2GC4C

Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
total genus 25
structure length 105
sequence length 105
chains with identical sequence G, K, O
ec nomenclature
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2gc4C00
2FQEA 1MZYA 1DYZA 4E9RA 4DPCX 2QT6A 1RZQA 2YXVA 3CVBA 3DKHA 5FC9A 3NT0A 4HCGA 1SHWA 1X9RA 5TK2A 2BWDA 4DP6X 1AANA 3SBQA 4NB7A 3SBRA 2VN3A 4BDVB 3NJFA 1CYXA 3QJRB 2LLNA 1FFTB 4A2FA 4CSZA 4A67A 2P80A 4P5SA 1UATA 2UXGA 4GYBA 1MG2C 2GC4C 1JOIA 2BZCA 1JZEA 1JZFA 4GP5B 3AG1B 4N8UA 5A7EA 2Q5BA 4DPBX 3UGEA 2I7SA 1IBZA 5AFAA 1NIFA 1AZBA 1FA4A 3HB3B 3IEAA 1ZIBA 1SJMA 3FSAA 1JXGA 1KDJA 4KOBA 2YAQA 2QPDB 2ZONA 1E30A 4GP8B 1J9QA 2RACA 3T6WA 3WNJA 4YSQA 2GBAA 1JVLA 4JKNA 2XLLA 2HX7A 2HX9A 1NIDA 2DV6A 1GY2A 2AFNA 3IE9A 2XV3A 2P80D 3HEIB 1HAUA 1HAWA 5AKRA 1L9RA 2XYBA 1A65A 4DP7X 2PP7A 5PCYA 1ZPUA 1ADWA 3JT2A 3NJKA 2PCFA 3QJSB 4N4YB 3KW8A 1IUZA 1TKWA 3QJTB 1SFHA 4QLWA 1NDTA 3ABKB 3CDZB 3T6VA 1SNRA 3GYRA 2UXFA 1KYAA 1ET7A 4M3HA 4X4KA 3S3CB 4HHWA 3NJGA 3WNIA 2WO2B 2YXWA 3JTBA 3ASNB 1PZCA 2HX8A 4YSRA 2VW7A 3PLYA 3TASA 2YAPA 4GP4B 2PPAA 1N68A 2BP0A 2TSBA 1OE1A 3BVDB 4YL4A 3NSYA 3TBCA 1KDIA 2BW5A 2OJ1A 3IN0A 4MFHA 2TSAA 3UAEA 1AIZA 1BYPA 3UAAA 5I28A 5I5IA 3NJHA 3X1FA 4YSSA 2J56A 1OF0A 2QDWA 3PCYA 1J9TA 1A8ZA 1MG3C 2XVBA 1WA2X 3AG2B 2H5UA 4E9TA 3ZDWA 3TU6A 1OCRB 2IWKA 2QDVA 1JVOA 5B7FA 2CALA 4BWTA 1PF3A 3T9WA 1HFUA 2IWEA 2R7EB 3ABGA 3QJVB 2WO3B 4A68A 1ET8A 3X1GA 1BQ5A 4YSAA 1RZPA 3EF4A 4A2HA 2XWZA 4F2FA 2ZXWB 1BXUA 1OE3A 4BK5C 4DPAX 3WKQA 1IC0A 3T6ZA 1J5DA 4L0PB 2DYRB 1I53A 4DP1X 1ETJA 2A3TA 2HXAA 2XXGA 2X87A 2BHFA 2XV2A 3ZX1A 1XB3A 3ABLB 3FS9A 4DP5X 1W6WA 2FT6A 5B1BB 1A4CA 3CG8A 1JXDA 3ASOB 3X1EA 4CSPA 7PCYA 1QLEB 4W9ZA 5ANHA 5I6NA 3FYIB 2WSDA 1ZIAA 3OQRA 4KO5A 1AZRA 1AG0A 2MTAA 4DP8X 3QQXA 3S8GB 2GHZA 1W8EA 2CBPA 1IBYA 2AZAA 1IKOP 5F7BA 3FQYA 1BAWA 2B08A 2JKWA 1AZCA 5PAZA 1V10A 3OM3B 2J57A 4G70B 3EH4B 2PP8A 1XB8A 2VSKB 1CC3A 2EINB 6PAZA 2NRDA 9PCYA 1L9SA 1GY1A 3U25A 1AR1B 2MRYA 1NICA 2PPEA 2AVFA 1CUOA 1GW0A 2YAMA 2VM3A 1GYCA 4KO7A 1DZ0A 2BO0A 3BQVA 4GXFA 2UX7A 4PCYA 4HCFA 4KO9A 3SQRA 4E9VA 4YSCA 3C75A 4A66A 1V55B 1ID2A 4HALA 2FWLB 2BP8B 1PNDA 4YSUA 5I6OA 1GS7A 4BDVA 1VLXA 1NWOA 2CUAA 4AKPA 2YAEA 1SF3A 3OMIB 1PMYA 4K9JA 2VW4A 2FQDA 2EIKB 4F7KA 2Q9OA 1ILSA 2AANA 2IWFA 1KCBA 2W8CA 3H4FA 2IH9A 2CCWA 1B3IA 2Y69B 2IDTA 3KW7A 3NJLA 3ZIYA 2QPEB 4YVUA 4ENZA 2CAKA 2GIMA 4E9QA 3AG3B 4YVNA 1AZUA 3D12B 3G5WA 3IN2A 1BEXA 2FT7A 4KOCA 2ZWNA 1SHXA 1NZRA 4DP2X 2XXFA 3FU7B 3NJMA 2PP9A 5I5MA 1NPJA 3NP3A 3NJNA 3ZBMA 5B3SB 3PAUA 1AS8A 1NTDA 2HZHA 3FSVA 3NYKA 4KNSA 1V54B 1GR7A 1ASQA 1RCYA 1ZDQA 2BWIA 1ET5A 1KBVA 1OE2A 4A2GA 1MZZA 3V9EA 5AZUA 3EH5B 2DWSA 1FWXA 3CDZA 1WS7A 3FPXA 3UABA 1ASPA 1BXVA 2HRGA 3GDCA 2OCCB 2PPFA 2IAAC 4JHVA 3FSWA 2CJ3A 2HLEB 2IDUA 3NSDA 1R1CA 2IDFA 3FU7A 1L9TA 3PAVA 3ABMB 4EF3A 1BYOA 2FQGA 4HIPA 4ZK8A 4UAHA 4G7RB 3NP4A 1BQRA 2DY2A 1QHQA 4TXVB 3H4HA 4WTQA 2HRHA 4AX3A 3FT0A 4FAAB 3FU8A 2GSMB 3X2QB 4KNUA 2FQFA 1X9UA 2H47C 2J5WA 4YSOA 3WKPA 1WS8A 3SBPA 2BZ7A 2VW6A 1PLCA 4M4RB 4P5RA 2N0MA 2BW4A 4GY4A 2R7EA 1OCCB 1N70A 2FNWA 1XMEB 2UX6A 2FJSA 1NWPA 4DP0X 3IBOA 1KGYE 5IY5B 4WKXA 1E65A 5B1JA 3ERXA 2DWTA 1PLBA 3AW5A 1ILUA 3OMNB 1SF5A 3TBBA 2FT8A 2UXVA 3AG4B 3CZUB 1E5ZA 3FQ1A 4KO6A 3FYEB 4NERA 4G72B 3FQ2A 2XUWA 4AKOA 2X88A 2I7OA 1JZGA 5I26A 4RH4A 1SDDB 2GB2A 1PZBA 5I6KA 3WG7B 3GXUB 4YSTA 1L9PA 1AZNA 1M57B 4YSDA 4W1TA 2EILB 1A4BA 1ZV2A 1RKRA 4E9XA 3QPKA 2XX1A 1JZHA 1GS6X 1CYWA 5D4IA 2XV0A 3FU9A 1URIA 1GSKA 4E9WA 2JXMA 3PPSA 1NINA 3PXLA 4Q8BA 4HHGA 3V9CA 1EZLA 8PAZA 4UF7C 3WI9A 5I6LA 2VSMB 2PPDA 2XU9A 3PAZA 2Y1AA 4YSPA 5EHFA 3S8FB 1AAJA 1PLAA 4E9SA 4BWUA 1ZDSA 1SDDA 3CVCA 1AG6A 1J9RA 1W6LA 2AZUA 3UACA 2IDQA 1M56B 1NIEA 2PPCA 5I6MA 3RYMA 2PCYA 4Q89A 4HCIA 2BP8A 4FA7B 2YAHA 5D4HA 5D4JA 5B1AB 2BP0B 1AACA 3CVDA 1XB6A 3QJQB 2IDSA 1L9OA 1CURA 5F7AA 3EHBB 1AQ8A 1TU2A 5I5JA 4DP9X 3WIAA 1M9WA 4A2EA 2EIJB 3H56A 3OMAB 1E67A 2B3IA 1KCWA 2E86A 2GC7C 2DYSB 1EHKB 2FTAA 4DP4X 1KV7A 3S3BB 1GS8A 3N2JA 3NJIA 1MDAA 1AS7A 1QNIA 3NJJA 2YAFA 1AS6A 1SFDA 4NAJA 2I85A 5I6PA 1PNCA 4G71B 4JHUA 4BXSV 1NIAA 1A4AA 1PY0A 3FPYA 2JFCA 5LDUA 1JZJA 2EIMB 1PCSA 4YSEA 1J9SA 1PZAA 2IH8A 4G7QB 1WA0X 2VMJA 3L45A 4A2DA 2J55A 2YQBA 3EH3B 1OCZB 1WA1X 1YLBB 5B1KA 2H3XC 1AOZA 7PAZA 4AI7A 2UXTA 1BXAA 1TEFA 2PLTA 1E5YA 4HAKA 5B1JC 4AKQA 4G7SB 3S3DB 3NSFA 4KNTA 3UADA 2GI0A 1JXFA 3T71A 2YAOA 4HZ1A 5B7EA 5TK4A 1J5CA 2VM4A 2XX0A 4AZUA 3DTUB 1A3ZA 3QJUB 4F2EA 5B7MA 3T6XA 3AZUA 1ASOA 3AY2A 4QKTA 1T5KA 3X1NA 1F56A 1WAEA 1NIBA 3N55A 3DIVA 1NPNA 1BQKA 4UANA 2ZOOA 1TEGA 5E9NA 1OCOB 4BWWA 1KBWA 3MX0B 1OOWA 1JZIA 1PAZA 3NSCA 1L9QA 2W88A 3X1BA 3OD3A 4E9YA 4BXVA 2OV0A 3TA4D 4PAZA 2YARA 3MBWB 1JERA 3FSZA 1OV8A 6PCYA
chains in the Genus database with same CATH superfamily
4EN2A 1OWRM 2ZWYA 3D51A 2VTFA 2FCBA 4H0LC 4CDGC 3MLYL 2CO2A 2QT6A 4K7PY 3FTZA 4BUHA 1UB5B 5FO9A 4OCWL 4NKIL 2GUOA 4NLAA 3NT0A 5BUGA 2RGSA 4TVUA 4OI9A 3AB0B 1AR1C 3DURA 3ARBB 5C0BB 4HJJL 5G55A 4YDVA 3QDJA 4GG6B 5HYEA 5C92A 3QJRB 4C4UA 4PV9B 1KCRL 4JB9L 1VPOL 1JNLH 1QEXA 1RK0A 5IMLA 1S7UA 3HPJA 4LCIH 4MHHI 1MG2C 4PS7A 3T4YA 1FORH 3SGDH 2K6WA 1R17A 3L3GA 3CDFA 4DPBX 4PH8A 1B0RB 2WQAA 5AFAA 4DQOH 3SKOB 2W9LA 3MLWL 3UTPE 2XA8L 5HVGB 5ERWB 4RFEB 4JKNA 4H8HA 4XBGB 4QRSA 2WVVB 5JOFA 4C8XA 2NR6C 1LE9A 4MQXC 3WCYA 2XWEA 3REWB 5MEPA 3IGLA 2VIRA 4OZIA 3DUHA 3GSVB 2HT2D 3LPPA 5G5DA 3TZVC 3LB6C 2LTQB 3BMWA 3LRSB 3ZDXB 2BWQA 4QXGH 2XN9E 3EYVB 3L3IA 1ET7A 2BRRL 2BXZA 3P11L 3M46A 4OY9A 1Z0NA 3O45B 2AI0H 4KTDH 3C60C 1H8SA 3GI9H 3PWNA 5BO1L 5C0JA 4PJ9D 3KE0A 2J71A 2HX8A 5IB5B 1WBYB 4N2NA 3IDXL 4PJ7A 5ANMA 5IW1A 2F6AA 1EAJA 4HU2A 3TLRA 2OTUA 5F9WC 1W0WA 2OJ1A 1RP8A 3KDMB 4NHUA 3UAEA 3MODH 3QWOB 5AVUB 5HXMA 4XE0A 1L3NA 5FKAA 2D3VA 3HJEA 3UTTD 1QRNE 1E6JH 4GQRA 4HXAL 4JO2H 5IR1B 2XIBA 4NN6B 3HB3D 4UT9A 4D94A 2GUYA 3WOVA 3FTSA 4XNUL 4BQ8A 2BC4A 2MTPA 3KVPA 1BVLA 4Q9CA 1FGVH 4PWJA 2WBJA 4HIIA 3POCA 4GQZA 1TTGA 5DQ9B 3MGTA 1G9MH 1QSFD 1Y6MR 2IXQA 3OKEB 4KUZH 4LKCA 4NO5A 4Z9KB 1Q0YH 3VD2A 3WKML 4WLCA 1BZDA 4OLUH 4E9LA 2FYYB 1BJ1J 3ZZLA 4NEHB 3V6OE 4F8OA 1BIHA 4K71B 5DRZA 4ZFFB 5JW4M 4KZCA 4X42A 3NEXA 3EJYD 5AUMA 3BPNB 4N6RA 5EC2B 5C0AA 1FZOA 4DP1X 4FG2A 4XPFH 1BFVL 1FZJB 2A3TA 3BZ5A 3IRCA 3O6FA 2WXLA 2VZOA 3FUJA 1XAUA 3QCUL 4AYEC 2BHFA 2VDQH 1MCNA 4RIRB 1EJ8A 3ARGC 4ZTOL 3L54A 4UTBA 3BUYA 1M1XB 4NKMA 2AS5M 2J2ZB 5I1AB 5DK0B 5E9DE 3SOBL 3SDYL 2NMSA 1KCUL 1ZXKA 4S10A 4K0OA 3MCG1 4YBLC 4CSPA 3AWEA 3FAWA 1A7NH 1U8IA 3ESVF 1YMMB 3HCVB 1KFGA 3JWOH 4PRID 3TH2T 4ABUA 3DX9A 3OQRA 1LE5A 4P5TD 1WSST 3UMNA 3O41A 3D0LA 4MNQE 1I3RB 2B9BA 2B08A 1FHGA 4Y16A 3QA3B 4KHXL 1D5IH 1OP5H 1U8KA 4GBXA 5DMYA 1GC1H 4PJHB 4MCYA 5FYKH 3QB7C 1USZA 4PWFA 1WRFA 2XSKA 2R27A 5E2WH 2DLFL 4L18A 3L48A 3DUSB 4NM8H 2DTMH 3ZUNC 2YHGA 1XT5A 2V2WB 5I0VA 4NHCL 5JZ7C 4KK5C 4CDHA 5FYKU 1GYCA 4KO7A 3BSZL 1NAMH 2AJYH 4HH9A 4PLKC 3VXSA 4BA8A 2MOVA 1SVBA 5D70H 3VRLE 4Z7QB 3U36A 5CBAB 1NANH 2F54D 3WFEH 1NWOA 2JCCE 2CUAA 2V4LA 4G3YH 3SJVB 1K8IB 2CPUA 2YAEA 3KS0J 3PWPD 1T0NB 3ZLQC 3MRIA 4KX9A 4WNQA 1F4XH 3HHMA 4GLRH 4XVSH 2DICA 2VLJD 4ZT1A 5GRVK 5IZ7A 3HI5L 1BM3H 1AMYA 4JDVA 4OCNC 1W0VB 4L3CA 4KZ0A 4A7TA 4XPGL 1VGEH 4YGAB 4L2LA 1J1OH 1YN6B 3DUUB 4H20H 4ZDHA 5BRZA 3T0EA 4PBXA 3FQUB 3P02A 4OV5B 4I1PA 3VXNB 4Z76B 2GYSA 1AGFA 1KCSL 5C0CB 3VTTA 4ORGA 5SX4I 4MJIE 1E4XH 3NH7H 4EUPH 5F9JB 3VU2A 3DOSA 1J05B 1OWWA 2VYRE 2X9ZA 2XXFA 2ZPKL 3CFQA 3NJMA 4J3OF 1I85A 4DEPB 5HYFA 4J3OH 1OSZB 1S7RB 3UC2A 2BSTA 4RNRA 3NYKA 4WCYL 4K3EL 3VXME 4HS3A 1QSVA 1UD2A 3EGSA 4HEPA 4Y5VC 3P77A 2C1PB 4PVNA 5AZUA 1FWXA 2J3SA 3MRCA 5BV7L 4ZRGA 3KLAB 4LSUL 1F02I 2ICEC 3DXAD 3GDCA 4G6ML 4J1UA 4PRBA 5DD6B 3H9SB 1BX2B 3FONB 3MHZA 4NJAL 2ADGA 1R1CA 2CHDA 5DRWA 4FXKB 3FU7A 1VSCA 3HC4L 1IEAB 5FV1L 3PP4L 5AZEH 4OZGE 2XI9A 2XCMC 3IDIB 3RL2B 2Z92A 1L7IL 3ISYA 2HJFA 5GZNC 4PJCE 2WN3A 5C71A 1DJGA 4WWKD 4U6XB 2HVKA 2YPLE 1Q0XH 2R51A 2OMTB 4KKCD 3W9EB 4AX3A 2EC9U 3U0PA 1OW0A 2JB5H 3M6DA 1ZHLB 2H0FA 2X4PA 1WH0A 4KNUA 4OCYL 4XP9L 3O9WD 3RWFA 5C0EA 1M53A 3IDNB 3GUTB 1UXWB 3OLDA 2E59A 5AW0B 3R0NA 3IJHA 4R0LA 2NY5C 2V3FA 5ISZD 4KQ4L 1OAXL 4EZMA 3IS1X 1H3XA 2VDKL 1E65A 5DEZA 4F7MA 4ZMAT 3RGVC 2VWEC 1FH2A 1UG9A 3QCVL 2CO7A 1SF5A 3CWGA 4EKXA 2WMPA 3QT2A 3V0WH 5HYJA 2V5RA 1ZA3A 4OF7A 4NO3A 1AGBA 5CJXC 5EU3B 2BP5M 4OT1L 4UZSA 4JFPA 4LDEB 3QDHA 5LGKA 4IDJL 3N1QC 2BNRB 3VCLB 3S35L 3BKYL 5GZOA 4YXLH 5DJYB 2LLLA 2HH0H 2YC1B 3MJ9L 1KMGA 4OD1H 2YO3A 3THML 3QDMB 3V0IA 2VDML 4O02B 3HMXH 1A4BA 1TQUA 5JPMA 1NFAA 4FZ8L 2C3XA 2XX1A 2P52A 3FT3B 1LNUB 4EJ1C 2YD0A 4JFHD 1DQDH 3BKML 3GO1L 1NUNB 2X4RB 1OK8A 1NINA 4Q8BA 3ECQA 1CGXA 3LHPH 5SWZE 3UYRH 4EO5A 4F7TB 4KVCL 1BZOA 1H0DB 1QFUL 2E76C 3CDCA 1BVKB 5DK2B 3NBNA 1RV6X 2KQMA 2NYZA 1Y1UA 3MJ6A 1UACH 4JDTH 5FW6A 3KCWA 3T65B 2NTSP 5A2JH 4UZGA 4MMXB 3JWNC 4H25B 4NFDA 3UG5A 2A0LD 4JRLA 4HPHA 3OSVA 5I6MA 1DJXA 3BLBA 5J13B 3L4ZA 4M62L 4JQVC 4ZUTB 4NNYA 3BZEA 1U2YA 2H32B 5F89A 2FJGB 3GMQB 3L3HA 4RBPH 1XGPB 4Y19B 4XMVA 3WNKA 4ZQTA 1GTNA 1JF6A 2UZPA 4RSYA 4Z18A 2VNCA 1NQBA 2J1YA 2O6DA 4ADGA 1CIUA 4Y4KC 3PYCA 4PGDA 1RAMA 2E74C 4F1ZA 2DI9A 4QJ4B 3IT8D 1M9WA 2ENPA 3V10A 4X4ME 4YIQB 5IKCB 4OJFL 1F6LL 1F4YL 4YMPA 5HHOB 3CGTA 2DLTA 2GC7C 2H3KA 4AL8C 1HXMB 1KV7A 1U3NA 1JGDB 4X99B 5IROC 4Z7VF 1PZ3A 5AWNL 5D1XC 2QJDA 1KIRB 1IILE 2D31A 2LOEA 1J0JA 2YEZB 5F0PB 3CNKA 1F58H 1H6TA 3BT2H 3D50A 2DB8A 2BDNL 5E8PA 1X3DA 1DBJH 3IFOB 2KC0A 3CPUA 1OVZA 1SQ2N 1S7VA 2XJKA 1QASA 1OZTG 1FZMB 2CKBH 2L8AA 2X70A 3DI2B 1N0XL 3O3DA 1SYVA 3WSQL 4D0CA 3S98A 1CFQB 5DYOB 5E03A 2FO8A 3OKNB 1ZEAH 2BNQB 3V0AC 1JFHA 1QSEA 2ATPB 2FIRT 2IQ9L 3W2DH 5HDLA 2HA1A 1J1XH 1H3PL 3FCTA 2H7WA 1P6FA 1ONQA 3QULB 1CIDA 3VDCA 2B1HH 4BZ2H 4KH2A 5KS9B 4YJZL 4Y1AE 5F7EL 5B7EA 4P2OD 1NCWL 1YEHL 3ESMA 4HZLB 3DTUB 1UJ3C 5D4QA 3S34H 3QG6A 3WMSA 3KS0H 5LBSA 2WXQA 3EOBA 4Z7UF 3VWJA 2H26A 3UPAA 5TDNA 4FQ2H 4FL4C 5AVXB 3B1UA 4LEXH 2QHRL 1J8HA 2WQUA 5C6PB 2HG5A 4ANUA 1OCOB 3DURB 3UTQA 4YDVB 2WAHA 3QDJB 4I0PD 1NBCA 4OLYH 4WIQA 2CR6A 4Y5YA 2G3NA 1RK0B 2IOIA 2OV0A 3X3FL 1JHKL 1WJ3A 3MDJA 1S7UB 2QR0A 5I75B 1G9EA 5C08D 3CSTA 2F7IA 2J1WA 4XPHL 2ICES 5FYKE 1BOGA 2QADB 5TH2B 1ZLSH 1UA3A 1NAKL 2YD3A 5F1IA 3QEQA 2L7QA 2HRPL 1IKNA 3OAYK 3L3GB 4KVNL 2V17H 3LJ3A 3HE7D 3U7WL 1LK3L 1W15A 4PIBA 5ISZE 2F15A 5I16A 1SHWA 1NMAH 2Y06H 5C0DA 5EIIA 4IOIB 2WCGA 3CQFA 4DP6X 2ZP9A 1DVFA 4A7UA 5DVMA 4QRSB 5JOFB 2WLNA 5CINH 3VGHA 3OHMB 1LE9B 3TONA 1CS6A 1CYXA 3TA3D 4BHUI 3E3QE 1CLZH 1R24A 5MEPB 3WY2A 2ZCZA 4OZIB 3OJMB 3QQ4B 5BVJA 4L1HA 1FG9C 4OZHF 1GMEA 2FEDD 3AFLA 4FQIL 1F11A 4HDIA 1TTUA 1Q9LA 1T83A 1RIVH 4BQ9A 4L9DA 4RGOH 4N0YH 4ES8A 4QXUH 4HHAA 2ENSA 5FO7A 3L3IB 4GFXA 2ADFH 1PBYA 4L3ED 1W72A 5FGSA 5TQ0L 1K3IA 3D2UD 3U4AA 3N43F 3VGBA 4I7ZC 5J89A 4MMZB 1X4XA 4F15B 5K1NA 3QNFA 2VRAA 4XRCB 1NCTA 5LN8A 1HE7A 3V2AR 4H2CA 3EJPA 5C0JB 1N18A 1UUSA 3QC5X 4PJ7B 2Q1EA 3B3BA 5GGSA 5D71L 1L9RA 2DWEA 3RNKA 2OTUB 4FFZL 5AW9B 1LD9B 3K8LA 4NHUB 3WYRA 1AXIB 1SOKA 1E3FA 3D34A 5DJ0A 1HCYA 5GGTL 1G94A 4PGCA 3VYNA 3ECUA 1FNSL 1CDCA 3RPBA 2G5BA 4Y9FA 1KYAA 5CEXA 1Y18B 3TBVA 3LPGA 4X4KA 4HFUL 3ARBD 4HGKC 5H37A 4IRJB 4TSBH 5C0BD 2BC4B 3IMWA 1BVLB 3DX6A 1S7QA 4HIIB 4J3TA 2NY4B 3QCTH 1TZIB 3WS3A 2IXQB 1B0IA 4ONHA 4NO5B 2EE2A 5KVEH 2J6EL 3PV7A 2TSBA 1OE1A 3U9PL 1KDIA 4IKKA 2VRQA 1MREH 2X3AA 1NGQH 2ZYHA 2CJTA 5DRZB 2MIZA 3B7SA 5AUMB 3V4VL 4N6RB 1EH9A 1DL7L 4GT7A 2DQFA 3EOTL 5CP3A 5C0AB 1FZOB 2WJ5A 4NUGL 4GI6A 3PJSB 1EX0A 1WA2X 2IGFH 3O6FB 3OLGA 4J7RA 2PWGA 2BSBA 2GSIB 2CR3A 5TGBB 3U9UA 5F96L 3BUYB 2Q76A 2XETA 4HUXA 4NKMB 4YC2C 4WFHD 4EDWL 5FS5A 4JY6A 4POUB 2XY2A 4YSAA 2WGXA 1MCWM 4PY7A 3BWZA 3V5DA 1EERB 1OPOA 1BXUA 2ZXWB 2ZD0A 3MRQA 1U8IB 1SDAB 2ZYIA 2ODIA 3S0PA 1TQBB 1KJMA 1NSNL 2A9DA 2FX9H 4MB4A 1V3LA 5CCKL 1LE5B 1KZYA 4KKLD 5CLXA 3F6IA 2IG2L 1WV7T 3O41B 3D0LB 1KIUA 3K74B 2AXWA 3FCGA 4MD0A 1TVDA 4B53A 1MFVA 4CNIB 1KBKA 2A38A 1KPRB 1U8KB 2VLMD 5I74B 5D2LF 4MCYB 1ETB1 2VR7A 1O7DC 2NY6C 1OGSA 4QRRE 3N40P 5AL0A 4XC1L 2OYLA 3L3JA 4W9ZA 4TVPH 2DEYX 2X2UA 3FYIB 4NQUA 1RZFL 3UTZB 5KJRL 3L9RA 3VXSB 2HT2C 4HH9B 4KXZH 4KZDH 4H8QA 1AZRA 4LL1A 5F9OH 3CCHB 4LAQL 3MFFA 4PSPA 2VSDA 1DQLH 4AGOA 1IBYA 2AXGA 1RD6A 3IJ7A 3ZPDA 1JRHL 2DBLL 3GXNA 1ADQA 3O2WH 2FSEA 2PWEA 1LMIA 3ATFA 1WFNA 5L0QB 5DHXB 2J57A 3CMOH 4LPXA 1WZKA 2OKMA 3FTVA 4WNQB 2E7HA 1EA9C 4PJ9C 4OU3A 1PW3A 2BNUA 3FFDA 2BSRA 4X6BA 3N6YA 4JZOA 3QNZA 3QUHA 1GW0A 1RU9L 4L3CB 4R7DA 4XCYB 5K59E 3IXAA 5CM1A 3BQVA 5BRZB 5JIHA 2EYSA 4QY8A 2PMZA 1OSEA 4CMMA 3GMOA 4Y88A 4R4NC 3WNPA 3HR5A 5JPNC 1MCJA 5I0WA 1AGFB 1KIQA 1VFMA 2CJUH 2P45B 1S46A 4LCIL 4ORGB 5EIVA 3FL7A 4ZUVA 1UEMA 1SHMA 4HP5A 3DOSB 4RWYH 1FORL 3JT0A 4XO5A 1SF3A 1VADA 1PMYA 4PLJD 4G8GB 4JANA 3SB3A 5D2LA 2YUWA 1T7VA 1U41A 2BSTB 1FLRL 4HS3B 4DQOL 2NQCA 3P3TA 1YMMD 3AY4A 3EGSB 4DJMA 3P77B 4FFVC 1MFBL 3NACH 4YVUA 1KTBA 4FOMA 1KBGH 3MRCB 3N42B 4JRYA 1IE5A 5FYLD 4PJEF 4CC4C 7FABH 4Z7VE 4EXPX 3HE6C 3EJYC 4J1UB 2P8MA 3F7YA 4XNAA 2FJUB 1YVLA 4N2AA 3TC9A 3B6SB 3HG2A 1FHNA 2ADGB 4KOCA 5DRWB 3FU7B 5IQ7H 3UZQA 3H2QA 4XX1E 1CL7H 4R96A 4QXGL 2VLJE 2E6JA 3RIAK 2Z92B 1U3ZA 2HZHA 1FL3B 3RTQC 2HJFB 1RCYA 1AZVA 3AS0A 1HQRA 3Q01A 4DEUA 2ZOWA 3DTDA 1BG9A 4XBPA 4B3EA 3CFJA 4KTDL 2AAAA 3U0PB 3GI9L 3RWFB 2X4PB 5C0EB 3EKCA 1JDCA 2WB1A 3WHXB 3EH1A 5E1QA 5I0XA 3SJVD 4YBHA 3SKJH 4Y2DC 3GSOA 5E4OA 2IBBA 3MODL 4KXDA 4UYQA 3ZDZB 3RG1C 2HFTA 3KZ8A 4K94H 3NIFB 2ZAIA 1E6JL 4JO2L 4AMWA 4Z7UE 4YH6A 1S3KH 4EF3A 5BUPA 4ZK8A 4BRVA 3BJ91 5T1KA 1JMZA 1BDYA 3BUQA 5E5RB 2CO7B 3I9AA 3POHA 4A7GF 5HYJB 2ARWA 2OCFD 2GSMB 1ZSHA 3QRBA 4XN9A 1AGBB 2H47C 2W07A 2ETWA 1G9ML 4KUZL 3F7RA 3QZMA 1F5WA 3P9LA 3EJCA 4PJEA 5C0CD 1Q0YL 2BZ7A 1NFDE 2NYYD 1A9VA 3RKDD 4MX7A 4MA7H 2UUDH 2QTEA 2NDFA 2CXGA 1H9VA 1N70A 1T2JA 5KSBA 1NWPA 4J4PA 2V8LA 4XPFL 2V33A 4FLSA 2J12B 2XRAH 3U1PA 3HG1E 4TNWK 4AJYV 2VDQL 1BVZA 1K4CA 3GMNA 3EDDA 3GMMB 2XKSA 5I82A 1HSBA 4FE9A 2WXHA 4AYFA 5G4NA 2XQ0A 3H9SD 4KV5F 4PJAA 2TRYA 2X88A 3LEXB 1H3TA 2I7OA 5LO7A 1MCOH 4UINH 8CGTA 4Q6IC 4NZUH 1A7NL 4DH2A 4LDLB 4Q0XH 2P1YA 4Y0GA 4OZHE 4RA3A 4GH7B 4OTXL 3VW3H 1L6XA 5D5ME 1ZV2A 2FUTA 2Y1ZA 4PLNC 4LCWA 2OMNA 1X5XA 2R56H 2QGDA 2QKIA 1XF5B 2QPUA 3ZHDA 3I9PA 1M71B 4GI9A 4YR6A 4NNYB 4XVOA 1D5IL 1G7JA 4ACTA 4J3VA 5F89B 3BZEB 1IGIH 1OGTA 1UH3A 3C9NB 5CFAA 4HK0A 5E6IA 3PDOA 5E2WL 4QI3A 4OVVA 1YCSA 2ZUUA 3LNIA 1M3JA 2JQAA 4YQXH 3ILPA 5DJAB 1WC7B 2H41A 2XQBH 2DTML 4YOKA 2ZKYA 2GEQA 1OB0A 4QRFA 1NAML 2AJYL 3IJ9A 3PV6A 4JREB 4ICXA 5I23A 3SPHA 3ILDA 4YHOH 2OK0H 3ML8A 3V5HB 1N6VA 5D70L 1IGYA 4YAQA 5HYSG 5I76A 1QFWH 3WFEL 1DEEA 4G3YL 2D31B 2BHYA 4LRIC 2JKIS 2ZUQC 3V6ZA 2APXA 1B2YA 2J25A 2WSKA 4KKCC 1S7TA 3CD4A 4L4JA 1L5GA 5E8PB 4DUWA 2BNRD 1AACA 2BP0B 4M43H 5KVEE 1ZSDB 1S7VB 5HD8C 1UVQA 3C5JA 3VA2C 3UERA 3BYTA 4D0CB 2WYTA 3ZVVA 3O3DB 1SYVB 3QDMD 4K9EH 2PYEE 1VGEL 3TF4A 1J1OL 1MRFH 1GGIH 1PVHA 3LEVH 3NFPB 5FHBH 1MFEL 4AY0A 1KCWA 4HJEA 4HUNB 2ILLA 3SQOL 1MAJA 2CDEA 3VB8A 3MBEA 4YHPA 1REIA 1AS7A 4K07A 3FCTB 3NH7L 1ONQB 2IOOA 3IJYB 4M1GH 5FYJH 1SFDA 4LCYA 3V0JA 5CGMA 1BAGA 5IHZA 2APTA 4DO6A 3ZYZA 4JHUA 4IGBB 4KWUA 3QG7H 3Q2VA 1I1AA 2XG5A 4MASA 2WQWA 1OP3H 1A7RH 5FYJU 5MENB 5AKVA 3EOBB 4KKBD 5EOCJ 5IVXF 3HR6A 3VWJB 4LF3A 1QACA 3WKYA 1JWSA 4M5TA 3ULSA 2E9IA 3QZOA 4EIUA 2ZX9A 1A22B 1J8HB 3ETTA 1WA1X 2HG5B 4FQXA 4PJBB 5F0LB 7PAZA 1KELH 4LCVA 3PJLA 2VLKB 3UTQB 1MDTA 3LX9A 4AQAA 1IE4A 3PWVA 4BFBD 1OT1A 4KNTA 2E7CA 3KG5A 4LO9A 2KDGA 2QR0B 4YE4H 1QUPA 4Y19D 5E6UB 3QR1A 1TETL 2VM4A 4AT6A 1BOGB 5FWRA 2J4WH 5DD1L 5E23A 4OVUA 4TVPE 1SN2A 2QQKH 2P49B 5HHOD 5K9KA 2JB5L 2CUMA 4MAYA 5I16B 3I3EA 5CU5A 2ZOOA 5C0DB 5EZJA 2L04A 1X6LA 1DVFB 1H5BA 4JKMA 5I71C 1VFUA 3T1WA 1ITCA 1E6OH 1UM4L 3O6LH 4GXVH 1XCWA 1R24B 3LKQA 3PDGA 3ZJAA 3Q7JA 1G87A 3US1A 4HOMA 2X2JA 4G9FD 4S1DD 3PXJA 3ZL2A 3MZTA 4HDIB 1J5OH 2ZX6A 3ZL1A 3OZKA 4DPCX 4AEHL 4HHAB 5FO7B 2VJXA 2MQGA 1HNFA 3V0WL 1W72B 4Z3HA 5IB3B 1CE6A 2G3XA 5CR1A 1AHKA 3MRMA 3SBQA 1IZJA 3EJJX 3AT8A 4BDVB 3O4LE 4RISH 1ETA1 4YXLL 4XNXH 1KXHA 2B1AH 2XWTB 4XWOC 1A7BA 4HWZA 5GGSB 2P80A 4FQPA 4P5SA 3RNKB 2MPVA 2CMRH 2GC4C 2LFEA 1EFXA 5J8OA 1N59A 4PRPE 5ELIA 2V9UA 2Q5BA 3MRJA 5DJ0B 1R5WB 5HHXH 3ZQWA 4PGCB 5LAPA 3RY4A 1FF5A 4LVOC 4LBAA 1JDAA 1S8DA 2G5BB 4XN7A 1DQDL 5CEXB 1N5AB 5CUSH 1JYWA 4JCMA 1FA4A 1J1PH 4OB5H 2YAQA 4BIKA 3V55A 3LHPL 3UYRL 2ERJC 3TBYB 3QDJD 3DX6B 1S7QB 3RWCA 4MLIA 3NAAL 1UCBH 1MWAA 3MRDB 3WS3B 1GY2A 2P44B 2YS4A 3AXIA 1UACL 3IFPB 3NCBB 4QO1A 3HEIB 1XDTT 1Z0MA 4JDTL 1R33A 4ONHB 4P59H 1FVEB 2DIAA 2QADD 3IGUA 4QHMA 3H3KA 3KW8A 2WD0A 2V3DA 1I7ZA 5F7MC 1XBRA 3LIUA 3P4MA 1TJIH 2WLLA 2Z0UA 2DQFB 4IMKA 3GC3A 1S9VA 2IFFH 3QWRA 3CFNA 4A37A 2EEXA 2GBUA 2LAGB 3U9UB 4BM7A 1OB1A 1ZJBA 3WN5A 2DKUA 2Q76B 3GZQA 1UXLA 4HUXB 4N8PA 4QAMB 4QHNA 3HRPA 3OAUH 3ME0A 2FWUA 1ZTXH 4NQQA 4JY6B 1T4KA 3HLAB 1YNTF 2YAPA 4I0PC 2ZOLA 4PY7B 3V5DB 1AQHA 3X17A 3MRQB 1Y7VA 4LRNH 1UH4A 3LZFL 3FRUB 1AIZA 1KJMB 4HV8A 4FERA 1HOEA 3UAAA 4PGEA 4FRWA 4XE5B 4Z7OF 4OCRL 1KTDA 1DN0A 4QRUA 4HKJB 4PY8J 5D1ZI 2X4SA 3ARRA 1A6UL 5C0BE 1F58L 3BT2L 3ESPA 4YLCA 3LPFA 1QFOA 5IIEA 1DBJL 3PFUA 2H0EA 4U4BA 2R7EB 4G8AC 1AHWB 3RTLA 2CKBL 4X5PA 1WIPA 3HAEA 3OXRB 5L88L 1J12A 2RQ8A 3L3JB 1IC0A 1KIPA 1ZEAL 2WKGA 4NIKB 3GBDA 3L9RB 1A3QA 3BVNA 3W2DL 1MJJA 1J1XL 3GMPB 3HPLA 2FECL 3Q2NA 5DMGD 2JKRM 3MFFB 4PUBL 4LLWA 4BZ2L 2B2XH 5HGGS 4IRJD 5TQ2H 4AEIH 5HP5A 1FNLA 1O0VA 1D6EA 2FSEB 3RWGA 1XB3A 1JNNH 3S34L 4P2AA 5KVMC 3N1FC 2NY4D 4I77H 1NOLA 4KV5E 2GI7A 2CCVA 5DLMH 4ILDA 3VFRB 3WU1A 1U8HA 2ZAHA 3SKNA 4Z7NF 4FQ2L 1IEBA 4NM4H 3FFDB 4B9GA 2BSRB 4OIFA 1OL0A 3OKLA 1QO3B 3PABA 5AYQA 1QLEB 4JZOB 4RQQA 5J6SA 3ELAT 3KYAA 1V3KA 4N0FA 3ZDXE 4R7DB 4MGXA 4WSKA 5C0AD 2ATAA 3BAXA 4QY8B 1U8NA 5EV7A 4CMMB 4OLYL 4KJPC 5SWQA 3O6FD 3WEBA 3HR5B 3ZE2F 3OAWA 3I02A 4HJIA 2NLJB 5L4MA 1KIQB 2EE6A 1IGTA 1VERA 5KTEH 4XXWA 4ZUVB 4NKDB 1ZLSL 1OZUA 1BZ7A 1JZ4A 2XQYG 3ARBC 1VADB 2WQ8A 2PP8A 3L5HA 4UDUA 4WGKA 4MDIA 4FA8A 2V17L 4JANB 5D2LB 5FECA 3II3A 1NICA 5EOCH 1X5AA 1OAJA 3NPZB 4JFEA 5K33A 3IFLH 1NMAL 3O4OB 1YPZF 2Y06L 4B27A 4X4XB 2AJSL 3CLEH 2WXIA 5CINL 4DNLA 2BOLA 4UQAA 3SQRA 4URKA 1FDLH 1CLZL 3F7YB 1HYRC 2KYIA 3RUGA 4TN9A 3FQTA 1DUYA 1WFUA 5MERA 3X11A 4EOWH 3UZQB 4I2XA 4R96B 3RX7A 4HUKB 2AJZA 1USQA 4RGOL 3MRKA 4N0YL 1ROWA 3B56A 4NUJA 4QXUL 3ZQXA 2ADFL 1HQRB 5CF3A 3UTSB 2G0KA 2DL2A 4L1DA 4XBPB 3BUDA 3CFJB 5E2JA 3VXSD 4X80L 4P46C 2XTLA 4PJXA 1NGZA 4ZSOE 2LTQC 1K8DB 4E9QA 3BX7C 3WLWD 5FYJE 3AQXA 4MNGA 1NGYA 4KKLC 1Y6KR 4KROB 3HTLX 1TJMA 4GUPA 3TN0A 3U0TB 1CICB 3G5WA 1RZIB 1WAPA 4NPJA 2HLFC 3GSOB 4OJCA 4PV8A 3BP5A 3HC3H 4FMFA 1O5DT 2WO4A 3KYNA 4NX0A 3OHXA 5IVXE 3PAUA 3IDGA 1HC1A 5GS2H 5T1KB 2A77H 4AJWA 1YMME 3QIWA 4TSBL 5BRZD 1TTCA 4PSRA 5GISL 3V6BR 4QD2E 4NN6C 2AF2A 3QPXL 2WLIA 4F58H 5KVEL 4HEME 1BREA 2IDUA 4MX7B 1MREL 5DZNA 2K70A 3QRFM 5K5YA 1NGQL 1KCVH 1T2QH 2FBRA 4G8GD 3N50A 5EFIA 3WXVH 3U79A 3V0EA 5KSBB 4EI0A 1BFOA 1KSRA 2YD7A 4HIPA 3HZYB 3GF8A 5LB1A 1RPUA 4R8WL 2IGFL 2DY2A 4LPWA 2ZCLL 3F85A 1S4IA 1K4CB 3GMNB 1TSHA 3FT0A 3PGCB 3X2QB 1HSBB 1CT8A 4UTAA 2DQIL 4HGWB 4PJAB 1IAII 1BV8A 1MFUA 4X5XA 1AZZC 3DTXA 1WFJA 2FX9L 4J3WA 4PY8I 5AVWB 3DHUA 2O72A 5DVKA 2WLMA 3ES6B 4LCWB 4PLJC 3S36H 4E2OA 1FV1A 4GRLC 4JJOA 4HOZA 5KSAA 3IVKA 2QKIB 1BVOA 2OI9B 5CWSB 4YR6B 2UXVA 3CZUB 3FULA 3VO0A 5L2KB 1D2PA 1G7JB 4KO6A 3FYEB 4OF6A 1OGTB 1I31A 4G72B 2FH8A 3FQ2A 4F5CE 4RX4D 5IQMA 1S6NA 4HK0B 4M6AA 3PDOB 5C0CE 4HKZA 3FJTA 3PG2A 5KSUA 5F6IB 2OMWA 1FVDA 4I3RH 4MQ7A 2ZUYA 4TVPL 4GKZA 1OKEA 3EAKA 5EO9A 2E0PA 4KVPA 1HXYB 1T5WA 4KZDL 3BH9A 1HDMA 3PV6B 1JD7A 5F9OL 2HVBA 1P4BL 5DI8A 3KPQB 4E9XA 1DQLL 1IGYB 4YAQB 3QPKA 1E40A 4IRZH 1Y0LA 3MU3A 5HYJD 1TFPA 3O2WL 2EJ1A 4MXQD 4F2MA 4Q97A 2YFOA 3U4EA 3CMOL 3V6ZB 2GJJA 3H9SE 1S7TB 5J1AA 3RI5F 1L5GB 4GO8A 3HC2A 4KQ3H 4NT6A 5GZOD 2Y1AA 5TF1H 2UY7B 5JIIA 1UVQB 4Z7IA 3C5JB 3CVCA 3U46A 3UTOA 4C57C 4G43B 1QUNA 2EUWA 5E1GA 3DBXA 3UJIH 1A1NB 3QR0A 2AZUA 4B97A 4I18A 2VB5A 1L6PA 5CJOH 2Y2WA 2CDEB 3BE1H 4YHPB 2CJUL 3TNNA 2IBGA 2EDTA 4G9DB 43CAA 1YEGL 2I69A 2V7NA 3BP6A 3SDCB 4LCYB 3WDJA 2JNZA 5IHZB 4N2CA 4ADIA 1ZTXE 3BGMA 3F5WB 1EZUA 5F1NA 3OJDA 1NC4A 2X2HA 1I1AB 1DVQA 1EO8H 3L95A 1DQQA 3WJLC 2HTKD 5GPRA 1SN0A 3GHBH 4LF3B 4ZMLA 1JWSB 4HSAC 4U0QB 4LNVA 1F41A 2CDFB 5J7CC 2NYYC 1PG7X 3NACL 1RK1A 4DP9X 5ALCH 1G1OA 3LQAC 1KBGL 2H1XA 3RKDC 1MW3A 2YPVA 3B8YA 5J3HD 3H56A 4FQXB 4JKWA 4PS4H 5AENA 3MXWL 7FABL 3BQUA 4Z7OE 2DQDL 1N7MH 2NOYA 3GB7A 3U1SH 4AQAB 1IBDA 2IADA 2YMOA 3M1CA 2VDRH 5FWQA 5IQ7L 2Y6SC 3FO2B 1CL7L 1PYWA 4N1CA 1DBAH 1S7SA 1XF3A 4QHKJ 5AD0A 2W80C 2A2QT 4YX2H 1UTDA 4XN4A 4GAYA 4DKEH 3AU1A 3WNNA 4LVNB 4P3CH 2V9RA 3QDME 1IAKA 1ESOA 2PW2A 4MRBA 3KWUA 4A2DA 5K9KB 5LWYH 3GLEA 4FXKC 4MAYB 2JVUA 5EDSA 1HK6A 4ELKA 5EZJB 3MNDA 1D5MA 1JZ3A 1H5BB 1GSMA 4NUQA 1YDPB 1JCKA 3SKJL 2ZIDA 3DDGA 2OQJB 4FTVA 3MNWB 5GXBB 3D85A 2GY7B 1S3KL 3NCEB 5B7MA 3H7BA 1O75A 1DBKL 5BQDA 1S5IL 3SPVA 1EV2E 3VWKC 1G6VK 2CQVA 2OMVA 4I85A 1XEDA 1BM7A 5T8IA 4B9ZA 1SJHA 4G1EA 4UANA 1CE6B 1TEGA 4BWWA 2SEBB 3MRMB 4W4OA 1JZIA 3BLKA 4JO3H 2ZKXA 3ZE2E 3X1BA 1CGSH 4DERA 4GINA 1UURA 1UT9A 2FO1A 4HWZB 4LASH 4QTIH 2CIKA 4IGBD 5EZPA 4Y19E 5D7SH 3CZLA 3LXCA 1N59B 5MEND 2VC2B 1H6UA 3VWJD 2BVOB 1FL6A 2FHBA 2LE9A 2VDPB 2XRAL 5ITFA 1MOEA 4J2XA 3WFHA 1J8HD 4N2OA 1YPZE 1QBLH 2DIBA 5HHOE 3NK3A 3V52H 1RERA 3VI4B 1SJEA 4TYUA 2VLKD 4NB7A 2QFPA 1N6QH 2W0LA 2KDYA 3OF6A 1MCOL 4UINL 3UAFA 2DJ4A 4QO1B 1FFTB 5EMYA 1Q0EA 4NQEA 4Q0XL 4G7VH 5BOZG 2YGVA 4ETQB 4UIKH 4Y1SA 3VW3L 1TCRA 1N0LA 3CZGA 1NCBH 5A7EA 3P4MB 3GZPA 4TNFA 1MCFA 2Y4SA 1MQ8A 4D3CH 4D8OA 5F7DA 3UGEA 2QPFA 1FYTE 1S9VB 3UYPA 2KZWA 1ZIBA 4FFYL 2R8SH 2BNQE 3S37X 1J86A 1IGIL 4B96A 1DVFD 3IBEA 4UWQB 1OB1B 3WN5B 4QHNB 5AVVB 3ME0B 2X3BA 5KS9E 3TOPA 4YQXL 3J2PA 1E9QB 2DM2A 3GPSA 3UMTA 1HAWA 1IKFH 1HILB 3DMMA 2Z8RA 2R0KH 3LZQA 5E8OA 2KI6A 4JK0D 3HBZA 1BXXA 2AMGA 4RGNB 4YHOL 2OK0L 4HV8B 4PGEB 1JZDC 1QFWL 2FZ3A 3MACH 2EDJA 4JO4L 3RAJH 1EO7A 5AB2A 1UWGH 1KTDB 1SNRA 1VRSA 1DN0B 1GYUA 2EIZA 2UXFA 4QRUB 2AK4B 3KYMB 4Z1PA 5IOKA 4CILA 2X4SB 2EXWD 4Q2ZA 1QI4A 4OF5A 4N24A 3K6FA 1UM6L 2W1NA 2WO2B 2XTJB 4JFFB 4M43L 3GBMH 1OQOA 2IVFC 1JS4A 3HAEB 4K9EL 5FOJA 3VFPB 1UT2A 1MRFL 1GGIL 2F8IA 4QNPE 4ZD3H 4YBQC 1IB5A 1KIPB 1YY9D 2ZUXA 3ALWA 1O9ZA 3BVNB 4S1DC 3KBPA 1MJJB 3HPLB 2J56A 4KH9A 5M95B 4M1GL 3IDJA 4KZEH 4CL7A 1AGCB 3AG2B 1T0MA 1SOXA 5T3XH 2J8OA 2C9SA 4RLDA 3QG7L 3VD1A 1U3HA 25C8L 2FBOJ 1A7RL 4N1HB 1F45A 4EZJA 2LR4A 1U8HB 4J8RA 3K3QA 3SKNB 1IEBB 2HYMA 2QVMA 5IQNA 3OKLB 3PABB 2WXRA 2XWZA 4A2HA 2VXUL 4RQQB 4XP4H 2NNCA 5FUCE 3UIYA 4XNBA 3RZCA 3GS7A 2CHNA 3ZYOA 3EYSH 2ALAA 4Y4HA 1KELL 2YUVA 3BD3A 3EJSA 3D06A 2G4EA 1INDL 5DTFA 2ENYA 3G6AB 4L0PB 1U8NB 2PR4H 1D5BA 4TOYH 4D9LL 1TLMA 2P47B 1CD1B 5SWQB 3MV8A 3I02B 1BQSA 5EF0A 4PMFA 4YE4L 2FDBP 4QF1A 1BZ7B 4L4TE 4MS8C 2Z64C 3FS9A 2V6HA 2J4WL 3ATEA 4UDUB 4PJ7E 4L05A 4IM8A 3MLUH 1AQKH 4MDIB 4IIZA 5C07A 2BSEA 2QQKL 5FECB 1D7BA 1KGCE 4E41B 4FQLH 3TH4T 3RJOA 7PCYA 4JFEB 1VACA 4U3SA 5I75C 2NDGA 5HDBE 1KGIA 3I6LE 1AH1A 5E8DH 2WSDA 3GNMH 4WO4C 4HS6A 4XB8A 1BEYL 4NCDA 2MTAA 2F53A 1E6OL 3MX0A 1FE8H 3JBG7 1UHVA 4UNVA 3PWUA 3RUGB 3FQTB 3QXAA 4X5QA 5C3TA 4JPVH 4PN6A 5MERB 3X11B 1RIHH 1J5OL 3I2CL 4I2XB 1CC3A 1FSKB 1VJSA 1HSAB 4KY1L 2AJZB 4LXFA 4NZJA 5D1ZB 4ADJA 4AEFA 3BSHA 4NUJB 4LCCA 4NN7B 4RDQG 4YXKH 2D73A 1XWVA 3TL5A 1FFRA 3ZIMA 3F84A 3VG0H 4LOFA 3RBSA 4U1JB 1N8OE 3KPSA 4PJXB 1FL5A 1R3LB 3C75A 4JFDE 2YFNA 4RISL 1XTMA 3E1ZA 5IB1A 2B1AL 4MNGB 1NGYB 4DCQA 4GUPB 5SWSA 3GSNH 2CMRL 3L17A 4MZ2A 4H13C 1JPEA 1ZXQA 3ZSTA 3V5KA 4PV8B 2IPTH 3BP5B 3RWEA 4TV3A 3GSXA 1DLHA 2LABA 3DX7B 2EE9A 5HHXL 1P5VA 1BF2A 2WQXA 4BGLA 5BZWA 3VI3F 5KWYC 5E00A 2AANA 5CUSL 2FUQA 1J1PL 4OB5L 3VD4A 1B3IA 4JJHA 3CHQA 3FQRA 4N8VG 3CXFA 2W38A 2COVD 3Q6FA 2O5YH 3HZMA 2WLIB 4P59L 4LLDB 1MN4A 1TPXC 2LVCA 1LXMA 3K6SA 3HN8A 2M83A 4LSDA 4XPBH 2XXMB 5EFIB 2WBJC 1TJIL 1XFPA 2B77A 5CEYA 5FGCE 2L4OA 1BFOB 2AABL 1NTDA 4IOSA 5G4OA 5K9QG 2N01B 1ASQA 5D1QE 4U1GB 5CZVH 3ZE0F 3SE4A 1JTOA 1MZZA 4A2GA 1D9KA 1WD9A 2B4CH 1ZTXL 1CT8B 2QQLH 3BUIA 5L4FA 1JV2A 2HCZX 1FGNH 3VJ6B 1MPAL 1UD3A 3TZVA 1HH9A 3EBHA 2IAAC 2RCSH 2CJ3A 1OAYH 2ITDA 3O6FC 5ESAA 4AYBA 3TV8A 3VAEA 3DTXB 3H85A 4LRNL 4XB7A 3GJEB 3S2CA 5HSFA 3O81A 3SE8H 3KXFE 2MWCA 4Q74A 3UTSD 1FV1B 4XVTH 3VI3A 3C60A 1PLGH 5HHME 3IVKB 4G8FB 1LP9B 1W72H 2J6WA 1AC6A 2F58L 3NEOA 4M7JL 4AQ1A 5IUSA 3MNZB 3Q43A 4KROD 4Y89A 4HKZB 4XC3H 1CICD 2YPKA 5KSUB 1XZWA 4YFDB 4KKQA 2OMWB 3S88H 4MQ7B 2H2SD 5BPPA 3K91A 4DWHA 2EIDA 5EO9B 5T1DL 4Y16C 4G8GE 1OOAA 3BDYL 1T5WB 3K72A 4GBXC 1XMEB 3BH9B 1HDMB 4H8WC 1NKOA 4OZFB 1I7UA 5I74C 1FPTH 5T1KD 2B5IC 3C6EA 2C9XA 2B2XL 5MEQA 1N8ZA 5TQ2L 1OGAA 4YO0A 4AEIL 2XWXA 3AW5A 2P5WA 3GHEH 5CGYD 3HI6H 4F2MB 4UT6A 3BD4A 1JNNL 1DHKA 1KLFA 2TRHA 3VQLA 3FQ1A 3U4EB 2CK0H 3UBXI 5J1AB 1UOLA 1UZ6F 4HWEH 4NT6B 4NM4L 3WLWC 3U46B 4TUJB 4FZEL 3K6NA 1QUNB 4J4PD 3KYOA 5L0QC 4QOKE 4I18B 5DUPH 2EILB 2XYCA 3MUZ1 3WHE1 3KBEA 3I50H 3LH2H 1QPKA 5TD4A 4XI5D 5ID1A 4RDBA 5CP3H 4YWGL 3QS3A 2VM9A 1BD2A 3DVNA 3BWUF 4N68A 1SY6H 5CZRA 5KOMC 43CAB 5KTEL 1YYCA 4NBXB 3VD5A 3BP6B 2R1WA 3JV6A 3TFBA 3BGMB 3T0EC 1G7HB 5F1NB 1M7IA 4DO4A 3OJDB 1NC4B 2FIKA 3CZFA 1XXDC 4O9HH 4IBUA 3FZUC 3FTGA 2Y6TE 3MPCA 5FFOA 5IQOA 3IFLL 1AG6A 2IC2A 3P4OB 5IHBA 5EBGA 4FQCH 1RK1B 1W6LA 3CLEL 3P9WB 1I85C 3JUYA 2CLRA 4LCWD 3BQUB 3OR6B 4CN6A 4B9KC 4HC1H 4ZFOL 5DR5H 2E3VA 3GB7B 5DS1A 1AO7A 2AEWA 2IADB 5L2KD 4GUCA 3QZBA 1A2YA 1MIMH 5TE6H 4IBVA 2R9HC 4EOWL 4XH2A 5JW4Q 1TVBB 1ZANL 4U1NB 3DGGA 4XODA 4X9BA 4BE6A 1S7SB 1XF3B 5B21A 3ZYIA 3BAWA 1XB6A 5GRUH 1CTMA 4PGBB 4Z5RB 2DIEA 3MAWA 5F7AA 3D52A 1AQ8A 3V7AG 2PW2B 2Q86B 3CV5A 3NN8A 4KJYA 4PYGA 4YHKH 3IAGC 4KMTH 1BMWA 2W60A 3PAYA 4DP4X 4PJGA 1D5MB 1NCDH 4IBWA 4Z7WF 4XCEA 3NJJA 1QNIA 2H1PH 3DYOA 1A6VH 5T3XE 4FTVB 4I9XA 4JE0A 3DDFA 3KEDA 2Q7AA 3HC3L 3LS4H 3UCQA 3BUBA 3D85B 5KVFL 2ENQA 4AGQA 1OW0C 2DAVA 1E3XA 3GM0A 3J7HA 5C0IA 4NJ9H 2A77L 5L9DH 3GSQB 3SPVB 2JV6A 4P2RA 1QLEH 3OKYA 5GGVH 3UBXA 3DETC 1J5IA 2OMVB 4G7YH 4MD5A 2MH4A 1HHIA 4PJIF 4R0LC 2WCSA 1SJHB 2EKSA 2JK5B 4G1EB 1JAEA 1EAOA 5ICXB 2YUXA 1AOZA 2UV3A 3CC5B 3SO3B 5KBKA 4F58L 2WXOA 3SDCD 4IBZA 1KCVL 2YD9A 1T2QL 4JPWH 4G5ZH 1W91A 2DM3A 3WXVL 4MXQC 1J5CA 1I1AD 3M1BA 3IAQA 3ZR6A 2DYPB 2FSDA 2Q7NA 3ULVD 3IDUA 4FKEA 1RZKC 5ITFB 3M17A 1D7FA 3REVA 3IMSA 2YBRA 3N55A 2ICWJ 4FQXD 3RWIB 1X4ZA 2VR9A 2QFRA 1D2OA 1SJEB 5LBVA 1HWWA 1PAZA 5JPMC 1WTGT 5A2CA 4Z7WA 4Q4IA 4NQEB 5EN3A 4ZFQA 5C0ND 4CU6A 4YFLI 1WWAX 5F7HA 3DJSA 4QWWD 1UH2A 3BLPX 3D87B 4MXWH 1TCRB 3QFJE 3EYOA 2QQQA 3S36L 5L2JA 3LN4B 3ZKMD 3WTSA 3HZKA 5ALBL 5F7DB 4OZ4A 1RZQA 2H45A 1UOWA 4MAYD 3UYPB 4KI5D 1LTXA 4HKBA 2BSSA 3D4GA 2N3JA 4APQA 5KBDA 4C56E 1CLOL 2WVSA 5F3HA 3SBRA 3D09A 2X7LA 2F2HA 3NJFA 4NQDB 4I3RL 1SQMA 4A2FA 4NQCA 3SPCA 2FEEI 1I7TA 3DMMB 3VFVA 3K1KC 5E8OB 3F83A 3NPSB 4HMEA 2PW1B 3RGVA 5MENE 3QS2A 2F1AA 4OCXL 2YXFA 3BCFA 2ADJA 2EECA 4IRZL 2DQTH 4UT9L 3RZWA 4OUUA 3U48A 3AWGA 3GXPA 3OG6B 1J88A 1J8HE 4JGMA 4TSCH 4PV1C 4RGMC 5CS7A 2EIZB 3A22A 4PJBE 4LLVA 4Q2ZB 2ZONA 1G7QB 3LD8C 4HCRH 5FM4A 1NC2B 2VLKE 1R3KB 2XLLA 3FFCA 4KQ3L 5TF1L 3V8OA 3QQ9C 3T4AA 1AI1H 1KJ2B 2P80D 1B88A 2XYBA 4ODXB 5D7LA 1HYSC 3BIBX 4ALAH 1EFXD 1CFSA 2PCFA 1KYUA 1Z3RA 2CNYA 4GXUN 1BZ9B 5JHMA 3K6IA 1BZQK 3BE1L 4WHDA 4APXA 5GHWH 3B3IA 5D9SA 2HVJA 4H7VA 1ZLVK 3ZE0E 1ZGLP 3IDJB 3GQFA 4M9OA 5AVQB 1JPSH 1T0MB 4FG6C 5FX3A 1C8QA 3MV7E 4C59B 2OSLB 3APMA 1XCQA 2MEJB 4LSVH 4M5YH 4RFNB 1EO8L 1KJVA 1JZ8A 1HH6A 1X5MA 3MRNA 3V4LA 3OJ2C 3VH8A 3GHBL 2F18A 4WUUB 4K8RC 3LH8A 4GP4B 3WXWL 4YL4A 5B38A 4QPEA 2UYLA 3RZCB 5GRWA 2GPZA 1XSJA 5IJVB 5B1CA 1MI5A 5ESQB 4G83A 3SKUD 5SX5K 1BYPA 1OAUH 5DTFB 3S35X 3W9DA 3U1SL 1D5BB 4F27A 1I8UA 3ARDB 4I4WA 1J9TA 2YRBA 3VB9A 1U30A 3KLHD 3U30C 2Y7MA 2J8HA 4QF1B 4X7FC 3CIAA 1DBAL 2HKFH 4Y4KA 4XN1A 5FM5M 4YX2L 3FFOA 1G7IA 4FNRA 2IH3A 2VLRE 4PU2A 5C07B 4P3CL 2W59A 3DHMA 3WY1A 1C8PA 1XGRA 4GUQA 4Y5YC 2XA3A 2NCMA 4KFMA 4WTZA 4GRWB 2ESVA 4RGND 5ECJE 2JKSA 1VACB 4TNVF 4U3SB 5A6IA 5D1XA 1M42A 1MW0A 4K5OA 2O5ZH 1QVOB 4HS6B 1J0HA 4A7SA 5DZAA 4ZOAA 2F53B 4WW1A 1GCFA 3DRTA 2IEPA 4JM0A 4F93B 2X87A 4HA1A 3RKPA 3PWUB 2VH5L 3QXAB 2XTJD 4JFFD 2DWYA 3L1FA 3K0WA 4OKVB 3IDYC 1DVFC 1UZ6E 2AEIT 1E5BA 3P69A 1CQYA 5J1SC 3UBFA 5CAYB 4GSUA 1GYWA 3ASOB 2M8XA 5FW7A 5IFAH 4RRPG 4Z3GA 3Q8FA 2V7HB 5IREA 3HC0A 2MJWA 4JO3L 4OJYA 1G9NC 1FL5B 2D0HA 2IAMB 3NEEA 2H6PB 1CGSL 1T83C 1IARB 2ZSVA 1V27A 1TQCC 2D4DA 4NQTA 5DJDA 3S3PA 1YNLL 4LASL 2AZAA 4QTIL 4DCQB 1IKOP 2Z4TA 5SWSB 5D7SL 1BAWA 3SDXF 4A6YA 4NDMA 4PCTA 3P40A 2VISB 3QZNA 3V5KB 3OM3B 5FOBA 2EXWC 3RWEB 1DLHB 1A9BB 1XB8A 2H8PA 2ICWI 3HN5A 9PCYA 1YO4A 2R69H 5IW3A 3NABL 4P57A 5E00B 4JCWA 3H3BC 1AR1B 3F7VB 3V52L 4U4IA 4TVSa 4PM1A 2VM3A 5E24E 1RZGB 1II4E 3DX8A 1DZ0A 2XIDA 1N6QL 2VLLA 4N87A 1A7OH 3TS8A 3G6DH 3HZMB 5EU5A 3ZE1B 1CFBA 4OLZH 4UIKL 1F97A 2ZWLT 5KAQG 1IC1A 3JUZA 3K6SB 1DSWA 2WNXA 1NGPH 2P5PA 1NCBL 3UCRA 4D3CL 1X5KA 2VW4A 4U6YA 4E41D 2ZOKA 2A6JA 3E6HA 5D7HA 4JFED 4S0SD 4F7KA 4UOZA 4WSJA 2AHIA 4MB3A 3G3LA 2A4EA 3MV9E 2A1WH 1F1DA 4G8IA 1BBJA 3H4FA 3RE0A 2R8SL 1WPCA 5H8DA 2GJ6A 4OCLC 4UZUA 3WDIA 4G42A 1D9KB 4P06A 1E4HA 1JV2B 5ECGA 4JGJA 4M5ZH 2X1OA 1XH3A 3TZVB 2Q7YA 1HH9B 1IKFL 2FBJH 3EYUL 3QDGA 2R0KL 5A2KH 1QATA 2ITDB 3BESR 4WI7A 3J07A 1EFQA 2R1YA 1HNYA 1QOKA 1T4WA 2G75A 5D1ZD 4P2CG 1EEUA 5I5MA 4ZNEE 3MACL 3RAJL 4H1LA 4WVRA 2K7PA 3HIZA 3PUCA 4XAKD 2BWIA 4Y8DC 3JWNG 3C60B 2X6BA 1OE2A 1Z7JA 4PJIE 3VGAC 5E5LA 1RQ5A 1NCAH 4H44C 3KWTA 2GVYA 3APCA 2BIIA 1TMCB 3TV3H 4AYID 3BH8A 4Z3IA 2DM7A 3QNXA 3GIVB 5F9WB 4NUPA 3WTVA 2BY1A 1FN4A 2YPKB 4YK4B 4HK3J 2GAZA 1DFXA 2R0ZL 4NXSA 3IDMB 1ECYA 4ZD3L 3RI5K 1QP1A 1C08A 2R1XA 4NOBA 4FJZA 2HFFA 3K72B 5HPMB 3GFUA 4YGVB 1I7UB 1JL8A 4OFYA 5EO0B 4O2FA 2ZUSA 4NC1E 4KZEL 5MEQB 5ESVA 1N8ZB 1OGAB 1BQRA 4MDJA 4YO0B 1NFKA 3NCMA 2P5WB 2NSXA 4M9PA 4WTQA 3N44B 5T3XL 5FFLA 1TG8A 4NBYB 2ICWA 2HT3D 4IS6A 1ACZA 4R6UA 1YEIH 4GKOA 5INDB 2FQFA 4N90D 5CZXC 1WS8A 4ZTEA 4QLRA 4O5LH 3RX9A 3NIDF 5D96C 3QAZC 4BV1A 2WANA 4XP4L 1XF2A 2CO6A 3UBGA 3NZHH 3RVXD 3EYSL 1NGWA 2LLGA 5J11C 5JMOC 5C7XH 2FNWA 3KYOB 1CXFA 1RZJC 2FJSA 2FATH 4KHTH 1T0PB 2PR4L 3A4EA 4TOYL 4D2NA 2X12A 3IMRA 4JFQB 3UTSE 5L4JA 4ZO6A 3ERXA 3O2VH 4NXKA 4HXBH 3QHTC 1ZGLM 1BD2B 2NX5B 3DVNB 1PZSA 3TBBA 1C5CH 2XQYA 1FNFA 4I89A 3X3GL 3TIDA 4ZFZB 1GMIA 2R1WB 3JV6B 2BY2A 3MLUL 1AQKL 4YBLB 4X50A 1WF5A 2FIKB 1QI3A 1EJOH 2BCKA 4FQLL 1E7UA 4EBQL 1TZGH 3IMVA 4YSTA 3TJEH 2XWBA 1AZNA 2ISDA 4DVRH 2DQJH 5FM8A 3ATDA 2OM5A 1P84K 2CLRB 5TE7H 2FK9A 4NNXA 4NPYA 1FE8L 4AIOA 2E56A 2EE0A 4PW3A 5JO5A 1AO7B 1I4FB 4JPVL 3AY4C 5DRNB 2I25N 1RIHL 4ANKA 1LO5B 4XH2B 3DJRA 3BDXA 4P07A 4QTFA 3DGGB 4LSTL 1BLIA 1AYRA 3PHQA 3WN6A 2WWMC 2UY6B 2BVUA 3O2DH 4YXKL 1DVXA 2QBWA 1QTSA 3O3AA 2DLEA 5JHDA 1P6WA 3VD9A 4TPRH 4JMXA 1EO5A 2NYKA 2D2CC 5CN2A 2EICA 5CJBA 2I9LA 3CX5J 5I30H 3WKNA 3AADB 3KPMB 2W60B 2FAUA 4PJGB 2B0SH 5CKAA 4I0KA 3QYNA 3L2MA 5E8EB 3RYMA 3T3MF 2FX7H 5DMIH 3GTTA 3OZ9H 4QEGA 2PCYA 3S5LG 3AAZA 3G04A 2IPTL 4NNPL 4KKNA 4MKTA 4KY2A 1ODUA 4JRXA 1ZHBA 5LBSL 5C0IB 2D0FA 1NCOA 1P9MA 1TXKA 1QR1B 4FI7A 1E50A 4IJTA 5DJZA 4YEFA 4KROC 5HHQA 3IWVA 2I9TA 2G2NA 4P2RB 3UBXB 4NP4L 3WIAA 7TAAA 4MD5B 2H2SC 4EQ2A 2EKSB 1RUAH 1T20A 4ZMYA 2O5YL 2UZXA 3LMJH 4V1DB 1R34A 3BP7A 3QORA 1T7WA 4TQPA 5C8JA 4WF7A 2O4EA 3R19A 4PS8A 1T22B 5L2KE 2WK2A 4U1IA 1YZZA 3EDKA 3KCPA 5LXVA 3IXTB 3FC8A 4KJWD 4XPBL 5CGYC 1CPUA 1FYHB 5KBMA 1NC4D 3KPRA 3M1BB 3RLSA 5M94B 4OKDA 1EHNA 3H55A 1JZJA 2EIMB 4NBZB 4Y5VB 5HVHB 1CBJA 2N4IA 5CZVL 1VIWA 1UGKA 3REVB 2YBRB 3WUWG 3FRPB 1R46A 2EYRB 4X8XA 3S37H 4H8UA 2BRQA 3HE6A 5A2IH 4ZOCA 3IU4H 3E2HC 3BQUD 4LE8A 1HKLH 4PJDF 3STBA 2B4CL 2HJLA 2QQLL 3GSWB 3MRGA 3LOWA 1BXAA 3V4PH 2Y5TA 1U58A 2RCSL 5ABAA 4XI5C 5CEZH 2A83B 2HN7A 4AYMC 5KN5A 3P2TA 4DGWC 5E4AA 4JFZH 1A1OB 4Z0XA 3SE8L 2DQEH 4UQDA 3EYOB 2MQCA 3BPOB 1XXFC 3PP3H 3FUHA 1P6AB 2JJWA 4PVMA 3OLIA 4XVTL 3HZKB 3OC8A 1PLGL 3WS6A 3ECBA 4OZ4B 4HLEA 3R4RA 2V2TA 1W72L 2YD5A 5DJXA 3BEWA 1URZA 5T5FH 2F7QA 4HKBB 2BSSB 3AS2A 4JM2A 3A4FA 4XO9A 4K3DH 3GTVA 1DJHA 3GWJA 5F3HB 3SKMA 4XC3L 2X7LB 4FTVD 1G0YR 1RURL 1T04B 3S88L 4Z6AT 3D85D 3SDXE 4NQCB 1U8OA 3MJWA 1I7TB 4YDIH 3SD5A 3VFVB 4QRPA 1DBMH 3CVIH 3KMDA 4P04A 3RGVB 4ELMF 3E7JA 1FPTL 1W80A 4YDKH 4YDNA 5E6IC 3VGFA 1MJUH 2ADJB 1PZDA 1JNHB 4JY4A 4OUUB 3GHEL 4EUPG 4OFIA 3RVVD 3HI6L 3DKHA 2DQCH 4QT5A 2HLAA 4N0UA 1WCQA 4HCGA 3BVXA 4X83A 1SMDA 1CN4A 1MCHA 2AQPA 4PJDA 4EVNA 4HWEL 3FFCB 3C09C 3FNKA 2VOTA 4FXGA 2VDOB 3T4AB 3FQXB 3HKFA 4JRWA 4WEBH 4P2YA 4P4RA 4QHUA 3QZPA 4P9MH 5J6HB 1JPFB 4FHJA 1CFSB 1JOIA 4JQXA 3L2LA 5DUPL 3KHOA 3DX1A 5AB0A 3I50L 3LH2L 4AOFA 1CDBA 1BLNA 3LRLA 1UOVA 4APXB 4F8QA 4H26A 1SY6L 3B3IB 2HVJB 3ULUF 1HWGB 3ULUH 4KI5E 3L9BA 4R7NA 1FAIH 5A1AA 2ZUTA 5HYQA 1JVLA 1JVKA 2W95A 3RWHA 3O11B 1KJVB 4O9HL 4UTAH 3IJ8A 3MRNB 1HL8A 4NQED 2OP4H 1WEJH 3MBEC 3VH8B 3BAJA 3EGDA 3CLFH 1WD8A 5T1JA 4FQCL 1A65A 5B38B 2PP7A 1R0AH 2UYLB 2HTLD 3EOYG 5GS0C 5I9QC 1MI5B 5EU7E 4ELMA 4HC1L 4AIXA 4ZW7A 1I1AC 5DR5L 3S96B 3ZRFC 2BIPA 2FH6A 3VTMA 1U8LA 3D1MC 5JR1L 4I4WB 5JA8B 3ULVC 1DANT 5EO1A 4FULA 3US9A 1JK9B 5TE6L 1K5WA 1FC2D 4PRDB 1T1XA 3KPTA 1AYOA 1MUJA 3GMLA 4FQXC 2UWEF 4Y4KB 2ZWZA 5GRUL 1P2CA 4IU2A 1G7IB 1PZCA 2IH3B 3MUGA 3C5XA 1CCZA 4M61A 3DMMD 2ZCKH 1XGRB 1RFDH 4KTGA 4LHQB 1R9FA 2D7PA 2ESVB 2DJSA 4AVIA 5C0NC 1GHFL 3FT4A 4YHKL 5BS0E 2FGWH 3GK8H 5KW9H 4UU9A 5D1XB 4OZFH 1NCDL 4QWWC 5E7BA 3X1FA 2BOBA 2EDEA 3SYPA 4C83B 3VXRA 2H1PL 4HIQA 1A6VL 4LVNC 3LRGA 3DRTB 5I1JH 1DJYA 2A6KA 2VQ1A 2XVBA 3VI4E 3LS4L 5EEZA 3ZTNH 1NC2D 3VFUA 4G59C 3QI9A 4MAYC 2BM3A 5DUJA 1A3RH 1GTFA 1JVOA 4BWTA 3TVMA 5HGDB 3T9WA 2C3GA 3NIDE 4NRYB 4P48A 2EC8A 4XVUD 2WP3O 3GBNL 3RIFF 1QLEL 1GZHA 5GGVL 5DC9B 3ZTJH 4F2FA 4ZXBA 3FQ4A 5JTWA 3E8VA 3WKQA 1H8LA 5FCSH 3IWUA 3T6ZA 1SHSA 4XOBA 1NEZA 3HC0B 3LIZA 2J1KA 5FUZH 2RB8A 1SXSA 3S8WA 3PHOB 4HPYH 4LEOA 5HHNB 5DJDB 1YEFH 4XPTH 1UJ3B 4R7XA 4FLQA 3STLA 1SOQA 4G5ZL 4A6YB 3HHRB 4ORZC 4NDMB 4ERSH 3VRJB 3MMEA 2AERT 2V2XA 3O6MH 3P30H 4X98B 5E6RB 1CMOA 1RHFA 3FUKA 1TQTA 1PKQB 4WUUD 2ITCA 4FL4B 4ZO7A 4S1SH 3PNWA 3CG8A 4WW2F 4KRPB 3RZCD 4P57B 5AW7B 4DN3H 5BQ7B 3IGKA 1JZ2A 1UD8A 2YRZA 4JPKH 5JOEA 3EOAA 1B0GA 5HDOA 1IAIH 3EJTA 3RWDA 4LOUD 1TVHA 2VLLB 3ARDD 4IHOB 2DZEA 2AK4E 5LBGA 3S8GB 1UWXK 3SGJC 3WAJA 5EU5B 3SZ6A 2EXYD 2Q6WB 1BBDL 1Z9MA 1KUMA 2JKWA 1CFTA 2XTJE 2LGNA 1Z5HA 2R4SH 4JFFE 4MXWL 1KLUA 3VXQB 2YR3A 3VMNA 3ZTCC 2WKLA 5C07D 3TT1H 4YN3A 1KCRH 4JB9H 3SY6A 2BSED 3EBGA 5D2NC 3U0WH 5CGBA 1CD0A 3HBGA 2ZOKB 3E6HB 4X8GA 3LPWA 4J23A 3G6JB 1AXTH 4AENA 1JP5A 2PPEA 3OGCA 2DLHA 1BBJB 1KGWA 2LU4A 1CUOA 2GJ6B 4BQBA 3LZPA 3F6LA 4XX1G 4ABWA 2F53D 4HCFA 3QJXA 4GSDL 1WBZA 1PX3A 3T3ME 4MCZA 2ZG1A 3DJTA 3H7LA 2Q7YB 1EXGA 1EBAA 4P2QA 1UZGA 2R1YB 5FA4A 4YXHH 2G75B 3WN5C 1A1MB 3QZWG 3HRZA 1PQZA 2W91A 2NPLX 2R2HA 4H1LB 3ZT6A 4TSCL 1QKZH 3SQBA 2V5MA 3L81A 3I3DA 1YUHB 3VFGL 1ZT1B 3WAKA 4JX0A 2ZXGA 3FCSA 3NVQA 4P0DA 1KT2B 2IAMD 4QJ3B 4RGNC 2GIMA 4NQSB 3HUJA 3QNXB 3N9GH 2RBLA 3VXPA 3IAPA 5SWSD 1FN4B 1EMTH 2GAZB 3MJ7A 4TUKH 1QNZH 2EVJA 2EO9A 1M05A 2ZQKA 1C08B 1OK0A 2R1XB 3UEZA 2HFFB 1MHPH 4I48A 1AR1D 1W2KT 4O2FB 4X7EC 5GHWL 1Z5YD 4E41E 1RL1A 4QAWA 1WFMA 1KXQA 2EE3A 5HJDA 35C8H 5KYYA 1Z9PA 1FNHA 4J39A 4MDJB 1ZV5A 1ET5A 3PXHA 4D9RE 4X6CA 3EH5B 3RL1B 2ICWB 4M5YL 2C3VA 4IS6B 4WTWA 1G0DA 4IBYA 2XNAA 3CN3A 3LKNA 3SN6N 4NGHH 1DVYA 2OMXA 4RDQF 1F3JA 2PN5A 1VFAA 4JHZA 4KTYA 4W6YB 2OCCB 4LQ1A 2NNAA 4GFTB 1UA6L 4H88H 2CO6B 3TWYA 3HZ3A 2YKKA 1NGWB 5E6ZA 3NFSH 1PU0A 5C09E 4G6AC 5AB1A 4IOSD 4JBSA 2HUEA 4DZBA 2OMBA 4WEMB 1NGXB 3VFTB 4OF3A 3TO2A 3GHPA 2E7MA 2K0RA 2K9UA 4TXVB 3WIHH 3W11D 3BVVA 4JG5A 1RJZA 4F8LA 2HKFL 4LLUA 1D9KD 3D39A 3RNQA 3R18A 1F6FB 4RMRA 1F3DH 2JKNA 5JHLH 2J5WA 1E4WH 5DXWA 3TZVD 2QSCH 2DJMA 2Z31A 3JZ7A 3LB6D 3MCLH 1P7QB 2BCKB 3L4UA 4OFPA 3N06B 1T1YA 1WP6A 4GAGL 3T3PB 1BZ8A 2JSFA 5DJ6A 3WIIL 3BUPA 3VFMA 3O0LA 4UQCA 1KCUH 4NZFA 1A7QH 2VAAA 2YJQA 4KX8A 4YDLC 1IAOB 3CFKA 4NNXB 3SGEI 3C60D 4NPYB 2ZJSL 5CO1A 3LNEA 5JO5B 3NCCB 1MNUH 4OJEH 2FT8A 4FQHB 4NRXA 4XNDA 5IFJB 3X14A 4HBCL 2NY6B 4B5EA 3W5NA 1BQHA 4IJ3B 3SHSA 3KHQA 4HH8A 2OX5A 3PHQB 4DUXA 2EAEA 3D25A 1KJ2H 1DDTA 3DBSA 3O3AB 5IFAL 5JHDB 2HPTA 4KHXH 1RJCA 3FU5A 4FI8A 1LK2A 4QYAA 4Q14A 1ZCRA 1L9PA 2BFGA 2FVNA 3RJDA 1CJYA 1G6RB 2CO1A 1DVSA 2CIIA 4L29A 1F6AA 1OGAD 3ULUE 2XZCH 3VXTA 2P5WD 4KXCA 3EUUA 2SODB 3BSZH 1HQ4A 3AAZB 3G04B 1PJ9A 4JRXB 1ZHBB 3QEGH 5LHDA 3E80A 2BIMA 1TIUA 3W37A 2PPDA 4AQEA 4MQTB 3S8FB 2R69L 5GJTL 1AAJA 4BWUA 4WI6A 5DJZB 3EADA 3TN0C 4CN4A 5HHQB 1E27A 1XD1A 2CWRA 2P5EA 3V0FA 4WDIA 2EH7H 3AS3A 4BA0A 4PBWD 3TGXA 1CXEA 3UTTB 4PJ5E 1DVTA 1T20B 1M56B 1A7OL 3H1ZA 5DYFA 5GIRB 2RH0A 3OHXC 3G6DL 1WVZA 4KKAC 1BD2D 1E9PA 1AXSA 2NX5D 3ZUCA 1BQUA 5JNYA 1LP9E 1KWKA 4AUYA 3NRFA 4OLZL 4XPGH 5MHSE 1HKFA 3HG3A 1WAAE 4U1IB 3QIWC 4Y9BA 5DWUH 3KCPB 2RAMA 1PD0A 3P3UA 2UWEE 3NIGB 2ENJA 1XH1A 5EF1A 3KPRB 4AC4A 3VUAA 5CIPA 5TFSH 1H19A 2R2EA 2BS8A 3A4AA 1BZEA 3ECVA 4NAMA 3OB8A 2A1WL 2ZPKH 4GRWH 4CC0A 4BH8A 3HE6B 4L8BA 3RVXC 5E7FA 4HLZG 3D07A 2HJLB 3F01A 2DYSB 2X6MA 4M5ZL 4FABH 1GIGH 1AO7D 2Y5TB 4BJLA 2FBJL 3FT9A 2DQ6A 4NFCA 1NA8A 4XXCA 5CFHA 5KN5B 3U9WA 2I85A 3QYMA 4G6MH 3RTQB 4Z78B 2B59A 4BXSV 2OMUA 1PY0A 3GRWH 3DV4B 2EP6A 1IVLA 1J87A 4NJAH 1LEKA 1PD6A 1J9SA 3F64A 4P46A 2X44D 3QUMB 1QFWM 1NCAL 1GPOL 3BEWB 1J8RA 4EAEA 2PCPA 2YQBA 3L7EA 5H94A 3TV3L 4JM2B 4U1KA 4B6ZA 2BOCA 1UD6A 1VHPA 4Y2DB 2EYTA 3NSFA 4XP9H 1G1KA 5KSAC 2FR4A 3HHSA 1DQIA 4WFFD 1U8OB 1YHPA 3ZHFA 2XN2A 4QRPB 4MKMA 2BX5A 4J27A 2X4OA 2ZOUA 4AGNA 1ES0B 2OLDA 2VDPL 2AC0A 4JZJA 1NJ9A 3LPOA 2J8UF 1K9TA 4P2RD 4PTUA 4JY4B 4TSAH 1HESA 4KQ4H 1IBBA 1HJBC 4QT5B 2HLAB 4N0UB 5F9AC 1RUML 3NCYP 4R84A 1YEIL 4V1DD 1JTTA 1CFVL 4Z23A 4ZMNA 4L1TA 1TO4A 3VXUA 4EVNB 4FXGB 3WIFB 3QCVH 1QMUA 4JHAL 5D7IA 4YUEH 3N41B 4P4RB 1SYSB 4O2CA 5C7XL 4YHZL 3ARQA 2FATL 4KHTL 1X5IA 4WJG3 2H4EA 3S35H 4AQ8C 3D4CA 3G9AB 5F7YC 4S11A 3EDFA 1BLNB 3QUZA 3MJ9H 1ZVHA 1C5CL 4AUUA 5I2IA 3F3HA 4TF4A 2WZ5A 3HVDA 1NLDL 2AJ3B 1V3MA 4GO9A 1T7ZA 1H15B 1YSOA 4JW3A 4LHUA 2HP4A 5HYQB 4I18C 3RWHB 3CZKA 3SY0A 1A8JH 3MRRA 2VN3A 1L9NA 4JPSA 4W68A 3CSYA 4UQ2A 4HWUA 3EGDB 4MSWB 2JIXA 5EUOF 3TJEL 4ELDA 4DVRL 4GRLA 1JZFA 5TE7L 3K8MA 2IIJA 2D3JA 2QVFB 3BZ4B 2IV9A 4TNVK 5ITBL 1U8LB 1IBZA 1NCUA 2A6IB 1Z9LA 1BHGA 3FSAA 1T1XB 2WNWA 3GMLB 2Y1YA 4V33A 3LKRA 4C4BA 3BN3B 2VN5A 3NQKA 3DX2A 3VTAA 4NQCD 4TPRL 4XMUA 1LO0H 2O30A 1JGEA 2AV1B 2YN3A 2WXKA 3RGVD 5I30L 5IOPA 4YHYC 2X41A 2V37A 1MH5B 1GVIA 3JV0A 4UU9B 2DQGH 1TQWA 2B0SL 5DGRA 4AV4A 3OKOA 5AVSB 4QRQA 4W9KC 2ZUQB 4LDOB 5DMIL 2VITA 1I1RA 4ZUSA 1F4YH 2VQ1B 4OFKA 4RFOL 3VFUB 3IU3A 1XGQA 3QI9B 3FFCD 5CZKA 3WNIA 5JLZA 2D0GA 3ASNB 4NQEE 5F3FA 2A9NH 1I8KA 1TF4A 5E0FA 5D7JC 4HJ1A 3WFZA 4HAGA 1VESA 3UZVA 5EUOA 4ZXBB 5HDRA 1RUAL 2X0VA 3LMJL 1EGJH 3WEAA 1QHPA 1NEZB 2Y7QA 5B4MD 2NY0B 3GJFH 3PQYB 1N64H 2OR7A 2Z4QA 5I28A 3ILQC 1N0XH 3G5VB 3CH8A 5IV2B 2OPCA 3CFIC 4M5SA 3STLB 3CFUA 3LNGA 1OCRB 5C86A 4NQDE 2CHXA 1QG3A 1OSYA 2V2XB 5DFVC 3PWJA 3IMBA 1TYJA 4W4OC 3SO3C 5EEXA 2ITCB 3LXUX 3BSGA 2WO3B 5F7EH 2WGNB 5L7XH 1NCWH 1YEHH 3EF4A 3MUY1 1MI5D 3IU4L 1OE3A 1HKLL 2YRLA 5E5MB 3QEUB 1UFGA 3GBLA 3EOAB 1B0GB 3K5SA 1FG2A 5AOMA 3V4PL 5DC4B 5TPWH 1TVHB 3KL0A 1KF9B 1KPUA 3B9EA 2AQ1A 1A25A 3PIQA 1F4WH 4AM0A 2XV2A 1IM9A 4JFZL 4Y4KD 1CFTB 4X6DA 1KLUB 2DQEL 3WY3A 4LARL 4DPRA 3X3FH 3QIUC 5EC1A 4ZMPA 2XWRA 5HI3D 1SLWA 2LAAA 3SD2A 2QVTA 2OBGA 2ESVD 3EW3B 3TCLB 3ZKND 5IROD 3HFFA 1FO0A 5I19H 3OGCB 5T5FL 1INEH 2PWDA 4ABQA 5D1XD 5I71B 4ANXA 1JZ6A 1A5FH 3VQ1C 4TULH 2DM4A 4MZ3A 5HJ3A 3ZO9A 2XN9A 2XQYK 4PJ6A 1S9YB 5CBEA 3TIEA 2Y22A 3V79C 2ADYA 4YDIL 3MO1A 3ROLB 1A14H 1GOHA 4M03A 3D3VE 5IFHH 3J27A 1DBML 3CVIL 3CFCH 1WT5A 4N2KA 4X2UA 5FA4B 2XZZA 4YDKL 5BZDA 5JORA 4WUUE 3HRZB 1PQZB 5KVGL 3E6FA 1L9SA 2FLMA 2R2HB 2F5BH 1YAZA 3KJ4B 1GY1A 3MBXL 3NFNA 2DQCL 5DEGA 5T5NG 3DMMC 2PO6A 3KAAA 3K6DA 3FCSB 5J0BA 3NOIA 4L9LA 3FK3A 4FYSA 3QUYC 3HUJB 2OL3B 4GG8B 4JFYA 4TMPA 2FWLB 4WEBL 1LEGA 3S4SA 1PNDA 3VXPB 4P9ML 2PF6A 2X09A 3IKCA 2OXHA 15C8L 3PL6A 4TLTA 4AJVA 5AVYB 3OMIB 5MEOA 1V5JA 1MRCL 4I48B 1SXZA 5D71H 4KRPD 5CJ8A 3VGEA 3HNTH 3GGWA 4FFZH 4GRWE 5KYYB 3V6OA 2ERJB 4M8UA 4OF0A 4XVUC 1FAIL 1CR9H 1LO3H 1OARH 2CCWA 4X6CB 4DGUA 1X5YA 2FO4A 1SMAA 3GXDA 2CAKA 4GO6B 2YGOA 4UTAL 3T2LA 1FNSH 2XNAB 3KM1A 3LKNB 1WEJL 1TNMA 2OMXB 4CVZA 3QIBC 1VFAB 3WTXA