2GC4C

Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
total genus 25
structure length 105
sequence length 105
chains with identical sequence G, K, O
ec nomenclature
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2gc4C00
5I6LA 4GP5B 1AZCA 1OCRB 1T5KA 1JERA 1ET5A 1NIEA 1KCWA 2R7EB 3N2JA 1X9RA 3AG1B 3CVBA 5B7EA 3OMAB 1E67A 3C75A 3NT0A 1MG2C 4DPCX 3ASNB 1ASOA 1GS7A 3IN2A 2XWZA 4E9RA 2IH9A 4UAHA 2GB2A 3ERXA 3CDZB 1DZ0A 1J9QA 2FQFA 1AG6A 2IDUA 4G7QB 4HCGA 4HIPA 2EIJB 1E5YA 4BK5C 1AS8A 1J9RA 1M56B 2H3XC 2UX6A 2BWIA 4DP4X 4DP5X 1OE2A 2CAKA 2BP8B 2YAMA 2HX8A 1CC3A 3T9WA 3FQ2A 2GC4C 2EIKB 3WKQA 1NPJA 2UXTA 2QDWA 3X1GA 3IE9A 4YVNA 4ENZA 4WTQA 2Y1AA 2XV0A 1A4CA 2XYBA 2GBAA 1PY0A 2FT8A 2YAEA 1TEFA 2PP8A 2YQBA 3ZIYA 3QJUB 1GS8A 5I6NA 2J57A 2FT7A 1J5CA 4KO5A 1YLBB 1JZEA 3CZUB 5I5IA 3EHBB 1GW0A 3WIAA 4YSCA 4G71B 3ZBMA 7PCYA 3WG7B 1OE3A 2BZCA 3HEIB 1J5DA 3NJMA 2CCWA 5AKRA 1L9OA 1MZZA 3GYRA 1TEGA 1JOIA 4HALA 3QQXA 1UATA 5TK2A 3PAZA 1JZJA 4UF7C 4UANA 1VLXA 2WSDA 3FYEB 2PP9A 3UABA 4AKQA 2IAAC 1AACA 1AAJA 2JXMA 2YARA 2DY2A 3U25A 4BXVA 2W88A 3MBWB 3L45A 2XV3A 3S3DB 2YAOA 1HAUA 1KDIA 4YL4A 1EZLA 3T6XA 4BWUA 3PAUA 2DWTA 1WA2X 3OMNB 3AZUA 4F2EA 1A8ZA 1CYWA 3ABMB 3H4HA 2QT6A 1RKRA 2Q5BA 2PPAA 3QJSB 1A3ZA 1SDDB 3TBBA 4A2GA 1ID2A 2VW7A 1KYAA 4YSQA 2XVBA 1BYPA 1RZPA 1OOWA 2YXVA 5I6KA 1FFTB 2FWLB 3NSFA 3WKPA 3NSDA 2BW4A 2J55A 3NYKA 4KOCA 3T71A 1A4BA 2YAFA 1QHQA 5AFAA 1SFHA 3PLYA 1JXDA 3S3BB 2X87A 4F7KA 1IBZA 3ABGA 3TU6A 2PLTA 2W8CA 2WO3B 2IWEA 3UAAA 2GHZA 3S8FB 1BQKA 1M57B 2HLEB 1AS7A 4M4RB 2VMJA 1ILSA 4PAZA 1KDJA 3FU7A 2GIMA 3GXUB 2AZAA 1WA0X 5B1JC 1OE1A 4GYBA 2BO0A 1QLEB 1GY1A 1BXUA 3NJFA 2EIMB 4DP7X 4K9JA 3FPYA 4A66A 2J56A 2XXFA 3SBPA 2BP0B 4YSTA 3G5WA 2CJ3A 1PNDA 5I28A 2XLLA 1EHKB 1PZCA 1X9UA 2IDTA 1AR1B 5I6OA 1KV7A 1J9SA 1WAEA 2HX9A 4YVUA 1BQ5A 4G72B 4KO9A 1OCZB 4EF3A 4YSUA 3EH4B 3NSYA 3RYMA 2VSMB 1NWOA 1RZQA 1NTDA 2AANA 2IWFA 1NPNA 1NICA 5B1BB 3CDZA 5PCYA 4F2FA 2FT6A 1GR7A 2ZXWB 1I53A 1E65A 1PLBA 1XB8A 3V9CA 1TU2A 3FSVA 2J5WA 4X4KA 3SBRA 1AOZA 4E9XA 2BP8A 4BXSV 1PZAA 1XMEB 4Q8BA 1AQ8A 2XX0A 1JXGA 3S8GB 1IKOP 3IEAA 2HRHA 2EILB 1ZV2A 3T6WA 4NERA 2BZ7A 3UGEA 1ZPUA 4AZUA 3NSCA 1WS7A 3FS9A 2JKWA 2PPCA 5I6PA 5D4HA 6PCYA 2AZUA 2VM3A 4E9QA 2FNWA 3NJGA 4BWWA 3KW7A 3TASA 3T6ZA 1JZHA 2QPDB 4A2EA 3ASOB 4YSSA 5PAZA 1OF0A 1PLAA 2H47C 3NJJA 4NAJA 4DPBX 3NJHA 1SFDA 5D4JA 3SBQA 1JVOA 2VW6A 1PZBA 4PCYA 3CVCA 4DP6X 1SNRA 1ET8A 3EH5B 3NP4A 1HFUA 5F7AA 3X2QB 1N70A 8PAZA 1JZIA 3FSAA 2YAPA 3X1NA 2AFNA 1NWPA 2VSKB 3UACA 1ASQA 3QJTB 1OCOB 1JVLA 1KBVA 3N55A 2E86A 4JHVA 5E9NA 3OM3B 4GXFA 4BDVA 4CSZA 2TSBA 1PMYA 4YSPA 1NIAA 5EHFA 4AKOA 1SDDA 3FU8A 2HZHA 2TSAA 4E9TA 3OQRA 5I6MA 3AG3B 1ILUA 2BWDA 1BXAA 2GI0A 5I26A 2PPFA 2XV2A 3X1EA 4RH4A 1OCCB 3JTBA 2BHFA 3NJLA 1KCBA 1SF3A 1L9SA 2DYSB 3PAVA 1V55B 4L0PB 3FPXA 4W1TA 2UXVA 3FSZA 4HCIA 2QDVA 4E9YA 5I5JA 2UXGA 3FSWA 2B3IA 4DP8X 5F7BA 2HRGA 2EINB 5B1AB 4E9VA 1JZFA 1ADWA 1JZGA 1N68A 2P80A 2XUWA 1ZIAA 2B08A 3FT0A 3HB3B 4DPAX 4DP0X 4P5RA 3NJIA 5AZUA 3MX0B 2OV0A 4W9ZA 4M3HA 2PP7A 4BWTA 4P5SA 1W8EA 3FYIB 3ABKB 4GP4B 3FQYA 1GS6X 3SQRA 2ZONA 3ABLB 2RACA 4TXVB 2VN3A 4KOBA 2R7EA 1ZIBA 2WO2B 4A68A 2CALA 4QKTA 2BP0A 5FC9A 1DYZA 4YSEA 3KW8A 1MDAA 4Q89A 4AX3A 2QPEB 3WNJA 1AIZA 3PCYA 2XU9A 3UAEA 1W6WA 2UX7A 1HAWA 3S3CB 4WKXA 2NRDA 1JXFA 2IWKA 9PCYA 1TKWA 5D4IA 3AG2B 4KNSA 1BAWA 2H5UA 3NJNA 1R1CA 3CG8A 5I5MA 3T6VA 2IDQA 4YSRA 2XX1A 1CYXA 4YSOA 4AI7A 4E9WA 1AZUA 1E30A 1WA1X 2HX7A 2GSMB 1ZDQA 4HHWA 1GY2A 3PXLA 2PPDA 4AKPA 1CURA 3BVDB 1AZNA 1BQRA 2FJSA 2YAHA 4HCFA 4DP2X 1QNIA 4GY4A 3AY2A 3BQVA 3GDCA 3QJQB 2X88A 2PCYA 1AS6A 4FA7B 2ZOOA 4N4YB 1A4AA 2I85A 4G70B 2N0MA 3TBCA 3DKHA 5IY5B 5B3SB 7PAZA 1SHXA 2VW4A 3QPKA 2LLNA 3TA4D 2DWSA 1NIDA 4FAAB 2IDSA 4HHGA 2MRYA 2OJ1A 5LDUA 1GYCA 2Y69B 3IBOA 3OD3A 4DP9X 1V54B 2DYRB 4NB7A 2IH8A 2OCCB 2PPEA 3AW5A 1M9WA 1ZDSA 1ASPA 4MFHA 1IUZA 1L9RA 3CVDA 2BW5A 4A2DA 4QLWA 1AZRA 3FU9A 2IDFA 3EF4A 4KNUA 2ZWNA 3PPSA 4KO6A 4JKNA 1IC0A 1PLCA 2JFCA 2A3TA 3D12B 1AZBA 1MZYA 4G7RB 4YSAA 1ETJA 1E5ZA 4G7SB 5B1JA 3IN0A 2FQEA 4A2FA 2AVFA 3AG4B 4HAKA 4HZ1A 3H4FA 1SJMA 1BYOA 1NZRA 5B7MA 1CUOA 1RCYA 1XB3A 1FWXA 2UXFA 3DTUB 2YXWA 4YSDA 1L9TA 3UADA 2FQGA 2FTAA 1SHWA 4ZK8A 4BDVB 3WNIA 4KNTA 3OMIB 1A65A 3X1BA 1NIFA 2I7OA 6PAZA 3FQ1A 2Q9OA 2P80D 4DP1X 4GP8B 4A2HA 2PCFA 1B3IA 3V9EA 2DV6A 1FA4A 3DIVA 1URIA 1AANA 1GSKA 5B7FA 1BEXA 1L9QA 3WI9A 4A67A 2VM4A 1NDTA 3ZDWA 1J9TA 1V10A 4CSPA 3FU7B 2HXAA 5ANHA 2YAQA 1KBWA 1SF5A 1BXVA 1W6LA 5B1KA 1L9PA 2CBPA 2MTAA 1PCSA 1AG0A 4JHUA 2I7SA 4E9SA 3QJRB 2CUAA 1NINA 3NP3A 3ZX1A 2XXGA 1ET7A 4N8UA 3H56A 5A7EA 2FQDA 2GC7C 1F56A 3JT2A 3NJKA 3EH3B 1KGYE 1WS8A 4KO7A 3QJVB 1IBYA 1XB6A 1PAZA 3X1FA 1MG3C 1NIBA 5TK4A 1OV8A 1PF3A 1PNCA
chains in the Genus database with same CATH superfamily
4NQXA 1OW0A 1AZCA 5I1EL 3HR5B 4ZXBA 3GMLB 5T5NF 1WWAX 4IBVA 1J1OL 3DURB 4TQEL 4PB9H 3LNDA 3AS0A 3Q1SH 2VZ3A 3A67H 1WZ1L 4F5CE 3EOAB 4PJ8B 4YXLL 2X38A 4P2YA 3DWTA 5T1LA 2CO7B 2KHAA 4M62L 1BF8A 4E9RA 3CVHH 3QIBD 1M2OA 4OM1H 1IE5A 2Z65C 3IGKA 3C6SA 4XZUA 3DUHA 3LQAL 3APCA 3HZYA 1OAQL 2O5ZL 4HCGA 1YEKH 4ESKA 1IGCH 4JFYA 5CEYA 1MHEA 1B2WH 4PS4L 4WFGD 4APQB 2K78A 2BP8B 3L9RA 2HX8A 1ZSDB 4Y5VB 3L17A 1WZKA 4JFDE 1ORQB 4C83A 1P7QD 4HUXB 5EU7E 3E9UA 1GXEA 4Y2LA 4XNBA 1ETA1 3LXCA 4ENZA 4HS8H 3OLIA 3VWJC 1SY6L 3BGFB 5GSVB 1S5IH 1WIOA 4KBPA 2A38A 3GUFA 4X9GA 4XPHH 2VE6A 2AEQL 3VVWA 4MLIA 4JM2D 1IAMA 1OT4A 2MQ0A 4LHUA 3BSGA 5I1CH 4PTUB 2R8SL 4UOZA 2HT3D 5CZXD 4FRWA 5FA3A 4H25A 5GS0L 3MRBA 4F57L 2OMXB 1UG9A 3PRZA 4TNFA 4YSCA 7FABL 2CCVA 4K8RL 3MRNA 2F1EA 2BOLA 2WKLA 1IAII 3SGDH 3MV9D 3VXTB 2B5IC 4OKVA 1P7QA 2BX5A 2OXHB 2X4NA 2YPKB 4N87A 4A2LA 4HALA 3MPCA 3JUYA 3S36H 4O2CB 3JQOB 3KLDA 5D8JH 1WK0A 3NGBB 1WBXA 1JZJA 3HE7C 3ZZ1A 1D6VH 3GJFH 4FULA 2CR6A 1C1EH 1L7TL 2PP9A 1UXWB 3QPXL 5TE4H 3LZRA 4YXHH 2IH3B 4POZD 1GGBH 1KPRB 4JM2A 3VW3H 2P47B 2H6PB 3LIZH 3IETB 3UTTB 1NBVL 2IQAB 1TENA 2BIHA 2DLTA 2VLLA 2B16A 3GHEL 2W0LA 4L4JA 1S7RA 3I6GB 5DJ2A 1Q0EA 3UJTH 3PAUA 1GKOA 5JQHC 1GOHA 3B6SA 3T0AA 4MJIA 2BSED 4P06A 3MV9A 5AVQB 2XA8L 3MA7A 2UZYB 5DURD 3WIHL 1OO2A 1LEIB 3HI5H 4KQ4L 3ULVC 3LEVH 4W9LC 1T0NA 2UUDH 1B0RB 2C9PA 5F97E 1E4XH 3QUYA 3BRGC 3MLTB 4OGAC 2YXVA 2DF3A 2XG5B 1FFTB 4IU3B 2H2PD 4MZIA 3FNKA 5DYFA 1I9IH 5C0FA 1UZ8B 4HUCA 4XO9A 1QHQA 3QFJB 4U1NB 3GRWL 4WHDA 1INEL 4OLYH 4N90D 2BIOA 3FT3B 3TEYA 1J9CT 1KXQA 2CNZA 3GF8A 4HPOH 4ZTOH 1BAFH 2KERA 2W8CA 3P40A 1QSEB 4XMVA 5FW8A 3WTVA 4HFWB 3QXTA 1Z0MA 3IAQA 1Z9SA 2QZ5A 3A22A 2TRYA 2N0KA 3SDAB 5EPMA 1CGSH 1OF2A 3N1FC 3DSNB 5ALBL 4N28A 1IAIM 1ERNA 4OQ1A 1ZTMA 2WCPA 3G08B 3FO0L 3SYQA 2O61B 4LLUB 3CFNA 1HZHL 2VZ1A 3HG1E 4ZPVA 4X9FA 4HJSA 4CVXB 4GYBA 3TNNB 3F84A 1RXLA 3ZE2F 4CADA 5AB2A 5M94B 2FZ3B 3ZPDA 3P3UA 1G9HA 5DD1H 3EDFA 3ZDXB 3G6AB 4TSCL 3BZDA 1E7UA 3T2NL 2K7QA 4YWGL 1GH7A 3UEZA 1W72H 3V0WL 1U8NB 2H0PA 3G5WA 4Q74A 4FG6C 2FO4A 3NZHL 4O5LH 5T1KA 4CN6A 2A73A 1KXVC 5EBGA 1CB4A 1MWOA 3FN3A 4YPJA 2NY6D 3QA3B 1IAOB 2ICEA 4PD4K 5CLWA 5IOKA 4F2MB 4BKTC 3IVKB 1OP4A 5E7BA 4K5PA 2E7LC 1G0XA 4PTTA 1KGCD 5J8OA 4U3CA 4TULL 3SKNA 1JPGA 2NTSP 1KXTA 5E2TH 1ZV5A 2ZWZA 5F1KC 1PX4A 3ZE1B 2PWDA 5KYYB 5DWUL 1H6UA 5F9AC 3DX6B 5GSRB 4A7VA 1ZOXA 1IAIL 2ZE0A 1MNUL 1NICA 3IDMA 5EA0L 5IQOA 2BFGA 3ARPA 2WMPB 2QFPA 4WI5A 4JPVL 3LEXA 3MV7B 1A66A 4X4KA 1FVCA 4QRPB 5DHVH 2B4CH 4JN1H 2WQSA 4FADA 1OT1A 2N4IA 4LSUL 4XPBH 2NZIA 4E9XA 3CU1A 2OSLA 3EZ8A 1AD9A 3LCYA 3O11A 3UYRL 4AWJC 2YO3A 3UPCA 2P8LB 3S34H 8FABB 4TQEH 1JNLL 3IEAA 4FABH 2BC4B 3FULA 4PPTA 5I8EA 4OCSL 2PR9A 3OC8A 4KKRA 3KE0A 4LVOB 3QUKA 3KYOA 4Z7VB 3PP3K 3WFHA 1DN0A 3W9EB 3KW7A 3TASA 1H3PH 2J8UA 3MRHB 4QRRB 4J5VA 5IBLD 2O5ZH 5HYEA 1I8MB 4Z78B 5CD3A 2JTDA 3U6XS 3NJHA 4KI1A 3KYAA 1A3RL 2X4RA 1AMYA 5ID0B 4Y2OB 3FDWA 2CRIA 5GRVL 5HPOA 5FYKH 1E9PA 4EI6B 1P5VA 5IESH 1QX1A 3IKCB 2ZF8A 4FD0A 3MRRB 5GS2H 2AFNA 3E3QC 4P23C 4D8PB 5IOPA 3CC1A 1D5RA 3NRQA 1FYTA 2N7AA 3SDYL 3DOSA 4L3AA 5TE7H 4AW4A 1ASQA 2KUTA 4LEOB 5IMOB 5LJYH 3RGVD 3X14B 4G8EA 2NY4C 1KBVA 2NUTB 2AMUA 2W0PA 3BWSA 4KHTL 5CJ8A 5DJ0A 3WE6B 1EVUA 1I1AC 2OL3H 3IGUA 3DIDA 4NRXB 4U1MB 4IRSB 4MTMA 4X2UA 4FQCL 2YK1H 7FABH 3A6BL 3KPTA 1MHPH 3QK0A 3L1FA 5EO1B 1LQSR 1RJYB 5T1DL 1TR7A 2YRLA 3GIZH 4F15B 5D6DA 4GLRH 3OWRA 3VTTA 4EVNB 4LCCB 2DIBA 1IGFL 4FYQA 2OR8A 5E0QA 3EOTH 5AVSB 5I6MA 4GRWE 4MCNA 3UBFA 5JHLL 1RK0B 1WFIA 3KM1A 3NRPA 5CGYD 1EXUA 3MJ7A 4Y4HB 3B2DC 2X4QA 2XC8A 3EJPA 4FQJH 2DYSB 1L6ZA 2YUZA 4KHXL 3RIKA 4GG6B 3N1QC 3SEPA 2UXVA 2VXSH 2BSDA 4FP8L 2MPAH 4KX9A 4E9YA 3MYJB 4MB5A 4JY4B 1ADQH 4XNXL 3EYUL 4M1CD 3W0WA 2VZTA 1IIKA 1CLCA 2EINB 5CS7A 4RGMB 2K6ZA 3HB3B 3Q8FA 1R75A 2QKIA 2XUWA 4GAJL 3REWB 3ZKMC 4DPAX 1WC7B 5TDNA 4NS0A 4NQDA 3JV5A 3V8CA 1G1YA 5JXEA 1BBDH 2A0LC 1C5BH 2CIKB 3MXVL 4J3WA 2X9ZA 4NRZB 4XC3H 1LP9A 3GMPA 3BKJH 5D72L 4OFQA 4P3CH 2FBJL 4U7KA 2VN3A 2VQ1A 1JNNL 2EVHA 2ZXCA 1ZIBA 2I32A 4G11A 4BKLB 2DQTH 2FYVA 2WW8A 5IHUH 1OALA 3O4OC 5KW9H 3EKCA 5EEXA 4XBEH 1YEEH 5KS9A 1T1YA 1AIZA 5KSAC 2EEFA 4P05A 4A38A 1UENA 3MJ9L 4ANXA 2F0CA 3BP5B 4UDUB 1IT9L 3HNSH 2GT9B 5T5FH 1FVDB 3BXNA 2CDEA 3I9GL 3T6VA 4AQ8C 4LXFA 1KTDA 3NZSA 3UC0H 2C9AA 1CYXA 2XX1A 1ES0A 5B3JF 4AI7A 4U0RB 4E9WA 1JJUA 5ETUB 1T6VN 5E2VH 2BSCA 4UTCA 2PYEB 4LSTL 4RFNC 4WKZA 4AKPA 3GSNH 4EI5B 1IZJA 1H3XA 3W39A 2KZWA 3IDNA 4KKAD 3L13A 4M7LH 3CH1B 1ITCA 4QF1A 4B5EA 3F5WA 4Y1TA 2AJUL 1MJ8H 5I8OL 5DJDA 2QQLH 2JJSC 5BZXA 2GSIA 1RZIB 4JZNB 5D1ZC 3VWKD 3NA4A 5DFAA 5TD4A 5F1OB 3TBCA 3MA9H 1AFVL 3FB6B 4K23L 2RGSA 3LD8C 3WXVH 4MAYC 2XKUA 4UQAA 1CPUA 4ZDHB 5AUMA 5T8IA 2NNXA 3NFPB 3MGOB 1G7MA 4Y1AE 3DO7A 1OK0A 1XF3A 3C87A 5DHYA 4A7TA 4B9IA 3FU6A 4CW1B 1L0PA 1NEZG 3LXUX 4J2QA 2GK2A 1BV8A 2R1XA 3BGAA 1MCCA 2I24N 3HC3H 1IUZA 5IEHA 2ODHA 4U6YB 3CVDA 1QBLH 3VYOA 1ZLUH 1B9ZA 1N9PA 4IRJB 1UCTA 2F8VA 1UJTA 2C7FA 4XH2B 1LDSA 3VWKA 1RSFA 3B43A 2ZKHL 1QSVA 2G3MA 3VXRB 5K1NA 1H8NA 5CJQH 4J39A 4P2OC 4GAGH 2DQJL 3P77B 4U4IA 4X5WA 3AG4B 3HAEA 5FLUA 5SX5K 4LKXA 4EAEA 1CS6A 4NAQA 3G5XB 4Q9BA 1MY7A 4X8JB 4FFYA 4DJMA 2F8OA 3HE6A 1QAWA 5SWQB 2EYSA 4FXGA 3ESMA 4JHWH 3BCDA 1NMCB 4QEGA 3P2BA 5GRJH 2LABA 2FQGA 1WH0A 3OMIB 3HW7A 4R9HA 3T4AA 1OTTC 1HXKA 5L2KE 3CZFA 2W9DL 3BT0A 3PNWA 4RAUB 3LB6C 3RVTC 4A6YH 5IR1B 2ZG1A 3AXLA 5DGRA 4OLVH 4PJIF 3VYPA 4UM9B 3RTQA 3CFKB 2PWFA 3CVIH 4O02L 5D7SH 4R96B 3SPVB 2EKSA 3LOWA 2TAAA 5CJXA 5IWLA 2V33A 3GZPA 1K8DA 3ILPB 4YGVA 4L1SA 4NNPH 1UVQA 4B60A 1BJ8A 3DX8A 1AG0A 3GD1C 3QARA 3ZE0B 1E42A 5F1IA 1N3NA 1QFUL 1YO4A 3II1A 3O8XB 1YNKH 4DPRA 3ARBC 1T66D 3AWFA 3NABH 3P4OA 2JI3A 4JO2H 1NBCA 4XWGH 4QYOA 4Z76B 5BRZD 2BJMH 3L3KB 4PJGE 4MD4B 3AU1B 5J6SA 2EH8H 1RZKL 4HIIB 1IBYA 3KCPB 3QDHA 3X1FA 5IZ7A 1Y18A 4FNQA 3FQUB 2CJUL 4JB9H 1LEGA 2V5SA 2E7MA 3D0LB 4GNKB 4HS6B 4FFZL 1FL3B 5JHLH 3RAJH 4AQAB 4R4BB 2YA1A 5EIIG 3QIWA 1DVFC 3D3VA 1UEMA 1FG9C 2APFA 5IVZB 4PRHE 3UYPB 1AQDA 2YMXL 4Q56A 1W0WA 2ZSWA 3JV4B 1AGDB 4LSPH 5E24E 1WAPA 2MQGA 1DZ0A 4FX5A 1F4WL 1QPXA 5KUMA 4OGXH 3EYUH 2BK8A 5DZVA 5DZPA 5FUZL 3RE0A 1FZMA 2NQ3A 3EG9A 1OE2A 5MI0C 4JE4B 3L4VA 3FQ2A 5F44A 3MKGA 1NEZB 4KZEL 4DN3L 4GQZA 3MXVH 2VL5A 4JDZA 4PGBB 2XSKA 4XBPA 2COVD 2WWMD 2YBRB 3QI9A 2ZOTA 2IANB 5BW7A 2WXFA 2J8HA 5C0BD 2CRMA 2FBJH 4U3SA 2VLJE 3LVTA 2DLFH 2NT0A 3RVXC 4DQOH 2XZAH 3VFVB 4UBDC 2ZUTA 4NO0B 2GFBA 3MYZA 1IBBA 1XF4A 3QDJA 4PJEF 4IKJA 1XCTB 2AHIA 3CZUB 5C97A 4LE8A 2HPTA 2QLYA 1X4ZA 3H9ZA 4UTBA 3OAZK 4NX0A 4OF7A 3TJEH 3HEIB 3CFQA 3IJ8A 1J5DA 5C0DB 4QY8A 2GUOB 3BD5A 4NWTH 4HG4J 1HHKB 3DGCR 5K33A 1IC4L 2IAMC 3AB0B 5HVGB 5LUMA 3BEWA 4LARH 1FH2A 3BT2L 3LHAA 1BF5A 3D34A 1YNLL 2HA1A 2G60L 3N41F 2FEEI 4FQ1H 5LAXA 1EK3A 3HCVA 4RMQA 1I8LA 2YR3A 5BQDA 1NGZB 4IHOB 4LSSL 1HAUA 1MCOH 2E9JA 2G9HA 4Q4EA 1EZLA 5DHXB 5I8OH 2Z7YA 1OTSC 2OSYA 4X6CF 1LMKA 2FWOB 3AZUA 3P0VH 3GMRA 1GSMA 2XG4B 4KK8C 5CP7B 5SWSD 1A0QH 3CMGA 3PGCA 1E2VA 4W4OA 4KI5F 1RZJC 1AFVH 4XVJH 2YUXA 4PJ5B 3BDYH 1KXHA 5H37A 1RMFH 1JV5B 2Y1ZA 3LNGA 5IB4A 3WKPA 1HL4A 3VXMB 5E8PB 1XZWA 2F53A 5HI3D 3KYMA 3FQRA 4GFTB 4JFWA 1UASA 3H9SE 3L3GB 1OAUL 2ZUSA 2HTLC 1HXMA 1ZGLM 3C5SA 2IGTA 3OJDB 2Y5TA 1XGTB 2DW5A 4F7KA 4NLHA 3K4DA 1TG8A 4Y2DD 5G4NA 5DMGD 3UAAA 2GYSA 5DGQA 4UT6H 4F8TA 5AYQA 3UBXA 3PFUA 5HDLA 1DBJL 3TWYA 1ILSA 2GJ6A 4MA1C 4Z77B 4MS6A 4P2RB 1ZHKB 1E9QA 5EIIB 1RUAL 3BH9B 3FU7A 4KK5D 3QG7L 4KTDL 1TQSA 4A37A 1CI5A 1HKLH 3VXUD 3RNKA 3BWZA 5GGQL 4RIRA 3WN5A 5LXVA 4OT1L 2J4WL 4Y9CA 5K9JL 2AXGA 1E9OB 1TQBB 3HPJA 4J28A 3AITA 1D2PA 1NAMH 2H2SD 3NJFA 1QKZL 4Z7WF 3TJPA 4Y2DA 5ALCL 4H0GA 5EBMA 4NKIL 3VSQA 3WUWA 2XN9A 1OL0A 4WO4B 1F4YL 3PWPB 4XMZA 5CSGA 3TN0D 3MV8B 4TLSA 1CDYA 2YLKA 2CJSA 2NDGA 4DZBA 1JK8A 1AHWB 3RWIA 1YY8A 1DJXA 1EQWA 1FNHA 3RTLA 1MDTA 3T09A 1F58H 3VXQB 4KO9A 1R3KA 3F62A 1OVZA 3ARYA 3K72B 3LRMA 4FZEL 1KIRB 1UQSB 5GGRY 2BVTA 4K2UL 4YN3A 1QFUH 3VGHA 1KNOB 3RX5A 4NO2A 1T4WA 4FNUA 3IXTB 4DAGH 4FNLL 3L5XH 1SVCP 4GSDL 1PLBA 4LSRL 3QNZB 4WFFE 2WZAA 4F5CA 1BVZA 3U4EA 5FB8A 4EUPA 5JA9A 3PREA 1HJBC 1UGKA 4HS3B 2CJUH 3ESOA 4YHNA 3RVVD 2WWOA 2J6EA 3M6DA 3CH8A 2FEEL 1RZGB 1U36A 4F7MB 4MBRA 1FO0H 1ZPUA 4QAWA 3KXFE 3FS9A 2JKWA 1Y0LA 4WRLA 3ZKNC 4XP5L 1J1XH 1R24A 5E99H 5ABZA 1JGDA 2DQMA 2OMZA 3RWFB 4HQQH 4XVOA 5KBKA 15C8L 2VN4A 4PGCA 1NCUA 4ZPTB 4KVNH 1G7HA 3KBEA 3GBDA 2UY7A 2B77A 4JFDA 1A21A 3E2HB 3SOBL 5HP5A 3RWJB 4XP1L 1G6RB 5BS0A 2EECA 2EUVA 3EYOB 1WF5A 1Y6KR 4NAJA 2EDBA 4X7DC 1MCEA 3LRHA 3KJ6L 3T3PF 4N85A 4JFPA 3ATBA 5BZZA 5KG9B 4AVKA 5AOZA 4Z5RB 4NQEB 1ZT4A 2ID5A 4PJAF 3MGTA 3IDGA 4NHUB 2PW2A 3L3OA 4OCMC 2H4EA 3MZGB 4GOSA 4N0YL 5A16B 4AIZA 4JFSA 3DVFA 3MBWA 5LQBH 3VXNB 4XNMA 3VGAB 4CUCA 2VDQB 4JHVA 1HHIB 5ADOH 3ATFA 3OAWA 3DMMA 3ZHDA 3UP1A 2QEJA 4ACPA 5E8NA 3H7BB 4H26A 1A6AA 1PBYA 3EXLA 2JQZA 1YEHL 2CKBA 1LK2A 5HVHC 2OJZH 2XPZA 1AGBA 2VUKA 3J27A 4HETA 3W81A 1PS3A 3BT2H 4NN6C 2XV6B 3C6LB 2G60H 1BECA 2LQRA 3PGDA 3QUHA 5DUML 1ZJBA 3ZDZB 3CN1A 3VSUA 3QHZL 5FA4B 3CUPA 1J5HA 3IU4L 3PE9A 1M7DA 3TZVA 1GZHA 4JO1H 3LQMA 4PWEA 3UJJH 4HWEH 1CFNB 3OPZL 3WIFA 4YS4A 2EICA 3BX7C 4U7SA 5A6IA 3VFMA 1UT9A 2ZOWA 2B3IA 1GGIL 4YDNA 3P9LB 2HRGA 4PJ8D 5B1AB 1DO5A 4ZI8A 1ZIAA 3U0TA 4PJFE 3OKMA 2BS71 4XMPH 4ADGA 4OTXH 4X7EC 4V33A 1FGNL 4W9ZA 1IL1A 1G94A 2R4SH 3V4PL 1CFSB 4IK6A 4AEHL 4GP4B 2XWTB 2D73A 4QXTA 3SQRA 3TJHC 2OLDA 2ZONA 4XN2A 3FTXA 5KYUA 3AGWA 2NSXA 3FFOA 3UAJC 5IEKA 4APQD 3Q6FA 3OG6B 4PJIB 3WNPA 3HR5A 3GMLA 3DURA 5GGVH 3H9HB 2WKOA 1DFBH 1JXJA 3L4YA 1PSKL 3GI8H 2VC2L 3O6FA 3KVPA 1P9MA 2NW2B 5TDPB 3RNQA 1XAUA 1U95A 1RJLB 5L88L 4JCMA 3HG1A 4JO8A 2CLZB 4F7CB 3Q8AA 4WKXA 1QO3A 3BLPX 3CN4A 1LO0H 3IRPX 4KTDH 2VUOA 1DJZA 4H1LH 4LVHB 5FIEA 2NNCA 4QOKA 5DD6A 3UC2A 3UZEC 2HRPH 2J71A 3CIQA 4RMRA 2RMNA 3C9NA 3PWNA 2F9BT 2V3FA 5C0IB 1WA1X 2NMSA 3UZVA 3PXLA 2PPDA 1YAIA 3G5ZB 5KEZA 4BE5A 1OGAB 3GS7A 4HUXA 1EEUA 5MEND 1K72A 2D31B 3PABA 2OMWA 3NQIA 4IJ3B 4RESB 3WHE0 3AQZA 4X6DE 1JUFA 2P3YA 1YNTF 1VA9A 1YG9A 4XAWH 1R0AH 5KTEH 3UG4A 1JGLH 4PB0L 4OCXH 3KZ8A 1YUKB 2A74A 3UTTD 1PFOA 1G7IB 2G4EA 1QRNE 2DWSA 4HHGA 4HUMB 1X5YA 4OQTL 5LDUA 5B3NA 3K81A 1YMHA 3JTTB 1TYEB 4HT1L 5KVEE 4YX2H 3PP3H 4DP9X 2H41A 3OKLB 2X4OA 5IVXE 3I9AA 2CDFB 5MENA 4YE0A 3CXDL 1ASPA 4FQXA 2J73A 1QR4A 2ARJA 3LV3B 4OF8A 2VB5A 1J8SA 3MUHL 1TTCA 4KNUA 1NANI 3CBRA 4KO6A 5CJBA 1UXWA 1R3IH 1WFJA 4GSDH 4UWQB 1ETJA 4XMWA 1MWAB 1KPRA 3GM8A 1IC7H 4DN4L 2FB4H 1KB5A 4X7TB 1SJMA 3QFJD 3MUY1 1PX8A 4FFVD 4TUJA 5ESVB 5B7MA 3FF8A 1NFDF 3R8QA 2Z92B 4PG2C 2MEJB 4L4VA 2UZYA 4PJEB 3UADA 2DAVA 1QSFE 1QSED 2BSTA 2LU4A 3MRLA 2MSPA 1B0RA 2N56A 3SDAD 1MFCH 4A7GA 3FH7A 2Y6SC 5CM1A 3TEXA 1H3TA 3IDXH 4L1HA 3HZKB 3QCVL 4XVUC 4JQIL 4IU3A 4XP1H 4AQEA 2AQSA 5KYWA 2AJ3B 2B2XL 2YWYA 3MRKB 3FT3A 4L5FE 5E5UB 4MHHG 5FM5O 1ZWIB 1YY9D 1SXBA 2OTWA 5EZLA 1RUMH 3C8HA 1FFOB 3MUUA 3N41B 4HFUH 2W07B 43C9A 2E8ZA 3ULUD 3QULA 3P1VA 2H8PB 1L9PA 4PRIB 3FOLB 3IXAA 5AZEH 1ZT7A 1PCSA 4ZQKB 4JHUA 3EYSL 1KJ2B 4JKLA 5B21A 2YQ3A 3VWJB 3LZFH 5DQ9A 1N5YL 3UX9B 1BA9A 1ZSHA 2H26A 1WAAF 4OM0H 1J48A 1AQMA 2ZQKA 1G7QB 3B7RL 4B7LA 1NLBH 4NCC1 4CVXA 2CPCA 2ZAGA 4L8DA 1BJMA 4N6QA 3VO0A 3QXDB 3RURA 4RSYA 1PG7X 2ZXGA 3X13A 1OV8A 4E0RB 3PHSA 2JCCE 1T22A 1C12B 3Q2NA 4G8FA 2WQAA 2VLMD 2B5IB 2DBLL 4M3KB 1Q0XH 1OB1B 1NUNB 1TQWA 5LCVH 4FHJA 1V3MA 5LKNA 1BFVL 2BMKA 3MV7D 4HEME 1SHMA 3HE7B 4BSVA 5DUMH 2XI9A 1V8HA 4AYEC 5IB3B 2F54B 4NNYB 4G7QB 2EIJB 3CD4A 3BO8B 4JREC 2AF2A 1U8OA 2AITA 3JT0A 2OR7A 4OKDA 2YWZA 3BISA 5F7NC 3Q8CA 4I0CC 4PRDA 1SQMA 1IQDA 1CLYL 5LG1A 5DJ8A 2UXTA 2QDWA 3GRBA 3LKOA 4H8HA 5HVFB 4Z7WB 2MTPA 1OSEA 4AEHH 4JRWA 4AK2A 5IUCA 1LM8V 2YAEA 2Z91A 4BM7A 4PJCE 5HGBB 2Q2EB 2R4RL 3SDCC 4AXWB 4GUQA 3ZIYA 2VXTL 4XXDA 4DGUA 3E9TA 3ULSB 1A1MB 2ROYA 4JRXE 1KWKA 3GBNL 2J57A 2NY7L 2XPYA 2A9DA 2WY3B 4WJ5B 2VOTA 4P99A 2VC2H 3GMQA 1JZDC 1ZLSH 3TPKA 2WBKA 2JKLA 3T0WA 4K94C 1M3IA 4RBPK 2X0UA 1FRGL 2CSPA 5D93C 1DTUA 4JFFB 5LO7A 2GY5A 4S1SL 5F96H 4YMPA 3GYRA 1TEGA 1HT6A 2VH5L 3FUMA 2CGRH 4HDIB 4WWNA 1FLRL 1LILA 3PXHA 4LLYB 2DWDA 4QGYA 4IRSD 5CF3A 3TS8A 3QRBA 4F8PA 4NWUL 2GBTA 3LKNB 4G7VH 4N8VB 2N01B 3F01A 4AZ8A 1DSWA 4CSSA 1QZNA 1RZFH 5HHOE 4EO5A 5SX5H 4ZOBA 4Y1AA 1WA2X 4F2EA 1CYWA 4JG0H 2P7TA 2ZYIA 2DQFB 4Y4HD 3OC5A 4PB0H 1VACA 2IQ9H 3L81A 4NP4H 5LNGA 4Q9CA 4JFOA 2BS8A 5D1QE 1TZIA 4IOFC 4QPEA 4KK9C 3KPRB 4U1MA 4IGBC 2VDLL 5C0AB 2J55A 5CILL 1RJYA 5AVZB 4GSRA 3NIGF 5L2JB 4PJBA 2VDRH 2X1XR 1MJJB 1ZK5A 2DMBA 3CXDH 2N59A 4YR6B 4PIBA 1SFHA 3HB3D 4FQ2H 1ZT1A 2EDRA 5IFAL 1WIUA 4XN7A 2IMNA 4WENB 4O00A 1I85A 4GSUA 3VI3E 1NCDL 4DTGH 2ENQA 4LLQB 4HOWA 4AITA 3PPEA 3ILEA 1FORL 4V1DA 5FM8A 3KYKH 4MNGB 3RZCC 3O2WL 4M4RB 1Q9LA 4P9HL 5F7EL 2DI8A 4GG6A 5I2IB 4WI8A 5I1JL 2HKAA 4H88L 4ZTPL 4TTGA 2L7JA 1BVKA 1OGTB 3RWHB 3HHSB 2V8MA 1Q9OA 2AXHA 4WW1B 3C60A 3W2DH 3HUJF 2ZCLH 4DGYH 4IOSA 3KWUA 2ZUVA 3BQUC 1P4LB 2AEWA 3UOAB 2ZP8A 1NOAA 3K6OA 5KWYC 3ECQA 2WXQA 4MMYB 1O9WA 3X12B 4LL9A 1BVLB 2X6AA 4PJ7A 1YN6A 2FHCA 3QCVH 1WGVA 4FMFA 2YMTA 4UILL 1YQVL 5ELIA 3J07A 1EHKB 2DMCA 2YPVH 4OIIH 4XB8A 2PYED 3H42L 1AD0B 4EI5D 4JFQB 5KOMC 2J3SA 1WAEA 1WZAA 3O3BB 1OSPH 3I6LE 5JDSA 3VB8A 1M7XA 3I9IA 5JPMA 3MJ6A 3VUAA 1FL5B 1NLDL 5C0EB 1I75A 2HFFB 4PJGA 3IGAB 4X7CC 3PDOB 4K3DL 2DD8H 4DEUA 1OT2A 1IJ9A 1K4CA 3CFIC 1FVDA 3Q0HA 4KUZH 4P23B 2DWEA 2P5EE 3D69B 5FKPA 4UUJA 5B1BB 5GGVY 5PCYA 4PW4A 4F2FA 2NY4B 4ZUWB 4PV9A 5J12C 1ZLEA 3TOPA 1I1AB 1T6BX 2HTKC 3QHFL 5IW1A 3SBRA 1AZZC 3QZPA 3CH1A 3JV6A 1RPQA 2VN7A 5TGBA 2EDNA 1R9FA 1PZAA 1CF8L 3PV6B 4FXKA 1ED3A 3KPQB 1VGEL 4WV1C 1WT5A 2AK4B 2B1HL 2QQKL 4JFEA 4CVZA 4GQQA 1MCQA 4HKJB 4MVBC 3QUGA 2R1YB 3HKFA 1XCQA 4RVBA 2Q87A 3VXRD 2PPCA 4LLVB 2HWZL 4LU5L 3NSJA 4HGWB 1DJYA 1NAKL 2QL1A 3SD2A 2VITB 1T1ZA 3EW3B 1EPFA 3NFPA 5T3ZD 4BWWA 1B0IA 2OCJA 3CFBA 1A4KB 1FIEA 2FD6L 3OAZH 2NNFA 1XTMA 4LOUD 4AYSA 4DKAA 3QR0A 4TN9A 2VR5A 3BP7A 1R47A 2EUZA 5LAPA 4N1CA 3KLQA 1JRHH 5E95B 3L5JA 2ZXDA 2VAAB 3IJHB 4NBYB 4DGVL 1PZBA 4JFVA 4PCYA 1TJIH 2AXWA 3NESA 4HLJA 4XMXA 2H3KA 5FYKE 4MJ5A 5BV7C 3CCHB 2HT4D 2OR9H 1UHVA 1BZEA 4ZYKA 3EO1A 3ESVF 3GXNA 2P52A 4P4KC 4UM9D 3G5XA 3GGWA 4JL1A 1T03H 1S78C 5SWQA 4BIKA 3GBNH 3ARGA 2QMJA 5D1XE 1I1YA 3T3PE 1XSKA 3HS0C 3HMWH 4G8AC 4B3VA 5F3BB 2LVEA 1SJVA 4G1EA 1QG3A 1IAKB 1EANA 1ZTXL 4LOVA 4AL8L 3O4OB 2QPFA 1FRGH 3SY6A 1F4AA 4RETB 4YSPA 3HJEA 2O6PA 2OMYB 4L2YA 1T5XB 2OZ4H 3O8XD 4R4ND 4HULB 5KSAB 2EVGA 3U2SB 1UXSB 2ISDA 1HI6B 2FSEB 3FN0L 1DEEB 4E9TA 5G5DA 3D87B 5FO7B 4Y4KC 1Z9NA 4U3HA 4UM9A 3WIIH 3ILDA 4Q97A 1JG9A 2BNRE 3CPLB 5MP6L 1HQ4B 1NGQH 2FJHA 2OMTB 4BK5A 4YNYB 1RULL 3IRZA 2D0GA 1BM3H 3HPLB 3IT8D 3LDBC 3S4SA 2BHFA 3SPVA 5IQ9A 1KY6A 4KROC 4ZO6A 1VEMA 1HYSC 4RFNB 4LQFH 4WIQA 3KYNA 2VDNH 2PYFB 2D8KA 4HCIA 1M7IB 2V2WA 5C0NC 2R69A 5ANME 1MIEL 1GTNA 5G4OA 1BFTA 1GMIA 4B97A 3EH1A 5D1ZB 4HUVB 4X9BA 5HPMB 2W5PA 2F74A 3RU8L 4Z76A 4L1BA 1OB0A 3LD8B 4MAYB 4J4PD 3I6SA 3V5DA 1XEDA 2BVEA 4JG1H 1GVIA 2CGYA 5JR1H 4HIIA 4AEIL 4LGRB 4YHMH 4M61B 4XP9H 2X9WA 3VJ6B 4LEBA 2PR4H 4KKPA 2H6OA 3BMVA 2DB8A 2GJJA 1SYSB 3MBXL 4YEEA 2V6HA 4WEBH 4BZ1A 1TZHB 2OKMA 1YPZE 2XZCL 2B59B 4R4BA 2Y6TE 3ORJA 3OJMB 2Z8RA 2IAND 3BAXA 5IVZA 1F02I 1RZ8B 5JXAH 1CQKA 3QH3B 3TBTB 4CN1A 5D1QC 4RZCB 1XR8B 3L16A 4P2OB 1AMXA 4U49A 4ZTPH 1TVDA 3FFDB 4OSUL 3BAJA 2IDQA 1QEXA 3B9VA 4EI0A 1AI1L 2K7PA 3K6DA 2HJKB 1CLZH 3WEAA 4LDOB 1UACH 3BH4A 4P5KA 3VFOB 4KJWD 1DDHA 5IMMA 2YEZA 4XN1A 5CLYA 1MFDH 3UG3A 2YAHA 5K9QG 3SDXF 2PCPA 5BJTA 3O0LA 1KJMB 1A4JA 1I7TB 2PCYA 1GOFA 5A3ID 4QXVA 4N4YB 5JO5A 3UZQA 1DANU 3L7EB 4ODSL 3WFCH 5L4MA 4LNRA 3H42H 3SKMB 3QPKA 1HDMB 3VRJA 5DJ6B 5KVDH 4FAAB 4S0HA 2JWYA 4W9IC 4LCIL 4BH7A 1I4FA 3IBOA 4JPQA 5GGTL 4Y8AA 1ZHBB 3P54A 3WMSA 4CC1A 4OLZL 5I1DB 4FCAA 4G3YL 5MEOA 3QPQD 1DE4B 3TXAA 3D39E 3BKCL 4X5XB 2EDOA 1QPKA 5T33H 5IV2A 4HV8A 4S2SA 2VYRE 4PJ5D 5CHNB 7CGTA 1HHKA 3GM0A 4X98A 3ARBB 4BINA 2ZWNA 1SDYA 1IGIH 1QABA 1MI5A 1ID5I 3D4ZA 3DA0A 1F2QA 3BHBA 4G7RB 1E5ZA 3HFML 3VXMD 3IN0A 4NC1E 3J2PA 1Q9WB 3MNZA 4I8DA 4X4XA 4ONHA 3BCFA 4J3OC 2F5AH 3QJHB 4IHOA 2XICA 3S2AA 2BNUA 1W16A 5DS1A 5DUBB 1UD2A 2HRLA 2J6WA 1P7KA 2QQKH 4X8CA 1G9EA 1MLCA 3UTPE 2FR4B 2FIKB 1NBYA 1E8WA 1YSOA 3WAJA 4HXBH 1AYRA 5HJBA 4ZK8A 5FK9B 5AWNL 1I1FA 3ZQXA 3FQ1A 1DVFB 1EX0A 4U1LB 2F5BL 4R4FH 1E27B 4NZ8A 4GKSA 1BIIB 1DQLL 1AGEA 1OPGL 3HTLX 2VLKD 4GMSH 1FVEA 3CC5A 3TONA 2DQEL 4X6BB 2OP4H 1T0OA 1IM9D 1SM3L 2YD3A 4WI7A 3QUMA 1OAYL 5E2WL 1DBML 3T77A 1LE9B 1XGTA 2XXMB 3WY2A 2HG0A 2WUCL 5MI0B 1DJWA 2NX5A 3NTCH 4GRWB 5IFHL 5C0RL 4M8QB 3L3DB 4JEGB 1CZ8L 3PWPD 4Q6IA 5I30L 3C8DA 3I6KA 5HGDB 2E7BA 1C5CH 3MV8D 4ZW8A 4CC4C 4GI9A 3FFCE 1DBAL 1X5MA 1ZHKA 1JD9A 2R0WL 4PY7A 2E9WA 3MZTA 3NP3A 2QSTA 4Y1SA 1B6UA 3P4MB 3GSVB 4N8UA 5E5LA 4DCQB 2VLKA 5AKTA 1P4BL 4PCSA 1PZSA 1ZTXH 1IM9A 2DLHA 1E9OA 2D7OA 3RB5A 3LS4L 3DX4A 3QO0B 1C16B 3NZ8B 1JZ4A 2VIRA 4N0CD 1H3WM 1AXIB 2IDCA 2YFNA 2QFRA 3CDGA 3EBGA 2Z35A 3N1MC 3SYCA 3VFNB 3P0YL 2LFEA 1F90H 1A9EA 1KCLA 1E67A 1ROWA 3JWDL 4UYPA 4UT9H 5MP6H 2HG5B 4DW2L 4DPCX 1RULH 5CUSH 2EH7L 5J1AA 4O2FB 3GSQA 5GS0C 3VXQA 1CD1B 1MFBL 2A9NH 5DRNB 3BUBA 3OHMB 3CK0L 2BVPB 1I7RB 1DLFH 2YD9A 3TVMC 4XCEB 4LIQL 4ODXB 4ENEC 4MBOA 4BBWA 2UX6A 1KNOA 1MIEH 2PABA 2OBGA 3RI5F 2CAKA 2R23B 4ONGL 4X0KA 3ZN6A 4M5YH 2L0DA 4HMCA 4DVRL 1U8CA 5DC9B 4GXUN 2AEOA 5LBSL 3X1GA 1KFAL 3B7SA 3CQFA 4QT5B 2GBAA 1B0GA 2QMKA 2WIIB 1TEFA 1LYQA 4S1RH 2NW3B 3ZZLA 5JOPE 4PP1C 3TFKD 1N6QH 3GKWL 3OL2A 1GS8A 4EEEA 4AMKL 4B9JA 2XY2A 3RY5A 3NPZB 1B88A 4BFIA 4F7MA 2XZCH 5F7LB 1Q1PA 2FL5B 4KX7A 1B9KA 3C5JB 4DEPC 4OCYL 4G71B 3ZTJH 4YIQB 4JFZL 3KBHE 1O6TA 1BG9A 4Z7OF 3NJMA 2NZ9D 4HLZG 2B9BA 4XX1E 3ZMRA 4MA1B 4F91B 2OW7A 1G6RA 4MCMA 5M7QA 1SGKA 3MQIA 3FYEB 4X6FA 3FO1B 5HHVL 1JGUL 2DMGA 1AE6L 4X6DA 1Z1WA 4MWFA 1MCLA 3OR7A 5JMOC 2FNBA 4XVSL 1T89C 5KG9A 3BGMA 2D7NA 4HIEB 4K7PL 1U3HA 5EO9B 2G3NA 3O4LE 4F1SA 2G2NA 4DUXA 4U6XB 1XXFC 2FX9L 3H4HA 3KWVA 4F7PA 4HKXA 4HPYL 5IVXA 3C6LD 5TDOA 4ICXA 5E5RB 2A83B 2MPVA 5MERB 4UQ3B 1HHIA 3AABA 3QB7C 4UDTB 2VW7A 1NGWA 32C2A 1BLNA 4AJWA 4UQDA 3OX8B 1TTUA 2VDOL 4TUOB 4RQQA 2IPUK 1NCOA 1H3VA 2EDHA 4I3RL 4NQSA 3STZB 4BCZA 4KC3B 4XNQA 4D9QD 3T71A 5KAQG 3BKCH 1MVUA 1JN6A 2H1PL 5I15L 1A7QH 3RX7A 2WLIB 5L2KB 3OKEB 1ZVNA 3CZEA 4OB5H 3SPIA 1I9RL 4E2OA 1KN4L 2DQDH 2E47A 3S8FB 3D08A 3RP1A 1BQKA 2WBXA 1AXTH 2J88L 3QEUA 2GSGB 3RZWA 4FERA 1AS7A 2VMJA 4NZUH 4YFLF 1I82A 1R5IA 2ZCHH 3TFBA 3N9GL 2VUYA 3BUYB 1CD9B 1EERB 2D4DA 1Z9PA 3E6FB 2GAZA 2R83A 2ZSVB 3KS0J 1JTTA 3P9MA 2AGJH 5EZJA 3SJVA 2YZ1A 2NR6C 3HS8A 3BDBA 4IEFA 5DZLA 4DP7X 3M1BA 1OAXH 1U8MA 2HT2C 4GG8A 4HIXH 3UYOD 3CLEL 2J1YA 2CJ3A 1MUJB 1MJUL 5E2UH 5DFVD 2H3NB 4UNUA 1EJ8A 4QRQB 4PJIA 2X4PA 4MGXA 1ONQB 1OSZA 1EGJL 2IDTA 1OGAD 5DJZA 5FYLD 1UOWA 3L5HA 2DL9A 3JWNC 2PTTB 5I0VA 1OCZB 4AMXA 3V6FA 1RJLA 3EH4B 3GC3A 5DRZA 3NSYA 1CT8B 9CGTA 5J06A 1S8DB 3KWWA 2NY0C 4XAKD 3V0GA 3RPBA 2WQRA 3QNXA 2DDQL 6FABL 1TTBA 1NPNA 5DEZA 2D4FA 1SXSA 2JCCA 2OA9A 2WIMA 4GH7B 1DR9A 1G4MA 5T3XD 1H8OA 3HZVB 3VSTA 3CHRA 1J12A 4WI9A 1JFQL 4UT7H 1F45A 2ICWA 4HEMA 1LO4H 4C58B 2J12B 1UWEH 4ZX4A 3DGGB 2W9EH 3I9PA 5BZWB 2LW3A 2G75B 3NCCB 4HEPG 2V3EA 1UFUA 4RMBA 5HVHB 3P0YH 5EB9A 3T6WA 3QQ9C 4RNRB 2VDQL 1V7ML 2WJ5A 3JWDH 4FI8A 5IJKA 3P30L 4DW2H 5D4HA 4L4TE 2VM3A 3GJEB 2O6EA 2VO8A 4KZCA 4X5PA 4NN6B 5FWQA 4RBPH 3MR9A 3TT1H 5EU4B 1JL8A 2VDKH 2CBOA 2DIJA 4YO0B 1Q72H 1A64A 4GRMA 2ARJQ 3LSOA 4B0MB 3LMJL 2BZDA 5I1KL 5F88A 4R84A 3WS6A 3P11H 5EOQL 4KDTA 2MKWA 2MCPL 1KACB 4M03A 5F7AA 4EDXA 3FQXA 4P04A 1NGYB 4XVTL 3VFWB 1IGML 2EE9A 4P46C 4WWKA 5FGRA 3D0VB 2X9YA 3C5ZC 5EEUA 4TTDC 3MOQA 2DI9A 5E9DB 1OCOB 3TO2A 4NT6A 3DPBB 5ESVA 1JVLA 5AW7B 3A23A 3HG5A 3V4VB 4YHPB 3WEOA 1UUNA 1NH6A 5FO8B 5D7LA 4CU6A 3GJFA 4PRID 1EAJA 5EF1A 2BY0A 3O9WA 1DQIA 1QLRA 4FN0A 4W93A 2WQ8A 3MRCB 5HYQA 1S7UB 5EC1A 1BD2B 1PMYA 1RVFH 3VWJD 4Z7QF 3Q05A 3FCSA 2HN7B 2WOYA 4BZ2L 5E23A 1NSNH 3VMPA 2HLFC 1K4DA 4F7TA 3IFNH 3ARVA 3OQRA 1EWHA 3NIDF 3PQYE 4WEUD 1WISA 1S7WB 4GEIA 5I66A 1DHKA 1BXAA 1QFOA 2X2HA 4PJ9C 4QTHB 1CXKA 1UOLA 1TETL 1WPCA 1DDTA 4R90L 3X1EA 3JTBA 3H9SB 3MGAA 1ZWIA 2EE2A 4HUWA 5C3IA 1G7PA 2CWRA 2YSSB 5IJVB 2W07A 5I17B 1BIHA 4HGMA 2H8PA 3O81A 3DV6B 4AGMA 5FO9B 3T2OA 3L4ZA 3JWOH 4YHZH 4X6CA 5IK3A 1K9TA 3FU0A 4KQ3H 2PXYC 3MO1A 4TSBH 3U6RB 3H0TB 3HE7D 4YE4L 3T65A 3MRJB 3V6ZB 2X05A 3NSXA 1G9ML 1X5FA 3M17A 3WS3A 4H8PA 1MCSA 3QRGH 1Z3GH 4P5SA 3FYIB 3Q9PA 4JW3A 3K1KC 2VDOH 2Q76B 3WENA 2H32B 4I3RH 4ZFZB 1UT2A 4OCRL 3W11C 3VQ1C 2RACA 3A47A 3Q9QA 2IV8A 3FW6A 4NZDA 4P4RA 5I15H 5E08H 4LPWA 2K6YA 4MNQB 3BD4A 3OKNB 5HDBE 5JIMA 2QGEA 1AQKL 1J8HA 2Q8BH 3MRIB 2P8MB 4Q89A 4QRTB 5B38G 3R18A 3R8BB 4LEXH 3HE7A 5IBTL 3UAEA 4B6ZA 2ZXEB 4OGAD 4NENB 5A2IH 3G5VA 1XWVA 4WFEE 5DMKA 3CG8A 4LQ1A 3PYCA 5ECJE 1PLGH 2XETA 4O4YL 1W72A 3BO8A 4DK6A 1J8KA 2J5LB 3KBFA 2JJTA 3WY4A 5KBNC 2YXFA 4O51B 5DQJA 3LKSB 5TF1H 1E28B 4GMTH 5HJ3B 5D6CB 4JFFD 5FYKU 1QNIA 5EU6E 2ED7A 1T7ZA 4Z7WA 1SVBA 3QP3A 2J1WA 1FL6A 4QHPA 4PBXA 4Z7NE 3Q5OA 1QYGH 1Z3RA 2XIBA 5KSBB 3L6FA 4RX4D 3GQFA 5FOJA 2WUBL 3RY4A 1E3XA 3I02B 3EDJA 1MW3A 2P5EA 1IO4C 3LRGA 4JAMA 2HKFH 3K2MC 2JIXA 2DYRB 4PW9A 3KXFB 1KB3A 2Q86B 1UZGA 4GPVA 2B0SL 3DSFH 2C1OA 3B7YA 3PV7A 4FG6D 1M9WA 4JRYE 5DHVA 1MSPA 1IZKA 2JXMB 1NMAH 4KY2A 1EHAA 4P9MH 5E4AA 3RY6A 4D8OA 2BW5A 1Z9MA 4LL4A 4M1DH 5IGXL 1F1GA 1L0XA 1SOKA 3MROA 1JYXA 3DK0A 4RMTA 3KPRD 3CV5A 3TBWA 4MHHI 1G43A 1KWGA 3BLBA 2IADB 3N0PB 4G7SB 2R0LL 5AOJA 1O5DT 5C0AD 1EEZB 1ZA6A 4LDCA 4N8VA 1FLTX 5AENA 1KJ2L 2JE8A 4JFXA 5IKCB 4LSDA 2O4EA 4U33A 1T3FA 3O3EA 4PJHF 1EO5A 1F00I 4I5BA 2Q8AL 1NM4A 3UBXI 3WMQA 4N5EC 3QFDA 3OKOA 4CU7A 3T0EE 4UNVA 1X9LA 3E8VA 3FMGL 3G6JE 3ZZSA 1KXVA 2ADJB 3X1BA 2YKLL 2ZWSA 1A7OL 5F9JA 4GP8B 4OCWH 2CK2A 2A1WH 1RZKC 2RTTA 2WXHA 4H40A 5J6HB 4Z7OB 3Q43A 4PGDA 1TZAA 4XOEA 2DV6A 1FA4A 4Y88A 4YXKL 1AANA 1HHHB 4R2GC 2Z7ZA 5G55A 4JREB 5ILTL 1J9TA 3V0FA 3ZKQD 3I75A 2EIZB 2R15A 4RDQG 1KTCA 1CE6B 4NO5B 2WXGA 4PRAA 1T1XA 4AUUA 2VSCA 4N8CL 4I89A 4YPGB 5GRUL 3QJFB 3KPMA 5JHDE 1HINL 2GTWB 3NUKA 4JDVA 4J3OF 4PJAA 3CSFA 4DOHE 3IFOA 4P3DB 1NINA 1U3YA 5MEQA 3SDCB 4HOXA 4K3EH 5B38B 2Z31A 3ZDYF 5E94B 3ULVL 3NG5A 3UTOA 5L4FA 1KGYE 1QD0A 5IBUG 4QTIL 2BNRA 1MG3C 2E4FA 2DYPD 3RGBA 4P23D 4QHNA 5D93B 3QWOA 1U93B 2GEQA 5GGSB 1KBGH 2NY4D 3CVBA 4KRLB 3C75A 1TETH 5FYJL 1I1AD 1XGRB 2I07B 2XWZA 3TH3T 1U8IA 5F7KC 1I8IB 3PHAA 4TQIA 2KS0A 2IH9A 3M8OL 4K9EL 1G4RA 2GB2A 3BH8A 4YDKL 1HXYB 2IDUA 2AK4D 4OZHE 4QHUB 5HYSB 5ITBH 3OR6A 3GXPA 5BO0D 2E7CA 2MKLC 5HHXH 5GGRA 1A6ZA 2DYPA 3UPRB 1N5AA 1LWJA 2X6VA 4ZUWA 3N40F 1M05B 3E1ZA 3DYOA 4P5MB 2Q20A 2WXJA 4WSKA 4ERSH 2JMRA 2FT8A 1UT1A 4XT1C 4MCYB 2ZP0T 3B3BA 4IGBB 3PV6A 3K2IA 1U8KA 2AK4A 2RCSH 1FV1B 1MIMH 1NUFA 2QV2A 4OLEA 4I4WB 3ZKMD 1V27A 4WI2A 4AGOA 4UM8B 1CDHA 1EBAA 2J72A 3ML9A 1LO3L 2C9QA 2WQUA 4ZFQA 4PLNC 3HAEH 2R51A 3GSNA 1DCLA 4NKOB 2DJUA 1GMEA 4UV4H 1MEXH 4FFYH 3RZCB 1SJEB 3QQXA 2VDML 4O4YH 1QVOB 4OD3H 1FFPB 3FO2B 3NN8A 4S0TD 1VLXA 2EC9U 2QLVB 2OZNA 4GKNB 5CNHA 4M3JA 4JKKA 1AACA 5E5MB 3D07A 4XXWC 4M7KL 5AOMA 3U25A 4BXVA 1ZHNB 3BQUB 5KSAD 4YDJB 3UTQB 1K6QL 1KULA 2XNAA 3JUZA 5E1HB 1VB9A 2DM3A 2XWRA 4P07A 3S35L 1F3RB 4XPTH 4APXB 5AW6B 1MFAL 1SN5A 2PPAA 4O58H 1YNTA 4PHXA 1JPEA 1WSST 4OZGF 2BVQB 1HWGB 1QLFB 5EEVA 2X2JA 5EF3A 3T8MA 3X11B 5I16A 5K93A 3RRQA 4KZ0A 2K8QA 1DVTA 3GSUA 1UOKA 5CINL 3HI6H 4OD2A 1QSFB 2JLLA 3O3UN 2OMYA 4JKPL 4ZUTA 4R3SB 1A7PL 2F8XC 4U1HA 4YLQT 5DI8A 4L8SC 5I8KL 4RISL 5D1ZD 3AXHA 4PREA 5CEXB 2NQCA 1IBZA 4MAYD 3IDIB 3TU6A 1M1XB 3ETBJ 4BHUA 3HRZA 1DLHA 1I9JH 3O45B 4FG2A 4Z0XB 5CEZD 1MLBB 3TO4A 1YYML 5J12B 5JOEA 2YGPA 1WBZA 4MMXA 4ODUB 3ZW3A 1XV8A 4XE0A 4LRIC 5EOCH 4GW1A 4GQ9L 2X3BA 2PF6A 3CX2A 2D03L 1I3RA 4YC2C 3MFFA 4WNSA 1L5GB 1NFDA 5GPRA 4WV1B 4Q0XH 5F1NB 2BO0A 3IDJB 4G6JL 5D1ZA 3V4LA 3QBTB 4PLJC 1A7OH 3MCLL 4J8RA 4UTAH 1GPOH 3KPSE 4P2OD 1A14L 2ADGA 2BP0B 5L8LB 1JNHA 1UB6B 2AQNA 5D2LF 1F5WA 4HJ1A 5I28A 4DESA 2XLLA 1HZLA 1RQ5A 1I8KA 5I1GL 2AEPL 4JE0A 5ILTH 4LSVL 2F19L 1TZHA 4GT7A 4O9HL 2WQVA 4I1NB 1OTTD 2NTFB 5FCSH 3T0EC 4YSUA 2JCWA 3L2LA 3LB6D 4PBDA 1AOHA 3KGTA 3RVTD 5BV7B 1Z5LB 3KL3A 3QH3A 2AANA 3O6LH 2Y0SA 3T3MB 3TBTA 1XSIA 1BFOB 3QEQB 4L3CB 1Q1JL 5TQ2H 3GSXB 5GZOA 1YMMA 1VJSA 3AWEA 1XAKA 2LAGB 4HK3N 4P4KB 5F89A 3WTXA 1FAIL 1XF2B 5CCJA 2HJKA 4I77L 1WAAA 3HS0B 1CDCA 1JDCA 4XZ4A 1GL4B 1X7TA 4ANWA 4ZFOA 3BRDA 1HS6A 1P4UA 3RL1B 4ZD3L 3LH9A 5AW8B 4UTBH 1CE1L 2BSRA 1JZ5A 2P45B 2EEDA 3S8WA 1X5HA 3TT3L 1J7VR 1KJMA 1M6UA 4H7VA 4X9YA 3V5KB 1DVYA 3D5OF 5LBGA 3HR6A 5E9AA 3VXSA 4I2XE 4PJDE 3ARBD 1FFQA 1H0DA 3PL6A 4FQHA 3CQQA 1RFDH 4FZ8H 4ZS6C 3EOBB 1CBVL 1REIA 4RMWA 2Z7UA 4N0UE 4PJCB 4Y4KB 2VWEE 4LLWB 1HDMA 1AXSB 4E9QA 5C07E 4Z95H 4FFTA 4JRXB 3V0DA 2X4SB 3LDBB 4KROB 2XXCB 4JPIA 3KWXA 4LP4A 4ABWA 1CK0H 1UADC 2QSCH 1M71A 3MTRA 4L3EE 1INQA 2R9HC 1KCKA 4KDWA 3BIKA 3NJJA 1JHKL 5FM4A 1AR1C 4DPBX 2R1WB 2ZOKB 5KSUA 3SY0A 5A2AA 5EEZA 2Z0BA 3TWCL 4KZDL 1GKEA 2ZXBA 3AUWB 2VW6A 1DVFD 4JUSA 4OJAA 5LNDA 1HFUA 1UM5L 3FO9A 1I1CA 5JLZB 4FLHA 1XT5A 2UZIL 2WNWA 1MKFA 3RUGA 3THML 4RA3A 1CR9H 3LH2H 4UIMB 3TYFA 4AYBA 1PZDA 4JY6B 3QJHA 1U92B 5EWIH 1SZNA 5LDSA 2DM7A 1EZUA 2F1BA 4HCRA 4X99A 1JPSH 2LHAA 4JJ5A 1XR9B 1FZOB 2PW1A 3WJJC 2ZIDA 2X70B 5HHOB 4Y4FC 5D5MF 1KCRH 3OM3B 4ODTL 2FEDC 4U1JA 4CSZA 2TSBA 4PBWD 4KWUA 4ODHL 3OZ9L 1LK3H 2DTML 3ZTCC 4OZ4B 1PVHA 4AYDC 1SDDA 1D5ZA 5C0JA 3DBXA 4QRSB 3SO3C 1K85A 3MRPB 5C09E 5K9OA 1U0QA 2VDMH 3ROLA 1NUGA 4R7DA 4WW2C 5D1QB 1ILUA 4KPHH 4U6VH 1O5PA 2B20A 4UBDD 3O4LA 5LG6A 3NCYS 3EFDL 3KM2A 4XCFH 3EF7A 4W9EC 1E4KA 3NJLA 1KCBA 3C5XA 4HXAL 4M7KH 2A6IA 3BI9X 4MD0B 4ABQA 2JK5B 4L8BB 3AM8C 3BOVA 1SJHA 3F6LA 4UQEA 4XWOC 5FXCH 4FJYA 1RIUH 1CO1A 5DK2A 3UJIH 3VM5A 3B1UA 3U7WH 3VD4A 5DA0B 4ELKB 3I2CL 4K55A 2IAMD 1MCRA 3QWRD 3U7YH 3D4GA 1QOKA 1ZVYA 1S46A 1M4KA 5HGHA 3BEVB 4E9VA 3P4MA 3HC2A 2X41A 1UM6H 2VT0A 1JWUB 4NUJB 4ODWB 5CBEB 4P2QE 4IKLA 5K9QI 3UL4A 5C2UB 3DV4B 1IFHH 2VR7A 3W9DB 1GS6X 1WD8A 2BIIA 1BMZA 3F58H 1XO8A 3RVWC 3WFBL 1OTSD 3AC0A 1GYUA 3ZYOA 4KK8D 5F7DA 1F41A 4KOBA 4L29A 3U1PA 5HHMB 3SQOH 1DQMH 3FOMA 2IG2H 3QXAA 4LT7A 3T4YA 4PGEB 4W9HC 2OQJB 2IAMA 5GGUA 2QPEB 5FDWA 3IJEA 3PCYA 2D0HA 3QQ3A 4FLSA 4OFKA 4JHAL 1KB5L 4EUPH 2HMIC 4KXZH 2GW5A 1Z9LA 1S9XB 3H3PH 2H5UA 1NAMA 2Z0UA 4N6RB 2J6EH 4W4NA 5I5MA 1P1ZA 2FRGP 2WNGA 1RU9L 3CTTA 2HTLD 2D03H 4IMKA 4IMLB 1GCYA 4ODXA 1IC5L 1Z5YD 1N8ZA 4J8QA 3PP4H 3DXAE 5ECGA 1XGQB 4H44C 3HUJA 3L5WB 5IMKA 1S7TB 1Z6JT 4HCFA 1QI3A 2WLJA 3V0HA 2BINA 4UIKH 4XMUA 3WO4C 4NQTA 2XWJA 5BOPA 3LHPL 4L8CB 3DVGB 3F7VA 3QORA 4U1IB 3D0AA 2WVVA 3NRFA 5AQ0A 1NDGB 1KEGL 1GZPB 2O5YL 3DYMA 5KVDE 1Z66A 1ROCA 1CIUA 4F33A 3C5JA 1HSAA 1W0YT 1KPUA 4OGYL 3AAZA 4JO5A 3U46A 1V54B 4IDJL 4OZFB 3DRTA 3BESR 4L9LC 4M8RA 2AXJA 3GMNB 3GXIA 3OZLA 4D0BA 3VFUB 3QEGH 2EDFA 2NLJA 1FAIH 1IGYA 5HYJB 4RWYH 5D96C 4Q9QH 4JKNA 4JKMA 1MZYA 1FO0A 2P49B 4ANVA 4LLDB 4HZ1A 1EEYB 5MEPA 4JS7A 4XGZA 3IGLA 5FFLA 2AAVA 2CKBH 1VFOA 1X5IA 1NZRA 3I50L 5H4ZA 1JWSB 1WUNT 2XWXA 4ZOAA 1GJUA 1MCPL 3U6XA 1L9TA 5JIDA 1G7JB 1VPOL 2EXYD 4KQ0A 1EBPA 2QBWA 3MRDB 2DJ4A 4C56B 3EUUA 3NFNB 5JW4Q 4ADJA 1U30A 1NCBL 1OAZL 3MLVL 2EACA 1E6JH 3L8QA 3OV6A 1HC1A 1OWRM 1FNSL 3OSKA 4NPYB 5E6UB 1QP1A 3EJYC 3QDME 3RDJA 3TVMB 4AT6A 4PWHA 1T20A 3RWCB 3QT2A 4Q4IA 3WO3B 1KELL 3ZKND 4KV5E 1SOSA 3LVEA 1KBWA 5E6IC 3ELQA 1OK8A 2XIIA 4LLMA 5EG6C 3FBKA 1JGVH 4WEEA 4MJ6A 1AJ7L 1ACCA 3IM1A 2BOBA 1XFPA 2MTAA 4DUVA 3DUSB 3TBVB 3SE8H 3ZQWA 4X5LA 5E8EB 3ZYJA 3JWNG 1KLGB 3MACL 3FZUC 3UCQA 2V9QA 2ODIA 4RGOH 4P0DA 5A2LH 3DHPA 1ZTXE 3CHSA 3O3AA 3PQYA 1BZ9A 4GT0A 5E2JA 4R0LA 2J43A 4JO3L 5ANMB 2HVBA 4DEPB 1GAFH 2CQVA 2MOVA 5E1GA 2YOAA 3KVDD 4MQ7B 3MX0A 3MCKB 2BP5M 3ZDYE 5I1AA 4XO5A 2R7EB 4O2EB 5DUPL 4YHYC 1EFXB 1BQHA 1LJMA 2H3NA 3U36B 4HJTA 2OJEB 3OMAB 5DJAB 1CBJA 4NZRL 4WJKB 3FUJA 1UA6L 2P4AB 3SGEI 2C3WA 1WCBB 2V0AA 5IROC 3LZLA 5CU5A 3GLDA 2DQGH 3HMXL 4R7NA 3MLSL 3F00A 2BNQE 2R29A 1CICA 5CZKA 2KLTA 3R4RA 4D3CH 3WJMB 1KGIA 1M56B 5EUOE 1L9NA 1A9BB 1BGXH 1Y07A 1X4YA 5HHNA 3DX0A 3ENEA 5TPWH 4G6ML 4JJHA 4HK0B 5C6TH 3CLFH 1JGEB 1R3JB 3A5VA 3GB7B 1ORSB 1U8PA 2YRPA 4WUUE 5IT2L 4M7LT 3FTYA 3WOVA 2FO8A 4G2AA 5BCAA 2H9GA 1L7IL 3VG0H 1CVRA 4PQXA 4F7EB 5BZWA 5L4JA 3EJZC 2FT7A 4LKCA 2CM6A 4J27A 1JPFB 4KO5A 4H1LA 1KBKA 2WXLA 3ARXA 1V3LA 2BCMA 2PO6A 4K5LA 3RJQB 2MNUA 1B4JH 1D5BB 4GQPH 4W9FC 1P7BA 5AB1A 4OZIE 1H6EA 1G0DA 1QA9B 5E9DD 4AC2A 3UAJD 2CLVB 4R26L 2DLGA 4UB0H 3IFLL 4XI5C 4WAFA 4M43H 4AG4L 3DNKA 1QFWI 2Y06L 4TLUA 2Y25A 5B8CC 4J3UA 4GBXA 4Z8FL 2DQ6A 3T8XB 3TBSA 2FJGB 1BD2D 4YHOH 2TRHA 3JZYA 4HIJA 5DK0B 3SDXA 2XWBB 4MYPA 4YL4A 3LHPH 2EZ0D 3ZT7A 1JZ2A 4ZFGH 4BWUA 1V3JA 3UTSB 1R34A 4KY1L 2DWTA 1HHJA 3ABMB 3S37X 3QUZA 1TYRA 3A0OA 4EDWH 2E9GA 5E9DA 3BKYL 3H53A 4IBLT 3LRSA 3J8F7 4YHIB 3V6OE 1EZVY 3UAJA 4BFBD 3H9SD 2CG9X 4F37K 1XIWC 2D7TH 2RFXB 1PTZA 4YHPA 3PFQA 5FV2A 2OMUB 1KCUL 4ELMF 4Z3JA 1F11A 2CLRB 2Z8WC 4QJ4B 4Q58C 2XFXB 2WWNA 3IMVA 3MRCA 4NIKB 4EBQL 1IBDA 3AMLA 4XX1G 5F72S 1VADA 3VXOA 2X2IA 4IRZL 3ALWA 3GRGA 4MRCA 2J2ZB 4U1KA 2NY0B 3PLYA 2E56A 4FCHA 4OIBA 2VXUH 2FX7L 4A6YB 3LNIA 1YYCA 4HBCL 1F18A 4NO3B 4ZUSA 5HBBA 3ZOAA 3VD0A 2BCKB 3OJVC 1XSOA 4E41E 3FF7A 2E27H 1IEBA 3QRLA 5BRQA 1G9NL 3C2AL 2J20A 4OLUL 4PRPD 1A5FL 2ICES 1SLXA 1WWCA 1JHTA 4JCWA 3ULUH 4MNQD 2IPTL 3V5HA 4XO8A 1BQLH 1GGCH 5E1AB 4OBRA 1WQVT 2YRBA 4JR9L 3H0TA 1VPOH 1EUUA 5J3HC 3B9EA 5K39B 3L3IA 3EJQA 4HC1L 4ECNA 3BVUA 4G9DB 5DEGB 5DU7A 3RPIB 3CNKA 4PSPA 1T4KA 5KVMC 2ILLA 3CFDA 4YDLC 3TTSA 4A66A 1EAOA 4YSTA 3WHXB 2W38A 1MHCB 4DGIL 5D2NA 4ZFZA 4PRPA 4IDLA 3U48A 4D7PA 2PWHA 4KTEH 3POHA 3DX1A 1PZCA 5C0GA 5TH2A 5DZJA 1LDPH 1M53A 4K73A 5JHDA 2GJRA 4MNQA 3X3GL 1KELH 1KV7A 4HF5H 4D0DB 5K1JA 1NEUA 2HX9A 1D9KA 2ITDB 1BQ5A 3O0RH 4Z7UF 4G72B 4ZUVA 3SKJL 2B39A 3M7OA 3DX7A 4L18A 1XGPB 1AJ7H 3B9KA 1BEYH 2Y6SD 3MCG1 4P46B 4XVUD 4MSWA 4NENA 4WFFD 4ZNCD 2N1KA 4S10A 1R5WA 3C5ZB 5HDQL 3ECWA 3WL9B 4LBEB 5DR5L 4HZLA 4KJPC 1A1OB 2HAZA 4O51A 1XB8A 3BP4A 2A6KA 4PS8A 2WXOA 4X6EA 5LCVA 3V9CA 2J5WA 2BY2A 3SYAA 5FPIA 3KXFD 1HN1A 3VGBA 4U2ZA 2H1XA 2W65A 3BAKA 4CGUB 2Y7SA 2XX0A 3K71B 2IMMA 4JMXA 3Q3GA 3VFRB 2WVSA 3A6OA 1Z0NA 1YHPA 2DWYA 1NGPL 3N40P 5DUPH 3MBEA 1EXGA 2DQUL 3C6EA 1FZJB 1SXAA 1H15B 3CN0A 3L4UA 4UMSA 3UGEA 1BOGA 2VTFA 4KTYA 4NZRH 1P4IL 1RERA 4PJ9B 1KTLB 3I02A 2K3HA 1CGYA 5EOTA 1A2YB 1KF9B 1HILB 2C9RA 3NJGA 3ZKSD 5E8DH 1MH5A 4J6RH 3IU3B 2JB5H 4AL8C 4CC0A 4DWHA 5IVNA 2AXFA 1A7RH 4YSSA 4MJIE 2Q86A 3MV9E 4NSKB 3ME0B 5LN4A 5DD3H 5LGHL 1SFDA 2FVNA 3NAAL 3HLAA 4N2IA 4WHTB 4WHYH 3OXSA 5F9DC 1KT2B 1KPVB 3QC6X 4ZOCA 3VX1A 1TNMA 5EU3B 2PXYB 5TFSH 1G7LA 2DOCA 1SOXA 5DJXA 5BOJA 4JGNA 4L9DA 5I82A 2ITFA 2KMWA 3LXAA 3FSAA 2YAPA 3NA9H 2NZ1A 3T1FA 3INUL 5L6YL 3TH4T 1V5JA 4ONOA 1MREH 2HJLA 2GJZB 4WK0B 4AV5A 1QLEL 4ZOEA 1Y6MR 2EYRA 2OX5A 2P24A 4N2GA 5F93C 4BZ1L 1KXQE 3N55A 4NUQA 1MQKL 3ZUCA 1A3LL 5EOCJ 3LNEA 3L5IA 4I18A 1PIFA 2CRZA 5FF6A 3E7JA 4IU2B 4KMTH 4JM4L 5FGCB 2HZHA 3NCJL 2I9TA 3SDCD 3RDTC 4R26H 3AG3B 5K9KB 5D5ME 2BWDA 2WINA 4MZ2A 5IG7B 1S3KL 5FCUH 2PPFA 1URLA 4TKWA 1OCCB 3MLZH 2ATKB 5AVXB 2QGCA 5A43C 1UWFA 5K59F 3RKPA 1L9SA 1PEZA 1BPVA 2HJFB 1BLIA 2W1NA 4MASA 5L7XH 4DNLA 2QDVA 4BSWB 2GTZB 4LASL 4WI0B 2GTWA 4HKZB 2XQYG 2Y24A 2Y4SA 1KZYA 1BOYA 3GTVA 3JVGA 1JZFA 1ADWA 1JZGA 2K9FB 2P80A 2Q7YB 4MAZA 2ZCKH 3UTZB 4DP0X 3ARFC 5ICYB 1ZXQA 4FTVA 5EN2B 1TZGH 1INDH 4YFEA 2P28B 5CLZA 3S5LA 4EOWH 2FX8H 4QXGH 1CGTA 4OI8A 2F15A 4MQXC 3EFOB 3ZVVA 1ZJAA 4ICWA 3VFPB 2IOIA 4ZO8A 1RZ7L 2VZOA 2ZJSH 2Y2TA 2YHGA 3LS5L 1HH6A 5I1IL 2DQCL 1XF1A 2HFEA 3PWLA 4GEJA 3V6OC 5I18H 2I07A 3FTGB 4IOFD 4ZAKA 2BS9A 4KK9D 4O02B 1GYWA 1A5FH 1QBAA 4IGBD 1PQZA 1HOEA 4PLOB 1BDYA 1MCNA 1FNGB 1HXYA 1KGCE 3PJSB 1Y7VA 5HYSA 4WTZA 1EEQA 2K4AA 1W2KT 1CN4A 3ECUA 4Z0BL 1RK1B 1JK9A 1PZ2A 2XHNA 2YPVA 4NYLA 3ET9F 3SN6N 1HOCB 1YDPA 2YFOA 2QZQA 1M05A 4UI2A 2H0FA 4HSAC 2J8UE 3RZCD 1ECZA 4YHLL 3PWVA 3Q1EA 5C2BL 1TSRA 4ZMYA 3ES6A 1OW0C 1HNYA 1X5KA 4ZXBC 4C8XA 2YGVA 4KH9A 5B3SB 1FF5A 1SHXA 3ZRFC 2R2BB 3QUML 4HLEA 3BVNA 1JBJA 4R2GB 3BQUD 3DJTA 1Q0YH 2Y69B 4E5XG 2ENSA 3P73A 1W8OA 7TAAA 2AJSH 2VXQH 1FH5L 4N1HB 4GO8A 4DO4A 4L4TB 4NKOA 4OUOA 2AAAA 1MW1A 3D2UB 3RZCA 1L4IA 2ZWLT 5IB1B 1XD1A 3CFEA 2GK0A 1YEJH 4HJJL 3TIEA 3KDPB 4GKNA 4Y8DC 3ZYZA 1GCFA 2XCMC 2V4LA 1KC5L 3BFQG 4I2XA 4YSAA 5EBLB 4XCNA 3RLSA 1YEGL 4BFOA 2V5MA 2FQEA 4AV4A 3VI4F 1QSFD 4HU8A 3WD5H 1IM3B 3QQ4A 3FQTA 5E00B 1ZHNA 1MAML 3ALXA 2FATL 1C08B 4S1DC 1Q9KA 2F18A 1NGPH 3I74A 3NIFB 2AMGA 4M6NL 4R83A 3R06B 1H6FA 2KQNA 5B4MC 2NXYC 1EJ6A 4PV8A 4GSQA 4PLKC 5GRWA 5JW3L 3DO4A 3IFPA 4WLCA 5CZRA 3X11A 4EN3A 5IHBA 2HTKD 2EUWA 3L95A 4E42B 5A2FA 5I1HL 3WJLC 2P5WB 3A4FA 1I7UB 3MRFB 4XBGA 3V9EA 1F2XK 1TFPA 2VMFA 1GZQA 3W0WE 2R69H 1YZZA 3FRUB 3IMWA 3OKKB 3D09A 4MVBD 3S2CA 5GHWL 2QJDA 4ZSOA 4XCYB 5JORB 2VO5A 4NQDE 2X2YA 3VTMA 3JWDC 1M1XA 2XPGB 2YAQA 3EYVB 5IB2A 2AQPA 2EDEA 3CFJB 1TVBB 2KDGA 1LP9E 3INUH 1CTMA 4PFEA 2HT3C 4TVPD 1I3GH 1DSFL 3LJ3A 3QDGD 5GRXG 2CK0L 2A9CA 3L7FA 2CO1A 3LIUA 1JYVA 5A1AA 3VD2A 4LP5A 4B9KC 5KS9E 3EGXA 3ATEA 5JW4N 4DZ8A 1EZSA 2GPZA 2C3HA 4FXTA 1CLVA 4ELMB 3QUXA 2IFFH 2Q10A 4KK6C 1PAZA 1XGUB 4FQIL 3QUYC 5INCB 1L3WA 3K8MA 3QEQD 3H1ZA 1OCRB 1NUDA 1ECYA 4UOW1 3JVFC 4P4KD 4OV5B 1ET5A 1NIEA 3X3FL 2AI0L 1S78D 3UO1H 5CWSA 3VMOA 5BVJA 1H9VA 3QDGA 1JNJA 1K2DB 3VFGH 1GC1L 1ASOA 3IN2A 3OTTA 3U7AA 1RJZB 3HZ3A 3TBYA 3BP6B 3ZL4H 2Z3FA 3BKML 1PX3A 5IVOA 1IGJB 3KNBA 2AABL 2HVJA 3CDZB 2CUMA 1AG6A 4IBYA 4HIPA 5DJCA 1N0XL 3SO5A 2BRRL 4G9FA 4WO0A 1PG7H 4M5ZL 1E5AA 1J9RA 5GZNA 3NEEA 2V5TA 3QEQA 4L3CA 3TV3H 1ML0A 2NY2C 2BWIA 4J3SA 4DP4X 4K5NA 4Y4KD 4ZMLA 4ZTEA 4B9YA 1SN0A 4E5XB 4GUPA 1XF2A 2G5RA 1D5MA 2A9MH 4L48A 4JRXD 4HD5A 4NM8L 4D9LH 1JPTH 3VVVA 3HS0A 4KROD 5EZPA 4IIQC 3PXJA 5TE6H 4YDVB 3RL1A 4DH2A 4B9FA 4OLXH 2PP8A 4WGKA 5C0ND 3OKDA 1C5DB 1DQKA 3WNMA 3WTUA 3EH2A 1DL7L 1NFIB 3PDGA 3R4DA 4YBLC 3MUGB 1CL7I 1UKSA 5EU6B 1J5CA 1HU8A 1HVXA 4WU7B 4L8SB 4W6YB 4Y19B 3R1GL 3S3SA 3EOBA 2DQCH 5AAMA 1JZEA 2WXPA 3U0PB 3SGDI 2ICEC 4LLWA 2BOCB 4M7ZC 4CNIA 1X5LA 5F0PB 4X9HA 4CMMB 3SE9L 1U8JA 4FXLA 4R5XA 1HNFA 1KN2L 3WEXA 4WO4C 4S11A 2RIKA 2OULB 4R8WH 5HHOD 3GINA 2P8PB 1DN2A 3UABA 1RHHB 2NY1C 4YC2B 4K7FB 1XH3B 1RI8A 3BW9B 4MAUL 4LRNH 2ITCA 3NFSL 1T21A 1WCQA 4UAOC 1TLMA 2XTLA 1DUZB 4L5FL 1CD0A 1KDIA 2WTRA 1EJOL 4N9GB 3MODL 4HK3J 4YHLH 4G42B 5D1QD 1U58B 3BC9A 4NFCA 4DSYA 3OMNB 1LGVA 1O6SA 3LN5A 5D7IE 1KGJA 1MW2A 3BZ4B 4LF3B 1E4XI 4IS6B 3TTYA 3R19A 4WCYH 2B7DT 1J5OL 1BWWA 1CFTB 2MCMA 4G1MB 3BDXA 1TJHH 2HFGL 5DMIL 1OOWA 3UBGA 4XB7A 1MFEH 2IGFL 5JUEH 4TRPH 3FAWA 3LEYH 2ROXA 4U1SA 1ZS2A 2OFQA 3T0EB 3G6JB 4OZ4A 2YAFA 4NCDA 1LO2L 5E8OB 2JELH 1WFNA 2G3ZA 2CKNA 3B7UX 3U1SL 4NDMB 1UM4L 1PW3A 5AD0A 3ABGA 3FB8A 4OD1H 2OI9C 4EJ1C 3F7YA 4PB9L 1ZE3H 4ODVL 3Q1SL 2SEBA 5LN8A 3A67L 4DKEH 3MNWA 3O2VH 4MDIB 5C08A 1DSYA 1YUHA 1FN4A 5H2BA 2BHYA 2WXIA 3D6GA 3FJTA 1ZXKA 3QZWG 4G8GB 4L8BA 3CVHL 4OM1L 4PAZA 4TPRH 2X4TA 4CDHA 4PJHA 5HHMD 4FHBD 1FGVH 1N67A 2FLRT 8CGTA 1YEKL 4OGZA 3ZE1F 3D3VE 2GVYA 3FQ4A 1X7QB 3BEVA 4HH9A 2O1AA 5IBLC 3WNOA 1B2WL 2VLRB 2VL4A 1DFXA 3MNVB 1JZ3A 1D5XB 1HKFA 4DOHB 1BXUA 1JTOA 5BRZE 1KV3A 4J3OD 1KGXA 2J56A 4PUBL 5AB9A 4TNWF 2CU9A 4HS8L 2OMVB 3FONB 5D6DC 3A6CL 4W6WB 1S5IL 5ID1A 5DT1H 1AR1B 2VMEA 4HOZA 4RGNC 1BW8A 5I6OA 3PNRB 3TIDB 2F61A 5FUCC 5I1CL 3OF6D 2WP3O 5JA8B 4DVBA 1BVNT 4HWBA 4M6MH 1BCIA 4WI6A 3QCTH 2ZNXA 1NTDA 3O3DA 1ZPLA 3B37A 4Z7VF 3VNZA 2IWFA 1BZ7A 1QFHA 4JPWH 2FWUA 4PRNA 2YSTA 3QDJE 2M83A 4IMLA 4MDRA 2FT6A 4FQQB 5D8JL 1NCIA 4OZHB 3RPKA 3ECVA 1XGQA 4Y4FB 1D6VL 2VISB 4UT9A 1ZRUA 4YXHL