4I13B

Nanobody ca1697 binding to the dhfr.folate binary complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
QVQLQESGGGLVQAGASLRLSCAASERLTVDYAIGWFRQAPGKEREFVAAISWGGGLTVYGESVEGRFTISRDIAKNTMNLQMNVLRPEDTANYYCAASRISYRVWNTIPYNKLTLWGRGTQVTVSSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrofolate reductase
publication title Exploring an alternative antibody interaction mechanism
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/immune system
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2012-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i13B00
4AIZB 2EDHA 1CTNA 3ZHKA 1EERB 3LVEA 4MD0A 1X5JA 4OD3L 2FECI 4XX1G 1ZA3A 3C6SA 5IFAL 4M9PA 4JJ5A 3VFNB 2CD0A 2JCCB 3P0VH 1RAMA 5FFLA 1MH5A 4OCYL 4P4RA 4GXUN 4YFLI 1MREH 4KRNA 4JM2D 1CDBA 1WFOA 4Y4FB 1SYVA 4Y8DC 3WYRA 1M7IA 5DJ8A 5F9JA 3QDJB 3QWRD 3FT3A 3FT2B 1KTKE 4LRIC 4MJIE 1AC0A 2OL3L 4ZUWB 3UTSD 3IFOB 1XIWC 1I9JL 3E6FB 4WI2A 4H1LH 1YZZA 2YPLB 5DWUH 2NY3D 3B8SA 5H37H 3WS3B 4XPHH 4RMUA 4O2FA 1OGAA 4Y5XB 3LZFL 4LCUB 3EDDA 1IM9D 1ZHNB 2JB5H 5ESQA 4YEFA 3UZQA 4WEBL 1QFPA 2P43B 4JG1H 4Y4HD 4HH9A 5A3ID 1ADQH 4DOHB 3INUL 4OAWA 2NX5D 5E2WL 2NLJB 2NY0C 4HPYH 3THML 5BXFB 5C92A 5K9JL 5CZVL 4HS6B 2FX9H 4P59H 4OM1H 5TDNA 3C09B 1FL3A 3H9ZA 3U0TB 4I2XA 1GC1L 3D1MC 4FXGB 1CVRA 4WGVB 6FABL 5C0DA 2IMMA 5GS0H 2OR8A 2VL4A 3SDYL 3IVKA 3TT3L 3DETD 5A40E 5GRXG 1A1NB 2GW5A 1T0MB 1MHCB 3EYVB 3O6KL 3C08H 5IW1A 3VRJB 2MCPH 3OKYA 2CH8A 3SDDA 3HUJA 3KPSE 3T8XB 4MQXC 3W39B 2PTTB 5GRVK 1NCUA 4OJFH 5CD5D 1KG0B 4D94A 4PJGA 1LK2A 4P46D 1AFVL 3ZYZA 5KVEH 5F1IB 1G7LB 5H8DA 3X3FH 1YMHA 5D1QC 1MI5B 3RNQA 1TMCB 3D3VD 3GI9L 5I1CH 4L8DB 4QHUB 1HXMA 3RIAK 5MENE 4FXKB 5DFWH 1G7PA 1J05B 3U1SH 3EAKA 2OR9L 5F72S 1ND0A 3DBXA 1Y18B 4LHUB 1SJVA 4Z8FL 2VDMH 2H32A 3NCCB 4ORGA 1KSRA 2NY4C 3QEHB 3S35L 3JV4A 3MR9B 4MNGB 1F58H 2VZOA 2X40A 1IC1A 4U1LB 4NQCB 4ZO7A 3MZGB 3MO1B 5INCA 1HHJA 2CDGB 3VXNB 4K23H 4JDTL 3FB7A 5IBLD 1BZ7A 1YPZE 1I8KA 3R1GL 4O2CA 4TSCL 3QIUC 3QPXH 2QEJA 2A6DA 1PQZA 4LSUH 2AJVH 3L5WA 4LIQH 5E5UB 4RFNB 4LRNH 4PJEB 3IJYA 1P53A 2XPGB 2E7MA 1SBBA 3B2VH 3MREA 3U46A 3EW3B 4YPGB 4OZGB 3SE9L 4YE4H 4TNVK 3R8QA 3O3AA 1H0DB 4ISVA 2QHRH 1IGFH 4N5ED 3GBLA 4FQCH 4P2QA 2EH8H 3OWEA 4JY4B 5EOQL 2VLLA 3P9WB 3LV3A 1MF2H 2GY7B 2A9NH 3ZE0F 4ZPVB 3MV7B 2WWMC 4K3DH 4LGPB 2NW3A 2F54B 5EUOF 2VERN 5C0AA 1U91A 1CFVL 2EDRA 4MWFA 2EDDA 1R6VA 3AM8C 3TM6A 1YEDB 3P73B 3AY4C 5AZEH 5TJWK 1JPSL 4FOMA 5EFIB 2X4TA 4R96A 1B6UA 3MA7B 2VMFA 1UGNA 4YDKL 1YNTA 4HZAA 4BK5A 3MRCB 1NCDH 5F88A 3QO0B 4H88L 1RK0A 1OD7A 4I8DA 2RAMA 5TQ0H 1QBLH 5D1XA 2FJGA 3U4EB 3KVQA 1HKLL 4NO0D 3QHFH 3HG1B 5T5FL 1P6AB 1ZT7A 2UZIH 3WO3B 3ROLA 1R24B 3UTTE 1KXVC 1DQML 4XAKD 2A9MH 1SVCP 3BKJH 5HHMD 2GSGA 4WHDA 4ZFGH 4QTHA 3FRUA 1UB5A 4LK4A 4DKFH 2JIXB 5D7JD 3IF1B 3T77A 4K55A 4GRLA 1FN4B 1U2HA 1UH2A 2AK4B 4JDZA 4LLUA 1J1XH 4JHAH 4Y16D 5DURB 2CIIA 3ZL4L 2VTFA 5BVJB 1R3HA 2H6PB 5E0QA 1TVHA 2B1HH 3U6RA 4DK6A 5CFHA 4OLXH 4X5WA 5JTWA 1MCWW 5BZWA 3V5DB 1EDQA 1ZA6B 4N0RA 4WWKA 4KI1A 3HNTL 4WU5A 1MFEH 2FECL 1YNKL 1CQYA 1CLOH 3CMOL 1CLCA 3RWEB 2E7LA 4OF7A 3I3EA 3MRBA 1YY8A 2AK1H 2BRRH 2PW2A 4X6DA 5FCSH 1TLKA 1NDGB 1BF2A 1YMMA 2ESVA 1GXEA 1FRGH 2G75A 3PDOB 1U6AL 4LAQH 5LGJB 1IC7H 5TE6L 1YC7A 2DQIH 2FZ3A 1ACZA 2R1WA 4B53A 5EO0B 4B41A 5HHQA 3S34L 4YHOL 5F9WB 1KYOJ 4LLYB 1WC7A 3LH2L 4JKKA 2YK1L 5BMFL 5BV7B 3IETB 4YHKH 4XNUH 3MRPB 3GFUA 4NBYB 2P5WE 4N90D 4H0IA 3QCTL 1LO5B 1TTGA 2DYPD 1UYWH 1GZPB 2H9GA 2G2RA 3QEQD 1V3LA 3WLBA 4P5TC 4I77L 4U1SB 1CFSB 2VR4A 5JO5B 3JXAA 2OL3A 5F1OB 3MRNA 4YJZL 2IG2H 3BEWA 3FCTB 5J9PB 2C1OB 1S3KH 4YZFF 1FL6B 4JAMA 5I1KH 4ZFZA 4S1DC 2P7TA 1A7PH 5DSCB 1HCFX 1PVHA 5MEOB 4UQ2B 3LD8B 2G5BB 4Q2ZB 1FGNH 1RPQA 3DXAD 5D7KE 3BKYH 4FQIL 1W8OA 3NABL 3UYRL 2W0LA 3ES6A 1F4YL 1E4XH 4ONFH 1MUJA 3SDXF 1FCCA 3W0WE 1KCLA 1RZFH 5D6CB 1J11A 2ORBH 2DJSA 1GJIA 2XA8H 3BH9A 1ZANH 5E7FA 3L3OA 4PGCB 1P69B 4JPVL 4UT6H 4Y4KB 4WHYH 1U0QA 4I3SH 4OB5L 1R5WB 4PLJD 5HHOA 2D31B 4ZNEA 3DV6B 4W4OA 5DC0A 2EE3A 3QFJE 4TVPH 2YRLA 3GI8H 3QXDB 5IMKA 3TCLA 5IB5A 1HN1A 5HY9B 4PJ5D 1LE5B 3F6IA 5BRZD 3OG4B 2A74B 4MDJA 5AZ2H 2QSCL 2AABL 4G8EB 1Q8MA 4N5UA 4Y1AA 3SKMA 1KBGH 5EC2B 2KKQA 4J3TA 3OKKB 3VXRD 1NEZA 3EYSH 4UI2A 3MLPA 5EU7C 4NUJA 1X5FA 4DQOL 1HCVA 5F70A 3BH8A 4C54A 4JFXA 1CTOA 2GI7A 3O3EB 3H3PH 3FRPA 2X1WL 2CQVA 2BHUA 4XX1E 5CD3A 1I8MA 1SJHA 2J7LA 4OCWH 2HN7B 3C60C 3F12B 5D1ZC 4KTDL 4OCMC 1UVQB 4K3JL 3QUYA 1NKOA 4G9DA 3TVMC 2V2TA 1XGRA 4LLDA 2MMXA 3KPPA 5FKAA 1ZKAA 3UROR 3KPNA 1U8NA 4RGOH 3C5ZD 4APQA 4KK5D 1HIML 4WHCA 1CXKA 3IDIA 4NCDA 5GS0C 2EXWD 1MRCL 5CSZB 4GKNA 1BEYL 2DQHH 4NQXA 3HZMB 2ZG3A 4YHYB 1S7WB 3GMNB 4HJGB 3V52L 3N85H 3OSKA 2EYSB 4R97B 3VXUA 3H7BB 1F8TL 3SJVD 3O9WA 4KVNL 4Q7DA 4QTIL 4MNHA 4M9OA 4MQSB 2NTFB 2R2BA 2HFEB 2XWBB 4EI5B 1UA6L 3DX8B 5IFHL 3VW3H 4ZAKB 3DPBA 4HX1A 4X7FC 5C2BL 5I1HH 2X4OB 1EH9A 4WO4A 5I2IA 3K7UA 2BVUA 4JFEA 1QA9A 4JM4L 4WV1B 2DQGL 3SDCC 3PP4H 4MX7A 1A0QL 3O8XD 4RMSA 4Z95H 2BHZA 2EDFA 4ZUTA 1T1WB 1FO0H 3LKSA 4X8XA 2CLVA 4FQJH 4CJ0A 3RGVD 4QXGL 1E4KC 1N3NA 2WBJC 4OGXH 1NGQH 3FONA 1I85C 1H9VA 3T0BA 5ETUA 3CD4A 3TO2A 4XP4L 4AJ0A 2EYRB 1U8KB 3G5XB 4HFWA 3RIFK 5AYUL 4GBXA 4NHCH 2AEQL 4TSBH 3U2SA 3IDUA 4N0UA 2PXYD 3L3DB 4M3KB 4CVZA 4ZUVB 3GSRA 3IGAB 5DDHA 3BAEH 1OSPL 5HVHB 3CVHA 5T3ZE 2NNAB 3MJ7B 4UAOC 4PRHA 4YO0A 3MUZ1 3HE7D 4KHTH 3S4SB 5EU6A 5JW4Q 5GRWA 3B5GA 1BQHB 4HWEL 5MP6L 1WBZB 4JFDA 4XH2A 1TNNA 1P2CA 1ZHLA 2X1XR 4NJAL 5A16A 1PKQE 2VZUA 4CW1A 1QPXA 1TPXC 2FRGP 1Y6MR 2YZ8A 5KG9A 1I75A 4PJFF 4LP5A 4U1NA 1IM3B 3BDXA 1BLNB 3V0WL 4UIKL 1ZTXL 4HUVB 3ARED 3T0EB 4F7PB 4ZNCD 5E4IA 3U36B 2X4PA 4LPWA 1BJ1J 4MJ6B 2W59A 5LAXB 2X70A 2J3SA 4ODTL 4NKIH 3ARXA 5GSRB 2HP4A 2AJZA 3BPOB 3RBGA 5T1LA 4QNPE 4M62L 4HLZH 2J8HA 1L6XA 2XFXB 3D85A 1G7JA 4OIIH 1KLFA 4JGJA 3M8OL 2YD5A 3KPMB 4JB9L 1AGDA 3SE8L 3GMPB 1MIMH 4XVJL 2C3VA 3SE4A 3TBVB 5FYKH 3HNSL 1JGDB 3FN0L 3PGCA 5IMMA 2R69L 2E27L 1GIGH 4LSSL 3WIIL 4TOYH 3NCFB 1FNGA 4K8RD 4TTDC 3RNKA 1X6LA 5DRNA 1BVLB 2AJSH 3UBXA 4DZBB 1M7DB 4QGYA 4PBXA 3TZVB 1S7UA 5SX5K 5TF0A 5HHNB 1KV3A 2Z35A 4QF1A 3BQUB 1W0WB 2OR7A 1MLCA 1MCCA 4QEGA 5ANME 4XXDB 2ENYA 4WUKL 5EUOB 2JJSA 2IPUK 2W60A 3WNNA 4O4YH 2GT9B 2DQCL 1U93B 3F7YA 4U6HB 1S5IL 3K46A 1WWAX 4XNQB 5IG7B 3D48R 4CADA 1G6VK 4NWUH 4WW1B 1D9KC 2VXUH 1Q94A 3QULB 3W9DB 5E24E 1FCGA 1IZKA 5C8JA 2C7UB 4ZS7H 1U3HD 4B7IA 4IRSC 4BH7A 3LDBB 2NTSP 4JKPL 3WNLA 3QQ4A 1FFOA 3ME0A 4BSVB 2BXZA 4LASL 2HJFA 1IQDB 1MHPL 4P4KB 3I2CH 1MFDL 5GGUA 5DYOB 3TFKC 1C5BH 1SM3H 2PO6A 3GKZA 4M5ZH 3SOBH 3CFIC 4MQ7B 3QUXB 3QDGB 1AD9B 2UWEA 2XWJB 3IXTA 4YAQB 5J56B 1CFTB 1F4WH 4MB5A 3MV9D 2RFXB 1IE5A 4CBPA 2DWEB 1WICA 1INDH 1BD2E 4IM8A 1ED3B 5IM7B 5KN5A 1OP3K 2Z0BA 5HYJD 4P49A 1ZVYA 4LARL 3CNKA 3ZT5A 5DHXB 2Q76B 4DVRH 3WE6A 3PWPD 3STZB 2I60L 3I6LD 1BQLL 3G6AB 4ETQA 2JELL 4X9BA 4Z0BL 1D5MA 1MVFA 2OXHA 4NZRH 3O4LB 1M05A 3DECA 3IAQA 1VB9A 3MBEB 4Y2DB 3P30L 5KVDL 1JNNL 4L4JA 1K6QH 1RZGB 3LKOA 5IBTL 2DQTL 4K71C 3HC4L 3TA3C 2XIDA 3ARZA 3V6OE 4ZTOH 4EUPA 1Z2KA 3RDTB 3KPRA 4CVXB 2YOCA 2V7NB 3DMMA 3WEXB 2K3TA 5IHUL 1F90L 5AEAA 1TJGL 4NN5C 5GGRY 2GEEA 3HLAB 3AAZB 5E5MB 4BQCA 4JZJA 4ZMAT 5I16A 1UH3A 2O5ZL 3WJLA 1AGCB 1JTOA 2FATH 3D69B 1NBZB 1P7QD 2NW2B 3B8YA 3I9GL 3O41B 4KROD 1U8MA 1FFNB 1N6UA 1BBDL 4PIRF 2J4WH 2CJUL 3NACH 1LDSA 4JRYA 1K2DA 3I85A 1FH5L 1BM3H 1T2JA 3TLRA 2VZ3A 4GQ9H 2BNRD 1UB6A 2W0PA 5DK2B 5GS3A 3IU3B 3L7EA 5HHXL 4EOWH 4L4VE 3N9GL 1WBXB 1JF6A 5EU3A 4O02H 4TPRH 5AWNH 2I5YL 3RVXC 1VEOA 2BDNH 2XZCH 1FDLL 5DLML 4U6VL 5IR1B 5A2FA 1HI6B 5IV2A 3BP5B 3CSBA 3ULVD 5SWSD 5DMGC 3KXFE 3CC5B 3MACL 4JQXC 4ZO8A 2EZ0C 3V0VA 3EJYD 1W8NA 4PJ7E 1MCHA 3ARUA 3SDXB 4JY6A 2DM7A 1P4BL 3MV8E 2OMNA 4NQED 4OUOA 4PD4J 4UINL 4I0PC 3X11A 1FYHB 3O6LH 1TJIH 1DLHB 1QFUL 5TE4H 2EEAA 4DCQA 2FR4B 2YEZA 2BSED 2Z8SA 4J8RB 5F44A 4HIEB 1WZ1H 3LEYH 2VDQL 4EXPX 2F74B 5I17B 2BVOB 3M1BA 4FZ8H 4PJDA 5F97E 5IROA 3RUGA 4AH2A 3ZTNL 1UZ8A 4M6NH 2WLZA 2B1AH 2BVQB 4NCC2 1WFTA 4CN6A 3BN9D 2CLZA 2IAND 3P77A 4LP4A 5E6ZA 4X7DC 4NT6A 4G80B 4DTGH 4N8CL 2C1PB 1QSFA 3I84A 1I3GH 4RQQB 3MJ6A 5F3HA 1ZLWH 4NIKB 4FQHA 1S5HB 5JMRA 1GGUA 3WXVH 4QHKI 1IAMA 4R7DB 5CIPA 2EIDA 1KJ2H 5IMOB 1NCTA 4JHZA 1KT2A 5D7LD 3WSQH 3MC0A 2EKSB 3RWGB 4S1RL 3IDMB 4LSVH 2P24B 5H94B 1K4CA 4A6YL 3MRFB 1IC4L 4U4BA 4U6XB 2YD6A 3QIBD 5HPMA 3LQZA 1R3JB 4S1QL 5CMAB 3ZKMC 2HRPL 4CL7A 2Q6WB 1I7UB 4Z77B 2VXTL 4F15B 3BPLC 5ID0A 4MNQB 5GJTL 3TBYA 4GRWF 1YNLH 3PQYB 1AXTH 2XQBL 3RVTD 3ARBA 3TEUA 5KSVB 1IILE 1MNUL 4FP8H 2WINB 3QJHA 5E8PB 1PG7W 2GJZA 4R6UA 1NMCC 1S7QB 4FG6D 3B9KA 3ARDB 1CFQA 2EH7H 4S2SB 3WS6C 3ARGA 4RGNB 2OTWB 2XN9A 3MRRA 3F7PC 4FXLA 3VH8G 2ZKHL 4OZFG 1VFUA 3LS5L 5D72H 2I9LA 5FYJL 1HHKA 1KENH 3QXAB 1AQKH 5D5MF 3VWJB 1P7HL 1AR1D 4GG6B 5LWYL 1YEFL 5FGCB 5H35A 4H20H 4M4RA 2HJLB 4WW2F 1AP2B 5GRVL 5LQBH 1H8NA 2XY1A 3JWOH 5TF1L 4KTEH 2DTML 5CP3A 2YSSA 3H2WA 4X4MA 5JHDA 3VWKB 4NZUL 2VKXA 3T4AB 5J6HA 2LQRA 5IQ7H 4MDIA 3IDNA 5TQ2H 1U8IA 3GBNH 2IADA 4U1KB 3NZHL 5E6IA 2X7LA 5EC1A 1QP1A 3EKCA 4IJ3B 5C0GA 4N68A 1DDHB 2FHFA 3HE6B 4G8GB 4EDXB 4IMLA 4Z7WF 1S7VB 1N0XH 2GJJA 3BGAA 3KWWA 3ULSB 4Z7UF 1DZBA 3QCVL 4MSWA 4W6XB 1FJ1B 3F62A 5CBEB 4LLMA 1FVEB 1HHIA 4E0RA 5HVWA 4XBEH 3LKPB 5KSUA 4OCNC 4YIQA 2RCSL 1DBKL 2DN7A 4P23A 5F9OL 1CG9A 4IRZL 4YGVB 4YQXH 1VFAB 3FQWA 3TC9A 3NTCL 3OX8B 3NPSB 3SPVB 3SKNB 1F6AA 2NX5E 3K0WA 3FO2B 3ZZ1A 1WITA 2VLJA 4DUVA 3HFML 3FFCD 1J8HA 2Y07L 3MLWL 1HYSD 2XTJC 4P2RA 1WLHA 2VB5A 4V2BA 4JRXB 2HTKC 2ZG1A 1EEUA 2H8PB 3O3BA 5F7DB 1KTDA 3GMQA 3IJSB 2XKSA 1JHTA 1FV1A 3UTPE 2BHYA 2CRIA 4GRWE 1LEGB 4N0YH 5BZDB 5J7CC 3MGAA 2ZG2A 3OGCA 2IAMB 2YPVL 5T1KD 3QUMH 2NXYD 5D2NB 3CXHK 4ODSL 3OKLA 4YPJA 2UYLB 3PV6B 3QO1A 4Z5RB 5EOCJ 1CE6A 1LK3L 5F7EL 5CKGA 4OZHA 1HHHB 4ODUA 4C58B 1I1FA 3RBSA 4NQTA 5E94A 3NVQA 3QR2A 4L9LC 1OGTA 2KL6A 3L5XL 5IW3A 3NIFE 3W11D 5IGXH 3EHBC 3T4YA 5DJXB 5EU4A 4G9FE 3G6JF 2Z31D 5GGSB 2VDPL 4G8FA 2VITB 4OLEA 4GW1A 2X89D 2XQYK 4MAYA 1C08B 2P42B 4TNWK 5DD6A 2L0DA 1N5YH 3AXLA 3BVNA 4GMTL 4QRRD 2ZCHL 1H5BB 4JREB 3O6FA 3T08A 3D3VE 4J4PD 4P3WA 4WI8A 1NGYA 3DRQB 3G5VA 3REWB 3RL1A 4J3WA 1FORH 1ZLUK 2MHAB 1FNSL 4R2GB 1T20B 1MHHA 3QUZB 2ZUYA 4JFFE 4GKOA 3G6DH 4OD2A 2X4QB 4D0BB 5C7XL 1HK6A 3BN3B 3MLVL 4HZLA 4QRPA 4F9PC 3HS0A 4NHUB 1JPTL 4MCYA 2HKHL 1JWUB 1OP5K 4JKWA 1DEEB 4C4KO 1CBVL 3KJ4B 3VH8A 1ZT1A 4XVUD 4OGYL 3EZ8A 4M7KL 1WBYB 43C9A 5I75B 1TVDA 2F15A 3BPNC 4M02A 1KEMH 2X44D 4JPKL 4YUEH 3VXOB 4TULH 3DVNA 1KN4L 3MBXL 5A2JH 4GG8A 4UMGA 3KLHD 1P7KA 1CICD 1T7XA 2EECA 5C0IB 4FMFA 3WFEL 4U6TA 1N7ML 1RK1B 3QXWA 4XNMB 5C2UB 3FFDB 2Z91A 1VACA 4PJ9A 1H15B 2R2CA 1T4KA 3F5WB 3I3BA 5I1IL 5FF6A 4WUUD 3OR7A 1UWGH 1QRNB 4EN3C 4PGEA 4GXUM 5DC9B 1IAOA 2LABA 2PO6D 1QSED 1U8PB 4X7EC 4X6CA 4E41E 5J1TC 3BZEA 4KKAC 3U30B 4OQTL 3VFWB 3V6FB 3MRQB 2D03L 1L0XA 4WFFE 5IB4B 1P9MA 4YXHH 2BSTB 2AAVA 3DVGB 4XCCH 1B4RA 1PG7X 2ZOKA 4J6RH 3MRKB 4JPIB 1W0VB 3RVWD 2FX8L 3WN5B 3ZHDA 2DQFB 3DO7B 2PW1B 4YBLB 5KSBF 5E1AB 1D6EA 3V4PH 3G5YB 4OUUB 1RURL 5DMKB 3MLUL 1HSBA 2B5IB 3G6JE 4M1CD 4QOKD 4YDIL 3ZMRA 2XKUA 1Z9SA 5DHVH 3MNWB 1T03L 3S9DB 1AC6A 1DLFH 4PJAA 3VJ6A 1VADB 4GRWH 4IOFC 1H3PL 3UJJL 1D5ZB 3IU4H 1RUAL 4HXBH 4LCWA 4NBXB 4PJHE 4XMLH 5DEFB 4DFHA 4OV5B 1I8IB 4NUGH 4A6YA 4MA3B 4UV4L 1NMAH 3BKCL 1ZGLB 4DGYL 3CUPB 5CHNA 4HIHA 4XNYH 4PP1C 3RU8H 1NANI 4HQQH 4AIZA 4NKQB 4Z7NE 3S37X 1I1YA 1OAKH 4FFZL 5B8CB 5F7UA 4MA7L 2ZWLT 1IGML 4LSTL 3X14B 2OI9B 3VFNA 2JCCA 5JW4R 4L1DA 2RB8A 3CZFA 3QNXB 5JOPD 1ZVHA 5LXGL 5DD5L 1MAKA 4UILH 3SE3A 3TPUB 4D0CA 2EIEA 1AXSB 3QDJA 5DK3A 4QWWD 4NJ9H 3FT2A 1TZGL 4NQDD 4ZUWA 3AS1A 3IFOA 2UV3A 4OTXL 5HVFB 3E6FA 2YPLA 1S7SB 4KWUA 3ZT6A 3RZCB 3OMZA 5I71B 1S9XB 2AJUH 4PGDB 3WS3A 1XFPA 5HYEA 3RX5A 1JUFB 5DVLA 4HIJB 4Y5XA 2JE8A 4PJ8C 4LCUA 3T0VA 1ZHNA 3V2AR 4Y19D 3F7VB 4JR9L 2COQA 2DL2A 2IFFL 4N9GB 4XWOC 1OQXA 2NLJA 5BXFA 4HT1H 2E9IA 4N90E 5I73B 1AHWB 1KB5H 4HS6A 3PJSB 4HUNB 4WCYL 4NGHH 4HJJL 5DFVD 2F5AL 4OLWL 5FUOL 3U0TA 5JZ7C 1KELH 5FECB 1JGLH 4U3XA 4FZEH 3GK8L 1KCSL 4FXGA 1XEDA 1A2YB 5CJ8A 3MLZH 2AW2A 1FSKB 4OZIE 2VDRH 2HFTA 3GIZH 3HI6L 2H26A 2EDLA 3BHBB 5JR1L 4CGTA 1JMXA 5CJQH 4UT9H 3MXWH 3QXUA 4ELKB 2P8LB 2RR3A 3GHBH 1T0MA 2UZXB 1YECH 4FTVB 3VFOB 5GIRB 3EYVA 3H6JA 3RWFB 3JWOC 5C6PB 2DI7A 2YD1A 3T8XA 1NBVH 3VCLB 2GJ6E 3BKML 2KUTA 1XGTB 4MA8L 4OM0L 1CGSL 1MSPA 2PTTA 3W39A 1X5ZA 1KG0A 5TDOB 1RZKH 4HUMB 3TV3L 5EG6C 5ACZB 2YA0A 4KVCH 2DMBA 5F1IA 1G7LA 4G6FD 3GB7B 3TYGL 3EDFA 1RZ8B 1RI8A 1MI5A 1H3GA 4GW5B 2CKNA 1MFCH 4L8DA 1DP0A 5D5MB 4HF5L 2IQ9H 3OJ2C 4FXKA 4XXCC 1J05A 1R3LB 4PGZA 3JBG7 1GGCL 1NGPL 4K2UL 4PJBB 4AEEA 4WW2B 1Y18A 2EO9A 1DQLH 1VEPA 1GH7A 3LPWA 4O51B 3VXRE 5KS9E 3NCJH 3QEHA 4JO3H 3MR9A 4MNGA 4M03A 4U1LA 3ZE1F 2ZJSL 4NQCA 3VG0H 1U58B 3MO1A 1MFBL 2CDGA 4M5YL 2V5YA 3VXNA 2VQTA 2AERT 3CZJA 2X9YA 4ELME 4IRJC 2BY1A 4G6AC 5HI5D 1JZ7A 5DVMA 4HD9A 5L8KB 1MJ7L 2IALB 2R1XB 2VLKB 3HUJF 2VDLL 4MXQD 4KK9C 3PGDB 4Q9QH 4X8JB 4Z7WB 4M61B 5T33H 1A64A 2CUHA 3WHXB 4Z7UB 4KUCD 3GGWB 4LVHC 4LLVB 1A3RH 4I18B 4PJEA 2LTQB 1ZLSH 3VFUB 2XPGA 2YR3A 2Z8VC 4YPGA 1FAIH 4M7LH 4OCRH 5HD8D 4OZGA 3H0TB 3VGGA 3KPLA 3RHWK 1UCBH 4UDTB 5JOEA 1K8IB 3T0WA 3HB3C 4IDJL 1H0DA 1TIUA 3D39B 1YQVL 1FBIL 3MOBL 1U3JA 4JY4A 3L3HB 3MLSL 1IT9L 1WQVT 3HMXL 1A7QH 1CYGA 5IB1B 1NCWH 2E7BA 4HKXB 1XGYH 4D3CH 4XB7A 4PGJA 3NPZB 1INEL 1UM5H 3MV7A 2B2XH 2HT3C 4QRSB 4ZPVA 3SJVE 4ERSL 1EJOH 3DI2B 5EBLB 5EWIL 2F54A 1HQ4B 3EJJX 1D5IL 3EOTH 3RZWA 2W92A 1FZJB 5KOMC 3P73A 4I0CC 2EDJA 1IVLA 2DQEH 3QEGL 2O93L 4L29B 3MRLB 5EPMB 1UCTA 5EFIA 3S97C 2PYED 2WUBL 3CH1B 3RKPA 1T1XB 4XCFL 2XA3A 3MA7A 2VSCA 3HPJB 5AYQA 4HMCA 5FDYA 4UV7H 2VLRB 1YEIH 3MRCA 1M7XA 1XIWD 3QO0A 4NNPL 4EJ1C 2X9WA 1C5CL 4ALAH 3ARFB 5EOCL 5KW9H 3NCYS 2QV2A 1WIPA 1QBMH 2NMSA 1OAQL 5I1EL 3HG1A 2IBGA 2FEDD 4R90H 1OAXH 3NCEB 5LBSH 5E2VH 1NCCL 4I2XE 1R24A 3WFBH 2DQJH 3TO4C 3LPGA 4OQTA 1RZ7H 1UFUA 4ZXBC 4LNVA 3H9SD 2C3HA 4DKDC 1NC4D 5B39B 1KIPB 4JN2B 2E3VA 2JIXA 2NY0D 3IF1A 5IB3B 1OY3B 1I1CA 1FN4A 2Q87A 2QTEA 2AK4A 3SGJC 2V9RA 2W9DH 3C6LB 3NZ8B 1JJUA 2W0KA 2DBLL 3HPLB 3QIWB 5BVJA 2QSTA 2Z93B 2H6PA 3A6CH 3WDIA 4JEGB 4WEMB 3FQRB 1MLBB 3FT4A 3AVEA 2XRAH 4K7PL 2CSPA 3V5DA 5D6DC 4YHZH 1ZA6A 2AI0L 5CEZD 1LVEA 1UJ3B 4Q9RH 3HR6A 2J6EH 1X5KA 4U7SA 4PJGE 5JLZB 3RWEA 3GO1H 3SGEI 1XF2A 3U7YH 4WY7L 5B3JF 1QUNA 2MSPA 3L3KB 1NDGA 5GJSL 1D5XB 4KI5E 1XF5B 5DD0H 1QBBA 3PDOA 5LGJA 1G1CA 4MQXD 1I9EA 2ZSWB 3U4BL 3D2UD 1JYNA 4WI5A 2DI9A 3QI9C 3PWLB 4E9LA 5I8OH 5EO0A 1A6AB 5C0BD 5A3IC 4HIIB 4LLYA 4RRPG 4UTAL 1ZEAL 2APTA 2ZCLH 3IETA 4HAFA 3PWUB 4IRSB 5D1QD 3MRPA 2CK2A 3CMGA 1KJMB 2WIIA 3S6CA 2OK0L 1LO5A 5JOFB 2IH3B 1G9EA 3BXNB 4HWUA 1GZPA 4ODVH 1Y0LB 1PY4A 4MB3A 3CLEH 1MRDH 1Y6KR 2ZUSA 1UM6L 1R0AH 4U1SA 3MLYL 2H1PH 3K2UL 1CFSA 5JO5A 3CIQA 3DARA 2LU4A 3A6OA 1OOAA 4YC2B 2NY4D 3UAJC 1NFDF 3I50H 4LHQB 3I6GB 5GXBB 2HWZH 1SQ2N 2C1OA 5J9PA 1FL6A 2QL1A 4KV5E 4X6DF 5D9SB 5IF0B 5SWZB 4ONHB 5JPNB 4JFZL 5DSCA 4U1IB 5MEOA 3GEWB 4UQ2A 3QIUD 5KVGH 4X99B 3T2NH 3UYOD 2G5BA 4Q2ZA 1I8LC 5I1JH 3RJQB 1A1MB 3ZDYF 4P2QE 1KFAL 4NZTH 3TN0C 4OGAD 1Q0YH 5DEZA 3WIHL 3KR3H 1F6LL 5IFJB 1IBGL 3VXMD 1I9IL 4P46C 1CZ8H 5D6CA 4BZ1L 5JQ6L 2C3WA 5M7QA 3ROOB 1ONQB 4PGCA 4Y4KA 4NBZB 2YRPA 5GISL 5JQHC 1R5WA 2IBZX 3P0YH 2D31A 4KKBC 1EVUA 3DV6A 4OFKA 3LEVL 3DX7B 1RUMH 2RJMA 4HPOH 1UWEH 5HY9A 3VI4E 2APVA 1LE5A 3BRDA 1QFWI 1YYMH 5GS2H 1HWGB 2BNQD 1FVDB 2A74A 5DD1L 1PFCA 4CN1A 4G8EA 4YHML 4H8WL 5EC2A 5HYJE 5D7SH 1AO7B 3OKKA 4PB0H 1ULVA 5IJKC 3QDMD 1FYTD 2J88L 1QFOA 3PWPE 1JWMB 2ZUTA 1MVUA 4RMTA 1G9NH 5FYJU 5L8JB 1MCKA 5FV1L 4K07A 2HN7A 3F12A 3QZWG 1E6JH 15C8H 1UVQA 4POYA 3KPQB 2YMXL 3P4NB 1PG7H 5KZCB 4OFYA 1IKFH 1PX3A 2BRQA 2P5EB 3SQOH 4OD1H 3SN6N 5IHZB 2Y1VA 2WWKT 5EORL 3TIDB 1G6RB 5CGYC 2R56L 3DROA 1CLZL 5CSZA 2Y36H 2L4OA 3DTXB 5MEPB 1VCAA 3HZMA 2Y7QB 1S7WA 1V8HA 2WP3O 4TYUA 4Y4FD 3GMNA 4HJGA 1WZLA 4NOBA 5E4EB 1A7OH 2EYSA 5CINL 3S36H 3H7BA 3P40A 1JGVH 4G7YH 2OP4L 3CDGB 4YXKL 3UTTB 2NTFA 1JRHH 2XWBA 5DEGB 4EI5A 5CCKL 3DX8A 3ARWA 3SKJH 4ZAKA 4OCXL 1RZKC 3QAZC 2IFGA 2CDEB 3ESVF 1UM4H 1R3IH 5I66B 1FZOB 1AKJD 4WV1A 2R8SL 1PBYA 4WEUD 3ZDYE 2NY2C 1J1OH 5HJ3B 3S37H 3HKFA 2H45A 2KQMA 3SGKC 1T1WA 2HRLA 1I7RB 2D7TH 2FGWH 1A5FH 3ULVE 5SWSE 1HOCA 5KSAC 4U49A 4GAGH 1IJ9A 3FQUB 3HMXA 5DGRA 2DDQH 3AS2A 4GMSH 2EYRA 1OGAB 1U8KA 3G5XA 2BCKB 3N1PC 5ESVB 4WFHD 8CGTA 3L3DA 1EEZA 4RGMC 4ZUVA 1QPPA 4P99A 1U8OB 3IGAA 4KMTL 5K33A 4GAJL 2NNAA 1KCKA 3MJ7A 1PY9A 3S4SA 1DQQB 5KANI 1BQHA 5TE7L 3K8KA 4XP6H 1WBZA 3L3GB 1N2RB 1AGFA 4P5TD 1ODAA 1NAMB 4HS3B 3HAEG 3B2UC 3MJGX 1CXLA 1PLGL 5ILTL 4X80L 3EYFB 3NAAL 3C8KA 2VIRB 1BLNA 5FAAA 3S88H 2YPKB 3K4AA 3MROA 1SYSB 5IUSA 4U1MB 3KYNB 4S1DD 1TNMA 3OAUH 4RWHA 4F7PA 3T0EA 5T5NF 4PV8B 3U36A 3R06B 5DT1H 5LAXA 1SBSH 1KNOB 5I1AB 4S1SH 5EBWB 3T0DA 5HHOE 4ZNEE 5GSRA 1JNLH 1MJ8H 2W9EH 4LPYA 3TNMB 3UPRA 5I8KL 5IESL 3Q5OA 3SCMB 2YUVA 5EA0H 1MFAH 4BSWB 2XFXA 5BS0D 3LIZH 3OG6B 1N64L 3KPMA 3GMPA 1QD0A 4DKEL 4L8SB 4FNLL 3TBVA 1JGDA 4LHUD 1B90A 4O9HL 3GJFB 3HI5L 3PGFL 1DBJH 1YMHB 3VXQB 1X4ZA 4X4ZA 4AIXA 3O4OB 2FIKB 1CLYL 1BVLA 4DZBA 1M7DA 3T3PF 3TZVA 3GNML 4HUUB 4POUB 4I1NB 3V5HA 3BQUA 1W0WA 4DAGL 2BJML 1LO4H 2H32B 5MHSE 2EDNA 4DGIL 3L5HA 4XXDA 3QZWA 2NQCA 5EUOA 1VHPA 3QFJB 1MCNA 5FYLL 2GT9A 1E6OH 1U93A 4U6HA 4QY8B 3RTQC 2V2WB 2YXMA 4MS8C 2VXQH 4XNQA 5GGQH 4KAQL 5IG7A 3LB6C 4HV8B 4QXUH 1BOYA 4KHXL 3K8LA 4WW1A 1QLEH 3NA4A 2WP3T 3QULA 3SDAC 3W9DA 1OWRM 4P3CH 2Y23A 5C08D 2C7UA 3C60D 3L5WB 3EFFB 3MZTA 4KJQC 4ZD3H 3TVMD 2C9AA 2Y25A 5C0CD 3RY6C 3BGFB 5FUZH 3JUYA 4BSVA 4XC1L 1CXFA 1IQDA 3MA9H 4R8WH 4YXLL 4P4KA 3GMRB 3GJFK 1CGUA 3QISA 5DYOA 4PLJC 1EMTH 5GS0D 5HGBB 1I3RB 1OQOA 5I6XB 5F93C 4OI8A 4OD3H 2BY0A 4N1CA 2XOTA 4CU8A 2X4UB 4MQ7A 1FIGL 4PRID 4JFEE 3QUXA 3QDGA 4HCRH 1AD9A 2XWJA 2MKLC 1RFDL 3PV7A 4M1DL 4YAQA 1CFTA 4OCYH 3IDXL 4YFLF 1R5IA 1J9CT 2RFXA 2DWEA 2EDTA 4FMKA 1ED3A 5IM7A 1NEUA 3PDGA 3MOAL 2Q76A 2P8MB 5ECJE 3AS0A 2OJEB 3WXWL 2MPAL 4I9WD 4R96B 2OL3H 3NOIA 3UCRA 5FM5O 3STZA 1QFWL 3ZKND 3G6AA 3BX7C 1I9JH 1S8DB 4S11A 3RL2B 2RGSA 4LLAA 4N0UE 2FBJL 5EZLB 3FFCE 1QEWB 2G5RA 3O4LA 1JZ4A 4M7ZB 1NAKH 2WBJD 3EYUL 3MBEA 4Y2DA 3LZFH 4KGJA 2MJWA 7FABL 1RZGA 4PRHE 3FMGL 5C07D 4WEBH 2WSKA 5C6TL 3CJJA 4XVSL 3INUH 3MFFB 5FA3B 4PR5A 1ZT7B 3RDTA 3ROLB 4CVXA 4FFYL 2V7NA 3THMH 3WEXA 2YWYA 3T3PE 2IPTL 3LRHA 5CZVH 5K9JH 1RZJL 5D2LB 1RIVL 4HEPG 1NFIB 5DI8B 3AAZA 5E5MA 5D70H 1X9QA 1AGCA 3OPZH 1GC1H 1EO8L 2NW2A 1DBML 1I1AB 1FFNA 2QLVB 3ALPA 3O2WL 3KJ6L 6FABH 2PNDA 5DJ6B 4NM8H 2Q3AA 3NH7L 4Y7MA 1BFTA 3NN8B 2CKBB 1KCUL 3QCUL 5DK2A 3TT3H 3GIVB 3IU3A 2VYRE 1A9EB 3V9FA 1WBXA 3ORJA 1NFDB 3HC3L 3JVGA 5DRWB 3VXSB 2D7PA 4QRRE 5IR1A 1HI6A 4ZS6C 4JFPB 4X6DB 1FPTL 3BP5A 3U9PL 2BVTA 2DIAA 4HMDA 3HA0A 3SO3B 2QJDA 3MJ8B 1M71B 1AFVH 2KDGA 4UT7L 3CC5A 3OKOB 3O6MH 3RX7A 3B6SB 3NGBC 2BERA 3BISA 4MQTB 1CIDA 4L3ED 1NDMB 4NN7C 3LN4B 4MYWB 3SDXA 4BZ2L 3QUKA 1B9ZA 1LGVA 2YRZA 4L4TB 1CXIA 3HZYB 1G9NC 2W0FB 4UOW0 2NY5L 2O26U 2OR9H 4OF5A 5CSGA 4ZTPH 3MLXL 4Z8FH 4JO4L 4OFDA 4J8RA 1ORQB 4HDIB 4HIEA 5HSFA 3HC0B 5CILH 2O5YL 3LS4L 3FL7A 3S35H 1WUNT 2F74A 5TPWH 2BVOA 1JZ2A 3RJDA 2YA1A 2BVQA 3CXDL 4P0DA 4JDTH 4M1GL 3SDDC 4TSCH 4W70A 4LQ1A 1XGQB 4G80A 3DURB 2C1PA 5HYQB 2P7TB 4JZOB 4RQQA 5HBBA 3QA3B 4HK3J 1S5HA 1VENA 1EFQA 1JF1B 1F6FB 3NFSH 4R7DA 4WUUE 3FTGB 5E95B 1SHMA 3VFRB 5IMOA 3V8OA 3SGDH 1JZ6A 4KI5C 2EKSA 3RWGA 3IDMA 3KPSD 2P24A 1WCQA 3MRHB 5H94A 3SE9H 4PV9B 3MRFA 4AMKL 4TSAL 5JXED 2UWEE 1A14L 4DKAA 4U6XA 1Q9KB 4HW6A 4CMHC 5CLTA 4Y2OA 4PB9L 3V0AC 5EOQH 1R3JA 5CMAA 2IWGA 3BW9B 2Q6WA 1I7UA 3BI9X 4NM4H 3KYAA 1FGVL 5J13C 4MNQA 2E9JA 4LQFL 4RISL 3DNKA 1CFVH 3AS3A 4PJDF 4YDVB 3RUGF 5KSVA 2JJTA 5MEND 2X4NB 3CVHH 2WINA 2X09A 3IAPA 5E8PA 1T21B 2YD9A 3A0OA 3TJHC 1JPSH 3T2OA 1TCMA 4Y1AB 3DX6A 1S7QA 3WFDL 1JFQL 5HDBF 4S2SA 5KAQG 4BSJA 4NUJB 2Y4SA 3BUTA 4LRIA 4UNTA 5DJDB 4UQ3B 1I9RL 4H88H 1CFBA 2DI8A 3QXAA 4NKDB 3VWJA 5FM4A 4GG6A 2F53D 1HKLH 3DIFB 4KJYB 3UJIH 1CGTA 2OZ4L 2HJLA 5T5FH 2JJUA 1AP2A 4N1EA 3P2TA 1U8NB 1TQCC 1MJUH 1S7TA 3STLB 2JJWA 3O11B 5DR5H 4X6BB 3T4AA 1DQMH 2IPKB 5F9AC 3TA3D 3T1FB 4U1KA 1A7NL 4JRYE 2VDKH 3V6ZB 4GLRH 5KJRL 3ZL4H 1DDHA 5BO1H 3HE6A 1MREL 4ZPTB 4G8GA 1S7VA 3GJEA 2IBZY 3ILQC 4PJXE 3ULSA 4OKVB 1FJ1A 1NCNA 5ABDE 5CBEA 5F7FA 3L9RB 1FVEA 1QR1B 2WIMA 3HNTH 1OAYL 1ZLWK 3LKPA 2AV7B 1YNKH 4RBPH 4P2YA 3CMOH 3WUWG 5D1XC 4R4FL 5CEXB 4YGVA 1BIIB 4C56D 1VFAA 2DM4A 5JUEL 3OX8A 3RVXD 1YA5A 3SPVA 2R0WL 5DQDL 3FO2A 1XMWA 1U6AH 5C0EB 3QJFB 4LDEB 5KTEL 4TVPD 4MAUL 2P1YA 4JG1L 5TE6H 5DMGD 5J3HC 2R0KL 4JRXA 4ZOAA 2H8PA 5F7DA 3S34H 4GRLC 4LFHD 3IJSA 5BMFH 4HC1L 4GBXB 1WT5A 1ZGLP 4CVZB 1LEGA 3RUGE 5L9DL 4RA0C 3WFCL 1I4FB 2IAMA 4ZUUB 5KVFL 3OKEB 2AJ3B 3MMEB 4GOSA 4WWKC 4YO0B 5BW7A 3ZDXF 1XCQA 4I77H 2UYLA 3PV6A 1QSFE 5HGGS 3QP3A 5D7IE 3F65A 3UX9B 2E7LC 1HHHA 4HUWB 5A16B 4D9QD 4EBQL 2FH8A 4UZGA 5E08H 3IS1X 4P2OB 3NFPB 3O3UN 5GGSA 2MCPL 5CZXC 3NIDE 3D0VB 1C08A 1DBAL 1HINH 2VH5L 2EDKA 5L0QC 5C0JB 1JV5B 1W0YT 2BNUB 3EDKA 3FQNB 2X4PB 3NABH 3UYRH 1H5BA 1J0JA 3FN9A 4F58H 3DRQA 3X3FL 2AJZB 3JSSA 1KPUB 3REWA 2Q3ZA 5F96L 1VA9A 2MHAA 4JPVH 4XC3L 4FFVC 5I1CL 3D85B 4OB5H 3AGVA 2EDOA 3QUZA 4D9LL 4XP1L 5F1NB 3P4LA 2X4QA 1F4AA 4D0BA 3ZKMD 2VDML 3ULUL 4F37F 4EUPH 12E8L 1JF5A 4NHUA 4MLSA 1K3IA 1FNGB 4OZHF 5F7YC 4YHNB 4YGAB 2P5WD 1DEEA 2QSCH 2XN9E 1AGEB 3GSVB 4KKLC 3ARTA 1WBYA 3QNZA 3U7WL 4DEPC 3LQAC 4U1GB 5DRXB 5L2KB 2M26A 4DQOH 4EXKA 3EDEA 2P46B 1P5VA 2BC4B 4ONGL 3VXOA 4LSUL 3AROA 2AJVL 1SEQL 4H1LG 5C0IA 1X6NA 3ET9F 1BGXL 4X4ME 1RK1A 5JHDE 4XNMA 4L5FL 4BYHA 3FFDA 4BZYA 4KUZL 2OJZH 1H15A 4KTDH 4K3JH 3B2VL 4FQQB 4N0FB 1NC2B 3SBWA 1EJ6A 3CX5K 3F5WA 3V6BR 4YE4L 4MZ2A 1GC1C 3VE0A 1QRNA 4W4OC 3BT2L 1B88A 5F1SA 3CFDB 4FQCL 2NY6B 1HIMH 1U8PA 4WGWB 4U3CA 2DIJA 4U0RC 3VXPB 4PRBB 3VFWA 2AEIT 4OZ4B 3MRQA 3V6FA 3CX2A 5IB4A 1MRCH 4K3DL 2BSTA 3NCYP 1HNFA 3MX0A 2RQ8A 3DVGA 4FQXB 1WISA 1B2WH 4JDVB 3V52H 3SY0A 3MRKA 4E42B 4JPIA 3QH3B 1W0VA 3WN5A 1F8TH 3DOSA 4KVNH 4QTIH 4F2MA 2DQFA 4TRPL 3DO7A 1LNUB 2PW1A 2I9TB 3ZE2E 3G5YA 4OUUA 5DMKA 1UA6H 2AJXL 5IFHH 3RI5K 1A8JH 3GBML 3TWCL 5C2BH 5I19L 4FG6C 2VLJE 4JM2B 4PLNC 4JM4H 4XI5D 3MNWA 2DQGH 3QUYC 5K93A 1VADA 2J5LB 3S5LG 4RMVA 3WNMA 2OSLB 1D5ZA 4OV5A 2ZNWA 1QBLL 4FFWC 5DEFA 3CCHB 1I8IA 5FYKD 3UTSB 1ZSDB 2QQLL 3UP1A 4MA3A 1G7IA 1WWCA 4QXGH 4YDLB 3QHFL 1KCVH 4XMKL 1ZGLA 2OTPA 3CUPA 2DM3A 1HZHL 2NY3B 1BWMA 4OF0A 4DFIA 4X6CF 2XTJD 4AT6B 3VD4A 5FCUL 4XWGL 5AYUH 4N8PA 2HTKD 5B8CA 5CIPH 1IM9B 3S3SA 3X14A 1UXWA 4Y4HB 4OZHE 3O9WC 2VKWA 3KPRB 3TJEL 4KDTA 3OF6A 2C4FT 3CSYB 3WJJA 1AXSA 5MP6H 4HWEH 5AD0B 1U8LB 4WO4C 1OL0A 2N7BA 4NJAH 2N4IA 3ARVA 5E2JA 5SX4H 5ISZD 4XPBL 2QSVA 4BQ8A 2WZPD 1S7SA 3OJVC 2YD2A 3RZCA 4LSRL 4WTWA 3IDGB 1S9XA 5DA0B 4PGDA 1ZTXH 4IMKA 2VXSH 3EHBD 1JUFA 2OZ4A 4WNQB 1V7NL 1TFHA 2ICEB 4LAQL 4MHHG 5C0NC 3F7VA 4XNZB 1VDGA 2E6JA 4ODTH 4POZC 3FB6B 1LEIB 3PHOB 4JVWA 2W1NA 4N9GA 4LF3B 5CJOH 2BVEA 1HYSC 2UVEA 3W81A 5CS7A 1BFSA 1JPST 3C8DA 3PJSA 2JCCF 3M8OH 1IC5L 1WVZA 3PL6D 4JB9H 4U2YA 3SE8H 4OIAA 4P46B 5I76B 4OLUL 3BD5A 5FECA 2E27H 2IGFL 3WIIH 4LCCB 1A2YA 5CP3H 1JHLL 4XAWL 5D71L 3D3VB 1RQ5A 3TNNB 4BFEA 5C09D 4XPTH 3BHBA 2DICA 2CPCA 4HAGA 1S3KL 4ELKA 4G42B 2P8LA 4WUKH 1MCEA 3FQTB 4Q58C 4FTVA 3ALXA 3VFOA 4GAFB 3RWFA 1QSVA 4PJDB 5DJCB 2DQCH 3OXSB 4MVBC 1MCPH 2EC9T 3MRJB 2CLZB 2VSDA 5ERWB 5TDOA 4Z7QF 1DVFB 3K81A 2X5PA 5ACZA 4J2XA 1JNJA 4ONFL 4KJPC 1MHEB 4TTGA 4NP4L 3GB7A 1JGUL 3GMOB 4FQHB 4PRNB 5D1ZA 4HC1A 1RZ8A 1RZFL 3E2HB 1LP9F 1YEKL 3IKKA 1X5HA 1ZANL 3RIAF 5E2TL 1F3RB 2ZUQC 4GW5A 4HK0B 4JANA 4TVSa 4AEIL 3DYOA 5D5MA 1XCTA 1NUGA 4EN3D 4LASH 1QKZL 1MHPH 4JCLA 1J10A 1R3LA 3GKWL 4KZEH 3EYOB 1H3VA 1MFDH 2V6HA 4HXAH 4PJBA 4WW2A 3GI8L 1IAII 3PQYD 3VG9C 1G6RL 1T6WA 4O51A 1KJVB 2HTLC 3TP4A 5I30L 3LKRB 5E9DD 5F7NC 1K3ZA 5AZ2L 3TPKA 4JY5H 2AQ1A 4PJAE 4XPAL 1U58A 3AB0B 3ARDD 2JJSC 5M94B 4MA1C 4LBEB 1Q9WB 4LCWE 1DL7L 3QYCA 2IALA 2R1XA 2VLKA 35C8L 5CUSL 5ICYB 3ZDZE 4QRTB 2J1KA 5IB2B 3G08B 3DHJA 3PGDA 4HLJA 4LARH 4X8JA 5JPMB 1MCIA 4M61A 1JPGB 1MELA 4F7TB 3WHXA 4Z7UA 1QO3B 3AU1B 3GGWA 2I60H 2QADC 1BQLH 3B9KB 4I18A 4LLVA 1CFQB 1DN2A 2JELH 3VFUA 5CSBA 5DQ9B 4Z0BH 2HA1A 4D9RE 3SDCA 4IOFD 4TNVF 4M48L 4KMQA 2NR6C 2I9LB 4UDTA 3VWKD 1K8IA 4RGOL 2JCCE 3D39A 5IQ9B 3P30H 5KVDH 1RJYB 8FABB 2NY1C 4PP1D 4KTYA 2GCYB 5IB1A 4HUXB 5IBTH 4HKXA 2DQTH 4NO0B 4S0TD 5BVPH 1JHKH 1OAZL 3HC4H 3IDYC 4QRSA 2PO6C 1GPOL 4X6FB 2Y6SC 5EBLA 2DM2A 1HQ4A 1IGJB 5F7KC 5IHUH 2V5TA 4MDIB 5DUBB 1FZJA 5HHMB 2YPLE 1CVSC 4XHQA 1DR9A 4PJCE 4L29A 5D7JB 2O5ZH 1DBBL 3EZJB 3MRLA 4XTRC 5EPMA 1OM3H 5GGVY 3I9GH 3JUZA 3CH1A 4JFHD 4Y16B 1T1XA 4FQ1L 1BBDH 4LLQB 5I1HL 4M93B 2CJUH 4GH7B 1NAML 1FH5H 2VLRA 3MOQA 2ZUVA 3BWUC 3ILPB 4Z7QE 2YUXA 3ARFA 3UTOA 1P4LA 5HHXH 1X7QB 1BD2D 3N9GH 2IC2A 2D4DA 4L8BB 4OZGF 5KSUB 1J7VR 2I5YH 1FDLH 2YA2A 2CR6A 5DLMH 3WNOA 4U6VH 2XXCB 2LU3A 4WFHE 1TTUA 5I1GL 4PJ8D 4MJIA 1J87A 1JYVA 1BVKA 1L7IL 3DMMC 4R7NB 4XWOD 2R39A 3VGAC 1WEJH 1L0QA 1J8HB 3ZKQD 1KIPA 4JN2A 2ERJC 3MACH 5IB3A 3TYFB 4WHYG 3UJTL 3O3BB 4JZJC 2APBA 3NZ8A 4NOFA 3HPLA 3QIWA 4Q6YA 5C0RH 3WJLC 1P4BH 2Z93A 3CSPA 1HNGA 1UACH 2GUOB 2EXYC 4UINH 5JZ7D 3FQRA 1MLBA 4R0LB 4FABH 2R15A 3FQXB 4K3GA 5J6GB 2F5BL 5JW4N 5LKNA 1UJ3A 32C2B 3OGCB 4LFHG 2DYPB 3IFNL 4Z9KB 3BSZL 5JLZA 3QEQB 3ZTNH 3EGSB 5EO1B 4DN3L 2H2SC 3L3KA 2MQ0A 4LAJH 5E94B 3ISWA 1D5XA 3BYYA 1XF5A 1MI5E 2FJHB 4F9LA 2ZSWA 1W72B 1T1ZA 3AUVA 1L9NA 4OLYL 3PWLA 3UTZB 4GW1B 4L4VD 5EU5B 3R0MA 1A6AA 4HIIA 1D9KA 1PYWB 2MKWA 5J0BA 3DXAB 4JO1L 4S1RH 4NKOB 3PWUA 4IRSA 4MNGE 4A6YH 3NA9H 1KJMA 4G8IB 3GSQB 2OMBA 1IC4H 4LPUA 5JOFA 2IH3A 3BXNA 3KXFD 4OT1H 3RFZC 1HE7A 5DFVC 1Y0LA 2GIYA 1QG3A 4S1QH 2HRPH 2AJSL 2VXTH 1KIRA 5E99L 3X3GL 1RULL 4OD2B 5GJTH 5IROC 3MV8D 5EU7E 4H0HB 3I6GA 3QNYB 2DJUA 2XQBH 3C2AL 4QRPB 5JDJA 4PJEE 2GSIB 1MNUH 5D9SA 4PJ5B 1A6TB 5IF0A 5SWZA 4ONHA 5JPNA 5IBUG 5BRZB 1CT8A 4U1IA 4LVOB 4IRJD 4G6AD 3VH8B 4O4YL 4OZFB 3DO3A 5C08E 4YH6A 1Q1JL 4X99A 4KK9D 1UKQA 5DVOA 1A1MA 1OARL 3L3IA 1QLRB 1A22B 2ZKHH 3WD5H 3LS5H 2I27N 3DVNB 1UJTA 5FYJH 5IVXE 4ZS7L 1T5WB 5IFJA 5LWYH 1RVFL 2F54E 3ROOA 1ONQA 5GGTL 1JPFB 1EAJA 1KIQA 3HB3D 2DTMH 3DX7A 5MERB 3L7FB 3WKMH 4NZUH 1KYOK 4U33A 1EFXD 1Q9OB 3C5ZB 2HT3D 5MI0C 3H9HB 4AL8L 1FVDA 1JWSB 3ARBC 4LOUC 3NZHH 3F58L 2Y5TB 1NMBL 1H3XA 4EEEA 1C12B 1YN7B 1AO7A 1NSNL 4YHLL 4FRWA 4MD5B 3GDBA 4I9WE 1TQBC 2ZOKB 1A1OB 1EGJL 2HKFL 3HG1E 3ARGC 3SJVB 1IAIL 5EZIL 2M8XA 4Q97A 5L8LB 4RX4A 5J11B 1V05A 4MXQC 4DVRL 4CRPA 1VERA 2CKBL 3NCBB 3DRTB 5T3ZL 1TXKA 1DBKH 1U3ZA 2RCSH 3LPFA 3N1GC 3MRMB 4GXVH 5F9OH 1WIOA 4IRZH 3KPQA 3BP7B 3O8XB 3P4NA 4UU9B 1AE6H 5EZJB 3O2VL 2P5EA 3HFMH 2X1QA 2Y07H 3QBTB 4HLZG 5IHZA 3RGVB 2PTUA 3TIDA 3TO4D 1G6RA 3TIEB 4ZTOL 3CLFL 1IEAB 4ZXBD 3DTXA 2A1WL 5MEPA 5E6IC 4OKDA 2NXZD 2Y7QA 4F7MB 3BZ4B 3S98A 1I1YB 4ZQKB 2OQJB 5HYIA 3CU1A 4LIQE 2PXYB 2HT2C 3CDGA 3VDCA 3UTTA 2FATL 5DEGA 4I0PA 3CZFB 5DXWA 3KLAB 2OX5A 4ODSH 1N5AB 2CDEA 5I66A 4D0CB 1FZOA 1QQDB 3HE7B 1LK3H 1OP9A 5F7EH 4R26L 4P23C 4GQ9L 3IFLL 5HJ3A 4DW2L 3UPCA 3Q1SL 1KTLB 4YBQC 2FDBP 5K9OB 3KAAA 5T1DH 1I7RA 1ZLVH 3GMMB 3IRPX 5I9QB 4RWYL 1MCBA 3B83A 4KPHL 2BDNL 5D96C 4JKMA 4MJ4A 4G43B 2VDPH 3L5IA 4JCMA 3FQUA 4BFGA 3RIFF 2O61B 5FHAL 3AREB 4GMTH 2FEDC 4L3EE 2BCKA 3HCVB 2PKDA 3QI9D 5E6YA 5ESVA 5I74C 2ZCHH 2Y06L 5JHLL 1G7MB 1U8OA 4HWBA 1KB9J 1UWXK 5I1DB 1EHAA 4J3SA 1DQQA 4NN6C 1LP9B 1WV7T 4MGXA 3L1OL 1SMOA 3L3GA 2ATKB 1N2RA 2ICWJ 3QRFM 3A6BL 5C7XH 3MLVH 2AXHA 1NAMA 3PE9A 4HS3A 2UZYB 3UTPD 1F00I 1JPTH 5FEBA 3UYPA 3UAJD 4HUKB 5ALCL 4WDIA 3EYFA 3CGTA 2VIRA 1X5AA 1CBVH 4JFOB 4P48A 2APXA 2AXGB 2YPKA 2ZNXA 1NCBH 2H26B 4J3VA 1SYSA 4OGYH 4OCLC 1K8DB 4M7KH 3KYNA 4U1MA 5J57B 3LKQB 2Z4QB 2DS4A 3U0WL 4PV8A 4MAYC 3R06A 1ES0B 3S7GA 1KNOA 4PBVC 5EBWA 3N1QC 4CU7A 5I1AA 2XXMB 4K3EH 3O6FC 4I5BB 5TDPB 3TNMA 3GZKA 3VFGL 1YN6B 5CGTA 3WFEH 1CDYA 3TN0D 4OF8A 3MQIA 2N56A 3SCMA 3UXFA 4BSWA 1C5DB 3DSFL 4G9FD 4U0QB 1A9BB 3B3IB 4L8SA 1A3LL 5I1IH 2YN3A 3GJFA 2IQAB 3VXQA 1U3HB 1KULA 3QSKB 4X4XB 4KKBD 1NBQA 2ILLA 2FIKA 3UTQB 1MCWM 4NC0B 1PKOA 4OQTH 2D03H 4HUUA 3W0WA 3AMKA 3OB0H 5D93B 3IT8D 4QXWA 4P9ML 1UH4A 1YNLL 1AXTL 1QNZL 3QHZL 4JFFD 1BZ9B 4A2LA 3QG7L 4M6AA 5AAWA 4KRPC 3D9AL 4QXTB 4JO2L 4KJWC 2ARJB 4H0GA 3QFJA 4CJ1A 1C7TA 4DN4L 3LHPL 1RURH 4QY8A 2V2WA 5ADPL 3WKNA 3MV9B 4YDIH 2ZP0T 4HV8A 2F53E 4KRLB 4Y89A 4PJ9C 4PRPD 4YK4C 1JL8A 1F3DH 1KENL 3EFFA 3UJJH 4LMQI 1P4IL 3FAWA 3DWTA 1RUAH 4OGAC 2ZUWA 3PWPB 4UV4H 1RU9L 3O2DL 4H20L 5EZOL 3BKCH 5LQBL 3VGEA 2DB8A 3GMRA 3JWOL 3KPLB 1N4XL 4KTEL 5ICZB 5LJYH 4JPWL 3JTTB 4XMPL 1P9MC 1IQWL 3MODH 5HGBA 5CGYD 1I3RA 4FFZH 1S9WB 3ZKXC 2A0LC 4MA7H 5BJTB 1GGIH 2X4UA 1IGMH 4LSTH 3U82B 5BV7H 1RJZB 1JBJA 3V4VH 1SJXA 3KDMB 4PFEA 4E41D 1XAUA 1J0IA 5LXGH 3LRGA 5DD5H 2HH0H 3H7LA 4WFFD 1BF8A 1ZMYA 3PP3H 5F7MC 1TZGH 2P8MA 5JA9A 2ZCKH 1ETZB 2OJEA 4C56E 4YNYB 4OTXH 1B3JA 1GOHA 1H8SA 1P7QB 1S8DA 4KROB 4V1DD 3RKDC 2NY2D 3BE1H 3S96B 4KMLB 3RL2A 1BHGA 1NBYB 4TVPE 5EZLA 4EIGB 1QEWA 4N8VG 3Q3GB 5GGTA 1UEYA 3EOAB 4ZDHB 2BNRB 3LMJL 2AEPH 3BDYH 5KSAD 1AI1L 2XZQL 4JR9H 2LU7A 2IFFH 2DLGA 3EUUA 3MFFA 5FA3A 3C6LD 3MUGB 3EOBB 1G7HA 5SWSB 3K8MA 5D2LA 4NQUA 3BZFB 4WCYH 4QHNB 1NFIA 5DI8A 2F5AH 4Y4FC 4OLWH 1Q9LB 3SE3C 4N0YL 5FUOH 4F57L 1EGJA 3GK8H 1KCSH 1I1AA 3RVVC 3T0EE 4D9QE 4NQEB 5DJ6A 3FT4B 3HI6H 3B2UD 3NN8A 2CKBA 4URTB 1T66C 4OV6F 3LRSB 5JR1H 1I7ZB 5C70A 3GIVA 1A9EA 4PPTA 5FO8B 1OSZA 1NFDA 5DRWA 3VXSA 4LCIH 2VXVL 4Y5XC 3UO1L 1B0GB 4U7MA 2YD4A 1XF2B 4JFPA 2N1KA 4LU5L 5E8NB 2UY7A 1OD9A 2FWOB 2HYMA 1N5YL 1CGSH 3D18B 5FO7B 2IANB 2IBBA 3MJ8A 5FB8B 3TV3H 1M71A 3OKOA 5D4QA 3B6SA 3TYGH 5DVKA 3C09C 3MGTB 1FORL 1NDMA 3LN4A 4IOSD 2NY7L 1FVCB 2A6KB 3ZE0E 4L4TA 4HGMA 3HZYA 5D7LB 2W0FA 2DBJA 2MTPA 3HR5B 5EUOE 4OFIA 5FOBB 3G6DL 2WIIB 2K9UA 1GGCH 1M1SA 3EFDL 3ZTJH 3ARPA 4AK1A 1ORQA 4HDIA 3HC0A 3QIBB 4W6WB 4L8CB 2ZJSH 1MFBH 5EIIB 4M5YH 2HFFB 5EUKB 2QQKH 3TH2T 3OTTA 1XGQA 1MJ7H 3DURA 1KEML 5HYQA 2ZSVB 4JZOA 4YUEL 4NNXA 4XRCB 3QA3A 3RTQD 4B7LA 4MS8D 5IIEB 2X1OA 3LB6D 3QDAA 3REVB 1JF1A 4R4BB 2KZWA 3SDAD 3VFRA 3FTGA 4CAGA 3BMWA 1CWVA 1D7FA 4KJQD 3MRHA 2YZ1A 1CU4L 3QFDB 2GJ6D 4PV9A 2ITCB 2Q8BL 3QDGE 1Q9KA 1YQVH 4Z18A 1FBIH 2EEBA 3MOBH 1IT9H 3HMXH 3QWQB 3BW9A 4RCAA 3N1MC 4O00A 4ZSOB 4ERSH 2BZDA 4YXHL 4FQLL 5EWIH 3UEZA 6CGTA 1D5IH 4YDVA 4PD4K 2X4NA 2A83B 1T21A 5J89A 3W5MA 3QEGH 1BECA 4C59B 1G0DA 3P11L 3V4PL 3O4LE 2WUBH 1JK8B 3ZT7A 3L3JB 4PJIB 3BD3A 5SX5H 4RFNC 4JHBA 1YDPB 1MVUB 5FYKE 3ZSSA 5DJDA 1HH6B 1DLFL 2D0FA 4UQ3A 2VABB 3VDAA 4NNPH 2XZAH 1MCDA 4NKDA 1C5CH 1F2XK 3IU4L 1OAQH 4NUGL 3DIFA 4KJYA 2XTJE 1EAPB 5E8EB 1F4XL 4GS7B 1MEXH 4XNYL 3FOMB 4CDGC 3STLA 1MPAL 1NCCH 1MY5A 3O11A 4UTBH 4X6BA 2E9BA 2IPKA 4LSQL 2QKIB 4YDJB 1TZIB 1T5XA 2A6IB 1F4HA 3T1FA 3FFCB 2XZZA 1V5JA 2Q7YB 3V6ZA 3DROB 1HXYB 2DBLH 4ZPTA 2HLFD 4X4YA 4UILL 5ISZE 3PUCA 5L7XL 4OKVA 3V6OA 1ZXQA 1GGTA 4YZFE 1NANH 3F7QA 3L9RA 3LCYA 2AI0H 3RVUC 3PHQB 4Q9CA 1TCRB 3CFEB 3OKMB 5J12B 4UIMB 2ARWA 1QR1A 2ITDB 2VC2L 4RAVB 5JXAL 1KC5L 2AV7A 4Q0XL 5T1KB 4IOIB 1GRWA 1J12A 2NXYB 4GKSB 5CEXA 4U6YB 3ZKNC 4GG6F 1BIIA 2AGJL 2GYSA 1JTTA 4AG4L 3O2DA 1OGAD 5GJSH 2FX7L 5E1HB 1OP3H 5F9DC 4HWNA 4ZS6D 3SDXE 5C0EA 3QJFA 2R0ZL 4LNRB 1CFNB 4P9HH 3U4BH 5A2KH 1VKXB 1HOCB 2EC8A 5MEQB 1QHOA 1ROWA 2Z31B 1A7RL 5GS2D 5F6IB 3Q48A 1CD1B 1FFPB 2DMKA 4XHJC 2JKXA 3DYMA 5L2JB 2QQQA 4UTAH 4QRRB 1ZEAH 4NGHL 1EEZB 3MJ9H 1A7BA 3DJ9A 2OK0H 1KELL 2HLAB 5C09E 4OGZA 1I4FA 4ZUUA 2M1KA 4F8QA 3OKEA 2AJ3A 4LPCA 3MLZL 3MMEA 1UM6H 3EOYG 1FLTX 3K2UH 3GIZL 2VWEE 4HUWA 1ZS8B 3WO4B 5GRYA 1AGFB 5ELIA 1BFVL 3HNVH 2E6PA 3OAYK 4P2OA 3NFPA 3C8KB 3WDJA 4M3JA 4TNWF 3SDDD 3CDYA 5E00B 3D0VA 2YUZA 3MROB 2PUQT 5C0JA 1JV5A 2BNUA 4LEOB 3FQNA 4XVTL 1KFAH 1RZKL 5F9WC 2FD6L 3KG5A 4EI6B 1QVOB 3AC0A 3QWOB 5BV7C 4RFOH 1KPUA 2HMIC 2Q86A 2I07B 4KI5D 4MNQE 1CICB 4BZ1H 5JQ6H 3UPRB 2VUYA 3MPCA 1OPGL 3PQYE 1R3KA 5GISH 5EBGA 5F1NA 1PAMA 1NH6A 4GW4B 3LEVH 3FZUC 1JGEB 4LVNC 3A67H 3MCLL 5E9DE 4WUUB 1A6WH 1MQKL 4ZO6A 4G5ZH 3O3DB 5CJBA 3BRFA 5EOTB 3MCKB 3NCJL 1QSEB 4YHNA 1J1PL 4JO3L 1J88A 1T89A 1T7WA 3ESUF 5DD1H 1AGEA 3GSVA 4H8WH 3V5HB 4HS8L 4OQ1A 4GG6E 2J88H 3TJHD 4Y5VB 4Q6IB 5CJXA 5DRXA 5L2KA 3DHMA 5F1KC 3QZWB 2BC4A 1N59B 1KPVB 2HVJB 2Q7NA 3HZVB 1MFNA 4QOKB 4FQQA 4N0FA 1NC2A 1FAIL 4M7LL 4HGWB 4Y4KC 3NFNA 5LCVH 2YMXH 1N0LA 2G60L 4P2QD 3CFDA 5KBNC 4ONOA 4G8GE 5JXEC 5EORH 3VXPA 4PRBA 4OZ4A 2R56H 4NYLB 1CLZH 5JNYB 1WAAA 5C0AD 1I1RA 4JFQB 3IRZA 3L6FB 4FQXA 4XP9L 4JDVA 4F33B 5CINH 4JFHE 5L88L 4E42A 3QH3A 4FQ2L 2GKIA 2OP4H 1LNUA 2E7CA 4YXKH 2J8UF 2I9TA 4PJFE 3ILQD 1XR9B 4M7JH 1R5IB 1OTUC 4KXZI 3U4AA 2CRYA 4JM2A 2XG4A 5D6DA 3IB4A 5E7BA 2YBRB 2R8SH 3QWRA 4JRXE 2OSLA 5D1XD 2AS5M 4NQDB 3CCHA 2C26A 1I7TB 3UTSA 1OLLA 1ZSDA 4PJXB 5T3XD 4O58H 3VA2C 1Z0NA 3C87A 5EN2B 3QXTA 3WHE1 4QYOB 1OAXL 4KKNA 3OZ9H 1W72L 5I18L 2FL5B 2DQJL 4AT6A 1PZ5B 5J3HD 4YHYC 5D2NE 1IM9A 2R1YB 4Y19B 4GRLD 3KHOA 4Y4HA 4R97C 5ITFA 4PR5B 4JG0H 2NX5A 3T65B 3CSYA 1JYWA 4EI5C 3HAEB 3OR6B 4ZAKC 1E4JA 3MUHL 5JW3H 5TE7H 1UG9A 5AD0A 1U8LA 4WWKD 3HZKB 2EDWA 4WV1C 1T83A 1HHGB 2FSEB 3IYLW 3QXVA 2J6EL 5B4MC 1PLGH 4PBWD 5ILTH 3MLRL 3IDGA 4ESKA 3U7YL 1MQ8A 4TUJB 4Y5YB 2B0SL 3H9YA 2Q1EA 1YMMD 2ESVD 2V5SA 4WNQA 4AEFA 5CZXD 3K3QA 2ICEA 5F8RC 3TF7C 5D7IB 3FB6A 1LEIA 3PHOA 5BQ7B 1CE1L 4LF3A 3V8CA 1HQRB 4ZOCA 5I8OL 5IESH 5LGHL 3CVIH 5HVHC 1TETL 3HRZB 4JKLA 4G3YL 1U2CA 4FNLH 4P46A 4I3RL 5I76A 4QRUB 4O9HH 3BIKB 3HI5H 4FFVD 4G6FB 2ZUUA 5IEKB 4JHWL 1LO3L 4H26B 4LCCA 4NC1E 4ODVL 4YWGH 1VGEL 5ESAB 3QUKB 3D3VA 3VA6A 1CLYH 3TNNA 2FCBA 5DMJB 4BUHA 4PTUB 2FLBT 3I50L 4DAGH 2BJMH 2EE2A 4X0KA 1SY6L 4DGIH 4KKLD 4G42A 5IEHB 3FQTA 3T0EC 3VFMB 4EDWL 1J5OL 5B38G 5B22A 5FYLH 5DJCA 1EK3A 3OXSA 2X05A 4KZDL 4IS6B 2JB6B 3MRJA 1QRNE 5ERWA 3BPOC 4NZDA 1RUQL 4KAQH 5C3LD 1DVFA 1EXUB 3TT1L 4UUJB 1MHEA 3VFTB 3KR3L 3GMOA 4PRNA 1OB1B 2CDFA 2AXJA 1CDIA 1EEYA 2AJYL 3CDFA 3MRDB 2WNGA 3I3DA 4HK0A 5HHOD 1AXIB 3RRQA 1N8ZB 1XF1A 4XC1H 1PEWA 3JWDL 4YXLH 5CLWA 1HILB 5CBAB 1DQDH 4J3XA 5FO9B 3EYOA 3TZVC 5DK0B 4LDLB 1XF4B 4HPOL 1QLFB 3BQUC 5IVZB 3TESA 3RAJL 1YYML 1KJVA 3LKRA 4PREB 3TGXA 4Y1AD 1FIGH 3MNZB 4IIQB 1CIUA 4M1DH 1RFDH 5HYSG 3WFHB 1IFHL 3BWAB 4LBEA 1Q9WA 5F89B 3OQ3B 4OFPA 1NGXB 4P9HC 4BQ9A 5ICYA 1INQB 3D25B 3GSXB 4QRTA 4Z7VB 5BOPA 5IB2A 4CVUA 3G08A 5JPMA 3BJLA 3MOAH 4YR6B 1JPGA 4F7TA 5K59F 3DX6B 1QBAA 2MPAH 5MHSD 3DGGB 4JRWA 2APFA 2QQNL 1QO3A 3AU1A 3I6KB 2PYEB 1II4E 5DQ9A 3QUYD 1ORSB 15C8L 3RHWF 3BGMB 5FKPB 2YC1B 5ITBL 3LDBC 2FBJH 4FFWD 4M00A 4MCZB 1XIWB 3OKNB 3EYUH 4P4KC 1AQDB 4APQD 5IQ9A 1EUTA 1RJYA 8FABA 3SQOL 1JI2A 2GCYA 2GHWB 4HUXA 2FH6A 4PJBF 4NO0A 5C6TH 2JTDA 4NNYB 3BUYB 1WGOA 2UUDK 2X10A 4A2MA 5JW4M 5I1LB 4X6FA 1S7TB 4FFYH 3QUXC 1IGJA 2IPTH 4LL9A 1C8PA 1RZJH 1RIVH 3VXUD 5DJ0A 5DUBA 3O9WD 3QRGH 4M43L 3H9SB 1JGVL 3HN3A 4G7YL 3VD7A 2NY0B 5D7JA 3HMWL 2VQUA 3AFLA 1AR2A 1EO8H 4ODXB 1DBMH 4Y16A 1RMFL 4D0DB 3FO0L 3O2WH 3KJ6H 4LLQA 4AM0B 4G6ML 3GJEB 4WO4D 1BP3B 4JFED 3T2QA 4KGLA 3NH7H 4RAUB 3GSNB 3ILPA 4OI9A 4K8RL 1LEKA 2YUWA 1KCUH 3QCUH 3S37L 3BPCB 4XI5C 1X7QA 2D7TL 4L8BA 2FGWL 3HC3H 1F5WA 3MBEC 4Y2DC 2Z8RA 1RV6X 4AENB 1MAML 3IS0X 1FPTH 4X7SL 5C0ND 4POZD 4GBXD 3RDTC 3ULUF 3EJZC 3OHXB 3OKDB 4R7NA 4RZCB 5A2IH 4UT7H 1KCRL 2JJVA 3D2UB 4H8WC 3TYFA 4F7CB 3DLQR 4KC3B 4NFCA 1CDCA 4PRHD 5C0BB 5EU6D 2YS4A 2GUOA 3V5KB 1Z9MA 1Z9LA 1MJJB 1ERNA 4R0LA 1LQSR 4RMRA 4JFDD 2NY5H 3P9LB 3FQXA 3GHEL 1T0NA 5D1QB 5J6GA 3MLXH 4WI7A 32C2A 3EO9L 2DYPA 4BUGA 4BJLA 4O2EB 2O5YH 5K59E 3QEQA 3M07A 1XCQB 5DTFB 3SGDI 3DVIA 3S88L 3EGSA 1SMAA 2PF6A 5EO1A 2NY4B 4M1GH 3D0LB 3OAUL 4WFED 3GM0A 3TH3T 4KY1L 3MGOB 1ACYH 5DT1L 5I15L 1HSAB 2FJHA 2GTZA 1NGZB 4MVBD 5D5ME 5CGMA 4S1SL 1W72A 2DAVA 1JNLL 5T1LD 3UTZA 3FB5B 4PJBE 5EU5A 5INDA 3QIUB 3D85D 1PYWA 4KJPD 3D6GA 3DXAA 2NYYC 2W07A 4NKOA 1U8HB 4PTTB 4UB0L 4AMKH 4G8IA 1F2QA 4TSAH 1DN0B 3GSQA 2LAAA 1DBJL 1EVTC 1A14H 3PL6C 2ADIB 3VXMB 2NPLX 4PB9H 4U05A 5J1AB 1GGYA 2VLKE 2B4CH 2DJ4A 3RY5A 1T1YA 4K9EL 1SEBB 1FGVH 2R4RL 4Z7WE 3FOLB 2HTLD 2FHCA 1V3MA 3GRWL 1L6ZA 3QNYA 4Z7UE 3V4UH 5DD3L 2YD3A 4PRDB 2GSIA 4BH8B 4PJ5A 1A6TA 2DOCA 5DZLA 2XYCA 3Q0HA 2DRUA 5BRZA 2BNQB 2VDOH 4XNXL 4HWZB 4QRQB 2VWEC 4OZFA 5FGRA 3WFDH 1JFQH 1E6OL 4AZ8A 4PRPE 3D39E 3QNZB 3VXRA 5GGQL 2J8UB 4QKXB 3QDMB 1FYTB 2PCPA 1CDGA 1QLRA 3D87B 5HDLA 2QADD 1YEEH 3ULUE 1I9RH 4OLVL 1T5WA 3T0AA 1TENA 3EO1B 1FNAA 4GLRI 3ARSA 1JPFA 2NR6D 3BIAX 5FUZL 2OZ4H 4AEHL 2NY1D 5MERA 4KQ4H 3VE0B 4F15C 3L7FA 2GTWB 4NO3B 1S9YA 1Q9OA 3UBXI 3LN5B 3C5ZA 3H9HA 2HG5B 1A6ZB 1A7NH 1JWSA 2Y6SD 3ULVL 2JJTC 1SY6A 2VLRE 2Y5TA 3PDDA 1ZAGA 4HCRL 4P5KB 3U48A 5KJRH 1C12A 1YN7A 4PLKC 4IEFB 1RIHL 2OTUA 2BY2A 4MD5A 2WUCL 2X41A 3SY0B 4XTRD 1A1OA 3ARDC 1TITA 1N6QL 4V1DE 5E5RB 3WUWB 4O5LL 1O7SA 4F2MB 1U36A 3SJVA 4RGNC 4PUBH 1OAYH 3LQMA 2VN4A 4J1UA 4J3OC 4ENEC 5HDQH 3DRTA 1ZT4B 3VWJC 2D3VA 3MRMA 1YEJL 4R4FH 1YPZF 4PJCB 3VD3A 1AKJB 1IRAY 4RFEB 5JUEH 4LPTA 5GPRA 3BP7A 3S36X 3O8XA 4UU9A 1NAKL 1RUKL 2R0WH 3C5JB 5DQDH 1A6VL 1V7MH 5EZJA 1XR8B 3VWKC 5KTEH 3LQAL 4LHJB 1G7IB 4MAUH 1F02I 1DSFH 1UENA 3RGVA 3TIEA 2R0KH 1X4XA 3KPRD 3RY4A 1IEAA 3CH8A 1WSST 3DMMD 4NWTH 1J0YA 2ICCA 2Q8AH 4IJ3C 4F7MA 3BZ4A 1I3VA 4HC1H 4D2NA 4FA8A 1XGPB 4ZQKA 4ZODA 2OQJA 3HE6C 1MWAB 2BSSB 2QR0A 2PXYA 5D70L 5L9DH 1UXWB 3PABB 3OPZL 3WFCH 2EXYD 5FHBL 5KVFH 3CPLB 3KLAA 4JRYD 1N5AA 4KK6C 1JZ8A 3OL2A 4NM8L 3WMSA 1EPFA 1QQDA 3HE7A 4DVBB 5JW5B 2EYTB 5T1MB 1CN4A 4HH8A 1A4KB 4EBQH 1JCKA 5K9OA 1KTLA 3PF2A 2DLFL 4P5TB 3GMMA 2EE6A 5IT2L 3NPSC 1FLRL 1L9MA 2H2SD 4G43A 4RMWA 1DBAH 2O61A 2VH5H 4I48B 3AREA 3BYTA 2X42A 3HCVA 1PGRB 3VI3F 5JA8B 2ADGB 3O6ML 1G7MA 5CZKA 5J8OA 3HHRB 3OBAA 2XY2A 1WT5C 1X5LA 3IJHB 3P4OB 1RZIB 4C4KT 5F96H 5I1DA 4XC3H 2IAMC 5BS0B 2MQCA 4D9LH 4NO5B 5ADOL 3QQNA 4XP1H 5SWZE 1LP9A 4Y88A 5D2NC 5BW7C 1MY7A 1BPVA 1T2QL 1CL7I 2ATKA 4ZTPL 3ULUH 4WI6A 12E8H 1NLDL 5CILL 5KSBE 2B39A 5TPWL 4JFOA 3VXTB 2AXGA 5ALBL 1K8DA 1IGTB 4H1LB 3LKQA 2Z4QA 3U7WH 1DVFD 2EDXA 2VDNL 3F6LA 3LN9A 1QSFD 1ES0A 4OSUL 1AIFB 4R4NC 3WNPA 4ONGH 4WJ5B 5IHBA 1SEQH 1H5BC 2GAZA 4JREC 4I5BA 3MFGB 1LO2L 5TDPA 2OS7A 2H2PC 1YN6A 3NFSL 1BGXH 1S7XB 4L5FH 3ZLQC 1RZJC 4KUZH 1ZHKB 1C5DA 1A9BA 2BVYA 4R2GC 3B3IA 3QUZC 5C08B 3C60B 2IQAA 5D1ZB 3BT2H 1U3HA 4X4XA 1AO7E 2Z9TA 3TVMB 1BX2B 3KYMB 4JVUA 4JANB 5C0CB 3U7AA 3UTQA 5M95B 1XCTB 3U9UB 2N7AA 3O81A 4NM4L 5IVXB 1LDPL 4V2CB 3VRIB 3RWHB 3B5HA 3KJ4C 5BOZG 3ARBD 1J0HA 4LOUD 4WU7B 2E9WA 1BZ9A 4NC1C 5IJVA 3CVHL 5I75C 4QXTA 4TRPH 1EBPA 2R23A 4OFVA 2ARJA 1ZLVK 1LE9B 4EVNB 4PRIB 3B9KD 4C83B 2AJXH 1FL5B 3S5LB 3GBMH 3TWCH 3MV9A 4JLRB 3ARGD 5I19H 2FHBA 2XN9D 5JIIA 2P5EE 3SBWC 5HYJA 1NEZG 3VI3E 1E28B 5H2BB 1XF3B 3PWPA 1CK0L 2QQLH 5F3BB 3SDCB 3UJIL 4XMKH 4PG2A 3FRPG 2CMRL 2NY5C 1HZHH 1JE6A 5ICZA 5JHDD 3U30C 1MJUL 3BDBA 1P1ZB 5IMLA 5DR5L 3JTTA 1RUPL 5FCUH 2WBJB 1WCBB 3OJDB 4XWGH 5SX4I 1JZ3A 2L7JA 2DLHA 3RA7L 1S9WA 7CGTA 2VR5A 5BJTA 5E6ID 2VDKL 3GRWA 5C07B 1RJZA 3WN5C 1YEHL 3KDMA 5C6WH 3ARYA 1OAUL 1WIUA 3TJEH 5BO1L 4YBLC 1F42A 2A38A 2HT2D 2X9XA 4HULB 4HKZB 2B5IC 4TQEL 1DUZB 1ETZA 4UAOB 4BQ6A 3OGOE 5ICXB 2IF7A 2OBGA 4XPBH 4YNYA 1TTFA 1ZHBB 1P7QA 1OGAE 4P23D 4LSRH 3S96A 3FHAA 1NBYA 1T80A 4YBQD 3OAZH 3Q3GA 5DRZB 1TPXB 3EOAA 4ZDHA 1P4LB 1Z5LB 2BNRA 3SQBA 2VLJD 1V7NH 3CK0H 5DHYB 1IGIL 1J8HD 4G6KH 4P2RD 2WV3A 1T0PB 2B4CC 5HHVL 4C55A 2QBWA 3RQ3A 2CR3A 4GSDL 5B8CC 2JLLA 5GRUH 3RWCA 1QHPA 2FBOJ 4X5XB 4MJIB 2AV1B 5JIKA 5IP4A 3MUGA 1KTRL 2OI9C 3EOBA 1KJ3H 2R29H 5E8OB 1BVKB 5SWSA 1IARB 3BZFA 3OB0K 5T5NG 4KDTC 4HCRA 1IC5H 4JQVC 3WJJC 4QHNA 1REIA 2NXZC 1Q9LA 4OLUH 2IGFH 4L3EB 3SKOA 1VPOH 1JHLH 4XAWH 5D71H 5TH2B 3ZE1E 3WFZA 1GAFH 4NQEA 4LVNB 1U9KA 4TUKL 3RZCC 1AJ7L 5I71C 3LRSA 1I7ZA 3HUJE 2EICA 3O45B 1PSKH 1IZJA 4IMKC 3G9VA 4CNIB 5FO8A 5E08L 1B0GA 2O5XH 1XH3B 3MNVB 2DWDB 4MAYD 5E8NA 4I4WB 4HFUL 1HINL 4PY7A 2FWOA 3FAXA 4L9DA 2D7NA 3D18A 4RA3A 5FO7A 2A6JB 2IANA 5DA4A 1AD0B 3O6FD 5FB8A 5I73C 1AHWC 3JV0A 1T1ZB 4NP4H 5C71A 4YX2L 1ZK9A 1JGUH 4PS4H 3S35X 4F58L 5D2LF 4KKCC 2VISB 4Z0XB 2VL5B 3MGTA 4K94H 4Z76B 1YEKH 3EIFA 1D9KB 1FVCA 2A6KA 4NFBA 5E2TH 4AEIH 4MMZC 1QKZH 2D7QA 1AGBB 5IWLA 5D7LA 1FSKC 3HR5A 1FG9C 3KPSB 5FOBA 3GKWH 4QRPD 1G6RH 3PP3K 2HFGL 5DFTA 3QEUB 4KRMB 3QIBA 4KQ3L 4OF6A 4MXWL 5I30H 4L8CA 3KS0H 2ED7A 1KIRB 1K5NB 4XPAH 4ODHL 5EIIA 2HFFA 1C1EH 5EUKA 4QHLB 4G7VL 1P84K 4ZYKB 4KRPD 4FS0A 4KJWD 3E6HB 1BFOB 1DL7H 1G84A 1NL0L 1AY1L 35C8H 3UBXG 2R2HA 1XZ0B 5CUSH 4S0SD 4BFIB 2ZSVA 5MENB 1CL7L 4XRCA 4N9OB 1CT8B 2XG5A 1OTSC 3PWJB 5IIEA 3REVA 4R4BA 1FG2B 1KN2L 2F19H 2X4SB 3ECBB 4W81A 4PJ9D 2OJZL 2PR4L 5EBMB 2P8PB 2K7QA 3L3IB 1Q72L 4M48H 3QFDA 4PYHA 2AVGA 1IKNA 1CS6A 2ITCA 2DLEA 1YPZB 1BZQK 5C0AE 4JGUA 2F53B 3L95B 4PRAB 4WW2C 4XBPB 1KIQB 4WTZG 4QNPF 1NLBH 3DV4B 1ZV5A 1OAZH 2V5RA 4ZSOA 1MRFH 1GPOH 1B4JL 1DE4B 4M6ML 2A0LD 2ARJQ 4HWBH 1B2WL 4K71B 4Z78B 3TA3B 2A83A