2GC4C

Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, electron transport
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
total genus 25
structure length 105
sequence length 105
chains with identical sequence G, K, O
ec nomenclature
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2gc4C00
4YSCA 4Q8BA 1SDDB 4G7QB 1UATA 2BZ7A 3OM3B 1IBYA 2MTAA 2XV0A 4F2EA 4KOCA 4JHVA 1BQ5A 1KBWA 3PAZA 3PAUA 5I5JA 1FA4A 3PPSA 2GBAA 5B1KA 4E9QA 2YAEA 2HLEB 2IDFA 3PLYA 5TK2A 4HHWA 3TA4D 2HX7A 3QPKA 3KW7A 5I6PA 1OE3A 1KYAA 1AIZA 2Y69B 1KBVA 3C75A 2FQGA 2YAMA 5D4HA 3WNJA 1ASOA 4YSOA 2Q5BA 4G71B 7PAZA 1IKOP 3S3CB 4GP8B 2BWIA 3WKQA 3PAVA 1J5CA 3NJKA 4HCIA 1L9SA 2XV3A 2FJSA 4Q89A 1V10A 1SF5A 2XV2A 1RKRA 1N68A 1J9RA 2AVFA 2P80A 4DP1X 2N0MA 1VLXA 4YVUA 1NIBA 1NIAA 2EIMB 3CDZB 5B1JC 2B3IA 4HALA 1AZUA 5I5IA 2XX0A 3T6XA 2BO0A 3H4HA 4HHGA 2FQEA 1ZIAA 1OOWA 4YSEA 1HAUA 2RACA 2FT8A 1SHWA 1TEFA 1L9QA 3FS9A 4HZ1A 3BQVA 2PPDA 1NPJA 1AOZA 1M57B 1NDTA 3IEAA 3BVDB 4E9YA 4N8UA 5I26A 3EF4A 5PAZA 2BP0B 1RZQA 3FT0A 3T6ZA 1OF0A 2DWTA 3AW5A 3OD3A 3ZIYA 4GP5B 3AY2A 1HAWA 1AG6A 3ZBMA 2GI0A 3X1GA 3FSZA 1TU2A 1GY2A 2Y1AA 3DKHA 1SDDA 3QJTB 4JKNA 2VN3A 3EH3B 3ZX1A 2A3TA 2BWDA 1ASQA 2DV6A 4UF7C 4M4RB 1OE2A 3N2JA 1ILUA 1PF3A 4GYBA 3X2QB 4DP8X 2GC4C 2UXTA 3S3DB 2YAFA 4YSAA 2AZAA 2J55A 4F2FA 3FYEB 2HX9A 3ABKB 2JFCA 5D4IA 2OJ1A 1GS8A 3JT2A 2WO3B 1BEXA 2X88A 1PLCA 1NIFA 1PNCA 4BDVA 1SFHA 3NJIA 3FQYA 2CCWA 1ID2A 1NTDA 2YQBA 1E30A 2EILB 3EHBB 3AG3B 4W1TA 1AZRA 1AANA 1W6LA 3IN0A 2PPFA 1A4CA 2JXMA 1JXDA 3WIAA 4DPAX 2NRDA 3CDZA 4DP4X 1OCZB 1F56A 3EH4B 1SHXA 1V55B 1J9SA 5B3SB 1J9QA 1AZBA 3PCYA 1DZ0A 2QPDB 1PLAA 4KO6A 2ZWNA 4BWWA 1NINA 4A67A 2FQDA 1E65A 2XU9A 2ZXWB 1JZIA 2PPCA 4NAJA 3OMNB 3IE9A 1OV8A 1B3IA 1BYPA 1JZEA 2DYSB 2W8CA 3NJGA 3FU7B 4YSDA 4DP2X 4BXVA 1A4BA 1XB8A 1T5KA 3NSYA 1ET7A 2BP0A 2E86A 2H47C 4NB7A 2PCFA 4YSTA 1OCCB 4W9ZA 2XX1A 3X1FA 1ILSA 1V54B 3UADA 4F7KA 3FU8A 7PCYA 3OMIB 1IC0A 4E9VA 3NP4A 1J5DA 2YXVA 1FFTB 2CAKA 3S3BB 4KO7A 4DP0X 1MG3C 1AACA 1URIA 1SNRA 1X9UA 4E9TA 4GXFA 1ASPA 3ABMB 4JHUA 1YLBB 1SFDA 5F7AA 1WA0X 2BW4A 4WTQA 1TKWA 5D4JA 4BDVB 3ABLB 2TSAA 2JKWA 4KO5A 1A4AA 1GSKA 4YSUA 1CYXA 4DPBX 3TBBA 1JXFA 2WSDA 1WS7A 2DYRB 2PPEA 3X1BA 1W6WA 3L45A 3SQRA 2DY2A 2I7SA 2I7OA 5FC9A 1SF3A 2P80D 5I5MA 3T71A 1BXUA 9PCYA 1CUOA 2BW5A 4RH4A 3H56A 1W8EA 1ZDSA 4QKTA 1ADWA 5E9NA 2QDWA 3T9WA 1NICA 3X1NA 3QJQB 2UX6A 1TEGA 1BYOA 2Q9OA 4AZUA 1NZRA 1AR1B 2PCYA 2UXFA 2QPEB 3NSCA 3IN2A 3AZUA 1PZAA 3FQ2A 2ZOOA 3TBCA 1IUZA 3UGEA 3ASOB 3FPYA 3AG2B 2EIKB 2UXGA 3UAAA 2XWZA 3FU7A 4MFHA 2VW6A 2FT7A 3PXLA 1QNIA 3NP3A 1WAEA 1WA1X 2J56A 1WA2X 2CBPA 2AFNA 2HZHA 1NIEA 4YSSA 1HFUA 4A68A 1WS8A 2CUAA 6PCYA 5B7MA 1PZCA 1MZYA 4YSPA 4E9SA 2UX7A 5A7EA 2BZCA 5I6LA 2ZONA 2IH8A 1BXVA 1NIDA 2VM3A 8PAZA 3N55A 2TSBA 5IY5B 2FWLB 1XMEB 2IDUA 3GYRA 4DP9X 1JZJA 4PAZA 4UAHA 3ZDWA 2IDTA 2PPAA 1E67A 1I53A 2BP8B 3CVDA 1OCRB 4YL4A 2YAPA 5I6MA 2GB2A 1BQKA 2OV0A 1XB3A 3NJNA 4FA7B 2XUWA 1AZNA 3SBQA 3UABA 3FU9A 4ENZA 1GY1A 2W88A 3NYKA 4A2HA 3MBWB 3S8GB 2YXWA 3GDCA 1GW0A 1KCWA 3U25A 2VM4A 4A66A 2IWEA 4G7RB 4G72B 5I6OA 1RZPA 3QJUB 1ET8A 4AKQA 2VW4A 1A8ZA 2QT6A 1AQ8A 1BAWA 2PP7A 2IWFA 1GS7A 2VW7A 2HXAA 3WG7B 1PZBA 1AS6A 2H5UA 5B7EA 1NWOA 1CURA 2H3XC 2HX8A 1ETJA 4A2DA 2CJ3A 2EIJB 4YSRA 3SBPA 1SJMA 3QJRB 3S8FB 1FWXA 2I85A 1JXGA 1JZHA 1GR7A 2AANA 1L9RA 4E9WA 3QQXA 2HRHA 5B1BB 3IBOA 3HEIB 1MDAA 4G7SB 4GP4B 3AG1B 2EINB 1JVOA 2PLTA 4YVNA 4BXSV 2BHFA 2FTAA 1QLEB 1EZLA 4ZK8A 1XB6A 1JZFA 1MG2C 1M56B 1NPNA 1ZPUA 5AZUA 3DTUB 1QHQA 1AAJA 4HCGA 2IH9A 5ANHA 4HCFA 3X1EA 4AKPA 3JTBA 2BP8A 2XXFA 3TASA 1PLBA 3FYIB 3WKPA 2FQFA 1CYWA 2IAAC 4A2FA 1ZDQA 1GYCA 5LDUA 2IDSA 1PNDA 2R7EA 2XXGA 3WNIA 3FQ1A 2CALA 1EHKB 4KNTA 4A2EA 3CZUB 4EF3A 3TU6A 3V9CA 3NT0A 1DYZA 4M3HA 1R1CA 4KNSA 4BWUA 1KDIA 1GS6X 4YSQA 2YAHA 2XYBA 3NSFA 2J57A 2MRYA 2PP8A 3FSVA 3FSWA 5F7BA 1PMYA 3RYMA 2QDVA 3FPXA 4PCYA 1MZZA 3DIVA 4QLWA 1KCBA 4DP7X 1JZGA 4KNUA 1KV7A 3ASNB 3UACA 4FAAB 1AZCA 2YARA 5I6NA 1J9TA 2OCCB 3GXUB 1M9WA 3ABGA 1L9OA 1OE1A 1E5ZA 3AG4B 3NJJA 2VSKB 4KO9A 2IDQA 1RCYA 1NWPA 4K9JA 4BK5C 3NJMA 4AX3A 4NERA 6PAZA 1AG0A 3D12B 2AZUA 3T6VA 1ZV2A 1CC3A 2UXVA 3T6WA 1OCOB 1E5YA 2B08A 2X87A 1AS8A 3SBRA 2J5WA 3QJVB 3NSDA 5I6KA 1BQRA 1N70A 5B1JA 4HIPA 4TXVB 5EHFA 4L0PB 5AKRA 3NJLA 4HAKA 2GIMA 2DWSA 2R7EB 2YAQA 2VMJA 3CG8A 4P5RA 3QJSB 4DP6X 3OQRA 3CVCA 3H4FA 4AI7A 3HB3B 2WO2B 5B1AB 4DPCX 3V9EA 1JERA 5AFAA 2GHZA 1KDJA 2LLNA 1A3ZA 1PY0A 3KW8A 4DP5X 1PAZA 4GY4A 5B7FA 2VSMB 2XVBA 4AKOA 1IBZA 3ERXA 1L9TA 1ZIBA 1PCSA 1BXAA 4BWTA 4X4KA 4A2GA 4N4YB 5TK4A 4E9XA 4E9RA 1L9PA 4G70B 3UAEA 1X9RA 3EH5B 1JVLA 2FNWA 2XLLA 5I28A 1KGYE 4CSZA 4UANA 3FSAA 2GSMB 4KOBA 3NJFA 1AS7A 2GC7C 4P5SA 3NJHA 2YAOA 2IWKA 4CSPA 1A65A 3G5WA 3MX0B 1ET5A 2PP9A 3WI9A 3OMAB 3CVBA 1JOIA 5PCYA 2HRGA 4WKXA 2FT6A
chains in the Genus database with same CATH superfamily
3G5VA 5GGQH 1MW2A 3VG9B 2F58H 1VCBC 4O02L 2K7QA 3T1FB 1XTLA 4M8QB 3FU5A 5GRJL 4G6JL 4EUPB 2O5YH 4BKSC 3NIFB 5D1XD 4FKEA 4AQEB 1BVNT 5IQ9A 5T5FA 4WENB 1J9CT 3ARED 3QG6B 3O4LE 4MQ7A 3IAGC 1ORSB 2BH0A 2R1YA 5IHZB 2R1XA 2BVYA 1Z0NA 3PLYA 2G5BA 3W11D 5DXWA 5I8KH 2IXQB 3QPKA 2PW1B 3RWCA 3FULA 3HCVA 3LH2H 4BQBA 2Z35B 4OUUB 1CQKA 4BH7B 2EUZA 4XGZB 3DX8B 3S5LA 2VSDA 5DWUH 2QTVA 3F01A 2Z64C 3CHQA 2HYMA 1EK3A 3CSFA 3ROLA 4F3FB 2NT0A 3LQAH 1NCAL 3W9DB 5BZDA 4U2YA 1SOSA 3PAVA 5AVQB 1J5CA 1DN2A 2VLMD 2R0LL 2IEPA 3QRLA 5C6PB 1L9SA 4PYHA 3WTWA 4TQHA 4LFHG 3Q05A 1WBXB 5ICXA 1T4WA 1V10A 3OGCB 2BCKA 3RNQA 2AJSL 1SBSL 4A7SA 4ZD3L 2J88H 5J1TC 5I1EL 1NFKA 2WSKA 1JRHI 1NAMA 2B3IA 4J3OH 4QTHB 4F37K 1K85A 3L3IA 1LO3L 4Z1PA 3C9NA 4JCWA 4M02A 4PI2A 4Y9EA 1JZDC 4NQCB 1BPLB 5KANI 4KKLD 5J6HB 1KIPB 3CSYA 1Z5LB 2YPVH 2GG1A 2C3GA 3LZRA 3LH9A 5SWZA 3WEXA 4DKFL 1OTUD 1HX0A 2JNZA 1IJ9A 2QADB 3BLBA 2CLVA 1II4E 5FCUH 2SODB 4HCRL 3AW5A 4JANA 5BS0E 5H4ZA 2A4ZA 4YHPB 2MTPA 1FFOB 3AY2A 2WXLA 3BZ4B 2V9UA 4OLVL 4EPSA 1B4RA 1HQRA 1JWSA 4HGWA 4UOZA 4PRHA 3V5HB 2NR6C 4TSAH 1S9WA 4L8DB 1J86A 2V7NB 4DKTA 2WBJD 4PV1C 1MI5A 1UJTA 3HNSH 3N1MC 2DQJH 1S46A 4LNRA 1GKEA 3P11L 4W4OA 5D9SA 4X7EC 3QPXH 3FCTA 1J1OL 1LO2L 1QYGH 1SHSA 3MRLA 4OCRL 5AL0A 5IMMB 1F90L 2B1OA 2F1EA 1XCTB 3ET9F 4R2GB 3ZZ1A 5I1IL 4XBPB 3ARFB 4H20H 5G5DA 3UAJD 2ITEA 4BGLA 3D5OF 5AZ2H 4YDKL 2EDBA 2HLAB 3WJMA 2EIZB 1MIMH 4PJDB 3IJYA 4N2HA 2IH1B 4YBQD 4I9WD 4HA1A 1NIFA 1E5UI 3VXTA 1TJHL 2CCWA 3LKOA 4HP5A 5DRXA 4NRYA 1U8CB 4IIQA 3AG3B 3ESNA 3V7AE 4BFGA 5IHWA 4IOFC 2XKNB 2AABH 3BWAA 3NCWA 4GW5B 1KUMA 1V55B 1SY6A 4XNUH 2VDMH 3IXTA 2OW6A 3EO9H 4Q14A 3SQOL 4NKIL 3NDYE 3L3KA 1XGPB 4QT5B 2G4GA 1FE8H 5A16B 3VGDA 4LIQE 4QRRB 3S6CA 1UHVA 2WIMA 2VXQH 4ZPTB 4ZS7H 1BVZA 5AYTA 5I73C 4OCWH 4F8TA 1XH0A 1IC5H 2B59B 4ODSL 4FQCL 3RL2A 4NRXB 3SCMD 4G6FB 2VDQB 3HI1A 4LOFA 4ODXB 4Y4FC 4GBXB 2YD7A 3DI2B 4GLRH 5D1ZB 3LOWA 3B9KC 4QY8B 2BS8A 4OJFL 2CO6B 5I15H 5J8OA 1UXLA 2AI0H 4KK9D 7PCYA 2D31A 1FO0H 1XH1A 2DTSA 3Q3GA 3R19A 4HULB 3C5ZB 3TT3L 3T3PF 2OX5A 3V4VB 2YD5A 3G5XA 3VI3F 4IRJA 4TUOA 3UTTA 1DBAL 4M4RA 1TCMA 2ITDB 4M8UA 1URLA 3U6RB 1ASPA 2P24B 5H37G 4HWEH 3HUJB 4ZUWA 4AYMC 1CL7H 2BW4A 4BDVB 5LAPA 3AGVA 5T1MA 1R3IH 3R8QA 2PO6D 4EN3D 4KMTH 2Q0ZX 3VXUA 2IANB 2PPEA 1BEYH 4Z3EA 2OCJA 5IROA 1R75A 4MXVE 4PRID 4PRPD 7FABL 4PY8J 5FC9A 5GGRY 5KTEL 4AITA 2P7TA 2PCXA 4F91B 1KTDB 2DWXA 2R56H 5E9NA 3U0PB 4AXWA 3KL5A 1R4XA 2QDWA 3ECUA 5DUPL 4O02B 5F9WC 5DCCA 1AZVA 3DARA 3FOMA 3JWOL 4KZ0A 2EDRA 4PS8A 3QWOB 2HG5B 4JFSA 1DBML 5DEZA 1TEGA 2WVVB 3GSRB 2Z7YA 3Q5YA 2HSIA 2Q9OA 2ARJA 4MKTA 4G6KL 1R3LB 4PGJA 2EYTA 1S9XB 3IJEB 3MRKB 4NC1C 3WJJA 2VMEA 3A6OA 1BX2B 3QR2A 4Q6IC 2DS4A 3OX8A 5E5MB 1E9QB 5D2LE 3T8XA 4GKSB 1A6WH 4PGBA 4XE5B 3LRMA 3QIBB 3OKEB 4ZTPH 4QLRA 2W9DH 4QRAA 4JFXA 3CBJB 4WSGA 4XE0A 1LO4L 5EIQA 3WEBA 3I2CL 1TEYA 4GKZA 3QS3A 1JHKH 1CR9H 3NP3A 1JF5A 2EXTA 1JSYA 1P5UB 5HGDB 1A2YB 2OAAA 3BISA 4HS6B 4U0RB 2MMXA 2AKRB 3CWGA 3OZ9L 5LCVA 5HHOB 2ZXBA 1Y1DA 2J2ZB 2JE8A 4JMXA 3L08A 4LMQE 5INCA 3T0EE 4KQ3H 4QHUB 1VERA 1MFEH 4TVSa 1G6VK 4WEEA 4XO9A 3TF4A 2BZCA 3I6GB 3KYMA 1IC1A 3UYRH 1IKNA 1NIDA 2FX9H 3DSNB 3EGXA 3MRJB 3QFDA 1CN4A 3MRNA 3N55A 3R7QA 3KPNA 3K7UA 1QFOA 3V4UH 2IDUA 5DMGC 2YRPA 1RK0B 3TFBA 3U36A 2RD0A 3N04A 1KPRB 4OD1H 4KY2A 1QLEH 1GJIA 1E4KA 1MF2H 3U1QA 2ZSWB 4J1UB 5ETUA 4QGYA 4ZDHB 5D5MA 1I8IA 2P1YA 5FDYA 1F8TH 2AW2A 1DHKA 3AT8A 5EUOF 1MN4A 3HHMA 1YEGH 3J27A 3PABA 3SBQA 1KT2A 1TTFA 1DQKA 1TZAA 2R39A 1O9ZA 2AVGA 5DRWA 4RGOH 1E9OA 1K72A 1NEUA 1NM9A 2Z0BA 1CGSH 3BUBA 3N1PC 4AM0Q 2DKMA 4GS7B 5B39A 1N6VA 2IWEA 1HJCA 3OVUB 1DSWA 4RDQG 2OL3A 3SGJA 1A8ZA 2OXGA 3MO1A 3UG5A 1KN4L 5DK0B 1S9YB 1YEKH 3FT9A 1HEZA 3QHZH 1YEEL 5GS2H 2R8SL 3BWUF 4KRMB 4YBLB 4DGYH 1DVFA 1L0XA 2H3XC 1UCBH 1U0QA 1ZANL 3G6AA 3PL6C 4DW2L 2ZUQB 5D8JH 2YPLA 2VDKH 5IKCA 2C7UA 5SX5H 4YSRA 1HHKA 2EDJA 4IU2A 4OZHE 4GG6A 3F84A 2I85A 4FERA 1T0PB 2M26A 4NQUA 3MLZL 4XMVA 5ADOH 4M1CC 3F7PC 3WIIH 1BOYA 1JXGA 2E59A 1HL5A 5IJKC 1GR7A 2B5IB 4HIEA 1QTSA 2HRHA 4UT7H 4KJPD 3PGCB 3BVXA 2GAZB 1BVLA 2ADGA 4OGXH 5B3JF 4JO3L 1FH2A 2ZSVB 1S9VA 2MQCA 1XMWA 1B0IA 3P0YL 4HG4K 3MRBB 3EYQC 3C6LB 3IRCA 2YSSA 3ZHLA 3VFUA 4B3VA 4KROC 4E41B 1LILA 3PGDB 2NXYD 1GHFH 1U21A 2FBOJ 1JK8A 4JPQA 4U6VH 2IH9A 3OB0H 5ANHA 3KJ6H 4IMLB 5GISH 1GH7A 4N8VA 2XXCB 5K69A 3AC0A 1HKFA 3ULSB 5JHLL 4N6RA 4DZBA 5HY9B 1KGCE 5C0AB 4QRBA 2KZWA 3OR6B 2P46B 3KXFB 1AXIB 3BFQG 4RGNB 4U1LB 4LHJB 3F65A 4QRPB 1JYNA 3QDGE 4HHAA 5HYEA 3UMTA 5DHEA 3VXSE 5JDSA 3H7LA 4NO0D 3CU1A 1S7TA 1E4HA 1GVIA 3AXIA 4K7FB 5F88B 4TNVK 3G04B 1Q9OA 2PXYA 2I9TB 1LD9A 3EJRA 5T1LB 2RH0A 4XMKH 3IU3A 4XZUA 3UTZA 3KWTA 4GPVA 3NSFA 3KBPA 2QPUA 1XSKA 2JJVA 2JF1A 4IW4C 3D25B 4OT1H 2FECI 5E1AB 2VDRL 5SX4I 1PVHA 5EZJA 1XF1A 1JZGA 2WQAA 3V55A 3L3JB 3QWNA 3U2JA 2YARA 4MS8C 1C12B 3NCEB 1XD0A 4GQPH 5JLZB 4FFTA 4D9QD 1T2QH 5JZ7C 4UQ9A 4PJ8A 3MJGX 1NWPA 4I48B 4XMXA 5ERWA 5F1IB 4Z77B 4U1JA 2ZXGA 2CGYA 4MQSB 3TIEB 5CCGE 2OP4H 4J3VA 4Z7VE 4Z78A 2AZUA 1MCOL 2YGQA 2ESVD 4IGBA 4R8WH 3GSVB 3VJ6A 1RZIB 4FEMA 4UQAA 3IU4L 1UEMA 1TTCA 2A5UA 4HT1H 1YJDL 4FXKA 2Y5QA 5D93C 5I1AB 4ELKA 1S78D 1IM3A 5EHFA 5SWSE 3UC2A 2PWDA 5LDSA 5FYJU 1ES0A 2HVKB 2CPCA 1XEUA 3BX7C 4B97A 1U9KA 1DSFH 1XQ4A 5FA4B 3B9AA 2W65A 4C83B 5GS1B 4MCYB 1B0RB 3NJVA 4KKNA 3IWVA 3KPSE 2DTMH 1Z66A 4OF7A 5GGVH 3DJTA 1M1XA 1ED3A 5GS2D 4ZFGL 1F3JA 1RJCA 3DI3B 5HGAB 4OD3H 2WB1A 4PJAF 2CDFB 4X4KA 4HUXB 5D7EA 2BMKB 1UJ3B 2Z4QB 3UBXA 5D7JD 2BVQB 3UAEA 4Y8AA 5I74B 3LVTA 3C09C 1YVLA 4LHUA 3TZVA 1LDPL 3VVVA 2E0PA 3FSAA 5ENWA 4C8XA 4K5LA 4U6XA 2EVHA 3RNKA 2P5WA 35C8L 1ORQA 3PGFH 1S7WB 4ODHL 3NZ8B 1QPPA 4YXHL 4P2QA 5IHLB 4WUKH 1DQDL 3AT9A 3BUTA 3ZTJH 2IGLA 2Z34A 3LNGA 1FLRH 4AUUA 2WN2A 4RLDA 3L6FA 3ZDXE 1PEZA 4TULL 5F1NA 5HDOA 4HUCA 5DK3A 1ET5A 3LZFL 2R4SH 4NC1E 1WBYA 4XH2A 3DXAB 1AGBB 3GZPA 4JDVB 5CU9A 4AQAB 1JP5A 2ENSA 5IBLC 2X0WA 3DETC 1GZHA 1QFUH 4WWKA 1C1EL 3NAAL 4WNSA 4ZMNA 3KE0A 3LZLA 4BKLA 4LPXA 3S96B 2D9CA 5AAWC 1REIA 3HPJB 2XA8H 3N85H 1Q9WB 4HUVA 5GGTL 3S7GA 4IBSA 1KCSL 1WWAX 2C3XA 2E7DA 5EU5B 4IHBA 4OLZL 5F0PB 1ZLVH 5BXFA 1U3HD 4AK1A 2IADB 4HBCH 4YSOA 5KYYB 1A7NH 4FC3E 4ODUB 3TYFA 4YX2H 1FVEB 2B16A 4C56E 4G83A 4L4VD 1YEHH 3VFVB 3E2HC 2YEVB 5H35A 4OAWB 5IFJA 5I8OH 4QGTA 4FQHA 1T66D 4FQ1H 3VFWB 4JHWL 3S35L 3M1BB 2YEQA 3SZKC 2Y2TA 2WCSA 2YLKA 4OZGA 4W9GC 3D1MC 4RSYA 3PDOB 4J23A 2BVPA 1Y1UA 4GQQA 4H1LA 1R5VB 1HAUA 5EA0H 3R1GL 1ACCA 1A14H 1U2CA 5CP7B 2C5DC 2H7WA 2WP3O 3QEGH 5C0CD 1W0VB 5I26A 5GZND 4XVJH 3WMSA 1YQVH 3TEWA 2PR4L 1TMCB 1AP2B 5TDOB 1UWGL 3VXMB 1VESA 1Y0LB 3GI9H 4XN7A 5C97A 2KI6A 1PJ9A 2A6JA 3ARQA 2FJGB 2WBJA 1RHHB 1B9KA 2Y1AA 3HVNA 1SDDA 3NSJA 4G6FD 4XXDA 1E50A 4TVPL 4GQ9H 3MRGB 1L6XA 4H25A 3LHPH 3V0VB 1T20A 2VR8A 5EO1A 5I1IH 4YGAB 1OE2A 2YKLH 5GRUL 2WLLB 4R0LA 2J5LB 4IDJH 4AL8H 4NOFA 4PJCE 1J1XL 1FV1A 4GRWB 3RJOA 3L5WB 1VEMA 12E8L 3B7SA 4R7NB 3UAJA 1UM4L 2VSCA 3PF2A 4L4JA 3BAKA 5ESQB 4DJMA 2B2XL 4GMTL 2W0FB 2X6VA 3PP4L 4WVRA 4KTDL 1YPZB 2VDRB 3QDJB 1YY9C 1L0QA 2FIRT 4LESA 1PLCA 2CH8A 4R5TA 4A7GF 3OG4B 4P5TA 3FQYA 5DO8A 4MXQD 5JIPA 4N9GA 5SX4H 4HX1A 3JWNE 3HG1B 2EO9A 4MD5B 4UT6L 1SYSB 2WVTA 1S5HB 3REVB 5JIQA 3IN0A 1LEKA 1M7DB 3KHOA 1HZLA 1E27B 2EE3A 3WLWD 2YWYA 3WXWL 2Q20A 3AACA 1K4DA 4GFTB 2OYLA 1WGVA 5SV3A 4DUXA 2JELH 3L4VA 4L1DA 1AHKA 2X7LA 1TENA 3WFHB 1M71B 5IQNA 3FT4B 3KWWB 5FECA 3TBSA 5CIPH 5JO5A 1MFCL 4U2ZA 1UZ6F 4NAJA 3HB3C 3HW7A 4IKIA 4JRWA 1JZEA 1W0YT 2WQWA 3K0WA 4G6ML 4UDUA 4GO9A 3SCMA 4ODTH 3T3MF 3QNZB 3QA3A 4O5LL 1OM3L 4U1GC 3KPQB 3TEYA 1ADQA 3B2DC 3WTTA 4CDHA 3RWHA 4QKXB 1YN7A 3AM8C 2EYSA 2P5EE 3D4ZA 4LPWA 5D2NC 3VI4F 1G7LA 1ZHKA 4YGVA 1NGYA 1EANA 1TNNA 1WFOA 3S3BB 1WZ1L 5DU7A 4L3CB 1X9UA 3MBXL 4IKNA 3FMGH 1ZWIA 4NHUA 4FLOA 4XHJC 2RB8A 3ETBJ 4E9TA 4H5SB 5A40E 3KNBB 1XIWC 4JKPL 1YLBB 3QUHA 4XPGH 3MYJB 3I85A 1TKWA 3E9UA 4LP5A 3ETBF 1PS3A 2PO6A 4JUTA 4EN3A 1R47A 2VXSL 3LXAA 4W9EC 5KTEH 4M7ZC 3NZHH 3ZRSA 3S34H 4PRPA 4PRIA 2WB7A 4E2OA 3T5WA 1KIQA 4HIHB 1EJOL 1RQ5A 3ASWA 4OF6A 2A73B 2A0LC 4LU5L 5I75C 5JIDA 3H56A 1ZDSA 2YPVA 2ZUVA 4HJGB 4PJEA 1L7IH 5JIIA 3IDIA 1LMIA 3FUIA 3O4OB 1Q0XH 5LBSL 3LD8C 3BWUC 3VXQA 4AZUA 4XNQB 4PRAA 3J8F7 1AKJB 4MA7L 2CDGB 1ULVA 4X4MA 3Q5TA 2NXZC 2YBRB 2B15A 4ODWB 3SQBB 2NY5C 1BAGA 1CXIA 2WTOA 1MJJB 5HHVL 3RVUD 4L8CA 4F33A 2A1WL 2XNAA 1TXKA 4PJHB 3GXFA 2R4RH 1YCSA 2QPFA 4FYQA 4IKJA 5C0GB 4PVMA 3WFEL 3O6LH 5IB3B 4G8GA 2W0LA 3LXBA 1DQTA 1UZ8B 1WA1X 2VL5A 5DTFA 1KZYA 2VDLH 3FXIC 4HKZB 1XF4B 2P8LA 1WA2X 4G8IB 2AFNA 4PBWD 4NO3B 1J1PL 5DHYB 5D70L 3UYOD 4K3DL 2VDOL 6PCYA 5GQBA 4QPEA 4G80B 4WEBL 4NUGH 2AK1H 2NY7H 5DJDA 2XY1A 1X5FA 3NRQA 4M8VA 2YK1L 1N5AB 1NCUA 4JB9H 3DRTB 4GUQA 8PAZA 2G30A 1WT5C 4I2XE 2CBOA 3HHSB 4AC2A 4F37F 1FZJA 4JZJC 5A2BA 4JJHA 5TFSH 3CFBB 3FN9A 4UOW1 2D7PA 4F2ME 4PVNA 3VMPA 5L8KB 1WTGT 4R96B 3H9SB 1QTPA 2YMXH 1S7QA 2P49B 2VLLA 3VTAA 2MH4A 4IBLT 4PFEA 5AKSA 3CFCL 3FDWA 1D5ZA 4E41D 3DX6B 3V0WL 4MA3A 2P8PB 1QNZL 4K2UH 1ZVSB 2KDGA 2XOTA 3R8BB 3ZE1F 5JW4M 5I9QC 3S8GB 2YGPA 2P47B 1NMCC 1UB5A 1K2DB 4NNXB 3A6BH 5B39G 5GS0H 3LEVL 4RGND 1KCLA 4WW2B 1CF8L 5KVEE 1KPVB 5JPNB 4ZXBD 3HLAA 5FYKE 3VB8A 5KAQF 5TH2B 4TOYL 4CGUB 1PY4A 4K3EL 2XBTA 1SEBB 3SDCB 4DW2H 5KSBF 1IFHH 1EVTC 2Z7UA 4PV9B 2HKFL 1J8RA 1LYQA 1JWUA 3LRHA 3SYPA 4NPKA 5AVVB 3CFUA 1ETJA 4YHOL 5DUBA 3II1A 1GCFA 1D6EA 4Z7WE 2GW5A 2O6DA 1Q9LA 1AO7D 4GKNA 5JDJA 5EF3A 4APQC 4XWGL 4ONFH 5F6IB 3F05A 4X5LA 4AIZA 3D0VA 4HH8A 5CN3A 2KHAA 1E3FA 1MDAA 3CC1A 1TFPA 4HV8A 2BIPA 5G4OA 3VA6A 3ZKXC 2EE9A 2VN6A 2WKGA 3IFNL 3SGKC 1JYWA 5DWPA 3FQNA 2WJ7A 2AXJA 4AGNA 2B4CC 2FX8L 5F6HI 1CDHA 1S7UB 2Y07L 5E8DL 2CK2A 1AAJA 3I02B 3O3BA 2X05A 1XL4A 1FFRA 1N7MH 3UZVA 3KLAA 4F7MB 1WAAE 4JK0D 1OOAA 5E00B 4EDWH 2APVA 3W39B 4N8VG 4O2FB 5DMYA 4P5MA 5KVDH 3RFZA 1DN0A 2YRZA 5HHNB 3MXVH 4LSPH 4UYPA 5LAXB 4AT6A 2R7EA 5K5YA 1A3LL 2X4QB 1TZHB 2MKLC 3WFDL 1BM3H 1PLGH 5DRNB 1SJHB 2J71A 1XR8A 2DQEH 2NW3A 5FK9A 5AG9A 1XGZA 4XN4A 3BSZL 3V9CA 3PQYB 1XBDA 4QCIA 3O6KL 2Z31C 3DUUA 1V7NL 1GS6X 1PW3A 2PW2B 3OLIA 4U1KB 1ESOA 2J57A 4JS7A 3OHXA 3DO7B 3X11B 4YH6A 1XGQA 2ZWYA 3PHQB 1G94A 3K3QA 4N2AA 2VUYA 5B38B 4XPHL 3L48A 4KJQC 1VFAA 4DVRL 4GO8A 4M1GL 2DLGA 5BRZD 1QEXA 3MJ8A 1ZA6A 3K80A 4I8DA 4R5XA 5I8CA 1H15B 1OAQL 3VD3A 3QIWC 1IEHA 4NT6B 2OJEB 4HGKC 4OGZA 4AIEA 3K71A 2NY1B 5EOQL 3NJJA 1MCOH 2Q86A 3G7TA 2APBA 4P2RA 1RFDL 3TCXA 3ARBD 1GMIA 1CC3A 4H8UA 4XPTL 1CO1A 1UVQA 3QH3B 4LBAA 1S7XA 4Y1AD 4F8OA 2G60L 43C9B 2CMRL 1H3WM 4NFBA 3QI9C 3MBED 2BSRA 3RHWK 3BKJH 4M8QA 3WDJA 3QP3A 3JYBA 2ZUWA 1A21A 1N70A 2W59A 3FQ4A 3MJ6A 1E28B 2F5BH 3D3VE 3F58H 4ZUSB 4MDIA 2GJPA 2NY2B 4LSSL 1ORSA 3EH2A 4X6CB 1RLWA 5IJBC 5IHZA 4BFBD 4LPCA 4UINH 5DJ2B 1XWVA 3HZ3A 2Z35A 4BH7A 1JPTL 4XGZA 3DX8A 3FUMA 1YEIH 4JLRA 3T2PA 1AXSB 1NCDH 1EZVX 4L1TA 1I8UA 1KSRA 1IRAY 3HNTL 1A1MB 4UUJB 1EEYA 1KIUA 1WBXA 2DBLL 1BXAA 2QSVA 3ZY7A 5D7JA 1CZ8H 1DLHB 1XGTA 2MPAH 3OGCA 2VDOB 5HDBF 1U8HB 3H2QA 3QPQC 3UBXG 2YD9A 3IFOB 1NCBH 1NQBA 4EQ2A 4J3BA 5D6CB 2CUMA 2R69L 1KCKA 3MUY1 1NC4D 4LHUG 2GSMB 1PBYA 4LSVL 3EHBC 4ZI8A 2GC7C 1HNFA 4JG1L 4UMGA 1ZJBA 5J6HA 1KIPA 1MFDH 1NGZA 5EORL 1QEWA 1AGFB 4WFGD 4KZDL 4HH9A 4KROB 3QR1A 5JORB 1KYDA 3HG0A 3KLKA 2C34A 4BFFA 1FFOA 2JI3A 3BZ4A 3SYOA 4DQOH 2AJUH 4LSTL 3T2QA 3VXMD 3WTVA 4K9EH 3V5HA 3KPRE 4L8DA 3BPOB 4P9ML 1VACB 4AZ8A 5A2IH 2BNRE 2HLEB 4GEJA 2DQGL 5TK2A 3HZVB 3NMEA 4G6AD 5IR1B 3N0PB 3QUMH 4WQOA 1KGXA 3IDNB 1U3HA 4S0HA 1HN1A 1K6QL 2YAMA 4BELD 4WI7A 2WQXA 1CDIA 3O3AA 5AW3B 1XCTA 4L4VA 4TRPH 1A66A 3FQXB 3VCLB 3MLTB 4PJXF 2XV3A 2NMSA 4JQIA 3HG2A 2ERJC 4Y8DC 4OB5H 3QULB 2EIZA 3ARGB 4LP8A 3W2DH 1RKRA 1HT6A 1N68A 3JZYA 3QDJD 4KVCH 4Q9QL 4G1MB 5LWYH 1KTRL 1R5WB 5FYLL 4PS7A 2R2BB 2J4WL 3WKNA 1MNNA 2RQEA 3CDZB 3EYFB 4NUJB 5FV2A 1GC1L 1F45A 1U8CA 3F12B 3HG1D 1DBKH 1N8OE 1DQJB 1GIGL 2GVYA 5I5IA 3GEFA 5HHXH 5I6XC 3Q6GL 4N2EA 4JO1L 3SKMB 4H1LG 3W38A 1MVUB 2F19L 2WXOA 3E6HB 1L9QA 4C4BA 5JA8B 1L0PA 3OF6D 5GZNA 1CXHA 1JDDA 2FBRA 5E99H 3BVDB 5F9JA 2MPVA 1WGOA 1XGPA 2EDOA 1F4AA 3WSQH 3ZSSA 4DGIL 3PV7A 3ZIYA 3EO1B 4GINA 4BQCA 1I82A 4ZPTA 3PIQB 4K5OA 3WHE1 5FDWA 3ZBMA 2B59A 5E8EB 4NRXA 4HQQL 1J87A 2ZE0A 3GMPA 4ODXA 4GBXA 1A9EB 4N5UA 4QY8A 3CBKB 5CWSB 1KJ2H 1RJLA 2UWEE 1G7PA 5GJTH 2A6DB 3D09A 4JAMB 4X9IA 3QIUC 3LEXB 3OKLA 4RMBA 5CEZH 1N10A 1RVFL 1WPCA 3GXTA 3V4VA 4EIGB 2FH6A 5J56B 1TSRA 5F7KC 2JKLA 4PS3A 1NGQL 1OO2A 1UA3A 2AEWA 5EUKB 1AIFB 3NTCL 2VZ3A 3U6RA 2C1OA 2P24A 1SJXA 3HUJA 3AB0B 3KWVA 4NO5B 2FDBP 4BDVA 5KBNC 1SFHA 3MNMA 4HXAL 5KBKA 1N67A 4JVPA 3H2PA 2W91A 3RL1A 3ZN6A 3S37X 4ZMWA 5EEZA 1UFGA 4M9PA 1A4CA 2EO7A 2IBZY 5TQ0H 4N26A 2EVIA 2NDGA 3WIAA 4LGSB 2NRDA 2ZNWA 3L5JA 4XPBH 3ULUH 1N9PA 3HE6D 3OKKA 1FNGB 3O3DB 2UUDH 3UCQA 4NQEB 4NUQA 3GS7A 4BFKA 2ZXEB 2YEZB 3ATBA 1RPUA 1QFHA 1KTDA 5B3SB 1ZT1B 3SKOB 3U0PA 4O02A 5DZVA 4KO6A 5E6IC 3DJ9A 5EIVA 3QCUL 2FQDA 2DMCA 3QWOA 2HG5A 4HS3B 1OM3H 3GSRA 3MKKA 1QHPA 4N0YH 1R3LA 4KV5F 2CK0L 1S9XA 3IJEA 2CKBB 3MRKA 3MYZA 3Q2VA 1BX2A 1ET7A 1AKJD 4RDQF 1VGEL 2BNQE 2HKHL 5A7BA 1E9QA 1OCCB 1Q94B 1BD2B 3BZFB 2YKKA 4GQRA 4U05A 4GXVL 3GJFH 1QOKA 4H26B 2DM7A 4NM8H 3ZQXA 1OALA 2DQDL 4Z7UE 4DGWC 1TVHA 3N42F 2F5AL 2Z1KA 4YHKL 3RPIA 5HGDA 1A2YA 1M9SA 4UTAH 4KO7A 1ANUA 5ITFB 3QISA 5AW4B 3QBTB 5HHOA 4YHZL 4HPYH 2J2ZA 4PJ5B 1XXDC 1RXLA 1OP4A 4QHUA 2JMRA 2A38A 4FG2A 3I6GA 4JG0H 3MRJA 4K5PA 4N6QA 1UWYA 3DSNA 5KUMA 2VQTA 2WSDA 3DDFA 3TONA 2R9HD 2O6PA 1WWBX 1ROCA 2IH3A 4RAVB 4C4UA 1ML0A 3O6FC 4NJ9H 1RK0A 4V1DB 4G59C 2XICA 5EPMA 4DEUA 3L4YA 3H9SD 3T8VA 1T80A 5T33L 1YMME 2X4UB 3GINA 1IEBB 4JFHE 4P3DB 4FHBD 4QKTA 4NQQA 3UP1A 2G2RB 4HCRA 4U3CA 4HS8L 43CAB 1Q4NX 4FKHA 5FWRA 1UB6B 5IHHA 3UTSB 4ZMQA 3T2NH 1RUKH 4W9CC 2N7BA 1FDLL 3QE5A 4FQXB 4PGCB 3MRDA 3T3PB 3VI3B 4OVVA 3SGDH 5I30L 4TVPD 1B4JL 1MH5A 1S9YA 2GIXA 4IS6B 5DJXB 1BZ8A 4ERSL 2VZSA 1J0ZA 2DL2A 4FL4C 1FNSH 2FT7A 2N4IA 4AQ1B 1EHLH 1TVDA 3FTGB 3V52L 4KU1A 3LV3B 4WEBH 3DYOA 3FK3A 5CEZD 1ZE3H 3BP5B 3GHBL 2X9ZA 4PJBE 2WZPD 5B7MA 2EDHA 2OI9B 4KK5D 2XRAH 5CSBA 1NKRA 3LZQA 5JUEL 5I6LA 4LVOC 3EDKA 1M7IB 1MCFA 1HH6A 2R0WL 5HD8D 5E24E 1OAYH 2GAZA 2VC2L 2NY0D 2ZSVA 3CFJB 2NY4B 1XMEB 3ULVF 1FJ1B 1G7QA 2BM3A 3C6LA 4NX0A 1Z5YD 5ILTH 1BQKA 4AENB 4E41A 3PGDA 2LLLA 1CFMA 1PX8A 4YZWA 2AAAA 4PEEA 4BRVA 3ULUD 3DJSA 3UBFA 3AAZA 2DJ4A 1NGPL 3ELQA 5AVWB 5C0AE 2QKIC 3ULSA 2DQUH 1LO0H 5HY9A 1ZLSH 1N0LB 5C0AA 1KCWA 3KXFA 1BZQK 3B3BA 4TV3A 4U1LA 1UQSB 4F8NA 1IZJA 4ZXBA 5I6OA 2VZVA 1D9KD 3IDJA 2H6PB 5BO1L 4YE4L 3THML 2VISA 3I74A 1D5MB 5F7UA 2XXMB 2G0KA 4K7FA 5F88A 4F58L 3G04A 2I9TA 3BKYL 5T1LA 1NKOA 4TTDC 5EU4A 4LSQH 3WEMA 3L4CA 1FYTD 3K46A 4IHOA 4X7SL 3QRFM 4N90D 1XGRB 2KYIA 3DURB 2KZKA 3KLLA 5D55A 1RLBA 3H9HB 4GG8A 2GBVA 1UG9A 2ZCKL 1JZHA 3MV7B 5DF0A 1JDAA 2UZYB 2CO1A 1C12A 2OZ4L 3LH8A 1ZGLM 4GRLB 3SODB 5DZLA 3EF7A 2NY1D 5EUOB 1EEUA 3N9GL 1J0JA 4H2AA 5F1IA 4Z77A 4PB9L 3TIEA 5KBLA 3KAAA 1DJWA 3TESA 1NPNA 3GSVA 3QDMB 2A9NL 5DEGB 1RZIA 1RZKC 3CQFA 5DVKA 4DCQB 2DQMA 4JHAH 5I71C 5DYFA 2UZPA 4KQ0A 3GBDA 3IJHA 5ECJE 2JKRM 4OIIH 5I1AA 1CYWA 4CC4C 3SYQA 4GAYB 2FH8A 4A2FA 3QUGA 4DIXA 1X9LA 2HVKA 3BSZH 2NY2D 4C55A 5KN5B 5IIEB 1IGCH 5FA4A 3ZDZE 3DHUA 4TL4A 5GS1A 5FKAB 5K9KA 4MCYA 2WZ6A 1B0RA 1QI4A 3LNHA 4XC3L 4M6OH 1E5BA 2VH5H 3FJTA 1EFQA 4L37A 3ZQWA 4L5FL 5ICYB 4YSQA 1N8ZB 4HISA 2PNDA 4GW1A 3HKZA 2VO5A 3M88A 4DEPC 2IDCA 2LAGB 5MEND 4ZAKD 4FQQB 5IBTH 2CDFA 3HI5H 4HUXA 4F5CE 2BMKA 2G2PA 4DSYA 1H8NA 1UJ3A 2EC9U 1EEZB 4NNPH 3VFSB 4EI5B 1O6TA 3TPUA 1WRFA 4LP4A 3TN0D 3VD0A 4NQDB 3M8OL 1TQUA 1UURA 1HQ4B 3P3SA 3CSGA 4LCCC 1F0LA 4FFWC 3RGBA 3KM2A 1MXGA 3EBGA 1HIML 3F7KA 3RIFK 1S7WA 2XETA 3NZ8A 1E5ZA 1C5DB 3PWUB 4PWHA 5FHBL 4BK5C 5K9QI 1MJUH 1OY3B 4PGDB 5I1JL 3GSQB 1XHHA 4I1RA 4KKAD 4OCNC 4Y1AA 1PZ5B 2WBKA 3U4BL 3VX0A 4CADA 3F5WB 3RWGB 2QGBA 5BJTB 3HRZB 1AGBA 3F7VB 1VADB 4JDVA 4AQAA 4YPJA 1T7WA 3ARDC 4G42B 3RGVB 4JRYD 4QMEA 3PJSB 5FM5M 5HI4C 4TXVB 1YQ2A 1UD3A 4QTIL 4ENEC 1GGBH 3HKFA 1MSPA 3MXWL 3S3SA 4Z95L 1KF9B 3PWPD 3WBDA 4JFOB 4Y7MA 2E4FA 1DO6A 1FZMB 4OCSL 3RGHA 1GCYA 2CD0A 2P8MB 2E47A 3MOBL 3F8UB 3SE8L 3B8YA 2RCSL 4YHIA 5I17B 4ELDA 4I5BB 2IADA 1CVSC 2GHZA 1KDJA 2XTJD 4LE8A 1A3ZA 3WD5H 2PKDA 1PKQA 4FGMA 5KYYA 2HA1A 4L1HA 1H9DA 1G7JA 1BBDH 3L3DB 3D48R 4BQ6A 1FVEA 5DLML 2WWMC 5TPWL 1L9TA 4OD2B 3VD1A 3VFVA 1LGVA 2R69H 1YECL 4LAQL 4OAWA 2D2OA 4JGNA 4LCVA 4E9RA 1JHTA 3MV8D 2P48B 3GMNB 3ARGD 4HMEA 1X9RA 2MCPL 2LU5A 4HKJB 4P4KB 4XAWH 4XPAH 1MIEH 3ISRA 3ULAB 3ZE1E 1E3XA 5EF0A 3U2IA 2FSDA 3M1BA 1TCRB 2XQBL 4P04A 5FV1L 5CP3A 1ZLWH 3WMQA 4PYGA 1QSEB 4JM2B 3C5XA 3JV6B 3RKDC 3ZKXB 1X4ZA 2VC2B 3PDOA 1R5VA 1ETZA 2WXQA 1U8JB 3DX2A 3DYMA 1OAKL 4Z7OF 5CP7A 1PZ2A 1LP9F 2DQHL 4TUKH 1W0VA 2AEPH 3CAFA 3M7FB 4Y4KD 5E2TL 1P4IL 2VXVH 1TQVA 1CXFA 5C0IA 1AP2A 5E2JA 5TDOA 1GGIH 3RZCC 4YLQT 2A9MH 3VXMA 5JHLA 5L2KE 3H3KA 1IGML 1N64L 1BQ5A 3EJZC 3JTTB 4DETA 1JHLH 2AQSA 3X3FH 2FJGA 1RHHA 4MMXB 3NIGE 1UKTA 2MHAA 3AUVA 1QVOB 4IRSD 4YDZA 3MRGA 4NFDA 4LZKA 3L4XA 1MCEA 3V0VA 4PJAB 4ADGA 3Q8EA 1QKZH 3C60C 5L9DH 2ZP9A 1OE3A 1SN0A 2WLLA 1B6DA 5GHWL 1PAMA 2FJHB 2Q5BA 3L5WA 3Q7JA 1BQHB 3CZKA 4R7NA 3UG4A 3U6XS 1X7QB 3LKPB 4DN4L 3QAZC 2W0FA 4JUSA 4N2GA 5E4OA 1YPZA 1KLFB 2E27L 5CLZA 2XPGA 3QDJA 5AW1B 3MDJA 2WVUA 5D7SL 5IGXL 4B96A 3T09A 2K6ZA 4YFLF 1NIAA 2WXPA 3HG1A 4MD5A 4J4PD 2JKNA 4ISVB 3KBFA 4BSVA 4DFIA 1S5HA 3VDBA 4J28A 3REVA 3MRPA 1M7DA 2XX0A 4KAQH 3GBMH 3MZTA 4RMQA 4L2YA 3VGHA 2E8ZA 4J5VA 2D8KA 2GTWA 4KI5D 3UO1L 5FR3A 4PVLA 1SDYA 2IO5A 4XR8C 5AOMA 2H45A 3WFHA 1AOZA 4RFOL 3FT4A 3VWJB 4MX7B 3KWWA 1S9KC 1G0DA 3FT0A 2Y6SD 5D7IF 1RMFH 1AY1L 4LASL 1HSBB 2EVFA 4KDTA 4P2OC 3SDDC 2DM2A 8FABA 1OW0A 4JKNA 4Z5RB 2ZCLH 2O6FA 4PU2A 5IQ7H 4G5ZH 1BD2D 1CD1B 2GTZA 3LB6C 4EZKA 2BWDA 3ZO0A 1FNFA 1LE5B 3P2DA 5M7QA 3N2JA 4XCCL 2VLRD 2K8QA 1A6AB 1Y7VA 5GJSL 2HAZA 4YSAA 1Q38A 1OGSA 3F6LA 4WCYH 4OFIA 1IC4H 3DVFA 3FYEB 2JQAA 4TF4A 2K6WA 4L3CA 3RY6A 5J3HD 3ILQC 4H5SA 2OXHA 2BRRL 3KNBA 1DE4B 2X88A 2X4NA 3BIBX 3EFDH 3MYJA 5SX5K 1X44A 2BSTA 3ESVF 5I19H 1JPFB 4LIQL 5TTRA 1JNLH 4AJVA 3EHBB 5H94B 2WGXA 1TQWA 2QVIA 3BOVA 3CFEB 1Y07A 3GXDA 3NG5A 1I9IL 2F53B 4N0CD 5E7FA 2ZOKB 3IGUA 1AE6H 1SXSA 4IK7A 3D2UB 3EH4B 2A73A 1SLVA 1Q1PA 3WIFA 4ESKA 3VQ1C 3RUGF 4FXGC 3BVUA 4PHZA 3L3HA 5DZAA 4UQ3A 2CO3A 3ZTJG 1PG7W 2MOQA 4KK6C 4UV4L 5D5MF 4PGEB 2Q87A 3F62A 1YDPB 4A67A 2WUBH 3AITA 3KYNB 3FFCB 3OB0K 5B8CB 4XNQA 3UJJH 3UTSD 4CC0A 4X7TB 1AKJA 1A4BA 4BXVA 1HYSC 4ZMXA 2EEXA 3DO4A 5F7EL 4FQXD 4NXSA 1CYGA 3SQBA 4YFDB 4Y4HC 1MJJA 5GS3A 1XGYL 1ILSA 1V54B 1P4UA 4PJHA 1JPST 1ETA1 1YYCA 5C0GA 3FQTB 4L3AA 3MLYL 5IB3A 3OKOB 3VRLE 1KELL 1U92A 4HJ0D 1WFIA 2BIQA 1P2CB 5B1CA 3RDTB 4U1NB 2H2SD 4IJ3B 2K4AA 4X9HA 2G4EA 3TO4B 4HKZA 4KHTH 3KLSA 4U1SB 2WWKO 4G8IA 4K8RC 5HDQH 2EVGA 2CJUH 2HTKC 4NO3A 2NW2A 2C4XA 3D52A 1IVTA 1MG3C 4PBVC 1MCKA 1O7SA 3SB3A 5DHYA 2VLKB 4G80A 2VOTA 3R0NA 4GG6F 3MLSL 4WFFD 1TDQA 4WZ9A 5F7AA 1H19A 1KCRL 5FYLD 1YNKL 3VSUA 2CDEA 3A5VA 4ETYA 2Q8BL 3HHSA 1I8MB 5HHMB 4XN8A 3ESMA 4N25A 5I82A 3G6JE 3U0TB 3N40P 3CFBA 3SBWA 2YMTA 4N5EC 1RULL 5F9OL 1D5BB 4NZ8A 3H9SA 4OBSA 5ECGA 5C07D 3VRIB 4Z7IA 2WXHA 3S37L 3OC5A 5D6DA 3H0TA 5BQ7A 5C8JB 3FCGA 4X42A 1U8LB 3T3MB 1KXVA 4HWUA 3DX6A 2W95A 4UB0L 2P8PA 4N2KA 2H1XA 1KXHA 2VERN 1ZVSA 2O72A 2DQFA 4WV1B 3FB5A 5JYMA 4FN0A 5GRVK 3QJQB 5BVPH 4Y1SA 2XN1A 3NCFB 4PJ9B 4JFDD 1NZRA 1EJ8A 4WW2A 5F3HB 3VI4B 1KPVA 3V5KB 5JQIB 5JPNA 2ZOOA 1VPOH 4MXWL 5TH2A 3AG2B 1SEBA 1ZHBB 2WLZA 3SDCA 4KZEH 5AZEL 2BSDA 3RTQD 1T7VA 1IT9L 4NC0B 4PV9A 5HYJE 4ZSOB 4XNXL 1KJ2A 1DCEA 2NT1A 3NIDF 4L2LA 2VN5A 4HK0B 2EUWA 1F2QA 4B9ZA 2CBPA 1KB3A 2L8AA 3L95B 4OFKA 3H42H 4RRPA 5E6UB 3HFFA 1JPEA 4RRPM 1HS6A 1PZCA 1A64A 3QCVH 1B0WA 5JQ6L 1NLDH 3HN8A 4UT6A 4AGOA 1QG3A 1U8KA 4GRLD 4KVNL 4FCAA 3QDHA 3QQNA 1MHEB 2UVEA 1CLZL 3B2PA 3W0WD 3QUZD 1MWOA 1UASA 3II2A 2BC4A 1CFTB 1NCWH 2GABA 3U7YH 2ADYA 4M6MH 2BHZA 2KLSA 3VXRE 3ZKNC 3MA7A 3OJDB 4NLAA 4KWUA 4R5VA 5H8DA 2XWBA 3MRFB 1FRGH 4F7MA 5E00A 3W39A 4DZ8B 1V7MH 1R6VA 3I75B 4M6AA 3BE1L 4FG4A 1D9KA 2DOCA 3CN0A 1RZPA 1TZHA 2LW3A 1NCTA 2JLPA 1LK2A 2NQ3A 1U3NA 1GS7A 2ALAA 4WU7B 3QEQE 4Y16D 2IQAB 3AJ7A 2PW2A 4U1KA 1I9RH 4DNLA 4ZX6A 2OTWB 1MJ8L 3GJFA 2HX8A 2XWEA 5EWIL 1UFUA 3X3GH 1PZ3A 1U8NA 3PHQA 3TO2B 4X4XA 5B38A 3RX7A 1A7BA 4M48L 1QR4A 1FORL 1HHHB 3TWYA 3MC0A 3V2AR 2NCEA 4A6YL 2ILLA 4N24A 3VXPB 2G0LA 1H15A 3DDGA 4XNYL 5DHXB 2OJEA 3MV9D 2DQTH 1ETB1 4RMWA 3G5YB 4PRNB 3LDBB 3WN6A 5JHDB 4WU5A 3ZR6A 3UYPB 4L48A 2X89D 3IGAB 4PSPA 1EO8H 4ZMAT 1G84A 2N1KA 3WIHL 5AZUA 4BQ9A 3P73A 4UBDD 1XH3B 1PTZA 3TT1L 1U3ZA 3O0RL 3G5ZB 4I0CC 5I1GH 5F8RC 3N43F 4YUEH 4NO2A 2XZQL 1CTOA 2GTQA 4X5XB 5KSBB 3RGVD 2X53A 4X6DF 5KYWB 4XCNB 5LBSA 1E28A 4CW1A 2HT2D 2PYED 3S88H 3BUQA 3D8MA 4W4OC 1BWWA 1UKSA 4H8WL 4FFZL 5E4AA 3C08L 5DJ2A 4KXCA 2KPWA 5IMLB 1Z1WA 4TMPA 3RVXC 3NT0A 5F93C 3V6BR 5EF1A 1S3RA 1CFNB 4KRNA 1AXSA 2NYYC 1MQ8A 3JWDC 1YNLL 4GT0A 1P7QB 3IF1B 2J3SA 1A1OB 3FSWA 3UEQA 1A1MA 2L7UA 3PS6A 4DUWA 5EOCJ 1X5HA 1MZZA 3CZNA 1DLHA 1GZQB 1QUNB 4IIQC 3TN0A 5DJYB 4P46D 1Y6NR 1U8HA 3B3IA 4FXTA 3IFOA 5D6CA 2XCMC 1G9NH 2DQ6A 1A7QH 1P1VA 1KB9K 4MVBC 3MJ9H 5DD3L 1N26A 3L8QA 1OE1A 1QSED 2J8OA 4JM2D 4OZGF 4C58B 1MRCH 3BUYB 1D7FA 2Q2EB 4HXBL 2ISDA 5LKNA 2M83A 2BP5M 3NJMA 4DKAA 1AGFA 3SJVD 2V9RA 3BGMA 4QHPA 5L0QB 4NJAL 4R4ND 3FFDB 3ZTNL 1HYRC 2EDQA 5CAYB 3EH1A 5JORA 2APWA 3SDYL 2EXWD 5FXCH 3VVWA 4MMZB 2EO1A 4QTIH 4L8SC 3NABL 5DJCB 1RU9L 4FTVE 2AAVA 2RHEA 1IGFL 1JJUA 2ARWA 2QVMA 5L6YH 3CV5A 1IAIM 5LGJA 2Y6TE 4TQIA 3KLHC 1HL4A 2IC2A 3TYGH 1A9BB 4G9FE 1QW8A 3A47A 3HZVA 4IJTA 3CVCA 4IRJC 3GZQA 4HEMA 3H7BB 2LU3A 5IW1B 3IDNA 2Z7ZA 2BIMA 3D18B 2BWQA 3GSOB 3U0WH 1PAZA 5T1DH 3FQXA 3VCLA 3MLTA 3GBNH 4N20A 1BZ9B 1TQBC 1ITCA 4FI8A 2F08A 3MV8A 4JFED 1JD7A 3ARGA 4GT7A 4L4TE 1GGUA 4G1MA 4Q0XL 3O3EB 4PWJA 2R2BA 2VRAA 4UTBH 1FZKB 2D7TL 3TVMD 4NUJA 2YJLA 3HZYB 3HR5B 3ARYA 3HAEB 5C0RL 3U1PA 2YAOA 2IWKA 1OQXA 2NSXA 1M3IA 1MVUA 3E6HA 4OGQC 5DO2C 2ADJB 1MELA 2PP9A 3QCTL 4Y4KA 5I71B 4HOMA 4NZRH 2AXGA 3TCLB 4LMQI 3GNMH 1QAWA 3IMRA 3VWJD 1KYFA 4QHKI 1UATA 3EO1A 1IBYA 1U3YA 5MI0B 4LCYA 1RUPL 3PIQA 4BV1A 2R2HA 1V3JA 2V5TA 4GUPB 4FE9A 3QZWA 3SGEI 5E8EA 2QQNH 2MCAA 5JOPD 5MERA 3HC3H 1ICTA 4WTZA 5FHAH 1Q9KB 4AV4A 4OJYA 3QK0A 3P3RA 4YHMH 2ENJA 3PAYA 1GYAA 2HMIC 2FE0A 4OVUA 4JFTA 3D06A 5IEHB 1G4MA 5E70A 2A6DA 3BSZA 4JAMA 3MNZA 3LEXA 1U36A 4YHYB 1O0VA 4L3EB 5HDBB 5L4MA 4YPGB 1J8SA 2J25A 4I0KA 4BK8A 2X0UA 4DEPB 3BN9D 1PSKH 5FUOH 5EUKA 1E9PB 1HXKA 3NCJL 4N3UA 1IKNC 4WHTA 4F8LA 2DD8L 1KEMH 3L2LA 1NFAA 2DLFH 3E0GA 4NO5A 1SUHA 1JCKA 4A6YB 4DTGH 1QR1B 4J4PA 5ISZE 5M94B 1NIBA 4PP1C 4RMSA 5EC1B 5G2NA 1E4KC 4N8PA 2EACA 5DD0H 4JPWL 1MFUA 4K94C 4PMEA 3ZE0F 3KJ4B 3NFSH 3K2UL 1I1CA 1HXYB 1FNGA 5EZOH 2AJYH 3O3DA 4GSQA 4NSKB 2GYSA 3D2UD 1MPAL 1CICD 2YEZA 3EGSA 4HZ1A 2R0KH 1AY1H 4HEPA 5AVUB 4DHLA 4UQBA 5BMFL 3IPFA 1OTSD 1L6PA 3DX7B 4OY9A 2HFGH 4YHNB 2ZAGA 3FW6A 4FQIL 4AMXA 4GP5B 2V33A 3LSOB 4YXKH 5D1QB 2L3BA 3FF8A 5FKPA 1DVFC 3AROA 1CLOL 3I84A 4R84A 3QJTB 4JQVA 2G3XA 1BD2A 3HS9A 4PJXB 2Y7QA 4H26A 4JPSA 4NKDB 2VLRA 2YZ1A 1JV5B 4PWEA 5A2KH 1OAZL 1PF3A 4GYBA 1LWHA 4M7LL 4PH8A 2UXTA 3CC5B 4ZUUB 3MODL 3Q1SL 4KTEL 3RDTD 1OARL 4OFPA 5ITFA 5SWZE 4ZO6A 4YWGH 3M07A 2F74B 1SEQL 4RZKA 3RAJH 4I18B 4PJ5A 4NQTA 3JT2A 1J8HD 4LIQH 3ULVL 2WO3B 1SVCP 4BZ1H 3ZL4L 4KPHH 4O4YH 3NJIA 2R69A 3OWRA 4HLEA 4M03A 1E30A 1RIHL 5EDSA 1TZIB 5DEJA 4FG6C 5TF1H 4PRHE 1CFVH 1FPTH 4W1TA 2ICEC 1AANA 4ZW7A 2E5EA 2PPFA 3RIFF 5DS8B 3VH8B 2BJMH 4HJIA 5CU5A 1KULA 1MI5E 3O4LD 5F89B 1ZSHA 1E6JL 1P4BH 5KSAB 5I1KH 3MREB 1IEBA 2H0FA 2XQYA 3O0LA 4P3DA 2G2RA 2N7AA 3VWKD 3EYVB 3PCYA 3GRWL 4PJGF 1KCUL 1BVOA 1TQCC 2L7EA 1UB6A 4K7PL 1KCVH 4PJIF 4RWYH 3OMNB 5LGHH 4XC1L 3UTSA 5C0BE 4J3XA 2HJKB 1B2YA 5CILH 4FQXA 4JBSA 1BJMA 2FWOB 2PXYC 3HE7C 4PGCA 4PJ9D 2VITB 4B7IA 1TU2B 4NB7A 1MW3A 1VA9A 4FMKA 5AWNL 1KELH 1MCRA 4BE6A 4IS6A 4PUBH 5F0LB 4OV5A 5DJXA 3JYCA 4BZ2H 3LIZH 4G3YL 3VW3H 4XP4H 1F5WA 4P59L 3D39E 4EKXA 4AQ1A 3FTGA 2CAKA 3IPEA 3LV3A 3NCYP 3MLVH 1Z3RA 4IDLA 3BP5A 4FZEL 2Y22A 4FP8H 3P9MB 1QBML 1UOLA 1VB9A 3MOQA 2BFVL 4XP1H 4PJ8C 3K2IA 5BRQA 1JTPA 3GMMA 5KW9L 2APFA 4FOMA 5BS0D 3CK0L 3QJXA 3VGFA 1T21A 4IGBC 5BQDA 2E56A 4ZFOL 3M86A 3V6ZB 1QSVA 1CBVL 5FA3B 2VYRE 5AW2B 1FJ1A 3ECBB 4HC1L 3VNYA 3SQRA 4FXKC 5F71A 2I7OA 1SF3A 2P80D 3BJ91 5BOZG 4NGHH 4R90H 5LGKA 4Z7QE 4PREA 1JVKA 5T5FL 4WI2A 1LE9A 2GEQA 1BVNP 4UQ2B 4UOW0 4ZODA 3T9WA 1W15A 3KL0A 2JTYA 1D5IL 4Y5YC 5DJ0B 5J12C 3BAEH 1JWMA 1I8AA 4OLXH 2BPBA 3H9YA 4JFDA 3N42B 1UQSA 1RAMA 2PCYA 5EFIB 1PG7X 3AMLA 3HC2A 1PZAA 3EW3B 1T6VN 2H6PA 5BV7C 3UBGA 4HD9A 2ZPKH 1IUZA 1D5MA 5GGRB 5E2VH 3VXUE 5KVDE 3MQIA 4Z6AT 3ILDA 4YDNA 4PY7A 2J56A 3P4NB 2ZIDA 4RFEA 4RA0C 3GM0A 3DURA 4B60A 1D2PA 2C3WA 1NIEA 1E4WL 4K07A 3DRQB 3QQ3B 2XBDA 3H9HA 4OTXL 1NSNH 5AW5B 4UNVA 1NEZA 2JQZA 5KVGE 3BEVB 4GRLA 4XP6H 2IH8A 1TQSA 1IGJB 5CHNB 2PWEA 1OZTG 4MNQB 5KSVB 1MREH 1QABA 3FB8B 2CWRA 2EEBA 1NBCA 3W0WA 3GSNL 2E7CA 2NYKA 3O9WD 1AHWB 3BFWA 3NACL 1HOEA 2Y7OA 4PAZA 2PPAA 3BKCL 3UDWA 1RURL 5FYKL 2WKLA 2I5YL 3FT2B 4XN1A 1MY5A 3QDMA 3NJNA 1GZHC 1ZSDB 3QNXB 4WWKC 3ZMNA 4DCQA 2WXKA 2BOBB 4AM0B 1NUGA 2XVGA 4PTTB 4G7VH 5A2LH 4BIKA 2WZAA 3W11C 2PTVA 3BE1H 4KKRA 3QZLA 3BIKB 3V95A 5DZNA 3NZUA 4XN5A 3BRGC 2B9AA 1RV6X 1TJMA 4RSVA 1OHZA 4GAYA 5F0MB 1NDGB 4CVXB 4Z8FH 2VM4A 4H8HA 1KYOJ 2E6PA 2W9EH 4G72B 5KN5A 2VW4A 3T0XA 2WNGA 3OPZH 3OHMB 4JFWA 4TNFA 2VRQA 3BDYL 3ZMRA 4Y16A 1SQ2N 2DW5A 32C2A 3FT3A 4OCMC 1AGDA 4W6XB 1XAUA 3DVNA 1A3RH 2I27N 3QWQB 4R4BB 4FQJL 3SDXB 3BVWA 3WUWA 3WDIA 1CJYA 3AGWA 1NLBL 1YEFH 3LN5B 4JDTH 4E36A 1F58H 5KS9E 5IVOA 2OPCA 1AGCB 5T1JA 2DEWX 4FQQA 4ZOEA 5KOMC 4W81A 2CJ3A 4XX1G 4QNPE 1SJMA 3B8SA 1XL6A 3VFSA 4EI5A 5B38G 3BWSA 1T83A 3OAZH 3ETSA 3EDEA 4NQDA 2OR9L 1HQ4A 3L3OB 4Y9BA 3MV9A 5GRWA 2AANA 1ODAA 2WIIB 3V8OA 2IPTH 1N2RB 3LKRB 1INEL 2K45A 1JVOA 5AYUH 1MW1A 3UC0H 4NBYB 1C5DA 1OD7A 3ILPB 2B1AL 5LLIC 3GSQA 4ELMA 3SKJL 3SDAB 4ALAC 1PZ5A 1MG2C 4U3SB 3F5WA 3INOA 2XJLA 2E76C 3UZQB 5BJTA 3HRZA 2DMKA 3F7VA 1ROWA 2YD0A 1GGCH 2WBJC 1I1AB 4FS0A 2XFXB 4JO2H 4G42A 3RGVA 3X17A 5C7XL 3PJSA 4NQSB 2GHWB 2XN9B 1F1AA 3LS4L 4CMHC 1T6BX 2PYEA 1UD8A 4YEFA 3WNIA 1DFBH 4R0LC 4ZX5A 1FSKC 3ALXA 2K3HA 4JFOA 2BZDA 4XVSL 2VR6A 4DN3L 1U42A 3M45A 4HIJB 4LSUH 3T0ED 3UAJC 2KUTA 4AYEC 1BG9A 5I17A 1A9VA 2JJUA 2J43A 1R1CA 4I5BA 4KKPA 4PLOB 1AFVL 2W81C 4LPTA 4MYWB 1M6UA 1DANU 1P0SE 3L3DA 5KZCB 4P5TC 2H3KA 2PP8A 4MBOA 5L88H 3QDAA 1I3GL 2LAAA 4OD2A 3GUTA 3BP7B 3WYRA 1EH9A 4XP5L 1YMHB 1R5IB 4DO6A 4NPYB 1WEJH 4MJ6B 3I3EA 4HKJA 1A22B 4P4KA 1RZJC 1G1KA 2IGFL 4XO3A 4A63A 4RGMB 4LRNL 3BZ5A 4XCFH 5IFHL 1MW0A 3NN8A 5I6NA 1QSEA 4JM2A 1J9TA 3JV6A 3DVGB 4P0DA 5K9JL 4ZFOB 1X5ZA 4Y9FA 5E1IA 1AQDA 3TWCH 2DIJA 5D7LB 3G5VB 3PHAA 3CIQA 4D0BA 2VE6A 4M8RA 4PW3A 2NSMA 3BCDA 4F93B 1T4KB 4YIQA 4I1PA 5IQ9B 2ICCA 3SCMC 4LQFL 3SBRA 2J5WA 1AXTH 3ARRA 4KXDA 2HB0A 2ETWA 2R1YB 2R1XB 3QJVB 1NKGA 2JJSA 5EN2B 2VLJB 5HJDA 1BQRA 4L0ZA 3SPGA 5B1JA 3JTTA 3L1OH 3RWCB 5I0DA 1UM5H 1NCNA 3NJLA 4HAKA 4MMXA 1LTXA 4AV0A 2CO7B 1EAPA 4TLTA 1QVOA 4LARL 2OS7A 1JPGB 5BZDB 3C6SB 4OGYL 3U79A 3LZOA 1TIUA 4AI7A 1U58B 4IMKA 4F15C 4EOWH 2WUCL 3GZKA 3O45B 1XTMA 2X3AA 1BJ8A 2GY5A 4WI6A 2V2TB 2BCKB 3RNQB 4JFVA 3GJFK 4ZPVB 1BQHA 2ZD0A 1DQLH 3KR3H 2Y7SA 1TETH 4H0IA 2EDMA 3LKPA 4BYHA 2EC9T 4XXCA 3G08B 1NAMB 1PCSA 2PO6C 2YUWA 2CBTA 3CX5J 4JFEA 3VFGH 3L3IB 1KLFA 4EN3C 3LNIA 5I1HL 5AB2A 3U6XA 2RFXA 5F3BB 1B4LA 3TVMA 1FGVL 1I9JH 3A22A 4ISVA 1HEJC 2OZ4A 3WEXB 1QUPA 1YEJH 3OZKA 4Z3IA 2EAEA 1K8DA 2AS5M 2MCMA 1KBKA 5E8OB 4JGMA 3EAKA 4PCTA 2Z3FA 4M7JH 1KGCD 3GLAA 3GSNB 2GSIB 5MP6L 2OTPA 3HMXH 3PWVA 1ITBB 5E23A 5E2UL 3JT0A 5ESVB 4YHLL 2EC8A 3MX0B 3QDGD 4R26H 4MJ2A 3HA0A 1JWSB 1MCDA 3VXSD 1NMAL 1WFMA 3VWJA 4MX7A 4B95C 2CGZA 3S2CA 5DMKB 3TL5A 4ZT1A 3WO3B 1O6SA 2D3LA 2ZWKA 1HSBA 1IKFH 3KPMB 3B9DA 3PPSA 3LS5L 3KBEA 3Q8BA 3QZWG 1O5PA 1CFBA 3NPZB 5B1KA 2PF6A 3MCLL 1MAJA 4Z5RA 4P5KB 4WTZG 3DX1A 2DWDA 4IOFD 1CD1A 4I1NB 1G6RH 3WHE0 1LE5A 2ZKXA 3D50A 4YK4C 1GXEA 1KYAA 1A6AA 3WJMB 4IBVA 4PBDA 2V2WB 2XC8A 3T08A 2FK9A 4N0UE 3WFCL 5IVXF 4GP8B 3WXVH 1BAFL 5KJ4A 1WE5A 5JW4Q 5IB1A 3NJKA 4NRYB 1BLIA 1YG9A 1H3PL 3TJPA 3R0MA 3DPBA 1TMQA 4Q89A 1DE4A 1G9MC 4HK3J 5BUAA 4YXLL 2WZ5A 2L0DA 3LYRA 3FTUA 4UIKL 3ZUCA 1Q72L 5AVXB 4D0DB 4YDLB 4Z7OB 1JPFA 2A6KB 1LP9B 3B9KD 5E6RB 3DK0A 1HHIB 3B37A 4GKLA 3DROB 5H94A 4XRCA 3CFEA 5SWSD 3APNA 2F53A 3EUUA 5F97E 2ZOKA 1OOWA 3MJ9A 2A74B 3O2VH 2WJ5A 4Q9RH 3D2UA 2AXFB 5EULV 4B9PA 1KB5L 2X4TA 2W9LA 1FBIL 5FS5A 1JZ5A 5KSAD 1FIGL 1W72L 3BQVA 2W1NA 2WCPA 4WSKA 1EHXA 4CBPA 2LV4A 4OSUH 4HEPG 4YDIH 4TTGA 3UJIH 4OCYH 3RLSA 4PGEA 4HIXL 5HGHB 1MCPL 1MRFH 1YDPA 3E1F1 1OF0A 5FGCE 4OI7A 2E7HA 3KPSD 4H4NA 2WVSA 4N87A 2H26A 3UFIA 3KYNA 4YC2B 3P0GB 5B8CA 2AK4B 2AF2A 1K8IB 3ZIMA 1DJZA 4X7TA 5J9PB 3CH8A 1CLYH 3IKCA 3BWZA 1ZGLP 5CKGA 5AVTB 5BVJB 4GI9A 1G7HB 4UQEA 1MFAH 3ZX1A 4F9LA 1WTLA 2X12A 4MAUH 4TUOB 1QFWI 3UTTB 2GEEA 3UAFA 1OARH 3FQTA 4HLZH 1MHCB 4JDEB 4M4RB 1RUAL 5EB9A 1HCZA 1IAIH 4NP4L 2GC4C 3RDTA 3LEYL 4ZUWB 1CFSA 4NIKB 1KN2H 3O41A 4U1SA 3MUJA 3GC3A 3KWXA 3VFRA 2KZ1B 1J8HA 3Q48A 5D7KD 5IWLC 1KBGL 5I76A 2DJUA 2VJXA 2D7MA 2QGDA 4WI3A 2BERA 4KKBC 1LXMA 5DR5H 2LE9A 1N4XH 3CH1B 4XO8A 1KXQA 1ZEAL 3D9AL 3ZDYF 3BEWB 1AQKL 3QARA 3U0TA 3WS6A 2CIIB 1VZIA 4AH2B 2CGRH 3DMMC 1D5BA 1HL9A 5D7IB 3NK4A 3FOMB 4EBQH 3GRWH 1BCIA 3N1QC 3RFZC 1U8LA 3VWKA 3BRFA 4PY8I 4NWTL 1AQMA 3EDDA 5KBPA 2NTSP 4WV1A 4UT9H 1NFDE 3OX8B 4W9DC 3T8XB 2LFGA 1EBPA 3FN0L 4O00A 5IB5B 4KK8C 3WKYA 1B3IA 4PJ9A 5JW4N 4C56D 4S1QL 3QYNA 3V5KA 2GJ6E 4G3YH 2LU7A 2O61B 3NCXA 5DMGD 1DP0A 3IFLL 1ZHBA 3BP6B 3OHXC 1YYML 1ZS8B 4O9HL 4NZJA 4M61B 3S3JA 4ZSOA 2OR8A 1J5DA 5DS2A 1FAIH 1OGAE 1Q0YL 1WHOA 2OQJB 4IRZH 3BPNB 1P84K 3O8XB 3FONB 2HT3C 1JAEA 3QFDB 4Z7AA 3B2VL 5IHUL 3VQMA 5EU7C 4P48A 2IG2L 3KPNB 3MA9L 4K23L 5KYNA 4F57L 3JVGA 4LLDB 2C4FT 3WOVA 2Y3NA 4TNEA 2BIOA 3P77A 4ZQKA 3ABLB 2QSCL 4DO5A 5BS0A 3IJSB 3RUGB 3O2WL 2EDLA 5BNXD 5DHVH 3PPEA 1WS7A 1MJ7L 1MHEA 4RCAA 5D5MB 1J05A 1I8IB 3KPRB 2V9TA 2YZ8A 1KJ3L 3KYKH 1JF1B 2VABB 1W6WA 4EQ3A 3O2DL 1S78C 3OJDA 4D9RE 1BXUA 2WYTA 3CHRA 2GT9A 3EJPA 3ATFA 3MRFA 5JNYB 4EIZC 3B9EA 3X1NA 3SOBH 4M1CD 5E0QA 4GAAA 4DZ8A 4HAFA 1QZNA 4OQTH 3I75A 1HEZB 1F1DA 4OLUH 1OPGH 5IBUG 1HCFX 1AR1B 1AQHA 1QSFB 3NRFA 4CSSA 1CLCA 1IQWH 3G6AB 4TSBH 3TBCA 3BD4A 1CDJA 2YPLB 4ZMPA 1BZDA 3QXTA 2DM4A 2EIKB 2UXGA 5BOJA 4ORGB 1HHKB 4EEEA 3ZE0E 1NC2B 4GG6B 2VW6A 4OLWL 2BX5A 4MD0B 2OTWA 3FL7A 2XDHA 2F7IA 1J48A 3TP4A 4OCXH 3TO2A 4HIEB 3US9A 3S5ZA 4ONGL 2K78A 5IOPB 1T6WA 3FO0H 2ADGB 3IGFA 4PJEE 3VXPA 3B2XA 4YSPA 4J3SA 1BQLL 1S9VB 3FOLB 1NEZG 1MWAL 2CIKB 5K1VA 4AVHA 5KVEH 3BKCH 3MLWH 2QADC 3VFUB 3G5YA 4PRNA 5HVFB 3BAWA 4U1MB 1PEWA 1RZFH 2CSPA 2I5YH 3M46A 4JFFE 4AW4A 4X4ME 1ZLWK 4ZFZA 5EDXA 1EHAA 3UYPA 2R0ZL 1ZV5A 4N8VB 3QHFL 4HBQA 1KB5B 4PWFA 1BXXA 1RUQH 1XZWA 5HYQB 4WHYH 3SDAD 4GMSH 4J3TA 3F7LA 5CO1A 1W72B 2UWEB 3H53A 1XH3A 4RFNB 3G5ZA 4G8GE 4UOQA 4N3TA 1OAJA 2V17H 4HHAB 3B34A 2P5ED 3K2KA 4X5XA 1GY1A 1CI3M 5TE7H 5C92A 5K9QG 5KSBA 2XN9D 4LSDA 1HDMA 1S7TB 2Q2LA 4GXUM 4MS8D 4NBXB 4QJ3B 5KEZA 3GRGA 2PXYB 1MRDL 1LD9B 4FNSA 4G7RB 1MHHA 2A77H 3KVPA 4XZUB 4AKQA 1OGPA 4MZIA 3L13A 1CS6A 1H3GA 2H32H 4R2GC 5AB0A 4S1DD 4O58H 3ARFC 3WG7B 3CIAA 4Z7NF 2H5UA 1PG7L 1CFNA 5MEQA 4W4NA 1QFWH 3PUCA 2VKXA 4OFVA 5CEYA 3WUWG 2H9GB 3IF1A 1EUUA 1A1OA 3CVHH 5FAAA 5KZCD 4RISL 5F7MC 1GKOA 3RBGA 4TQEH 5EO0B 2OKMA 4AY0A 1GZQA 1QUNA 3RA7L 1S3KL 3WKML 3MRRB 5DJYA 4JM0A 2AP2A 4IBQA 5CUSL 1TTRA 3CUPB 3DNKA 4ANVA 5J5EA 4RA3A 4DQAA 5KVFL 1VEPA 4PR5B 5ITBL 3PXHA 3RFRA 5ESAA 3N06B 5HGGS 3VJ6B 5GZNC 3RVVC 1I7ZA 1CT8B 1JK9B 5D2LA 4XP9L 5GGQL 1MLBB 3FQUB 3SE3A 1M56B 2F58L 4KDWA 4HPOH 3F7RA 1U6AH 4Z7UB 1ES0B 2B0SH 4MMZA 2O5YL 3QRGH 4XOEA 4EXKA 4GBXC 2BP8A 5EG6C 4OI8A 2IAAC 1ZCRA 2FRGP 2NZ9C 1A9BA 2N1TE 5I8KL 4D7BA 5DGRA 1L7TH 3LH2L 4OM0H 1U30A 4PJFF 2X1PA 5DWUL 1IGYA 1ED3B 3H7BA 3GI8L 2XHNA 1DYZA 2H6OA 3LQAL 1C5CH 3PDGA 3ZSTA 5JR1H 2G3NA 1DQVA 3D18A 4LEBA 4GAGH 4IBTA 3B7RL 3GSOA 3RY4A 4MXQC 5D71H 3D0LA 4GRWF 2MCG1 3TZVB 1HWWA 1BZ9A 2CHDA 2QDVA 3SEPA 3CGTA 1ORQB 4U0QB 4QLWA 4QOKE 1MVFA 1YPZF 1UGKA 4P2QB 3HI6H 3O3EA 4M5ZH 4K4KA 1FZKA 3T4AB 4HJEA 1VKXA 2JB5H 3HZYA 5F1NB 1EJFA 4MAYD 4MNGE 3HAEA 3ABGA 2YPVL 4XH2B 3TGXA 1BMWA 4KO9A 4UAOB 3N43B 4CJ1A 2QZ5A 1H8OA 4HJ1A 5CS7A 4X6DB 5D1XB 2ADJA 5FCUL 3RWDB 5EMYA 5HTSA 1TLMA 5FYKD 4KQ4H 5EOTB 1BV8A 3T6WA 1H6EA 3AREB 1TNMA 4Y19E 4ZYKB 3K8LA 3TCLA 2CBQA 3KCWA 3B1UA 1T7ZA 5E6YA 1FVCA 4FQ2H 3JV4B 4OUOA 4HUVB 2XACC 4HSCX 1Z9MA 2WYHA 1K3ZA 2G9KA 3LPPA 2PABA 5AKRA 4CGTA 3HNSL 4OZHA 2DQJL 2E9WA 4BGDA 1A4JB 4QHLB 1Z3GH 1Q9KA 4MJIE 2FB4L 3I3BA 5IEHA 4NN7B 2OR7A 1P5UC 1UZGA 2DKSA 1B4TA 1RPKA 4U0RC 2YOCA 1QYGL 1YHPA 4L3EA 2H3NB 2EEFA 4YPGA 5AFAA 4P2RE 1G7IB 4H20L 4P06A 5AZ2L 1UH2A 3EUDA 1BQHG 1MIML 1IV8A 3Q2CA 4KNQA 2MQ0A 3P4OA 5LXGH 3HTLX 4OZGB 3BI9X 1CE1H 4A6YA 2X6BA 2BVPB 1QR1A 1JVLA 1PDKB 2XLLA 4H1LB 2WYZA 2V8LA 3EZ8A 1WITA 5LJYH 1DJYA 2X4PB 3NIFE 3Q6FA 4U7KA 5CBEA 1MWAB 5JW4R 1JGUH 5BO0D 2XPZA 2AABL 2FD6H 2A83B 3KVQA 3FB6A 5J11B 3WFBH 2ICWB 1HXYA 4G7YH 2VDML 4NSKA 1N0XL 3EO9L 4XNUL 3VXSA 3KYOB 2BSSA 1WHPA 1AJ7H 5DA0B 4AK2A 1FE8L 1MAMH 1IL1B 3DX7A 4GS7C 4PTUB 2WBJB 1E6OH 1SQMA 3A6CH 2Y72A 1SDDB 4MZ3A 4UZUA 4ZS7L 2VXQL 5K9OB 4C4KT 1QO3A 4OCWL 1IC5L 2MTAA 3LSOA 3MNDA 4CMHB 4FYSA 4F2EA 5I18H 1OP3H 2VXTH 1T20B 5D1QA 4BFOA 4HOXA 5IB4B 2AK4D 3JTSB 4YBLC 1E5CA 2GJZB 4FYTA 1JXJA 1FV1B 4WO4D 5I15L 3ECWA 2AI0L 4PJXA 2HX7A 1FO0L 4NKDA 3MU3A 4PLKD 5HI3D 4PJHF 5L2JB 1NOLA 4NQCE 2AQ2A 2GK0B 3CC5A 3K4DA 4N0FB 4ZUUA 4G71B 3NSXA 3KYAA 1BLNB 2P4AB 2XN2A 4R3SA 4ATTA 1RH8A 2B5IC 3CHXA 3ARTA 3L7FB 1QZ1A 3N5AA 3MRQA 1Q72H 1WZMA 4HWEL 4YZFF 1CL7L 1RJZA 4U3HA 2ROYA 5IMKB 1R3IL 3FO2A 4WEUD 2H8PB 2EIEA 1NEPA 1VLXA 4ZOCA 2V7HB 1O7DC 3D6GA 3B9KA 1TZIA 4KMTL 2WINB 1SN5A 3C6LC 1BEYL 3LMJH 1AZUA 4Q6KA 3B6SB 3CZGA 3H4HA 3VH8A 3WL9A 3B56A 4AYBA 3TBSB 4YSEA 5JO5B 3KDPB 1TLKA 3P69A 1FVDA 4OJDH 2R56L 2EYRA 3TFKC 3U4EB 3ZDZB 3CXHK 3MREA 3RILA 5KSAA 2XKSA 1M57B 3SCMB 2E6QA 1NDTA 3EYVA 4R97B 4RGNC 3L5XL 5E8PB 3KPSA 3EF4A 1EZVY 2JIXD 1T1WA 4ZXBC 1UYWH 3EBHA 4D0CA 2EZ0D 1XIWD 3VYNA 3I9GL 5F0JB 3HBQA 5F6HJ 3SD5A 5DMIH 1LO5B 3L2NA 2ZX5A 5CZVH 5LNDA 2HJKA 2XIDA 1YN7B 4PJDE 5IREA 4M5YH 1R3JA 4KC3B 1NUDA 1XX9C 2B4CH 1L5GA 1TU2A 1A6WL 1PY9A 1X5YA 2DRUA 2VITA 3EOTH 3P02A 4OIAA 4WW2F 4DESA 2Q1EA 3UBHA 4YGVB 4ZTPL 2W9DL 1N6QH 4WRLA 1Y6MR 3FUHA 3JUYA 1JHKL 1CR9L 1W16A 1ZWIB 2BY1A 2I25N 3KCPB 1CD8A 2X1QA 3K74B 4XAKE 2ZX9A 1DQMH 1TKWB 3ML8A 2PO6B 2VDNL 3O8XD 1Y6KR 3NFNB 4KQ3L 3EKCA 3QFJE 1MFEL 3P9MA 4KKQA 5MEPA 1C9SA 3L4UA 3T65B 3UYRL 1AQKH 4PRPB 4PRIB 2FX9L 5HI5D 5DVNA 2NXZD 4QRRE 3N40F 1IGTA 3CPLB 1YNTA 2O30A 5HPMA 3V6ZA 1T2JA 5HYFA 3V0FA 5FA3A 3WMPA 4PD4K 2ZWLT 3KPRD 4OD1L 3ECBA 3R06B 1A7OH 2Y7MA 4NWTH 2Y24A 3JWOC 4B9KC 3BT2H 4DP4X 2BNRD 3VO0A 1ZTXE 3FO1A 4HIIB 1F4XH 1YEGL 2YN5A 3VXQB 4PRAB 1J9QA 4UQ2A 2FATH 5L4FA 1S7SA 3ULUF 2QPDB 4RGOL 1Z6JT 5B3NA 2AHIA 4RIRA 1KV3A 1SPDA 2VAAB 1E65A 1CGSL 3CVIH 1BF5A 2PPCA 5ADPH 1RPQA 5GS1C 4UI2A 5EFIA 5AAPA 5ES4B 1AR1D 3HUJE 2ZWSA 2BP0A 2GITA 4ZUVA 1A5FH 1T1ZB 1YEKL 2HFEB 3QHZL 5DFAA 3TH2T 1AKPA 2XTSA 5GGRA 2K7PA 4DGYL 3UADA 1UCBL 4YK4B 4ETQB 5LG6A 1IC0A 1UJ3C 1NC2D 2IANE 2VDKL 1LJMA 4JFZH 1NH6A 5D8JL 5DJZB 3M17A 5I74C 3P4NA 3GS4A 2R2EA 4LLUB 2ADFH 4RBPH 3PJNA 1KFGA 2VZOA 1OXYA 1VAHA 3DRQA 1IARB 3EFOB 3QQ3A 4UTCA 2BHYA 1KLUB 3WIIL 4FRWA 5ADOL 3O2WH 3J7HA 4JHUA 4UT7L 3UTPE 4ANXA 2YD6A 3SN6N 5AVYB 1IGJA 4OGXL 4JPIA 2FUTA 4LL1A 4MNQA 1GSKA 5DK2B 3ROOB 3ZE2F 4C47A