1X5AA

The solution structure of the second fibronectin type iii domain of mouse ephrin type-a receptor 1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
107
structure length
107
Chain Sequence
GSSGSSGAESLSGLSLKLVKKEPRQLELTWAGSRPRNPGGNLSYELHVLNQDEEWHQMVLEPRVLLTKLQPDTTYIVRVRTLTPLGPGPFSPDHEFRTSPPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the second fibronectin type III domain of mouse Ephrin type-A receptor 1
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords Ephrin type-A receptor 1
total genus 9
structure length 107
sequence length 107
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1x5aA01
2AAVA 3LKOA 3TBYA 3MRIB 4DTGL 3FN0H 4P5TD 2HYMA 3QO0A 3BT2L 1S9XA 1CXEA 3D25B 4TTGA 5JHLL 3VXME 1AQDB 4XX1G 4IS6A 4LK4A 3BP4B 1RZ8A 2VQUA 2B0SH 3MV7D 1BIIA 5D70H 1SBSH 4CW1A 3WFBH 4UNTA 4G80B 3ZTJH 3QDJA 3KJ6L 2FR4A 1QKZH 1BLNB 1F97A 3MGOB 5GISH 4ONOA 4KI1A 4EN3A 4LCUA 4QXGL 5H37G 3IB4A 3CU1A 4KJWC 5F93C 2F8XC 5AAMA 1DBKH 2V7NB 1IE5A 4HULB 1KULA 4Z0XB 1WBXA 1Z9LA 3MRIA 4G3YH 5SWZE 3SDYH 4GMSL 1TETH 1F58H 4C83A 5L8KB 1V8HA 1OWRM 2OR9L 5EU6D 1DEEA 1CL7L 3RIAK 4LLAA 2BY1A 3LRSB 3QUKB 3VFOB 1NBZB 5KVEL 5GHWH 4AEHL 3MXVH 2QKIA 3ROLA 5DJZB 2X05A 4JG0H 4K8RC 3ILQC 1KT2B 2BP3A 3DECA 4FFWD 1GGBH 1RVFH 4L8DB 4HWEL 3BP4A 4P4RB 3QXAB 2G75B 4IJ3C 5FIEA 2APVA 1YEJH 1OW0A 3SE4A 4NRYB 2JB5H 1BZQK 2BNQB 4P5KA 2BY2A 4XMKL 5LGHL 3T2NL 1Q0YL 2OXHA 3UP1A 1Z5LA 3ELAT 2K1MA 4IOFC 3DV6A 5DMGC 5IW6B 5C0JA 3O81A 5FGCE 5HGAB 5BS0A 3VMNA 1I7RB 2IQ9H 1T66C 1R3JA 3LS4H 4JRXB 4M5ZH 4UAOC 4JZNA 1QPXA 1J11A 4UV4L 5ID0A 3NPSC 4I0PC 2F74A 1SM3L 4G8FA 2WZPD 3T1FB 2C1PA 2HH0L 4X7SL 1CICA 1CLYL 3GKZA 3CDGB 4PB0H 4OZFG 1XH3A 4MJ6B 2DTSA 2YOCA 5CD3B 3MBEB 4WTWA 5IBLC 1JNLL 1CVRA 2GK0A 5HPOA 5ESAA 3V6OE 2R9HD 2JJWA 3QJHB 5CBAA 5CGTA 1JGUH 4K94L 1N8ZB 5C07D 4ETQB 4JE4B 1W0YT 4YFLF 5T3ZL 2PO6C 5L9DH 4OKVA 3HN3A 1I9RH 4JDTL 2R23A 2VAAB 5DJDB 5IKCB 1AKJA 4MX7A 1PJ9A 4M6AA 3EBAA 1GRWA 4HK0B 3F62A 3DYOA 3ZE1F 1D5MA 1XZ0B 3QR2A 5KG9A 3MLPA 3TYFA 4ZUTA 5T1KA 4M62L 5JHDA 4LCCA 4TQEH 5CEZH 2X4OA 1LNUA 2Q76A 3K2MC 3MRFA 1QNZL 1MCLA 3PNWA 1MHPL 4OIAA 3TWCH 1CG9A 4GAFB 3VXNB 4QXWA 1NGXB 3BDYL 4NM4H 3MXWL 2XN9B 8FABA 3TVMB 2WLYA 5CFHA 4G6MH 1ONQA 1RHHA 3MA7B 4NN5C 1REIA 5GS0L 3HB3D 5T3ZE 3IXAA 2HG5A 3NA4A 3PJSB 2UZIL 2DKMA 2OR9H 4WFHE 4YDVA 3OKLB 4JM2B 1V7ML 4Y19A 2CLZA 4FQJH 3UZEA 3QIBC 1FFPA 3WD5H 5I30H 3DURB 3RWJA 1GGUA 1KELH 4FMFA 4U3HA 3VH8G 1IM9A 2CLVA 4PJEB 2XKSA 2UYLB 3FQNB 4AY0A 4EIZC 1JRHL 5D1ZB 3C5ZC 4BFIB 1EVUA 1MI5E 4JRYD 4J3SA 4X5XB 3KWWB 3ULSA 1GHFL 4W4OC 2O5YL 1LE5A 1GOGA 5B4MD 5FCUH 5I1GL 5MERA 1NGPL 3ZZ1A 3JTTB 4QHLB 1J8KA 2CIKA 2H3NA 3IDYC 5SV4A 3DBXB 3LDBB 3QPQD 4JFFD 1T1ZA 4TUJA 3H9HB 1DVFC 4MHHI 1EFXD 3MO1A 2VABB 3T0WA 2XY1A 2ED8A 5H35B 5IB1B 3CDCA 3S5LB 4X7EC 1N5AA 3KXFD 4Y0GA 4EXKA 1FZKA 3TN0A 2VDML 3RI5K 3L3HB 2ARJA 2VL5B 5JNYA 5T33H 1FCCA 5JXEA 4DVBA 5DDHA 1RZKC 1JV5B 1JNNL 1MF2H 2Q7NA 3HNSL 3X12A 3WHE0 4WJ5A 3H8NA 3CH1B 4EBQL 4ODTH 3HNVL 2VXQH 2IPTH 4M6ML 4BZ1H 1RJZA 3P0VH 3OAZK 2B5IB 1G84A 4HIIB 5E5MA 5HYJE 5KSBE 1XIWB 1RURL 2QQNH 2NLJB 1AHWC 4LRIC 1N7MH 3VFMB 4O2EA 3QP3A 4ODUA 1DN0A 1YNTA 2H9GA 1I9RL 4JDTH 3I6GB 1IQDB 1WZKA 4NO0B 4WEBL 5FYKL 3MRQB 3UDWA 4HZLA 5D72H 3IF1B 3MUY1 4JHWH 1S9YA 2ZUUA 4OM1L 2ZWLT 1MCCA 3O11B 4H20H 5J4MA 5J0BA 3HPLB 3PWPE 3K0WA 4JRYE 4AIZB 2P46B 4F9LA 1JF5A 4PJ8A 5F1OB 4QHUA 1RJLA 3RWIB 4BELD 1JI1A 4K2UL 3TIEB 3KDMA 3W82A 4X99A 4WUUB 1NFIB 1DLFH 4NKOB 4MCYA 4OIIH 2NXYB 2DQFB 3IKCA 3AS1A 1J9CT 5T3XD 1CDIA 1B0RB 5FECA 1BECA 1NMCB 4FTVA 4EI6A 4ZUWA 4UIKL 5EO1A 4OUOA 1V7MH 3LV3A 5IMKB 4HEME 1ZLVH 5AUMB 4XCNA 4XXCC 3K81A 1OP3K 1U8IB 32C2A 1UJTA 5I18H 3BI9X 3VE0A 4M6NH 2JJSA 4MZ2A 2Q3AA 5MHSD 4D9RD 2YD4A 5SWSA 1QHPA 1ERNA 4IMKA 2A6JA 3C2AL 2P42B 3F7VB 1JYWA 1FGVH 3O4LA 5E2WH 1U8HA 1N0XH 1QFWH 1TQCB 2IMNA 4XMLH 1U2HA 5D6DA 3C5SB 3PWVA 1LO3H 4HH8A 3D85A 1C5BH 5IHZB 3K3QA 1J5OH 5HYFA 4L4JA 1A3LL 5I15H 4PJXA 4P2OA 2D7MA 3RL2A 4CVZB 1ZEAL 4Z7OE 4M7ZC 4APQA 4MJID 1EV2E 5CUSL 3KPOB 5IP4A 3WNLA 5F96L 1S78D 4GUPB 2FX8L 5IFHL 2NY0B 3QIUA 4GMTL 4KVNH 5K59F 3U4EB 1B6DA 3DVGA 3RY5A 3GMQB 1A7OL 1FQ9C 5JXEC 4WO4B 2X10A 1KPRA 4P5TB 1XGPA 2AQ1A 1OP5H 3X11A 3BUYB 4BA8A 1CT8A 5IBUG 4AG4L 5K9KA 4JQVC 5IVZA 4PJBE 3SDCA 4ZXBC 1RZ7H 4DFHA 4XVJH 5EU5A 1MCBA 3H9SE 5JO5A 5JTWA 2V5SA 1TVBB 2BY0A 4G5ZH 4QRTA 3R8BB 2FZ3A 3MCLH 3RNQB 1OY3B 1S7SB 1T1YA 2HFEA 4WEBH 5FYKH 3SKJH 5T1DL 4OLZH 5IR1A 4DKEH 2R56H 3V5DA 3MCG1 5DLML 4UB0L 5J1TC 4LPTA 4I48A 5D1XA 3S35X 2R0KH 4MDJB 3RNKA 3BAEH 1RD6A 5IVNA 1M6OA 5JDSA 2LABA 2F54A 4NQCD 5A16B 1I8MA 3OJ2C 3QWRA 5E08L 3BE1L 4H25A 3ZL4H 3KPSD 2NY7L 4WI9A 5ITFB 4ESKA 3OWEA 2H1PH 2P5EA 4GBXD 5HDQH 4WV1A 3LSOA 5DD0H 1VGEL 5GPRA 3SHSA 4MA1B 4Y4HB 2NX5A 1PX3A 2WWMC 5JO5B 4U1LA 1NCCH 4MAYD 5I1KH 5HGDB 5KSUB 1HHJB 1UGNA 2J5LC 3VXOB 4JANB 1CT8B 3OR6A 4H1LH 3FT4A 2N1KA 1MCPL 4OD1L 2ERJB 4XAKD 3RVUC 5J7CC 4K7PX 2VUOA 1Q8MA 4WFGD 1YEDB 3IJHB 2Q1EA 3BQUC 5CD5D 3QEGH 1YECH 3BP7A 1XGTA 3ZSTA 3S4SG 5JPMB 4B7IA 1JZ8A 3KPQA 2XNAB 4JGMA 3VG0L 3QDME 2ZOLB 3RL2B 4FZEH 3IS0X 2RFXA 3PP4L 4LLYA 2V2TA 1NGYA 3G9VA 2OR8A 4HK3J 2X4NB 2DBLL 3TIDA 4GRWB 2DQJH 1D5ZB 2FX8H 4ACPA 1LO5B 3C5SA 4KJPD 2R15A 2P24B 3STZB 1AGCA 1WBYB 2CKBL 2KUTA 1MJJB 3KLAA 3QEHA 2R2EA 1DVFD 4G9FB 5CHNA 2Y36H 1KN4L 1CBVL 3DI2B 3V95A 3LQMA 3L3OB 1Q0XL 4R90H 4B7LA 3BFOA 5IBUB 2W0KA 2AK4D 2A73B 3EDKA 3OKMA 5DD3H 5HD8D 4NZTH 4HIXH 4XPGL 4FXLA 3LN5B 1MLBA 1LQSR 1U3HC 3HMXL 4H5SA 5BQ7B 4XI5C 2DLFL 4B41A 4G6FD 4YGVB 1KIPA 4ZUSA 3PV7A 1G7PA 5D1QA 2F19H 1FZJB 4P23C 5I1HH 2VISA 4HPOL 4IIQB 1ADQL 3WBDA 1OW0C 4XAKE 5L8JB 2CXGA 3MRRA 1RUAL 3ARXA 5GZNC 4LCYA 3O2WL 1EJOH 1LVEA 3B83A 2HLAB 5HI4D 4RBPH 1SEQL 3TBVA 1FDLH 1A1MB 3NCCB 3IFOB 4ZUVA 2WSKA 4AIZA 1M71A 1BFOB 1F42A 5IIEB 4QHNB 1RK1A 2RIKA 2FL5A 5HYJA 2GSGB 5IMMA 4HZLB 1Q38A 4NO0A 4ONGL 4UIMA 1HWHB 5F7LB 4RFNB 1GOFA 3C8HA 3O2DA 4A2MA 4YHKH 3QWRD 2X4NA 4Z8FL 4X4YB 2WUCL 1PYWB 4L1DA 4AL8H 3HS0A 2RFXB 1F4WH 4UUJB 4D0BA 2A9NL 4R26H 3MQIA 4JRYB 3IETB 1RJZB 4IRJB 4HS8H 3QQ3B 1D9KC 5JW3L 3UPAA 2HJLB 5FEBA 5FGSA 3QDAA 4KHTL 4KK5D 1CZ8H 3KYOB 2FBJH 4OF3A 1ZHKB 3CSYA 2IPKB 3TZVD 3V8CA 1T0MA 1VFOA 5DQDL 1U8MB 3PWPA 2R4RL 5FM5M 1BJMA 3HUJE 3TN0B 5IHBA 4JFFB 5LQBL 1ZVSA 5ADPH 3HTLX 5TDNB 1PLGL 3W39B 1M7XA 1TVHA 2GFBB 2YC1A 3BH8B 5IOPB 3SPVA 5INCA 4ZS7L 4X6EB 5CLTA 5I19L 1YJDC 4NO5A 3ARGB 5DJCB 1MIML 4KJQD 1OGAE 5I8OL 1AXSB 3GNMH 5J6HB 2F9BT 4MLIA 3RGVB 1XIWC 2AEWA 4ORZC 2YMXL 4S1DD 3D69A 3D5OF 4HD9A 4TULL 3Q5TA 1A6TB 2UYLA 4KV5E 4L8SC 4OGXH 4P2YA 3MJ9L 3PGFH 3PWNB 4Q2ZB 1R5IB 3H3BC 3JWNC 4HV8A 5L2KE 3QNXB 1U95A 4NZTL 4Y19B 1P5UA 4WV1C 4R97B 5C09A 1GXEA 3MSPA 3JV0A 1BWMA 4QHKJ 1PG7L 1MQKH 1RZKH 2HFEB 1H3PH 2X4QA 1IBGL 5KSAC 1UWGL 4IOIA 1HDMA 2R9HC 4ZD3L 2XQYG 4PP1C 4X6BA 2BC4A 4HPOH 4PFEA 1KCVL 2NY2D 2V7HA 3UTSD 2FX9H 1NC2D 2UY7A 5K9KB 4YIQA 1KB5B 3NACH 3PQYD 5T3XL 4PRIE 1SEQH 2N56A 1S7QA 3CFBB 4JLRA 4KMLB 1FZMB 5DJ0A 3ARUA 2DQCL 1FORH 2XWJA 2FNBA 5HHMB 1F13A 2AK1H 4LFHG 4NC1C 3BD4A 1DUYA 2P5WE 3DVGB 4HUMB 1FP5A 3P30L 4BH8A 1J1PH 4Y5YC 1RUKH 4KJWD 5ANME 4AMKL 4RFOL 3WFHA 2MKLC 1X5XA 2X1OA 4L4TD 5CSBA 3P4MA 1ZGLA 5CKGA 3JWDH 2J8UE 3MR9A 1J05A 5I76A 4RRPG 2A6KA 4OD3L 4G43B 4X8XA 2HA1A 2J5LB 2QSCL 4L29B 3HR6A 3OKOB 3NIDF 1FRGH 1FVCB 4M8VA 1XH3B 3BDBA 4WW2C 3D85B 2UUDK 3KPSA 2C1PB 5B8CC 8CGTA 1YYLH 3MMEB 3BPLC 2C4XA 3GGWA 4V1DD 5BV7L 3O41B 1FG9C 2O5ZL 4J4PC 1G7LA 5CWSA 1R3JB 1IC4L 3PGDB 4O4YL 5E95B 5ESQA 2WM0A 1C12A 3M17A 3ARTA 1GIGL 2YA0A 5ALBH 4UAOB 1BZ9A 5B4MC 5DMKB 5EO1B 1E27B 1X6LA 1GGYA 3EOBA 4TPRH 4PG9A 5I8OH 4Y4FC 5D2NC 4PP2B 4NC2B 2WBKA 2FSEA 1RJYB 3MNVA 2EC9U 3FHQA 3BH9A 1IRAY 2HVKA 4RAVA 1G6RH 1OAZH 3X3GL 4KRPB 4U31A 3VXRA 3MJ9H 3PGFL 4P4KB 2CKNA 4WW1B 1I9JL 3MFGB 2LE9A 3LKPB 3LRSA 2XXCB 4Z7QE 1JZ5A 2G60H 4GAJL 3O4LD 5BJTA 3U9PL 2XYCA 2PO6D 3IVKA 1LK2B 2BFVL 1KJ3H 1S3KH 4C83B 4ISVA 1S9YB 2J88L 3TPUB 2OQJA 4M3KB 3KXFE 1PKQE 2HMIC 4GG6B 1WBXB 3JV6B 5DFVD 4HEPG 1ZK9A 2OXGA 5JOEA 1TZIA 1WC7A 3WHXA 3C2SA 3KYNB 3N1GC 3OJDA 4Z7WF 1TTGA 3KJ4C 3MV9E 4C4KO 3HRPA 3HZKA 4WJ5B 4NZDA 5KVFL 1I4FA 3LKRB 5I1JH 2B20A 3O3AA 4LLDB 3QBTB 1U8PB 2V2XB 4AYFA 4RFOH 1CDCA 3UPRB 4XXDA 4CKVX 4N0CC 5C6WH 4XP1L 2R2HB 4I5BB 4PJ8D 4U33A 3MRPA 2R4SL 1VHPA 4LSQH 3PHQB 4CL7A 1FAIH 2MWCA 1DBJL 4K3EL 4R96A 1CR9L 2NXZD 4U1KA 1KGCD 3E0GA 1GCFA 3QUYB 1BQHG 4U6VH 5MP6L 1J1XL 1RUPL 4N90D 4YDKL 4K9EL 3QIWC 2VZOA 4MMXC 2P47B 1KLGA 2NW3B 1R3HB 5F9WB 2DIAA 2ED9A 2DIJA 4RMVA 1LO2L 1LO0H 2DQGL 3D1MC 2X1WL 1I9IL 2D31A 4NRZB 2WWKT 1S7UA 4NO3B 4L3CA 2YN3A 3NA9H 5D1QD 4HF5H 2Q86B 4EJ1C 2NY0C 4XNQA 4ETYA 1T2JA 4F15C 4PV9B 2ICEB 1ES0A 4RIRB 4S0SD 3KHOA 3TBTA 5EUOB 5GSRA 1XGUA 4K9EC 2EDXA 3BWAB 5EBMB 1FVEA 3OV6A 2WIMA 3VFUA 2LVCA 3DROA 1A9EA 4OZIB 4FFZL 3LPWA 4MNQB 3AFLA 4YZFF 4I8DA 2F15A 2O5XL 4LKXA 1K3ZA 1BFTA 1ZT7A 3UYRH 2Y5EA 3FMGH 1LHZA 4OLYL 1GJIA 1OF2A 3VFGH 5ADOL 1QFHA 3UPCA 2X4OB 4BSWB 4HAFA 2X4TA 1CL7I 3F12B 1XAUA 1FLRH 1FN4B 3TJEH 2QTEA 5IFJB 3FQRB 1D5MB 5IWLC 4HK0A 2Y07L 3MBEC 1YPZB 3DNKA 3RAJL 2W1NA 3OMZA 4OF7A 3H9SB 1BVLA 5C07A 1JZ6A 5C0GB 2UZYB 5J9PB 4HMDA 1Y0LA 1MCRA 4CVWA 3Q1SH 5JR1H 2VDNH 4EI5B 1UYWH 5DFTA 4PREB 3CCHA 4LCIH 4KZEH 5F71A 1U91A 5I1IL 3QWOA 1ND0A 1W0VA 4LAQH 4JPVL 5DRXA 4NKDA 4P2RA 1K4DA 2H45A 5I1JL 4JFYB 1OHQA 4K3JL 1D5BB 4L9DA 4F3FB 3KPMA 2ZOKA 5CEYB 4JPKL 2YPKB 1MPAH 2FIRT 1AO7E 3SE9H 2OTUB 3FB6A 4Y5YB 1EBPA 5JIKA 1QEWB 2MCPH 3DROB 1UXWA 4U1JB 1HQ4B 3MYJB 1A5FL 2FHCA 2J7LA 3NPZB 4OJFH 1XGUB 3FZUD 5JOFB 2A9ML 4X5WA 3SDCD 5DHVB 1RUPH 4YDKH 1UWXK 4WDIB 3WCYA 2D0FA 4CVUA 5E24E 2YEZA 1RIHL 2MMXA 1AGBB 1HNGA 5D7SH 4ZO9A 1U3HB 3CVHB 4RZCB 1NUDA 4WCYL 1NFDE 1RI8A 4L8DA 1JN6B 1NAKH 1HIML 1I9IH 3QULB 2XA8H 4Q58C 4U1HB 5T5NF 5FOBB 3A6BL 3VXTB 4XCCH 4LCWD 5D5MB 1CICD 2BJMH 4NP4H 2C1OB 3GSOA 3KGRA 4D0CB 4O9HL 1S7XA 4APQD 1WTLA 5KOMC 3BWUC 3MACL 5EO0B 3IDGA 3PP3H 4KK8C 3TO4A 4ONFH 5I0DA 2QR0B 4PJAE 4RWYL 4LLDA 4RAUA 2WQRA 1AR1D 4OZHB 4GW4B 5F1KC 3C6SB 43CAA 4HKZB 3ZDYF 3ZTNL 2H41A 2RB8A 1KG0B 4PJGA 3AREB 4M1CC 5D8JH 4YHZL 4M43H 4OZHA 5HJ3A 3QIBB 1AO7A 1R3LA 3VJ6A 1AQDA 2NY2B 3BKCH 4EDWH 1VESA 2ZUQB 4RGOL 3WHXB 1CTNA 1TZIB 2VMFA 2HTLC 4TUKL 2CRZA 3SJVA 2EIEA 4Y4FB 1H5BC 5D6CB 5D2NE 3TCLA 5DJAA 4GBXC 4TVPE 5GRUH 5DHVH 3O8XA 3OB0H 4PJAB 1QSFD 2JCCB 4YXHL 3W9DB 2EYSA 2VDQL 5EORL 4PLNC 5I0ZA 5D7IF 1Z3GH 1UKTA 4GQPH 4XPTL 3DRQA 3T0EB 3P4NA 4U1HA 4ZTOL 2M8XA 1IJ9A 3RUGE 1MPAL 3SE9L 5CZXC 4G42A 1A14H 2ICCA 4OCYH 2GTWA 2GEEA 2O61A 4MD4A 4AH2B 3VI3E 1HI6B 3WIIL 3IU4H 4G9DA 5LKNA 1WZ1H 3P9LA 1JJUA 4PJCB 2YWYA 4OJFL 3BN9D 5J57B 2E7CA 1FC2D 1SEBB 3SGJA 1BZ9B 1AFVH 3PE9A 1QSZA 2I9LB 4YHNB 2Z4QB 3RI5F 4K71B 3WYRA 1NDMA 3FN0L 4Q6IB 1U3JA 5TE6H 5F7DB 2BNQE 3FFCD 1MCWW 1H3UA 4KHXL 1I1RA 2XI9A 4YLQT 1NAKL 2P8LA 5FYJL 3KPMB 2NXZC 1VCAA 1G1CA 1UJ3B 4OZGE 4XCCL 1JCKA 2CGRL 2BJML 1QSVA 3T3PE 1U91B 1KLUB 3BGAA 2XZAL 1F4HA 3PWUB 4GRLC 1Y0LB 1JPFB 5MHSE 4EVNA 3KLHC 2AXGA 1T1XA 4JCMA 3OX8A 5CLWA 2B1AL 2NTFB 3BZDA 3VH8A 1ZLUH 4JFXA 4ELKA 2CUMA 1S9VB 3ROOA 1UH2A 4IDJL 3IDNA 4Q9QL 3VRIA 1MRFL 1KLFA 5EBLA 4NN5B 5EN2B 1YEHH 2X70B 3IRPX 4PJFE 3AMLA 5IHLB 1B4JH 2OZ4H 3VFWA 3CFBA 2HT2C 5GS2H 1OF2B 4LHUG 4OBRA 4XPHH 4GRWH 1AY1L 2I07A 4LHUD 4KZDL 1YNKL 3FCTA 1GGBL 5GXBB 2VIRB 1VERA 3ULVE 3ULVC 5EIIA 3O6FC 1U8QB 4XNXL 1Q9LA 5DJXB 4CNIA 2GKIA 2ESVA 3HE7D 4LFHD 3WEXA 1NMBL 1JF6A 3PHOB 1SJEB 5HI4C 3BWAA 3BSZL 2OCFD 1JHKL 1ZHLA 4L4VD 3JTSA 3VXMB 3HC3H 2BDNH 1B90A 4D3CH 3HUJA 5DZLA 2C3HA 3IDMA 3ULVH 3PWNA 4OF8A 2EDEA 3FQWA 1U0QA 5DJ8B 3QHTC 3SO5A 3QUML 3CSPA 1KIRA 2DJ4A 5EU6E 4EQ2A 2FO4B 4U6HA 2JB6A 2Y5TB 3EFFB 3QT2A 3HUJB 5JUEL 3DO3A 3QHFH 5CILL 5A2KH 3MNZA 1MRDL 4NZRL 5KS9B 1S7VA 4IRJC 3V6OC 2ATKB 4TYUA 4X80L 1JNHA 3LEYH 4UV7L 3M8OL 1AHWA 4LRIA 1FL3B 4PRDB 3OJMB 1U8QA 2E9WA 5B38B 4I4WA 5KBNC 1NL0H 1A7PH 4I3RH 1G9ML 1MFEL 4GOSA 3MV7E 1OL0A 4OQTH 3M07A 2VXVH 4XXDB 4Z18A 3WJLC 3EO0B 3UC0H 1DEDA 1BMGA 1U8PA 2V2XA 2VLRA 3QFJD 5GS0C 2CGRH 5DJ6B 1E4XI 4OLXL 4ZDHB 3MV8A 5IB5A 4I9WD 4LSVL 2EXWD 4KK9C 3OAUL 4QGTA 1DQMH 3VXUD 4CGTA 3FO1A 3FTGA 4NM4L 4Y4HC 3RPKA 1YMHB 1XIWD 2HT3D 2F58L 1EPFA 1PQZA 1I3VA 3R8QA 1WBZB 2H32B 1JPFA 2NY5H 5GS0H 2JJTA 4LQFH 3JV6A 3JV4B 3WXWL 4K71C 2OMNA 5DTFA 3VW3H 2WUBL 4HFUL 2EH7L 3OXRB 5D1XC 3HC4H 1JPSL 4CU6A 1LDPL 1T1WB 5J06A 4IMLB 2UVFA 4FQJL 4KKNA 5J12C 2P43B 4GAYB 4OCWL 3JWDC 2HLAA 1OVZA 2YPVL 1NLDL 4AIXA 1FPTL 4WU5B 3EDJA 4ZPTB 3RWGB 1EAJA 4KZDH 3MRRB 3LHPL 5F7YC 4M03A 2SEBB 3B3IA 5E5RB 3MLRL 4TSCL 3PQYB 4M5YH 4YHOH 2ZSVB 3KPNB 2VE6B 2PXYA 4G8EB 2H6PA 1QLEL 2YBRB 4M48L 4K7FA 4HS6A 1O5DT 5DQJB 3P11L 4Z7NE 3WN5A 3BSZH 1CS6A 2ICWA 3BQUB 2GTZB 3VDAA 3ZE2F 5GIRB 2A73A 3OKMB 4U7SA 3WIHH 3T8XB 1J0KA 3D39E 3ZYJA 5B39G 1T22A 3U0WL 4OFKA 3IAGC 3WUWB 3RJDA 2NTSP 3U4BL 3CXHK 4IOFD 4NKMB 1G7LB 4XWGH 3UJIH 3QNZB 3SCMC 4DFIA 1DQDH 3P4NB 3NBNA 3GGWB 2R8SL 2BVPB 5JUEH 5LGJA 1AI1L 4PTTB 2APXA 4MXWL 5DJ2A 5BRZB 4ZXBD 2EYSB 4HCRA 3HR5B 4PUBH 1NCBL 4JFEB 1PDKA 1R5VA 4HS3A 5K9JL 4CMHC 1WWCA 2HFGL 3P0VL 2V2TB 2OMBA 4Y4FA 5BZWB 3UTOA 1A1OB 1P7KB 4POZD 3BZEB 1U3HD 4M8QB 1Q1JL 1J05B 2A6IB 4DTGH 1G9MH 1OAQH 4ALAL 5IBLD 4W6YB 1WAAF 4YX2L 2UVEA 3L3JB 2LAAA 3HG1A 1GC1L 4TSBH 3QDJD 2EDYA 4M00A 1CGSL 1RZJL 4XCEB 2YUVA 3KLDA 3RKPA 4J4PA 2EO1A 4G8GB 1RK0B 1XFPA 4MZ3A 4M61B 1JGLH 4IEFB 2X4RA 3NH7H 4GLRH 7FABL 4PJBF 3ZDZF 4U6YA 5ESVB 4RAUB 1W72H 4NQDD 4S1SL 3S4SA 5HDBE 1GOHA 1WV7T 5T3ZD 1TTUA 5D7KD 4YUEL 1EVTC 3LD8C 5EZLB 5K59E 4O5LH 1CD8A 2YSSA 3B9VA 4H26B 3V52H 4LLMA 4OF0A 2F53D 3SQOH 3OKNB 3CUPB 5CJ5A 4G3YL 1F90H 3IDUA 3WE6A 5E5UB 3G5XB 3GSOB 3HC4L 2AV7A 1CDUA 2W9DL 1CF8L 2W59A 5ITFA 1MCSA 1AQKH 2ZUQC 1GC1C 2KBGA 1Q72L 4POYA 4QEGA 5FYLL 2YPVH 1M6OB 3WUZA 4NZUH 1ZLUK 1R5IA 5C0RL 5IBTH 3ZE0E 3BN3B 3BEWB 3E6FA 2G9HA 1FVDA 4JDZA 2V5YA 4N0YH 4DAGL 1YEJL 3RNQA 3KS0H 4HX1B 4XP4H 5J6HA 3X13A 2HN7A 1TQBC 2R0LL 1ZVYA 3ZHDA 4R4BB 1HCFX 3Q6FA 4XNZC 1LEGB 5KSAA 1P1ZB 5KANG 1OAUH 1HQ4A 3MYJA 3S37L 4X6EA 1NLBL 4ODHL 5I1LA 2GQHA 1TQCC 3P0GB 4PJHE 2GCYA 5I17A 1AJ7L 2CLRA 3FQUA 5IQ9B 4LLQA 1KPRB 4EOWH 3OR7B 4KAQL 4CJ0A 5CP3A 2IWGA 3ZMRA 2Z31B 2EYRA 4PJ5B 4V1DE 2H8PA 4EXPX 3PWPB 4EQ3A 2R8SH 1OLLA 5EA0L 2X4UA 4HW6A 1MFCH 3KYOA 1YEEL 1R0AH 3REWA 3TZVA 5F9JA 3VFTA 3IDXL 1Z0NA 5DC4B 1LEIB 2DMCA 4H88L 1R5WA 1JTOA 1S7TB 4MYWB 5DWUH 5INDA 4H0GA 3QDGB 4PJ7B 4N0UB 1A1NA 4CVZA 2E27H 1QYGL 5FAAA 5C0DA 5EU3A 1MJUH 3ARFB 1ZSDA 3QEQE 5TGBB 4U2ZA 1C1EH 5F6IC 4D9QE 2LAGB 3F8UB 1X5KA 1T20A 2QADC 3MRCB 5JIPA 3SKJL 2C7UA 1J87A 3KYAA 2W9EL 4BSWA 4XPBH 4FFVC 1D5XA 4LASH 1M71B 5GRVK 5D6DC 2ZUWA 4GKZB 5DQ9A 3V0VB 2Q7YB 4NQUA 3VXPB 5A3IC 2MNUA 3BZ4B 1FGNL 1M05B 2PTTA 5E08H 3GMOA 3H7BB 1YNLH 2IH3A 4L4VE 2NY7H 3RUGB 3HCVB 3OZ9H 4HC1L 1UVQB 5AZEL 3RBSA 4MDIB 1QBLL 4NNPH 5EBMA 1KV3A 4MDIA 5GSRB 1EGJH 2J4WL 2UZIH 2R69L 4LAJH 2Q86A 3MLUL 1Q72H 3H9SD 2VITA 3MLXL 4FQXB 4J1UB 4R4NC 1QR1B 1OGAA 3RWIA 5FYLH 3DSFL 1EUTA 4IM8A 3SE8H 4MA3B 3BXNA 1KELL 3WJJC 3UBXI 4BYHA 3EHBD 4NM8H 5FO7A 1ZT1B 4OFDA 5DO2D 3HPLA 1D5XB 1MJJA 5FGCB 1TETL 2AJVL 4DN3L 1MJ8L 4Y16D 2F5AL 5F7EL 4M7LL 4J7RA 4WTXA 1EH9A 5FUOL 3VFNB 1S9KC 4L3EE 4WI2A 3KPSE 3HI6H 4P49A 3I50H 1SYSB 4TTDC 3WHE1 4HKBB 5I2IA 5JOPD 4HIIA 2ZOLA 5E5MB 4P3CH 5JMRA 2A0LC 4HWEH 1WFNA 2PW1B 1C5CH 3V0AC 3O0RL 2YRPA 3HUJF 1S7TA 5CSZB 2HKFL 4OCMC 1YEGL 2UWEE 1FO0B 1MWAA 2VDMH 5D2LA 5T33L 1NMAH 5IEKB 4JFOB 4PJBA 4PJ5A 3N85H 2Z31A 4YNYB 5BOZG 4HPYL 3K7UA 3FT4B 1IC5L 4JFDE 3B2VL 15C8L 2CDFA 4XPFH 4PV8A 2CLRB 1EEZA 2PN5A 1H8OA 2QQNL 4NZJA 3ZE1E 5GS2D 3TNMA 2CIKB 2H3NB 1LEGA 2E7HA 4PB0L 5TQ0L 5IV2B 5DUML 2QL1A 2LU7A 1UKQA 1LE5B 2DIBA 4KTYA 2EO9A 2RCSL 1DQLL 4LSPL 3LN4B 1YEFL 5EU4A 3RGVD 4JDZB 4HG4J 5HBBA 3BIBX 2AJYH 2Y25A 1V3MA 4KKAC 1CE1H 4XAWH 5C0EB 5IB2A 1UWEH 3B6SA 1FDLL 1NFKA 5D7LA 4ELMA 5D1XB 1ROWA 1JZ7A 2IBZY 3GSQA 2EEDA 3NAAL 1T3FB 4KK6D 1JNJA 5D5MF 3ZYIA 1T1YB 3CUPA 2GITB 4PRBA 4YHLH 4LKCB 1HXYB 3FB8A 2V17H 2A74B 2J4WH 1SJHA 1DUZA 4NHUB 3PHSA 1RHHB 3WNOA 3AXLA 3GSUB 4LLWA 1KJ2L 5DS8A 3MLUH 1NGXA 2FEDC 3MLXH 3QEUB 4XHQA 1G9NH 2K9UA 4HHAA 1OSZB 4PBVC 3X11B 5I1AA 2KPNA 4Y4FD 3U7YL 3HMWH 4WI7A 5D7LE 3MMEA 3T0EE 5T1KB 1A0QH 1FE8H 3ECBB 3K8MA 3OF6D 1AO7D 5I66A 3QUXD 3RTQC 3QA3B 4M61A 4POZC 2Y9RT 2F5AH 3LMJH 5E2WL 1AKJB 4MX7B 3CC5B 3ULUE 1FVCA 2VAAA 2GI7A 4G8IA 3EOAB 4GUPA 4ODVL 3HG1B 4G43A 1TCMA 1C5DB 2N7AA 1XGYL 3I50L 3U7WL 1IAOB 5KSAD 3MRDB 4OB5H 3EOAA 3GBLA 5JPNA 3WFHB 2B5IC 3BW9B 2ZUVA 1A21A 1J8HE 4BQ9A 5BRZA 4LSUH 4U6TA 1IAKA 1J88A 3Q48A 3PDOB 3O6LL 1NBYB 3AUVA 4JG1H 1H3GA 5ICZA 3Q5OA 5J11C 3GEWB 1FYTD 1S7QB 3QNZA 1DN2A 4PY7A 2N4IA 3U9UB 4UT9H 5JQ6H 2WW8A 5SV3A 3QEUA 1I7RA 1JWUA 1NDGB 3D87B 3GMLB 3BPNC 1EEUA 1K5NB 3WIHA 3DV6B 2AV1A 2B39A 3LV3B 4GO6B 1KTKE 4MHHG 4NQSB 2CUHA 3DXAB 4WHTB 3IDJB 3L5IA 3MOAH 4P2OC 1W8OA 1IMHC 3DTXB 4ZXBA 1NH6A 4NRYA 3VWJC 1MF2L 1MNUH 1IBGH 2MPAL 3NCMA 3GKWH 2DQFA 2R56L 4LARH 1FFNB 3TM6A 2I24N 4JFPA 3N1PC 4OLWH 2FX9L 1VENA 1TNMA 4Q2ZA 3HMXA 4R2GD 4M93B 4TOYH 2NY3D 5B39A 3HZVA 3VGFA 1B2WL 4FZ8L 2DQCH 2E9BA 1P4IL 1F3RB 1KPVB 4J4PD 4F8QA 4RSVA 1AC0A 4H1LB 4KC3B 4RX4D 1J10A 3S96B 1BBDH 4JHWL 5DTFB 4FFVD 4NQVA 2YPLB 4L8BB 4YAQB 4KVCH 2V17L 4LBEB 1I8IA 2ZPKL 3NIFE 4RGMC 4UTAH 1DN0B 3LQAL 1CIDA 5C9JA 3WFCH 2YUZA 1OAKL 1H3WM 1U8LB 4IBLT 4NFDA 5IK3A 5I1KL 1NCTA 3FO1B 1TLKA 2AEIT 2VLJA 5TDNA 1G9NL 2GJZB 2WQ8A 2YUWA 3TA3D 3HE7B 4OIIL 5EBWB 4G80A 5F7KC 5J1AB 5HDBF 4UDTA 3BP5A 3I3BA 4FQLL 4NWUH 4NUJB 4U1SB 3GIZH 5EOCH 1YC8A 4OKDA 1D7FA 2H2SD 4R4FH 5HYJD 1P53A 4LSSH 4NWTH 3PXHA 4DVBB 5BZDB 3L3HA 5BO1L 4LGPB 4R4ND 3I6KB 3IAQA 1INDL 1Z9OA 1BQUA 4KGLA 3QO0B 1XGYH 3ISWA 2BXZA 1NFDA 4M02A 1OCWH 1FL3A 4ODWA 2DLEA 1A8JH 4LLVA 3U0TB 1YPZE 3LQAC 2QLVB 1EEYB 2OLDA 2QHRL 3FFCE 5C6PB 1PY4A 5HHXH 3CX5K 4CMHB 4W4NA 5F6HJ 1KTDA 2IALA 1J5OL 1RFDH 2W07A 4MVBD 4HWNA 4D9LL 1B0GA 1FL6B 3WLWC 3U46B 3M45A 4JRWA 4FABL 4TVPD 4DW2L 2BVEA 3FQWB 1DL7L 2IF7A 2VOTA 2Z93A 3U83A 1QFUL 3JUYA 4TSAL 3L6FA 5E94B 4PD4J 1FFRA 5HPMA 4HCRH 1LP9F 4OCXH 3VXMA 3JTSB 4XPGH 2FD6L 2WP3T 3S36X 1ZANL 1H15B 3G08B 3CDFA 4FQHB 4OLUH 3JZ7A 1H8NA 1EIBA 5C0CE 5C0FA 2VDPH 4RMSA 1F45A 3G6JA 4C55A 3R1GL 2W65A 4YHPA 4AJ0A 2MPAH 3AMKA 4O58L 3FRUB 2IH3B 2R2CA 3GDBA 5I75B 2F19L 3LKNB 1GPOH 2OTWA 4NJ9L 1RHFA 1CGXA 4TNVF 1TJGL 2P5WD 5EUOE 2DLIA 5ANMB 1KCUH 1MHEB 2ICWI 1MREL 4MAUL 2BOBB 1YUHA 3MJ7A 3KLAB 3VFWB 4MA8H 2A77L 1OARH 1BFSA 4YDLC 5IEHA 3SN6N 1NCDL 1FJ1A 1ZA6A 4C56B 5IROC 2NY1C 1Q9OB 4XP6H 2EKSA 1T66D 3QDJE 2FH8A 1ZSDB 2DI8A 3U36B 3VWKA 3AS0A 1M7IB 3TT3L 5C0IA 3LVEA 2D0GA 5EO9B 3WLBA 5L0QB 3QXVA 2NPLX 4QTHB 5JDJA 1I1AC 1H3VA 1EHAA 3W0WB 5JPMA 1JP5A 3PF2A 1CR9H 4UINL 3KJ4B 1KOAA 2DQTL 4LEXH 3AGVA 1MVUB 4F7TB 5AAWA 1VGEH 1WT5C 3W5MA 3S9DB 3ZKNC 4JO4L 1G7IA 1JZ2A 1NMCC 2EYRB 3GBNH 3SE3C 1NCCL 2EEBA 3PWLB 2R4RH 5MI0B 4XRCB 2GJ6B 5F21B 4DKDC 5DSCB 4EI5C 1U8NB 1D9KB 4KPHH 4LLQB 2EXYD 1I8LA 3GSVA 1UT9A 1HH9A 1H8SA 4YXLL 3F7RA 1NBQA 1BGXL 5C0JB 5E99L 2KZWA 3RVXD 1LO4L 5M95B 2RHEA 4BFEA 1GL4B 4OCNC 4DVRH 2L4OA 5HTSA 3ULUH 2DQHL 5FA4B 1FVDB 2G9HB 4XB8A 1BQLL 1A64A 2MHAA 3O4LE 1JI2A 1ACYL 1TXKA 5BOPA 4O2FB 5JDSB 4TULH 4P3DB 4Y4KB 3RNKB 3FB5A 1B9ZA 4N90E 3FT3B 4RDQG 1SMAA 3DUHA 1RSFA 3NFPA 5BW7A 3MPCA 3EJZD 3ULUC 2DBLH 3ARBC 4X7DC 4OZHF 5MEOA 5T1MB 2AXFA 5A2LH 1S7SA 4PJAA 5DMGD 4Z0BL 5MENA 2VDPL 2CKBH 2YSSB 4JN2A 1AH1A 1FYHB 3ZYOA 3FL7A 1KN4H 4CVXA 1MUJA 4R3SA 3V9FA 1OM3L 2DQDH 4PV8B 1EUUA 1KENH 3TO2B 1U41A 1AE6L 3V6FB 3BN9C 2YR3A 1VFAA 3L9RA 5E2VL 4L9LA 1GYAA 1BD2D 4MS8C 4XCYA 4OZGA 5HHOB 3CDYA 2A77H 4BQ8A 2D7TH 2RBLA 1HINL 4NN7C 3QWQB 1E4KA 5DURD 1TITA 2UWEB 5I1HL 4PGZA 3O9WD 2HWZL 3G6DH 2EIZB 2W91A 4Z7WA 5EFIA 5DXWA 2IANA 4FG6C 2A6IA 5DZNA 3I2CL 1W8NA 2VRAA 4HUNB 1F00I 3TT3H 3HHRB 1JK8A 3ET9F 5F44A 3SKMA 1NUGA 3MLVL 4P9ML 4ZFGL 1SYVB 2YA1A 5M7QA 3PG2A 2EDBA 3VGAC 1FYTE 5HHQA 4OV5B 3EUUA 3LH2L 1S8DA 2CMRL 4ZSOB 1TCRB 3PDDA 4JJHA 1ZTXH 1SVZA 3JVGA 4KV5F 1E4WH 3WJJA 2FYYA 3GBNL 4POUB 5SWSB 3OKEA 3SDAA 5L2KB 1KC5L 2LTQB 4ZTPH 2X9YA 5D7SL 4A2LA 1YYLL 5K9QG 1IAIH 5DEGB 4LPCA 2KDGA 2VERN 3DGGB 5D9SB 1T22B 4RZCA 5JA8B 4H8WH 4DZ8A 1HHHB 3MRJB 4R26L 3WFZA 2XOTA 4X6FA 4N8CH 3BPNB 5EZOH 4YXLH 3OAYK 4ENEC 1EMTL 3H42L 3OGOE 1J0YA 2NXZB 5JOFA 4JN1H 4J23A 4U1IA 2VLKD 4GXVL 1A6AA 1B0RA 1OAYL 3VRLF 3BRGC 3W2DH 5DQDH 3ES6B 3MACH 1BQHB 2ZSVA 4I77L 3HZYA 3HCVA 1UXWB 3CXDH 5MEQB 3NIGE 3VFRA 4QOKE 4KI5C 1GZQB 1Q9KB 1NGWA 2Y23A 1XF2A 3TV3H 4BKLB 2ID5A 4RWYH 4PJFA 1TENA 5HGBA 1IVLA 1WWWX 5DQ9B 1HH6B 2OX5A 1B4RA 2PF6A 3QI9B 1WCBB 5HDLA 5D7KE 3UBXG 3CCHB 2ADJA 5L88H 4MVBC 1FG2A 1UCTA 4Z0BH 5CJ8A 2M1KA 4UTBH 4ODUB 2Q8BH 1MCFA 5C2BH 3GUTA 5AEAA 3REVA 2CO6B 3TPKA 5A40E 4JHAH 5EU3B 2I5YL 4HQQH 4PG2A 5C07B 4KTDL 4QXUL 4R2GB 4R7DB 1X5IA 3SDDA 1JWSB 1JFQH 4QOKB 1YN7B 4M7KH 2J3SA 5INDB 4PBXA 5EZIL 1AP2B 1KYOJ 1JTPA 1FNFA 4NNXA 5E2TH 1JV5A 1PG7H 3SCMB 1A47A 4P5MA 4H0IA 5EH1A 2D7TL 5E8EB 4CMMB 1A6UL 3PWJA 4FQXD 4JDVA 1MQ8A 1RMFL 3R06A 3GSXB 1EX0A 4XP1H 1NC2A 4JPIB 4MSWB 3V5HA 2I27N 1ZLSH 1MFAH 1AHWB 2AW2A 5GGVL 4N5ED 3GI9L 4ZFOB 5I6XB 5J8OA 2C3XA 4YC2C 4F33A 3I3EA 4AENB 1UA6H 4WGWB 4KK9D 4PJCF 1KPUB 3OKDB 1NAML 3C60B 3QUMB 3EYQD 5CKAA 3I6LE 4JKKA 1A9BB 4LPUA 1X5FA 4HGWA 3HLAB 4F7PA 4HGWB 2VLJD 2ARJQ 4YFEA 4HXAH 1N3NA 3CFCH 3UZVB 3WS3A 3QUMA 3C60A 3OSKA 4WTZG 3BJ91 5F7UA 5GSVA 3WNMA 4BM7A 4HMEA 3P40A 2ITCB 2QSCH 3VGHA 1S7RB 3BKJL 5ALCL 2R2BB 2P49B 4OI8A 2ESVD 5JZ7D 3DMMD 3X3FH 2GT9B 5E1AA 1IARB 4RGNC 5DJYA 4RFEB 4ZODA 3G6AB 1RZJC 3CGTA 4G6JH 4WI3A 1QFWI 4BZ2L 3R06B 2NW2B 3JWOH 1L6XA 8FABB 5H94B 1TJIL 3IXTB 2XPGB 4RISL 4I5BA 1WEJL 5HSFA 5EPMA 4EKXA 2F5BH 1I7ZB 2DL9A 2VNCA 5E8EA 2CK0H 4OFYD 4JQXC 1C16B 4LCCB 4OFVA 5I73C 4HGMA 4NNXB 3HI1B 1T83A 2PUQT 5E4EC 5CJBA 1NCUA 3KAAA 1WVZA 3QIUD 5JOPE 2BNRD 4AQOA 2XZQH 2B2XL 1N64L 2DICA 4KRPC 2X1QA 3FT2A 2K7QA 2KL6A 3OF6A 5SWZA 1OPGH 2DM7A 1A7QL 2VH5H 4PJIE 5FV1L 1B0WA 2ZNXA 3K2UH 2I5YH 4HQQL 4L3EB 2YKLH 2QV2A 2EYTB 4LRNL 3RKDD 4X9GA 3HAEA 3MLZH 5F9DC 2EEAA 3RIFK 2XZCH 3F6LA 4GKSA 4KXZI 4M7KL 4S1RH 5AD0B 3GBML 1HYSC 5HYSA 1EO5A 3T1WA 1IGIH 1J86A 1JGVL 1LK2A 4NO0D 2NZIA 2EH8L 4C56D 3IFPB 2NMSA 1P84K 4X4XB 3L1OH 3PDGA 4FFWC 4JKPL 5FF6B 4L8SB 2P8LB 2BVPA 1MCOH 4UBDD 2BSTB 2UUDH 3ZT7A 1XF2B 1HSAB 1NGWB 1QFWM 3QI9C 4O02L 4E5XB 5ISZB 2ORBL 2VZ3A 1X5JA 4K7PL 5FXCH 3HE6B 2PYED 4W81A 4NQCA 3A67L 5KVDL 5CILH 2BZDA 2IAND 2P5ED 4GBXA 4P9HH 3IGAA 1MCDA 1RIUH 3BUTA 4U1IB 4OZIE 2E8YA 3LS5L 1BJ1H 3VGBA 1T0NA 3H7LA 2BNQA 5D7JC 4X80H 3MC0A 5EC2B 4X6FB 3WL9A 3M8OH 2IADA 2VDLL 5SX5H 3IU3A 4X8JA 3OGCB 3KPNA 2I9TA 1T89C 5I1DA 1MFEH 4PS4L 1KT2A 2IG2H 2AEQL 2RJMA 2BNRE 3VRLE 3C5ZB 3KPRB 2EDRA 5HY9A 4N8PA 1HIMH 5FO8B 2WV3A 4YDIL 4DOHE 5JIHA 4R7NB 2DTMH 4MD0B 4OV5A 4F58H 4GAGL 1FH5L 2DDQL 2BERA 3OKOA 3QFDB 3QIWB 4OLXH 2R0WL 4UU9B 3EGSA 4OZFA 1PZUB 1FNAA 2X1XR 1PKOA 4Z7QF 5D6CA 3GFUA 3JV4A 1MEXL 4OSUH 5A3ID 3UJJH 1BD2E 1NKRA 3E3QC 1YMHA 3FTGB 4JB9H 1ZGLB 4S1QH 1XR9B 2R1YA 4XVSL 4OGYH 3V79C 1HE7A 1A4JA 3RDTA 3QDJB 1IEAA 4PGBA 3SDYL 3QAZC 4HKZA 1QSED 5DJ6A 2DWEB 3U1SL 2HRPH 2OJZH 3TCXA 4KDWA 2WBJA 3V6FA 5L0QC 3CJJA 5K9OA 3KPRE 1F6AB 1DTUA 3CZJA 3VWJB 2EXYC 5D8JL 5DHYA 1P6AB 5LWYL 1ZHBB 2IAMA 4NHCH 3I75A 3NOIA 2W0FA 3BZFB 3TO4B 5H94A 2VSCA 1OPGL 4Z95H 4M7JH 4EN3D 1RVFL 3MLRH 4TSCH 5C0CB 3U6RA 3MCKA 1QQDB 3DUUB 4AT6A 1T21B 5EO0A 3QO1A 5ADOH 3BISA 4RNRA 1VFBB 3EDEA 4PGCA 2A1WL 5T1MA 3T77B 4HUXA 2F53B 2YPLD 3GI8L 2VWEE 3WKML 3NFPB 4WUKL 5EU6A 3QNXA 3EFDH 3RAJH 4XPTH 1MCOL 3EFFA 4O2FA 2Z91B 4LPYA 1SHMA 4JFHE 4ZTOH 1RPQA 4YFDB 1A6TA 5DJ8A 4KDVA 3S88H 5JLZA 5HHNA 1UACL 3VXQB 5EZJB 5CZXD 3ZE0F 1UYWL 1CFSA 4Z76A 1NC4A 4P9HL 3C09C 4FP8L 4PJIF 2WIIA 4LP4A 4UT7L 3ARSA 3T65B 5I8CB 1MFBL 1WCQA 1CFQB 1WF5A 5SWSD 1JNLH 5INCB 4NBXB 3VXMD 1S9WA 3HFMH 1Q9LB 5DJXA 5CZVL 2C4FT 4G8GE 3FB6B 1HCVA 3MREB 4UOW0 1CLCA 3VWKD 4TRPH 5D7IE 5TQ2H 3WUWG 5D1ZD 3DO7B 4KMQA 2D3VA 1Y18B 1CGSH 2HLFC 1YN6B 5JW5B 1A5FH 5IJVB 4OLVH 4WWKB 1YDPB 4GFTB 4L3AA 2Z35A 3CH8A 1AD0B 3TYGL 5MEND 5KVMC 1JGLL 3O9WC 5KN5B 4F58L 3QPXL 4M1DH 5EN2A 4A6YB 2NYYD 5EBLB 5E8OB 2DN7A 5I9QC 4MNGB 3IETA 5J9PA 1IQWL 1YN7A 3MGAA 4QOKA 5IVXF 1FCGA 1OP5K 1K6QH 2BXYA 1U3YA 4OSUL 3ROOB 5C0IB 5C9KA 1A6VL 1Q94A 3MRKA 1EFXB 4G6AC 3STLA 4YUEH 3HS0B 2YPLE 1I7TB 5E8DL 3KS0J 3NFNA 4XVSH 4WU7B 5ILTH 5BV7B 4G7YH 4F2MA 1N5YH 4F15B 4XTRD 4HDIB 3D39A 3F12A 4PLKC 1DBBL 4M1GH 1G7MB 2V9TA 4TNVK 3B9KB 4R0LC 3RX8A 2DD8H 3QUZB 3BMVA 1E28A 1TPXC 2YUXA 3IFOA 5FM8A 1ZT7B 3TBVB 3AM8C 3IYLW 1N2RA 4LHQB 3WD5L 3H9ZA 3N1MC 4XPHL 4NHCL 5ERWA 3VGAB 5ID1A 3MV8E 2A83B 5F7DA 4DEPC 4NO2A 2AK4B 5HI5D 1CXHA 2I9LA 1LE9A 4NQDE 4GG6E 5JXAH 4JY5L 3CZFB 4MQXC 4Z7VA 5DD6B 2O5YH 3G08A 1X5LA 3I6LD 1A6AB 4MWFB 2GY5A 4RGNE 1NMBH 1FSKC 4RIRA 1E4XH 1JYXA 4IJ3B 3RZCD 1UB6B 1ZA3B 3WKMH 1ORQA 1HKLL 1MIEL 2OL3H 3BIAX 3RY4A 3NZ8B 2YXFA 4AH2A 2QADD 4D3CL 2BVYA 3LAFA 4OFIA 3L3OA 3HAEH 4LVHB 1RZGB 4X0KA 3T4AB 4NRXB 1YEIL 2IALB 3FO2A 4TUOB 2EDWA 1BIHA 1U93A 4GSDL 3QHFL 3EYVB 1WQVT 4PR5A 4ORGA 4Q6IC 4BH7B 5T5FL 3GHEL 1LO5A 1J0IA 2I60H 3QCTL 1FZOA 4AM0B 2IMMA 4P46D 4U2YA 4EUPA 1NUNB 1YMME 4HKJA 3QCUL 4FQ1L 3C60D 1E6OH 1SYVA 3BQUD 5CD5C 1BOGB 1MFBH 3BD5A 4RX4A 1J18A 1MCQA 1X6NA 2GJ6D 3LEYL 3DWTA 4N0FB 4UV7H 4XPAH 3CK0L 4N0CD 1OQOA 3DIFA 5F89A 2IBZX 5HYQA 1T04B 4DQOL 3D9AH 3O4OB 4OCYL 3BT2H 4S10A 5HJ3B 5JHLH 3NFSH 2VXVL 1UADC 5BVJB 3ZDXE 5CINL 1BD2A 2DM2A 5BRZD 3OPZL 5SX5K 3D48R 5DRZB 3QRFM 4AEEA 1D3CA 5JXED 4H20L 2EDLA 3JV5A 4BUGA 4I2XB 3OJDB 3UBXA 3V6BR 2AI0L 4GW4A 4OZHE 5D70L 1XCQB 4GW1A 1BP3B 1ORSA 4KROD 4Z77B 1QLFA 1IC1A 4LSRL 2QR0A 3FKUS 4CVXB 3UTZB 2AKRA 5E7BA 5E8DH 2MQ0A 1CXFA 4JFQA 1DLFL 1IL1A 1BX2A 2NX5B 4FFYH 3C8KB 5EWIH 1I8KB 4J12A 4LQFL 2X7LA 4G7YL 2DQUH 1KACB 2Y06H 4FA8A 1KPVA 1F3DH 4JREC 5FYJE 3IVKB 2J8UB 1FIGH 2VLKA 4JZJC 4GRLB 3HZVB 3L7FA 5KW9L 3BPOC 3LKPA 5E8PA 1LDPH 2PYEE 1WAAE 3T3ME 2ZCKH 3L5XH 3O8XD 4KJYA 3TNNB 4AEFA 3INUH 3DSFH 3UTPE 3X17A 1F4XL 3QRGL 2QJDA 3R4DA 4NQED 1JHLH 2NY4C 3SDAD 5FA4A 9CGTA 2E8ZA 1EAPB 3BHBB 1QR4A 4JO2H 1X5YA 2EE2A 5FGBA 35C8L 1G6VK 2JB5L 4RMRA 3BRFA 5IB4B 1TPXB 1Q0YH 1K5NA 4XC1L 5CEZE 3EYFB 1JPTH 1C12B 3T04D 5DVNA 3L3KA 3NMEA 2JELL 5ISZD 3WIHL 1EO8H 4OT1L 1ZEAH 2G2RB 1U8NA 4PY7B 4XBEH 4Y5YA 5LAXB 4X6DB 2PYEB 1HHKB 4NC0B 4M5ZL 4R6UA 3U4BH 4KY1H 1EFQA 3KPSB 5F96H 2HKFH 1D5BA 1A6WL 4YHIB 5DEZA 5C08B 3Q3GB 5IFHH 3MOBL 2VDRH 1WFTA 1CLYH 4F7TA 1AI1H 3V0WH 2ZG1A 5KSBF 2VLLB 3C60C 4PREA 3MRNA 1CFVL 3PL6D 5K9JH 4NGHL 4OZGF 4F7MA 5I71C 3LPFA 4LVEA 3G5VA 2BSRA 1C5DA 5CIPH 2VQ1B 1JGUL 3MRNB 3VXSE 2DLTA 4I2XE 3CIQA 2AJUH 2Z31D 3NFSL 4GG8A 3Q3GA 3SOBH 3WXVL 5E56A 1DUYB 3HNTL 4OCRL 4P9HC 1ZXQA 5CINH 4Z7UE 2RR3A 5IFJA 3EYQC 5IEHB 1FN4A 1YQ2A 3OPZH 2R1XB 4BK4A 1FZMA 5CEXA 5HVHC 3MJ7B 1YUHB 2BOBA 3NZHL 5DHXB 4M62H 1FYTB 1NL0L 2ADIA 4I3RL 5FKAB 3AXLB 1KCSL 2EECA 3ARDB 3BE1H 1DUZB 4ZFFB 1PSKH 4Y2DB 1HDMB 4ZUWB 5C7XH 3RJQB 4X7FC 3DGCR 3EO1B 2CDEB 2H1PL 3QH3A 1UC6A 3DXAD 3MGTB 5FECB 4FQHA 5C0FB 1F90L 2ED7A 5D7IB 5E2JA 4DGIH 2E7LC 2QEJA 3UBXB 4P2QE 4HV8B 1DFBL 1INEL 5F7NC 2VDOH 3QQ9D 5C0EA 4X99B 1H3XA 1CE6A 2AP2A 2X89A 1I75A 3TNNA 2Z93B 5C1MB 4GKNB 2YD7A 4QHUB 3CLEH 2E9IA 3SDXA 3L7FB 3U7YH 1UCBH 3BPCA 3LN4A 3NIFF 3WFEH 1A0QL 2XWBB 5E6IB 3WS6C 4KU1A 3WNKA 1MCEA 3RGVA 1UXSA 3SKNA 4P2QB 3T0VA 4OD1H 3ARBB 2NY2C 2CSPA 4L5FL 4DGVH 3MRQA 1GHFH 5KVGH 3SCMD 1G7QA 1T4KA 1QBBA 3TNMB 4LLVB 4W68A 3C08H 3V7MA 1IT9H 5F7HA 1ZKAA 4Z77A 1I7UA 1MHHA 4HKXB 4F8TA 2NLJA 4NFBA 1CDJA 5DMJB 1P7QA 1U8JA 4FZEL 4FN0A 1RULL 4LSTL 1JPGA 4M5YL 2DM4A 1RZGA 4X0KB 5F72S 3T4AA 5IEKA 4HWBA 2CKBB 5E9DB 3IAPA 1VADA 3O2VL 4M9PA 4M48H 4PLOB 4E0RB 3MLTB 3MOBH 2VDRL 2VUYA 5JNYB 5FHAL 4DWHA 1UM5H 2DMBA 4JG1L 3RKDC 4JRYA 3HE7A 3P9WB 5EBWA 3K46A 5J1AA 4QRRB 1J0HA 4OZ4A 2VLJB 4UQ2A 1VPOL 4O00A 1MCKA 3ZT6A 3MO1B 3KYNA 2E27L 2EC8A 2P5WA 3UJIL 2FBOJ 1K8DB 4IHOB 5T1LD 1CN4A 3VFNA 3VU2A 1TNNA 5F88A 1XF4B 2HH0H 1LP9B 2FGWH 4X98B 3VXUA 4DKAA 3MOAL 1KBGH 3ARBA 2GSGA 2WWMD 4H1LA 3HNTH 4OCRH 4OUUA 1NCBH 4OGAD 1BZ7B 2BSSB 1CD0A 1ZT1A 1EHNA 3B9KC 3V4PH 1A1MA 2XFXA 2EDTA 2OTPA 3G9AB 4DOHB 1ADQH 3CVIL 1NAMA 4HDIA 2XTJD 4O2CA 5GGRA 2E7MA 2VITB 4YX2H 2NY4B 3JXAA 1ZA3A 1UB6A 1FZJA 1G7PB 3BH9B 5D1QB 3CPLB 3KXFB 3QAZB 1P4IH 1INQA 3I9GL 3QZWA 1UVQA 3RWFB 4XBGA 4Z7VF 25C8L 4QRPB 4P99A 7FABH 4RMTA 1G7JA 3B9KD 1VKXB 3FFDB 3EOBB 4NO2B 3V4UL 3VI4E 4D8PB 3WO4B 2AV1B 3C6LD 3MA7A 5GGRY 3WFCL 5H8DA 3VXPA 1LP9E 3OKYA 2ADIB 3K8KA 1CG9B 5CHNB 5CWSB 3ALPA 2J6EL 4Y2DC 3VFVA 4IRSA 4X9IA 1CGUA 5ICZB 3KPLA 4HS8L 2ADGB 3STZA 1T2QL 4YHML 2FRGP 1UJ3C 3ILQD 3SQOL 2DF3A 1NCAH 3QXDA 2MQCA 4EDXA 2XTLA 3NFNB 2HKHL 4Y5VB 1C5BL 3M1BB 3MV7B 1ZWIB 5I8CA 5IW3A 2J6EA 2OM5A 3C08L 4U05A 3QDHA 3STLB 1T03H 3MRKB 5D2LF 4JO3H 1EJ6A 4HT1H 1K4CA 1NC4B 1WICA 3PV6A 1L9NA 3OKKA 4MNGE 4ENED 5BRZE 2CJUH 4LDOB 5L7XL 3HE6C 1XGTB 3VFTB 4XZUB 3W0WD 1PW3A 2FHFA 1N0LA 2VTFA 1YDPA 4XP4L 4FQQA 4J3OC 1XMWA 2ZCLH 4AEIH 3MOQA 4KVNL 4PJ9C 1OAUL 5EU6B 3OR7A 4G8FB 1CCZA 3EJYC 3P0YH 4NDMB 1KJ2A 3HG1D 3S37X 5IQ9A 3GJEA 4E41E 4JANA 5IFAH 2AJXH 4YWGL 4XPFL 1QA9A 1P1ZA 2XKNB 5IW6A 4NHUA 5GZND 3RZCC 4Y4HA 2FD6H 4Z76B 1CWVA 3GRWL 2Q8AL 4X4MA 1KBGL 3BDXA 1Z2KA 3HPJA 3QNYA 3MRHB 4XWOC 4H25B 1NGZA 1U8KB 5A43C 1TJGH 2AJYL 3CVIH 4WO4C 1P9MC 2WBWB 3D3VE 5BVPH 2LU4A 1L0QA 5HVHB 1XR9A 5EU4B 3D69B 4P46C 1EERB 4KKBD 4BQ6A 2FIKB 5C0NC 3WE6B 1F4AA 2FZ3B 4QRTB 3F7PC 1TVBA 4OM1H 4XPBL 1QQDA 3DUUA 4XP6L 5ICYA 1IAMA 1V3JA 4LASL 4M7ZB 2B0SL 3MBED 4OZFB 5AYUH 5HGHA 3WFBL 3DLQR 3E6HA 2W0FB 3SPVB 3UZQA 1QKZL 1KJ2H 4A6YL 4EN3B 1XGPB 1G0DA 3W39A 5C0CD 5K9OB 2EIDA 3I3DA 4U6YB 4YNYA 4JFEE 1OLZA 1TIUA 3QJFB 1BD2B 4JQIL 3ZSSA 3LN9A 3IFLH 5AZ2H 4KI5D 1EGJL 1T6WA 1I1AB 3LMJL 5EUKB 2QSVA 1JE6A 1HQRB 4PJAF 3EZ8A 4G6KH 5KOVC 3MRMB 3N06B 4JO3L 4HKBA 1PG7W 4GKOA 4IRZH 5M94B 3LKOB 4WW2A 4NM8L 2D0HA 5EOCJ 3EGSB 1BOGA 4NQCB 5KZCB 1R5VB 4HS3B 3C6LA 1FL5A 1QO3A 2HAZA 4YPGA 4Y16A 4Y16C 4JR9L 3P4OB 5TE4H 1KJVA 4PR5B 4BH7A 3CVHH 5IMMB 3H9YA 1KIQB 5FF6A 4F37K 2E9JA 4ZYKB 1ZGLM 4Y4HD 1JF1B 3PIQA 3WDJA 5FDWA 4ZUVB 5CCKH 4LF3A 3MX0A 3UJTL 1QBMH 2AGJH 4F57H 1VACA 3NPSB 3IJSA 4I0PB 4NQEA 4YWGH 4Y5VC 4HUKB 1ORQB 4L8CB 4KKAD 1YEGH 4HC1A 2D7OA 3QQ4B 4K7FB 5GGSB 3HMXH 1X5AA 4G8EA 1D5IL 1F6FB 3HI5L 5CP7B 3EO9H 2J88H 2M26A 5IJKC 4P3WA 4R0LA 1A7BA 5BQ7A 3B8SA 3UO1H 1MJ7H 3P9MA 4WUUA 2COQA 3B3IB 3LN5A 5F7WC 1A7RH 2ILLA 2H26B 2J2ZA 1HSAA 3ULUF 15C8H 4LCWA 3UXFA 3T3PF 2BVOA 4WHDA 4PRPD 2HT4D 1RUAH 4ODXA 2YK1L 4KH2A 4X4XA 1E6JH 4Y2DD 1TTFA 4XVJL 4BSVB 5SWSE 4XT1C 1KXVC 3E1F1 1URLA 3QFJA 4Y88A 3D39B 5AD0A 3QI9D 1IQDA 4P46A 4MMZC 3UROR 3L95A 2PTUA 2AK4E 1YC7A 5DJYB 1PQZB 5DLMH 1I3GL 5CBEB 2Q3ZA 2AABH 5SWZB 1NGQL 1CE1L 1CD9B 1XIWA 4AL8L 4A6YH 1XF5A 3D18A 1IGTB 3WS3B 4O51A 2RAMA 1K3IA 1N3NB 5JW4R 3CH1A 1GGCL 4Z7NF 1ZS8A 5D2LE 5GZOC 3GIZL 4I13B 1D6VL 3D3VB 1K2DA 3MFFA 2P8PA 4XNYH 2B4CL 4NNYA 3DVFA 1BVKB 3ALWA 4WEMB 1N5AB 3MYZA 3UMTA 4UNVA 2HTKD 3K74B 1EHLH 4WENB 1CK0H 3GSNL 2XQBH 3MA9L 3U2SB 4JKMA 4MD5B 4OF5A 2OBGA 2GT9A 3JVGC 2Y6SC 3H3PL 2ZSWA 4ZS7H 2R2BA 3V7AE 1S7RA 1S7VB 2YWZA 5E7FA 2ITCA 4JR9H 4NCC2 5IMLB 3OBAA 2HMID 3LSOB 3DUSA 1KFAH 2YD1A 3CVHL 4L4VB 4TN9A 1DQQA 2JB6B 1K2DB 5DR5H 4I77H 5IM7A 1IAIM 1VEMA 4BFIA 4LU5L 2GAZB 2NX5E 1RUMH 2A6DB 3O3DA 4LNRB 1UZ6F 3N1FC 2CIIB 2CD0A 3DURA 1CICC 1NJ9B 3O6FA 3RWJB 1D9KD 4QRUB 3UJTH 1XGRB 3ZDXF 3OKDA 1KPUA 1CLOH 3RWEA 3OKLA 1ZHLB 1OB1B 2BVUA 2F53A 3IS1X 4N0UE 3G5XA 1UM4H 2DBJA 3QDMB 1FBIH 3T4YA 2HJFA 1ZANH 4OLUL 3I84A 1RU9L 3IFNH 2Y07H 3AS3A 1T21A 1B3JA 5HHVL 4AT6B 3HNSH 1YYMH 4WFED 3HNVH 2VXQL 1JGDB 4ODSL 2I07B 3RDTC 1CBVH 1KCVH 3I75B 3BUYA 2Z31C 1KNOA 2VQTA 1JFQL 1FNSH 4XX1E 4ODXB 3VWJA 3HRZB 4HSQA 5D7JD 4ZSOE 3A6CL 4XNMA 3ESVF 5KG9B 1TZGL 4LCWB 4DK6A 1EO7A 2AQ3A 4FQIH 4L4TA 1AP2A 4PTUB 1GZQA 4YHYC 4LCIL 1FORL 1OARL 2X6MA 1KJMA 5DJDA 4U0RB 5ETUB 4LAQL 3TBSA 4GS7B 4N9GA 3V6ZB 1AGFB 5GGSA 2HVJB 2XKUA 4YGAB 4WO4D 4LIQL 4OLWL 5E4EB 3DETD 43C9B 4OM0L 1P84J 3AY4A 2JCCE 2WWKO 5F3BA 1ZLSL 3CSBA 3IJSB 4NQEB 1FG2B 4TOYL 4J3UA 5GRZA 3MRJA 4GXUM 5DMIH 5ENWA 3ME0A 3ETBF 3UTTD 4XGZB 3UYPA 4YZFE 3DGGA 5D9SA 5FDWB 1G1YA 5JORA 5FFLA 4R7NA 3CDGA 2EE6A 5FO9A 1OP9A 4ZOBA 5FO8A 5C0BB 2B4CH 4U0QB 3RVWC 2YD9A 4WCYH 1U8IA 1CK0L 32C2B 1P7QD 3GSNH 4W6XB 2IADB 1IC4H 4WW2B 2Y4SA 2DB8A 3O6KL 4WFEE 1IZJA 1WT5A 5JW3H 2D03H 3BP6B 4FQLH 5IVOA 5TDPA 3C2AH 5EFIB 1LO4H 4HS6B 1WISA 2AQ2A 4KQ4H 4N5EC 4MXQD 3SJVD 4MD4B 1I1AA 4DZ8B 2GTWB 4NQEE 3V6ZA 1DE4B 3QXAA 4P4RA 3CD4A 4MCYB 1INDH 3PQYA 1NFIA 3UX9B 5L2KD 4BZ2H 1BQLH 5DEGA 1A3LH 5I15L 4L4TB 1TJIH 4WFFD 1KB9K 2C3VA 1L6ZA 3C5JB 2Z9TA 2F5BL 4OZIF 3HRZA 4ZSOA 4L8SA 4GAYA 3DX8A 4V1DA 3KR3L 4J6RH 4CN1A 3TH3T 3RTQD 3W9DA 3TP4A 2G60L 1JGDA 4GAJH 3OXRA 2VLMD 1DZBA 3TLRA 3U9PH 3UTSE 4LVOC 3HAEB 2O93L 3LEVH 1WBZA 2H32A 5TF1H 4ZQKA 3PQYE 4X4ZA 1A7QH 2HRLA 5ITBH 2D7QA 4LCUB 5A1AA 4TSAH 5DO2C 3FFCB 3BX7C 4M1CD 2VZVA 5FA3B 2QBWA 4KI5E 4KDTC 3TBSB 3GM8A 3RA7H 1YMMD 4UOW1 4PG2C 3RWHB 3GBMH 1BIIB 2DRUA 1PEZA 4PP1D 1NGZB 2GJ6E 5IT2H 4LNRA 1MQKL 1RZKL 3WO4C 3HPJB 1DQQB 4XVTL 1I7ZA 4NKQB 4R3SB 3GSNB 2ZCHH 1CI5A 4Q9BA 2EDJA 3TFKD 1BBJB 2NR6D 3UTSA 2XKNA 5DI8A 2R4SH 1BEYH 4RFEA 3NACL 5T3XH 3TJHC 3PGCA 5GZOD 3MLVH 4P9MH 4P57A 4MA8L 3V7AG 2X09A 1FAIL 5CP3H 5ISZE 2K3TA 1NCDH 2ATKA 5F6IB 3S6CA 4XRCA 1ZHNB 5KSBA 5MERB 3P30H 5HDQL 2FO1A 1KEGH 1H0DA 4Z78B 2XG5A 1Y6NR 1RUKL 2VR9A 4AMKH 4K9EH 4NNYB 3QULA 2Y5TA 2FWOA 4YBLC 1MELA 1YJDL 3W81A 1BOYA 1R3IH 4F7PB 1EBAA 1IAIL 4KKLD 4MLSA 4K07A 4PJEA 3MJ8A 4WRLA 4ZAKD 3LKQB 2OL3A 5FOJA 5I8EB 1IGTA 4WDIA 5LJYH 1GGIH 5E9DD 2CLZB 3O6KH 4JM2A 5F9WC 1IEBB 1TZHB 4PJEE 1SJEA 3PHOA 2HG5B 3PJSA 2R0WH 4MNQE 4WY7L 3VXSD 4Y1AE 4Y5VA 3H6JA 1HH9B 3GSVB 3W2DL 3HC0B 3UTQB 5B3JF 3LEXB 3RVVC 1OTSD 4UQ3A 4DZBA 4OTXH 4IRSB 3SBWA 1MHEA 1ULVA 2P8PB 4P2RB 5DD5H 4E9LA 4PRIA 1NEUA 5FUZH 1MRCL 5MEPB 1IGCH 4WWKD 2BVOB 1UFUA 2OTWB 5DEFA 5EULV 3U1SH 3RL1A 4X83A 1FLRL 3FRUA 3BPOB 4X7CC 3ZKQD 1G7JB 1VKXA 1A3RL 5EO9A 5LWYH 4R0LB 1MY7A 1JHTB 1S9VA 3LEVL 2PCPA 3ZKND 5C2UB 1CU4L 1JZ3A 1OQXA 3U36A 2FATH 4HZAA 4LOUC 1ITCA 5IF0B 1TVDA 5ITBL 1AD9A 1QVOA 3FAXA 2NY4D 4TVPL 1T1XB 2EKSB 2NY3C 2FDBP 1I9JH 3ARFD 3L95B 5DGQA 4L8CA 1DBAL 3PWUA 4QY8A 2CQVA 3P77B 4WI5A 2DYPB 5GGRB 1PY9A 4MAYA 3QFJB 3U46A 3WV0A 4E41D 4LF3B 4PGEB 1IEHA 2W0LA 4FRWA 1IGJB 1MSPA 2YRLA 3EFDL 1WZMA 1KCRH 4HJ0D 1LMKA 3T1FA 1CQKA 1GAFH 1LP9A 2DQIH 3P4OA 3VXUB 3GO1L 3CMOH 3QUMH 4MNQD 3S88L 3U0PB 4IHOA 3TA3A 1AE6H 2CDGB 1PZ5A 4L3ED 2XG4A 1BEYL 4QTIL 3G6JF 3E8UL 1MFNA 3QQ4A 4RMQA 1K9TA 3AROA 1NBVL 1KCLA 3D3VD 1WTGT 4P5KB 1IKFH 3CLFH 3F58H 4KJPC 2E6QA 2ZUYA 1HI6A 4KWUA 1U42A 4JZJB 1BM3L 3O45A 1L7IL 1JPST 3MLTA 4E0RA 1YJDH 1Z6JT 5CIPA 4S11A 2X4SA 3SDDD 3KHQA 4HXAL 1KIQA 3GM0A 4QWWD 2FECL 1F4WL 3T0EA 1BJ1J 2XA8L 2GJZA 3O4OC 1DBJH 4K3EH 3VFOA 4W4OA 2OI9B 4F7EA 1RIVL 1U8LA 4Y16B 5IK3B 3QPXH 2JCCA 3RZCA 3FQTB 2CMRH 4NP4L 3MZGB 4DN4H 4WY7H 5IESH 1SBSL 3TCLB 3MLYH 4YAQA 4LEOB 4K8RD 1YY8B 3MROA 2UY6A 4Z0XA 3DPBA 1A6VH 4PB9L 4HGKC 1A7NH 1J8HA 2DAVA 1VEPA 4PRHD 5B39B 5EUKA 3C5ZD 3KPRD 3WN5C 3CNKA 3VXRD 3LKRA 4WEUD 3NA9L 2FR4B 2CK0L 1X7QA 4OIBA 1MRCH 4XH2A 5FUZL 4U1SA 5I19H 4GMSH 3BP5B 5JIIA 1MIMH 1OAYH 2XACC 1WLHA 5TDOA 1L0YA 43CAB 1J0JA 1CL7H 4J3WA 3MRHA 1S5IL 3RHWK 3TO2A 4OCWH 1I3UA 3W0WE 1VFUA 1M1SA 4XMPH 1FPTH 3E6HB 3FHAA 1CGTA 3BKCL 3SKUD 4JQXA 1CXKA 5BXFB 4NQVB 4OLYH 1NEZG 2APFA 5JXAL 4JY5H 3MLZL 5DK2A 4WFHD 4JFHD 3ZYZA 3GJEB 5LGHH 4UILH 1JGVH 1KB5H 2PO6A 4Z7OF 3VA2C 5CGMA 3NGBC 2R1XA 2VDQH 5EORH 3D0VA 1NBYA 3FT3A 4NQDB 2FECI 4QHMB 4G7VL 4PLKD 4IMKC 2IFFL 2IQ9L 3N1QC 3F6IA 4JM2C 1HEZB 3RBGA 4WTZA 1HXMB 4M7LT 2NCMA 1A14L 5F1NA 1RJYA 3LD8B 3GMPA 5EZIH 1CFNB 3O9WA 1LD9A 3G5VB 1ITBB 3IDJA 4MXWH 1IKNA 4ZO7A 2I60L 4OCSL 1RIUL 1NBVH 5I1IH 4K3DL 1P4LB 5FCSH 1ZWIA 3MV7A 3M17B 4JJ5A 3HZMA 5ELIA 3GMNA 4JY6A 5FM4A 4LLUB 4JPKH 3TFKC 4YHIA 3QIBD 2ADFL 1DJSA 2OTUA 3B4NA 4K94H 5F1SA 4DQOH 5TE6L 3QUZC 2MTPA 4YE4H 3RU8H 2NY6D 3LB6D 3GI9H 2HT3C 3VWKC 3VXUE 3DJ9A 4JHBA 3SKOA 2Z92A 5F9AC 3GHBH 3D0LA 1FRGL 3MV11 3SGDH 3MRDA 4D8PA 1SJHB 4DN4L 3G6JE 5FHBH 4TQEL 2A6KB 5CEZL 1IFHL 2IGFH 4JY4A 5SWQB 3BHBA 3T0ED 1K4CB 1CGVA 3RWFA 3UJJL 2QSTA 1N6UA 3VWKB 4UDUA 3S36L 5TFSH 4JB9L 3M1BA 5DUPH 4MCZA 4M3JA 2XIDA 4P59H 1YPZA 1HHIB 3FONA 2IAMD 5IMOB 3A6BH 1FV1B 1GIGH 1Z0MA 3L5WA 3PWPD 5CJXC 5I66B 2YD3A 3DVNB 3O6ML 1T7ZA 5FGBC 3MUJA 2BNQD 3D0VB 1OT1A 3X3FL 2HP4A 3ARYA 3VFVB 1KB5A 1MHCA 1S5IH 2BOCB 5DK0A 4HIEB 1EXUB 5FYKD 5I30L 3C8KA 2ZP0T 2BVTA 2ZJSL 4X6BB 1SQ2N 4MNQA 4JFQB 2V9QA 4LKCA 4PRBB 1GVIA 1JBJA 3F5WA 3D39D 3QZWB 1ORSB 2CDFB 4P2OD 4JPWH 4UQ2B 2P1YA 2ZUTA 3WJLA 2G5BA 5I1GH 1I1FA 2WLZA 2XRAH 2XZQL 3B6SB 2BFVH 5TDOB 1JHKH 4PJBB 1KTLA 2I26N 4L3CB 1S7UB 1X5ZA 3LZFL 4XP5L 1MCIA 1F4YH 4O2CB 4LOUD 1V7NL 3F65A 1EA9C 2VH5L 2OK0L 4PJDE 1G9EA 4NN7B 2BSSA 3T09A 3D6GA 1JPGB 3O3BB 4OQTA 5LGKA 3MV01 5E6ID 2EDOA 2VAJA 1SYSA 3SGDI 4X98A 1EEQA 4PJDF 3CFEB 5DJCA 2KQNA 4OCSH 3SDAC 4HKJB 1N6QL 4EUPB 3BH8A 4ODTL 1NFDB 3PHQA 5C09E 3BKMH 5GGVY 4OZ4B 1QRKA 3MRPB 5J3HC 2XN9D 4JFOA 3BPCB 3OXSA 1SMOA 1MCNA 5GJSH 3IU4L 5I74B 5B22A 5EOTB 3EYUH 1T80A 1XR8A 3UEZA 3HZKB 4FQXA 4J1UA 5J1SC 1QR1A 5I75C 1FNGA 3F7YB 4QO1A 1VFMA 2XT1B 5GGTH 1C8PA 1IQWH 4NSKB 4S2SA 1IFHH 4NJAH 4U1NB 4HKXA 3MGTA 1BWWA 1AXTH 2AEQH 1CFBA 1P2CA 2AJ3B 1YNLL 4Y2DA 5TPWL 4ZFFA 4GG6A 2AJZB 2XA3A 4XCFL 4P59L 5FKAA 3S96A 1EXUA 4Y7MA 1RK1B 1FYTA 2JF1A 3TBWB 5IIEA 1IGJA 6FABH 1L0XA 3CFKA 4HJ0C 4HIJA 3VRJB 3NCJH 5CEXB 2C3WA 1MEXH 2BK8A 2L7JA 1ZE3C 4LCYB 1G7HB 1U8OA 3DVNA 2EDFA 1KSRA 2O26U 3MRCA 2B1AH 1CE6B 2IANE 1NLDH 2GJJA 4Z7WE 2DQEH 4WNQB 4JKLA 4GLRI 1PGRB 1QVOB 2VKXA 4QYOB 2YA2A 3PXJA 3FMGL 2D7NA 2NX5D 1Q94B 3QH3B 1JHTA 4PP2A 4JY4B 2BSRB 4PRNB 3EJJX 5SWQA 4PG9B 2EXWC 3MJ6A 2F8OA 1R5WB 3ARDA 4HG4K 2V2WB 2CR6A 3I02A 4XVUC 3T0XA 5C3LD 3RIFF 4UMGA 5IJKA 3NTCH 3LZFH 4XP5H 2W38A 1AY1H 2Z35B 2D2OA 4YBHA 3WMSA 3EJZC 5E8NB 3ULUD 1WBYA 4PJGF 1O7SA 1IM9D 4LPXA 3UTTB 5CSGA 1DQDL 3MREA 4NUGH 3QHZL 3GK8L 3FQUB 5DT1H 1D5ZA 5D96C 2X41A 1Q9WB 2OJEA 2X4PA 3HE7C 5FHAH 3TEUA 2VXSL 3CFDB 3T65A 1P4LA 4JO1H 3QCVL 2FCBA 1BAFL 3ULVL 1A1NB 1VPOH 1WIOA 3BKML 5MI0C 1T5WA 4HIHA 4KQ3H 1OAQL 4ALAH 5F9JB 1XGQA 3BEWA 3E6FB 4HUVA 5T3ZH 3GSRB 4NZRH 1MRDH 5DRNB 3RWCA 4YEFA 3L5JA 5HYIA 3MCLL 5DUMH 4CN6A 4F9LC 5EU7E 1H0DB 1DQLH 1UWXH 3VD9A 1HHKA 2PYEA 3DOSA 1T5XA 4Y19E 4JGUA 4KUCD 4JLRB 1AR2A 4KUCF 5GGTL 1ED3A 1W72L 1VFBA 3WLWD 1A7PL 4NN6B 4FQCH 3DXAE 2KQMA 5I1LB 4RNRB 2PR4L 5KSAB 5BXFA 3AVEA 2NY6C 3LB6C 3ZL4L 3MXWH 5TPWH 1HXYA 3WIFA 1M4KA 5ACLA 4O5LL 12E8L 1QLFB 25C8H 3V52L 5AWNH 1NUFA 3FOLB 4HJGA 3V4UH 6FABL 1OTUC 2WBJB 1PFCA 4ELMB 3NCJL 4LVNB 1JGEB 5E9DE 4U49A 1AQKL 1RK0A 5GRXG 4DKFL 4XCEA 1HHGB 1F8TL 1RZIA 4JQVA 1L9MA 3HMWL 2NY5L 5IR1B 2RQ8A 2VR4A 1JHLL 1L7TL 2VJXA 2NY0D 4ZS6C 4MXVE 2GK2A 2ZKHH 2EH7H 1DBBH 1P7KA 1A1OA 2LU3A 4H26A 3S97C 2HKHH 2OSLB 2XWTA 5I16B 3U79A 5FCUL 2AKRB 4UU9A 5A2JH 3UTZA 3QFDA 3STBA 2C5DC 2NYYC 4XP9H 3MLWL 1KXTB 1G0XA 4JEGB 3O2DH 3NTCL 4CDGC 2UWEF 1LWRA 3EYVA 1FO0H 3KYKL 5HY9B 2HJKB 4I2XA 5I74C 3C5ZA 3KPRA 3FO2B 2WANA 4TUKH 4YHOL 3FO0H 4NKMA 1HNFA 3W11D 2IPKA 5CIPB 4NUGL 1CVSC 5HI3D 3U30B 2FJFB 4HFWB 3P11H 3T2NH 4YXHH 4LIQE 3EDFA 1MFCL 2VXSH 1HKLH 1I1AD 1MIEH 5JW4Q 4OFYA 5F8RC 1MI5B 4EBQH 4NGHH 1ZMYA 4YDJB 4ZAKC 2Y36L 4MWFA 5IFAL 5DYOB 3MRLB 3E3QE 3T2QA 4LHUB 1Q0XH 4R90L 1QYGH 5DD1H 1PZ5B 2CDGA 4JFEA 3TA3B 3HE6A 4JGJA 4UI2A 5IHZA 3B9EA 4EEEA 3THML 1D6EA 4I1NB 4X7SH 3WIIH 4U1GB 4WFFE 1WZ1L 2DLFH 5HYJB 5H2BB 1VGKA 3QCUH 4NRXA 2N7BA 5D72L 1E28B 1MFDL 3IFPA 3QUZA 4JM2D 5A2FA 4XPAL 3RGHA 1NQBA 4MAYB 4KK6C 1OGAB 2UV3A 4N1CA 1CTOA 2D4DA 1HYSD 3MV9B 5F3BB 3BYYA 2MJWA 4FTVB 4EI6B 3WN5B 4TSBL 2P48B 4FZ8H 4IRSC 1PSKL 3K4ZA 5EIQA 5JHDD 2HVJA 3HAEG 3BRDA 2EDQA 4PJ5D 4Z7VB 4HC1H 1CFTA 1A4KB 4OLEA 5AWNL 5J56B 3O3EA 4ONGH 4WGVB 2EDNA 1KJMB 4MNGA 2SEBA 3KDMB 5EU7C 5CMAB 5ERWB 2R69H 2FX7L 4PRID 1RJLB 2V9RA 4LSRH 5C6TH 2BSED 3QDGD 2VLRB 4WWKC 1QRNB 1KNOB 2IQAB 3CLEL 2VLKE 2W0PA 4PRPB 5KTEH 2XPGA 4HWBL 5EWIL 2VO5A 5D96B 3DSNA 3R0MA 4F2MB 5AZ2L 1NANH 4I4WB 5B38A 3Q6GH 3DYPA 1YNTB 2DWDB 4IDLA 1N0XL 1QFWL 4NPYB 4XMLL 5KVGL 1WK0A 4N5UA 2JJVA 5E1AB 3TZVC 4P23D 3OL2A 3TJHD 1CFQA 3VXRE 3VFMA 3ARFA 4XWOD 2ZCKL 1B4JL 2OZ4L 5D2NB 1HILB 3WO3B 2J1KA 3SBWC 2LFGA 2WIIB 3INUL 5CJQL 3HI6L 3VI3F 5SWZD 5C0RH 1CFSB 2XNAA 3MUHL 1IM3B 1R6VA 5DZOA 3O6FB 1RULH 4A6YA 5CUSH 1C5CL 3O3DB 2A6DA 3FO0L 4J8RA 1MLCB 2GAZA 4DAGH 5HI3C 1AD0A 5TE4L 4KKLC 1ACZA 2ARJB 3MNWA 3FQXA 1NGPH 1QRNE 1NMAL 4Z78A 4LMQI 5C86A 5IB1A 2VSDA 2ZZUT 4F33B 4HUXB 4XHJC 5KS9E 5I17B 5B8CA 4ZUUA 4Y5XB 1R3KB 3BESR 2VZTA 3QG7H 4QHLA 4KY1L 4WWID 3MCKB 5E4IA 4MNHB 1OTSC 5KS9A 4HX1A 1LILA 3GSNA 5EA0H 5BS0E 4JDVB 1S5HA 1JRHI 2VXTL 3KWWA 4G5ZL 3IDYB 4CMMA 3JUZA 1SBBA 5D1ZA 2RCSH 4LSPH 1MLCA 1MFDH 2IPTL 4M6MH 4BZ1L 3EYOA 3K8LA