1X5AA

The solution structure of the second fibronectin type iii domain of mouse ephrin type-a receptor 1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
107
structure length
107
Chain Sequence
GSSGSSGAESLSGLSLKLVKKEPRQLELTWAGSRPRNPGGNLSYELHVLNQDEEWHQMVLEPRVLLTKLQPDTTYIVRVRTLTPLGPGPFSPDHEFRTSPPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 1
publication title The solution structure of the second fibronectin type III domain of mouse Ephrin type-A receptor 1
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 9
structure length 107
sequence length 107
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1x5aA01
1QEWB 2BNRB 5C1MB 3FOLA 3SN6N 4Z8FL 5JIPA 3VWJA 5IBTL 4YFEA 1DANU 3RIAK 4Z7WA 1B0GA 1IC1A 3EYQD 1MQKH 5KS9F 4JHBA 3WFHA 5AEAA 2P8LB 1MNUH 3DHJA 4BQBA 3WUWB 4Q9CA 3NAAH 4LRIC 5LKNA 1G9ML 1U92B 4HJGA 4L3EA 3IAQA 4HS8H 3WIIL 1YEKH 2VERN 2IPKB 1A21A 1JGLL 2W92A 2H3NA 3BRDA 1ZA6B 1S8DB 3CC5A 2IPUK 2Y72A 3TO4D 3P4NB 1NBQA 2KZ1B 1OP3H 4MNGB 5FECA 4YZFE 3SGKC 2Z31B 1EFXD 1WV7T 4JHZA 4PY8J 4FQ1L 4UT7L 1YJDH 2GAZB 5L8KB 5KN5B 1L7IH 2R8SH 4I77H 3Q2CA 5IIEA 3BO8A 1J0JA 1T0NA 3QHZL 4HZLB 4PPTA 4FG6D 2X7LA 3O81A 3EOYG 5DI8A 2VO5A 4YBLC 5CINL 3QDJA 5EOCL 5JORB 3L3GA 3SKMB 3VFGL 4DGYL 1QRKA 3VXTB 3RWJB 1WBZA 2GJ6E 4R2GD 3SE3C 5CP3A 4R4FL 1FZJB 1CXLA 3LEVH 3K8LA 3GI9L 1U42A 1UXSB 3QUYB 2NY4B 5GJSH 4ETQA 3RGHA 4QGYA 1Q0YH 4V1DB 2A1WL 4XC3H 2VH5L 4HJJH 4JY5H 2DICA 3S96A 4GKNA 2IF7A 4RNRB 4Z7QE 3ELAT 3AAZB 1NPUA 1PFCA 5DA4A 1XGTA 1NFDE 2WAHA 4G5ZH 2V5RA 2GSGA 1U0QA 3FQWA 4MXQC 3EO1A 3TPUA 1NLDH 1EO7A 1TTFA 2NY3D 1CN4A 3W9DA 3ARFC 3RWCB 1WTGT 3BT2L 5C0CB 3VDBA 3PDOA 5AZEH 5TFSH 1CT8A 4I4WA 4XH2A 5EOTA 4XMPL 3CX5J 4O4YL 4OT1H 3A6OA 4NKMA 1XR8B 1ORQB 4LVEA 3EFFB 1ZT4A 1D5XB 4JM4H 3HI6H 5JQ6H 1NUDA 2FYYB 15C8H 1EO8H 2FEDD 2YXMA 3W0WE 3GGWA 3L6FA 4QRRE 4L8DA 4HKXA 2X1OA 4DWHA 3D39B 1MPAL 1MOEA 5T33H 5EORL 3OX8A 3QIWB 2XWJA 1AGFB 3TBVA 3F7YB 2OM5A 1AD9A 2HRLA 1U8OB 3EO0A 4WGWB 2E8ZA 5TGBB 5EBLB 2DN7A 3MUGA 1I1AD 4QRTA 1NMBH 3QDAA 5FB8B 5FM8A 5JHDE 3TLRA 3B9AA 3JWOC 3QG7H 4PJ7B 5C08B 2IGFH 2J8OA 2G60H 5CJXC 4IBLT 1EXUB 1H5BB 3SGEH 2G75B 5IMOA 1U8LA 1WBXA 5TH2B 3MLUL 2APBA 5IFAL 5E2WH 2X4NB 4ERSH 1B9ZA 1MCPL 2XTJC 1QG3A 1FFPB 4ZSOB 1NMAH 3VGAC 1W8OA 9CGTA 4RFEB 1M6OB 1RULH 3HC4H 5I18L 2EEBA 5J11B 4XXCA 5I8CA 4KK5D 4HMDA 2YEZB 1IGCH 4NP4L 4P2RD 2VIRB 5D7JA 1J1XH 1LHZA 1CD0A 3BH8B 4PREB 1KB9J 1MJ7L 1EMTH 4D9QD 4CBPA 4DKEH 1HILB 1G7MB 2I60L 5J8OA 1CBVL 5E6IA 1I7RB 2CIKA 4EN3A 1U8KA 3LEYH 4XWGL 2B5IC 2HWZH 1CYGA 2PR4H 4H0HB 4HUWA 4Y5VB 3UPAA 3IU4H 3DETC 5DTFA 3GB7B 4Z9KB 5DSCA 4ODVL 1EJ6A 3QUXB 5IJKA 3DRQB 3G04A 3T1FB 2R2BB 3OKMB 2R15A 4Q9RL 1KULA 4PJ5A 3EFDH 1MF2H 1RUAH 3SCMC 3U9UA 1FJ1B 2MQCA 2EDYA 3GMQB 3TO4C 1PKQA 1CQKA 4FQCH 2CR3A 4JFYA 3CXDH 5I8OL 2AV7A 1RZGA 3TWCL 5I1AB 2J8UF 5D2NA 4NN6B 4Y4FA 4H8WL 5E99H 4PJFF 4ELKB 3NTCH 4MD4A 5I0ZA 1QQDB 5FGSA 4HUKB 1U41A 4YBHA 1A5FL 4GRWH 4JPKH 4K55A 4P46A 4FG6C 1OVZA 5GS0L 3R8QA 1MRFL 5ITBH 4XI5D 3SOBH 2EE2A 4KJQD 4G7YL 4P3CH 4R2GC 4PJCF 3O9WA 5TDPA 3EYFB 4DOHB 4OLXL 2XIDA 4NSKB 2O5ZL 1ZLSH 1A0QH 1ZHNB 5B4MC 1O0VA 1N8ZA 2CRYA 3LMJH 5BRZB 1FL3A 5HHXH 2QHRH 3VJ6A 4KKCC 4HFWA 2ED9A 3IDGA 1QHOA 3T0EE 1Z9MA 3SQOH 2D7QA 2OTUB 3HZKB 4X9HA 3CGTA 4Y5XA 3G08B 2A6DB 4JZNB 2ATPB 2Y5TA 2NY3C 2YD7A 2MPAL 5C0EB 1Z3GH 4QHMB 4X80H 4HUVB 5I30L 1G7QA 1CFSB 4XBGA 4TSAL 4GQ9H 2Q6WA 1FN4A 5ABDE 1Q1JL 1KGCE 5CZXC 1FZOA 1O7VA 1A7QH 4K7FA 4F7EB 2VLRA 4LLMA 2BZDA 4OUUA 3LSOB 2FH6A 3KGRA 3FO0H 5SX5K 3T2NL 5DK3A 1B3JA 5I9QB 3QCTL 4XAKE 3GSNB 4JE4B 1N59B 3EBAA 4R90H 1H15A 4I0PA 2VMFA 4G9FA 4MD0A 3RTQC 3SGEI 1GVIA 1G7JB 5GXBB 5I1HH 1KSRA 5AD0A 5IMKA 3GSNH 3S96B 5IBLD 4LDOB 4OIAA 3IDXH 2WUBL 5TDNA 5CUSL 1XGTB 1IGIH 4TUKL 1BBDH 5IM7B 4P2QD 3BSZH 4LSRH 4HJ0C 5I75C 3C6LA 4OV6F 3FQWB 4HULB 1EAPB 4EI5A 1HHKA 4OM1H 4QXTB 3SE8H 1S78D 4FFYL 4UU9A 3OG4B 4FQQB 2JELH 3VA6A 1I9JL 3NCJL 3QI9B 4KK5C 1RMFL 4I4WB 3GMMA 1EHLH 4LNRA 4MJIA 5E5MA 1LK2A 4R97C 2FJHB 1HH6A 5T1DL 2ZOLB 5K9OB 5ID1A 3IAGC 3ARBA 4NT6A 3QFJD 4ODXA 4F58H 4RGNE 2X4SA 3W39B 1NCWH 4WI2A 5D7IA 3M8OL 1FE8L 1DL7L 1MLCA 1A6UH 4J12A 2BMKA 5B8CA 1P4LA 3SPVA 4G6ML 2Z91B 2VDRL 4HKXB 1CD1B 1I4FB 4TRPH 2XWJB 3GI8L 4JFED 5C09A 3NH7L 1W72A 1Y18A 4HF5H 5C07D 5HDQL 4I2XB 3MRDB 1HXYA 1UT9A 2EDNA 2LV4A 3VRLF 3NPZB 2WW8A 3MGOB 1AO7B 4U6HA 2BOBB 1G0DA 4ZQKB 1BFVL 4P5MA 3U1SL 2UYLA 4Y4HD 3KLHC 1RZ7H 1P84J 4X4MA 1UKQA 3IDMB 1F6AB 1HDMA 2QQKH 3S37L 1FDLL 4EOWH 1R5IA 4PRPD 4N0UA 5D1QB 4D0CB 4ZPTB 4LP5A 2R2HA 4GQPH 4JPVL 4HXBH 1T66C 4HS6B 1YNKL 5T1LD 3R06A 1RAMA 2QADB 3HRZA 1I3GL 4KJQC 3RVXD 3TJEL 3X3GL 1D5IL 3L95B 1NCAH 3LQAL 3DVFA 1I1CA 4BKLB 3HZYB 4K23H 1B0RB 4FQXA 4HS3B 1UH4A 3G5XA 4U31A 3ZYIA 1NEZB 3O0RH 5MI0C 2JB6B 1C5CL 4LMQI 5DEGA 3PE9A 3C60B 1ED3B 3ZDZF 5E2JA 5D96B 4QNPF 3O4LE 4KKBD 3CPLA 2P8PA 4XCEB 1KN4H 3F7QA 1TJHL 5ADOH 1CG9B 5DSCB 5TQ0L 3MRMA 3PABA 5A2IH 2BHYA 5BXFB 3TNNB 4EUPG 4ELME 3UYOD 1FGNH 3D3VB 3D87B 1F11A 1TZGH 3ULSA 1OAKL 2R1XB 5FUZH 3V7AG 5DJ8B 1RZKC 3MREB 4K2UH 4LSTL 3RU8L 5J9PB 2YZ1A 1X5YA 2F15A 2O61A 2ZP0T 4NBZB 4LNVA 4X6DB 5BOPA 1FRGH 4BFIB 3SE9L 3EO9L 4P23D 3O6FA 3ARGA 1LO4L 2X4PB 3CNKA 4ZUTA 3P73A 2BXYA 5F7KC 2DM2A 3C8HA 2H2PD 3KXFD 1B90A 3OKNB 3VFUB 4CMHB 4GS7B 4LGSB 4AH2A 2A6JB 1ZOXA 3MRBB 4C4KT 8CGTA 3D18A 2XN9B 4PRBA 5I1EL 4JFDA 1CFVH 1T21B 1PVHA 2GY5A 3IU3A 5IROC 4C56D 3D85D 4IHOB 1F4WH 5ID0A 4X83A 3OTTA 1IQWH 3G6JA 4ENEC 1VFUA 2BHZA 2PTTA 4BSWB 5JW4R 4BJLA 1I8KB 4F2MB 2OZ4H 1FL3B 3FCTB 3I50H 5IBLC 5KOVC 3HG1D 1U91A 4R26L 2DJSA 2ZZUT 1UXWB 4ZODA 4IOFC 4CJ0A 1N26A 4PP2A 25C8H 4O2CB 4Y5XB 1W8NA 3STLB 4Y5YA 2RFXB 4K3JH 3V6ZA 4P2OD 4GKSB 1S78C 1G9NH 3PQYE 4GXUM 5JTWA 1WISA 5IHBA 3QZWG 1FLRH 3QNYA 3A67H 2R1YB 3RWDA 3OKEA 4J3XA 3F5WB 3MCLL 3KLSA 3I6GB 2OQJA 4KK9D 1BZ7B 2D4FA 3FO1B 1DBAL 3BHBB 4XBGB 4ZS7H 4PLJD 5BS0A 4QEGA 2Q86A 1FNHA 3WDJA 3MJ8B 1NCBH 2CLVA 4DCQA 2X1PA 3NA9H 1OW0C 2ZUQB 4WFHE 3F7RA 2VLRB 4NQCD 3SDDD 4GSDH 2H32H 2EIDA 4RMQA 3V6FB 1W72L 3LKQA 3U4AA 4EJ1C 4GBXB 2XY2A 2PXYB 1HNFA 3O3BB 4QXGH 1ZVSA 2DKSA 4YHIB 4YFDB 1XF3A 4WUUB 3V5HB 5HGBA 3P11H 4C58B 4WHYH 5SV3A 1GSMA 1H15B 4YNYB 4G9FB 4OKDA 3KHQA 4PGDB 1NGZB 5BO1H 1P2CB 2ZNXA 1J8HE 1HXMA 3HC0B 3VWKC 2GITB 1SQ2N 1JZ5A 4Y4HC 4ZYKB 1T3FA 2P8MA 4WEBH 3WL9A 2BP3A 5D7LD 1EEZA 3B2VL 5KOMC 2W0PA 3KPRD 5EIVA 1E28B 3LPFA 1WT5C 3MA7A 1HHKB 4EI5B 2H8PB 1CK0L 4RGOH 1A7RL 3HNSL 4XPFL 6FABH 3ESVF 4TVPE 5DUPH 3PGFL 4HGKC 5DVLA 2I27N 5E5MB 5MEND 5IB3B 3GNML 3U4BL 3RDTA 1UB6B 3VI3E 2E6PA 3V6OE 4HW6A 2WM0A 3FHAA 3AFLA 4MCZA 2BRRH 4ONGH 5HGAB 4WNQA 1NBYB 4QTHB 3PWLB 5LWYH 2YA2A 4ZAKD 5CJBA 4OD3L 4AZ8A 3T8XB 4KKBC 3KJ4C 3MMEA 2OSLB 2P5EB 5BV7B 3PL6C 4FQLL 1BQUA 5BV7H 2R0ZL 2HVKA 3P2TA 3U48A 3HMWL 1K9TA 4IMLA 4JFZL 2X4RA 2CD0A 4AT6A 1U8IB 4O02L 1DE4B 4OQ1A 5AG8A 1T7ZA 4R0LA 5E8PA 1OT2A 5C0AA 1NGPH 4ONFH 3MRNB 1D6VL 1R5IB 4KUCF 3EHBD 3PHQA 5B3JF 5JA9A 1H3TA 3E2HB 3WFCL 5IR1A 1KTLB 3IF1A 3CFCL 1EZVX 4DZBB 1K6QL 3MRFA 4NUGH 3HRZB 3IJHA 3LKNA 4RGMB 2FJGA 3KHOA 5CJOH 2BVQB 2DWEB 1GGCL 5KVEL 4X8JA 1R3JA 3RGVB 5E8OA 5DMGD 1IFHL 2X4QB 1QSEA 3BGMA 2V2WA 5DO2D 2HJLB 4XPTL 2DYPA 3BKML 1P9MA 3MGAA 3HMXA 5FYJH 3MJ6A 3CPLB 4UIKL 4AG4L 4YDKH 4YIQA 5BW7C 1A6AB 2IBBA 3MV9A 1FG9C 4PRDA 3FFDA 1MFNA 2K1MA 4WHDA 2AXFB 1B0WA 4X98A 3T4YB 3ULUD 4U1NA 4P2OC 2OK0L 4BQ8A 4WV1C 1ZANH 1SJHA 4NQVA 3IFLL 3LIZL 2RBLA 4OV5B 2HTKD 3STZA 2ZUVA 3MV8D 4YHKL 4OB5H 4KK9C 3BQUD 1QA9B 4HX1B 4ODTL 5F8QC 2XNAB 3TYGH 1ORSA 2BSSB 5CIPB 1Z9LA 1RJZB 4D0DB 4QHUA 2YD2A 5CIPH 2GUOA 5HGDA 4FZ8H 5F1OB 3DMMA 1YY8B 2AV1B 3D18B 3MZGB 2RHEA 3HC3H 2MCPH 2HMID 4JFDB 2JJUA 2G5BA 5DMJB 3TV3L 5K9QG 5KSBB 3MV01 3P30L 4KAQH 4OFIA 2CK0H 1IEBB 3TT1L 1EPFA 2AJUH 5DGQA 1XGRA 1JHKH 1CICA 1CGVA 4PJAA 2Q20A 3HFMH 3QHTC 1TCRB 3MACL 3VXRA 4GAGL 1MFBL 3MLPA 1A3LL 2DI8A 1MUJA 2VDMH 4DUXA 3BZEA 4FP8L 2CUHA 1HYRC 3ZYZA 1XGQA 3CZFA 1QNZL 5H94B 2LTQC 2HH0L 1MVUB 4DFHA 1A9BB 3GSRA 3CUPA 2F54E 2VXUH 1DBML 4M5ZL 4WJ5A 3OG6B 5J12C 2OQJB 5EU4B 5CEZH 2MSPA 3O3DA 5C0BB 2P49B 3TJHD 4G8GA 4E41E 2N4IA 4NQSA 1FO0B 4MJ5A 3U9PL 4L4VA 4M5YH 5DK2A 3OJVC 2P5WA 1FO0H 3C5ZD 4PRID 3DVGB 4EUPA 1BBJB 2M8XA 4ZAKC 1XF2B 5B22A 2ZKHL 4BSVB 5IQ9B 3BWUC 4LEXH 2NY6D 3S35L 3FN9A 4QYOA 8FABA 4BSJA 3RL1A 5T1KD 2DLEA 2NXYC 3ULVL 2FSEB 2VQ1B 1NAKH 1RUKH 1Z5LB 4Q0XL 3GJFB 5GS2H 1XF3B 2F8XC 1S7SB 3U83A 5H35A 3GJFH 4WY7L 4X4ZA 3IDJA 1R0AL 1VFBB 5D9SA 1HHIA 3OPZH 4HPOH 4HSQA 3HA0A 2J8UA 5FO7A 1UJ3B 5DQJA 3I02A 1AGCB 5DRZB 1PY9A 4PJFA 3CMGA 1E4XH 1UCBH 4AENA 1ONQB 3EHBC 4JN1H 2EDKA 4OKVB 2D7TH 2AK4E 4WHTB 3JTTB 2ESVA 2NLJB 4R4BB 1QSFD 3P0YH 4MQ7B 1JUFB 1FG2B 3NN8B 1TPXB 2ZOKA 4LHUA 2R9HC 5KJRH 3MC0A 4PJCA 2QQQA 2EDWA 1L6XA 1KCUL 1NCNA 3MJ9A 2K7QA 2UWEB 1M7DA 2XG5A 5DMGC 1SEQL 2VLLB 2BC4A 3PV6B 3UTZB 4Z5RA 5D7KE 4JZJC 3ZTNL 1QYGL 1IRAY 1JPGA 1J5OH 3HMXL 1P1ZB 4CVXA 4POZC 3QZWA 1AQKL 4KY1L 3ES6B 4U1MA 1A8JH 3EOTH 4F9LC 1GC1C 3QEUB 5KS9B 2ADFL 4ZXBD 4EDWL 1U6AH 3V2AR 1CF8H 2R56H 4MNQE 1KLFA 3RAJL 5I1DA 1FL6B 2H2SD 4HWNA 2FO1A 2Z4QA 5I1GL 4JDZA 2HVKB 1XZ0B 3ROLB 2H1PL 4LLWA 4MA8L 5KVDH 5IHZB 4ODSH 3MRJA 5HJ3B 1KEML 1OF2A 2HTKC 4LQFL 3RVVD 3FHQA 3G6DH 5TE4H 1BLNB 3BGFC 2G9HB 1PSKL 3R1GH 5F96H 3BQUC 3VGBA 5E8PB 1CXIA 4PG2A 3V52L 4LLDA 2FGWH 2DBLH 3VRJB 5HHQB 1RJLA 3VRIA 3GIZL 5D1XD 5FO9A 1MH5A 3ZE1F 3C09B 2IG2H 3L5HA 3WHE1 1GGIH 5EBGA 4FTVD 3DBXA 3HE7A 2F53B 43C9B 3NGBC 4DTGL 5IOPA 2HMIC 3TO2B 4KKNA 4PJHB 3S36L 2GSIA 3ORJA 1VERA 1Q72H 4LLYA 5SWZA 2ADIB 1UM5H 5CSZB 4N9GA 4FXGA 1A3RH 4H20L 3V4VL 2V2WB 3H9SD 2BCKA 2NYYC 1MREH 4KGJA 3GUTB 5LGKA 3QDGE 4L4TB 2E7CA 4XNXH 4F7CB 4L5FH 2VL4A 4AK1A 3LN4A 4PY7B 1EUUA 3PF2A 2PW2A 4QY8B 1AE6H 1DBJH 4YIQB 1CLZL 1HSAB 5DJZA 2QLVB 3Q6FA 4PJGF 1KIPA 2UZIH 4LSSL 4PRHB 1N64L 1YYMH 2PO6B 4XX1E 4PS4H 4NGHH 1F4XH 3BWAA 4O5LL 2HA1A 2NY2B 1I8LC 1YMHA 3IFOB 5EC2A 4RWYL 1AR1D 3VFPB 5HVFB 3O11B 4P0DA 3AY4A 4ALAH 2FEEI 4M7ZB 1TITA 3HS0A 1LEGA 4KROB 3C5ZC 2BSTA 4QHUB 2EECA 2GUOB 3KYAA 4L29A 4QWWD 4WW1A 2ZSWA 5DHVA 5EBMA 5DUMH 4U1HB 4JRXE 4GUPA 4KH2A 4P5TD 1U2CA 4JRYB 4QRUA 4O51A 1IT9H 1JRHL 1FNGA 5SX4H 1KCVL 2IJ0C 5I8KL 3SEPA 5HGHA 1KPVA 5E9DD 4K8RD 5I6XB 4PJ8A 3W5MA 1IAIH 3BP5B 5DJ2A 1MY7A 3B9KA 3IJYB 1CDBA 5DEFB 5ESAA 1I75A 4OZGB 4XPGH 3MRLB 1JGEA 1QLEH 2VE6A 4PJDF 1XGQB 4I9WD 1FPTH 3BGAA 5FFLA 3X12A 1D9KD 2IH1A 4Y8DC 3O2DH 2PCPB 1V3JA 3BYYA 4LCUB 1HQ4B 4N90D 4NWTL 1XF5A 4WW2C 5ELIA 1MAMH 5IMLA 4ISVA 3MJ9L 4OLUH 1OQXA 4M48H 3BP4A 3P40A 4WFFE 1JF5A 5DD6A 4W4OC 2ZNWA 2CLRB 4APQB 4HMCA 1OAQH 4JO1H 2B0SH 2V5SA 5L2KD 3CMOH 4L4VB 2GIYA 3A0OA 1QBML 4R6UA 4PGJA 4JFPA 1ZGLA 2VJXA 5IB1B 3B5GA 4JPWH 4EBQL 1T04B 1CE6A 4I3RL 1IGJB 4ZNCD 3CFKB 2YPLE 3UTSD 3L3KA 4QYOB 3UTTD 8FABB 5KW9H 1XIWA 3B9VA 2H41A 4X6CA 3W9EB 5C0JA 2H2SC 5AUMA 2VKXA 4ODBD 1C16A 1A1OA 3LS5H 3RVVC 5JXAH 4MXWL 1JPSL 3RA7L 3VXMA 2AEIT 1BJMA 2BNRD 1KENH 2J8UB 3RRQA 5D2LE 5T5NG 2FB4L 3SGJA 1F8TL 4PJFB 4ZUSB 4AENB 4C57C 2DRUA 1N4XH 3D9AH 3EYVB 2X4OB 2EDBA 3G5ZB 4P4KA 1QRNB 4ZTPH 2FHBA 3JTSA 1HKLL 4LASL 3FRPG 4WHCA 2JJTC 4PJCB 5GQBA 3RUGE 1JGUH 1BGXL 1TVHA 3RHWK 1WQVT 1U3JA 3PHSA 1FYTE 2F5AL 3RKDC 5F1SA 3F7VA 2Z31D 3U0WL 1T20A 1ZA3B 2C1PB 2X1WL 3TH3T 1UFUA 3RVTC 2ZCKL 5ERWA 1MWAB 5DRWA 5E95B 5HHOE 1RIHH 3DX7A 1MWAH 1MCNA 4IRZL 1WZMA 1U8NA 1E6JH 4HKJA 1OAZL 2AJXH 3QDMA 3SJVB 4LRIA 4J2XA 5MEQB 3V95A 4TN9A 4JFFE 3UTPE 2X5PA 4JDZB 3U36B 2W0FA 4Z0BH 3F8UB 2GJ6D 3OHXB 1EDQA 2ED8A 2YUWA 4LCCA 2DM7A 3QSKB 4ZPVA 4K7PX 1FLTX 3NFSH 1OPGH 1RZFH 2VUOA 3QUYD 1LEIA 3SGKA 1OP5H 2Y7QA 3HPJB 4NUJA 4HK0B 1DQDL 4C59B 2VL5B 3JWDH 5HI4C 4V1DD 4LVNC 4GAJL 1W0VB 2IANE 4Z7NF 35C8L 5H37H 1H3PL 3EDFA 2BNQB 5D71H 3GMRA 4QWWC 4BUGA 3DBXB 2AEQH 4XP5L 5SX4I 2W9DL 4YXHH 3VFGH 1IEAA 1N6UA 1CD9B 4Z95H 1FZKA 1UWGL 4P5TC 3SE3A 2SEBB 3WFDH 3PWPE 2DQIL 4R4FH 2EC9U 3MYZA 5C0CD 4PJ7E 4TTGA 3NFPA 3KPMA 1ZHLA 4C55A 5EPMA 2BCKB 4K8RC 1AY1H 2NX5A 1YMMA 5IUSA 3BKJH 4M9PA 5JPNB 5KVFL 3TBSA 5I2IA 2PNDA 3GSQB 2D0HA 1R24B 1MI5A 3LH2L 4X7SL 4YPGA 4ODUA 2XYCA 3W0WD 3D2UA 4EIZC 5INCB 1IAIM 2IFGA 1KIPB 2AQ1A 5ACZA 5HVHB 5HYJA 1D9KC 1KTDB 3QIWD 3CSGA 5F7FA 3FOMA 2IALA 3ARFA 1KCRL 1D7FA 3MFFB 3BT2H 3PWJA 5FYLH 2OXHA 4XVSL 4ODWA 2APVA 4CDGC 1KJVA 1RFDH 3TVMB 2W0KA 3EJZD 5JIKA 5IHUL 1GGBH 4XAWL 4KU1A 5AYUL 4EVNB 1NC4B 3MBEC 2YOCA 5E2UH 1IM9A 5D7SL 2Q76A 3EW3B 1KC5L 1UM4H 4U1LA 3IVKB 1MPAH 3CDGA 3UTQB 5JXED 4HV8A 4WO4C 1OTTD 4NQXA 3T65A 4O51B 4PGEA 1XH3A 3DGGB 3K3QA 5EU3A 3HE6C 1CGTA 4HK3J 1TJIL 4X99B 3QP3A 1KPVB 1A14L 4D3CL 3BKYL 5DR5H 4JN2B 3VFNB 5CJXA 4PJ8B 1YEIH 3A6BL 2VLKE 4L8SB 3WD5H 5C7XL 1KIRB 3K1KC 1MEXL 4BFGA 4LKXB 3T0VA 4HIEA 4NDMA 3OKDB 1W0WB 2VLJB 5GRVK 4BZ2H 3DXAE 2NY5L 3IDIB 1ITBB 4P3DA 4ZOAA 4Q97A 5I18H 5JO5B 3QEHA 2DQDH 5IMLB 1S7RB 3OGCB 4CVZB 4MAYB 1IBGH 5DD6B 5JNYA 1YC7A 1I85C 3B8YA 3CSYA 3IFPA 4Z7WE 2D4DA 4EIGB 3DRTA 4HBQA 4O2EA 2NR6D 3L5XL 4KHTH 1T83C 2J4WL 3NFNB 1YJDC 3QNXB 5HHNB 4NN7B 3TC9A 3NZHL 4S1SL 1CBVH 2Z31C 2YN5A 3AB0B 4JFPB 4M7JH 4DN3L 2F5BL 3IKKA 2EE6A 4JG1L 4LOUD 1H8NA 1WWBX 4RQQA 4X5WB 4UINL 3V4UL 4L3EE 2HFFB 1QVOA 3OR7A 5GJTL 1C1EL 1JN6A 4QHNA 1MAKA 5JW4N 1JYVA 3MPCA 5DVMA 4OIBA 2WWMD 4NQEB 1YDPA 3SCMA 4L9LC 3LKSB 3O3UN 5J1AA 3WSQL 2FX8L 2MHAA 3TO4A 3QUYC 4KJPD 5T1MA 5C0DB 1YEGH 5LCVL 3OAUH 2FGZA 1EEYA 1RI8A 4HWZA 1BVLB 1KJMB 1F90L 1F3DJ 1D3CA 3QEQD 4KJWD 1KG0B 3QDJE 4BQCA 4XCYB 1CFQB 2DS4A 4XP6L 1JNNL 4CN4A 3MLSH 2FR4A 4KZDH 4UILL 5EU5B 3QQ4A 3T0ED 4P2YA 2BJMH 3BP6A 4LLVA 4U6VL 1OM3H 4OGZA 2A38A 1N6QL 5K9KA 4UQ2A 1KTRL 3TT3H 1UGNA 3WFZA 1K8IA 5GRXG 4QHLB 1UWXH 3OSKA 4LARL 4LSPH 2H6PA 5ENWA 5TE7H 2YBRB 4G6JL 3ZKMD 2X42A 1ACYL 2FATH 4YDLB 4JB9L 3A6CL 1SBBA 3K74B 4CUCA 4WCYH 2FLBT 3I75A 1WFUA 2WUCH 4NO5A 5DRWB 5E7FA 1G1YA 1UA6H 3VI4F 1U8NB 2OMNA 4HKJB 1H3UA 1YN6A 2WBKA 5F1KC 5IK3A 3ULUF 4F15B 1X5AA 4YHMH 1X6LA 1S9VA 3D25A 3L3DB 5DVKA 4U6TA 3QIWC 5I1JH 5EH1A 2ITDA 2MPAH 4OQTH 4RMWA 4XP1L 1I7ZB 3GSXB 3OKKA 4QOKB 3EJJX 3LRGA 4GW1B 4XAKD 4GMSL 4YDVA 4DFIA 4NQUA 3IKCA 2GKIA 2GTWA 3EJZC 3IXAA 4ZG1A 1JK8A 2DJUA 3WKMH 3WJJC 4X9GA 1OLZA 1SMAA 1OSZA 4RAUB 1NH6A 1MFAL 4MA3A 1H5BC 4YUEL 3WS3A 1SEBA 4LBEA 3RKPA 4YBLB 4MZ2A 3C8KA 3KPNA 4IRJB 5GGTA 3N0PB 4NZJA 1LEKB 1FZKB 1HQRA 1NFDA 1OTTC 1RHHA 3QWOA 3T2NH 4IDJL 1R5WB 1ZVHA 5FM5O 2F74B 1UEYA 3JWOL 4DK3A 1EGJA 3RTQA 3KPMB 2W9LA 5EU6B 4KI5E 4XRCA 1YMMB 2HFGL 2YD1A 5DD1H 2HT3C 4XBEH 4OZ4A 2UVFA 1BOGA 2BNUA 4RGND 3RIAF 1CXEA 1T7WA 1F6LL 2RCSH 4P5KA 4TUOA 1MFEH 4FABL 3FRPA 3D2UB 2V2TA 4AEFA 2C9AA 1TDQA 2VAAB 2DQFB 3KYOA 4Y5VC 1T2JA 4R4ND 5HYJB 5EIIB 4C83B 2B7DT 2L7UA 1WFTA 2X05A 1OT1A 5E70A 3MOBH 3FFCA 4Z76B 3LZFL 5T5FH 2VDNL 2XWTA 2YD9A 5HYSB 1QR1A 1NCUA 4I8DA 4JO4H 5DJYB 5EB9A 2YA0A 3NMEA 4GRMB 4Z7VF 5T1DH 2GW5A 3MOAL 2NR6C 1HSBA 4LQ1A 5JLZA 4P4RB 2I07A 3L7FA 4NN6C 2IQAB 4HHAB 1DFBL 4LOUC 3M1BA 4XHQA 3QUKB 4UB0L 4EQ2A 5D1QD 3QEGL 1BQHG 4PJ5E 3CDGB 2Q7YA 2O5XL 1J87A 2BY1A 4NKIH 4LSQH 3CLFL 5F9JA 4NZTL 1JTOA 3B5HA 3FQXB 2WWMC 5J89A 1PKQE 1IGYB 1JL8A 3UYRH 5D2NE 3PHOB 4UQ3B 4E0RA 2YZ8A 1DQJB 4KJPC 1JWSB 3DVNA 1JMXA 4NJ9L 5T3XH 4KTEL 4XTRD 3N9GL 5DRNB 4JCLA 5I15L 3FMGL 5IFJB 1MHHA 4HLZG 3C60D 4JLRB 2XTJB 4KJWC 4XCNA 5KTEH 1GGTA 3O4LD 4MX7B 3U6RB 1WLHA 3VXNB 1KELH 2IAMD 3GRWA 2C1OB 4KGLA 4D2NA 4HWBA 4IIQB 1UYWL 2X4TB 3HB3D 2ZUXA 5GHWH 1KJ2A 1CXHA 2OP4H 4NC1E 1D5IH 4KQ3L 3H3KA 3D3VD 1AGDB 4NZDA 5E2VL 5JNYB 3IFPB 3FQRA 4X9BA 4GG6B 3FO9A 3DURB 3C08H 2W60A 3W82A 3H3PL 1CGSL 3ZKNC 3X14B 2EH7L 4N0CD 3O45B 1OARL 2DAVA 5EZOL 4B50A 5DS8A 2VXSL 1RIUH 4P99A 4XZUB 4OZFB 5CEXA 2OR9L 4HEPG 3G5YA 2DBJA 1HOCB 3BMVA 2VC2L 3BXNB 3T0XA 2FCBA 3X17A 4OZFH 4KV5E 4L3CA 3CVHB 1U93B 2XN9D 1FVDB 1AI1L 1D5ZB 1N3NA 2EKJA 1E27B 1DN0A 1DQMH 4J23A 5IEKB 3CVHH 3PDGA 3JZ7A 3OJMB 5LGHL 3TO4B 5I9QC 5T1MB 1A4KB 1HWGB 1EFXB 3NIDE 2WQRA 1Z9OA 4XWOC 1VB9A 5DMKB 1NKOA 1J1PH 4UTBL 1YQ2A 3QCUL 2VDKH 1LO4H 2VLRE 5DGRA 5DJCA 5TPWH 3RY6C 3HNVH 1INQB 3UO1L 5GGTL 3QWRA 3I6KA 1CVRA 3HZMA 1K2DB 2QL1A 3S8WA 1GOHA 1ACZA 3VDAA 5E8DL 5EUOB 4UQ2B 2JCCA 5IROA 5BVPH 2JIXA 1U95B 4G9FE 1EV2E 4OCXL 1EGJL 5HYFA 3MXWH 1YEDB 4QHKI 1Y0LB 2ICWJ 2DQEH 1BFOA 4P2CG 2R2CA 1LO0H 4F7PB 3E8UH 5HHVL 3PWNA 4HPYL 3FONB 4PJIA 3LKPB 2DMBA 3SDXA 3U79A 5K9JH 2AXGB 2AGJL 4P2QA 4G9DB 4B7LA 4LSUL 5DURD 1YN6B 3DWTA 4RISL 3FTGB 4YWGL 4PJDA 1MCSA 4Q7DA 2XKSA 1BZ9A 4R4NC 2E9JA 1S9VB 4MJIE 2NY3B 5FF6A 1JNHA 1AKJB 3I6LE 4GBXD 3AU1A 3OKKB 3C5JA 3RZCD 4IS6B 1S5HA 4GG8A 3QNZB 4YR6A 1M71A 4WUUD 4KJYB 3S6CA 3P4OB 3MUY1 5D7IE 3GMLA 1JK8B 5FXCH 1TZIA 5JDSB 1FH5H 4NNYA 4TPRL 2VOTA 3QFJA 2R2EA 1T6VN 3ESUF 3RJDA 5FOBA 1VADB 1AIFA 4MA3B 2D31A 1OW0A 1SEBB 1N2RA 5C09E 2QTEA 1HHGA 1N0XL 3KLDA 3EYUH 3VXUA 4YHNB 5IKCA 2ENYA 1IAKB 5D1QC 4LAQL 1YQVL 4JFEA 1BWWA 1UWEL 3CCHB 1S7WB 1RHHB 2EE9A 2R29L 4G8FA 4NNPL 4TVPD 1UG9A 1I1AB 1I9IL 1N5AB 2QADC 3HCVB 5IT2H 3L3OB 1RPQA 1LDPH 2CJUH 4LKCB 4FXKB 1RURH 4BH8A 1F00I 3IDYB 4H1LG 1NUNB 3ZT6A 4X4ME 3DGCR 4WFGE 5EA0L 5INDB 1KLUB 1BOGB 3KR3L 3VWKA 3TPKA 4ZS6D 4N0UE 1ROWA 4Y4HA 4ZFFA 1REIA 3SKJH 1KEGL 3IJSA 1JNJA 2ZG1A 4TUOB 5A40E 4PBWD 3C60C 2V2TB 1YPZF 4OF8A 4M62H 1OGTA 3GRWL 3B2VH 4PRPA 4TOYL 5D96C 4NKOB 4KMTL 4HWBL 1WT5A 2OL3A 2JLLA 2EKSB 3SDCD 3EYOA 1TNNA 2IAMC 5J56B 1KJ2L 1P5VA 3EDJA 3LEXB 4MDIA 1INDL 3HB3C 3HNSH 1PZ5A 5FCUL 2BOCB 3BZFB 1IGFH 4RWHA 2XWTB 3FT4A 3L3JA 4R97B 5D70H 4P2RB 1QBLL 2AJ3B 2OJEB 4LGRB 1NDMB 4HQQH 2IH3B 3UJJL 3C6SA 1CDIA 2R4SH 4HCRA 3L7FB 1T7VA 2RGSA 1PX4A 4N0CC 1MQ8A 3PGDA 4G42B 2HRPH 2DB8A 4MS8D 2VXTL 3E3QC 3MLWH 3CLEH 4G8EB 4YPJA 2RJMA 4GS7C 1YUHB 3DARA 4S11A 3PL6A 2DLFL 2I9LB 32C2B 4J3TA 4F37K 3IDUA 4FQLH 4ODHH 4DN4L 3P9LA 1RZKL 1CU4L 4JG0H 1YYLH 1UZ6E 1VPOL 4JFZH 3RGVD 4XVJL 4E0RB 4ZOCA 4L8BB 1X6NA 3QIUA 3EIFA 2KDGA 4UTAL 1RZJH 1ADQH 3QHFH 1DUZA 5GISL 3PJSB 5FYJD 5GS3A 2Q8BL 2HN7B 2L4OA 3R8BB 1T22A 3C5SB 3VXSD 2AXJA 1XCQA 4TUJB 4Z78A 4PG9B 1KCSH 4JFDE 4TQEH 5E1AA 3RL2B 3FKUS 3SGDH 2A77H 4LSVL 3RZWA 4G6AD 4JY6A 3ZDYE 1G9NC 3CFIC 5F1NA 3TIDB 3G6JE 1BVKB 4RMTA 3MRIA 2ATKA 1C12A 5DD0H 4C56A 1GGCH 1E4WH 3WLWD 2BY2A 4WFEE 2XV6B 3QRGH 2W65A 2V17L 3L3HA 4XPAH 5ILTL 4YZFF 1CLOL 3DIFA 2W60B 1BX2A 1ZTXL 3P9MB 3IGAA 4XPTH 4JANA 43CAA 3E6HA 2ZPKL 5IVXB 3ZE2E 3HG1A 4M6AA 3GSUA 4BFBD 1ZLUH 2IPTH 1AR2A 4HFUL 4UIKH 3UZEA 4PR5B 3WN5B 5BW7A 4AG4H 3BUYA 2PYEA 1B4RA 1NGYA 2LU3A 2ZUQC 5ETUA 3ZSTA 2GCYB 4P2OA 4AY0A 4PJGB 3D0LB 4WV1A 3MJ7B 4GBXC 3IFLH 5I8EA 1DN0B 2YPKA 4PJEA 2YPVH 5J1SC 2PXYC 4DGVL 1ZWIB 2DQGH 1QD0A 5BS0E 2NMSA 3VD5A 4F57L 2B2XL 5D5MA 1DVFD 2BK8A 3BIKB 5LQBL 1BQHA 5GGVL 5F88A 3Q1SH 1W2KT 3HI1B 4G43A 3QXAB 2VDOL 4FS0A 3JVGC 3VXOB 4I18B 4N0YL 3DX8B 3BPOB 4WTZG 5E8NA 3C9NA 4FHBD 4PV9B 4OCWL 4AIZA 4YQXL 4PJBA 5EOCJ 3TV3H 1JWUB 1ES0A 5F7EL 3P30H 1IC4L 1FORH 2F54D 1TVDA 2BVPB 3TT1H 4QXUH 4YE4L 4GW5B 5BCAA 3EYSH 4PB9L 5C0BD 4E41D 4U6YB 1JHTB 3FT2B 1GZQB 3I84A 3I9GL 4QXWA 3GSVA 4KHXL 4ZS6C 4GAGH 4XNUH 4W6XB 1PW3A 1RSFA 1L7TH 4OD1L 2OL3L 4KDTC 4NRYA 3MROB 1T03L 1IC5L 5GSVA 1RJCA 4PJDB 7FABH 3I3DA 1T2QL 4MGXA 4FA8A 2HH0H 3B2UD 4N8VB 2YSSA 4CU8A 1LD9A 5BV7C 5EC1A 1A6VH 1K4DB 1KLGB 5BZDA 2Q8AL 3AU1B 1DBMH 2A6KB 1HKFA 4DW2L 3FB8B 4GG8B 3CH1B 5AZ2H 3L3IA 1SJXA 4M7LT 4GMTH 3DUSA 5DJXA 3TEUA 1YY9C 5KSUB 3GMLB 4WDIA 2YC1A 3HNTL 4FQ2L 1K4CB 5C9KA 1BEYL 3KPTA 4HCRL 4S1RL 3GMNA 1N7ML 1I1YB 1S9WB 4ZAKA 2D0FA 4JFHE 3I2CH 5HD8D 2LQRA 1NFIA 4I0KA 4WEMB 4HG4K 4NOBA 1IGMH 4MS8C 3X3FH 3E2HC 3ULVE 1RV6X 5ISZB 2AK4D 3DO7B 4HGWA 1QFOA 3O3AB 3L9RA 5C07B 3HAEG 4J6RH 4HXAH 4PIRF 4RGMC 2DTMH 1R3KA 2B39A 4X4XA 2EYTA 4NPYA 3RGVC 2DKMA 4MWFA 5CGTA 3MRPA 1LO3H 1R0AH 5MEOB 2X70A 4M8QB 3GFUA 1TETL 2CKBB 4Y4HB 1EH9A 1H3WM 4Q2ZB 2CKBH 3CDCA 3CVIL 3OAYK 3SGDI 4KZEL 2CDEB 5J3HD 4PRPB 2Z35A 1Q9WB 5F6HI 5HHPB 2MOVA 4XNYL 4TVSa 2IADA 2AI0H 2XXCB 3Q3GB 4N0RA 1BPVA 2DWDA 4O2FB 4G6AC 5T1LB 1FV1A 1F4HA 1XGPB 5E24E 4RZCB 4M6NL 2EICA 2WANA 1A7OH 3GK8H 1F3RB 3LRHA 1AFVH 4OI8A 2P24B 4OFYD 4CDHA 5K93A 3F12B 1Q94A 5CCKL 5F1IA 5C71A 3MV9E 2PW1A 4GRWF 5LAXA 4KY1H 2RB8A 2NXZD 4NRXA 5FYKH 2KH2B 1NAMB 4F9LA 4ZD3L 4LLUB 4EDWH 1FBIH 1NAMH 2C3WA 4LRNH 5CWSA 5A2FA 1KYOK 2APFA 2QQLH 5DD5H 4Z18A 1FCCA 5D72H 4J1UA 4U1JB 1ZLVH 3V5DB 4LCYB 3DX9A 4KVNL 3MNZA 4LQFH 3HR6A 4G3YH 2FRGP 4I48A 3BQUA 3VW3L 2UUDH 1MIML 1P7QB 5FIEA 3WHXB 4ZFOA 3E1F1 4P23B 5FCSH 4M61B 5IF0B 4MAUL 5BQ7A 2A2QT 2P7TB 5HDBF 1T22B 4JHWH 3GIZH 5TE6H 1MIEH 1JPTH 3N1GC 1CR9L 3KXFB 1C5BL 1KT2B 4JRYE 5EUKA 4OGAC 4GKZB 5C0RL 4H1LA 4JY6B 5KVGL 1X7QB 3BAEL 5JUEH 1H9VA 2X89A 1Z6JT 3D85B 3DV4B 1YEHL 3H6JA 2ZJSL 1FVEA 4PJAE 4PRNA 4X4YB 2DM4A 3BRFA 5DD3L 3QO1A 2FL5A 1BD2D 2OR8A 3V4VH 3VXRE 3X11A 1AXSA 3QQNA 2ZCHL 3U46A 1CZ8H 3WUWG 2G2RB 3GKWH 2XFXB 3E6HB 3NZ8B 1HK6A 3KPLB 2J5LB 1UKSA 3CK0L 3S98A 4MNHA 5D8JH 1I1FA 1X5KA 1H3XA 3ROOB 4X0KB 5ICZB 3BUYB 2CDGA 1NL0L 5FA4B 1AGEB 4P2OB 4YAQA 1CE1L 1I7UB 4KWUA 3LRSA 4E5XA 5CD3A 1P7KA 4OI9A 1IEHA 4FZEH 1I8LA 2HFEA 5A2JH 4G8GE 1A9EA 1PLGH 1UACH 1A3QA 1KB5A 1QLFA 4PTUA 3C2AH 5JPMB 1SBSH 4L4VE 1NDGA 4PRAA 2P5WE 2AQ3A 4KK6D 5F88B 4Z7VA 4LK4A 3KDMA 1NBVH 2R69H 1V8HA 3V7AE 5I17B 1NUGA 2E6JA 4PRIA 4YHOL 1ND0B 5IEHB 3RBSA 4TSBL 5F9WB 1UJ3C 4JQIL 4L8CB 4ZDHB 4NQCB 4NZRH 5CJQH 5A3ID 3SDDB 1LNUB 2PN5A 4WRLA 5ALBH 3C9NB 1XCTB 3GJEA 1NKRA 5I16A 4QKXB 3F62A 2XZZA 1A6ZB 2X2YA 3AC0A 4YH6A 5CGYC 3QIBD 2CMRH 3LN5B 1DLHA 1AJ7H 1II4E 1JFQH 2DLGA 2XKNB 1TPXC 3DTXB 4RMSA 3QUMA 2J8UE 4WFFD 2AJYH 1BQLL 4N8CH 5CZVH 1S7XB 2AK1H 4JKPH 4PJFE 1E6OL 3GSWB 4JM2D 5LXGL 1S7TB 4G80B 4H25A 3JV6A 1DBKL 2ESVE 4OCSL 1WEJL 5D7LB 4QHKJ 3ARZA 5IV2A 4OAWA 1QZ1A 3KPRB 1FNSH 3NACL 2YPLD 2JK5B 2XZCH 3VG0L 2YSSB 3FB5A 4PJCE 2V7HB 2HVJA 5DMYA 1LP9A 4WW2A 3RWHA 4IOIB 4OZHA 1EERB 3HUJF 4P9ML 4PY8I 1J7VR 3C8DA 3LB6D 2CDFB 2I9TB 4JPIA 4OLEA 1YEFH 1V7MH 4F3FA 4OZIA 5MENB 1DUYA 4W4OA 5DUBB 1OL0A 1CIUA 4KRPD 3TYFB 4X7TB 3CFDA 4NYLB 5H2BA 1XGYH 1H0DB 3S88L 2W1NA 3PIQA 3EOAB 1C5DB 2Z92B 4HZAA 2H45A 1D5BA 1GC1L 4ZAKB 2YK1L 4NQDA 5GZOD 2NXZC 2W9EH 3VU2A 4R7DB 3IDNB 3BH9A 1SJEA 3DROA 1G0XA 1QRND 3HI5L 1ERNA 1QPPA 3GM8A 3P0VL 1MHEA 3FQUB 4NHCH 3M17A 5DHYB 3RWGA 2XWBA 3IS1X 4QRSB 2BHUA 1JIBA 3BDYH 2LABA 3PGCB 4RA0C 1GRWA 3H42L 3P9WB 2X70B 4EDXA 4WTZA 4ZFOL 1MRDL 3WKNA 2BFVL 5GGRY 3O6ML 3OJDB 1A7PL 4JKWA 3JV4B 3FZUD 4MB4A 3OR6A 2FBJH 3U7YH 1JF1A 5ALCL 1NMCB 2AS5M 3KLAB 2APTA 5T3ZH 1UQSA 1P6FA 2PKDA 2QR0A 4OJFL 3UC0L 4FTVA 3P77B 4UZGA 4HDIB 2P44B 1OAYL 5EO9A 1U58A 4JFFD 3FQTB 3HRPA 3UTPD 5SWZE 2JKXA 2P46B 3S3SA 4ELMF 4LASH 1G7HA 2PO6C 2JJTA 5LGJB 4Y1AA 3GEWB 1WK0A 5EG6C 4OLWL 3AMKA 4JZJB 1HHHB 2JJSC 3H9SA 4UUJA 4NHUA 2A9NH 1JWMB 4DGIL 3K4DA 4HUNB 2ZCKH 4F7TA 4X5XB 4OGYL 5A1AA 1AXIB 4KROC 2BNQD 1AC6A 3KPQA 3MNWA 5C0IA 1OCWH 4XCFL 1G7IB 3P4MB 2V9TA 3K8KA 3SY0B 5FUOH 1V3MA 2NY7L 2A6IB 1KB5L 1UB5B 3ULUH 1G6RA 2OR7A 3DX9B 5DLML 2AKRB 3JUYA 1TQBB 2D03H 2V5YA 3MV8B 5JR1L 3B6SA 5I71B 3ZKSD 3MLZH 4WUKL 4NFBA 3NBNA 3KPOB 3MLVL 2UY7A 5JOFA 1OB1A 1WZ1L 4Y8AA 2OX5A 3MLTB 4RFNB 1RIVL 2VWEE 2VXVL 2XZQL 1T0MA 5DHVH 5F7DA 4DVBB 3HAEA 3QXDA 3KPSD 1FGVH 2E27L 4JKKA 4JVUA 5DQDH 5A3IC 4MB3A 1FZMA 4LGPB 4H1LB 2R0KH 1S5IH 1Y6MR 4OBRA 4LHJB 1HZHL 5CJ5A 4P5TA 1UWGH 5FYLD 2IMNA 2EXWD 3LDBB 3VRLE 3O8XD 4HG4J 3QUML 1Q9LB 5C9JB 3MO1A 5EN2A 4Z7UA 4R8WH 3X11B 4YEEA 5E9DA 1ODAA 1H8SA 2VN4A 1CQYA 4JQVC 4APQC 1E4KC 1GPOL 4H0GA 4U1GB 2R4RL 1ZT1B 4QTIH 4LFHD 4S1DD 4MNHB 3UJIL 3LOWA 1FFNB 4AEHL 2VABA 2BDNH 3VCLA 4ORGA 4YDJB 1XF4A 4LDEB 5CD5D 2EXYD 4RSVA 1KCRH 2V2XB 4Y19A 5E2TH 3LS4L 2H26B 2NTSP 4XVSH 1I9RH 2UUDK 5SWQB 1VCAA 1ITCA 1M05A 4PUBL 3U7AA 4XVUD 1Q9KB 4K7PL 4KRPC 4Z7VB 2Q87A 2AJZA 4K3EL 1V7NL 3MCKA 1G7LB 3LN9A 2VLKD 3TIEA 3MBEA 3REWA 4Q6IB 3C5ZB 3U0PA 4NKQB 2VDQH 2A74A 5DA0B 4X6CE 1T4KB 5GZOC 4FFVD 2NY6B 1S9YA 5DZNA 4Z0XA 3VFVB 2EDJA 4WO4A 3DXAD 1ZV5A 3UTTA 3F7PC 3MBXH 5T1KB 2HTLD 2DOCA 3S36X 3DYPA 4H88L 5JIIA 3HE6A 3VXME 5DF0A 4XC1L 5JW3H 3QO0B 5EDXA 3VWJD 2C3VB 2L7JA 1QEWA 3BFOA 3RPIB 2VDPH 2BNRA 1KYOJ 3S9DB 1VGKB 4J4PC 4OIIH 4LVOB 2DD8L 3K0WA 1BJ1H 1NGQL 3FZUC 1UZ8B 1JZ6A 5HI3D 4HWEH 3W2DL 4YO0B 4L3ED 5BVJB 4OGXH 3S3PA 3J7HA 4ZOBA 4AEIH 2D9CA 2P8LA 1RU9L 1QSFB 2HVJB 3WUWA 5DC9B 1U92A 4JPIB 4O9HL 4HUXA 4N68A 3RFZC 2IPKA 1DUYB 5DYOB 2AJVH 2VXQL 1I85A 1NBZB 1GIGL 1ZA6A 1S8DA 3DJ9A 1U3HB 1DANT 1FL5A 2X9WA 3BOVA 3IFNH 4Y4KB 3P4NA 1T1XB 4MNGA 3JWDC 2V7NB 4OCLC 4JDTH 2Z31A 3NZHH 1IGTB 4YC2B 2GAZA 5KN5A 3V6BR 1P4BL 3QDME 4MQXC 2PF6A 1YEEH 2VZ1A 3WEXB 4JG1H 3QDHA 3BD3A 3QDJD 5GS0D 1F3JB 3HTLX 4PGCB 3TBTB 1JV5B 4HZLA 4XP4L 4ZXBB 1WBYB 3K8MA 4QCIB 4YXLL 4G6KH 1SJEB 5CP7B 5JORA 5KBNC 1N5YL 3T09A 3KWWB 2OJZL 3VXTA 1G6RL 3RWJA 2CGRH 2R39A 4L9LA 3WNLA 1Q0XL 1FZJA 4NZUH 2XPGB 1T1WB 4OD2B 1HN1A 5CAYB 1FIEA 1UXSA 3FB7B 3QUYA 3TH4T 2HT2D 4H26B 5C70A 1EFQA 3LV3B 5LCVH 4HKBB 5IGXL 5DWUH 4MDJA 4V1DA 3UBXB 4CKVX 3GHBH 5DJ0B 4RNRA 3N85H 5D1XB 3L5IA 4BH7B 1GAFH 4ZNEA 2NNAB 1U8HB 3VFRA 4UV4L 2DQCL 3UPRB 4ZTOH 12E8L 4XMKH 5C0GB 4NCC2 5HVHC 3W5NA 2VDLH 4KQ4L 4PFEA 2DIBA 2EXWC 3GIVB 3OL2A 2NX5E 3RWCA 5FGCB 5B3NA 1YMME 2XRAH 5C0CA 5F6HJ 5EZJB 1MI5E 4UUJB 1IC7H 3TVMC 1XR8A 1ORQA 3EFFA 2A0LD 5L8JB 1D5XA 1KFAL 1ZGLP 4GLRI 4ZO9A 1U3ZA 4MQSB 2FYYA 2YWYA 3DECA 1WITA 4DKDC 4S1DC 5HYJE 2BERA 2EE3A 3KPQB 4MJ6B 3V0VB 1GCFA 3U2SB 3D39A 5KG9B 4TNWF 4IRJD 3QIWA 1AGFA 3F7YA 1EBPA 1U8OA 3BUTA 5TGBA 5KAQF 1DBBL 2EDTA 5EBLA 3DHMA 2GJZB 5AWNH 3GBNH 4I5BA 1KXTB 2YD6A 3NCCB 2QSCH 2IBZY 5GGUA 4ZFGL 5FB8A 3MLYH 4XVUC 5HYQB 2DQJH 3WJJA 1J0KA 2M26A 1OB1B 1U3YA 1P6AB 5C08A 1SYSA 2B1AL 4L8SC 4R3SB 1T0MB 3WFEH 1H5BA 2G75A 5TH2A 4PD4K 2X4NA 3STBA 4K94H 4ZOEA 3VXQB 3WV0A 4HIIA 4FFVC 3MRRB 2BVTA 4ZSOA 1FFPA 3ILPB 4PGZA 4P5TB 4RFEA 1RK1A 2HTLC 5D7JD 4RMVA 5E8EA 4EEEA 3CD4A 1GGYA 2YEZA 4MAYC 3MV7B 2VIRA 3RHWF 3BI9X 5IHLB 2HFGH 3BH8A 5IWLC 2HKFH 5MHSE 2XTJE 4K3HA 2Z8SA 1HILA 1G7MA 1MCDA 1MQKL 1RUMH 4NN7C 4KKAD 1I8MB 5IB2B 5L7XH 3CSBA 3AB0C 3PWVB 1XR9A 1M7IB 1YPZB 2DMKA 4Y5VA 4HS8L 2VITB 3VCLB 3QXUA 1QFUL 4PJXF 1YEKL 1D9KB 4PJ5D 3GB7A 5C6TH 2WBWB 4Y7MA 4E9LA 3CFBB 3QUXA 1N0LA 4N1HB 3DRQA 4XPHH 3T1FA 2R2BA 3OKMA 5FUCC 1WJ3A 1DR9A 1A1MB 1PEZA 5CLTA 1G7PB 1YJDL 1L7IL 4Y4FD 1FJ1A 3MOAH 2R8SL 4I77L 5T3XD 5L2KB 3GMOA 2Y06H 2F58H 4MA7H 5I1AA 2WINB 4LEOB 4P46D 4WHYG 5CMAA 4ELKA 5BMFH 1QQDA 2UV3A 3UTSB 3UTTB 3MYJB 1OWRM 2FNBA 3LEVL 1MFDH 2D0GA 4NZTH 1XEDA 5FAAA 5GJSL 1DEEB 1Q0YL 1T5WB 5IG7B 2PETA 3EYFA 1CFBA 4XC3L 3HPLB 4HJJL 4B7IA 4JY5L 2GJJA 1GOFA 5SX5H 4NSKA 2HT2C 1JHLH 3UBXI 5KANI 2P1YA 3VGFA 1ZHNA 2ADJB 4YDLC 4M43H 5GRYA 4U6XA 5BRZA 4G5ZL 3QEQA 1QKZH 1I9EA 5E7BA 1NLDL 3H8NA 2F19H 1X4YA 2DQTH 5I19H 3DO3A 1BMGA 1B2WH 2VAJA 5AZEL 5TFSL 2OTUA 3HZKA 3G08A 5IBUB 2A6DA 5DFVD 4JZNA 2R0LH 4F15C 5J1TC 2VZTA 2ATPA 5GS1B 4HUXB 4OT1L 2DIAA 3SDAB 5C0EA 1Z0NA 4M1CD 3O2VH 4QHMA 4JM4L 1FL5B 5JQ6L 4AM0B 3TN0B 4HUVA 1KJ3H 2FZ3B 1U8QA 15C8L 1EO8L 1LO5B 1CFSA 3ARVA 1A02N 5IQ7L 5TF1H 4YHZH 1OSPH 1OARH 4X7FC 5D1ZD 4F8QA 5T33L 4ONOA 2V5TA 4F7EA 4ZO7A 5I73B 4ESKA 3DYOA 5ANMA 4IRJC 1NMBL 1NSNL 3LSOA 4XP9H 4NM4H 2GJ6B 3F58L 4PJHF 4L9LB 1DP0A 1T1YB 3QUZB 3QG7L 4CADB 2AAVA 2IGFL 2DDQH 2G60L 2ARJQ 1WFOA 3GSNA 4NBYB 3KAAA 1N59A 2XOTA 4MDJB 3GO1H 1G7JA 3F65A 1GZPB 3FAXA 4B53A 3C6LD 1NQBA 1MHCB 1MVFA 1NMAL 3T1WA 1IM3B 3RY6A 3VFRB 5IM7A 1RULL 3Q6GH 3MRGB 4MVBD 2EZ0D 4YFLF 2DL9A 1K85A 1EAPA 4QXTA 5IW1B 1IGCL 1QO3B 5FV1L 5F3HB 1PYWA 1EO5A 4FQQA 3I6LD 4MCYB 4DUVA 5IJVB 1AKJD 1L4IA 1J1XL 3UCRA 3DYMA 5D7JC 3QI9A 4HC1H 5E5RB 4DKEL 3ARBD 4MSWB 4ZUVB 4DVRL 1HIMH 1L0YA 3NCMA 2NZ9D 2FJHA 2X09A 1EVUA 2ZOLA 3OZ9H 5HHVH 5K9OA 1QFWH 2HKHH 1MCOH 2B1HH 2HWZL 2PR4L 1IAMA 1JJUA 1D6EB 3W39A 3IU4L 4KKAC 5TDOA 1TZHB 5FKAB 3W0WB 3B5TA 4YHYC 1EIBA 4X6EB 5L0QB 4QRRB 3FFCE 3RVWD 2Z91A 2YKLL 4YWGH 1CD1A 1I4FA 3EFDL 1MF2L 1OAUH 1RUAL 5FKPB 4X6FB 3CFEB 1OWWA 2R23B 3V5KB 3HUJA 4OFVA 4FQCL 2HLFC 4I2XA 4D9QE 3MRDA 4I5BB 3CXDL 3DUHA 5GGUB 2DQHH 1CGXA 4OF5A 1F02I 3ARSA 4N0FB 4AL8H 3S5LB 4Y4FC 3MGOA 4LLQB 3NTCL 1AO7A 1SM3H 4PP1D 4U1SB 1L9NA 3VE0B 2BOBA 1SYSB 4ZQKA 3ZHKA 4JGUA 4JPKL 5KAQG 4OF0A 3IDMA 1F6AA 4OZGF 1FVCB 5ITBL 3SOBL 3MSPA 1JNLH 4HIIB 5D1QA 1LVEA 4D0CA 4P3CL 4ZPTA 3OAZK 4U1KB 4ZUWB 1RK1B 4HS6A 4IIQC 2R29H 4YBQD 3PP3K 5E8EB 4FQXD 1ZLSL 3INUL 4YJZL 1A0QL 3L95A 4M7KH 4NCDA 3NIFE 3LMJL 4BKLA 3HZYA 5HHXL 4BZ1H 2QHRL 1B0RA 1YEJH 4HS3A 4JM2F 1NEZA 2ADGB 5TQ2H 2JB6A 2YRZA 5DEZA 1F4YH 4OCYL 3SQOL 2DI9A 3C60A 1ED3A 1VGEH 1XR9B 4TOYH 1PQZB 5I1IH 3EYQC 4LVHB 4KXZH 3ZHDA 2IAMA 4XCEA 2UY6A 1CG9A 1Z3GL 4B0MM 2K3TA 4NRZB 4X80L 5BXFA 4F80A 4OTXH 3TNNA 5EO0A 2GQHA 3D3VA 4M1CC 4GQ9L 2R1XA 5DJ8A 3MREA 1G0YR 3O6FD 5J9PA 3GMOB 4RDQF 3UJJH 2IFFH 3MA9H 4X6DA 5D2LF 4BFIA 1A7QL 3O2WH 5CMAB 2FO4B 3TGXA 2X4PA 4GRWB 3PG2A 5D1ZC 4U7MA 5L2JB 2O93L 3UJTH 3OKNA 3VFUA 3FO0L 2A6JA 3MRBA 3WS6C 5LBSL 1JE6A 2BSED 4J3UA 3UMTA 2XN9A 4R90L 1CU4H 4UBDD 5I1HL 1IQDA 1T21A 3RUGF 4LAJH 4HIHB 3GSNL 4IHOA 4WFED 4YGAB 5C0FB 4POUB 3IDXL 2GK2A 2LFGA 5EOQL 3WYRA 1X5ZA 5FM4A 4BSWA 4POYA 3FT3B 1IGIL 5GISH 1BP3B 4JFXA 4JZOB 1I8KA 1IMHC 4U6XB 3BSZL 3D5OF 4LSRL 1HE7A 3QEQB 4F2MA 3FCTA 1W0YT 4QF1A 1FCGA 4OM1L 3SE8L 4KDWA 3T0EB 2JCCE 1UXWA 4XHJD 5IVNA 4OFPA 2FH8A 2EZ0C 4XPBH 2JELL 3T3ME 3AROA 1NCDH 4KDVA 5EWIH 4O2CA 3STLA 1X3DA 2RFXA 5L6YL 1EHLL 4GKSA 2ICEB 4Z77B 4XNMB 3MLRH 3DV6A 2R1YA 1QFWI 2HJFB 4D9LH 1JYNA 3BRGC 3F5WA 4PJIE 4F58L 2W07A 1AP2B 3I6GA 3SDXE 1NCWL 1U8QB 4HWUA 1BZ7A 3FO1A 2OTWB 3BHBA 4P2QE 1A6UL 2ZPKH 4UV7H 3RX8A 3QPXH 4JY4B 3MJ8A 4PJDE 3V8CA 2DI7A 4TRPL 2FEDC 2H32A 1IL1A 3AXLA 1QFWM 3RVWC 5SWSD 2WMPA 1TJGH 4HF5L 2YMXH 5ANMB 3IYLW 3MGTB 4XNQB 3V6FA 4GBXA 1MFCH 2PXYA 2HLAB 3O3BA 5F21B 4YHIA 3QFJE 1I1AC 4WUUA 3V5HA 2B2XH 3SKOB 1CDJA 5GGSY 1FNEB 4YNYA 1RZ7L 1TIUA 3IDYC 4PGDA 1NGZA 3M07A 4LCWD 4K07A 5IESH 2QQKL 3EZJB 4OM0H 1P2CA 4AJ0A 4EOWL 4PP1C 3BP7B 3JVGA 3VXUE 3HC0A 3QULB 2GITA 4S1QH 3BD4A 4GAYB 4ZYKA 4HXBL 4JFEE 5D93C 4N0YH 4WVRA 3BDXA 5AYQA 1RJYB 1E28A 2VYRE 1KPUB 1HHJB 1NCAL 2H8PA 1PYWB 4M1DH 4OSUH 4K23L 3RDTD 1IVLA 4FQXC 1AD0B 4CNIB 2PTVA 3O0RL 4K71B 4PB9H 5IB3A 3TF7C 4AMKH 1S9KC 3DSFH 4HMEA 1MLBB 1UB6A 4PRPE 5ICYB 4RGNB 2CLZB 4KXZI 3BKCH 5TDOB 4KDTA 1S7VB 1QFHA 3NVQA 4OD1H 5F97E 4D8PB 2OL3H 5HGAA 1NBYA 4QTHA 3PWLA 4JFHD 3WNKA 3T8XA 1EHAA 4RAVB 3ZSSA 3T3PF 2GTZA 2OSLA 3THMH 2P5EA 3ULVD 1FGNL 5EZLB 1NLBL 3WO3B 1TZGL 5ISZD 2WBJB 1HINL 3O6LH 5FUZL 3HUJB 4U0QB 1J1OH 2E3VA 1EX0A 1FRGL 4NC0B 5C0AD 1RZJC 3HNTH 4FQ2H 1U8IA 1YNTB 4HCRH 1DE4A 4S1RH 4UT9H 4UT6H 3QJFB 4YHLH 2X9YA 1BFTA 3O4OC 4I3SH 3MRNA 1ZSDB 5I1CH 4S2SB 1U9KA 5HSFA 3BEVB 1CFVL 1CL7H 3VFSA 1RUPL 1KTLA 2EDEA 4DZBA 1F4WL 4JJ5B 4XI5C 3GBLA 1IQWL 4NWUL 5E6ZA 2Y07H 2BVQA 1QSED 2DWEA 2VISB 3RGVA 3WIFA 1IKNC 1U8MB 3RJQB 1WCQA 3GMPB 3I50L 2DYPD 2X4QA 4Z7NE 1HH9B 3GHEH 1A4JA 2VSCA 3MODH 3G6AA 4Q9BA 4F33B 5K59E 2HJLA 1MHPH 4HIJB 5JW5B 5FYKD 1M1SA 25C8L 3MV9D 3VXSA 3O4LB 4XBPB 3FN3A 1BJ1J 1CXKA 4K3JL 1K5NB 5GGQH 2IAMB 1G9NL 5GIRB 4XHJC 4C56E 5FO8B 4RMRA 3WN5C 1A6AA 3A67L 2J88H 4FFWD 2AXFA 3RNQB 2ID5A 1R3HB 4P57B 3T4YA 4ELMB 2CO6B 4WU7B 5EO0B 3E6FB 1XF1A 4ZS7L 2HYMA 2X1XR 1GHFH 4OV5A 3DI3B 1YECL 4KTDL 4JFOB 3HG1E 4DQOH 4NO0D 1NCBL 2N56A 1RVFL 1QA9A 4HX1A 4JKLA 4K3DH 4MZ3A 2CIIB 3ARDB 1P7QD 3NA9L 2XNAA 4DAGH 2BSSA 2PYEE 4MLSA 4N1CA 5IFHL 5CIPA 3DMMD 1RJZA 4I18C 4D0DA 4NO3B 1VFAB 4ZD3H 5B38B 3BPOC 4PGBB 4PJEE 2Z0BA 1YY8A 4QXGL 3WXVH 2AV1A 2Z8WC 5D5ME 1IQDB 2EDXA 2Z93B 3T4AA 4IMKC 2KBGA 3KYMB 5F89B 5KSBA 4KVNH 1CICD 1QSVA 2NW2B 5BO1L 1KUMA 1J86A 2EEAA 1IEBA 5EFIB 2WV3A 3K2UH 1QP1A 3B3IB 1MIMH 1A2YA 4WEBL 4JFXB 1IAOA 4MAUH 1TCRA 4NQCE 2BVYA 4ORZC 2J8HA 4QF1B 4LF3B 5JDJA 1B6DA 1CR9H 1MJ8L 3VH8B 4PJBE 3O41A 5GGRB 4RGOL 6FABL 1NC2D 1B4JH 4M6OH 3H0TB 5DUPL 2W91A 4OLZH 5H94A 3PQYB 3KYKL 1MVUA 1A9BA 3N1MC 1YEHH 2ZUUA 3DV6B 3WXWH 4G8GD 2YUVA 4NM8H 1MCFA 3QJHB 5MERB 2NW3B 2VZVA 1NGXB 5EU4A 2BRRL 5C0BA 1IKFH 4NKDB 2P5WD 4ONGL 4G6FD 3KYNB 5E56A 5LWYL 2Y36H 3H9ZA 1FO0A 1OGAD 3DX6B 4YDIL 5F3BB 1C7TA 5CBEB 3DVGA 3I85A 4XXDB 5DURB 1BBJA 1FHGA 2H32B 1IL1B 3AXLB 1XF2A 2R0WH 4BSVA 5IQ9A 7CGTA 3ARED 1IE5A 5BV7L 1SYVB 5H37G 1CE1H 3VD4A 2PYFB 4ZMAT 2KQNA 3AS1A 5IB4B 5JA8B 3OKOB 4F37F 3TFKD 5F72S 2FSEA 2OS7A 3RZCB 4YHPB 2VQ1A 1Z5LA 3GJFA 2XT1B 2Y25A 3IXTB 1S7SA 3ZL4H 4KI5F 5CHNB 1NGPL 4JHAH 4ONFL 4HH9B 3HZVB 1I7TB 1VFBA 1J8HB 2EDLA 1A64A 1L0XA 2I5YH 2QQNH 4YHOH 1WAAA 1CL7I 1JGVH 1UJ3A 2ESVD 6CGTA 1AGCA 5DRZA 2KKQA 2LVEA 1ONQA 5CJOL 2J12B 4W4NA 2XQBL 1UADC 3FO2B 5KSVB 4OKVA 4GXVH 4LHUD 4WHTA 4BQ9A 5DQ9B 3JTTA 2NLJA 4R4BA 3WNOA 4MQ7A 1JUFA 3RVXC 3T77A 1FG2A 3CU7A 3NN8A 2AEPH 1V3LA 1TNMA 4TVPH 3AS2A 3ZT7A 1QPXA 2UWEA 2VLLA 3PV6A 1FFRA 3UTZA 5FYJL 3DLQR 3VFOB 5J6HB 4NFDA 5E6YA 2KL6A 1P1ZA 3QQ9D 1IARB 3ES6A 3W11D 2GTZB 3SDCB 4GXUN 1CTOA 3QEUA 3UAJD 1ZANL 5KS9A 1FQ9C 3DUUB 2VQUA 2FECL 4UOW0 1FL6A 1XZ0A 3ROLA 4Q58C 5IHZA 5HJ3A 3TYGL 3WLBB 3LKRB 4MHHG 1BLNA 2G9HA 4LPTA 2XZAL 1F3DH 1PG7H 4FZ8L 4P23C 3VRJA 3TCXA 3FJTA 3GBMH 4GJTB 5T3ZD 5HHQA 2J6EH 4TSCH 5L8LB 3HC3L 1OAXH 2H2PC 1R3IH 2EDQA 3VFSB 3L1OH 4KRMB 4M1GH 5D6DC 1I3RB 3BIBX 4TULH 1OTSD 5CILH 4KAQL 2F53A 43C9A 2CK0L 2CRMA 3FQNB 5SWZD 4PTTB 3TO2A 2YD8A 2AJUL 1J0IA 4PJHA 1JHKL 5IB5A 3WIFB 1LO2H 1KIQB 3HFML 2ADIA 3H42H 5CSZA 4GG6F 3BEWA 1A4JB 1I8IB 2NPLX 3G6AB 3GUTA 3K2MC 5FM5M 3WFBH 4HIXH 1JVKA 2VDML 4L4TA 5ILTH 5ALCH 1MCKA 2FX9H 3ZE0E 4F7CA 3VXSB 2J5LC 4LU5L 2CRIA 4PY7A 3V0WH 3VFWB 4QY8A 2MCG1 1DQQB 4BUHA 4QRPD 4YX2H 2GK0A 1HSAA 4P59H 2VXUL 4YEFA 4PRHA 2PO6A 4QRQB 5CEZL 3VMOA 3B9EA 3IFOA 1BD2A 3SE4C 4UOJA 1Y6NR 3VFPA 3NIDF 3D69B 4M5YL 3V79C 1FO0L 1S9XA 3O11A 3WO4B 4PLJC 2FEEL 4JO3H 1T1ZB 3IB4A 5DJ6B 5F9WC 3REVB 3MRHA 4U1HA 3SDDC 3AREC 1NAKL 1RUKL 1ZT7B 4FMKA 2G5RA 5C6PB 3JV5A 5EUOF 4Y16B 4FQIH 3V8OA 4UDTB 4JRYA 3T4AB 2ORBH 4M4PA 1D5MA 4Z7VE 4R96A 4DEPC 2VSDA 3OPZL 4HPOL 1DVFB 4HT1H 3B9KD 4PRIE 4F9PC 2ITCB 1A2YB 4U2ZA 3OGOE 1IAOB 1F13A 1E4XL 1UCBL 2YWZA 1DQLH 1TVBB 3BP5A 4JN1L 4BZYA 4XMLH 3IJYA 5DEFA 1WIPA 3AVEA 2D7TL 5E5UB 3MUZ1 2E27H 3O41B 4OZGA 4X5LA 3MRLA 3T0AA 2GEEA 3O2DA 1LK3H 2QKIB 4PV8B 2ZSVB 3BVNB 3NPSC 2PCPA 4LCUA 4HUUB 1HQ4A 2F54B 1JZ7A 2B8OT 3WNPA 1BREA 5D7IF 1J5OL 4YXKH 3H9HA 4E41B 2CLRA 5FGBC 4APQA 1SY6A 4U7SA 1O5DT 3K80A 3EOTL 1A7NH 1ULVA 1U6AL 1CF8L 1KN2L 2R56L 3MR9B 2ZG2A 3QQ9C 4JFQB 5IB1A 5F9DC 1LP9E 4GRLB 4OZHE 1T04A 5C3LD 1IGJA 3CFKA 5GRJL 5HYIA 4PJXB 4OZIE 2VNCA 3SKUD 5KVDL 4M8VA 5E03A 4ODSL 3L7EB 3W9EA 1OOAA 1VACB 2IC2A 2QSQA 3G6DL 3H7BB 3LS4H 5TE4L 3R1GL 5EU7C 5F96L 4A6YH 2BXZA 3QH3B 3RY4A 2FGWL 3CFJB 2DBLL 2W38A 5CBAB 4NQDE 3FB6B 3CAFA 1RHFA 5F7MC 5MP6H 2AABH 2PUQT 2VZUA 1A1NB 1VFOA 2MTPA 2YUZA 2R1WB 4MJ4A 4P4KD 5ESVA 4ZUSA 5LG1A 2E9WA 1WVZA 1DEDA 1NMCC 1MJJB 1KB9K 5CSBA 1F58H 3DOSA 3EYVA 2AK4B 2X4OA 3G5ZA 3VXPB 1QRNA 1OTSC 1Q72L 3O6KH 1UM5L 1R3LB 3T77B 1A3RL 5CEYB 1MREL 3SO3B 4JEGB 1P69B 1BIIB 2EIZB 3ARXA 1U3HD 4XNXL 4L5FL 3ALXA 5GZND 4J4PA 4Y4KD 1AE6L 1DBJL 2C1PA 1ZA3A 5DO2C 3VFTB 4DKFL 4FTVE 1FIGL 1MWAA 3EOBA 3LKOB 5HYSG 4RCAA 1FAIL 2UZIL 2BY3A 5J13B 1BIHA 1YYML 4NGHL 1F4XL 5C2BH 4MNQB 2FECI 5FGCE 4Y1AE 3SJVA 4CJ1A 3EKCA 5MEQA 1EEUA 1AQDB 1MY5A 3ULUC 4XGZA 3U36A 3H9SE 3OHXA 1SMOA 2C26A 1JZ3A 1UZ6F 5I66B 1X5FA 2C3GA 4ALAL 1NCCL 1TQBC 3TBYB 2ARJB 5I71C 3HPJA 4HK0A 1C7SA 1EJOH 2VL5A 3FN0H 1S3KH 4B5EA 1W0VA 5DUML 2NXZB 4RFNC 4NC2B 2BNQA 1Q9OB 4P9HH 2E7BA 5FOJA 5ICXB 5HPMB 4A2LA 3N50A 2WIIB 3ZDYF 5HHMD 4E42B 3G6JF 1CFNB 3TNMB 2CKNA 2ICWB 3S4SB 2SEBA 1Q0XH 5IB5B 4F8TA 2NX5D 2ARWA 3LDBC 4TYUA 3MXVH 4K9EL 1TCMA 1E4JA 3BEWB 4MJ2A 3SDYH 5IGXH 1MI5D 2W59A 4OLYL 1ZLWK 1HEZB 5ESQB 5IVXF 5EBWB 5A16B 4XPGL 5JPNA 3GSQA 1ZEAH 1R24A 4PB0H 4U1GC 1FPTL 3KPSA 3Q5OA 1DCLA 2EYRA 3O2DL 5DRXB 2OTPA 2WIMA 3ARFD 1ZXQA 2GK0B 2Y1VA 5INCA 3C87A 4X6BB 4FNLH 2EC9T 4FQHB 3PP4H 4OLUL 4M48L 3ARUA 2VLME 4Z7UE 1KTDA 2QEJA 5E9DE 1KBGH 1AHWB 3IAPA 2VZSA 2XQYG 3MFFA 1OAQL 2FBOJ 5HYEA 4JO1L 2B0SL 4AIOA 1BD2B 1QUNA 1SY6L 4LPYA 4OZFG 3TVMA 5E4EC 4EI6B 1S9XB 3D0VB 3TJHC 1IM9D 2QSVA 2X4UB 4JPWL 1NANH 1YNLL 3R0NA 2YS4A 4GO6B 1CS6A 1QFPA 4EVNA 5FDWB 5BJTA 3U82B 1NC4A 4Q6IC 1CFTB 5KW9L 1FFOB 4Y19E 3G5VB 4N90E 2E9BA 3MRHB 4JRXB 3IVKA 5FA3A 2FD6H 2NY6C 3AUVA 3MNVB 5L9DH 3UTQA 5E08H 1RZ8B 2B4CH 4UIMA 3QT2A 5KSAB 1D5MB 3LS5L 4R96B 5JXAL 3DGGA 2MQ3A 5J0BA 3UP1A 1KENL 4X99A 3OF6A 5GSRA 5DJDA 1NGWB 3OKLB 1KPRB 1ZHKB 1WC7B 1KXVC 3MV7D 5I76B 4DZ8B 4JN2A 3VFNA 5DK0B 5DT1H 4RBPK 1E4XI 4L8SA 3TBWB 5IW6B 2B1AH 2C7UB 2BX5A 1N4XL 1KIRA 1AXTH 1CVSC 3D9AL 3LAFA 4LKXA 4LVOC 3QFDB 3UTSE 3UTTE 5GRUH 1W0WA 3OKDA 4OF3A 3ZYOA 2VLJA 5EZIH 4ZTPL 5IMMB 1TQCB 4V2CB 3ETBF 2ERJB 1WF5A 2F9BT 2OBGA 4R7NB 2MWCA 3IDIA 3DNKA 5JMRA 2CK2A 3PNWB 1JGUL 1NFKA 1DLFL 3QIBB 1SVZA 5JO5A 4F7MB 3S97C 1M7XA 2BNRE 1S7RA 3OGCA 4CVZA 4MAYA 4RX4A 1MCIA 3HLAB 2GT9B 5IVOA 1CDYA 3H9HB 4KK8D 1INEL 5IWLA 1U3HC 2JB5L 1WIUA 4X9IA 5GZNC 4Y4KC 5HHNA 3NFNA 3QNXA 1RIHL 4JM2B 4NN5B 2YD5A 1MWAL 4OCRH 4KMQA 3DETD 3ZLQC 1E6JL 2AJXL 4YC2C 4XCCH 4MB5A 4X9FA 1H3VA 2HP4A 4X5WA 2N7BA 2HFFA 1MELA 3ULVF 1QFUH 3ZO0A 2YPLB 2DM3A 1LWRA 1X5GA 2ICCA 4Z0BL 4ZXBC 3SCMD 1NCTA 1P84K 2P47B 4LCCC 3NFSL 1OPGL 1RZFL 4NQEA 3WDIA 5DMIH 1EAJA 1A22B 4MNGE 3LKSA 3MLXL 3JWDL 4KRPB 5C0DA 1LE5B 4KFZC 5D71L 2A83B 2BSRB 1BVLA 2CQVA 1KJMA 5D2LB 3QXTA 4UOW1 3RWFB 1VKXB 5ESVB 2AEQL 1KG0A 4YXHL 1EHNA 4XCYA 1CFQA 5D1XC 5ADPH 1G6VK 3MRCA 3BZDA 3J8F7 4Z95L 5EU5A 3OB0K 3BE1H 3WFDL 1BM3H 4XNZB 1P4IL 2ICWI 3BPCB 5L88H 2A73B 4WEUD 5B4MD 1AY1L 4IRSD 3RUGB 4QHLA 5J6GB 4V1DE 3SDAD 3BKJL 4G8IB 4MD5B 4KTYA 2YBRA 1JZ8A 3MRQB 1FYTB 4KKCD 4LPUA 3TN0D 4Z8FH 3T0DA 4ZNEE 5IBTH 4Z7OE 1A7BA 2I24N 1J05B 1Y6KR 3EOBB 1MCBA 1KCLA 3UTOA 4AIXA 2EIEA 5HHOB 1TENA 4YFLI 3KNBB 4DUWA 3ECBA 5FYLL 5C0CE 4JFFB 5LJYH 1G9MH 4OQTA 1MCRA 1BVZA 1H3GA 3L3DA 1JGDB 4XGZB 1RFDL 3WIIH 2VB5A 1FC1A 2N7AA 3VD9A 1JGLH 1MRCL 2H9GB 3Q5YA 3QUZD 1I7ZA 3GSXA 1GGBL 1NANI 1AR1C 4QOKA 3BX7C 1TXKA 4GW1A 2I26N 5CZXD 5E2UL 3B9DA 4FQ1H 4UT7H 1UM4L 5IQ7H 2IANB 4Y2DB 1DDHB 3D39E 3QA3B 4RAUA 4K94C 3QHZH 4M4RA 3L5WB 3TA3B 5CINH 4DJMA 5EOCH 4IRJA 1B6UA 4ZUUB 4DGYH 1NSNH 3SKNB 3F58H 1LEKA 5CKGA 5C3TA 3RTQD 3PWPB 4PJAF 5DR5L 4CN6A 1R5WA 4OFDA 3GI9H 2F74A 5C08E 1YEIL 1IAII 3WD5L 3S34L 2GY7B 2LE9A 5D6CB 5EU6A 3PWUB 2A1WH 3HN3A 2VH5H 4HJ0D 4DK6A 5DXWA 4BZ2L 4ZSOE 3KPSB 3U7WL 5DFWH 3EUUA 2EYRB 2FX7L 4U0RB 3X13B 2Y23A 4QRRD 2DQDL 2VAAA 3FFCD 1ZHBB 2DQFA 2Y6SD 1O7SA 3BPLB 3K46A 5EIIA 1IBGL 4C83A 3RP1A 3BW9B 3O8XB 4Z76A 3JXAA 1S7QB 4KHTL 5HYSA 4DVRH 5JW4Q 4XMPH 5DJYA 4O4YH 4Y88A 2Q7NA 4KK8C 3OMZA 5JHDD 4GRMA 4J7RA 3T0BA 4GW4B 4M7JL 3NOIA 2BVOB 5A2LH 3QG6B 4CW1B 5BJTB 2ILLA 2VTFA 3TZVB 4P4RA 2EYSA 3OKYA 2IQAA 4HHAA 1F97A 2YKLH 3QUKA 2QBWA 2UVEA 5FA3B 1XGUB 5EORH 1HYSD 4JDVB 4UIMB 2XG4A 2IMMA 4UNTA 2IWGA 3IETB 5HY9B 1QBBA 5HPOA 3FQXA 3OB8A 1YEGL 2EO9A 2YHGA 3TCLB 1IGYA 3OAUL 5GSRB 1R5VB 5DJDB 3U4EB 3KLHD 3PHOA 4UQ3A 1DQJA 3VGHA 1JWSA 3LQZB 4GRWE 2VLKB 5DDHB 4KZDL 3MLSL 5FYJU 4WU5B 2MMXA 5DRNA 4PBXA 5IFJA 5GGSB 2FIKB 2BJML 3H9YA 1J0YA 3MLUH 1OM3L 1T66D 5IFAH 2WQ8A 4JLRA 1MCPH 5JOPE 4MX7A 1PBYA 3DXAB 3U6RA 3JUZA 3VXNA 2C1OA 3TT3L 3RY5A 3K1DA 4IIQA 1X5XA 3MRKB 3OXSB 4DOHE 2X4TA 4LSPL 5TE7L 3INUH 5GS1C 2FATL 3FOLB 3RNKA 4IRSC 3VWJB 4NP4H 3SDAC 1AGDA 5BRZE 4Z7WB 3LQMA 3QEQE 4WCYL 1B0GB 2HAZA 3JSSA 2WUCL 4GG6A 5HDBE 4LMQE 4N8VG 1MJ7H 3RI5K 3TN0C 4DKAA 4KPHL 1UA6L 3DURA 1T80A 2I60H 3WFHB 4OCYH 1C8PA 1MCJA 3X14A 2K7PA 4XWGH 3O45A 4L3EB 4HJGB 1OLLA 4YHML 5I1JL 4XZUA 4NNXA 4OZFA 4WTWA 5FV2A 4OQTL 2H3NB 3BXNA 1HOCA 4ODVH 5I73C 3CC5B 2HJKA 4Q9RH 3CVHA 1U93A 5FECB 1FVDA 1D5ZA 1E27A 2GFBA 4WGVB 5IEKA 3WKML 3QUZC 5IIEB 3BO8B 1A4KA 5DVOA 5I8OH 1EFXA 1T0NB 3TWCH 3VGEA 2X7LB 5DMKA 4H8WH 5DI8B 3QWRD 4WI5A 3QDJB 3EDEA 5D1ZA 4EKXA 3MUJA 3L3GB 5ANME 4JR9L 3MRCB 1A5FH 1WBZB 1X5HA 1INQA 2QHLA 1JTPA 2WLZA 5GS0H 3VGDA 3WS6A 2JIXD 5LBSH 1MRFH 1K2DA 5CP3H 4BQ6A 4ENED 5EUOA 4ETQB 4G7YH 2EDOA 3RX5A 1U95A 4OLVL 5DD1L 4XBEL 4OLXH 4GKNB 2O5ZH 1YEDA 5EOQH 1Y0LA 2RCSL 4Y0GA 3LD8C 1MFEL 5IP4A 4F7PA 4IOFD 4PJ9D 3FONA 3T2QA 2GSGB 3LKPA 4LPXA 3EO1B 1KGCD 4MXVE 3TPUB 4JGJA 3ZYJA 2AXGA 2XACC 4G9DA 4W6YB 3W9DB 3I3BA 5EIQA 3MOBL 5L0QC 3ECBB 3MFGB 3PDOB 1OP3K 2Y6SC 3FTGA 1CT8B 5T5FL 5L6YH 4XH2B 5EOTB 4AEEA 4JO4L 4J3SA 2V6HA 1AKJA 4NKMB 1ZT4B 2X9XA 4HKZA 3QAZB 4IS6A 3QNZA 3W81A 4KJYA 5I30H 2V9RA 3P4OA 3QCVL 3GGWB 4TSAH 5JDSA 3L6FB 2O5YL 4L8DB 1G84A 3NIGF 1Q1JH 3O3EA 3VXUD 3M45A 1VADA 3OX8B 2E9IA 3TBVB 1AD9B 4NKIL 5FGRA 3EO0B 4MHHI 4LSQL 2WZPD 4FRWA 3MUGB 4YHNA 3HUJE 2FWOA 1IAKA 4QRTB 4I2XE 4D9RE 1F4AA 5JXEC 4UNVA 1HYSC 4JQXC 2AJSL 3IRZA 3UYRL 3CCHA 1S7WA 3U30B 1OQOA 1VEPA 1I3VA 4L4JA 1I1AA 2CXKA 1BF8A 1N5AA 1AO7E 3HCVA 3QCTH 5T3XL 3L3OA 3VWKD 5C86A 4LKCA 4FXKA 2M1KA 1BJ8A 4OCNC 3UDWC 1U8LB 1WBXB 5IMOB 2EDDA 1MJUL 1VA9A 2XA8L 2COQA 5INDA 1KLUA 5KTEL 1F42A 1A6TA 2WUBH 1KELL 2OMBA 5CUSH 4TUKH 3RIFK 1T89C 5GHWL 4NKOA 5I8CB 1MCHA 2OP4L 1WIOA 1YN7A 4LVHC 2EKSA 3TP4A 4FFYH 3LEXA 4ONHA 3V9FA 5F9AC 2WBJD 4OCMC 5D7JB 1I9JH 5F6IB 2BOCA 3BZFA