQA 4G7QB 4G71B 1EHKB 4YSRA 4AKQA 2DV6A 3QJVB 1SF3A 2BHFA 2VMJA 4YSTA 4K9JA 4P5RA 4MFHA 3WKQA 1ASPA 2AANA 3ABGA 3OMAB 3T6VA 1NZRA 2B08A 2CCWA 3MBWB 4NB7A 3CVCA 1ZDQA 2AVFA 3AW5A 7PAZA 5B1JA 4A2DA 2YAPA 2BWIA 5I5MA 2W8CA 4PCYA 5TK2A 1MG3C 1NDTA 1PLBA 2Q5BA 2GHZA 1J9SA 3AY2A 1NPJA 3NJJA 2BP0A 3NSFA 4KOBA 5FC9A 3UABA 4E9SA 1JZFA 2FQDA 4WTQA 2FQFA 1OOWA 3SBQA 1KCBA 2AZUA 2VSKB 1QHQA 4AKOA 2FT7A 1BYOA 3FU7A 4UF7C 4YSOA 1NTDA 3GYRA 5I6MA 3NJLA 4DP5X 1WS8A 2PPDA 1N68A 3S3CB 2BP8A 2YAHA 2YQBA 3BQVA 3NP3A 2CAKA 1CYXA 1YLBB 2IDFA 4W1TA 4BDVB 1TKWA 1IBYA 3WI9A 3EHBB 4BXSV 4HIPA 1IBZA 3QJQB 3NJHA 4DP4X 4ZK8A 1ZIBA 1KBVA 8PAZA 2PLTA 4BWTA 1VLXA 3IE9A 5AZUA 3NJFA 3X1GA 4PAZA 3QJTB 1CYWA 3NJGA 1ASOA 3ZBMA 1ZIAA 4AX3A 2FT8A 1E30A 1SFDA 1ZPUA 3FQ2A 2LLNA 1SFHA 4M4RB 3UADA 3N2JA 2XV3A 1OCOB 5AKRA 3CDZB 1FWXA 4HCIA 4FAAB 3S3BB 5IY5B 3L45A 6PCYA 3T6WA 3ABLB 1KDJA 5E9NA 1PMYA 1QNIA 3TASA 2Y1AA 4DPCX 1AAJA 1W8EA 2YAOA 4ENZA 1NINA 2H47C 1KGYE 2NRDA 3CZUB 5B7FA 1A8ZA 2GIMA 2R7EA 2BWDA 2HRGA 5D4HA 2JXMA 3FYEB 3JTBA 4E9QA 4YSEA 2IDSA 1XB3A 4E9VA 1DZ0A 2OJ1A 2DY2A 1X9UA 1ASQA 1F56A 1QLEB 3T6ZA 3QJSB 4L0PB 2FT6A 1ET7A 1BXAA 1J5DA 3SBPA 2H5UA 4G70B 4NERA 1HAWA 2VW6A 1BAWA 1E5YA 2OCCB 4F2FA 1X9RA 1URIA 2MRYA 2IH9A 3FPXA 2PP7A 3IEAA 3QJRB 4N8UA 2DYRB 1RZQA 1I53A 4GXFA 4YVUA 2J57A 4DP7X 4KO7A 3DKHA 1AZUA 1BXUA 4E9XA 1HFUA 1SHWA 3T6XA 2IDUA 1A4CA 1GS8A 3ZDWA 2UXFA 2PPEA 3SBRA 1TEGA 4DP8X 1AS8A 2FJSA 1GSKA 1MZYA 4G7RB 4HCFA 5PAZA 2PPFA 1E65A 2VM3A 2XUWA 3OM3B 4A2HA 3EH5B 1IKOP 2XWZA 1NIEA 3FQ1A 3NJNA 2ZWNA 4E9YA 4KO9A 4F2EA 3TBCA 1OCCB 1R1CA 1WA2X 1SJMA 3UGEA 4F7KA 4P5SA 1N70A 3FU7B 1PF3A 5I6OA 4A68A 2QPDB 2HX7A 3CVBA 1FA4A 2BP8B 1KBWA 1NIDA 1ETJA 2UX6A 2WSDA 1L9OA 2FTAA 1A65A 2GI0A 3N55A 3TA4D 1XB6A 3S3DB 3QPKA 2VSMB 2X87A 4BK5C 1IC0A 1NIBA 2HXAA 2PCFA 1JXGA 3WG7B 5B1KA 2BO0A 1V54B 3NSDA 3S8GB 2DWSA 1AR1B 3KW8A 3WIAA 2GBAA 4HHWA 3X1EA 3X1NA 1JZIA 2HRHA 4HHGA 1OE3A 5LDUA 2GC4C 4TXVB 1JZJA 1PLAA 1EZLA 2IWKA 3NJKA 5A7EA 1XB8A 1PZAA 2ZOOA 4KNUA 2J5WA 2CUAA 2YXVA 3FQYA 4KO6A 1TEFA 1A3ZA 3C75A 1ZV2A 2TSBA 1W6LA 2EIKB 1CUOA 2PCYA 4HALA 4DP0X 1ET5A 1KV7A 1OE2A 3FSAA 3FSVA 3FS9A 4JHUA 4NAJA 2MTAA 1BQ5A 1MDAA 1GYCA 1GY1A 2GC7C 2IDQA 2I85A 2WO2B 2XV2A 3PPSA 1GS7A 3NP4A 4W9ZA 4YSUA 2R7EB 3GDCA 1ID2A 2JKWA 3NSCA 5I28A 4EF3A 3TU6A 3FPYA 1L9SA 2PPAA 5I6PA 3G5WA 2ZXWB 3OQRA 2HLEB 2J55A 1WA0X 2CJ3A 2IH8A 5B1BB 2IDTA 2GB2A 5F7BA 5I6KA 1RKRA 1E5ZA 2HZHA 2XXFA 4A2FA 1WS7A 3X1FA 2FQEA 1W6WA 3IN2A 1BQKA 3NYKA 2AFNA 4M3HA 7PCYA 1WA1X 4E9RA 2YAEA 2XXGA 3HB3B 1MG2C 1ET8A 3AZUA 3FT0A 1J9TA 2QPEB 3OMNB 4G72B 2VM4A 4JKNA 2EIJB 1SDDB 3NJMA 1BXVA 2EINB 2XX1A 2YAFA 2BW5A 3CVDA 4KOCA 1PNCA
chains in the Genus database with same CATH superfamily
2AQ1A 4ZFFB 1YNLL 4N0UB 4JFUA 4JRXA 3QUGA 3WDIA 2B9AA 1RLBA 2F19L 2IMMA 4P05A 4ZUSB 4MMXC 3GKWL 5I1KH 2J20A 1G9MH 4V2CB 5I74B 4W9GC 4B3EA 5DJYB 5CIPB 3UIZA 3QHZL 3KDMB 2UZYA 3VFTA 4JFDE 4PV9A 4Q9BA 5DYOA 1DVUA 3UTSB 4WGWB 3KCWA 2VJXA 1BYPA 3QXAB 3FSWA 1JRHL 3ZXAC 4JDZA 5C0JB 2Z91A 4NHUB 2H7WA 4N2IA 4YSQA 3LEYL 2UYLA 1Y1UA 2OL3A 4N0FA 1BZDA 2J4WL 4NJ9H 4EIZC 5I1CL 3SSGA 3GLZA 5FKPB 2ADYA 1A5FH 5A16A 4LSVL 4MZ2A 1EBPA 5IEHB 3BKCH 1NCWH 4UT6H 4Z7WF 5I6NA 2VQ1A 3PDOA 4ZSOA 1TTGA 2Z35A 2EUXA 4KBPA 2J8UA 4GUPB 5CGMA 3US1A 4UIMA 3VYPA 2J1YA 1R5IB 1XIWD 2HRPH 1D7BA 1X5YA 4K0OA 4NOBA 2C9SA 3T0XA 3HR5A 4YXLL 4MKTA 1JZ4A 2G3NA 4AENA 1L7TL 4QEGA 1MFDH 1MH5A 4WFHD 2F74A 5DEJA 2E86A 5FO2A 5E4EB 3H4FA 1N12A 1QLFB 1YEEL 3D85D 3F3HA 4HIHA 2AJZB 5D1XD 3O2DA 2AXHA 5TE7L 3SOTA 1AMXA 4WO0A 1D6VL 3SDCD 1SXBA 5K9OA 3IMBA 3OF6A 3V2AR 2JI1A 1JPFB 3K6SB 3RWHA 4OSUL 3LS4L 2NXYC 3FTGA 3IM1A 1I1AB 4KITB 1ES0B 4XP4H 2G5RA 4DZ8B 4A7SA 1BBJB 1H9DA 3H85A 4UOJA 4GRWB 4L4TD 5D2NA 5L9DH 3Q13A 5GRJH 3TEYA 4NZUH 3DRTA 4JL2A 1XH1A 4Q52A 3P9LA 4JFFE 1L9TA 1BWWA 2DLTA 4I3SH 3BPCA 4KKLC 1M7IB 3POHA 4OD3H 3TJEL 5DGQA 4MAUH 4FKHA 1CF8H 1M6OA 3FCTB 1BVNT 4G6MH 3F12A 2DQGL 4P5TA 2ZCHL 1XH3B 4Y8DC 2ZOUA 3TFBA 2EVGA 4IBVA 4FFZL 1JPTL 1MJJB 4RRPA 3DK0A 5J06A 3II3A 3WE6A 1E27A 3MGOB 4QRBA 4G82A 5D7IA 5J13C 1Q0XH 1OW0C 2VLRE 4EXPX 3CFNA 1XMEB 4XP6H 1PCSA 4JRXB 3QQ9C 1W0WB 4FXKB 3RVWC 1OIOA 3W3BA 2M8XA 3WY2A 3ZIYA 1NBVL 4JCWA 2CO1A 4ALAC 3OHXC 1R17A 4P9HL 4JFQA 4F9PA 1A3QA 4OIFA 2HLFD 2UZYB 3U46B 2V7HB 5DYOB 3VFTB 3PQYE 2N0KA 1EAPA 5J1AA 5HGBA 4ZRGA 4Z7WA 5CZRA 1P9MA 1U8HA 4JDZB 1RULL 5EF3A 2Z91B 2WKGA 1VRSA 1U8QB 4Z78A 1EXGA 4BSJA 1U36A 2OL3B 4N0FB 3SKUD 3S7GA 2JJVA 5GRVL 5KANG 5ADOH 5E00A 3TXAA 2BM3A 2VWEE 3S8FB 1XIWA 3DTXA 2P52A 5A16B 1S46A 1WWCA 4N22A 4QXGL 5JQ6L 1S7WA 2Z35B 3ESOA 1RUMH 3RGHA 4N2LA 1ILUA 2WOBA 3E9TA 2Z31C 5DCCA 4L4VB 4M4RA 1OF2B 4XH2A 1ANUA 4I1RA 1MHEB 4NQCD 3F04A 4AENB 1LEGA 4PR5A 5B3SB 1IFRA 1MH5B 2EDWA 2F74B 3SN6N 3NT0A 2ZTBA 3B2XA 1MZZA 1INEL 1VZIA 5EOTB 2YSTA 4G80A 4YIQB 1UATA 5LCVH 4F24A 3TJHC 3SDCA 4WO4D 3O6MH 2B0SH 4HIHB 5JORA 2EQDA 4ORGB 4E5XA 2C7FA 5FEBA 1V27A 3CBJB 4UQ3A 4AGOA 5CR8A 1F4WL 1KXTA 1USZA 5FW8A 4AI7A 3FYIB 3SIKA 5ANHA 3SE4C 1KPUB 1LWJA 1XEDA 3IU4L 4QYOA 3PHQA 1U8OB 4L4TA 4QRPA 3RWHB 2I27N 3FTGB 4Z7NB 4P4RA 1TYJA 2VE6A 2NYZA 1SF3A 4F8NA 3BZEA 3RWFA 4ZG1A 1GYAA 2ZCLL 3A23A 5JUEL 5F1KC 5T5NF 2HT3C 5D2NB 3F6LA 3DRTB 4MFHA 1HK6A 1MFAH 5D9SA 1ITBB 3QXDA 3R19A 4LHJB 2V2TB 3BPCB 3QUZB 3T6VA 3MZTA 4HEME 3U4BL 2VDKH 2PWEA 2JQAA 4B27A 2ZWZA 1ROCA 1X5MA 3F12B 4PRIA 1ZA3A 3LEXA 4PGCA 4XC3H 4LFHG 5DJ8B 3LXBA 1E27B 3BESR 1EK3A 3PU7A 2GEQA 3FUEA 4R7DA 4D8PB 4AVHA 4Y19D 5JQIB 1DUYA 3QZLA 2ZUQB 3PUUA 1Q94A 3OG4B 1R3IL 3PGFH 1RZFL 1BPLB 1Y6NR 2Y23A 5FK9A 3TVMC 1YEHH 3KM1A 2FQFA 1HXMA 4ZW6A 2WD0A 3D4ZA 3FDWA 4AIZA 2X9WA 2WLYA 1KCBA 1D6EA 5E8PA 1QA9A 2DMBA 3JUZA 5HHNB 5HI4D 3Q8CA 5AG8A 2WSPA 3AB0B 2ADJA 4WV1B 1EAPB 5HGBB 1J0HA 5J1AB 1DQQA 4Z7WB 2NY0D 1VADB 2CGYA 3LIZH 2IDFA 1I8AA 1U8HB 2DF3A 4CA4A 3WI9A 3QFJE 3AT0A 2ADGA 4FTVA 1MJ7H 3OJMB 1KGCD 3OJDA 3D3VE 4DZBA 1A7RH 1RZIA 2XQYG 5D1QD 4A7TA 1XIWB 3DTXB 1HZLA 2YRZA 4AG4H 4LVHB 2WANA 4IRZH 2MJWA 3QJTB 1DSYA 3ZBMA 3K81A 5JIPA 3QJXA 1MRCH 4KK6C 1MFCL 3MACH 4ERSL 5KVDH 4HOMA 4PJFA 4M4RB 5IWLC 3UBFA 3D85B 1NCCL 3U1SH 4PR5B 5EBMA 1X5IA 1BV8A 4URTB 4WO4A 3SDDC 2EDXA 3AROA 1H6UA 4NKIL 1CYGA 1PG7X 3A5VA 2ZKXA 4UWQB 3K6IA 1EDHA 1HH6B 5CIPH 3SDCB 1FLRL 5JORB 1T03H 3BCDA 3BP4A 4DKDC 3MCKA 5ID0A 2BNRE 2AK1H 2H2PC 1S4IA 4UQ3B 1WZLA 3FN3A 5I0YA 3ZN6A 5AOMA 2F9BT 1A7QH 1KXTB 2FR4A 1JPST 1ERNA 1ADQL 2EXTA 4K8RD 2BOBA 4QYOB 1A0QH 1XB3A 5CSGA 1WWWX 2E5EA 4BUGA 4L4TB 1ASQA 4DN3L 3BEVA 3NABH 2K6YA 1C08A 4Z0BL 4F3FA 2IPUG 3RWFB 3BZEB 2ZUXA 4Z9KB 1TQCC 1B4JL 2YIHA 2VW6A 1OHQA 2BIHA 1JSYA 3U6RA 3GLDA 1J8SA 3HS8A 5D9SB 1R75A 3QG6A 3BSZL 3QXDB 1DQML 4N25A 5JDJA 4FDWA 5DA0B 4JEGB 3RVTD 1VCBC 2APSA 1WITA 2VUYA 1U6AH 5F1NA 4Q9RL 4GMSL 1IC4H 3LEXB 4PGCB 3UYRH 1FVCB 4EN3C 1BOGA 4RDBA 5FDWA 2DIJA 1OL0A 1X5LA 1Z2KA 2A4ZA 1EAQA 2VN7A 3MU3A 4MAYA 4FQXA 2VLMD 4HULB 2LE9A 4L1SA 1MSPA 5K9JH 5D7LE 1EHLH 1FGVL 1T5XB 4A2HA 5JHDD 3ZTEA 5GRXG 4A63A 4AL8C 1HXMB 3QW9A 2VAJA 2BSCA 5E8PB 4AYFA 5I9QC 4P5SA 5B39G 4KXZH 1F4YH 1IBGH 2CR6A 5EDXA 2ADJB 4OF5A 3CVBA 1YEKH 4EUPA 1DQQB 4OGXL 1WIUA 5HYJE 5D1QA 2ED7A 5IROD 1QKZL 4JJ5B 1RPQA 1GKEA 2NT1A 4HU8A 4X4MA 2ADGB 1XGTA 2XA3A 4M1GH 5J6SA 3N55A 3SY0B 1IB5A 2W9LA 3FO0L 4M7LT 3NZHL 4HFUL 4NKDB 3P0VH 5ALCL 1MJUL 1TQBB 4DZBB 3QUMA 1RZIB 5E8NA 4TNEA 5DVOA 4OY9A 4LVEA 1NGZA 4NQCB 3SYOA 5A6IA 4RRPM 3VCLA 1MIEL 2GEEA 4OGYL 1BWMA 4LASL 4HCRA 2B4CC 1NFDF 2FBJL 4YNYA 4MQXC 2VERN 4QTHA 4ODBD 5LXGL 3SGJC 4HU2A 1XB8A 1GOFA 5EBMB 4WO4B 3QDJA 3L54A 3ARBC 3O4OB 4NFCA 2TSBA 3DJRA 5E7BA 4L8CA 4WUUA 1DBAL 1UWXH 4KY1L 3DYMA 4PS4L 3V7MA 2HMID 5LQBH 3KWWA 3BP4B 1L9NA 3MCKB 1SN5A 5CEZD 5ID0B 3U0TA 2Q10A 5SX5H 1IT9L 1FFQA 1TCRB 3BZFA 3G6DH 2BSEA 4GIAA 3VX0A 5DZ9A 2BOBB 3BPOB 2Z9TA 5HDQL 1E6JH 3LPOA 3N1MC 5BZZA 3BEVB 3VD7A 1M05B 3IDYC 5H94A 2GTZB 1TLMA 2VLKA 5B1BB 1VEPA 2JKJA 3AAZA 3EJJX 4U3HA 1C08B 1QHPA 5SV4A 3ZT5A 5FCSH 4F3FB 3MLZH 1HHKA 3CIQA 5FYLE 1LEIB 3KLSA 4LKCB 5I1IL 3O4LA 4Z7UB 1UQSA 5FGBA 1WS7A 2HJFB 4A2FA 4HEPA 2IFFL 4OI9A 3IN2A 5AZEH 3EIFA 2VR6A 5FB8B 1RJYA 1CB4A 1NBYB 1A7NL 1ZHBA 1TTAA 1JDDA 3PABA 4FZEL 5CILH 3R8QA 3UAJD 4C47A 2OMUA 1XXFC 2VXSH 4Y19B 3TONA 1NANH 1JL8A 25C8L 2W94A 5DMIH 5GGVH 4N20A 4NN7B 5F1NB 5FGCB 1IAOB 2AJSH 3VXUA 1UZGA 1BOGB 5DD3L 4JO3H 3F6JA 5FDWB 1B2WH 5FW6A 1R0AL 3KLHD 3TWCL 3W1ZA 4FFVD 1IJ9A 2OYLA 5C0CD 2VL5B 3OR7A 2FHCA 3O2DH 4JPVL 4K07A 1RSFA 1D7FA 5T1KD 1AG0A 1J88A 3DXAD 5IBTL 5H4ZA 1AHWB 1DL7L 1R33A 2CHDA 3HHSA 1G5GA 1O6VA 2FQGA 1JPGB 1FAIH 2NY0B 4YN3A 4AYFB 1GW6A 2YAMA 5D1ZC 1KGWA 1KCSH 4S1RL 5CMAA 3LRLA 1MLCB 3NACH 1A6AA 4EUPB 3E7JA 3HZ3A 4LBAA 1G7PA 3FUFA 5D1QB 3KWTA 1Q9OB 4POUB 1R6VA 4OZFG 5ESVA 4Z5RB 4WFED 1NFDA 1DVQA 4WI6A 3OVUB 1E4KC 3ZHFA 4DP2X 3F84A 4L8BA 4R6UA 3RTLA 2UXVA 4MDIA 2BSSB 5I1GH 3EHBD 3QUMB 5DJDA 3L6FA 3FN0H 4B9YA 5JMRA 4BFRA 3MNWB 1UACH 2Y07H 4M8QB 4FABL 1AGCA 1NIAA 4QDGA 4WY7L 1Q0EA 1CWVA 3K6OA 4MVBD 4MMXA 3FU3A 4JFXA 2MCAA 2CK0H 1JF6A 2ATKA 5JPNA 3CG8A 1Z1WA 3D87B 3H3PL 3QDJB 4PJ5E 3CX5J 4L8CB 1CR9L 1PZCA 4OR1A 2D0HA 3OLEA 4XCCH 5T33H 3KJ4B 3KWWB 5ANMB 2MNWA 1WHOA 4IKLA 2ZXBA 4N6RA 3U0TB 1U4FA 1CMOA 1HOCB 4XOCA 3BKML 3BPNB 4HQQL 4NIKB 5JR1L 1NQBA 1BQLH 2X2IA 3ZDZF 1JHLL 4DPBX 5DK2A 4A39A 1DN0A 5DF0A 3NCEB 4UI2A 1R3HA 2ZUVA 1JOIA 3AAZB 4BFBD 2JJSC 1KLGB 2G30A 3VJ6B 4OGAC 1HHKB 5A2LH 4JFVA 4M4PA 4UTBA 1Q72L 4IK7A 2IQAB 1R5VA 4MS6A 1UQSB 1REIA 5FECB 1NBQA 4I5BA 3FUMA 4OD2B 4FL4C 1BBDH 1G9EA 1RJYB 3GJFK 1ZHBB 4R4FH 3BRGC 3CC5A 3RVVD 2BY3A 2OMUB 5GISH 4BKSC 1GY2A 4E41D 5ETUA 3QDGD 1KZYA 5C0CA 4LT7A 3SYPA 5A2CA 4QXWA 3TWYA 2AXFA 5T1KA 4F7PA 3MXWL 4LEEA 5DRNB 1LLAA 3KYKH 4H26A 5JHDB 3H2PA 4IOSD 1MCEA 3QI9C 3R4DA 3UTTD 2QGBA 3OR7B 1OT2A 3LHPH 4J27A 5JW4M 2H32H 5FHBH 1WCQA 3PIQA 3QAZC 3RI5K 4W81A 4HKJA 2QPFA 4N8VG 3HHSB 1X4XA 2A6IA 3TYFA 2JI2A 5HVWA 4ZW3A 2XZZA 4S1DC 1FCGA 4XX5A 5DFWH 3IMWA 3I9GL 4HPHA 5CMAB 2GJPA 1QRKA 1RZKL 3WO3B 4N8CL 1AG6A 4QRSA 4C56E 1TYRA 2JKNA 4LCYA 1G7PB 5BVPH 1QSFD 2DM3A 1QRND 4LAQH 1ZA6A 5MHSE 4GUOA 3B8SA 4MB3A 2IWEA 4S0TD 2HFEA 5ESVB 1ZANH 5ISZE 1NFDB 2XTJD 5T5FL 2VW4A 3STZB 4M6OL 2FGZA 4L8BB 2O5ZL 3OTTA 4YDLB 5IB5A 1FL5B 1OW0A 3H56A 5DJDB 3L6FB 5F7AA 5E9DA 1HNFA 1AGCB 1V55B 5FM4A 1FSKB 2PPCA 3HCVA 4JFXB 3BAYA 2QADD 4UNVA 3R4RA 4JB9L 4OUUB 4QNPE 1II4E 1MHCA 5JPNB 4FA7B 1GC1C 3SOBH 3BEWB 2J56A 4FQ2H 4KTDH 1IVLA 1PG7L 1XCTA 1M6UA 1WSST 3C08L 2BZDA 5A2IH 3OKMA 1L0QA 2QTVA 2Y4SA 4X8XA 3VDBA 3AREC 4PLKD 2VWEC 2DWTA 5TE4H 4XVUD 4JMXA 5IBUB 1WZ1H 2AQTA 4R84A 5LAXB 2KPWA 4P2AA 2G75A 4H25B 4D94A 1GGCH 4UBDC 2CJUL 1G1KA 1F6AA 1T1WB 3GBMH 1JXKA 1DN0B 1OP3H 4BV1A 2Z31A 4HJJL 1R3HB 2ITEA 2CKBB 4DO5A 3UCRA 4A7QA 1AZZC 1JPSL 3WDJA 4OKVA 4UV7L 3P11H 5CHNA 4NXSA 4TS6A 1GAFH 3LV3B 5KSUA 4E41A 4I9WE 2YQGA 3K4ZA 4LLMA 2P9RA 5SWSE 4FI8A 4K15A 3X3FL 2B08A 1R9FA 1JYVA 1BJ1J 3CC5B 3VXTA 5DYFA 3B2PA 4M93B 1I4FA 4PB9L 3UAFA 1XAUA 5C0CB 1A1MA 4IOSA 1J0YA 3D34A 3UTTA 1CXIA 5C0EA 1KN2L 1EVUA 4PLJC 3DX8B 3Q0HA 5T1KB 4F33A 4F7PB 1UCBL 4UT9H 3BZ5A 3FOMA 3ZE1F 4EAEA 3UABA 3U2JA 4JPIA 3LPPA 2X6MA 4N1EA 4I3GA 4WJKB 4ENEC 4G7VH 3IDJB 5EN2A 3CJJA 3SBQA 4HKJB 1CU4H 3H3KA 4UTAA 4LCIL 4NHCH 4HWZA 4AKOA 3TYFB 4JY6B 2E9IA 4XXDA 3MBED 1QSFA 4Z0XB 3L5WA 5I6MA 4FNUA 3QRFM 1N5AA 3S3CB 2YAHA 3O3BB 3Q3GA 4QRUB 1BF5A 1V8HA 1D5XA 4W1TA 1ZLSL 3EYUL 1MREH 1SXCA 2BNQD 4QRSB 3DIDA 2R2BB 2O6FA 3EHBB 3H6JA 1TQTA 1IBZA 3WFDL 5BOZG 1ZA6B 4J23A 5GXBB 4AEHL 4DP4X 1N67A 3JQOB 3MJ9H 1JTPA 5H37G 4YR6B 5BO1L 5IB5B 4F58L 4M8VA 4LVNB 2YEQA 3NGBC 4ANXA 5E9DB 4Z7QB 5HPMA 5E94A 4EN3D 4ZTOL 5BQDA 2E7CA 4MHHG 1XD0A 4LHQB 3TVMA 5KVEH 4JK0D 3N85H 2NMSA 4V1DD 4IQHA 5JZ7D 2WLLB 3HCVB 4M7LL 5C6WH 1HINL 1TFHA 2EDTA 2EO1A 2ZUUA 3K0WA 3ZVVA 5AW2B 3HS0C 1RSYA 6PCYA 5JW3H 1CXHA 4R3SA 3H0TA 2VQTA 2BXYA 1XCTB 3ECQA 2PABA 4WK2B 1KGYE 2VDMH 3MRJA 3ZDZB 1A21A 2WYHA 1TTUA 3C2SA 3GTVA 3TZVC 1V3JA 1U8KA 4EVNB 5DRZA 3FQXA 4JM0A 1KG0B 1TTRA 2G4EA 4YE0A 3LKPB 2ZX6A 3F7QA 4P99A 1NM9A 4YSEA 4P46C 3BC9A 4AT6A 1MHHA 3OXSA 1AGDA 1DBKH 4E9VA 1WO2A 4IRJC 2P42B 4O5LH 3M8OL 4X8CA 3RTQD 1F6AB 1RFDH 2CGRH 5I8CB 2X9XA 4J3WA 1UM6H 2EEDA 1TQWA 4GQRA 1E4WH 3QUMH 4K9EC 4M8RA 5D7EA 5C07A 5IWLA 5EIVA 2V9UA 2KPNA 5J12C 1DFBL 4J7RA 1T0NB 3FUDA 4L5FL 1LK3H 5HI3C 5C9JB 1J86A 4XHJD 4GMTL 4OLYL 3QWQB 4E41B 4PJDE 3QDGB 1G6RL 3RZCC 4HK0A 4HCRH 4WU5A 4LLMB 1FV1A 1N9PA 4XPFL 1YN6A 4RMVA 4Q7DA 4TSAH 4JO4L 4Y89A 2E56A 2QHRL 4I85A 4LLUA 4MXQC 4XPBH 4KQ4L 3VXTB 1UJTA 1PD1A 4U3XA 5L0QB 1I4FB 2XDHA 1NMBL 1ECZA 3HTLX 2O5NA 1HFUA 4R4NC 3UTTB 4X5XB 1A4CA 3KJ6L 4F33B 4MASA 3L3JA 2K3TA 4K3JH 1SLWA 3H9HB 3PNWA 1K85A 1DP0A 2QKIC 1A7PH 3HC2A 4JM2D 4B9CA 1OVZA 3D0VA 1TEYA 3VXSD 3VXOA 4ONOA 2VKWA 4JM2F 1UA6L 1JV2A 3MYJA 2AV1A 2W65A 5HHMD 1O9ZA 3IETB 2IOOA 4N0YL 4HWZB 1QNZL 4ZMOA 1SDAB 5E03A 3GO1L 3HHMA 3Q2VA 2I69A 1QSFB 2OSLA 1QRNB 2YGPA 2WXJA 1SXZA 2OCJA 1N5AB 1VDGA 5F7FA 3BP6A 3Q3GB 4LCUB 2XTJB 1B9KA 4N3UA 2BXZA 1I7UA 2LTQC 5IBLD 1XCXA 5CR1A 3NCXA 1KB5H 1GHFH 4QHKI 2GI0A 4I77H 4EN3A 3HC4L 4HBCH 1GZPB 2ERJC 2WXPA 3AUWB 4B9PA 1EHAA 4MWFB 3WG7B 3QPXL 4V1DA 3VXRE 3EYQC 1RZGA 1IAII 2QADB 3NEEA 2DWSA 5K93A 3S8GB 5F0JB 5TFSL 3UBXA 1XD1A 3DX4A 2VM9A 3EJSA 5DZVA 4ZFOB 4MZRA 4MA3A 4KK5C 1G4RA 2MOGA 3ENEA 4JHAH 1UG9A 5JIIA 1G43A 2DQUH 1PLAA 1P0SE 2J5LC 1G9NC 3MQIA 3MRMB 3WUZA 4XR8C 4FFYL 5IFAH 3MTXA 1ODUA 2YOAA 4U1IA 2W38A 3F2LA 4X0KB 4UQBA 4N9GA 1EO8H 2FB4L 3QHFL 4XNYL 5AAMC 1QFOA 3FCGA 1NAKH 4LSUL 4AQOA 4P23C 4XBEL 3MRJB 3KPQB 4YDKH 5IQ9B 2WVUA 3HOGA 4W9CC 5M95B 3GDCA 5DRZB 3FQXB 1LQSR 3AWFA 4ONHA 4FMVA 5BRPA 4FRWA 2CDFB 4AT6B 1FNHA 3OXSB 1AGDB 1YN7B 2G60L 5AOZA 3MLSH 4Q9QL 4QTIL 3K8MA 4ZFGL 3OQRA 3O9WD 5HYSG 4P5MB 2ZICA 2IDTA 2DPKA 1QLEL 4ODVH 2QBWA 4AJ0A 5HJ3B 4OTXL 1MCWM 3SGJA 1NCOA 4XTRC 3H7BA 4Y4FC 2A6JA 4NRXA 2EYSA 2RBLA 2FQEA 1FL3A 3ARBA 4ZXBC 4HK0B 2YAEA 4ZO6A 4V11A 5GGQH 5J6GB 3HLAA 3KPSE 1YN6B 3ZE1B 3N9GL 3OMNB 4WI7A 2Y2WA 4LLUB 2YPKA 4JKNA 4A04A 2RGSA 3NAAH 5IFJB 3R1GL 4HFWA 1MQ8A 4KOCA 2IPTH 1IE4A 5BRZE 2Z3FA 4PB0H 4UNUA 1S7XA 3VWKC 3TBYB 3VSUA 1S3KH 1JI1A 5L6YL 1HSBA 3PNWB 2MPVA 1IX2A 5B7MA 4ELME 4HV8B 5I1EH 4S0SD 1C16A 4PG2A 4NS0A 3VXOB 3OZ9H 3IJYB 3SYAA 4HLZH 2AV1B 2ZX9A 2W65B 3FCSA 1JTTA 2RCSL 3CFQA 1X9QA 4WU7A 1P4BH 2OSLB 1IQWH 3DVGA 5DT1H 4OGAD 5CJ5A 5KVGH 3VFSA 1RIVH 4UTBH 5I15H 4Q56A 3B9DA 3KW7A 3WUWG 2HX9A 4Y5YA 3FTWA 2V7NA 4D2NA 2BZCA 4KKZA 3VAEA 2F58H 3VD4A 4PJ8C 4PJIE 1CXFA 3FRPG 4HYTB 4EN3B 3RG1C 4ZOBA 4IJ3B 5GGTA 4V1DB 1X7TA 4PJBE 1RZGB 3RX8A 2EYRA 2ZIDA 4OF6A 2ZKHH 4QRFA 4CKVX 1DJIA 3BE1H 5C7XL 4DEPB 3A3YB 1FNLA 2P80D 3WFBH 2FJFB 1K8DB 5HHQB 4MA3B 1FFPA 1YYCA 1PEZA 4WI4A 2P24A 5F89A 3RA7L 2AJUH 1JFQH 1C5CL 4F15C 1C1EL 1ROWA 5TK4A 2H26A 4KHXL 1PCXA 1SLUA 4WGVB 1JGLL 2P49B 3V0AC 5AOJA 4H0LC 3UIYA 1YECL 2YPLD 1QFPA 4K5LA 4E68A 4HPYH 4KI5E 1MCOL 3CE1A 1RUPH 3VNYA 3O9WA 5AW4B 1E4KA 4JQVA 4MXWL 3RTQB 4KDTC 3P0YL 2WPGA 2D7QA 4B5EA 1IGJA 1MEXH 2L3BA 5I26A 2JI3A 1ACYH 4QRTB 3VXNA 3GSNL 5B4MD 1LDPH 5LNEA 1UKSA 5L2KD 2FL5A 3QCTL 2KLSA 4TTDD 1Z5LA 3PCYA 3K71A 3EFOB 4BFGA 2C9VA 1KB3A 2LT9A 1CGXA 3T6QC 4I3RH 4FLSA 2A6JB 2VR5A 1E4XH 4HBQA 4NRXB 2EYSB 1JF5A 4FQCH 5BMFL 1JG9A 1FL3B 4GEJA 1WHPA 1HESA 4PJEE 5AALA 4TLSA 1I9RH 5I18H 2EZ0C 3HLAB 2R0LH 4PW9A 4ALAH 1MWAL 1WK0A 1B0IA 3K8KA 3QEQE 1YY9D 3WSQL 4BZ2L 1CBJA 3GUTA 3T0ED 4JM2B 2L0DA 1G5AA 2HFGL 1T5KA 4RAUA 4CC1A 3VA2C 3VXSB 2V8MA 2H6PA 2WTOA 1E7VA 4X5QA 5TJWK 4ZOCA 4NC0B 5HHPA 2ZKWA 1HSBB 2H3KA 5HHMB 3SJVE 2TRYA 1XL6A 4ZX4A 4ELKA 2JJSA 2ALAA 3T77A 4FMFA 4ZTEA 2XU9A 3EJRA 1QR1A 2CKNA 3FCSB 3OSVA 4K23L 1X5AA 4UB0H 5IV2A 3CPLA 1F13A 3LYRA 3DVGB 4I0PD 2FSDA 3VFSB 1F11A 1UEMA 4Y16D 5EOCL 5F7DA 3FOLA 2LFEA 5F9OL 2Y7OA 1SHXA 4RISH 4F57L 3CVHA 4Y5YB 3D4GA 3KXFE 2VR4A 1A4JA 3NSXA 2P80A 2WGNB 1OGSA 4IW4C 5E5RB 5DUPL 3D12B 1QP1A 4HJ0C 1A1NA 3MUJA 4RGNE 3T2OA 4CILA 3IWVA 3GSQA 3M1CA 5I0DA 4LFHD 5IF0B 4XN9A 4TV3A 3IDXL 3IGUA 1IM3A 1HJBC 2P24B 3L1OH 4QD2E 1JZHA 5GSRA 4BELD 2VXQL 3QEGL 4KX9A 4P9HC 2YPLA 2C3WA 2I9TB 1JJUA 4XN4A 1CLVA 4JLRA 3BUPA 1XSKA 2H26B 2HCZX 1CL7H 4AH2B 4XO5A 4NJAH 1DVXA 1SY6A 1WT5C 2W0FB 3BP7B 5AYQA 3S37H 1MCFA 3KD4A 2X05A 3KYNA 2JE8A 4K7PY 5F1IA 5AW0B 1D5IL 1ETZB 4KXCA 3U30C 2VLRA 3O9WB 5L2KA 5DSCA 2EEFA 4U0RC 1W80A 5AW7B 5JNYA 3A22A 1GYUA 5I1HL 3L5XL 1DO6A 3P3RA 5AVXB 2B59A 4LRIA 1FJ1A 2C7UA 2V3EA 4Y88A 4ZMYA 1G0DA 3WHE1 4GAAA 2Z7UA 3V4UL 5JOEA 3GMRB 4NKMB 3VXNB 3WJMB 4ZPVA 1TOXA 3ALXA 3QJVB 4XCNB 3VG9C 2FL5B 1HYSC 3PWVB 1OT1A 2VUOA 2CDGB 3P4OA 5AOIA 1NEZB 4FXGC 3K71B 3VW3H 1MRDH 2D4FA 3PQYA 2ZXDA 2WBWB 4KKCC 5TDOA 4DUVA 2WWKT 5L4FA 3HFMH 2A9DA 2VO8A 4OI8A 5HGGS 2DWDA 2GUOB 3F7VB 5IEKA 3AREA 4LEXL 5F7EL 2ZCKH 2OULB 3GUTB 3UP1A 4GB9A 5I5MA 1ZGLB 4Y4HC 3FQ4A 4RAUB 3KBEA 4X99B 5GGRY 4ZUWB 3KH4A 1FZOB 2H6PB 1B0WA 3NJJA 4KOBA 3AY2A 4XZ4A 3ZKQD 5HHPB 2PKDA 1WISA 4ELDA 5GGRA 2XC8A 1VFMA 1N0XL 1Q0YL 4WZ9A 5EU3A 3T77B 1R3KB 3AM8C 4I0PA 4MLSA 2GFBA 2OMBA 1QR1B 2DH2A 3I75A 1JDCA 4HUWA 1TVBA 4JPWH 3GYRA 4NZRH 1YNKL 4UM8A 3CPLB 2H0JA 4XBGA 4ETYA 5KSBB 4QRAA 3MRCB 1OB1A 3GNML 3RFZC 4ZUTB 5AW9B 1F11B 1CJYA 2CM6A 5F7DB 3VQMA 4LPWA 3MBXH 4BFNA 3CVHB 1EO7A 2BSTB 5B8CC 1YO4A 2XG4B 2C1PA 1L5GA 1A4JB 1FNSH 1WAAE 3FH7A 4TVSa 3S4SG 5JW4Q 4IBTA 1CGWA 3SCMD 1MI5E 1DLHA 5LBSA 3EGSA 2VDNL 3UMTA 4M7KL 5HJBA 2JKRM 4WDIB 1CF1A 2VDOH 4Y7MA 1D2OA 4A1RA 5J7CC 2ZD0A 4OM1H 4TVPE 5AKRA 5I0XA 3B7UX 5CFAA 2A74A 4FOMA 1SHSA 3SDXF 2YPLB 3KMDA 2BY1A 4J6RH 2PTTA 3ZDXB 4ACTA 3MLPA 2QR0A 2OP4H 15C8L 2X0VA 5DQDL 4X80H 2O4EA 1KCVL 4UIKL 3CZUB 2YD9A 7FABH 5I30L 2DEXX 1M7UA 4LSTH 1JZ8A 1HU8A 2WINA 3KYNB 3L4UA 1TZGH 5F1IB 3TCTA 2F8XC 1JHKH 3I6LD 4FFTA 2HRGA 1P4IH 4QR7A 2X3CA 1JGIA 5L2KB 1LE5A 5DSCB 4LLQB 4RWHA 5JNYB 1R3JA 4OT1H 4KHTL 3T6ZA 1FJ1B 1M7XA 1VENA 2C7UB 1ND0B 2LVEA 4FYRA 4ZPVB 1GGUA 3GMLA 1NLBL 3N6YA 4BGLA 1S5IH 3EYQD 5T1DH 3CBRA 1XCWA 5IHZB 3Q06A 4PBDA 3LQAL 4FHJA 3DGGA 1D9KC 4F2FA 1N64L 1X9RA 3AACA 3QQ4A 5EIIG 3HS0A 4YGVA 4XE5B 3EDEA 1FNGA 3FPXA 4W9KC 1GCFA 5TDOB 5FF6A 4L5FE 4JKPL 5L8LB 2EH8H 3GIZH 4S1SH 3T0EB 2ZAIA 4FHKA 4XHQA 4AL8H 4GW1A 1IAIL 1N5YL 2DWDB 4FNQA 1A3LH 1AQDB 2Q7NA 4PRNA 2APWA 3KYAA 4M6MH 3D3VA 3TZVA 4CDHA 3OAZK 1LP9F 4E9XA 2X70A 4I9XA 4POZC 4JDTH 3TFKD 3DO7A 3II2A 2CIKA 5F1SA 3SD2A 1OGAE 4ABUA 3I50L 3ZE0E 4IRJA 4NP4H 4ZNCD 2L7QA 4NFBA 5DR5H 2XUWA 3IFLL 1LE9B 1MRFL 1KBPA 1O9VA 1ZT4A 5GGRB 4F1SA 3ZSTA 5E2WH 3CMOL 2XACC 3RWJA 3TBCA 1V7NH 1I1RA 4I0PB 1CDGA 3OAWA 3FZUD 3HRZB 2GFBB 3C5SB 3I75B 4Q0XL 2DQIL 2Q7AA 4HUWB 1TVBB 1WGOA 1I3GH 4Y16B 1O7DE 4KKAC 3O6KH 4M1CC 2FJGB 3BD4A 1P84K 4XBGB 2B4CH 2HX7A 4KAQH 2ZT9C 1OB1B 1VFBA 5SX4H 2RR3A 2EJ1A 2ZJSH 3C2AL 1ETJA 1E8YA 3L7FA 2YA0A 4KU1A 3SCMA 3BUQA 4C4BA 2IANE 3BAJA 3VACA 1YQVL 2CCLA 1VEMA 3RB7A 5I75B 4HUMB 2C1PB 3GMMA 3CFDB 3GBEA 3SDXA 1CG9A 2V2XA 4XPTL 1IZJA 4H88H 4I18B 1K5NA 1DLHB 4QXVA 2QKIA 1FZJA 3U7YH 3CUPB 4WNQA 3GXNA 5DJXB 3QDMD 3QIWC 2GBAA 2ZX5A 4PJ9C 4EDWH 2GI7A 1MFBH 4QYAA 1EZLA 5DHMC 1U3ZA 4UQ9A 3FHAA 1WWAX 2A74B 5IHUH 3HI1A 5DRWA 3NCJL 2EVIA 2X2JA 1MQKH 3PWPD 3PG2A 2PTTB 5IREA 5B39A 1OWWA 4XMTA 4S1QH 4HALA 4XCYB 3RIAF 3W9EA 1A6ZA 2FUQA 2I5YL 1FC2D 4YK4C 1GYCA 3MBWA 1RPUA 2Q1EA 2I85A 1W91A 4F8OA 5C0IA 3AQXA 2NUTB 2OBGA 4PFEA 5KSAC 1Z9NA 4OCYL 3CFCH 3SE8H 4B53A 4K94C 1LE5B 4RGMC 1MAMH 5D7LA 2J88H 1TO4A 1AYRA 1R3JB 1L9SA 5GGUA 5IM7A 3V4PB 2J73A 1DQDH 2J55A 3WLBA 2ID5A 1U93A 3RWDA 2WJ5A 2Q0ZX 4OCSL 1JZ5A 4EIGB 3GMLB 1E5ZA 3RWGB 2DN7A 2XBDA 1MVUA 3IKCA 1URZA 1AE6L 1L4IA 3DGGB 1LP9A 1IGMH 3A6BL 3BMWA 3QQ4B 4PWFA 1AC6A 1L0XA 4UAOB 1WEJL 1KB9J 1FNGB 4YGVB 4NPYA 4M3HA 1OARL 5HYJA 2XFGB 2X1PA 4WJ5A 1CIDA 1LWRA 3T3PF 4GW1B 3I3BA 4X2UA 4PRNB 4XC1H 2VXUL 2Z34A 3TYGH 4K3EH 2BVUA 2EINB 1HE8A 3KCPA 4LOFA 3DO7B 2BW5A 3IGFA 1CZ8H 1IKFH 1M42A 4WVRA 5EZOH 1HCFX 1TCMA 1L9MA 2G0LA 3E6HA 1JGEB 4L8DB 3TT3H 5B7EA 4LKXA 1ULVA 1CLYH 4CADB 3RWJB 5DMGD 1KC5H 4NWUL 4TOYH 3EYSL 4OAWB 1PNDA 5DO2D 3S5ZA 4KKBD 4ZXBA 1MXDA 1LO2H 1JD9A 5CU5A 3AQZA 3MN8A 4H0GA 4EI5D 5F0LB 3U82B 5IMMA 1VSCA 3LZQA 4B95C 1BMWA 5TE6L 5D7KD 3RY6C 1AQKL 3L7FB 3D08A 4XVTH 3SCMB 4G1MA 5C0AE 3FC8A 3OQ3B 4D0BA 1D3CA 3DURA 2QV4A 2XBZA 2EZ0D 4PMFA 2HWZL 1A9BA 3QNZA 2BS71 2X0WA 3GMMB 3GSWA 2OSXA 5ESQB 2V2XB 3L7EA 3SDXB 3VWKA 3B37A 1K5NB 3FTVA 4NNPL 2J12B 1FZJB 2M26A 2QKIB 4WNQB 3GQFA 1NH6A 5JOFB 1XSOA 3K91A 4NM4H 4PJXE 1PD0A 1LL1A 1WD9A 5F97E 3U2SA 4GFTB 3VI4E 2XN1A 1EXUA 4WHYG 3RVXC 5DD5L 5DRWB 4ZO8A 5E7FA 2VITA 3BVDB 4ODHL 1M3IA 2WJ7A 2BIIA 2QQQA 3ARFC 4PCTA 1A02N 2C1OA 3L9EA 2GK2A 4HIXH 3W9EB 3A21A 4PV1C 1PS3A 1BP3B 4HJUA 5DVMA 1OSPL 3EUUA 5I1DB 3VMNA 4MQ7B 4UANA 1RZJL 1R24A 1NMAH 1FO0L 5FLVA 5ACLA 1F58L 3A6CH 3TBTA 1WFOA 2FAUA 2GBVA 4MD5A 5GGUB 4MCNA 3GD1C 1F90H 1XR9A 2G2RA 1QWNA 1BZ9B 1V3KA 3CQPA 4MNQD 1U93B 1GJWA 3BDXA 3RWDB 3CFKB 3QK0A 4HPOH 4MB4A 1MJ8L 2F53D 2NSMA 4G8IB 3VRJB 1MVUB 4ZI8A 1OF0A 2FECI 4HGWA 4JQXC 4ZD3H 1LP9B 4JO1L 1TSHA 5E5LA 3BMVA 1M7DA 5LBVA 3SKJH 3IDNA 3G9VA 4NPYB 4HOXA 5CCJA 3AG2B 1ACXA 1DQLL 2BZ7A 4WJ5B 4KI5C 4NQTA 1NBCA 4XO9A 1I3VA 2LU7A 5E2UL 5AW3B 2CRMA 2YA2A 3IMRA 4OFYD 2AI0H 4LDOB 3UMNA 1O0VA 5C08E 4LO9A 1AACA 2IOMA 2EDOA 1SY6H 1OGTA 1U4EA 2ZE0A 4PIRF 4QLRA 2X42A 3RAJH 2IXQA 2W88A 5C9KA 3E6HB 4FQIH 4PY8J 1LD9A 4X7CC 4LKXB 2COQA 2UUDH 2AJYH 5AYUL 4K7PH 4O4YL 5MEOB 4YSPA 4HUNB 4NQDD 3ARYA 3BWAA 1MNUL 1Z5HA 3JZYA 2A83A 4OFDA 4R8WH 4JHVA 3DJTA 1GZHC 2NY6C 3GI9H 2WK2A 1G7QA 1C5DB 4HISA 5BXFA 4QRRD 1PLCA 1B3IA 4DETA 1AOZA 1GC1H 2VN5A 4G1MB 4X83A 4OLZH 2NR6D 3N91A 4D0BB 3I9PA 4PJCE 1JNNH 3JVFC 5EFIA 4Y2NA 3SDAD 2CBMA 1I8KA 3OZKA 1QZNA 3QSKB 2WUBH 3T4YB 2X6BA 1CGSL 4MB1A 4ZW8A 3ZSSA 1W8NA 5E1HB 2RB8A 2C9AA 1UXSB 2LV4A 3PWPB 4OD1H 5LB1A 3LS5H 3T5WA 1G7HB 3L4YA 4CMMA 1YA5A 3VVWA 1CQYA 4N2FA 2ZXCA 3HUJE 4N8VA 2R2EA 3ATAA 5MEND 3VGAB 1OTUD 2Z7WA 5BS0E 4EN2A 5TPWL 2X4SA 3PWUB 4W6XB 2AW2A 5AUMB 3TT1L 1O5PA 1RZKC 3ZX1A 4P04A 3DTUB 1OGPA 2OV0A 1HNGA 3G9AB 3K2IA 5EA0L 4FFZA 4BSVA 3UAEA 4HCGA 2LAAA 5EC2A 4MNQA 4RGNC 4IU3B 4U1KA 1R24B 1A3RL 1BFOA 4JZNA 3GM8A 3KS0H 2YJQA 1MFMA 2F53A 3TBTB 3ZYJA 3KHOA 4MD5B 3LZLA 5EU4A 4F93B 4AKQA 1HEHC 1XR9B 1MLBB 4QWWD 1WTLA 3T3PB 1UENA 2A6KA 4YHZL 1KY6A 3U1QA 4JN2A 3MODH 5LBSH 1E7UA 1XGYH 4U1NA 3QFGA 4P57A 4HJGB 5FS5A 3VFGL 1EEUA 4C56A 1M7DB 3IDNB 2V6HA 3IXTA 3FH5A 5CZVH 1AI1H 2PXYD 4NZDA 5JLZB 2H6UA 5DHEA 3QPQC 5ISZA 1SMOA 3QARA 1S7UA 1K5WA 4FQ1L 3UZQA 3MGAA 1VACA 2ILLA 3HB3D 1OP5K 4IBQA 1RQ5A 2HKFL 2YZ8A 1OGTB 4KMTL 5L7XH 4PREB 5FXCH 1I8LA 4GG6B 3GEWB 1Y18A 3T65A 3QFDA 5T3ZL 2IXQB 5I66B 4MLIA 4GKNA 3VXQB 5E1IA 3FFOA 1LD9B 3JVGC 4PP2A 1HQRB 4FXGA 4U1JA 4XN5A 5DC2A 2KI6A 4XCEA 4EI5B 3LEVL 2OTUA 1JP5A 3BH4A 4GQ9L 2HT4C 4UF7C 4QRRA 2AQ2A 1JWMA 2EXYC 3L3IB 3QEHA 2A83B 3FO9A 3NP3A 4NKOA 4RMBA 1G7QB 1FFOB 5BXFB 2RFXA 3ILQC 5IGXH 3H9SE 4G9DB 4XNXH 1T1YA 4TQHA 3QUXC 1OCWH 1OT4A 3BFOA 3RILA 4BWTA 4OQ1A 5BUPA 2DJUA 2OL3L 4XWOC 2ZAHA 4O2CA 3ZOAA 1BM3L 2Z7YA 4LSQL 4TL4A 2ED8A 3NJGA 2NT0A 1ZTMA 3DDFA 2VL4A 3VO0A 5CLZA 4DT2A 2X28A 4WK0B 3AQYA 4UQDA 3FQ2A 4LPCA 2Z1KA 3V6OA 4LDLB 4XNBA 4CMMB 4XWGH 4HCIA 2XFXA 3FQNA 3QHTC 5C09A 1Z3GL 2XY2A 2ZP0T 2R2EB 5EG6C 1EH9A 3FONA 4K9EH 3CWGA 4JKWA 3NFPB 3FUHA 2H47C 3VFOB 3REVA 2OW7A 4Z3JA 2YRPA 3HZVA 4PJDF 2GSIB 5AENA 1CXKA 1FE8L 2SEBA 5B8CA 2ENSA 2K8MA 4R0LC 5EC2B 3QR1A 4UYPA 2BHZA 4MNQB 4NQEA 2ZOWA 5C1MB 1BFOB 4JZNB 3U9PH 2X2HA 5CP3H 5F93C 3DV4A 1IGFH 2F53B 2IPKB 2JLPA 2EDYA 3HMXL 3EYOB 5EU4B 1KULA 4U6TA 4KUZL 4UZUA 4TPRH 1QI4A 2AGJL 4JN1H 2EH7L 2A6KB 3BJLA 1F5WA 2PXYA 4YPGA 5MI0B 4JKMA 4P57B 3CNKA 4MNGA 2FUTA 3IEAA 3QJRB 1UM5H 3CXDH 3WFHA 3IXTB 3TPUA 2WUCH 1JK8A 3L3GA 3MUHL 4WF7A 1TJIH 2GTWB 1S9VA 6FABH 2JB6B 3RIAK 4OCRH 5IESL 1IGIH 3O11B 3PWLA 3GJEB 3AXHA 3EXLA 2VDLB 4H2CA 3UJJL 1VACB 4H20L 4M5YH 3F64A 3WS3A 2ARWA 1M2OA 3ELQA 4XI5C 3EADA 5FKAA 3T4AB 4ZMLA 2G5UA 4FG2A 4QXUL 2WZ5A 1UWEH 4HKXB 2M1KA 4G6JH 3T65B 1DCEA 1E65A 1CT8A 1FN4A 3QFDB 5IG7B 4JY4B 4P9MH 4WFFE 3FUJA 2HUHA 4NQDB 2HT2C 1PYWB 1GOGA 2KT6A 4GKNB 1SXSA 4OCNC 2CWRA 4PP2B 1D9KA 4XCEB 2OTUB 4LSRL 2RTTA 1PF3A 4L0ZA 5HVFB 4QRRB 5I6OA 2H1PH 4ZS6D 3KPMA 2YPVL 1NMCC 1JWMB 1NOFA 3QEHB 2E9GA 4YHOH 5IB4A 2GITB 1NIDA 3SDAB 2UX6A 1G9NH 3OC5A 4OJEH 1MCPH 2RFXB 2VUKA 3CLEH 5I71B 4JJOA 3RIFK 1CFSA 3HNTH 5I6XC 3U4EA 3PJLA 5FA4A 4ONGH 4BK5C 1XSJA 3BD5A 4TL5A 3RWCB 5B1KA 3GTNA 2DYPA 1ADQA 3HE6C 4O2CB 4XN2A 4B50A 3FN9A 2WXGA 3KW8A 2K78A 2R1XB 4HHWA 4Q9CA 5MENB 1OAJA 2OR8A 1OE3A 4EOWH 2WLIB 3V0WH 3NCCB 1O7DC 4PJDA 4HS8L 2YWZA 2ETWA 2XFXB 3FQNB 2QV2A 2ZOOA 1XX9C 5C09B 5EOCJ 3BSZA 3JV4A 1CK0L 1W6LA 3H1ZA 3FONB 2VIRB 2J8OA 3NIFB 2PCYA 3AU0A 4BINA 3K2MC 4H1LA 1F41A 5TF1L 4LQ1A 3TEWA 4OLWH 3MRDA 3DJ9A 3HI6L 3HZVB 4FXTA 2GC7C 4YSUA 2SEBB 5B8CB 3DARA 2QQNL 1DANU 2R0ZL 1BVOA 3TU6A 3VG0H 2WTRB 4NQEB 5FIEA 2B2XH 3QR2A 4Q14A 4YDIH 1GA2A 1C7SA 5EZIL 5TQ0H 2NY7H 4ODXB 1JBJA 3QIWA 3TN0D 2GW5A 1BJ1H 2PETA 3OAYH 4DNLA 3C6LD 4N0RA 3JWOL 2DQ6A 4Q2ZA 1T89C 2EUZA 2YK1L 4NSKB 2PXYB 3CHQA 3GB7A 3IDIA 2DH3A 1N4XL 5FYLH 1QBLL 1QEXA 3WS6C 4MNGB 3HFFA 2YOCA 3DX2A 5K9KA 4R83A 1MW1A 1MAKA 2QELA 3HB3B 4IOIA 3WFHB 3TPUB 1CFBA 4H13C 3L3GB 3EJYD 2W9EL 4JRWA 2FRGP 3P73A 4HIEA 4RWYH 3UO8B 3ZHLA 1KCUL 3RJDA 3X3GL 3VXRA 3WS3B 1PZ2A 5KSAA 5E4OA 5FKAB 3X2QB 2Y5QA 2ADFL 1DYZA 2HUEA 4G9FD 3KPNA 5D7JD 2YKLL 1OPOA 3JSSA 1CT8B 2YEZA 4YGAB 4OZFH 3VQ2C 4OCXL 5HYSA 3WLWD 1NCDL 1NIFA 3ME0B 2EDJA 3VFMA 4GSQA 2P3YA 4CVZA 1YEJL 1XBDA 3LB6C 1IILE 1KJVA 1F0LA 1YNLH 3G3LA 1E5CA 1FYTD 1E67A 3KPMB 2F19H 5E5UB 3GKWH 3ZR5A 4GRLD 3VGFA 4YDNA 1XT5A 5CJXA 4X50A 4JO2H 2P5WD 3AVEA 2O5YL 2YC1A 3QHZH 3MV8D 4EI6B 1F2QA 3MGTA 3U4EB 2FO8A 3UTZA 3IJHB 5FA4B 5E8DL 2FECL 2EYTA 3LEYH 2BP5M 1OTTD 2DMCA 5DLML 2Q2LA 43CAA 1PIGA 5I1CH 2J4WH 4LB8A 5D5MF 2YS4A 3ARQA 3WIHA 2GJJA 2QQKL 1RIHL 1RK7A 1FI8C 1QWUA 4LSVH 5GZOC 5CF3A 3GFUA 3G5YA 3CLWA 3KPSA 1LVEA 2QGEA 1YEIL 1FDLL 4KJWC 4HJIA 1I1YA 4YXLH 1KGIA 1X7QA 4H1LB 4ETQA 3OLDA 1P5UB 4HZ1A 3MRDB 3AWEA 1TUPA 1RLWA 1U95A 4PGEA 2QTEA 3WUWA 2NY6D 3V0JA 4RSVA 3NSJA 3TN0A 1YEEH 4MCZB 3OMIB 3C6LA 2OJZL 4ELMA 4FADA 4KNSA 4ZPTB 4A2GA 3ULUD 5E6RB 3KPLA 3A4AA 2IADA 1BQHB 4XZUA 3ZKMD 1J8HE 5I5JA 3QIWB 2DRUA 4LLAA 1FZMA 4CVUA 1G0XA 1D6VH 2Z4QA 4Q2ZB 4N4YB 3LS4H 2ZONA 3IDIB 3GB7B 3D0LB 2BWQA 3FB6A 5FUOL 4OJFL 5LN4A 3WTXA 5K9KB 5F88A 4BFIA 3PXJA 3TNMA 2WWMD 4ZAKD 4NLHA 4CMHB 3ELAT 5C8JB 1I9JL 1GYWA 3ARFA 2CRZA 4IOIB 2X1QA 4AITA 4IS6B 3RIKA 2JXMB 1CFQA 4X7SL 3P73B 5IMKB 4HIEB 3TNNA 4G9FA 4DOHE 3TJEH 2VZUA 2KZKA 2X4NA 3S96A 4QJ3B 2RH0A 1A4BA 4OFIA 1CICC 1DANT 1BM7A 1QWHA 5DK3A 4Y5XA 2H4EA 3CZJA 3PPEA 1JWUA 2HTLC 2DQGH 3X12B 4RGMB 4R97C 2AAAA 2E9BA 2ZCHH 3MMEA 1PAMA 2CLRB 2PUQT 1JPTH 3F5WA 4FFZH 3KYMA 4NNYB 2EXWD 4NZTH 5EO1B 5HGDA 3WEOA 5EBWA 2YEZB 1EXHA 5F7LB 4PVLA 5KVDE 4NEHB 1K4DA 4GRLA 3SO5A 1ECYA 3VFMB 4JQXA 4N0UE 4YBLB 2WP3T 1TZ8A 4OQTL 1WBXA 4BFKA 4E9WA 2KKQA 3WBDA 3QXTA 4W9EC 4BDVA 3FBKA 1EVTC 1NBVH 4B0MB 1AIZA 2ITDA 4P9HH 3GMOB 4WEBL 4ZO7A 5D5MA 2DJMA 2YD4A 2YC1B 2XPZA 3INOA 3ZY7A 3V52L 3UTSE 1KCWA 1NUNB 3IS1X 5JXEC 2EIBA 3MGTB 2CA4A 1BAFH 1BVLB 1RULH 4FCAA 3OJVC 4BA0A 3WY4A 5TQ2L 5FHAL 4WNSA 1OP9A 5ICYA 5I2IA 2N1TE 6PAZA 2WVVB 3CDZA 4XB8A 4QXGH 4YDJA 5JQ6H 3M88A 2XWCA 5CN1A 2WTPA 3IE4A 3X14B 1DQJB 3HHRB 4PCKA 4ZUUB 5JO5A 4B9ZA 3G5YB 3NJIA 4U0QB 4IDJL 4YOKA 1X6LA 2E7LC 5JXAL 1AS6A 3I6KA 1BMZA 1GZHA 4HSAC 1H8NA 3LZPA 1E2ZA 4GQZA 4MB5A 4PH8A 3SGKC 2OI9B 3MNZA 4ETQB 1CE1L 4XAKD 3ZE2F 3ZKXC 3WUWB 3FMGL 2C3XA 1INEH 1TMQA 4K8RL 4FQLL 4KV5E 4YHMH 3V95A 2EDBA 3TN0B 3OKDB 3C6LB 1F18A 4GKZA 3S2CA 1GRWA 3LSOA 3KPLB 2A73A 2IADB 4XZUB 3WAJA 1XZWA 2GIYA 2WNWA 5E8OA 3QUXD 1F4WH 1FZMB 3DC0A 2X40A 2Y3AA 3IU4H 1J5OL 5FV1L 2VMJA 5H4YA 3G5ZB 4P5RA 4JG5A 2AV7A 1QW9A 5BJTA 1S7RB 3N3EA 1OQOA 1N2RA 3BVTA 1JGDB 5E8EA 3ABGA 2ZCLH 5F88B 4BFIB 4GRWE 2CCWA 5JUEH 5L4IA 3AU1A 3SYCA 2EICA 3FT3A 3KPOA 4KPHL 3KXFA 3MVSA 3HG1D 1J1PH 2EDQA 4Y5VC 1ZVHA 5AKTA 2KLRA 4G9FB 4MXVF 2L7UA 3E9UA 5D7JB 1NCBH 5T5FA 4DGIH 3U4BH 2HPOA 3H55A 1YVLA 4Y5XB 4GAYA 1BIHA 1DN2A 5E2TL 5HDRA 1JWUB 4DFHA 2DMGA 2XWBB 5DUBB 1GGIL 4E9SA 2W95A 1JZFA 3F5WB 3QXVA 5HGDB 1Y0LA 3IXAA 5EBWB 3K5SA 1FYTB 3KPPA 4M3KB 1MCKA 1V5JA 4KX8A 5T3ZE 4DN4L 5FX3A 1CD1A 1HZHL 2VSKB 4GRLB 5H37H 2X1OA 1AJ7H 2BSDA 1R3IH 4JRXE 1QSZA 1RZFH 4MMZA 2P5WB 3HG2A 2XN0A 5TDPB 1U8MB 2E8ZA 3MV8B 1JZ2A 3RWIA 3LMJL 5DD6B 4UQCA 4BDVB 4N87A 4JFHE 3ZU8A 5DJZA 4BXSV 5D5MB 3S9DB 1UVQA 1DEEA 3NFSL 4BJLA 4D9QD 3BHBA 3EFFB 2I60L 1HDMA 2WC7A 4XNDA 4XP9L 2IV9A 3LH2L 1VFAB 4LCCB 3L9BA 1CYWA 1EFXD 1PZSA 3INUH 3BAWA 4HETA 2Y7LA 2FT8A 3L4VA 3GS7A 5AVYB 3V0FA 2LLNA 5I2IB 3C8DA 3QUYD 4L23A 1ZLWK 4AUYA 2V17L 2XV3A 3MCG1 1ID5I 3CDZB 3ZQ9A 3JWNG 5IY5B 4XMWA 5HD8D 1UJ3C 2R1YA 5EEVA 5K5YA 4C4KO 5JO5B 3T6WA 3Q48A 3SYQA 4ERSH 1T1XA 4L4VE 3I6KB 3OB0H 2Y1AA 5J8OA 2NY6B 4RBPK 4DPCX 1NCCH 3MNZB 3V7AE 5CEZL 1MCRA 4F27A 4Z77A 2Z0BA 4NKIH 4BIKA 4X6DF 1NGYA 3QUXA 4MDJA 4FJZA 1SM3H 4K3HA 4Y4KC 4W9HC 2IDSA 4ADGA 4GKZB 3VFRA 3ZT7A 4LOUC 4U1LA 1MWOA 3LSOB 4P3CH 3S4SA 3J07A 5FGSA 1LO4L 4I1NB 5AOLA 3RPKA 2NCEA 2ZSWA 1PTZA 2WZ0A 5KN5A 1ED3A 4LSPH 2HVKA 1J0IA 3FTZA 4ZAKB 4ISVA 2OCCB 3N5AA 4M5ZL 2CKBL 4U3SA 3T8VA 2AV7B 4WI5A 4HVBA 4Z7NE 1CD9B 2IH9A 5CNHA 1N2RB 1LILA 2Q20A 5E8EB 4XP5L 4I87A 4Z0BH 1NDGB 3MRFB 1B4JH 1I53A 4GXFA 5D2NE 4YVUA 3AU1B 3APCA 4OFQA 5E99H 1GGYA 3FT3B 3DPBA 5CBEA 5EZJA 1QPPA 3RGVD 1DQMH 1IKNA 2BFGA 1TVHA 4KKPA 5C2BL 5IVZB 3PGDA 3BAKA 4M03A 2V9TA 4UU9A 4GBXD 3QG7L 3UYOD 1IMHC 3WDHA 4Q9RH 2WMPB 2XSKA 4GMSH 2GQHA 1U8CA 3BT2L 5C0DA 3MO1B 4HG4K 1Q9KA 1Y0LB 3IXAB 1IKOP 1T7YA 1NFIA 1NIEA 1RL1A 1OCCB 3VGBA 1OHZA 3LQAC 1UHVA 4EZKA 1S7VA 4GI6A 5F7UA 3AABA 1S9YB 3H53A 5EULV 4MMZB 3KLLA 1FGVH 1F97A 4OJCA 3WO4C 1M3JA 5AVUB 3RWIB 4ADJA 5EEWA 1YJDL 3IGLA 1V05A 3S36X 3N0AA 4UV4L 3P30L 2BNUB 5DJZB 2C4FU 3IPFA 1UVQB 1DEEB 4KFZC 2AQ3A 3D06A 4IHOA 1KACB 4LBEB 2NQ3A 2YO3A 4NFDA 3BHBB 4Z7WE 4OGXH 1MXGA 2EEXA 3ASWA 3MKKA 1THAA 3GSRA 3APFA 3ECWA 1QKZH 4XRCA 5FCUL 4KQ0A 1CTNA 5HDBB 2G2PA 2ALWA 3WIAA 1GIGL 3X1EA 1AR2A 3NZHH 4HFUH 3GWJA 5ALCH 4K94H 3WN5C 2OTWB 2QSCH 4PS7A 3DSFH 3QYCA 5CGTA 3ZE2B 5E2VL 3UTOA 5B38B 2JJTC 4X6DA 3MV01 4WFHE 1NCTA 1G6RA 2CO4A 4OGYH 1T1XB 4LASH 2EIKB 5I5RA 5K59E 1CUOA 2D0FA 2FBJH 5LXGH 4WGKA 1L3NA 3FS9A 3AT8A 2WO2B 1OGAA 2MQGA 3NP4A 3QQDA 1YPZB 2YR3A 4M9OA 3QUXB 3DUHA 4NO3A 1KN4H 5CAYB 1DBAH 2YD8A 4KY1H 4LPYA 3AFLA 3HE6A 4PS4H 3IDGB 3VFRB 1CFNA 4OV6F 1E2VA 3KYOA 2ZSWB 1IT9H 3MLUL 5DZLA 4Y9CA 4L29A 1ED3B 1JN6A 4FF9A 1WQVT 4KC3B 4M62L 1ZLVH 2HVKB 5HDQH 3IVKA 2HZHA 3N41F 1YAIA 4L4TE 1YUKB 4U3SB 5A3IC 5ADPL 2FCBA 4L37A 5SV3A 1B0GA 2H3NA 4YFDB 1QW8A 3HG1B 5F0PB 3S48A 3E8UL 1Z6JT 4NUPA 5F96L 4A7GF 1BPVA 2BFVL 4X7FC 3HW7A 5I1IH 4P06A 5LWYL 2HVJA 1IL1A 3DPBB 2XA8L 2EIJB 4GBXA 5EZPA 1SDDB 5EZJB 3VGGA 4N5ED 5AEAA 3T8XA 2A0LD 3JWDL 4FZEH 4DAGL 1A7NH 4L1TA 4FFWC 1UURA 5CJOL 3PGDB 2ZQKA 4UU9B 25C8H 3PWNB 2EVJA 4NBXB 5C0DB 1Q9KB 3DECA 4LZKA 4OBSA 4MQTB 5DD3H 3WNNA 3CFBA 1R0AH 2YD2A 2YARA 3UBGA 5IQNA 2ARJQ 1PJ9A 3HVDA 3PP4L 4YHKL 4FFYA 1JXFA 4JPVH 3WS6A 4DESA 4UTAL 2XWXA 1WVZA 1ZE3C 5IBTH 1MOEA 1DL7H 2WBXA 3DI2B 3U0WH 2JCCB 5AB2A 1H0DA 1KWKA 4B9FA 1EFXB 4S1RH 4M61A 4IHOB 5H2BB 2P7TA 3LKOA 2BS9A 3DGCR 1CVSC 3QDHA 2ED6A 3GSRB 2D2OA 3QUYB 2D03L 3EGDA 4K2UL 4XRCB 1NWOA 4JZJA 2E9JA 4NZFA 1H3VA 1AFVL 5CKGA 5DHVB 1GMEA 1XGZA 3H54A 4MTMA 4PRAA 3BSHA 2IH3A 2H3XC 3N1GC 4B60A 4ZFOL 3LKRA 4NQCE 4P2OC 3EJTA 1IC1A 1JERA 4PGDA 1W15A 4WY7H 4X6DB 3L4ZA 5KUMA 4O02B 2CO2A 2CLZB 4MA1C 4OF3A 1PL3A 4WI9A 3EH3B 3ETBJ 2P8LA 2BC4A 4Y9GA 3H3PH 12E8L 5B1AB 2C4FT 2CHXA 2RD0A 3CFJB 3QQ3A 5T1MA 1EV2E 3B9EA 3QQDB 1JZGA 4NAQA 1BD2D 4J28A 1CR9H 4NO3B 3MUY1 2QPUA 4NUJB 2MQ0A 4X7EC 1CFNB 2A9MH 1OAUL 4QCIA 2CO6A 1DVFC 4A7GA 3QIUD 1NLDL 4L29B 5D7HA 1JN6B 2CBPA 1EANA 2VLJD 3P77A 5BZDB 3BKMH 4HQQH 1QAWA 5JR1H 3LPGA 2H9GA 1JHLH 2X4PA 3O81A 4W4OA 4L37B 1SOQA 1E4HA 3HPLA 4RGOL 4L2YA 4XO3A 1AS7A 3RB5A 3ZGIA 1KEML 3RGVB 2VZVA 1F4HA 5C0AA 3HMWL 1Q72H 2C34A 2P4AB 1OANA 4OZHF 4Z7UE 4M7ZB 4ZNEA 4EE2A 1WAEA 4ZUVA 2HVJB 1IL1B 4OLXL 4PP1C 3VRIB 1G7LA 4GBXB 4CSZA 3UC0L 2ZKMX 4QRQB 3L4TA 3T8XB 1RZJC 1F86A 5T5NG 2R0KL 2CH8A 3GIVA 2YGNA 3N1PC 4BZ1L 4Y19E 2FJHA 1G84A 4PJXA 1TETL 4HXAL 1JVKA 5FGCE 3CFTA 4O51A 3E6FA 2Q86A 4PJCF 3CFUA 3MJGX 4P07A 2VDQB 3SPIA 5IHLB 3MXWH 2EDNA 5I73B 1TQUA 3VXMD 3WXVL 3KBFA 3O3AA 1TNNA 2M83A 3LD8B 3BI9X 4TNFA 3BJ91 1S9KC 5LVEA 2JMRA 4LEOB 1N10A 4XT1C 3Q9PA 1PAZA 2BERA 3IMVA 2A99A 4Y0GA 3LQMA 3HUJF 1SOSA 3WENA 3HR6A 3QT2A 2FE0A 4OLUH 2VJ0A 5IJVA 1H0DB 4X9HA 4CRPA 3J7HA 4M61B 3RP1A 1KGCE 3I9GH 3PHOB 2P7TB 4ANUA 3LKOB 1RZKH 4IBSA 4N8CH 5D1QE 3P02A 2NY2C 3EGDB 4JZJB 4X4ME 1TT6A 1CFMA 1ZHNB 3GSNA 2OZ4A 5CN2A 2CQVA 2W9DH 5T5FH 2IH3B 4W68A 1BIIA 4M6OH 2O5ZH 4PRPD 3OHMB 2DDQL 4OW6A 2JB5L 2OTPA 5DTFA 1AR1D 1L6ZA 2VXVH 2J6EA 1ETA1 3DA0A 4PGDB 3FU9A 4TMPA 3ASOB 3M1OA 4ZOAA 5I74C 4YSCA 1O6SA 5LO7A 2AZAA 1UB5A 4IRSD 4FNLL 4YO0A 5C08A 2HRPL 4EUPG 4JB9H 2NX5D 1MWAA 5TH2B 5BO0D 4CW1A 3QRLA 3MR9A 3QDJE 4BZ2A 3VXPA 1NCAL 2I9LA 2KYIA 3NCMA 5DDHB 1PG7H 5T1MB 4AEIL 4KRMB 2ZSVB 3C08H 4LHUD 2HJKA 2XX0A 3N41B 1QEWA 4GP8B 5GHWL 2KZBA 3T09A 3QIUA 3JTTA 4HMEA 2K6WA 4ZW7A 2A4EA 5M94B 1ZHKA 4XXWC 4G71B 5ANME 3GHBL 1U8JB 2CO6B 2BJML 2VDPH 1IAMA 3FU6A 4OZHA 1B90A 4X5RA 1T7VA 3HZYA 3P77B 1T6VN 3L9YA 2GHWB 1M9SA 2H9GB 2V8LA 2X4PB 1EJ6A 1QFUL 2OXGA 4P2RD 4HJJH 4OIIL 3HPLB 3AY4C 2E7LA 3S8WA 1NZRA 3CZSA 2X1WL 4JBSA 1JPSH 3SGKA 1COBA 2IBZY 2ZYHA 5E4EC 2NNCA 4PJCA 3CN0A 1IBHA 4ZUVB 5CSBA 1XF3A 1YEWA 5KG9A 3X3FH 3AQDA 4AXWA 4OD3L 4TUOA 4JREB 3GIVB 2K7PA 1HWHB 1VZGA 1MFVA 3BWUF 2VLME 2DMKA 3D69A 3LXCA 2EDMA 1U3HD 3L95A 1KN2H 2JWYA 1F2XK 1ZHLA 1I1AC 3HUJA 1UCBH 1R5WA 5JHDE 4HHAA 4F7CA 5JDSB 5ITBL 4E2OA 2K1MA 2VXQA 3QXWA 1IC5L 1R19A 3LKSA 3V6FA 1QTPA 1ZKAA 3ARXA 2YQBA 3EJPA 3MKGA 3S36L 5DMKA 2B1OA 1YHPA 3FQWA 4LCIH 1AXTL 4Y5VA 3MCLL 5E1QA 4OZIF 2MNJB 2XI9A 4XMZA 5IJVB 2R0WL 3CDYA 3KGTA 2W92A 4GKOA 3OSKA 1OSZB 3MRRA 1A6TB 1ZLSH 3EYUH 5A2FA 4Z3FA 2GABA 4FLHA 4B9KC 2FEDD 2F54D 1IIKA 3WFDH 4LGSB 3ZMRA 5GGTL 1QLRA 1WZKA 3CVIL 4W4NA 3I02B 1NFDE 3GSNB 1DSFL 4K5NA 5C71A 3JZ7A 1X5JA 4BM7A 3VFPA 5BO1H 1OCOB 1TZHA 2WXIA 3B43A 4L1BA 4J3TA 4F58H 2DQHL 4FXKC 4IRSA 3ZK0A 4ZTOH 2NYKA 3NJXA 4TVPH 1FFRA 3JWNC 5MERA 1O6SB 4WHTA 5IP4A 1HINH 1UB5B 4YO0B 1BD2B 3P3TA 2KZWA 4UOW1 1Z66A 1MWAB 5KVMC 4CW1B 3BAEL 3MR9B 2BWDA 2D0GA 1IGCL 3FYEB 5A1AA 2WAQA 3IJSA 2BHUA 2XVLA 4EO5A 1QEWB 3QIUB 3JTTB 1LMKA 2LU3A 3MV9D 3QJSB 1VGKA 2VLJB 3O6ML 4P49A 1UWYA 4YBQD 4YLCA 3MRPA 1EGJA 1YAZA 3WHE0 4OZHB 5HYEA 4I13B 1AZVA 3HZYB 4G5ZL 3M8OH 1OPGL 1UJ3A 3CHOA 2Q8BL 2OXGB 1QFWM 2R29L 1JNJA 4APQC 3QWRD 1QQDB 3TIDB 4DCQB 1E3FA 1DFBH 3W82A 4AGMA 4L5FH 5D6CA 3T2PA 3DVNB 4GMTH 3IYLW 2ATAA 1SXAA 1G6RH 2OK0L 1JZ3A 3OLIA 2FX7H 4TKWA 1A7OL 1RJLA 3P3UA 4R5TA 2PPEA 1BG9A 3AS0A 4JANA 4JO4H 4XPFH 4AXWB 2QHRH 3WTVA 3DX6B 1BYNA 4KQ4H 4Q6KA 2F0CA 4N1HB 4AQZA 3VXMB 1MZYA 2MCG1 5IB3A 5C0CE 3C8HA 3D69B 4XVJL 3L95B 3EH5B 4TQPA 2XWZA 3V0EA 1P1ZA 3KJ6H 2JNZA 1ZHLB 4F2EA 4KO9A 3KL3A 3F01A 1R5WB 1G4MA 2X9ZA 4HHAB 3Q01A 1KIQA 3L9RB 4OZIA 2QGDA 2NUPA 3LKSB 2N3JA 4QF1B 3V6FB 5JA9A 3EUDA 5D2NC 2CMRL 4BRJA 2WXOA 2EDKA 2QPDB 2Y6SC 1UA6H 3DWTA 3DSNA 1KBWA 2H0PA 5DMKB 5EU5B 2E47A 3NEOA 1CLCA 3T2QA 4F91B 4HDIA 3QUZC 1QNZH 4N0YH 3GO1H 5CZXC 4OGZA 2CZNA 5GS2H 2NZ1A 4Z3IA 2XKNA 3MI6A 2ADIA 4WFEE 2UZIL 3DI3B 3MRRB 4P59L 3KVPA 2ENPA 2QFPA 3H2QA 4PRPB 4Y1TA 1AR1B 4MJ6A 1QLRB 2WCGA 3HC4H 1SJHB 1O75A 2ZUQC 1JRHI 4LVOB 4UUJB 3W9DA 3BUTA 2Y36L 5J0BA 3QPXH 2CJTA 3VFPB 1E42A 2CE6A 4Z7QE 2OKMA 2OMWA 5E9DE 5LDSA 3BXNB 4IRSB 1KFAL 3IK2A 1B2YA 2WQSA 3KL0A 5TFSH 2NX5B 2XKSA 2GUYA 3VM7A 1OY3B 2MQ3A 4YAQA 5ACZA 5C0BD 3MUZ1 3SQBB 2Y2TA 2YQ2A 1T3FA 2OXHB 3AB0C 5AZ2L 1KV7A 4WHTB 4LHUB 2ZAGA 4WV1C 4FFYH 1JV5A 4PD4K 3MV9A 2W0PA 1P9MC 1WRFA 1HI6A 2OX5B 5IHWA 4JFWA 1D5ZB 3CFEA 2FB4H 3OGCA 3QHFH 4QOKD 4KGLA 4XNYH 3IRCA 3MLXL 3CZEA 4LSUH 3ZDZE 5ES4B 4XBEH 2DQFA 1EFQA 3F65A 2FBRA 2ZXWB 1VGKB 2X5PA 3GZQA 5DEGA 2AKRB 1WA0X 1XIWC 2UZXA 3VMOA 4OV5B 4LVHC 2DM4A 4D7PA 3QR0A 3MRPB 2AK1L 4P2RB 3WN5A 4K3DL 2G60H 2HB0A 2LLGA 4Q9QH 3QVAA 4FI6A 4QTIH 1ZS8B 1A0QL 2JJTA 3FU0A 4C54A 3X11A 4HWNA 3NYKA 1KLUB 2G9HA 2OLDA 1QLEH 2VZSA 2Q3ZA 3I85A 4OTXH 1MG2C 5JHMA 5D1XC 4G72B 5F71A 1KIUA 3P4NA 4PIBA 4AM0A 2X89D 4KKRA 1SYSA 2JKTM 4U7SA 4E41E 5JPMB 3QDGE 4Y2DC 2Z0UA 3MC0A 3SDCC 1U41A 1U3HB 3SKMA 1RJLB 4C83A 4K4KA 2Z7ZA 1I7ZB 3N9GH 1WYJA 3RZWA 1NJ9B 2DM2A 1ZSDA 4U7MA 4HUCA 3UTTE 1KJ3H 2B3IA 1Z32X 2H6OA 3FSZA 3R1GH 5FO8A 1P1ZB 3UYRL 1WICA 1EIBA 3JWOC 4AIEA 4H5SA 4QHUA 3MLTB 3PP3K 2D2CC 4TNGA 5L6YH 4OZIB 4LK4A 2NUPB 1FF5A 2FWLB 3ZYOA 5AB0A 3U0PA 1Z9SB 3PAYA 1ZVSA 3LPWA 3RX9A 3SKNA 3DSNB 2Z92A 3L3DA 4DH2A 5C3IA 2GJ6D 4OU3A 3RDTD 2RCSH 2APXA 1KXQA 4HDIB 2OQJB 1QSFE 5AAPA 1MFNA 1QRNE 2EDHA 4WHYH 2F54B 1Y1DA 5BPPA 3CHXA 4KX7A 1F4YL 2XKNB 4XN7A 3TA3D 5CCHE 2XTJE 3NA9L 5AW6B 2NW2A 2V5YA 4LARL 2EIMB 2QT6A 4MJ6B 3KGRA 1GGBL 3R0NA 4M1GL 1NPNA 3P0VL 4FLQA 4KH9A 4QAMB 2HLFC 2ZYIA 4LMQI 4GS7B 1K2DB 3V5HB 4ZMPA 1TKWB 5C7XH 5KYNA 5A2JH 3E1F1 4YAQB 1OD9A 2EO9A 4U1SA 3QIBD 2IH1A 1T3FB 5AVQB 2E27L 3RA7H 3D39D 4XODA 4CGTA 1JVLA 3EBIA 4AMXA 1T0MA 1WE5A 1RZ8A 1C1EH 4F37K 2P26A 2WIIA 3MV9B 4QGYA 5IMLA 1HI6B 2ZOLA 2ZNXA 1ESOA 4HA1A 1JGLH 3KDPB 1J5HA 3CFEB 1KENL 5GPRA 3OGCB 2FJUB 3D0AA 4WLCA 1TQBC 2DQFB 1LMIA 1MCOH 4PY7A 2Y6TE 5DEGB 3OR6A 4QHMA 5LQBL 1I3RA 2ZCZA 1VB9A 4MXWH 4BHUI 4NC1E 3V4PL 1JNLL 4PWKA 3BP5A 5GZND 3WN5B 4LLWA 2YN5A 3G6DL 1HIML 3NTCL 4P2OA 2X12A 4JS7A 2QHLA 1KYFA 5CZKA 5MEQA 1E6JL 4YQXL 4DPAX 3MSPA 1ZT7A 3QCTH 2V4LA 4GRMA 2XHNA 2Y2YA 4WO4C 2XIDA 2UXTA 5BUGA 3O4OC 5SWQA 5A7BA 5CBAB 5KBDA 1KIUB 3P4NB 3I2CL 2DB8A 4LLYA 2R23B 4XPGL 3WFCL 4AM0B 5BMFH 4GOSA 1AKJD 2WQAA 5DJ0A 3B83A 1AZCA 1DVYA 2F8OA 2NYYD 3SKMB 5AZEL 2EEBA 3ZE1E 2F7IA 3IS0X 4C83B 4D9LL 1Q1PA 4PLOB 3WSQH 4BZ2H 1DJYA 1ZSDB 3ARDC 4QLWA 1LO0L 3BPOC 2PWHA 5GGVL 5KBPA 4BD4A 4HC1H 5FO8B 2FATL 1H15B 2DQCL 3P4MA 2RQ8A 1MHPL 1PQZA 5K9QI 3F7LA 2GJ6A 3VFUA 3SE9L 4ZDHB 3U0PB 2W0KA 1V7ML 1ZVSB 3LNHA 5ESAA 4JAMA 3NK3A 1MCJA 2DLGA 2F8VA 3EBAA 3L3DB 4X9GA 1WCBB 3KL5A 1ZJBA 5HHXL 3TA3A 2NY4D 4APXA 5AG9A 5SWZD 4QT5B 1RHFA 1S9WA 4K23H 4F92B 2XTSA 4HP5A 4NUGL 1MY7A 1W0VB 4CU6A 4J3BA 4LE8A 3I9IA 5F9WC 3U6XA 4NN7C 1J8HA 1FO0A 1F1AA 5I1LA 5EOCH 4BWUA 3GSXA 3NCWA 4MJHA 4F57H 3CQFA 4K7FA 4MNHA 1TTBA 3WL9B 1QI3A 4HOWA 2DYSB 2MKWA 5DUPH 5C0BB 4V1DE 3QIBA 5HI4C