4I13B

Nanobody ca1697 binding to the dhfr.folate binary complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
b'QVQLQESGGGLVQAGASLRLSCAASERLTVDYAIGWFRQAPGKEREFVAAISWGGGLTVYGESVEGRFTISRDIAKNTMNLQMNVLRPEDTANYYCAASRISYRVWNTIPYNKLTLWGRGTQVTVSSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrofolate reductase
publication title Exploring an alternative antibody interaction mechanism
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/immune system
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2012-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4i13B00
1S7RB 2VAAA 4N0CC 3K8KA 4UNTA 1AHWC 4J3VA 1UXWA 1GAFL 5C0ND 2EDOA 5T3ZL 2VQ1A 3FQWA 2ZOLA 4CGTA 4GO6B 1L6XA 3DMMC 1S9VB 5IKCA 3K0WA 4XB7A 1A14L 1IC7H 5CZVH 2E9JA 4YQXH 1RVFH 1GZQB 2VDRL 1NMCB 4PB0L 5GGSA 3QUYC 43CAA 2GJ6D 4QOKE 2X2YA 1GZPA 4AEEA 5GRUH 2DJSA 3M17A 5ACZB 3J8F7 3A6BL 3BO8B 2XTJD 1RULL 1X5ZA 1BPVA 5CINH 3W81A 4G8IA 3KPLB 4JFQA 4Z7WB 5I0DA 5FYKE 2X7LB 1PLGL 1T2JA 4XZUB 1DBJL 1IAOB 4NQCE 1ZA6A 5DVKA 4R97C 3VXSA 1W72A 4JM4L 1IRAY 4PIRF 2DQEL 3ZKNC 2P5ED 4MX7B 1N5AB 4UINH 4DK3A 4NQDD 4KKNA 5IFJB 1KJ3L 1HHJA 3NPSB 4A6YB 3EDFA 4XB8A 2YPLB 5DEFB 1FGVH 4OAWA 3AREC 1MJ7L 4JPWH 3SE9H 1ADQH 1A6ZA 3EO1B 4N68A 4I0CC 5F3BB 4PRIA 5ICYB 1BFVH 5D1ZC 3SKNB 1NCNA 3LZFH 4UT7H 3IDYB 4L9LC 4NCC1 4PY7B 4DKFL 4RRPG 5C1MB 3OKOB 5EIVA 5FAAA 5HYQA 1FYTB 3KHQA 4TVPE 1L7IL 2QADB 4U1KA 1M71A 2FYYA 3UXFA 5CP7A 4GH7B 2ED8A 1QQDA 4PLJC 5HGHA 4MA7L 3WMSA 4X9GA 2V7HA 4G43A 3RWIB 1WFOA 4FZEH 2NXYB 1HQ4B 4I8DA 4K7PX 4LNVA 3KPNA 4BZ2H 3ARBC 3EFDH 2ESVD 3O8XA 2E7LC 4MQSB 3SDXF 1XGYL 3QCVL 1NKRA 1QLFB 4O2FB 3TYFA 1A9BA 1P84J 4NO5B 3IDXH 1P5UA 1FFOB 4YNYB 5DLML 5DUBA 3FB8A 5E1AB 2HLAB 5IEHB 3GHBL 3GSNH 4JVUA 4AIOA 4XPGL 1T66D 3VXOA 4FQ2H 4QRRE 1P4LB 2Z8VC 5GGSY 1A1MA 3V0AC 5DRZA 3T0EC 1CD0A 5E5MA 1OCWL 2BNRE 3DPBA 3LEVH 4K71B 1FVDA 2DLFH 4IRSB 1XH3B 4HSQA 3F7VA 3H7LA 2PYFA 4X6CE 3V5HB 4YDVA 3HR6A 1IFHH 1LE9B 5MI0C 2GSIA 5H94A 5D5MA 1H3TA 3U4EA 3VFTA 5KANI 1IGTA 4GBXA 3RHWK 3ARED 4JGJA 5IHUH 5SWSB 4YDLB 3PXHA 4FFVD 4G6KH 1F4XH 4PJ7B 4LCCB 5D1ZD 4PJDA 1I8LA 4W6WB 2AEPL 5DUML 4ACPA 2X4RA 35C8L 2P8LB 2ICES 2F74A 2YPLD 4JR9L 4XVJL 4D9RD 2J1KA 1DQTA 3TNMB 4S1SL 2PO6C 2J88L 4ODXB 1FV1A 3KPPB 4WFGE 5EO9A 5L88H 2CXKA 4W6YB 4M7ZC 4H26A 1KJ2A 3ELAT 5TGBB 4L29A 3BGAA 4WNQB 1A7QL 2M26A 1KBGL 3LQAC 3MREA 3KLAB 2UVFA 2D7TH 3GMLA 3HC3H 1OF2B 2Y5TA 4OLXL 2AK4D 1FYTD 1WFTA 3ARBD 3MZGB 2CUMA 3QO1A 2QADD 1S9XA 1C12A 3H9SB 1YNKH 3QWRD 3GSUA 3T3MF 1LO2H 4L1HA 5HGAB 2WBJC 3GJFB 3QHTC 4YPJA 1OVZA 5JIIA 3KR3L 4K3DL 3OB8A 1YDPA 5GPRA 5IWLA 4ODUB 5C2BH 4PJEF 5TJWK 3ZHDA 4HXAH 4D0CA 3KWWB 4JG1L 1WUNT 3HMWH 2HVJB 3QIBD 2CIKA 4XNXL 1P53A 2DF3A 3BKYH 3GSWA 4I2XE 4BK5A 1C5CH 1F00I 1BQHG 4LSTL 1Z9LA 1OP5K 1UB5A 2HFFB 1UVQA 4YZFE 1VFOA 5E8NA 3D3VA 4QHMB 4KZEH 3ZKMC 1CFBA 3N06B 1MVUB 1OQXA 3BP7A 5MENE 4EQ3A 5HJ3A 1MFBL 4NFCA 3TJEL 3VGDA 4JCMA 4O51A 5I2IB 5IGXH 4F9LA 4IHOA 4Z95H 5LGKA 2YMXH 1JJUA 2DDQH 4WU5A 1YEIL 5LXGL 4H0GA 4PBXA 1Y6MR 1IAIM 2Z91B 4IRSD 4Q6IC 1CICA 3MOBL 2WINA 1HXYA 2JK5B 1SJHB 1RIHL 3ARGA 5I1AA 3O3BA 4M3JA 5DFTA 3PHQB 4JAMA 3RVWC 1BMGA 3CFDA 1SEQL 4QXTB 2VKWA 4KKCC 1WZMA 2DQGH 4LSSH 2H26B 5E8EB 4Y5VA 2X70A 5I71C 2EIBA 4P23B 1K9TA 3OB0K 4IMLA 1NBYB 4WHTB 4IDJH 1UCTA 1S5HA 3LH2H 3QDGA 4DQOH 3EYOA 2Q6WA 4XAKD 4AH2B 1NBVH 1OTSC 3DRQB 5B39B 3MXWH 5DJ0A 4JQVC 5JIKA 3V4VH 5ISZE 1SJXA 4FQCH 4LLVB 5DQJA 2FB4H 5HDLA 3JWNC 4MD4A 2KQNA 3MFFB 3WS6C 3JV5A 4NWTH 3SBWC 3WIFB 4M43H 1YEKH 2NPLX 1YQ2A 5CD5C 5H35A 2IAMC 4JDZA 4ZUUB 3H9SD 1RPQA 3CLEL 2OJEB 4KK9D 4M61A 5D7SL 2DRUA 3I2CL 1B4JL 2JLLA 3S8WA 3QI9A 4LLYA 4OZFH 4M7LT 3SDDB 1E28B 3CZJA 3ZKMD 1FBIL 2AVGA 1G0XA 1IZJA 3C6LA 2VIRB 3H9YA 1IE5A 3GBMH 4LOUC 4WW1A 4U3XA 4P2OA 4ZTOH 5EU7C 3HC4L 4AEHH 1LK3H 1NCDH 5BS0A 3LDBB 5SX5K 4LBEA 4X6DA 1OD7A 3C09C 3VXMD 4B41A 3I85A 4L8CA 4PR5A 1FDLL 4Y16A 3LRGA 1LD9B 4MZ2A 1LILA 5TE4L 3DUSA 3BD5A 3LVEA 1XGUB 3FO1A 3MRJB 3VXPB 5C9KA 4UBDD 1A7OL 4RNRA 4PPTA 1NAML 1BD2A 2FX8L 2Y07H 5INCB 5T3ZD 4GG6E 2N4IA 4O00A 4Z7OE 5JNYA 4Y5YA 1RZFH 2NCMA 4KTDH 1TITA 3CLFH 4BH7B 3QXVA 1LO3H 3BKJL 1NFIB 4PP2B 1R3LA 3TZVD 3FHAA 1F6AB 1I7RB 2EYSA 4G7VH 1BECA 3O41A 3QUMB 1WZ1L 4P23D 5J7CC 4XXCC 3HLAA 3GI9L 2JJSA 1KCSL 2Y7QA 2DMBA 2O26U 5IJVB 1XGRA 3QCUH 1IQDA 2A74A 3OPZH 4PJHA 4XP6H 4XPHL 3OB0H 3LOWA 2P5WB 1VKXB 2XACC 4PJBA 5DC9B 4L8BB 1N2RB 3UTTA 4I0PB 3WKNA 2RBLA 5A2IH 1TQBB 3BPNC 3STLA 1GRWA 1KPUA 4IRZH 1YEEH 5GRVK 3S88L 1IL1B 1HXMB 4R8WH 4LOUD 3KJ4B 5EBLB 4OM1L 5DF0A 4PJ8A 2D7MA 1AQDA 4YXLH 3DNKA 4PFEA 1OPGL 5E5RB 5ESAA 4YBLB 3IB4A 4KV5E 1T7ZA 3PP4H 3W5MA 4LVHB 4NWUH 1ZSDB 2X4QB 3TBWA 3OF6A 3IRZA 4ALAL 2NTSP 1H5BA 4PTTB 1RUPL 1LEGB 4Q7DA 3T4YA 4I4WB 4JANA 4HLJA 4F7CA 4HUXA 1RK1B 4QTIL 2AI0L 2OXGA 1JCKA 3VDCA 1P7KB 2JJTC 1LO0H 5F8RC 4J3WA 3IDNB 3RTQB 3I6LE 3REVA 4XP5L 3U48A 1BBJB 2WM0A 5ALBL 4OD3L 4TQEH 5I8CA 3OQ3B 1CBVH 3MV8B 4NKOB 3UDWA 1ZHNB 1MAMH 3IU3B 3TFKD 2OP4H 1WF5A 2J8UE 2IG2H 1M05A 1MREH 3FT3B 5C08B 4MNHA 5I30H 1JPSH 2OTWB 4X6FA 4GMSL 1K4DB 3LV3A 3MRMA 4OKVB 4AEIL 4KHTL 1R3HB 4O5LH 5DD5L 1A3LL 2KQMA 5JR1H 1ZT7B 5GRJL 1KB5B 1T03L 4BUHA 3HE6C 3JV6B 4N1CA 5L8JB 3DLQR 2EDWA 3ME0A 4P46A 3RA7H 3HCVB 5BV7H 1BF2A 1BEYL 3BIBX 2VLJA 3NZHH 4Z0BH 5AAMA 2P5WD 1NKOA 2VDNL 5JXEA 4HUVA 4I0PD 5D2LA 4KDTA 1CDJA 4MNQB 1AE6H 4EOWL 5JIPA 1KXVC 2VISA 3ALPA 1ES0B 4FZ8H 2W60A 3R8QA 4LAQL 4GAJH 4GRWH 4PRHB 3ZE0E 1UM6L 1IGCL 3NFPB 4KTYA 1ZOXA 1P7HL 2VZSA 4F2MA 5IFHL 3CXDL 2VXVH 3SDAC 4I9WD 1YPZA 2HRLA 4ZD3L 2APWA 4JREB 4MJ6A 2H45A 4M5YL 4D9QD 4OCXH 1YYLH 3L9RB 4HKZA 2SEBA 1H8NA 1U6AL 5SWZB 4LFHD 3RUGA 1YQVL 1KYOK 4MHHG 1CFNB 3LHPL 3JTTB 2IQAA 3NACH 4ZUWB 5EOQL 3HZYB 1IQWL 4JRXE 1TTUA 3O2VL 4NT6B 4H25A 2KKQA 5ESVA 2FCBA 3MYZA 5IMOA 4RFEA 1RMFH 3VJ6B 4ZUSA 4P5TB 4NSKA 4E41D 4KQ4L 5AYUL 4POZD 3H3PL 1LE5B 3EDEA 5CSZA 5DRWA 1QRNB 2EYTB 2Z92B 4RGNE 2Z31B 3TYGL 1YY9D 4IS6B 5IFAL 3MV8D 4HUWA 1U92B 3PWJB 1BOGA 5I1JH 5C08D 4WO4C 5DA0B 4FTVA 3PQYB 5F6HI 3KPQA 1NEZA 4CMHC 1M7IA 1R5IB 3QIUC 4YPGA 2XZZA 3NBNA 3VFWB 4M5ZH 1D9KA 2EDDA 3RY5A 1N0XL 4OV6F 5FUOH 4S0TD 3T0DA 5FKPB 1T7WA 1T7XA 1KGCE 3BP4B 5D7JC 1KC5H 3DI2B 3TT1H 1BX2A 4NZRH 3O6KH 3OX8A 1XAUA 4P2QB 4OF3A 3MBEA 4H1LA 3P11L 5C0JA 4HJGB 1A7BA 3QUXB 5EO1A 3SDAD 4WGWB 5A40E 2C1PB 5J4MA 3W9EA 4MNQD 2FEDC 4JLRA 4S2SB 2GAZA 2X44D 1MJJB 2X4UB 3SGKC 2VL5B 2YK1L 4EN3B 3GSNA 5F1NB 3D0VB 2D03H 4PRHD 1A02N 25C8H 1YN6B 2H1PH 4XP4H 4RQQA 5I1CL 3GSQA 5ADPL 1RUKL 2X05A 4WCYL 1ACZA 3CC5B 1CXIA 1KLGB 3LN5B 4G80A 1DLFL 5SWZD 5C0AE 3VE0A 2P24A 3UTQB 3V6ZA 15C8L 4JZNA 2DL9A 2BNQA 2IALA 5CUSL 4QF1A 3OL2A 2DLGA 3FB7B 3KDMA 3TESA 2VXUL 3G08A 1MWAH 2FECI 4P5TD 4F7EB 1AGCB 1X5GA 2BY2A 3BISA 12E8H 3KYMB 5HVHC 3QDJE 4PJAF 5EN2B 1N7ML 1M4KA 3BMVA 1QRND 4NIKB 2Z31D 4PYHA 4GSDL 1V05A 1UWGH 1RURL 4FQJH 1QSZA 1V5JA 1F90H 3PQYD 1RZGB 4HIHA 3TF7C 3WLWD 3IDMB 3GMNA 5FXCH 3U82B 1C08B 1JNLH 3BHBA 4XGZB 1IC5L 1VEMA 4HWUA 1SYVA 4K7FB 3KYNA 3NH7H 3OWEA 4DVBA 4PJIE 4GJTB 4PB9L 3GIZL 4CDHA 2ITCB 2C26A 4WV1C 4DAGL 5C8JB 2DLEA 4LVEA 1IEBA 1ZEAH 3H3BC 4PJCF 3TJHC 2CKBA 5GGTL 1MHEB 2F5BH 4B7IA 3P4NB 4M7JH 5EG6C 5C0FB 4NUGL 1CDBA 3QUXD 5A3ID 1JE6A 2A9MH 5LQBL 2Y4SA 2FD6H 4YWGH 1JGLL 5IB3A 5IF0A 4M6ML 4TSAH 4EN3D 2AJXL 3ABZA 3BUYB 4QRUA 5AUMB 2Y1VA 4ZODA 5JMOC 4OCNC 1MVFA 5DQDL 2O5YL 4JZJB 5B3NA 1T0MB 1UJTA 3CDFA 3CCHB 3IRPX 1J11A 5C0EA 5AZEH 4NNPH 5EA0H 4NQEE 1IM9A 4KK8C 5F44A 2ZUUA 4DVRH 5IHLB 1OY3B 1YECL 3DGCR 4HKJB 4YHPB 5SV4A 5F88B 4OZ4B 2W91A 2OM5A 1AGEB 4XP1H 3U9PH 1FRGH 4RFOL 5I1KL 2F53E 3CVHA 3C87A 5FM5M 5BZWA 1U8NB 1KACB 3B43A 3ES6A 4S10A 4DKDC 2D4DA 1RUAH 5DMKB 1QSED 2YZ1A 3F7PC 2NY1C 4NPYA 4NC0B 3MLWL 1EVTC 1R3IL 1TJIL 4KUZL 4F7TA 2QQNL 4U1NB 3HZMB 4N8VA 1AI1L 5FA3A 4G9FB 4YJZL 2YD5A 1HZHH 3OJMB 2E9IA 4M4RA 3V5KB 4CRPA 3KYAA 3UJIH 3D25B 4GQ9H 4MD0B 4Q9BA 4GKZA 5B8CA 1KTRL 1UWEH 3LQAH 4ZNEE 1J1XL 1E6JH 1S7TB 1JNNL 4MD5B 1CQKA 1Q72H 2E27H 3PUCA 4HCRH 2UZIL 2AJVH 3LB6C 4X4XA 2L4OA 1X5AA 2NW3B 4EI5B 5I66B 1KULA 5CMAA 5JO5A 4MDJA 1MCIA 1P1ZB 1XF3A 3A6CH 3C5SB 1BVKB 3S37X 1FP5A 5HHOA 3IETA 1S7VB 5D7LB 5HHXL 1I8IA 2YD6A 3QDME 2XN9A 2HVKA 2ATPB 4U1LB 1MCBA 1Q9KB 2HKHH 1KIUA 2G2RA 4J8RA 4YXHL 3IS0X 3SGJC 5DEGA 4XTRD 1SM3L 3WLBA 3QQ9C 5JUEL 3FTGB 1N8ZB 1MIEH 1XCQA 1VGKA 3TN0A 1O0VA 2V2XB 4XMLL 1ZKAA 1WAAE 5IG7B 4Y4KA 1A1NB 1BQSA 2W38A 1H15A 4Y19B 1MJ8L 4RAUB 1OSZB 1KTDB 3DTXB 4WVRA 5D71H 1CD8A 1EK3A 4HUNB 3N85L 4Y1AE 3KHOA 5FYLD 4GKSB 4YLQT 1W0WA 2C3VA 2D9CA 3ZYZA 2ZP0T 3BD3A 1CR9L 3F5WB 3VD5A 1ZVYA 4WUUA 2IJ0C 1PKQA 3K81A 3VI4F 4NDMB 5EC1A 5ETUA 5HVFB 5D2NE 1BVLA 2JELL 1N5YL 2M8XA 3R1GH 4S1QL 4OCRL 3U36B 3TO4B 4FQIH 3B3IA 1FZJB 2QSQA 5F1IA 1IKNA 5EU4A 4F15B 1VESA 4PJ9C 3LKNB 3PGFH 2P44B 1NGQL 3WXVL 3X3FL 2V9TA 5FHBL 2FGWH 2IANA 4P4KD 3A6BH 3O6FA 4M1GL 3HUJB 1BZQK 2ZUVA 1MHCA 3A6OA 4EI5D 2F54B 3MUJA 2IADA 1F8TL 3QH3A 1G0DA 3TGXA 3PHSA 1PLGH 3RWGB 4D3CL 5CSGA 1NCAL 5F7LB 3RKDD 4F57H 5BOZG 1DN0B 4PJ5A 43C9A 4MQXC 1UWXH 3RDTB 5D7LD 3N1MC 1KXTB 4IJ3B 1MCWM 5IR1B 4XPTL 4YXKL 4TYUA 4N1HB 4FA8A 2DQEH 1KB9J 1FIGL 3N9GL 3RY6C 3O2DL 4XRCA 2ICWB 4BSVA 1HYSC 1J8HA 3O3DB 4F9PA 3MC0A 3C6SA 4KZDH 3QNYB 1MFCL 5ITFA 4HWNA 1A3RH 4PRDB 2PYEE 5F7KC 3RBSA 2NX5E 1LP9E 3DXAA 1IJ9A 4YK4B 1K5NB 4I0KA 5KOVC 1MELA 4Y19D 4MSWA 5DTFB 1KXQE 5FECB 2A6JA 5I16B 1MCOL 1R3KB 1ACYL 4NZDA 5CIPH 3P9MA 2DTML 4LLQA 5A2LH 1W8NA 3WKML 5K9KA 3UPCA 3CDYA 4OF7A 1PZ5B 4I3GA 4GW4A 3TT3L 1T5XA 1DVFA 1FQ9C 3CDGA 3QUZB 5DUPL 4EUPH 1A7NH 1XR8B 5C0CB 4JFYA 1JK8B 5FKAA 2BMKB 1FO0L 5ILTL 2VUYA 3O3EB 3GSXA 4HMEA 1H0DB 5INDA 3MMEA 1WZKA 5DLMH 1UJ3B 5J1SC 5C0GA 3REWA 4J7RA 3VFUA 3GHBH 1G7JA 5F7HA 4XMPL 2AV7A 4JFXA 1XR9A 3G5XB 3MA9L 4XCCH 3DV6A 1CE1L 1I1YB 1U91A 2IMNA 1RFDH 4LSPL 2AJ3A 3L3JA 4X6CF 4HXBH 5LAXA 2YS4A 4QEGA 3HPJA 2JCCB 4IM8A 4C4KO 1PAMA 2GJ6A 2A83A 2J4WL 4HAFA 2R4SH 4XNMA 4G42A 1IGJA 4RMRA 2HJFA 4Z9KB 2P48B 1N59B 1FZOA 35C8H 1LO5B 5JW3H 4H5SA 1NUDA 1IGFL 4JR9H 4XVJH 1AKJA 4FP8L 3DBXA 4OTXH 5EZOL 4QWWC 4S1SH 3X12B 3RY4A 1MFEL 4ESKA 1BGXH 3L3DA 2R2CA 3FOLB 1QBLH 1YEDA 4NQXA 1RZJC 1A7QH 1DLHA 5KS9B 2QSTA 1GGBL 5I76B 1CFQA 1GGUA 2VH5L 2WQ8A 3ISWA 1I8MA 4ODHL 2ZSVA 1OWWA 2P5EA 4N0YL 3HI1A 1MUJB 4M48L 2QTEA 2O61A 3AY4A 4NQDA 2NY0B 2PW1B 3Q6GL 4LDLB 3GFUA 3O3AA 4EVNA 2A6DB 1HDMB 1I85A 2CDEA 2G9HA 4J4PD 1NEZG 3EIFA 5B38G 2NR6C 5BQ7A 3ETBF 1OAQL 2B4CH 3QUZD 3D39E 4M6OL 5LGJB 1AHWA 3LEYL 3WFHB 2MFNA 4M4PA 5C0CD 2EICA 1A1OA 1ZGLP 4JG1H 2FJHB 5D1QD 4PGDA 1AGFB 1MRDL 2WV3A 4AEFA 3SE3C 4TSCL 3TA3D 1CLZL 2BSRA 3T2NL 5FYKL 1J0JA 3K7UA 2FEEL 1WT5C 4H1LG 4XPFL 5KW9L 1X5YA 4YZFF 3TJEH 3KXFB 5DZNA 2LQRA 2EDTA 3V6OC 1ZTXL 2FX9H 5HHME 1UG9A 4JFDB 2ESVA 4W70A 3P30H 2V7NB 4OCLC 2VR4A 1A4JB 2VLLA 3DVIA 3MOBH 3MGTB 2XXCB 3ULUD 2OZ4L 3OG4B 1K4CB 4G3YL 4E0RA 4ZSOE 1JGUL 2EKSA 1RIHH 3VRJA 4H20L 3V0WL 5H37G 3NA4A 4I3RH 5ACZA 4WW2F 1SEQH 3SO3C 4WWKB 3T3PE 5AEAA 1FORH 1D5BB 1YC7A 3WE6A 4K94C 5GGRA 3KPLA 4Z7WA 5D72L 3LIZH 5EB9A 5JHDA 5D9SA 1EUUA 1IAOA 2R8SL 4EZMA 2QHRL 1KOAA 4TVPL 4Y4FB 5J6HA 4GW1B 4NNXB 1A9EA 5BJTB 5DO2C 5F7YC 2EH7H 4DW2H 4MAYB 4JHWH 3AREA 3TH3T 3GBLA 3MV9E 5KG9A 4MX7A 5J13B 1N5AA 5D1ZA 5AWNL 2XICA 3MCLL 3F12B 1ZA3B 2NY0D 1U3HB 4A6YA 1B6DA 1WWAX 2YPLA 5DEFA 2FNBA 4DK6A 4OJFH 3CLEH 4PJGB 2XXMB 5DC4B 4R2GB 1N0LA 3EO1A 3HR5A 5H8DA 1B4JH 1QSFB 2YD2A 3SKNA 1ITCA 3CIQA 3BPOC 2DJUA 5CJXC 1VEOA 4BFBD 2HMIC 3OKOA 1BZ9B 1CZ8L 1S7QB 1XF2B 2AK4A 1FYTA 3ARBA 3AGVA 5HPMB 1T6WA 3RWEB 4TULH 2NY4B 4U6XB 5E6ZA 1CLCA 4OT1H 3QWRA 3BGFC 4HS6A 3RWIA 5TE4H 5FV2A 4U6YB 3KXFD 3VH8A 1TQCB 2EDBA 1BQUA 4RMVA 1ZLVK 3TVMB 1MI5A 5D96C 3HAEB 1LQSR 1A7OH 5CJOL 1RAMA 1G0YR 1NAMH 2FX8H 4P99A 2OTPA 3B5TA 3MUZ1 4GG6F 2DM7A 4QXUL 3QIBA 4Z7OF 4F58H 4UQ3B 4JZOB 1QLFA 3ZYIA 2YRPA 2YKLL 4I18C 4NO5A 5DJAB 2EYRB 5E1AA 5IEHA 4HD9A 4ZDHB 3TP4A 4WWKD 5E6ID 4Q9RL 3RWCB 5LCVL 5EU6A 2YC1B 3IAGC 1RJLB 2WWMD 5EBGA 3GI9H 3IAQA 1QG3A 2V5RA 3V5DB 4YHZL 5BRZB 1AJ7L 4IRSA 1XH3A 2Z0BA 1FL5B 1FNSH 5C6PB 1KCRL 2NYYD 1DANU 5GGRY 1LE9A 1EAPA 2PO6A 3A0OA 4WI5A 2BXZA 3NCEB 4MAYD 3ZSSA 2IFFH 1QFOA 3GMMA 4HAGA 5C7XH 4NKIL 5FGBC 1JV5B 4D8PB 2GEEA 3K3QA 4OZHB 3UTSB 1MLBB 2YD1A 4GAGH 1B0GB 4H0IA 1VPOH 1CXHA 2HG5B 2V5SA 4GG8B 1U3HD 4OGAC 1BFSA 3IDIB 3S88H 1AXTL 3TNMA 4KU1A 4KKLC 3CUPA 2BY3A 4R2GD 4OM1H 4K71C 2XRAH 3PF2A 5DI8B 4BSWB 4R0LB 5CD3B 4UV4H 4LLDB 1P9MC 1VERA 4ZXBB 3KLAA 1UENA 4KV5F 1GGTA 2ZUWA 1MHPL 3DUUB 4QRTB 1VFAB 2QV2A 5CKGA 1U58A 1RUPH 2NY4D 2R2EB 1UM5L 1KG0B 3LMJL 5FUCC 4M02A 2YPKB 5HGAA 2X9YA 5CP3H 4UOJA 2B5IB 1MQ8A 3IJSA 3TVMD 3U7YL 1NFDA 4YHKH 1FG2A 3MLPA 4JHAL 3QT2A 3FQUB 2X9XA 1OM3L 1V3MA 3U46A 3MJ9H 1DTUA 5ALBH 1U8QB 3ILQD 4F3FB 2MPAL 1ZLVH 3BZEA 2HVJA 3BP6A 1T5WB 4LASL 5DD0H 4Y2DB 5KSBE 5TPWL 2X09A 2XKUA 3DX6B 2J8UF 2BVEA 2HFFA 2JKXA 3VXMA 3C5JA 2XZCL 2Y25A 1DBKL 5I6XC 1X5HA 3HPLA 5E99L 3MV9B 1T2XA 4KHTH 5I2IA 5DD5H 5EU5B 4WI8A 3M8OH 5GRJH 2A6KB 3KJ6H 3IDGA 2Z91A 3BZFB 5K9QI 3VFMB 4JRYE 4OGAD 4ZQKB 4M9OA 2HKFL 1ROWA 1AP2A 1FNEA 3QRGL 3JV4B 2PTUA 1YMMA 1JGDB 3PHQA 3KG5A 1I4FB 4EOWH 1P4IL 4QXTA 3KPSB 2EIDA 3TZVA 3OKEB 3KPRE 5E8EA 4P23A 4TPRH 2FH6A 1EDQA 4PGCA 5IESH 3UPRA 3ZE0F 2W1NA 3NCMA 2NY3D 3SBWA 1MFDH 3C5ZB 2WMPA 5B39A 3UAJC 1NFKA 4RDQF 2W92A 3EUUA 3OZ9L 4G8GE 4DGIL 4Q58C 1Q1JL 1A6AB 5GJSL 4ZXBD 4WDIB 4PREB 2FGZA 2IPUK 3BH8B 3RX8A 3QFJB 4JO1L 3QZWG 3MFFA 4G8EA 4UQ2B 3LHPH 4Y5XB 5KJRL 3AB0C 3HFML 3QG6A 3UZVB 5EOQH 2LVEA 2E7HA 3P77B 2AERT 5HD8C 1JPTL 5A16B 3WSQH 1XF4A 2XNAB 3NIFE 3KPOB 5EZJA 3ZDXE 2R23B 2DTSA 4M8QB 3W39B 4OI7A 4WHYH 4DGVH 2ZG3A 1EEYB 4S1RL 4LVNB 1WEJH 4JY5H 4P57B 5HVGB 1VSCA 2MCPL 1DCLA 1E28A 1EHLH 1IM3A 4RBPK 4GRWE 4ETQB 2NY7L 5IFAH 1WFNA 4KVCL 2ZG1A 4N0FB 5GS0D 2NY6B 4Y2DD 1JHKL 3G5ZB 5EUOB 3CDCA 2C4FU 3QHFL 4ELME 1LD9A 1UT9A 1YEGL 4JG0L 2R0WL 1B9ZA 3RVVD 4N90E 3EDDA 5C0BE 3MRJA 2B1HL 2LTQB 4N8CH 2E3VA 4L5FL 3W9DA 2XZQH 1KN2H 4XNYL 5INCA 3SDDC 1IAKA 1OGAB 1W0YT 2FLBT 4OBRA 2UWEE 3S98A 3KGRA 3PDGA 4XXCA 1C7SA 4NZUL 2GCYB 1F11A 2D7NA 3P11H 5H2BB 2OR9H 6FABL 1S9WB 1YNLL 1TJGL 3LDBC 4K8RL 2PXYC 1NFIA 4LSRH 4HFUL 4LSDA 4PP2A 3L6FA 1GGCH 3KPSD 3MRLA 4ZO9A 1IGYB 1RZ7L 3MV7A 1INEL 3MLRH 4LCUA 5BCAA 5HPOA 1QLEH 4PS4L 3NGBB 3HA0A 5F72S 5E2VL 2ARJB 3FB5B 1G7LB 5ADPH 2I60L 2DJ4A 3VMOA 2AXGA 1A5FL 1QOKA 1XF5B 5IJKC 1DLFH 5EFIB 4DUXA 5CGTA 1VKXA 4GAYA 3QFJD 4C59B 1HIMH 4MXWL 4I0PA 3SJVD 4OV5B 4XCNA 4JB9L 1BFOA 5D93C 4DFIA 1CGUA 4UOW1 5J9PB 1T1ZA 4MJIA 4P9HL 5CS7A 5F7MC 2VMFA 1F42A 1WTGT 2VXUH 3I75B 4LVOB 5EBLA 2YUZA 5BVJA 3EAKA 1MRCH 5FGCE 1QO3B 4ERSL 3MRBA 5IW3A 3DGGB 1PY4A 2HLFD 1MCRA 5CAYB 3QUKA 4YUEL 3WN5C 4ENED 3EFFB 3G6JB 4KJPD 2NY6D 1OGTB 1RURH 1V7MH 4MMZC 3L7FA 4PTTA 5F3HB 3EGSA 2F5AL 2X4PB 1DP0A 1I9IL 3SKJH 1RK1A 1D5IL 1IC5H 2BRRH 4E41A 5D70L 1YUHB 1MEXL 1NAKL 2BHYA 3IDNA 3WIIL 2P8PA 4UB0L 4PB9H 4DOHB 1NGWB 1BBJA 1OGAD 3IXTB 5F9JA 4PJIF 1HOCB 2GTWA 5EBMB 4DAGH 1I7TB 3DYMA 4L3CA 5GGTH 1NC4B 3FT3A 1NMAH 5C08A 5JLZB 3HE6A 2OTWA 1XIWC 1HINL 1FVCB 1K4DA 5T1DL 1A6WL 5F7EH 1SY6A 1CF8L 3AM8C 4WFGD 3UJTL 5C0RL 2C3XA 2F15A 4OQTA 1R3HA 2GQHA 3B9EA 1JTTA 4WW2C 2VE6B 4CADB 3U0WH 3JV6A 2ENSA 4ELKA 3RTQC 1EO7A 2OI9B 4OZIE 4YAQB 4GXUM 3HCVA 3CSGA 5GISL 2E8YA 4LRIC 3FONB 3SDAA 1YECH 2PTTB 1EGJL 2VUOA 4CW1B 4X98B 3IGAB 4MNQA 1G6RL 1ES0A 2XIDA 4R9HA 3FQRB 1OAKL 3QEQB 4PRHA 1QP1A 1CFVL 4W81A 2OL3L 2EXYC 3MLWH 1R3IH 1TJIH 3FQNA 2CLVB 1I1AB 4NC2B 4P3DB 2NTFA 3F62A 2XA8L 3QXWA 5D6CA 3L9RA 5F7DB 5SWZA 2ZNXA 4XI5C 4FQQB 4PRIE 1SJVA 1CFNA 3U30B 2B7DT 3P4OB 4HUUB 4ZUWA 1AQKL 1JPFB 4I3SL 1JRHL 1E4WL 3QYCA 4N0UE 1I75A 2YBRB 2DKSA 3UO1H 1FZMA 4NT6A 1EUTA 1LDPH 4P2CG 5E6YA 5EPMA 2HRPL 1VADB 4P5TA 1RJYB 1RZJH 4M62L 3BRGC 1EXUB 1J1XH 5D7IB 3SDXA 4XX1G 3O6ML 1QRNA 1UM4L 4HLZH 4IS6A 3VWKD 3VDBA 1AR1C 3AAZB 3VXNA 3GB7B 2MSPA 4JN1L 1NC4D 3OKKB 4MMXC 5DK2B 3G04B 3PQYA 5KBNC 1RJZB 1U8OA 3BT2L 1MQKH 4KGJA 3VFWA 2GUOB 3E2HB 5FKPA 3EZ8A 1WCBB 4Z77A 5FM4A 3HNTH 2LU7A 2WQRA 3RVUD 3GRWL 5F8QC 2CJUL 3CFKB 2X4TA 1INDL 4M9PA 5DJ6A 4YDKH 1NCWL 3TPUB 4QRSB 4O2CB 1NAMA 5T3XH 2NY2C 3HE7B 4KI1A 4XMLH 1YNTB 5LGHH 4WGVB 4HJGA 3QUXA 1F3DH 3LEXA 2GW5A 2EXYD 1N6VA 1WAAF 1YEFL 5CZKA 5D5ME 4S2SA 1CI5A 1CE6B 5HGGS 5IB2B 2X4UA 4PGBB 1UZ6E 3BEVB 1MIML 4EN3A 2W65B 5F1NA 5GJTL 3HMXL 4YGAB 5I1IL 4PJDE 3QEQD 2FX7L 3A67L 3N85H 1P2CA 3GSOB 5CEZH 1X7QA 2ITDB 3CC5A 1I1AD 2VAAB 4RWYL 1CYGA 1TNMA 2ZJSH 3EOYG 4K8RC 3EJZC 4KKAC 4DEPB 4OLYL 3SGEI 5IVZA 3UTQA 4DN3L 1UXWB 2B0SH 3EZJB 2JELH 4K94H 4MVBD 2VQ1B 4JO2L 3FQWB 4JDVA 4LGSB 2ZOLB 4S1QH 1WV7T 5IKCB 4OI8A 3FB7A 4K3GA 3N50A 5K59E 3K2UL 1ZHKB 1QSEA 5CEXB 3WXVH 3X3FH 5C70A 2VTFA 1A6UH 3K4AA 4FS0A 2V9QA 1E27A 3M17B 3VGFA 2ZCLL 3NCYS 4WI6A 3IF1B 1JF6A 1FNFA 1ZV5A 1F8TH 4JFQB 1VENA 1OAZL 2COQA 1RZGA 3ARTA 5EU3A 4CJ0A 1JTOA 3IDMA 4LLUA 1MH5A 2D4FA 1ZXQA 5C3TA 1KIPA 4KRNA 1S78D 2YD4A 4YXKH 4LLWB 5DR5L 5IMKA 2E6JA 5SWQB 4XGZA 3VXUB 4KI5E 1DUZA 3N9GH 3VXSB 1W72B 4N5ED 3KPMB 4JE4B 3S5LA 4NZJA 2ITCA 4P2YA 1MFCH 5C09E 1PX4A 4XPAL 3ZT6A 1HHJB 1MHEA 1UACL 4X9HA 3P4NA 1BWMA 3AFLA 3BN9C 4M1DH 1LP9F 2LAAA 1A6ZB 2ZG2A 5ANMB 4OCWL 5IV2B 3VXRE 5AUMA 2Y36L 5JPNA 3ZKXB 1OOAA 1U95B 3P4MB 3B2VH 3BAEL 2RCSL 1P6AB 1R6VA 2DTMH 5DA4A 1T0MA 1BWWA 3CCHA 1EO8H 3WKMH 4U1KB 5KAQG 1M71B 2FYYB 3AROA 1ORQB 2RIKA 4WFHD 1NUGA 1QQDB 2X4SB 5HGHB 2XQBH 5B3JE 4MJ5B 4HKJA 4YHPA 4ONGH 4OZ4A 5JW5B 1NL0L 4KJYA 3AU1A 2C3GA 3UC0L 2ADFL 1FO0H 1TTGA 1U8NA 3O8XB 3AXLA 4U05A 4LNRA 4AMKH 1Z3GL 1IEHA 2DL2A 2FLRT 3ARFC 3MRKB 1RZKC 3G5YB 3TYFB 4XMPH 2HT3D 4YX2L 5DUBB 3FB8B 3ZO0A 1LWRA 3FFCE 3P0YL 4HIXL 3MA9H 2X1OA 3IFLH 4U1NA 1DQJA 3HZMA 2VDQH 1GGIL 4H8WL 5C0IB 3MJ8A 2W9EL 4Y8AA 1XGQA 5DRZB 5E5MB 2HWZL 3BWUC 2R1XA 4NN7B 4RGNC 4AENA 1FVDB 5CLTA 1P4BL 1U8JB 1IEAA 4X6DE 3D25A 4YDVB 4MD0A 2NZIA 2FR4A 3VXUD 2GSIB 2J4WH 5B39G 4EDWL 4HX1A 4UTBL 1CLYL 4P4KA 3VFTB 1FVEB 1IGTB 4GBXB 1S7TA 3OR7B 2JB5L 3WJJA 3IYLW 1JHTA 4PJDB 4EI5A 4FP8H 5FYJE 4HULB 4UNUA 1BD2E 2X4RB 2HT4D 3RGVD 4XC1H 2CMRL 4WJ5B 1HSBB 5EO9B 1BVKA 3P0GB 2CDFB 5MP6H 4UT6L 5IBLC 2H32A 5E2WH 5KSAB 2VH5H 4L29B 1MJUL 4ODHH 4NC1E 2ATPA 1DQDL 5FOBB 5HI5C 1VCAA 2A73A 1OTTC 1PX3A 2P8MA 2EDXA 5C07D 4ZS6D 2G5BA 5E4IA 5I18L 3CSBA 1H9VA 3HKFA 4NUJA 4ONFL 3QO1B 4GFTB 3LD8B 3QNXA 5HYFA 2V2XA 5IG7A 5BVPL 2EDEA 4BK4A 2EDHA 1A4KA 4G6JH 1GHFH 1ZLWK 4Y19A 3FT2A 1JHLL 4O9HL 3GJFH 2CQVA 4HBCL 4PJBE 1YDPB 3FRUA 3UTTE 2AXHA 2CIIB 1KTDA 4HH9A 3UBXI 2DMKA 1JTPA 3O8XD 3V8CA 4D0CB 1MRDH 3X3GL 1BHGA 2DLIA 2FATL 2CIKB 2DQDL 5IBTH 2EDJA 3GSWB 4Z7UB 5FHAH 4Q97A 1CLZH 2R1WA 4XPBL 1UB5B 5K93A 5E8NB 3D3VB 2FEEI 3ESUF 4NDMA 1ZTXH 2C3WA 5AD0A 1QKZL 2LVCA 1F2QA 2ZUQB 1VB9A 1MHHB 2BXYA 4O51B 4IHOB 2ZSWA 2APBA 3BVNA 4Y4HB 3ARDD 4WU5B 3T09A 3U36A 5TQ0H 1FZJA 2OZ4H 4G3YH 1IC7L 3LKNA 1KGCD 2EEAA 4YQXL 1RVFL 1HXYB 5HYEA 4H20H 3V0WH 3ARGB 4K9EH 4GBXD 3O3BB 4JAMB 4Q74A 3HUJA 3J7HA 5GRUL 1UADC 1URLA 1ZWIA 3CU1A 3CFDB 3T3PF 2XY2A 4NRZA 4Y5VB 2X70B 3PHOA 5CINL 1WLHA 3RWGA 4IMLB 1BJ1H 5TF1H 2E9WA 4WFFE 3LRSB 4HGWA 3QDGB 3EYOB 1DE4B 5IR1A 5KSAD 1G84A 2VLKE 5DJ0B 4KK5C 2DM2A 5T1LD 3FO2B 3IJHB 1BAFH 3CD4A 3HB3D 1I9EA 5DQJB 3WNMA 4MD4B 4LFHG 4LAJH 4HKXA 4C56E 2F8XC 2IH3A 3VFNA 3O3DA 4UINL 2AJYH 3QNYA 5H35B 3O4LE 4PRDA 1NMBH 2IH1A 1NCUA 1JF1A 1AIFA 4JDZB 1FGVL 1I3UA 3OBAA 5DK3A 1RK0A 4OF0A 3LKPB 4JPWL 4M61B 5ADOH 1ADQL 2R0KL 1T7VA 5HDOA 5DTFA 5FA4A 5FECA 3QI9B 5D2LE 1YZZA 4LLYB 1SYSB 1T7YA 4JFHE 1ZLWH 2OQJA 3D1MC 3SDCB 3C6LB 1A7PH 5BZDA 1REIA 3UYOD 1KCLA 1AR2A 3W0WA 4WW1B 4P2OB 1EJ6A 1KIQA 1Q8MA 5DJ2A 5BS0B 1WGOA 4HW6A 5BO1L 4LBEB 4OI9A 4L8CB 1EPFA 1PZ5A 3AS2A 4J4PA 4PR5B 4Y16B 5DS8A 3MXVH 2NXZB 3CH8A 3QUZA 3DUSB 4FZEL 5CJ8A 4MWFA 3ARQA 1XR8A 1DFBH 2VZUA 5IOPB 4Y4HD 3T04D 4BZ2L 4JQXC 3EFDL 3WNPA 2AV1A 4RNRB 2GSGB 1BD2B 4YC2B 5D1QA 3O3EA 3V0VA 5DZLA 1HE7A 3QNZB 5GGQL 4R6UA 2YWZA 3P9LB 4UU9A 4KTEL 3U9UA 3TA3A 3WNNA 3FN3A 3OKDB 1F2XK 3ARGD 3Q3GA 4G8FA 1YJDH 4Q9RH 2C7UB 5F71A 5EZLB 2DLHA 1R3LB 4FQ2L 4BFEA 1I1YA 2Z4QB 1D6EA 1RZ8A 4DTGH 1MCKA 3HLAB 3QUMH 2EO1A 3ULVE 3QDGD 1XGRB 1U8KB 3UPAA 4U1JB 2A74B 3QPQC 3BESR 1B3JA 4PJHB 1IFHL 1RIVH 1QFPA 2G75A 4ZAKC 1GC1L 3PWVA 4G6KL 2GIYA 3V52L 2YRLA 1F4XL 4H8WC 5T33L 1FNHA 3HNVH 5DYOA 4TRPH 3X12A 1KPUB 4HDIB 4EBQL 5KN5B 4X5LA 3UYRH 3GUTB 5DRXA 3GMRA 3FO0H 4PJ8B 1AQDB 3LS5H 5I76A 4OQ1A 3BWAA 2H6PB 3HZVA 3QISA 3QI9D 3ZDZE 5IQ7H 5FDWA 4ZFGL 3S3JA 4LSUH 2X40A 2D7TL 4PGEB 3SDCD 3C6LD 3HC3L 3QO0A 3TBWB 5DHVB 2PW1A 2FH8A 1UM5H 2R29H 5F7WC 5DJDB 3RVTD 5BS0D 2ARJQ 2A6DA 3BEWB 3T4YB 2VXSH 4U31A 1S5IL 3Q1SH 4HJ0C 4F7CB 4HUXB 3D85A 1LO2L 4K23H 5DD3L 2NXZD 5TH2B 4P2RA 3U7YH 5IUSA 1OLLA 4JHAH 3SE4A 3BQUC 4EIGB 2BNQE 5C2BL 4LSQL 1J05A 3VWJC 4JM2F 4HXAL 5D2NC 2VR5A 5I8CB 5TPWH 2UZYB 1K3ZA 1MLCA 4WFEE 1JWMB 3BKYL 5KSBF 1M05B 2XZCH 4MNHB 1C5CL 4JGMA 3ALXA 4U2ZA 4X6FB 2AEQH 2BDNL 3S96B 3QPQD 2VC2H 3MYJA 4KZEL 1DUYB 3LV3B 3MRMB 3BD4A 2VLRB 5BMFL 4R4NC 3TBTB 5F9OL 5IGXL 3X14B 2V7NA 5MHSD 2YMXL 3QEUA 1A4JA 2HKFH 1KB5H 1Y18A 3QRGH 4P46B 4LPYA 1WQVT 4KJQD 2VLJB 2VQTA 3ZKSD 1P4IH 4PJCA 4HUVB 5E6IA 2B2XH 3LPGA 1KN4H 1D5BA 4P4RB 4JJ5A 1M6OB 2VISB 2DQGL 2DWDB 2W60B 3S36H 5IVXE 1DSFH 3RPIA 3R0MA 4IDJL 3L3OB 3H2WA 1P6FA 3LH2L 5F1KC 4PJXB 4DQOL 1S7XB 1RZIB 2IFGA 4F2MB 4F37F 4PJ8D 3OZ9H 1NBVL 4X7TB 1Q1JH 1YPZB 5GJSH 4CVXB 3MXWL 4RIRA 4MAYA 1BLNA 4AM0B 2M2DA 3HZKA 5KJRH 3V4VL 4GRLC 1G7IA 3RUGB 2FB4L 2ZOKB 2QQKH 2QQQA 2IQAB 3F58H 3OF6D 4WI9A 1S3KL 3BQUD 3O2DA 2YWYA 5L6YL 4M43L 4N0RA 4KWUA 1P84K 3ULSA 1HH9B 2F58H 4PJGA 1VHPA 2G5RA 4H25B 5ESVB 3NIFF 1F3DJ 4OLWL 3ZDXF 4S1RH 5IMOB 4ZUSB 4V1DE 3VGGA 1M1SA 2KPNA 3V4UL 4Y4FC 1QBAA 2MQ0A 5CSZB 1S7QA 4GRWF 5HPMA 3N0PB 1EEZB 1X5FA 1PG7L 1IAIL 3RWEA 4HUWB 4U6XA 4UMGA 1JYWA 3GM0A 4AEHL 1NCDL 4YBQD 4FTVB 2ICEA 1F58H 4Z7VE 1JWSA 4ELMF 4YPGB 2R0WH 4M00A 4I18A 2FL5B 1D9KB 2VLRD 3TVMA 2B1HH 3O0RL 4JKMA 5E08H 4K3EH 4KPHH 4LHQB 2QJDA 1FE8H 1CG9A 2MJWA 5CHNA 2UWEF 4JZOA 1FO0A 6FABH 2ADGA 1IT9H 1RZFL 3QULB 1YNLH 4PG9A 3CLFL 2VLJD 3MBEB 4H1LB 4PRPA 4HFUH 2HTKD 5C0JB 1LO3L 3W9EB 1INEH 2VDPH 1RJLA 2GAZB 4NP4H 4G7VL 2V5TA 3QIWC 4IIQC 1TQCC 3GSNB 5J1AB 5E2VH 5ID0A 1H3WM 1FL5A 4RQQB 1H3PH 5HTSA 3GSQB 3QCUL 3ZHKA 5HHOE 3OPZL 5KZCB 3E1F1 4TUJB 5CBAA 1JZ8A 1JV5A 3WDJA 4JB9H 4XWOC 3DHJA 4D8PA 4CVWA 3VE0B 4OZHA 1MLBA 2KBGA 3BJLA 4OZGB 5J89A 4JZNB 1B0GA 4NYLA 4QKXB 2HG5A 4L4TE 3U1SH 4GG8A 1G7PA 2APVA 3IDIA 1JZ6A 4JO3H 4IRZL 1I8KA 2YD9A 3KDMB 3AC0A 3G08B 2ATKA 1FAKT 4R0LA 5CD3A 4ERSH 4YXLL 4LLDA 3VGAC 4ZXBA 2R0LH 4TNVF 3BH9A 5LJYH 1GC1C 4XC3H 3VFGH 3RI5F 3PP4L 5TFSL 1G9MC 4M6NL 4QRTA 3U0PB 2DQFA 3S4SA 4NFBA 4MXVE 1WBXA 5AG9A 3I6KB 2BHZA 4NKQB 4RSVA 1KG0A 1UKTA 3CJJA 4M3KB 5DSCA 2DIAA 3O81A 1PKQE 2WUBH 1NAKH 4GS7C 4HWBH 4KRMB 1LO0L 2CGRH 4P5KA 5GGUA 3WIIH 3F7RA 3HRPA 1U8QA 1C7TA 4JFFB 3RVXD 3W11D 4UV7H 2HTLD 1N6UA 1CBVL 2BZDA 1IEBB 1MAML 2JB6A 2IG2L 3EOAA 1MREL 4PRBA 4RMWA 1HINH 1JPSL 5I30L 1TZGH 1A6WH 1CF8H 5JXAL 2ILLA 3SQBA 1OAYH 5C0RH 5E4EC 5EU5A 5IF0B 4CU8A 3RWDA 3B9AA 3JV0A 5JR1L 3T1FB 4Q6YA 3WL9B 4ZQKA 1ZAGA 4FOMA 4OZIF 1RZKH 1S7UA 4PJ5E 2NY5C 3RA7L 4PJFB 4KXZH 4Z6AT 5KZCD 1X5XA 4OLVH 1IM9B 3NZHL 3HG1E 1SVCP 3KPSA 2HFGH 1KENL 1LMKA 4L4VD 3HNSH 4HUMB 1J8HE 3RWHB 5I73B 2V5YA 4GAJL 1TTFA 1QBBA 3ES6B 3P9WB 2OL3H 4G6AD 2VLME 3L5HA 2IPUG 4NPYB 5I1EH 4WDIA 3VFSA 3BH8A 3EYQD 3QFJA 3B8YA 4OCXL 4UQ2A 1YYLL 3O9WD 4QY8B 4IOIA 4W4OC 2R2BA 4Y5XA 3ROLA 3SJVA 3MRPB 4N8VB 3UP1A 1AQKH 1QFWH 4I3SH 3QPXL 1JRHH 5ENWA 3JWDH 3V4PL 3P77A 4NGHL 2X1QA 2DN7A 3GMOA 4PGZA 3RRQA 1JRHI 4YHML 2XNAA 3FZUC 3KPOA 2R23A 4M8QA 5JIHA 1TJHL 3H3KA 4KQ3H 4OFIA 3C5ZC 4GKZB 2EZ0C 3PJSA 2KZ1B 2Q7NA 1UH3A 3O6MH 3U0TA 5CCKH 4JO4L 4ETQA 1UM4H 4JFFD 1K2DA 3UTPE 4U0RB 1GJIA 3G5ZA 4OZFB 4MXQC 5CMAB 5EUOA 1FLRH 5JO5B 3MNWB 4QRRA 3QJHB 1CIDA 1I1CA 3BT2H 3QWOB 1XF3B 5GZOD 1QFHA 5E70A 3IETB 1EX0A 4M5ZL 4MA3B 5TE6H 2XN9B 4EXPX 2HVKB 1NCTA 3T8XB 3GRWH 4I48B 2Y6SC 3S6CA 1EHXA 3OKYA 1INDH 4WUKH 1KC5L 3FN0H 1SMOA 1NCWH 4MCZB 3EYVA 3U6RB 3TT1L 5DEGB 4NZRL 3O6KL 3WLBB 2GCYA 4RISL 5JOPD 1XCQB 1VGKB 3WFEH 3ZE2F 5E24E 1KIRA 2DB8A 4PRAB 4Y4KB 3TBVB 1LO4H 2GJ6E 4YO0B 4AL8H 1H15B 1AXIB 2AXFA 5D5MF 1JN6A 2BX5A 4GXVH 4U1SA 5GJTH 1UZ6F 4I13B 3GEWB 4F7MB 2FX7H 3U2SA 3VGBA 2XTJE 4LCIL 5JQ6H 2D03L 5CZXC 2ARJA 4XCEB 1JZ7A 3FB5A 1G7LA 25C8L 2H1PL 1BJ1J 1W0WB 2C3VB 1FC1A 1KT2B 5L7XL 2CKNA 1HILB 1S7WA 2BRQA 4WUUB 4U1GC 4DN3H 4OV5A 2DBJA 3CH1A 3PL6C 1Z0NA 5EC1B 5ETUB 4JO2H 3TH4T 2ED7A 4NQDE 3WN5A 5T3XE 3MV01 5I75B 3EYFA 1WC7A 4GOSA 3GGWA 1U3JA 5F1IB 1D6VL 4IRJC 5EU4B 4MXQD 5K59F 2VJXA 3VD9A 1QO3A 3PGCB 1NBZB 4X5XB 3R8BB 3UROR 12E8L 3RZCC 3DGGA 2W9DL 4M6AA 2I07B 2IANB 2ZCLH 2UZXB 1NANH 3WNOA 4L3EB 2HYMA 3EFFA 3G6JA 4J3TA 5D6DA 1NANI 2Q86B 1MHCB 1QRKA 3CK0H 1ZVSA 2IADB 5MENA 5HY9B 5CEZE 1UWGL 2X4PA 3BP5B 4JM2C 1HEZA 2VZTA 5EO0A 1F90L 5DT1H 1JNLL 5CGYC 2DQTL 5E94A 4KI5F 2XN9D 1YUHA 5DJ8A 3C60C 3V6FB 2QQLL 2K7QA 1NGWA 5J3HC 3WUWA 3VWKA 4KH2A 1HOCA 1FL3B 4WW2A 4XHJD 2GKIA 3C6SB 1NC4A 4BH8B 5J6GA 1ZEAL 2F5BL 1R0AH 4M7JL 1FVCA 3DXAB 2A9ML 4C54A 2Q7YA 5BW7A 4YWGL 4MSWB 1JPGB 2RB8A 5C0DA 2EIZB 2VE6A 4CADA 2H8PA 4KC3B 2RCSH 4RFNC 4Z7WE 2CDGB 3GSRA 4YAQA 4HPYL 5B4MC 4LLQB 5CBEA 4Y0GA 2HJKB 4ZFOL 3BOVA 4WEBL 1NLBH 2D9QB 1CK0H 3FONA 5F6IC 2RAMA 2W59A 4NNPL 2PTTA 5EUKA 3KYOA 4X98A 3RPKA 4XX1E 3SO5A 2Q3ZA 5BV7B 4GW4B 4OF5A 4RAHA 3CDGB 3UC0H 2MCG1 2CLRA 4FQXC 4GUPB 2BVTA 4P3CL 4I5BA 3U9PL 4YEFA 1FRGL 3MJGX 3QEQA 4JFYB 3RNQA 5L2KD 1NCCH 2R15A 1EA9C 3NTCH 3SCMB 2YPLE 1RSFA 3GSXB 4D9RE 1T83A 2PR4L 1X5KA 3JZ7A 3KPTA 5INDB 3MMEB 5J12B 2CLVA 1I1AA 2OI9C 4JM2D 5FCSH 2YSSA 1MPAH 2GT9B 3REWB 3GZKA 4QO1A 3VFUB 3P0YH 2IAND 5F7DA 4JFXB 8FABA 1RIUH 4O2EB 4L3ED 1GGIH 4H8WH 1XR9B 2XWBA 2W9EH 2XQYK 1DBAL 2V17H 1JGVL 3DV6B 1JPFA 1U91B 4PY8J 3VGHA 1FYTE 2YBRA 1TDQA 1ED3B 5HI3D 3WFZA 2FJGA 4OGXH 4KROD 5ICXA 4X6DF 3ULUH 1EXUA 1CLYH 2F19H 4GQ9L 3HPJB 4GG6A 1OB1B 3MR9A 2BVUA 3HRZB 4AG4L 1E6JL 1IGJB 4MQTB 3QFDA 1I3RA 3QQ4A 4XBGB 2E27L 4HCRL 1UEYA 2AJVL 4CU7A 2BVOA 1AKJB 3DBXB 4LKCB 3KPRD 3L3DB 3DXAD 3QP3A 2BY1A 3L1OH 1YEDB 1D5XB 2DS4A 5GS1B 1WWWX 2GUOA 3DSFL 5D7KD 1BBDH 3I3EA 1KJ2L 5FO7A 3BSZH 5I18H 2P5EB 3AMKA 1H8SA 2HKHL 3ZL4H 4BFIB 3CFKA 4QRSA 4UILH 1JNJA 4LU5H 3O3AB 4EVNB 1F5WA 1L4IA 5BVPH 1MIEL 2DQHH 3S34L 5BQ7B 2DKUA 1JHLH 5SWSE 5IB2A 1TENA 4PGBA 3BZ4A 1QZ1A 2APXA 2MKWA 2V2WB 1AHWB 1FPTH 4PJBF 4YHLH 3HAEG 3EDJA 1EERB 4JQIH 1A1OB 5F97E 1X5JA 3SCMD 5K33A 5FUCE 4PGDB 3QWQB 2XZAL 3BDYH 1PVHA 2ITDA 3VW3L 2CO7B 3G6AA 4XAKE 1Q9OB 4XPBH 3MTRA 2BSRB 2IMMA 3EW3B 2HT2D 5F96H 3C9NA 3HE7C 1QKZH 1UZ8A 2N7BA 5D1XC 4X7FC 1XT5A 2ESVB 3R1GL 3VFRB 4Z7QE 1X6NA 4YFLF 2VLLB 5C0BD 4FQIL 2PNDA 1ZHKA 5CJQL 5CEXA 3H9SE 4E0RB 3PGFL 4HZAA 2EKSB 1HQRA 3VRJB 2J5LC 2YXMA 4APQD 1JWUB 2FGWL 3DUHA 5I9QC 5J1TC 1MWAB 4R97B 1C1EL 2J8UA 4AZ8A 4D2NA 3EDKA 3VXTB 3IF1A 2X41A 2H41A 3WE6B 4FFWD 1AKJD 3FJTA 5GGRB 2J6EA 1JPST 5JHDB 2AJSL 1Z5LA 3MQIA 1OW0A 4UAOC 5D9SB 1AO7B 4F57L 2O93L 3DETD 1Q94A 1GSMA 5SWQA 4LLWA 3VXME 3VXUA 2DICA 2KUTA 5J6HB 2DI9A 1A9EB 3OXRB 3KPMA 4ZOAA 1U3YA 4QCIA 4J6RH 3AREB 5KG9B 1CLOH 3B9VA 2X5PA 3MSPA 3O11A 5D1ZB 1ETZB 1UEMA 5GZNC 1G6VK 5T3ZE 1T2QL 1TZHA 4L9LB 3RGVA 1E6OH 4KZDL 1IBGH 1A3RL 1AC0A 4HWEH 4JPKH 2R0KH 3HR5B 3PWLA 4N0CD 3SOBL 5ANMA 2FO1A 4Z5RB 5IV2A 4MNGB 3VMNA 3NA9H 5D2LF 5C07A 1E4XL 1U95A 3P4MA 1GOFA 5D1XD 2AK4B 1DZBA 3MRFB 3ARBB 1NPUA 3DMMD 1MNUH 2PKDA 3M45A 3S35L 5BO1H 2VB5A 4EXKA 1ORQA 2X4SA 5FM5O 1OTUC 4MJ5A 3T0BA 4HS6B 3G6DH 5JW5A 2XKSA 4XNZC 3QUYD 3VH8B 3V7AE 1X5IA 1EGJA 1MI5B 5IW6B 1A7NL 1G6RA 3HAEH 4FG6C 3KLHC 1XCTA 4I77L 4NN5C 4NJ9H 5GGQH 3T0EB 3MLXH 3QIBB 4KTEH 5FYJL 3MRKA 3G5YA 3P73A 2NLJB 3RX7A 1DQLL 1RU9H 5B21A 2Q8AH 1G7MA 4HS8H 3PV6A 3MOAL 1JZ5A 1NGZB 5MI0B 3DX7A 5F1SA 5C0IA 5EU6B 4DUVA 2A9NL 4XCCL 3ZKND 1KPRA 3ARDA 2GI7A 2VZVA 5IMLA 5JHDD 1RFDL 4L8DA 1YY8A 1AO7D 3GSVA 1CGSH 1U8JA 4OSUH 4YHNB 4HXBL 1EAPB 2PO6B 3W82A 3STBA 4BKLB 1FVEA 2DLTA 4M7ZB 3OR7A 4KJWC 3GMMB 4KRLB 1GC1H 2R4SL 3DYPA 4X0KA 3V52H 2R69H 3GJEA 3MROB 1G9MH 5T33H 4UT9H 3H9ZA 4EBQH 2Z93B 5JW3L 4G6ML 4OTXL 3RQ3A 1HN1A 4JN2B 4WJ5A 1HSBA 2CDFA 3CUPB 2R4RH 4NN7C 2WW8A 1BGXL 5I74C 3WIHA 5KSAA 3QG7H 1QBLL 1VFMA 5T1LA 4ZFGH 5FOBA 4PLJD 1QEWB 2WWKT 5TDNA 3ZDZF 5MEOB 2WBJB 3QA3A 5T5NG 3EO9H 5JZ7C 2A38A 4BELD 3WD5H 1U58B 1S5IH 5AYQA 1U8IB 1HWGB 3CFJA 3NIGE 5DD3H 4TOYH 2P5WE 1EH9A 1RUMH 4MA8L 1JL8A 4QXGH 1BQLH 2B4CL 3IJSB 1MI5D 1NFDB 2CIIA 1FG2B 4LSQH 4TVSa 3U46B 2A0LC 2R39A 1EBPA 3BYTA 1UA6H 3QDJA 3T0ED 3JTSB 3BZEB 3HMXA 3BP6B 3PXJA 4MJ4A 1H8OA 4Z7UA 1NC2D 2NY5H 2DOCA 1K3IA 1KB9K 4Q6IB 3VXMB 3C5JB 2BDNH 3IFNL 3LD8C 4I9WE 2IWGA 2LABA 3THMH 3HPLB 5BMFH 4D9QE 5EU6D 2HP4A 1W0VB 1MHHA 2D7OA 5F9OH 2FX9L 2DWEA 3EJYC 4Y4HA 4PP1C 4BZ1H 1P7QD 4LDOB 3P30L 1AY1H 5IWLC 3KLSA 3IDJB 3IDGB 2BVQA 1GPOL 5I71B 3S37L 5DD6A 1AP2B 1FNEB 3VI3E 2PO6D 1YMMB 4PJIA 1B0RB 2X42A 2FO4B 4E41E 4I3RL 3TZVB 3WHE1 2JF1A 4KI5C 1OAXH 1FORL 1ZE3C 1P69B 4WWID 4F9LC 4PGCB 2H2SC 5ERWB 3MV8E 3UPRB 3OKNB 5IVXF 3LIZL 3CXHJ 3LRSA 5C08E 1DE4A 1R24B 4HKBA 1VFUA 3X13A 2IAMB 1CICC 3D0LB 2FHCA 3D5OF 5ID1B 3FO2A 3IJHA 2RR3A 2EH7L 4DW2L 4JHWL 4MB5A 1H3GA 2WBJD 4G8EB 4ODTL 2WANA 1J0IA 2O5XH 1S3KH 4NQEA 3QG6B 5L6YH 4UDTA 4IOSD 4M8VA 1XF4B 4OLWH 4OJFL 3ZTJG 5EZJB 4CVZA 1J88A 3LKPA 3V4UH 1ULVA 3L95A 3C09B 2FIRT 3QHZH 4LSVH 4MNQE 1SYSA 4F7PA 1IM3B 3R4DA 3FQXB 1MFAL 3KLDA 4I1NB 1PSKH 3SDCA 2ZCKH 2NMSA 3RAJH 1TPXC 3CGTA 3VCLA 2YA0A 4PRHE 1PG7H 1IAIH 3MNVB 4P48A 4TULL 1IAII 5CIPB 3WBDA 4LCYA 4OT1L 4Z76A 2GITA 4Z7VF 4OCSL 1OAUH 1F4HA 5SWZE 3O0RH 4NJAH 1PDKA 3RVWD 5C9JB 5IOPA 4KK6C 3IFPA 4U33A 4XP9L 4UIKH 4B50A 2GSGA 3W9DB 1IAKB 4KKCD 4MA1C 4F37K 3QNZA 3H0TB 3P9LA 4KHXL 4F58L 1YMMD 3OKDA 4UNVA 1F11B 4P2OC 1NDGB 4B0MM 1MCWW 1OTSD 2C7UA 5C09D 3KYKH 5EZLA 1J1PH 3L6FB 3MRLB 3MV7B 3STZA 3MJ7A 3FHQA 1QRNE 2Z4QA 4LCUB 4M1CC 1KSRA 3MO1A 4P3WA 4ZAKA 3L3IA 1LEKB 2B1AH 3G5VB 3BPNB 1FNSL 1U8KA 1ND0A 4U1JA 3PQYE 3D69A 5CD5D 5AZ2H 2AXGB 4BFGA 5J56B 2IAMD 3HTLX 2I24N 4NOBA 3BW9A 4Y5YC 1ITBB 5JW4N 4ODVH 4CAGA 4F80A 1FNLA 2IFFL 4GAYB 3EOTH 5C7XL 4X7CC 4XCNB 1BFOB 1UB6B 3OAUL 5DFVC 4RGOH 1DN2A 4NC1C 1T1ZB 2ICWJ 4GAGL 1VPOL 4HDIA 4MJIB 1U8MA 2VOTA 4HC1H 5KN5A 4YFEA 5EC2A 4PG2C 3GUTA 4Y7MA 4P2QE 1TZIB 1FZKA 5I17B 3QDAA 2XRAL 2AABH 4HV8A 5BVJB 4JHZA 2H6PA 4Y1AA 4D0DA 1GXEA 3JSSA 4UV4L 3MRBB 4ZPVA 3QUKB 5TFSH 4PGEA 2ADIA 1JZ4A 4M6NH 3ARZA 4KGLA 5DHVA 3RX5A 4MXVF 3BQUA 3FFCD 5K9JH 1NGXA 5DJDA 3L7FB 2Q1EA 4DKAA 3VWJA 3BEWA 3EGSB 1QLRB 4PLKC 3CFBA 5LWYH 3ZTJH 2BSTA 5TH2A 4HJJL 4E41B 1EBAA 3DV4A 4R26H 3VA6A 4YHKL 4OF8A 4POYA 2P8PB 3IJYA 3MJ9L 2J2ZA 5F9JB 4LQFH 2GTWB 3PNWA 4L3CB 5DD0L 1JWMA 2XI9A 1WTLA 3NCYP 4ODSL 1YA5A 3HE6B 5SX4H 1H5BC 7CGTA 5JXAH 1EHNA 3ZHLA 5CWSA 1AD9B 3S96A 2CKBL 1ZHBB 5A2FA 1DUYA 4HH8A 3MV7D 2VLRA 2B4CC 3MLYH 3TBTA 4AJ0A 1SEBA 4NQSA 1I7ZA 1L9MA 1TLKA 3X14A 2GJZA 3M8OL 4Q9QL 5F9WC 3KJ6L 4G5ZH 1U8LB 4ELKB 1RJCA 4JFEB 4ZUTA 1ZHLB 1BJMA 1HKLL 1FGNH 3UDWC 1TVHB 4TNVK 4YFDB 4GW5A 3SDAB 4XBPA 1KENH 4NKMA 4P4RA 1M6OA 1NH6A 2NX5A 2DWDA 1LP9A 4GRLA 5C3LD 4MJID 4MB4A 4LEOA 1D5MA 4TPRL 2XG5A 5IESL 3L3OA 3CVHL 3MRRA 4PJXA 1S7XA 1MFDL 1RZIA 4X7TA 3FQNB 3Q5YA 4CVXA 4AM0A 2NTFB 4KUCD 4PLKD 5EULV 3L3GA 5D6CB 4XT1C 3SN6N 1V8HA 2DD8H 2ZOKA 2QL1A 1X4YA 4DKEH 5JXEC 1NUFA 3QPXH 4HIJB 2L7UA 3V4PH 4DN4H 3PWNA 4A2MA 4NGHH 4KDTC 2GJJA 1A7RH 4YHMH 1HH9A 1QFUL 1FZMB 3E6HA 1UCBH 3FCTA 3WSQL 1TJHH 5EORH 5EPMB 3QB7C 5MEQA 3NFNB 4IMKC 1JZ2A 4WO4B 4DGVL 32C2A 4HT1H 1WEJL 4JY5L 4CMHB 3B9KC 3SDXB 3QIUB 4JO4H 2DM3A 1EHLL 4RA3A 1ADQA 4U49A 2GY5A 3BRFA 2BSED 1EEZA 3VXNB 5FYLE 4CU6A 4BSJA 4ZFFA 3HE6D 1U8OB 3WNLA 2VSCA 5JA8B 3LS4L 2FL5A 5IMMB 5IB5A 5EIIA 2ZNWA 5F7UA 3CSPA 2WIMA 4Z77B 1XGTA 4N8CL 4G9FE 4YGVA 9CGTA 2XZQL 1KN2L 1IAMA 2X4TB 2Z9TA 4JFED 5DJ6B 4NN6C 3QULA 3EO0A 1NAMB 3HC0A 4RISH 3U83A 5GRZA 3ULVC 2NNAA 5JOEA 2VXTH 4Z0XB 2BVPB 2DQUH 2OR9L 3LEXB 1INQB 1YYML 4HPOL 4LSRL 5DC0A 1GGCL 4QHNA 4FXLA 3D48R 1ZLUH 4NNYA 3MLRL 1CD1A 5J1AA 1QLEL 4LCIH 1FJ1A 3GMQB 4BQ6A 4JVWA 3WUZA 4ZPTA 2ADJB 5ICZB 3PIQA 5L7XH 1JNHA 1P2CB 3DX9B 2BVYA 1X7QB 3GIVA 5D7LE 4L8SC 2H2PC 4TUJA 1FC2D 1WIUA 3MRHA 3MBEC 1HIML 5IVZB 3TO2B 4OZGA 1T0NA 1WBYA 5HVHB 3MRNA 1BIHA 4L4VA 3LSOA 4OLZL 4JDVB 1D6VH 1T1XA 5DGRA 2IPTH 3BDBA 3MUGA 4PJEB 5I1GL 1QSEB 2AK1H 4GKNA 4GAFB 4WO4D 4YE4H 2W9DH 1MRCL 3JXAA 4TUKH 4X99A 3QIUD 4Y19E 3VD3A 1E27B 5IT2L 2F8OA 3O9WA 2DBLH 2EDRA 2JIXA 3U0PA 4X7SH 3AS0A 3T0XA 1FN4A 3GHEH 3I6KA 1V7ML 5D7JD 5EU3B 4LLUB 1MH5B 5HI4C 1TFHA 1KIPB 4WV1B 2DQTH 1ZT4B 3SKJL 5IMKB 1DUZB 2BRRL 5IB1B 4KKBC 2QQLH 1KCVL 1W72H 4M7KL 2FEDD 4PLOB 5F7NC 4FNLH 1DL7L 2YEZA 5I1LA 1MF2L 4NFDA 3D9AL 4LPUA 4NO2A 4JFFA 3S5LB 3FRPA 3PDOB 1X4XA 1NMAL 2XG4A 2HA1A 1T0PB 5A2JH 4HWZB 5JOFA 5F7EL 1PEZA 2L0DA 4U6VH 1T21B 3HUJE 5E9DB 1FLTX 4LARL 3T0WA 5JPNB 2IQ9L 4S11A 3U0WL 3T1FA 4J1UB 3VMPA 2F54E 3MLTA 1UKQA 3QBTB 2Q8BH 3WL9A 4HPYH 4Z7WF 1IILE 4LHUB 4JHBA 4WEBH 4PJFA 5F70A 4LMQE 5FYKU 2NY1B 4ORGA 3ZT5A 3WDIA 4AQ1B 3BI9X 4KJYB 4P3CH 1CN4A 3AU1B 3TBYA 3RWHA 2IC2A 4QRPB 2E6PA 3AXLB 1HHGB 5I8OL 2M1KA 2PR4H 4LNRB 3VG9C 5DJZB 3WXWH 2JJUA 4FFZL 3D18A 1B4RA 4NQUA 3FQTB 3NCFB 5DHYA 4QY8A 1OARH 1DQJB 1EJOH 3MRPA 1DBAH 1WCQA 1JGVH 3I6GB 1Y0LA 3MJ8B 1QPXA 1XGQB 2DIBA 1C5DA 2G60H 4NM4H 4W68A 4LCWB 4NO3B 1TETL 5EOCL 2R1XB 4AENB 3UO1L 1VGEL 4ZG1A 1BF8A 1LDPL 2GTZA 5E1HB 1IEAB 3TJHD 2K7PA 3BE1L 1HI6A 2FR4B 1RZJL 4F33B 4FXGA 1YEJH 4HX1B 2UV3A 4P4KB 4AG4H 1T04A 3DVFA 5FB8A 4Q9CA 1C8PA 5C0CE 3HHRB 1JHTB 1UWXK 3Q0HA 4HS3A 4OZFA 3GK8H 2H3NB 3QRFM 1QACA 4IDLA 3MNWA 3QJHA 3QWOA 2VXQH 1DQMH 3ILPB 1CGXA 3LRHA 1MQKL 1Q9WB 2H32B 4XBEH 3DSFH 4MA3A 1KJ2H 4KK8D 5E03A 5E9DD 4X83A 3T8XA 2A73B 2I9LA 2WIIA 5B8CC 3DVGB 2P8MB 4I48A 2RQ8A 3HNTL 5DVNA 2G5BB 1IC4L 1WZLA 4MCZA 3U6RA 1J0HA 4LHUD 1MCCA 4U3HA 4AT6A 5FK9A 4NUJB 2XY1A 4YDKL 5TE7H 4TTDC 3VRLE 5KVDH 3ULUE 3NZ8B 5T5FH 4U7SA 5T3XL 3QNXB 3S34H 4XMKL 2AJUH 4XH2A 3TBVA 4PRAA 2JCCE 3TIEB 4BM7A 2NY1D 5LGHL 3SE8H 3E8UH 4YO0A 1A4KB 2W9LA 1L0YA 5J11C 3FT2B 5EBWB 3UZEA 1BQHA 4F7MA 4PJ7F 3FRUB 3AVEA 4V1DD 4HH9B 4XCEA 4QRPD 4O58H 4OBSA 3PL6A 4XVSH 5KSUB 5M95B 3O6LH 1G1YA 4KAQL 2XZAH 1KT2A 3VW3H 1CDIA 3B4NA 1HILA 3OR6B 4KRPC 3JVGA 5CEZL 2R1WB 4S0SD 4N8PA 5KS9E 1Z0MA 2ZJSL 4PJ9B 1T22B 4JVPA 4ONHB 3TN0C 5AD0B 4GLRH 4Y4KC 3RZCA 2B0SL 2I27N 2PTVA 5BOPA 2MQ3A 4K94L 5E2JA 2ZSWB 1W2KT 3BVNB 2VDKL 4LCWD 4GLRI 5L2KA 1N6QH 4QLRA 1SVZA 4Z7QF 3LB6D 4XWGL 5IM7A 5CJQH 3L5WB 1WK0A 3PGCA 2UUDK 1NBZA 4JM2A 4X5XA 5KVGH 4YH6A 2I07A 2O5ZH 1A6UL 5GGVL 3LY6A 1C1EH 4L3EA 1JI2A 4JRWA 1ZWIB 2Q86A 3L3HA 3WHXA 1EFXB 2PCPB 1IGIL 4NRZB 1L6ZA 3PHOB 1LDSA 4K2UL 5HY9A 1WJ3A 2AJSH 3BP5A 4J3XA 5KAQF 5IQ9B 5I8EA 2XWTA 4HGWB 5I8KH 3T65B 3QQ9D 4TTDD 4RAVB 1IKNC 1OL0A 3TV3H 1FFPA 2QR0A 1FAIL 3KXFE 1T4KA 1SMAA 3LAFA 3V6FA 1HHIA 2HFEA 1RY7B 1YMHA 4JFDE 1S7SB 1FL3A 3O6FC 4HKXB 3K46A 3OJ2C 5IK3A 2IH3B 3VFNB 1T2QH 5IW1A 3VFOB 3K2MC 4BH8A 3BKCL 3BPLC 3LKOB 7FABH 2IH1B 4OIAA 1JF1B 1AIFB 3KPRA 4L4TD 1BM3H 4QHUA 2NZ9C 5KTEH 4A6YL 3ZT7A 4U1IA 1T1YB 3NMEA 3SOBH 2FDBP 1RK0B 4M1DL 3GKWH 1JPGA 5FA4B 2XYCA 4RCAA 1X5LA 2EIZA 1E4XH 1A6PA 1J9CT 2OQJB 4G8GA 1E4XI 2CDGA 3B2VL 4OFPA 1MCPH 4XAWH 4HEME 5BZDB 3S35H 5E8OA 3W0WB 2HJKA 3Q6FA 1B90A 4JDTH 1KIQB 1EO8L 4UIMA 5DJ2B 2BERA 4PJ9D 3TNNA 5DS8B 1Y6NR 3RWJA 2XQBL 1BIIA 4ONGL 4HIEB 3EHBC 4GUPA 4MWFB 4I77H 5HGDA 4MCYA 2AV1B 5D1QB 3SCMA 3V0VB 1WWCA 5FYJH 4R7NA 4NBZB 4RMQA 1DQLH 4PJGE 4AMKL 4UU9B 1WITA 3U9UB 3TA3B 2GT9A 4MQXD 3VRIA 4JKPH 1QSFE 3Q3GB 4G8FB 4F8QA 3MOAH 5HYJB 2PF6A 4O2EA 2WBKA 4QTHA 1J5OH 2UUDH 3IFLL 2A9NH 1EFXD 2VDQL 3SGDH 1D6EB 1DVFC 1RZ8B 3O4OC 1ED3A 2AGJL 4XVTH 1HYSD 5C0BA 1QNZL 1A47A 4U2YA 2KDGA 3FT4B 1PQZA 4ORZC 5JDSA 4KDVA 3UTZB 3H9HA 4APQA 1QTYT 1OB1A 4YBHA 2UWEA 2G75B 3HRZA 4D9LH 4M93C 3PWVB 1PYWB 4OKDA 4XBGA 3CZFA 4WTXA 3BXNB 4PV8A 5DYOB 4G6MH 3HG1D 5C0NC 4LKCA 5KVFL 5F89B 1EEQA 4XC1L 3PP3K 5MP6L 5DRXB 1D5XA 3GMRB 5GS1A 4OFYD 5E2WL 3WYRA 3BWAB 3HZVB 1U0QA 5FDWB 4OD2B 1QA9B 4BFIA 4UTAL 3QO0B 3FO9A 4PBVC 5BRZE 3W0WD 3INUL 2XTJC 4ZUVB 2P7TA 5EWIH 4YFLI 2WAHA 4MA8H 3D85B 4L3AA 4G6JL 1GHFL 4P2RB 2V2WA 4OZHE 3UTSE 4HIIA 3F7QA 1KELH 1J05B 1DBBH 1AC6A 1J10A 1MAKA 4OIIH 4PJAB 5D1XA 1K8DA 2FJFA 3DMMA 2ED9A 5IBTL 1MLCB 3AY4C 5IHBA 1Q9OA 3P40A 4KMTH 5FHAL 3IFNH 2EE9A 5HYJD 3RBGA 4G9DA 2N1KA 4U3CA 5IBUB 3TEUA 3MYJB 3QUYA 4C58B 4X7EC 1ZK9A 1HHHB 5ACMA 4ZOBA 3VFRA 3SO3B 3CX5K 4GXUN 3QEUB 4OM0H 5TQ0L 1GPOH 3OV6A 3VI4E 3S37H 1V3JA 3PDDA 1Y18B 5TF0A 4QWWD 2W0LA 3IVKA 3V9FA 1HSAA 1OLZA 3ZYOA 1SQ2N 3VI3F 3U79A 1I1RA 4JFPB 1JWUA 5C2UB 4K9EL 1MWAA 4PJCB 5TQ2H 5E6IB 3VXTA 1B2WH 4MQ7A 5KANG 1PG7X 4JJ5B 3L3KA 2V5MA 1AO7A 2DQCL 3RPIB 5TF1L 3U4BL 2LFGA 4R3SB 3DYOA 3C8DA 3OXRA 5J57B 2X1XR 4RIRB 1AGBB 1NJ9B 1BLNB 3CX2A 1NMCC 3SDYL 4OZIA 3HZKB 3PP3H 2NR6D 1BAFL 3PWPD 1G7IB 4ODTH 2W0FB 4X4MA 5C71A 2KH2B 1T66C 1ETZA 3BPOB 1CFTB 1U36A 2AJYL 2OMNA 4L9LA 3WFCH 3ULSB 1NMBL 1VACB 1LEIA 4ZTPH 3ESVF 3WCYA 3TPKA 3D85D 1U3ZA 3VFVB 5T3XD 4P2RD 4Z5RA 5DFWH 4MNGA 5ADOL 3E3QC 3KPSE 3CMGA 5HXMA 1E4KC 3BGFB 1MFAH 1XGPA 1QBML 1MCQA 2QSCL 4IBLT 4FFVC 3MRFA 5D96B 4WY7H 1A7PL 4BQ8A 4X4YA 4U7KA 1R3JA 2EC9U 4E5XA 3ULVH 2LAGB 5JW4R 2E7LA 3FRPG 3NPSC 4U1HB 4OCSH 2ICEB 5F9AC 1UYWL 1JWSB 4ZFOA 4N0UA 5CEZD 3MXVL 4I18B 3OAYK 3QFJE 2GYSA 4LIQE 3R06B 2MOVA 3SJVE 5IW6A 5KSVB 4XP9H 3QXDB 1DFBL 2ZUSA 3MBXH 3T0EA 4R90H 3IDYC 4KHXH 1CG9B 2KL6A 4JY6B 3TCXA 5CHNB 2NLJA 1NC2A 1KCUH 1FO0B 4XCFH 3TC9A 2ADGB 4R4BB 1KUMA 4PG9B 2QADC 4PRPB 2HH0H 1YJDL 2P49B 4ZOEA 4H1LH 1NGZA 5E8PB 5DO2D 4OD1H 4CN6A 1P7QA 2DYPB 2NXYC 2B8OT 2Q76B 3I9GL 5ID0B 1OT1A 3CNKA 4DTGL 3UYPA 3QUML 5EUOE 3FL7A 4NHCL 3V79C 4YHNA 4BKLA 3MV11 3QIBC 1EVUA 1U8HA 5H37H 1RIVL 5CBAB 3M1BA 3MROA 5ITBH 3OAUH 4N8VG 4NYLB 2HMID 2Z93A 2X89D 1OGAE 3HNVL 1G7PB 4TRPL 4NRXB 4TSBH 4JN2A 3RL1B 1I8KB 4HCRA 3ZE1E 3OAZK 3L5XH 2NY3B 4NZTH 3UYRL 2VSDA 2ATKB 4IRSC 1J87A 3FO0L 1KPVB 4PTUA 3LS5L 1QEWA 5K9OA 5MEOA 5IQ7L 2WBJA 3BH9B 4LSUL 4YDLC 5DRNB 2ZUXA 2DQFB 3S4SB 1WBXB 4LCCC 3BX7C 1EV2E 4OZFG 2BFVH 3HI6H 2R29L 3LQZB 3OTTA 5GRWA 1U8IA 5C6TH 2HJLA 4U6HB 2VXSL 3RWFA 3Q1SL 5DSCB 5KVEL 3T2PA 4HJJH 1OP9A 4K23L 2E9BA 2VRAA 2WUCH 5I1DB 4CBPA 4OB5L 4EKXA 4C4KT 2WK2A 4AIZB 4P5KB 4LKXB 5GGUB 5I6XB 3RU8H 4PD4J 1QR1B 5L2JA 1ZMYA 5FO9A 3OAYH 3JTSA 2CRYA 3UBXB 5ECJE 4QOKB 4N9OB 2OMBA 4NO0B 2NXYD 1QYGH 4KFZC 4ZO8A 4ODSH 1Y6KR 4ZMAT 4Q6IA 4XCYA 2JB6B 3EOAB 2UYLA 4PRPD 3QEHA 4PRBB 2CKBH 4HK0A 1XZ0A 5I1HH 2AEQL 4X9FA 4DCQB 4FMKA 2R1YA 5GHWL 1UH2A 1W0VA 2VC2L 4KK9C 1J0KA 4OGYH 4NQCB 1SY6L 2DYPD 3HI5L 4Q9QH 3G6JE 3RWDB 2QSVA 3IDJA 4OQTL 3LKRB 1F3JB 1Q9LB 1KB5L 1CXLA 1HKLH 1S7UB 4KKLD 1B0RA 2GFBB 3MLZL 3F7YA 2FO4A 3CPLA 3WJLC 5C09A 4MYWB 1NQBA 3FFDA 3OMZA 2B2XL 3EYUH 4JQVA 1KN4L 4DOHE 1SBBA 4OCYL 4EI6A 3WS6A 5ERWA 3AB0B 5SWSD 3OKNA 5HHNB 3S36L 4LLMA 3CVHH 4UBDC 1DSFL 1AD0B 3VXRA 1R24A 1J7VR 1TIUA 5DMGC 2IAMA 2QKIA 3D0LA 5ID1A 1MCLA 3OAZH 3NABH 2EEBA 4K9EC 3VFSB 3PV7A 3SJVB 4IOIB 2R2BB 3ROLB 2QQKL 5A43C 3DX8A 3F58L 3TZVC 5ENWB 1X6LA 2ZZUT 1QFUH 3DIFA 3GO1H 3GMOB 4P23C 2F58L 5MEPA 3IKCB 4EIZC 3WEXB 1J0ZA 1II4E 3DSNA 4U6TA 4BJLA 3PJSB 2OYPA 1PBYA 3U0TB 3FQXA 1DQQB 4QOKD 3QEQE 1K2DB 1ZLSH 4NO0D 3FFCA 3MNVA 1U8PA 3IXAB 5FCUH 4QRRB 4U1MB 5CIPA 5IVNA 1AFVH 3OKLA 2QBWA 4TUOA 3QXAA 3LS4H 2GK0B 5J8OA 2BNRB 1F58L 5FYKD 1IGML 1NCBL 4NQCD 5C9JA 2PXYB 4X6CB 3DVNB 3T0VA 1S9YA 5E08L 4K3EL 1H3UA 4MB3A 4KPHL 3CFIC 1HNFA 1MCNA 3H0TA 4EUPA 1FE8L 5FFLA 3EYVB 4X4ZA 2DQJH 1OP5H 3H42H 2I5YH 3ZTNH 1IT9L 4V2BA 1NDGA 1Q0XH 2DQIL 1YYMH 1KIRB 4HPOH 5DMGD 3UAJD 5D7IE 1UQSA 4FQLL 2AXFB 2AJZB 4Z7NE 2VDPL 3QEGH 4WI2A 1JN6B 1V7NL 4U1SB 4NP4L 1LEKA 3U2SB 1TMCB 5D93B 1CDGA 3G5VA 2XFXB 5E95B 3MNZB 1H3PL 2VABB 4ODWA 5DZOA 5HD8D 4PG2A 5ABDE 2C4XA 2XPGB 3TFKC 1S7WB 1Q0YL 1YJDC 4TVPD 2AS5M 1CGVA 1RHFA 3GI8H 1V3LA 1WBZA 1UB6A 3CH1B 5E8DH 4C55A 4FXKB 4HK3N 4OLZH 4R4FH 1FFNB 1O7SA 3U1SL 5HHQA 2J8HA 3WN5B 4JO3L 3AS3A 2R9HC 3EYFB 1WC7B 3GGWB 2QEJA 1TZIA 5EZIL 5I1GH 5EDXA 5I17A 3BN3B 1MSPA 4LP4A 1KJVB 3DURA 2EE2A 4FQ1H 5E00A 3V8OA 4E9LA 1JP5A 5IT2H 5L9DH 2IGFH 2R0LL 4I2XB 3Q5TA 5EOTA 3RL2A 3O45B 4XC3L 3VFGL 2JJTA 4I0PC 5HDQH 1ZVSB 2VZ1A 1TQBC 4GMTL 3B83A 3SDDD 4QRRD 5MENB 4K3JH 1QLRA 2YXFA 4DZBA 1L7TH 4MLSA 1HEZB 5EO0B 1A6TB 2BNRD 3C08H 4WFHE 2HAZA 3KJ4C 5E94B 1FSKB 1XIWB 2IF7A 2PW2A 3ORJA 1KCVH 2WUBL 2PXYD 4M7KH 5DJ8B 4HWBL 1N4XL 1DL7H 2CGRL 1MF2H 4YBLC 3D9AH 1RHHB 3WUWB 3VWKB 1KF9B 5SX5H 4WW2B 4LVHC 3BKMH 2UY6A 3TWCL 2CLZA 4LPCA 4UV7L 4Y8DC 2X1PA 5J6GB 1T3FA 3L7EB 3NFSH 2BNUA 1AD9A 1ZHBA 1TZGL 3KS0H 4OLEA 2Q7YB 4FFYL 3FAWA 1OAYL 3HUJF 4LARH 3CFCH 5TDOB 2IQ9H 5C0DB 3S3PA 2H8PB 1RUQL 2VLKA 4POZC 1U8LA 5GS2H 5BXFA 3LN4A 4JFEA 3GSRB 5ISZB 2LU4A 2E7MA 5CBEB 1ZHLA 1YY9C 3VA2C 1RZKL 1CT8A 2E6QA 2R9HD 4C56A 5GIRA 3WFBH 1TVHA 3VXUE 4OLVL 5EUKB 3KYOB 3VXSE 4HHAA 3O4LA 1KLUB 1ZS8B 4N5UA 2HFGL 1F4YL 2CLRB 4I5BB 1WFUA 3HNSL