1L4IA

Crystal structure of the periplasmic chaperone sfae
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
205
structure length
189
Chain Sequence
b'GVALGATRVIYPEGQKQVQLAVTNNDDKSSYLIQSWIENAEGKKDARFVITPPLFSMQGKKENTLRIIDATNGQMPEDRESLFWVNVKAIPAMDLQFAIVSRIKLLYRPQGLVIPPEQAPGKLEFTRELTLFNPTPYYLTVTDLKAGNKSLENTMVPPQGKVTVNIGGDITYKTINDYGALTEQVRGVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SfaE PROTEIN
publication title Structure of the S pilus periplasmic chaperone SfaE at 2.2 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 31
structure length 189
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l4iA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l4iA02
3GMQA 1BJ8A 2GQHA 1CGTA 1INQB 3MGAA 2BVPB 4YX2H 3BD3A 5FHBL 5LQBL 4P3CL 1FVDA 3RZCD 3WD5H 3WE6A 1UKQA 3AY4C 3VXRA 4XNZC 5SWSB 4PRPE 5DEGA 3S36X 3RWGB 3Q5OA 3VXPB 3EFFB 1UH3A 1MJJB 3QNXA 1WJ3A 2IQ9H 1MVUB 3FHQA 4QT5B 5T1MA 3V52H 1TZHA 3OX8A 5DO2C 3E1F1 4PS4H 4Q9QH 4X4XA 3FB8A 3M1BA 4NHUB 3L5XL 5F70A 5I19H 3CFCL 1NLBL 4PJIA 5FUZL 4YUEH 5SX4H 1J7VR 4WO4C 2YSSA 4FFVC 3WIHL 1MIEL 2HJKB 1NGZB 4J2XA 5IMLB 3GBMH 2DQJL 2X4RA 2G9HA 3EO1B 1DQMH 5BS0E 5I30L 4X7SH 1RPQA 4IIQC 5CGMA 1OAZL 4KI5D 3V6OE 2YS4A 4WWID 1JHTA 3TNMB 3DVNA 5LVEA 3WDIA 1QBLH 5D1QB 3P77B 3CFBA 5J06A 3RL1A 3QJHB 5I76B 2YXFA 1I1AD 1QSED 1IM9D 1YEJL 4PRIA 5IFHH 1OARL 1EX0A 3GMRB 4JFFB 32C2B 3U4EA 3RRQA 1NKRA 4YBQD 4FG6C 4HGWB 1VGKB 5I1DB 3BQUB 1TZIA 1A3QA 4S1QH 1WCBA 3DWTA 1YQVL 5D96B 2XACC 4XMPL 5TDOA 4HS6B 4CUCA 5ICZB 5C0JA 4X6CE 1QBML 4I0PB 1FN4B 1OD9A 1RZ8A 4U33A 4F3FB 5CJOH 5ERWB 4U1JA 1VFMA 3MXVH 1Z3GH 2XZCL 1F90H 3UJJH 4F8QA 4JO2L 1H5BA 5ECJE 4HS3A 2Y23A 3D3VA 3D39A 1UADC 3QUZC 1KJ2A 5EC2B 3FO2B 1OTTD 4XBGB 5ANME 1DVFD 5SWZB 2UY7A 1TLKA 2EH8H 3P9MA 2FD6L 2CDFA 1CBVL 3BH8A 3CFJA 5FDYA 1G7JA 4Q6IA 5E8OB 3GKWH 1FG2A 3HZMA 3OKEA 3PP3H 4HCRA 5GS0H 5D7IF 3DHJA 5FIEA 3MRDB 4HKJB 3WIHA 1T83C 4TULL 3ULUL 2Z92A 4GW4B 2HFGH 3JTSB 1VFUA 2XZZA 3FKUS 2OXGA 3VXSB 1ZHNB 5TFSH 5INDB 1IILE 1ZGLA 5C09D 1A7PL 4LMQI 3TYGL 1RZIB 1OY3B 4FXGA 3B9EA 3IDNA 3B3IA 3RL2B 3V4PL 3T2QA 4MWFA 4KK6C 2HG5B 2VIRA 4JPVL 5GS0D 2APFA 3G6DL 2AQ3A 3KPSD 3U46A 4X99B 1AHWC 3X14B 1P7KA 2QQLH 3L3OA 2GJJA 3A67H 4HF5H 1L6ZA 4EIGB 4YHLL 4MA3B 2IANB 3PL6C 4M8VA 1FFOB 1KTRL 1OAKL 2CUMA 4F9LA 4MNQA 2F74B 4X5XA 3T77B 3CXHJ 5F97E 1FAKT 4NKIH 3TBTB 5B39G 1PDKA 2DKMA 1P9MC 2OI9B 5EULV 3H42H 5HGBB 5IJVB 3GMQB 4HV8A 4UTAL 2ICES 4GRWB 2BNQD 4UB0L 2EDJA 1KGCE 3ZDXE 3UYPA 5F7EH 3D85A 4R8WH 2OL3L 1FVDB 1EEZA 3WE6B 4I0KA 1M7XA 5IEKA 3VXRB 4WWKC 2EZ0D 3DRQA 1CFNA 2KZ1B 1LP9F 3X3FL 4LKCA 4EOWH 1D9KD 1IGIL 1NAKL 1C8PA 3KPMA 4IJ3C 3HI5L 2HT4C 5T1MB 4OCMC 1XF4A 4H0GA 1TZHB 1RK1A 1KF9B 3OX8B 4E41A 1H3UA 1ZMYA 1R3HA 3W39A 4X4XB 1X4YA 1KIUA 4P9HH 3FB8B 3O2DH 5EIIA 3M1BB 3NACL 1BZ7A 5CUSL 2XKUA 1OW0A 1YPZB 4OLYH 1MHEA 4PJIB 3V6ZA 5KW9H 1PQZB 5TE6L 1A7QL 1Q9KA 3RWIB 3UYRH 2YSSB 3LMJH 5JIIA 2WBJD 3BJ91 3S37H 1TJIL 1IKNC 4M7JL 2X4RB 2G9HB 5DK0A 4OF0A 1MAML 1JHTB 4XCCL 4CJ0A 1SYVA 3DVNB 2XA8L 4MXQD 3GMLA 4JB9H 3CFBB 4ZO6A 4TNVF 3NN8A 3RL1B 1HI6B 4PRIB 1F4YH 4JVUA 1A7NH 5MERA 2O5ZH 4MXWL 1DLFL 1QR4A 5EUOB 3U4EB 3UMTA 4X80H 2BFVL 3BKML 4MJ6A 1OGAB 1TZIB 4OSUH 4MXVF 4LDLB 1WCBB 5I1JH 1HKLL 4RFOL 1FHGA 1BVZA 1U0QA 1QYGL 3LN4B 4PJDF 4QGTA 3NPSC 3ARFA 3O45A 1UYWH 2VDQH 4YXHL 3U82B 2A9NH 2LFGA 4HIHA 3RI5F 3BO8A 1V3LA 4IM8A 4P2QA 5C0JB 2IEPA 1OB1A 1P2CA 1VEPA 2DQEL 5EPMB 4IHOB 1ITCA 4IIQB 2Z31C 2OL3A 4V1DD 3T0EA 1ZWIA 4XVJL 4U1JB 4X83A 1QBAA 1DSFL 5BMFL 4JJ5A 1H5BB 5CEZL 1ZGLP 4HS3B 1U2CA 2R0LH 3MBXH 3VFTA 5DC9B 3K2MC 4MDJA 2Z8RA 4TPRL 3D3VB 5DGRA 1KJ2B 1KBGL 1VFOA 3VU2A 4LP5A 4XI5D 1AJ7L 4LSVL 2CDFB 2L0DA 3BKYL 3BSZH 5I8CA 4GOSA 3BH8B 3CFJB 4D9RD 2EH7H 4WTXA 1G7JB 2JB5L 5DD6A 3HZMB 4NC0B 2RBLA 1ETZA 4P2OD 5DF0A 3V79C 4JRYA 4YBHA 2Z92B 1UCBH 1FZOA 3RVUC 4RISH 4XMLH 4GT7A 3LB6C 4ODVL 3C5ZC 4Y89A 5IB1A 4FXGB 4OUOA 4HPYH 4U6XA 3B3IB 2FL5A 3C6LA 3OG4B 3QUXD 3FB5A 5CCKL 3OF6A 2VIRB 3F5WA 3PWVB 5BJTA 1U3ZA 4LHUG 4JFQA 2O26U 3C8HA 3SE4A 3U46B 3NGBB 3TGXA 1I85A 2QR0A 1X5AA 1P7KB 3L3OB 3VG0H 1KTDA 1A6VL 3EAKA 1NEUA 2W92A 1PLGH 1TQCB 1V7ML 4M6NL 4X9IA 3HA0A 4DK3A 1S9WB 3KPNA 1UKTA 4YPGB 1FNGA 4MNQB 2ZKHL 4ODBD 1FFPA 4MGXA 5IQ9A 5DA0B 2PO6C 5BXFA 1LE9A 3MMEB 5I15H 5E56A 3V4UH 4L4VE 4DJMA 2R69H 3GI8L 5SWSD 5EOCH 4I18A 1Q9LA 4Y4KC 1FLRH 4HZAA 4LU5H 5KSVA 4HV8B 5A40E 3LAFA 3SKOA 4PV8A 4HFWA 5HHMB 2J8HA 3ARGC 1JZ7A 2YUVA 1EEZB 3AC0A 1VADA 3OPZH 3DRQB 1CFNB 3TT3H 1EHLH 1FV1A 2NCMA 5DVLA 4W4OC 5I1IL 1IGJB 4DTGL 2WWKT 3BIKA 4RMRA 3KPMB 3VJ6A 3VFPA 4OZIE 4ORGA 1D6VL 1DEEA 2W9EH 4JZOA 1KIPA 4C56A 2A38A 2VWEE 4OLUH 3C60C 4E41B 4S0SD 4JZJC 1R3HB 4P59L 2ZUXA 2G5BA 5EIIB 4PJBE 4FFYH 1BZ7B 1NCWH 1CICA 1MHEB 3V6ZB 2V17L 2J2ZA 2E27H 4JPKH 1W72L 3MV9E 2HMIC 5D1QD 1MCPL 1JWMA 1CL7H 2NXYC 3GJEA 4XC3L 4TOYL 35C8H 1FP5A 1E6OH 1MSPA 2EDDA 5DK0B 3E6HA 2HN7A 25C8H 4JFFD 2YPVL 3LS5H 4WWKB 4NM4H 3C08H 3BWUC 3REWB 3GSXA 4K23L 3MLXL 3QWOA 1SYVB 5D72H 4OT1L 3BQUD 4Y7MA 2J1KA 3NN8B 2XIDA 4MJIA 5GJSH 5D2NE 1ORQA 2X7LB 5DQ9A 3VDCA 1SM3L 3BH9A 3BOVA 4M1GL 1DBAL 3F58H 4WI9A 4I0PD 2VXVL 4LCWA 4MJ6B 3P0YH 3AROA 1QSFA 4LAQH 2EDHA 3B8YA 1YECL 4R7NA 5GJTH 3WXWH 2Q76B 1YNLL 3MV7A 3ARFB 1KJ3L 4GBXC 4Y4HC 4HIHB 3BO8B 3J7HA 4P2QB 1OB1B 2OMBA 4PJ7F 2XWJA 5IVXF 4UNUA 1I4FA 4F15C 1RVFH 4CMHB 5SWZD 3U30C 5JHLH 2OL3B 1CXEA 3INUL 1ZWIB 3HMXL 3GKZA 4KJPD 5ISZA 5BV7C 3K0WA 4DVRL 4QF1A 3QFJA 1XGYL 3VFTB 4MDJB 2IG2H 1EAPA 1JZ6A 1DTUA 2VZTA 3H9YA 3KXFA 2AJUL 1MFAL 3VXSD 4NQCA 3N9GH 4RZCA 5I8CB 3T8XB 4PJ8A 1KENH 3OKKA 4OFIA 3EIFA 4OIIL 4TVPE 4ZUVA 3FFCD 2HLAA 2OTWA 1JPSH 5DD6B 3GMNA 3EYOA 4L8CA 1CGWA 1ETZB 3CFDA 4WUKL 4JRYB 2XZAH 3RUGA 3CMGA 1CLZH 2PYEE 2AABH 4LIQE 1FZOB 3PGDA 4NQDE 4XMKL 4HEME 2UWEA 3ZL4H 3PGFH 3K8MA 1T0PB 3KLAA 4U6XB 3C6LB 3V5KB 3H3PL 2A6JA 5I1CH 3FB5B 1HIML 2IAND 4NP4H 4UMGA 5A1AA 1YEGH 1TDQA 1DUZA 3F5WB 5F7WC 3VWJA 4AJ0A 1FLTX 3P4MA 1URLA 5C71A 2QR0B 4MB4A 5F1SA 1KTDB 4LSQH 1NANI 3VFMA 5C0CA 4PJEF 1JRHI 1FNGB 4J4PC 1FFPB 5IQ9B 3HC4L 4NO3A 5BXFB 1LE9B 4NQVA 4TSAL 5AZEL 2F53A 4U1KA 1INEL 5EU6A 2FCBA 4NKDA 4NRXA 4I18B 4MQTB 1Q9LB 2X1XR 5JXEA 3W5NA 3K4DA 5KSVB 2VR5A 4S1RH 2FH8A 3SKOB 1UXWA 1NH6A 4PV8B 4CVUA 1L7TH 3T08A 3LS4H 4HFWB 3K4ZA 2MJWA 1AP2A 4YHNA 1VADB 3FAWA 1FV1B 2VLRA 3BIKB 3EYVA 5I0ZA 4H20H 3HNVL 3VFPB 2XWTA 4ORGB 1GJIA 1DEEB 4HT1L 4C56B 4JZOB 1KIPB 3C09C 1T4KA 1QHPA 4PJHE 4HUUA 1NCBH 3LD8C 3Q1SH 3O6KL 4J4PA 2G5BB 2JIXA 5BRZA 1X4XA 4EEEA 3RVWD 4OCSL 1CICB 3QQ9D 2ICWI 1G9NC 5GRXG 2FEEL 2RGSA 2DDQH 2DM4A 1EHXA 4DGIL 3FQUA 2VDOL 3QAZC 3U7WH 1LO2L 2DQGL 2FHBA 3EW3B 3F12A 1HINL 2KKQA 3T0VA 4Q6YA 3GJEB 1KIRA 3MLWL 4OFKA 4PRID 1ES0A 2FR4A 5E4EC 4GMTL 2CKNA 5CGTA 2VL5B 2QHRL 3QRGL 2VABA 3GSXB 3QPQC 3QWOB 1X5KA 1I8MA 2CK0L 5EOQL 4EDXA 1OGAD 3ESVF 1QZ1A 5CZVH 1UZ6E 4NKMA 4U3XA 5E8PA 5EA0L 1FORL 4MJIB 1CE6A 2ITCA 1JVKA 1ORQB 2X4QA 1SEQL 1EZVY 1H3PL 4ONGL 2C3XA 2ORBH 5L8LB 1KJ2H 5DQ9B 2C4XA 3GMPA 3BH9B 3BZFA 3JSSA 4JO3L 4LCWB 4NNPL 3K4AA 4ONOA 1E0OB 2NX5E 1QSFB 4AYFA 2N1KA 4W6YB 3OB0H 4R7NB 2VMFA 4XXDA 5JW4N 2OXHA 5ALCL 4U7SA 2ED8A 1NLBH 3RWJA 4Z7WE 4ZNEA 3CVIL 4ERSH 2YN5A 5MEQA 1ADQL 1CGVA 5DD0H 4HCRH 5C7XH 3WFBL 3D3VD 2XWJB 4UV7L 5E95B 1I4FB 3B2VL 2I60H 4OCRL 4UIMA 5T1DL 2Z0BA 1Q1JL 4AY0A 2ZUVA 4FG6D 3GRWA 4ETYA 3PXHA 1VGEH 4NWUL 2MQ3A 4IRJA 3BUTA 3O8XA 2O5XH 3DX7A 4YZFF 3H9ZA 4LRNL 1EAPB 3GI9H 4YBLB 2CMRH 1FNHA 2EDRA 1JIBA 3KXFB 5CBAA 1BOYA 3MCKB 4PRAA 1NUGA 3MGTA 2GSIA 1MY7A 4U1GC 4RZCB 4NNXA 4PJ8B 1R5VA 1QR1A 3OKKB 4ZUVB 3LKPA 1OWRM 3NCEB 2HLAB 2OTWB 5C0BB 4L8CB 3BZEA 3CFDB 1T7YA 4X6EA 1WIPA 3RUGB 1I9IH 2AJYL 4BFEA 3QQNA 4OV5A 3PGDB 4XMPH 5KVDL 5DVKA 1RZGA 2UWEB 4N1CA 2MMXA 3WFDH 3UC0H 1LDPL 4YO0B 3KLAB 3VD9A 1TJGL 1B2WL 1LO5B 2A6JB 3BMVA 4H5SA 5FYLL 1DUZB 4MNQD 3ZKQD 3VWJB 4LVNC 4PB0L 3P4MB 4NSKA 4APQA 4HG4J 3TIDA 2B8OT 2A77H 3QQ3B 1SJEA 4NDMA 1JGDA 1YEIH 5FYKL 1BQLH 4FTVE 4N8PA 3N1MC 2WSKA 4G6ML 3WYRA 1JWSA 3BXNA 1CGSL 5GRWA 3VFMB 2ZSWA 3CPLB 5D5MA 3MCG1 5C0CB 3ZSSA 4RSVA 4LARL 5HHMD 3SHSA 2R0KL 4NO3B 4NQVB 5EWIH 4KK6D 4PJDE 4MYWB 2F53B 3DXAA 1CDGA 3K8LA 5I71B 5EU6B 1ADQA 3R1GH 1J11A 4NKDB 4NRXB 3PP4L 1UQSB 1SY6L 5HXMA 4UTBH 3MRNA 3KLDA 3WHXA 4YHYB 1UXWB 4KQ4L 3CZFA 2NYYC 2W0FA 1BM3L 3MO1A 4H26A 2X4PA 4GQPH 3IETA 4E41D 2BSSA 2K9UA 3NTCL 4XPFH 4X4ME 4KHTL 1UXSA 4YHNB 5E2UH 5DUBA 4ZFZA 3BRDA 1A6AA 2V5SA 5J0BA 4RAHA 4ZYKA 2UZYB 4PTTA 3AVEA 3NFSL 1M1SA 2VLRB 4KI5F 1UWEH 3EYVB 4CN4A 2R0WH 4JDTH 1FNAA 4P2CG 3X17A 2YA2A 1IAOA 2XWTB 4AG4L 5F9DC 2OQJA 3TIEA 2XKNA 4JGUA 1T4KB 1ZS8A 3LKQA 3O6FA 5DMIL 1QNZL 4JY6A 4LCIH 4RMTA 2JIXB 3WHE1 1ZVHA 2Y07L 1RZJL 2VDKL 1HHJA 5F7HA 4X98B 4BQ6A 1G1YA 4HDIA 2P24A 5KS9E 4WWKD 4PRPA 1VKXA 3FQUB 2VRAA 3F12B 3H3BC 5L7XH 2HT4D 1BFTA 2NY5L 4JQVA 5DJ8A 1ES0B 3HAEG 5KSUA 3CSYA 2FR4B 2VH5L 4PRDA 4M7LH 2VABB 4Q97A 3JWOL 1I8MB 3GBNL 4HW6A 4BSVA 2ZCLL 4EDXB 2ERJC 4CRPA 2A9MH 4NKMB 1JYVA 4DKEH 4M6OH 2X9WA 2E7BA 3TZVC 3LD8B 3ARFD 1YJDC 3DVFA 1Q72H 4ZPTA 5J12C 3GMPB 4P2QD 4YGVA 2CKBL 3BZFB 4MVBC 5C6TH 5DJXA 5BS0A 1MEXH 3T04D 1RUAL 2JB6B 3V6OA 4XXDB 1J87A 2B1HL 3QAZB 3RWJB 3Q6GH 1SY6A 4J3WA 3V5DA 1KN2L 1XR9A 2QLVB 5MEQB 5J11C 4F80A 4TUKH 5C3LD 1Q0YL 1CLOL 5E4EB 4KROB 5IT2H 4UIMB 5IK3A 2KL6A 5J3HD 1Y6KR 4KDVA 3W2DL 4XWGH 3P40A 3NIDE 4OCLC 7CGTA 4IRJB 3O8XB 3DX7B 5JMOC 4ZAKA 2KQNA 4XCYA 2DLFH 4B53A 5HYEA 4JRYD 5CBAB 4Z7NE 4D9QD 3FAXA 4PRAB 2FIKA 4X6CA 5GRUH 2IBZY 1UA6H 2VQ1A 1R5VB 4MXWH 3ZYZA 1QR1B 3GB7A 3LKPB 5M95B 1TTGA 3C6LD 4N68A 4N8VG 2DMBA 1JHLH 3QR2A 3UJIL 5E08L 1U8PA 3BZEB 5A16B 1X6LA 3NCCB 1EVTC 3VW3H 3OF6D 1HQRA 2FX9L 3I9GH 2XQYG 4OV5B 1RZGB 3MOBH 4JN1H 2BVEA 1IKFL 4L4TB 3GJFK 3LIZH 1YNKL 1H3XA 4FQXA 4H5SB 5GZNC 1BZQK 1DFBH 5KVEL 2VDPH 1K6QH 2VDRL 4NSKB 5I1KH 3NFPA 1DBML 3BAEH 4APQB 3WJLA 3TIDB 3X13A 4NDMB 1JGDB 5IFAL 3DVIA 4FQCH 4IRSC 3MJ8B 4LDOB 1JWSB 2ZSWB 5DMJB 2IFGA 1TJHH 3V4VH 4PUBH 5IBUG 5GRJL 4J1UA 4RAVA 1KPUA 5KAQG 1FDLL 2ZOLA 1KCSL 3DXAB 4UDUB 3ILQC 1OAQL 3DSFH 4IOIA 5I6XC 4PJCE 2X05A 4N1EA 4PJ7E 4H1LB 5J1SC 3MRNB 4K94H 2WAHA 3WHXB 5IJKA 1BEYL 5DMGC 3CZFB 3OKOA 1A6WH 4C56D 3MO1B 4H26B 2BP3A 4PTUA 4WFED 2X4PB 4JG0H 1KEGL 3IETB 3WSQL 2BSSB 3PQYE 4HPOL 3WLWC 2Q6WA 1JNHA 3QXAA 4LVNB 4WU5A 1UXSB 2Y6SD 3FT4A 5DUBB 4ZFZB 3UTZB 1B90A 5C3TA 2Y06H 1A7RL 2UUDH 4Z95L 4ZYKB 3TYFA 1CICD 4PTTB 4WV1A 5JXAL 3VG9C 1IAOB 4IRSA 4EDWH 2F19L 2OQJB 5F9WC 3TIEB 2XKNB 3FT3A 1B88A 4N90D 1ZS8B 3LKQB 3NBNA 3O6FB 2YD4A 4JY6B 3HMWL 1JYXA 1I7RA 2EDTA 4I77L 4PPTA 1CF8L 1HHJB 3X11A 3FN0H 4AMKH 4HDIB 5GPRA 2AK1L 2P24B 1ZXQA 1HNGA 1VESA 3VI3F 43CAB 4WW2C 4PRPB 5E70A 1OTSC 3HC3L 4FQHA 1KELH 3B4NA 3ZMRA 3L5WA 1VKXB 3AMLA 4OJFL 4IMLA 1I3VA 4MJID 2IAMA 1PEWA 4LDEB 5DJ8B 5DJYA 3OAUL 3CSYB 2AJSH 2AW2A 2HTLC 1L4IA 4PRDB 1MIML 4OB5H 4XGZB 4JKPH 3KDMA 2YRLA 3MJ9L 4LCWD 4BSVB 5E6YA 4HJJH 1QSFD 1X4ZA 5EU5A 5IESL 4KPHL 5JUEL 3FHAA 2GY7B 3A6OA 4IDJH 4NCDA 1OAUH 2D03H 4ZPTB 3MJ7A 2NXYD 4OZ4A 1I3RA 5DXWA 2QADB 4Z0BL 5DJXB 5BS0B 1U36A 5EZIH 4HWNA 1OCWL 2A0LC 4ZFGL 5CSGA 4ODUA 3RNKA 3QIWA 3VH8G 4XPGL 3V95A 1DBKL 3V5DB 5HI4C 1XR9B 4LSSH 1B4JL 2KUTA 1G9EA 4UQ3A 2EDWA 2E7HA 4BKLA 4M4PA 3KXFD 4TOYH 1YY9C 5AAMA 4NBZB 1QPPA 4RCAA 4WRLA 3MLRL 1MRCL 2RHEA 4PJ8D 3SGDI 4JO1H 4LLQA 5BV7H 4Y16A 1MELA 2X44D 4MNGE 2E9BA 5C0BD 4ZAKB 4UT6H 3UDWA 4XCYB 3S88L 1Z9OA 2HJLB 5DZLA 5J12B 1JF6A 4X6CB 1OAXH 1WFTA 2VQ1B 1FCGA 5F6HI 1XH3A 3SJVA 1AQKH 1JRHH 3GB7B 5HVHC 2GUOA 2A83A 3S98A 5TE4H 1U8PB 1EPFA 1HQRB 1ED3A 2CSPA 3VWJD 3W0WE 2D7OA 3OKDA 5FEBA 5I1HL 1MY5A 1K5NA 1DDHA 2GJ6A 5ANMB 3MODH 4PYGA 3ARDC 2R8SL 3L7FA 1S9VA 4KH2A 5ALBH 4ISVA 4FQXB 4N0YL 3CX5J 1H0DA 5C0CD 3MJ9A 5FKPA 1AE6H 4NZUL 4FZ8H 2DF3A 3TBYA 1P5UA 5T5FL 5KOMC 2SEBA 3IU3A 5IEHA 1W0VB 3F7RA 2F53D 4O2FA 1T89A 4DAGL 2A1WL 4GRLA 3X13B 3BI9X 1U8MB 2AJ3A 3O3DB 5EU6D 3WNOA 1O0VA 5JXED 4LSRL 4XWOD 2DMKA 4RGNE 4WEBL 2VUOA 3MCLH 2Y4SA 4MB3A 1KXQE 2HVJA 1MCLA 3TJEH 5C9JA 3MRKA 4WTZA 5E1HB 3BFOA 4J1UB 1KPUB 3GHEH 1MCHA 4HKBB 4RAVB 4U1SB 2ZOLB 2OMNA 4QNPE 1J86A 1RURL 3QHTC 3WKML 4IOIB 2VLRD 3U1SL 1NFIA 2KPNA 2FGWL 2WUCH 4K3JL 3VD4A 2P5WE 3E3QE 3OBAA 5IBLC 3OKOB 1J8KA 3ROOA 4PTUB 3MLUL 1U8JA 3O9WA 5FYJL 3MFGB 4J4PD 3LQZA 1JNHB 2Q6WB 2ATPB 2QSVA 1UC6A 1JP5A 2JIXD 4WU5B 3FT4B 5KTEH 5FV1L 4L4VA 3IDJA 2YC1A 3LEYL 5C0EA 4WV1B 3UAJD 1AXSA 4HFUH 4IRSB 1T1YA 4YQXH 3FT3B 4BZ1H 3QHZL 4F57L 3VCLA 2EC9T 1ZE3C 3AS3A 4ZD3L 1I7RB 1WWBX 2DICA 2BXZA 4L8SA 5CLWA 5JMRA 5CP3A 5DUPH 4BSJA 5JW3H 4QTHA 3LPFA 4TNWK 4FQHB 5GGVY 4P2YA 5HI3D 3CDGA 2X4SA 2DLHA 1AC0A 5EZOL 5KVFH 3KYAA 4IMLB 3EYSH 3S37X 3CDYA 3WN5A 3QIBC 4KVCH 4YHZH 3VXUE 3UBXG 5DJYB 4P3DB 3KNBA 5FGRA 5D7LE 2BOCA 4MHHG 4PJBA 3BUYA 3B5TA 5IVOA 4R4BA 3GRWH 4KKLD 2F5AL 3QPXL 3HI1A 3MRMA 4K9EC 4KGJA 3K74B 1OPGL 4LLVA 3MJ7B 4OZ4B 2W9DH 1I3RB 1IC4L 3TP4A 4ZMAT 4YDIL 2X09A 1FE8L 3ARQA 1T0MA 5F1IA 4N0CC 1WISA 4KROD 3UCRA 4J6RH 2H2PD 1KTLA 4JM4L 1P4BH 3C87A 4NJ9L 2Q3ZA 2HKFL 3BIAX 3QHFH 4NZDA 3KPQA 3QIWB 5DUMH 4IRJD 3O8XD 4X0KA 4DN4L 2BOBA 1XGQA 1PYWA 3SPVA 1CQYA 2C7UB 3VRLF 3HPLA 5CLTA 5D2NA 2FGZA 1KB9J 2NXZC 1JTTA 4BKLB 3QG7H 3MSPA 2EIBA 2QSCH 1GZPA 2N7BA 4K3DL 5H2BB 2OLDA 2CR6A 4LLQB 4Y16B 4OIAA 5DFVC 4KC3B 5C0RL 1QOKA 1B0GA 3MUHL 1N6VA 3DPBA 3I2CH 5E99L 3STZA 4X9FA 3SGKA 5I1EH 3EFDH 3BGMA 4M1DL 4L4TD 2GUOB 1F58L 2A83B 4GRWF 3BYTA 5L2KA 1OSZA 5ESVA 4JHWL 3I6GA 3SDYH 1IEBB 2BDNH 5IGXL 1G0DA 4FQJH 3OKDB 4APQD 3UTPE 3HE7C 3KPRE 4NGHH 1K5NB 1UM5H 1DDHB 4V2CB 1JGUL 4XCFL 3RA7H 5IOPA 3L7FB 1S9VB 4PJGE 4H1LH 1WFOA 4ISVB 1MCOH 4U0RC 5LGHH 5SX5K 3T2NL 4JY4B 5TDNA 1H0DB 3FQWA 5FKPB 4QRQB 1T03L 1QHOA 1U92A 4GLRH 2NY4B 3BPLB 1IGFL 2SEBB 3H9HA 3IU3B 5FAAA 5IEHB 1HCFX 3DXAD 4O2FB 5D70L 1MJ7L 4GRLB 2DI8A 2AJ3B 5JPNB 4RDQG 2YZ1A 2PYEA 4PJIF 3V0WH 1KC5L 1T04A 3L3IA 4NQDA 3CH8A 1JYWA 1V7NL 1JI2A 1S5IL 3QRFM 4M00A 1PAMA 4AEIL 4ELKA 5C9JB 2VZOA 2BNRA 4Z76A 1YA5A 4M43H 1A3LL 4RGOH 3ZTJH 4WFFE 2F5BL 2A6KA 3KYKL 4FZEL 4PJ9C 2EIZB 5EORH 4BQCA 3HLAA 3TFKC 1BGXH 1NFIB 3ARDB 1F42A 3BW9A 5GGQH 4YEEA 2APBA 3ROOB 4OZGA 3CK0H 2J12B 5GS1A 1U8JB 3O9WB 2LV4A 3O6FD 1DQLL 3NCJL 3LQZB 3S4SG 4U3HA 2B1AL 3D25A 2NR6C 3V0VA 5HGDA 2QQKH 3VGBA 3ZT7A 4L4VB 3IDJB 2YC1B 2VUYA 3BZDA 4L3EA 1T66D 1AXSB 4PRPD 2YD7A 1T1YB 3RX5A 4JCLA 1U3YA 4EBQH 4MJ5A 2QTEA 1FH5H 2NYYD 3H2WA 1CDIA 4O5LH 5DHXB 1NQBA 3R4DA 2D0GA 2HKHL 4XC1H 5CKAA 3LDBC 4PRBB 1LO3H 2V2TB 3GK8L 4DZBA 2B5IC 1JN6A 4IOFC 1OHQA 1FRGH 3QO1A 3FB7B 4PJHA 1TVHA 1RJYA 1T6WA 3KNBB 1KLFA 3BP4A 4GRMB 4ODXA 1Q0XH 3B9KA 4PJBB 2QADD 3BUYB 1NCTA 1L0XA 2J88L 5BS0D 4HUXA 4R4BB 1WTLA 1RD6A 4OZFG 1X6NA 2Q8AL 1Z9LA 3MX0A 3HI1B 3MRMB 3MV9B 4GH7B 1FG9C 5C0FA 4LLVB 1C16A 4Z7QF 5F1IB 1T0MB 1JHKL 1IQDA 2OJZH 3ES6A 5GS2H 1KTLB 2YUWA 5GHWH 3KWWA 2GAZA 2DKSA 5EZJB 5HHPA 1OAYL 1EUTA 3X3GH 2AKRB 2BOBB 1XGQB 1PYWB 3SE9L 3SPVB 2ZP0T 4ZAKD 4KZDH 3HPLB 1F4AA 5D2NB 4OKVA 4DEPC 1DL7L 3RP1A 5GZOC 5E8DH 4MVBD 5FGSA 5GS2D 3MZTA 4KQ3H 1DEDA 3V2AR 1AR2A 1YEKL 1BOGA 2JKXA 2NX5A 1GZPB 2DLGA 1RULL 2P1YA 2XN9A 3EDEA 3OG6B 4QRPA 4M1CD 3RTQC 1NC2A 4Z7WA 1J0JA 2BXYA 2XZQH 3MRBB 3HUJE 1B0GB 4FXLA 4I9WE 2YA1A 4QWWC 5L0QC 1R6VA 4UOW0 4O4YL 5ICXB 4KAQH 5I17A 3K1KC 3AB0C 4P5TC 1KULA 2BHZA 3BGMB 4F33B 3QFDA 2ICWJ 5DRWA 4FQ2L 2R56H 3VI3E 3HRPA 5GSRA 4OUUA 4FQXD 1LK3L 3QT2A 1NCAL 1OSZB 5ESVB 12E8L 2IF7A 4AM0A 3I6GB 4F37K 4RWYH 2GSGA 3NCYS 1ORSB 1FSKC 3P9WB 3AUVA 4M02A 5IOPB 1P69B 1G0XA 3FQWB 3V7MA 1U92B 3H9HB 5KJRH 2XYCA 5T3ZH 3FB6B 1UM6H 3TC9A 2W65B 4HIIA 1A1NB 1OOAA 2PYEB 2D7PA 3L3IB 1T04B 4PRNA 1QFUH 4NQDB 3SDCA 2D0FA 3NVQA 1IC7H 2IH1A 5CP7B 5KVGH 4TTDC 4ELKB 1E4XI 1CGYA 2CIKA 1J1PH 4S1DD 1H3GA 4Z76B 3ORJA 3N85L 3FOLB 2AQ2A 2A6KB 2ICEA 2IBGA 1SBSL 2Y7QB 1T2JA 3HLAB 5IW1A 1MLCA 1S78D 5F7NC 2AEPH 5D7SH 3BW9B 1MLBB 5IKCA 1MCJA 4FTVA 4IRSD 4UZGA 4OZGB 4TVSa 1RUQL 5H35A 4JKLA 3VFOB 1N64H 2X70A 1KGCD 3LRHA 3D25B 2FWOA 3V0VB 5HGDB 4Y4FA 4ZUWA 2NZ9D 5CJQH 4PJDA 1D5XA 4XPAH 5D7KD 5I74C 5K93A 3WKNA 3IJSB 2X6MA 1CXKA 3WIFA 5FOBB 3VFUA 4G8IA 3NZHL 4QHMA 1WBXA 4PG2C 1VENA 4LLAA 1G9NL 1KIQA 4HLZH 3ZDZF 4X4MA 2HT2D 1JV5A 3UYOD 4PJ9B 2Z35A 5L8JB 3F62A 3V0AC 2HLFC 3SKMA 4HJGA 1A5FH 3PIQA 1YDPA 1JN6B 5D1ZC 5HYSG 2V2WA 3BP5A 3QO1B 5A3ID 4PJHB 1RJYB 3BP4B 1T7ZA 4ODXB 5HBBA 3B9KB 3UPRA 1QFWL 3TO4A 3DBXA 1QFOA 5KSAC 3SDAC 4PLKC 4ZSOE 5I18H 3MLVL 4HUXB 1BD2E 3SGDH 3TO2B 4Q74A 5KS9A 1K9TA 2AXGB 2R0ZL 2D2OA 2AEIT 3EHBC 3QIWD 4JFEE 2NY3B 3GIVA 2DAVA 2X1QA 5HHQA 1OP9A 3BN9C 3RIFF 2DTMH 3VFRA 3ZZ1A 3DMMA 1MCIA 1RUMH 4YWGL 4GSDL 4KMTH 1IQDB 2R1XA 1S9XA 4N8CH 3KLHC 1FJ1A 3G9AB 3LDBB 3QG6A 3MYZA 4HIXL 3GHBH 3L3DA 4PD4K 3KWWB 3PWLA 5J6HA 1QLRB 1LNUA 2GAZB 2PCPA 3VMOA 5HHPB 4DK6A 2ZJSH 3HCVA 4D0BB 4Y16D 1MF2H 2ID5A 4JDVA 5MI0C 3FCTA 3H9SE 4S11A 1LVEA 5KSAA 2CXKA 3IDYB 5C1MB 4Z9KB 1BOGB 2NX5B 4OFYA 1HHIA 3ZKXB 4EXPX 5DT1H 1NC2B 4Z7WB 3JWDC 3KGRA 4K7FA 2MHAA 3GUTA 1K3ZA 1FAIH 1NLDL 5I17B 5AWNL 1LO0H 1V3MA 2YK1H 4BM7A 1P1ZA 5C0AA 3QFDB 1N26A 5FO8A 5DRWB 3QCVH 5DI8A 5GSRB 5T3XE 1S7WA 4GS7C 1WZLA 4AM0B 2NY4D 3NA4A 3QIUC 4GG8A 1EEYA 5AYUH 5ABDE 4TNWF 3LHPH 1AFVH 5T5NF 1J1XH 2F15A 4DEPB 4GRLD 3B83A 2FJFB 2I9LA 4K7PH 1GGIH 1KG0B 2X10A 5IHZA 1U6AL 4NKQB 1MQKL 1MFCH 3L3GA 4GMSL 1QFWI 5I8KH 5CJXA 1HOCA 1N8ZB 1WVZA 3EO9L 3RTQB 1GC1C 3LSOA 3SE3C 3F7YA 3BGFB 2H2SD 1D7FA 5KOVC 4OD3L 4JY5L 4PRNB 3AB0B 3SDCB 4P5TB 1J8HE 4ZTOL 1FBIH 2IH1B 3IU4H 3ARDD 4EUPH 3G6AA 5AEAA 1MNUH 3KR3H 1RFDH 2CIKB 1VEMA 2IQAA 3O9WD 15C8L 4KGLA 4U1LA 4ZTPH 3F65A 2QBWA 4MCYA 3QQ4A 4Y5YA 2IPKA 4L4VD 5IW1B 2VZSA 3KPOA 3VRLE 5D71H 1FYTE 1YN7A 2UZXB 1R3IH 4FTVB 4OCWL 1UEMA 1ZK9A 2X70B 3ZE0F 2PR4L 1ACZA 5DLMH 1OP5K 1CZ8H 4OGYH 4DWHA 4WW1A 1DANT 4WUUE 4MDIB 4LEXL 4PJDB 1D5XB 1NMAL 3SBWC 3NAAH 3EZ8A 1BPVA 4JHAL 4NO0A 2XTJC 3KJ6H 1ZTXL 3CC5A 4PJCA 3WIFB 4ZO7A 1NL0L 2D7QA 3VFUB 4G8IB 2N56A 5IWLA 4QHMB 2GTZA 1WBXB 5EU7C 3P30L 1F6LL 1CE1H 1HCVA 1KIQB 1Q8MA 3PQYA 1CFVL 5GGUA 4QXUH 4UT9L 1EERB 3ZSTA 2ADFH 1UEYA 5TF0A 2UVFA 2Z35B 4G9FA 1T1WA 1WWCA 4YFEA 3B6SA 3SKMB 4YPJA 1M7DA 3VXRE 3PIQB 3QDGE 1YDPB 4WEMB 3MV9D 2DBLL 1Z0MA 2PETA 3BP5B 1IFHL 2WMPA 3ARUA 3HFML 4TSBL 2DQUH 3ZTNH 3UO1H 2C4FT 4EIZC 3UPRB 1CDBA 3TO4B 1VHPA 3DBXB 3D18A 4M93B 2R29H 4QTIH 4DGVL 3W81A 4NWTL 4XAKE 5KS9B 1BLNA 1TTFA 4OGAD 3KJ4B 4FABL 2VKWA 1YJDL 3DETD 3W82A 4K9EH 3GIVB 5TE7H 1WZKA 3L3HA 1B3JA 2E5EA 4XVSL 3EZJB 4MD4A 3RDTA 1JUFB 1RSFA 3DMMB 1CK0H 2VDLL 4OLXH 3ARZA 3RUGF 4PGCA 4H0HB 4ETQA 2R1WA 1FJ1B 2UWEF 3QG6B 3L3DB 4UV4L 3TH3T 3PWLB 5CKGA 5J6HB 1MFNA 2PCPB 5INCA 3HCVB 4JRXA 1XIWC 1A21A 1DN0A 4X9HA 4JDVB 3FCTB 2B0SL 2H1PL 4KKCC 4NN7C 3W9DB 3GSNL 4QLRA 3SKJL 4S1SH 4XVTL 5KSAB 3O3AA 2IFFH 3CLFH 5IHUL 4K3EH 1U8QA 4GW1A 1ZAGA 2NY2C 3HI6H 4AQOA 1XAUA 1HHIB 1E6JL 4LFHD 2BERA 2Q7YB 2NW2A 4UT7H 4TVPH 3RWCA 1P6FA 4K7FB 2MHAB 3W9EA 3GUTB 4KDTA 2J6EH 1NDGA 4UINH 2P42B 2VC2H 4W70A 2GITB 5EDXA 2Z91A 3V6FA 4LIQH 1EXUA 1P1ZB 1U8HA 5FO8B 3RAJH 2VLME 5I75C 5DI8B 5GGSY 4XP5H 4HULB 5TQ2H 1S7WB 4HLJA 4TVPD 2BJML 2NY1B 4L9LA 5DFVD 2VXSL 3JVGA 2NNAA 4P23A 5AUMA 4GG8B 4JVWA 3MQIA 4C4KO 3I50L 3LOWA 4M5YH 1BZ9A 5E5RB 2B4CL 4O9HH 1CD1A 5DRXB 2WQ8A 4YXKL 3D39E 2PYED 4G7YH 4NQDD 4XCNA 3L3GB 2HWZL 1KXVC 3ZHLA 4KKNA 5F89A 3CUPA 4Z6AT 3LSOB 1J1OH 4P99A 4YHKL 3F7YB 5DQJA 4M48H 2FX7H 3W0WA 4HH9B 4K2UH 5B3JF 4Z7QE 3GSOB 3K2UL 2V5MA 1CU4H 1N6QL 3G6AB 3ZHDA 1XR8A 4TUOA 3E3QC 3IRPX 4LGSB 5MP6H 3S6CA 2IQAB 4U1LB 2AI0L 4NKOA 5I1AA 1BIIA 4IRZH 4UIKL 1RMFH 2FX8L 3MNVA 4MCYB 4G5ZH 4K07A 4NRZB 4XPTL 4C83A 2ZUUA 4JM2A 1HILA 1YEEL 3QQ4B 4Y5YB 2IPKB 1SMOA 4XNXL 1GGBL 4NT6B 3KPOB 2A6IA 4TN9A 2EDQA 3GSNA 2MSPA 1YN7B 2YBRA 2Z93A 4M03A 2ZUQB 5GRYA 1UH4A 2ZG2A 1J5OH 3QEGH 4EI5A 5E2VH 3VXQB 3SOBH 4YR6A 4HBCH 4Z8FL 4PGZA 6FABL 2EC9U 1EEUA 4JAMA 1CGUA 4PJ9D 2GHWB 5L6YL 4NO0B 1ND0A 1MCDA 2FATH 1A0QL 3BEVA 3QUYA 4PJCB 4PJ7B 3GZKA 4O02L 2AJVH 2P5WA 1RUKL 3BZ4B 5F6HJ 3SCMA 1ERNA 3BT2H 3LKSA 3T2OA 4F9PA 3DO7A 2RQ8A 1EO8H 3PQYB 4OQTL 5GGUB 4A2LA 2PYFA 5KSBF 4Y19A 3B9KD 3VGAC 4G9FB 1T1WB 3O0RL 3JV0A 1L0YA 5DWUH 1K4DA 2YPLE 3B6SB 1EMTH 1KCLA 4F7EA 3RZCC 1BX2A 1QQDA 1N7ML 1C08A 1CLCA 3DROA 1TQBB 4NQEE 1S7VA 2NY3D 5K9JH 3OJMB 3MRGA 2VJXA 5J4MA 3WS6C 3D9AH 4EZMA 2F54A 4D3CH 1BJ1H 3D18B 4M6MH 2NMSA 4B0MM 4DUVA 2BSED 4JKWA 4UU9B 1E4KC 3BP6B 3THML 1T5XA 4IEFB 3S36L 2YD8A 1AY1H 3KPPA 5J9PA 5JOPE 4J23A 5A2LH 3VE0A 2CGRL 3VFSA 1T1ZA 4BFGA 3ULUE 3L3HB 4FXKA 3BPOC 3FQNA 4MD4B 3RDTB 5IB4B 3MRIB 3VXUA 1NKOA 1X3DA 2X9YA 3ARVA 4OM0H 5GISL 1A8JH 1UGNA 5C0NC 4PGCB 4XPBH 5D7LA 3LKRA 2C3WA 4ETQB 1BBDH 5DMKA 1W0WB 4FRWA 4UILH 5I9QB 5INCB 2NX5D 1WICA 1DN0B 3HNSH 1MCWW 4KI5C 1RAMA 1IAII 3EOAA 2BVQA 1NGYB 4M7ZB 1FL6B 1NC2D 5BVPL 2WZPD 4OZHA 4PFEA 4N9OB 2NTSP 4BJLA 3BRGC 3BE1L 5FA3A 1AIFA 2RCSL 1KCUH 1K8DB 5FM8A 2VZUA 3O3AB 1G9MC 1MWAL 3OKLA 1U8QB 4GW1B 1RUPL 4JVPA 3MRCA 2RR3A 4R97C 3RY6A 3AU1A 4R6UA 4YBQC 5D5MF 4U1MA 9CGTA 3G5YB 1T2QL 3B43A 3W9EB 1FPTL 3ROLB 1NDGB 1NDMA 1T1XA 4OFPA 3V6FB 5ID1A 3L1OH 4MA1C 3WNPA 5F9AC 3ZDZE 1EXUB 4OQTA 4P2QE 2VNCA 1WF5A 4D9LH 1E4XH 1DQQA 1FZJB 2AJXL 7FABH 3EOTH 1HN1A 2DD8L 4LLWA 3T0EE 2NNAB 5AUMB 3RTQD 4ZOBA 1WFNA 3TESA 5JLZA 1XCTA 2LVEA 2DQCL 1CD1B 1Q9WA 4R3SA 1I1CA 3MRHA 3OAZH 4XCNB 4P5TD 1QACA 4NC2B 1OTTC 3ZT5A 2PTTA 3TNNB 5F89B 1CD8A 3U2SA 4ZOEA 1FIEA 1MRDH 4MA7L 5DQJB 1N2RA 3W0WB 4W81A 3GEWB 1QFHA 2JE8A 2LAGB 1OWWA 2FBJL 1QRNA 4QHUA 3S96B 4HWBH 1UT9A 4FTVD 1XR8B 4PJGA 1NCDH 5I1AB 4TSCL 2AVGA 1MHHA 1ZANH 4ODTL 3TV3H 1XT5A 1JGEA 3MACL 1GRWA 3G08A 5DHVA 4OF5A 4C83B 5L9DL 1GGYA 2Q3AA 3FO9A 4JM2B 1HILB 5DVOA 5F72S 3BDYL 4IMKC 4L4JA 2L4OA 2J4WL 2YBRB 1SBBA 2Z93B 4LQ1A 4XP4H 2R4RL 3I3BA 5IB2A 5TGBA 1T7WA 5A43C 5CILL 4RGNB 4EI5B 4HUKB 1KCVH 1GZQA 4YR6B 1QSZA 3GNML 1CVSC 1U9KA 4HUNB 5HYIA 4XP6H 1MFBL 2FHFA 4JAMB 2Q8BL 2EDLA 3G6JE 1P4IL 4NM8L 2YEZA 4Q0XL 2RB8A 5ITBL 3BEVB 4DGYH 4Q2ZA 5CS7A 4DFHA 2P5WB 4MQXD 5HHXL 3SCMB 5BZDA 3LKSB 3DO7B 1ZEAH 2LTQC 1MJUH 4BQ8A 3TVMA 2I9TA 2CRIA 1WGOA 2PYFB 3HPJA 3S34L 3S3JA 2WUBL 4GXUN 3TO4D 2BVTA 4QRRE 5L8KB 4L5FH 1K4DB 2QQNL 3MLSH 3RU8L 1WT5C 5CEZE 4F7EB 1BX2B 1QQDB 5F7DA 1C08B 4LL9A 2EZ0C 3DROB 1U91B 4W6WB 3ETBF 1MI5E 1FC2D 1D9KC 4XBEL 1JFQL 1RK0A 3GIZL 4G3YH 1NAMA 3PDGA 5MENA 4KK8D 4ENED 1CGXA 1ZLUK 3DMMD 2F54B 3OZ9H 4X4ZA 4HSQA 1FCCA 2YR3A 2V7NA 3PNWB 2FZ3A 4KMQA 2VSDA 3RQ3A 2OR8A 3KPPB 5J9PB 4M62H 2XRAL 4U7KA 3VE0B 3VFSB 1T1ZB 1WWWX 2P8MB 4FXKB 3FQNB 3VA6A 4IS6A 1RZ7L 4GKZA 4X6DF 4GG6E 2DM3A 5T1KA 3E8UH 3VXUB 4ZXBA 1F2XK 1U2HA 2IADB 5D7LB 3IDXL 5KSAD 2GJZA 1KT2A 1NBZA 3H3KA 1YN6A 3OMZA 4P9HC 5IQ7L 5I8OH 1WT5A 4OFYD 1HHGA 4LOUD 2DQDH 2BVQB 1G0YR 4HQQL 2F58L 4J3SA 3TWCH 3I75B 2FIRT 2VDML 3B5GA 4WGVB 2ZUSA 3BN9D 5FA3B 5GXBB 1A6ZA 3GDBA 3PUCA 3QI9A 3I6LD 8FABB 4BZ2H 3OKLB 3HRZA 4JPIA 4XP1H 4NN5B 2JJUA 1AD0A 4CNIA 3K3QA 3MRCB 3AU1B 4GAYB 3PWJA 2PXYA 2XKSA 3WEXA 4U1MB 4G6JL 2NY1D 1JE6A 3BPOB 4U6HA 5DQDL 4YDKL 2AEQH 1NDMB 5D1XC 5GSVA 1F13A 3MV7E 5DR5L 3QBTB 3BKJH 1ACYL 1T1XB 2DIJA 4LCCA 2HFFA 4KHXL 5C70A 2QL1A 4RBPH 1F4XL 4YXLL 4JFHE 2FSEA 4LLWB 3NABH 1J10A 5KG9A 5ISZE 1H9VA 3KPLA 5JLZB 1XCTB 2V6HA 3HUJA 1CYGA 3QFJE 4PB9H 1A3RL 4H8WH 1RIHL 1Q9WB 2KBGA 1QLEH 3VDBA 4R3SB 5F9OL 5DJ0A 3MRHB 3RVVC 5B8CC 4LQFL 1DP0A 3BVNB 2OTUA 2D4FA 1SJVA 4OCXH 3VFGH 4OTXH 2PTTB 3AREA 2EE6A 4NQCE 5HYJA 4BELD 3U2SB 3WFEH 4LVHC 2I26N 1CLYL 1OM3H 4NN6B 1N2RB 1GC1H 4S10A 2APVA 3SQOL 4KZEL 1HSBA 2UZIH 2FHCA 4P2OC 4MA1B 4KTEH 3Q6FA 4MS8C 5IMMA 4QHUB 4ONFH 1AKJB 4PJGB 3EYUL 1UWXH 3NIFF 1INDL 4FN0A 1BVKA 2AEWA 1IC5L 1MHHB 1Q9OA 1JGEB 3G08B 3QUXC 3FO9B 5IHBA 4HKZA 1FNLA 4NO0D 1DBBH 4JPWH 2EYRA 1UJ3C 2WP3T 5TGBB 4Q9RH 2LQRA 5HDQH 2JK5A 2XQBH 2D7TL 2YOCA 1GZQB 3PHQB 3IDGA 2DLEA 3TA3A 3MPCA 5C8JA 4FQLL 5I16A 1D5MA 3PQYD 3CSPA 2OZ4H 4XTRD 4G9FD 2NW3A 5F96L 2YEZB 1QTYT 4Q2ZB 5GGTL 2CLRA 5JR1H 4FNLH 3CXDL 1MCWM 1PX3A 5BZDB 5F3BA 1S7SA 3LQAC 3TVMB 1JGVH 3BPCA 3B2UD 4P0DA 3MR9A 1AXTH 2NY7H 3HPJB 4N0UE 1J9CT 1A14L 1DBJH 2NTFA 4F7TA 2DWEB 1KB5L 4XT1C 4JEGB 3DI3B 4EXKA 1YNTA 1DLHA 4KUZH 5F7DB 1IGMH 1G7MA 4OLVH 4KTDL 1RK0B 3PG2A 1B6UA 1NAMB 4ELMA 1PY9A 3RDTD 2J5LC 3DX6A 1HQ4B 3VXOA 2V7NB 2Y36L 5BRZE 3IF1A 1H8SA 2FZ3B 4DW2L 1NGWB 4Y2OA 2IALB 1R3KB 5FUCE 1FIGL 5DD1L 1VSCA 3R8BB 3MLYH 4IS6B 4GKZB 1RZKL 2LTQB 4YH6A 3TT1L 5T1KB 4BK5A 4JQIL 4ZXBB 5CEYA 3O2WL 2XXMB 1WUNT 2XPGA 2OTPA 3T4YA 1NBZB 3OGOE 4RX4D 1YN6B 4ZSOA 4NJAL 1BD2A 2EEBA 2VO5A 1YYMH 1HWHB 1PSKH 3WBDA 1QVOA 2F8OA 1TETH 3BQUC 5JPMA 3FRPG 1N4XL 2Z4QA 1A6ZB 5IMOA 5IBTL 5B22A 3SE8H 5D96C 2BY0A 3HRZB 3DOSA 4YHMH 3P0VL 4CNIB 3SY0A 1NMCB 2MPAL 4KKBD 5JZ7D 4FQ1H 3NIGE 3FQTB 2PXYB 3O2VL 4WI8A 4I0PC 3WEXB 4QYOA 5HHOE 1E4WL 2BSRA 4PR5A 1GIGL 1QG3A 3C5SA 4U6HB 3CCHA 2D7NA 5GSVB 2C5DC 4ZNEE 3IXAA 4KKCD 4WI6A 3H9SA 4MAYA 5IROA 4LSPL 2MFNA 3DURA 2HFFB 3UPCA 4YLQT 5KSBE 1GPOH 1MREH 2OR9L 4M7KH 3U0WH 1KB5A 3N1FC 2CDEA 4NC1C 2FSEB 3A6BL 4KJPC 1U8IA 3HUJB 4YK4B 2R9HC 3W0WD 1J0ZA 3GSWA 1N5AA 3F6IA 4JFDE 4NRYB 4LGPB 5DJ0B 2IPUG 4OD1L 2OK0L 1UM4L 2FYYA 2OTUB 1G6RL 2B2XL 3AREB 1MJ8L 2VZ3A 4RQQA 5L88L 2VL4A 1FVEB 1JMZA 1JNNL 3C8KA 4RMVA 4XBPA 5SWQA 3T3PE 1I1YA 1C1EH 1E6JH 1FO0L 3NH7L 5D1XB 3QDME 5D8JL 1HSBB 4JM2D 3VWKA 1AI1L 2EDKA 2IGFL 2DM7A 4R90H 3Q6FB 1JGLL 5IMMB 3RPKA 1XZ0A 2WANA 2YUZA 5EN2B 1N5YH 4JO4L 2YMXL 4ZS7H 1BVKB 4RGND 4EI5D 4HGMA 1MRFL 4N8VA 4U6VL 3HNTL 2OR7A 4GQ9L 4BUHA 4HKZB 4GAJH 4U6YB 1FGVH 4UNVA 4PJBF 2YKLH 5LXGH 5E8EA 1QKZH 1XCQA 4R4FL 3CDCA 4Z18A 5LCVL 4P5MA 4BH8B 4RGMB 3KG5A 1DANU 2EYRB 3CVHA 2FECI 3WJJA 1F4WH 5DRZA 3IT8D 1J8HA 4HXAH 2ZCKL 1D5IH 5IW6A 2R1YA 4EJ1C 3HN3A 2OI9C 5CJ8A 2P5WD 3IFNL 1MUJB 3IDGB 3SCMD 3ZDYE 5C8JB 5I16B 1NGPH 1A7OH 5D5ME 1D5MB 3AAZA 1WZ1L 5EBMA 3WXVL 5TPWH 1GXEA 1F11A 2NW3B 4PY8I 4MNHA 4E42A 5A2IH 1SYSA 3GSRA 2WNGA 1FYTA 3MOAL 3LEVL 5F3BB 1F8TL 1S7SB 5CHNA 5ADPH 1CXLA 4FFZL 1T7VA 3BPCB 1N6QH 1GGCH 1QEWA 4X7DC 2CDGA 2CLVA 1EA9C 4F7TB 2F54D 3QZWB 1MFDL 4HXBH 5D2LE 5F1OB 4A2MA 1XEDA 5C2BL 1PD6A 2C4FU 3O6LH 4WUUA 3PWPA 1YNTB 1DLHB 1MH5A 2R39A 4HHAA 1HDMA 1IAIH 3NA9L 1G7MB 5HHVL 3T65B 1NCCL 4LKXA 4XXCA 2MCPH 3A6CH 4I3GA 5C07E 3VXUD 5F7FA 1D6EA 4KV5E 3VXOB 3QULA 1T0NA 1HYRC 1DCLA 3IF1B 4LLDA 5D7LD 1FO0A 3T0AA 5ADOH 2H32A 3LRGA 2VLLA 3RVWC 3QQ9C 1RI8A 4NO5A 4G8FB 1VEOA 3PV6A 3QDGA 2VR4A 2H3NA 1GH7A 5KN5A 1AC6A 4KTYA 1RZFH 1BAFH 5CEYB 1OGTA 5HI5D 4MX7A 2XPGB 3T4YB 3HE6A 4F2MA 2CH8A 1FGNH 5FYLE 2O5YH 4P9ML 4ZSOB 4MAUL 1BD2B 2I5YH 2WIIA 4I3SH 4JFPA 3R0NA 1DQJA 2EDOA 3P11H 1QVOB 5DJ6A 1R3JA 4JFEB 2ADGA 4XX1G 4QOKE 5JPMB 3B8SA 2J5LB 5FYKE 2Z4QB 4XB8A 5IMOB 4DN3H 2CJUH 4KK9C 5C0ND 5TF1H 1G9MH 3SY0B 5JQ6L 2FB4L 2BMKA 3AXLA 1PFCA 3JWDL 3C5JA 5D93C 2DQIL 2BSRB 4OKDA 1NBVL 2RJMA 1NSNH 4PR5B 3C5SB 1EFXA 3CCHB 3IXAB 4ZUUB 1U3HA 3H9SB 4MAYB 1IL1A 4HKXA 1I8KA 1H5BC 3QSKB 4HC1H 4EN3A 3DURB 5IP4A 1T21B 3IFLH 5DK2A 1CWVA 3RGVA 3BWAA 5DD3L 1KB5B 3WCYA 1KEMH 2CDEB 3ZKSD 4OZGF 3D2UA 4YHOH 3U9PL 4YDJB 1U8IB 1AQDA 3VH8A 1TZGL 2Q20A 3OAYK 3MBEA 1I7ZA 4LF3B 3GSWB 4K7PX 4MSWA 4Q6IC 5JDJA 3UTPD 3KPRD 2FYYB 1ZSDA 4WDIA 5E2WL 5BVJB 5LWYL 3C2AL 3RWDA 4YGAB 3F7VA 2HFEA 1CDJA 1ZOXA 1AKJD 4G6KL 4RQQB 4Y2DA 2Z8WC 4PLOB 4WCYL 5FUOH 1L7IL 3H0TA 4XBPB 1I1YB 3SGEI 1ZVYA 2APXA 3QH3A 4JFZH 1T3FA 4O2EB 3R8QA 3V9FA 4HWEH 4KRPB 5I1GH 3MUZ1 4X6DE 1J0IA 5LBSL 4WFGE 2K1MA 4JR9L 2JJWA 4OLZH 2ENSA 4LASL 5AAWA 3BKCL 5F88A 5ELIA 3NGBC 3S7GA 3S5LA 3P2TA 4XPHH 1BWMA 3GJFA 3DV6A 5E7FA 5JW4Q 3FO0H 1TQCC 4N8VB 4PJHF 3DARA 1O7VA 2YD9A 3VRIA 5JNYA 1YEHL 4JFXA 4K8RL 4Q9CA 5DVMA 4UBDD 2DLIA 4F9LC 4WFFD 5E8EB 1EV2E 1XCQB 4P5MB 3CVHB 3DO3A 1J8HB 2R1YB 1I9RL 4OGXH 2GYSA 4ODSH 1EO7A 4DKFH 4CDGC 5JO5A 4F58L 1NAMH 4KY1L 3AAZB 3QCUH 4XRCA 3TVMD 3FRUA 5EBMB 4L3CA 3JXAA 4MQ7A 2GY5A 1F11B 1OLLA 2JELL 3KYOB 4MNHB 1KJMB 3QA3A 4E42B 1SYSB 1UFUA 1A9EB 3ULVL 1A6UL 1GAFH 5DD5H 1FYTB 5A2JH 4ODHL 3WIIL 5CHNB 1UZ6F 3BPNB 4FFWD 5TQ0H 5ILTH 3M8OH 1QEWB 3CLEH 5IBUB 2PKDA 2BRRL 2CLVB 5F3HA 5IV2A 3O3EA 4WUUB 2GKIA 1OVZA 2ZSVA 3HZVA 3DV4A 4GXVL 1MH5B 4HHAB 1HDMB 2AGJL 1FNEA 2XG5A 5D6DA 5JA9A 5F8QC 3QEQE 1OW0C 2DQHH 1W2KT 4H1LG 5BZWA 2R4SL 1RQ5A 5FHAL 4Z7WF 5GRVL 4PJ5A 3WS3A 5T1KD 3U4BH 1D6EB 3QULB 4ZXBD 1T0NB 1LHZA 5IR1A 1FO0B 1IBGL 3S35H 2H32B 2VLLB 3QEUA 2GW5A 2Z8VC 2YPLA 4J3VA 4A6YL 1JZ2A 1I3GL 5D7KE 1IGCL 4NO5B 4O58H 3QDGB 4JG1H 2VDNH 5DEGB 2H3NB 2VLKA 4NQEA 5IVZA 2MCG1 3NIFE 3QNXB 1DQDL 2IPTL 1OGTB 3MLZH 1AGDA 4TQEL 2VTFA 1C5BH 3CMOH 4CVZA 1NCUA 3U48A 2YZ8A 3ZTJG 3EYFA 3HE6B 4NZTH 5C0GA 1P53A 4F2MB 2AXFA 2MOVA 2LE9A 2WIIB 3DX9A 5E94A 1YEFH 1UCTA 1DQJB 2PXYD 1CR9H 5HHNA 5DJ6B 5B4MD 2ADGB 3REVA 1BFVH 5E9DE 2CIIA 4OCYH 1EGJL 3UBXA 1RIUH 3ARFC 3MOQA 4XB7A 4P46A 2P8PA 3UBXI 3AFLA 4W4NA 4Z0XA 2BMKB 3AXLB 4NUGL 4MHHI 1H15A 3C5JB 3CSGA 3RWFA 4CMHC 2BY2A 4YFLF 1EFXB 3T0EC 3CIQA 1U3HB 3RPIA 4JHZA 4I9WD 1IL1B 1I8KB 1KCRL 1ONQA 4EN3B 1ZLSH 1X5XA 1KN4H 4NYLA 4JRWA 2BY3A 4LSTH 5DK2B 2B7DT 3RGVB 3BWAB 2HT3D 4PP2A 3LN5A 5JORA 3ARED 3LKOA 4TRPL 3D2UB 5J3HC 2BK8A 4HEPG 3TCLA 1AQDB 3ARWA 4XAWL 1LO4H 1A1OA 5D1XD 3MBEB 1I7ZB 1I9JL 3UZVB 1UACH 4HH8A 4OM1L 4MSWB 4MA8L 2VXQL 5TDOB 1ZSDB 1NMBH 4WDIB 1MHPL 1WEJH 2EDBA 3RWDB 3ARBA 3F7VB 2HFEB 1H3TA 1RIVL 4BYHA 3M45A 4Y2DB 5D93B 2WLZA 2GIYA 3H0TB 1RZ8B 3SJVE 3QH3B 1ODAA 4A6YA 5C9KA 1TIUA 3O6ML 5FCUL 3C6LC 3F7PC 1HZHL 1O7SA 3EGSA 1YYLH 3UTSE 4NFDA 1FNSH 3RVVD 3D39B 5F88B 3DGCR 3SE4C 3S5LB 1I85C 1MPAH 2GJ6E 3GJFB 3MA7A 2GK2A 3DV6B 5KAQF 1JNLL 3P9MB 3QO0A 3AS0A 5JNYB 1SJHA 3MUY1 4JFXB 4HZLA 3T3MF 1OSPH 3MXWH 2EKJA 4Q6IB 1FG2B 1EGJA 3OKEB 1P84K 5KS9F 2ZCHH 3G5VA 4MS8D 4R2GB 4PG9A 4I18C 1MFEH 1ZGLB 4XP9L 5JO5B 1R0AL 1XGTA 4U1IA 4XRCB 3FRUB 4GAGH 4L3CB 3IDNB 4HMEA 1TPXB 3QA3B 4AH2A 4MWFB 1YMMA 4HUMB 1G7PA 3VXMA 2VXTL 4NZRH 4XNUL 3CAFA 3QUML 3QUKA 1MVFA 3GMMA 3DHMA 3SGJA 4KRNA 4YDVA 3LQAH 3QXDA 5F3HB 5IV2B 3O3EB 3P4OA 1XF5A 2ADJA 2ZSVB 3HZVB 4X6FA 5GGVL 4X5XB 2YD3A 3UJTL 1PG7H 4O2CA 3WFCL 3DV4B 2Y6SC 3G6JA 1FNEB 4LGRB 1CICC 3QCTL 5BZWB 1VPOH 4UQ2A 1IQWH 4X5LA 1A6PA 4G6FB 4FQQA 4K94C 3WS3B 3MA9H 4X7FC 4KXZH 2XT1B 4YX2L 5IR1B 3U7YH 3WD5L 3D85B 2GTWA 4QRRA 3QEUB 2YPLB 2BZDA 3FONA 3MJGX 1BD2D 4RWHA 4BFIA 5BO1H 5IEKB 1FZKA 1UWGH 1WTGT 2IQ9L 3NIDF 4LHJB 2VLKB 4JFED 1SQ2N 4LKCB 1MI5A 1F3RB 4NQEB 4WU7A 3EJZD 5IVZB 3V52L 4B7IA 4D8PA 1AGDB 3E2HB 4PS4L 4Q9QL 4CVZB 3TN0A 1XF4B 1C5CH 3EYFB 1RK1B 2HTKC 1F00I 2AXFB 1TVBA 4Z7NF 3UZQA 5LGKA 3W39B 5I19L 3GO1H 2E6QA 2OP4H 3DX9B 4YUEL 5E94B 5MEPA 1QO3A 2VXUH 1UVQA 3LZFH 4AT6A 5HHNB 5FOJA 1P7HL 4I3RH 3REVB 1BHGA 3IJHA 4WY7H 1CN4A 2CIIB 2QV2A 3Q2CA 1Q9KB 4GG6A 3NCYP 3GBML 2FO4A 3UBXB 2X9XA 3H9SD 4MAYD 2FEDD 4P46B 2P8PB 4HJ0D 1DQML 4X7SL 1LEGA 4FQIH 1TCRA 3P3YA 4KVNH 1H15B 2X4NA 5CINH 4RRPG 3RWFB 2EECA 4OZFA 4DQOH 1QBLL 3EOYG 5T3XH 5DMYA 1EJOH 3RPIB 3QUMA 1M6OA 2ED7A 3GMLB 2HH0H 1ONQB 3CFIC 5IFHL 4HLZG 1BQHG 1CFQA 2I27N 1QA9A 1J18A 1ROWA 4XNYH 3QXTA 4PP2B 4YBLC 5FYJE 5MERB 4QXGH 4HGKC 3T0BA 1GGTA 2PNDA 4S1QL 2WINA 5BCAA 2KH2B 3SO3B 1GOGA 5DJDA 3TCLB 5T3XD 1IAKA 4PJ8C 3HS0A 2VR9A 1A1OB 5DRNA 4OIBA 2AS5M 2VISA 4KRPD 4H88H 4TTGA 4PIRF 3O45B 2IJ0C 4QRUA 3ARBB 3CVHH 5AZ2H 5F1NA 2WP3O 3EUUA 1NJ9A 4NHCH 4PJCF 5CJOL 1P2CB 3MXVL 1Z3GL 4LSUH 1JF1A 4A6YB 2IWGA 1F90L 3UJJL 3T0EB 3V5HA 2BC4A 4ALAH 3PWNA 3EGSB 5L2KE 3RIAK 2R9HD 2GI7A 4JJ5B 1E27A 1G6VK 3VWJC 3Q48A 3LH2H 3I6KA 2EH8L 3TJHD 1YY8A 1J8HD 4LSPH 3MA7B 1JWUA 4HAGA 4WHCA 5IVNA 1GGUA 4KRMB 4OFDA 1K8IA 3O41A 1SJHB 3GKWL 4PGBA 5FO7A 1F3JA 5GS0L 4HZLB 3I3EA 4HS8H 4J3XA 3ZE2F 1IEHA 2HFGL 1W72A 5I73B 2WBWB 1I1AA 1QSEA 5TFSL 4R7DA 3G5VB 4J3TA 1TNMA 5I71C 1FYTD 4PG9B 5JXEC 1I7TA 4XWOC 1XGTB 4U1IB 3TBSA 5IB1B 4YHYC 2AV7A 5EUKA 1ZLWK 2F8XC 2FL5B 3IYLW 4AEHH 4GRWH 2BNRE 4M3KB 4AH2B 4WUUD 4NQUA 4AL8H 5BJTB 1G7PB 2QQLL 4NQXA 5B38G 3VXMB 3A67L 4JFQB 2JJSA 3GFUA 4HF5L 3BDBA 3TM6A 4OLWH 1NUFA 4NCC1 4OZGE 1TCMA 3QXDB 5FM5M 4PGDA 4O51A 3KPNB 3P4OB 2ADJB 4NKIL 4WI7A 5HVWA 4X6FB 2HRPH 3RKDD 4O2CB 4QXTA 3G6JB 3H42L 3OXRA 4L3EE 2AXJA 4UQ2B 3UAJC 1DVFA 3QDGD 4KKAD 1S8DA 3VXRD 1KNOA 2ATKA 5FV2A 4FA8A 2MQCA 2H9GA 3FMGH 1N59A 3HR5A 4PJAA 5F7EL 4YE4H 4R8WL 4P48A 4I13B 2G60H 3F7QA 4N0UA 4Z7UF 3UP1A 3HMXA 1IT9H 3HE6D 3OGCA 2GTWB 4QRRB 4M5ZH 2I24N 3FONB 4XAKD 4XCEA 4ZO9A 4EOWL 1FZKB 5I66A 2DQTH 4EUPG 2N7AA 1N0XH 3OHXA 4WU7B 5HI3C 1MI5B 4G7VH 3VJ6B 2FRGP 1S3KH 4P9HL 5E2TH 3O2DL 5J6GA 2WWMD 1TVBB 5FXCH 4P4KA 4OLYL 5EZLA 5KW9L 4AQ1B 5MEPB 1QO3B 1UVQB 1WWAX 4CDHA 3KPSA 5EO9A 2AQ1A 4FP8H 4HK0A 5LJYH 4DOHE 2UV3A 3IJHB 3UYRL 2PF6A 3LMJL 4KKLC 5HYSA 3S37L 4GG6B 4BA8A 1GHFH 1U3HD 3T1WA 4YC2B 2NQCA 1NGQH 2CUIA 1RU9H 3LPWA 1JWMB 4EN3D 1M7IA 4LCUA 1LEGB 1TCRB 3E6HB 3RGVD 2HN7B 3SGEH 2X4NB 4QRTA 3QDHA 3WFZA 1X5YA 4KROC 1TNNA 2H2PC 1M4KA 3D2UD 2CO7B 4FS0A 4JB9L 3D6GA 4ZNCD 3CJJA 5FHBH 5LQBH 4P3CH 3RWEA 1M6OB 4IRJC 3KYNA 3O8XC 4Y88A 3MBED 1F4YL 4JM2F 1A7NL 4KK9D 2O5ZL 5CD3A 1FYHB 1EAJA 3K80A 1QA9B 5HVGB 3DUUA 3HZKA 4OSUL 4X5WA 3GJFH 3QXUA 1I8LA 1T80A 2WINB 5I1JL 4Y2DD 2VLMD 1X5IA 5DJDB 1IAKB 5HHOA 3SO5A 3HS0B 4K3GA 2HFTA 5ID0A 5EBGA 3L5XH 1UYWL 2VDQL 2XN9E 5DRNB 2A9NL 4QRPE 3B9AA 2XOTA 3CFCH 1IE5A 4QNPF 5FUZH 3MV7B 2V7HA 5D7JA 5LGJA 1NJ9B 2BY1A 2PN5A 1TFHA 3D39D 5KSBA 3WIHH 1MIEH 1JF1B 4ZG1A 2DQJH 3C8DA 4OAWA 4JQXA 3V5HB 2BC4B 2G2RA 4JE4B 5LAXA 5ISZB 3MBXL 2R0LL 3PWNB 5I30H 3QDAA 1E4JA 1JK8A 4H0IA 1CXFA 1OAZH 4QF1B 3QFJB 2WBJA 1WQVT 5JHDE 4JFDA 3I6KB 4LPUA 1JI1A 3EKCA 4APQC 1JWUB 3BSZL 4CJ1A 2E7LA 4R2GD 2L7JA 1F4HA 1YEJH 4LFHG 4NQCB 1OARH 1K8IB 2EH7L 3O41B 4NOBA 4LNVA 4PGBB 1F3JB 4MZ2A 2ARJQ 5HDBF 3QDMA 3GMNB 3EYOB 1W72B 1CI5A 1UCBL 2FEEI 2MNUA 1R24A 4RISL 4XMLL 1O5DT 1YQVH 4FHBD 1CDCA 4C59B 1PBYA 4HPYL 4EQ3A 1I7TB 1AR1D 3ISWA 5EUKB 1QBMH 3TPUA 1HE7A 1HYSD 5C6WH 4NQXB 3VG0L 3TBWA 1LMKA 1UJTA 3HC0A 3L6FA 2XZCH 1PLGL 1WBZA 4JO2H 3WLBA 3UXFA 3VA2C 2XQYK 5EU4A 3T0DA 4G6FD 4OZHF 1CG9A 4PGDB 2OS7A 3O6FC 5I15L 3V4UL 3IFOA 2FD6H 3DI2B 4QXTB 1Z2KA 2EO9A 2R69L 3D85D 3ME0A 1CBVH 5EOCL 1PKQE 2YPLD 1FLRL 1AGFA 3L9RA 4LU5L 4U1KB 5ENWA 1T66C 4ODWA 1KNOB 3FQRA 2VLKD 2ZG1A 4NQED 2H9GB 4TULH 1N59B 4PJAB 3WHE0 3ULUH 3D0LA 4KJWD 4N0UB 2W0PA 2XI9A 4U1HA 1A7PH 3OGCB 3OPZL 5D2LA 3TYGH 3FOMA 4JQVC 2P47B 3TT3L 1EHLL 1AP2B 1CFSA 4WW2F 4XCEB 2WV3A 4N9GA 5I66B 3V4PH 3RHWK 2C3GA 3DUHA 1TTUA 5KBNC 3EJYC 2W9EL 3OHXB 4JPVH 5JOPD 3RVXD 2X40A 3VGEA 4OLUL 2XY2A 3ULUD 3DGGA 3G6DH 5DGQA 3QEHA 5C07A 4FFYL 5J6GB 4HUUB 1NCWL 4P4KB 2QHLA 4P46D 4YHLH 5EZLB 5BRZB 3L5HA 3T3ME 2QADC 1OAKH 2E27L 5JOFA 4M3JA 2NLJA 4JPKL 5EO9B 1QLFA 4HK0B 1OP3K 3RI5K 3H8NA 3V6OC 4QXWA 3BD4A 5HYSB 1KYOK 1CL7L 2DKUA 35C8L 4J8RA 4MMZC 3CU7A 1E6OL 1TVDA 5K9QI 3HR6A 1V5JA 1M7IB 2PTVA 25C8L 4LCUB 1KIRB 4G6AD 4YIQA 4UTAH 1AD9A 1D5ZA 3C08L 4NM4L 4UB0H 3QDJE 4PY8J 5D72L 1XF2A 2VLJE 4PJGF 4MZ3A 2OL3H 3N1GC 5E6IC 4XX1E 3RWEB 5GJSL 4QOKA 5E8PB 3KYNB 3X3FH 4MLSA 2P43B 1CE6B 4MB5A 5CD3B 1IGIH 1NAKH 4ZAKC 2ITCB 4C55A 2X4QB 3F58L 2P48B 3ARBD 3DUUB 1U93A 3HZKB 3P0YL 3HI5H 1KPVA 1WIUA 4X5WB 4LAQL 4QGYA 4NHUA 5GJTL 3AM8A 3WXWL 5HHOB 5DZOA 3NACH 5CUSH 3T0ED 2YD5A 1CFTA 1Q38A 4M1CC 2V7HB 2X4OA 5D7JB 1FZMA 5TE6H 1RVFL 1A7QH 5JHLL 3I6LE 1NCNA 2C1OA 5KSBB 1VDGA 2NY5C 1TJIH 3UTOA 1HXMA 4M7JH 5C0AE 3D48R 1JCKA 4Y5XA 2G2RB 5LAXB 1F97A 4GW5A 4LRIA 5E6IA 4FQXC 1JK8B 2IG2L 1MAMH 3AMKA 5D1QA 3P77A 1IARB 4XCCH 2OM5A 2XA8H 1A7BA 3HZYA 4JFDB 3QJHA 3WJLC 4IDLA 3N9GL 1BMGA 1KENL 4UUJA 3MGTB 2GSIB 4NNXB 4Z7OF 2J3SA 1JPSL 1DLFH 4POUB 2EC8A 4CU7A 2BFVH 3BKMH 3QDMB 2XZAL 1CLZL 2AABL 4X6DA 1HKLH 1R24B 4HS6A 2EYSA 4RFOH 4X6EB 4EI6A 3VXMD 1QYGH 3ZL4L 3PGFL 2WQRA 4YXHH 5I1CL 4YDLB 4NP4L 2W0LA 3JTTA 1YEGL 4PBWD 5IJKC 2DQEH 3RVTD 3TPUB 4S1DC 3ZHKA 5FGBA 5IG7A 4L29A 4XVJH 3TBWB 3MV8E 4LSQL 1DSFH 3HC0B 3L6FB 4KUCD 5BMFH 1WBZB 1L6XA 1LQSR 5CEZH 1N3NA 5EU4B 1SJEB 4WV1C 1S78C 4TPRH 4B50A 4XHJD 4KDWA 2YD1A 4DZ8A 1KBGH 2CKBA 3BXNB 3U6RA 5D5MB 1AJ7H 1JL8A 4LSVH 4RA3A 4AEFA 3IFOB 3BKYH 4CGTA 4QRRD 2X41A 4Y5VA 5CZXD 2NZ9C 3I02A 5DSCA 1AGFB 4HKJA 5CEZD 1Q94A 4S1RL 5ENWB 2JB5H 3JTSA 4ODWB 3FQRB 1W0YT 1L7TL 3LS4L 1ITBB 4RBPK 1MI5D 1BQUA 5INDA 4F7PA 3D0LB 5E24E 2HJFA 2W0FB 4UOJA 3KHQA 3FFCA 4U1HB 5D2LB 4ODVH 3DUSA 2IAMC 3FOMB 1CFSB 4K3HA 2HT2C 4N9GB 4G9FE 1A6AB 4H20L 5JA8B 5CCKH 5I8EA 3QEQA 3X14A 3QYCA 4RMQA 4R0LA 1NCBL 3DGGB 3Q1SL 5GRZA 3QEHB 3HUJF 4NOFA 1GCFA 1ZHLA 5C07B 1A6VH 2IANA 5A3IC 1P5VA 1N0LA 5BW7A 5HGHA 1V7MH 4M6NH 2F74A 4G8GE 5DJZA 5AYQA 1TITA 1XGUA 3KVQA 1HKFA 2DDQL 3ZE2E 5JOFB 2NLJB 4NUJA 5GGRY 2ZKHH 1QLFB 3U7WL 1L9MA 3OJ2C 4NIKB 1UWXK 4J8RB 3QIWC 3GI8H 1WK0A 1KV3A 2HTKD 4YIQB 1AD9B 4FOMA 1D5ZB 5KSUB 2FLBT 1XF2B 2DMCA 5CZVL 5BQ7A 1HXYA 5C6PB 1VA9A 5KZCB 4JRXE 4QOKB 2EIDA 5E9DA 5I1IH 3BN3B 4Y16C 1RJZA 2ORBL 1KJ2L 4DTGH 3MV7D 5DEZA 3UDWC 2W91A 1D6VH 1U93B 4J3OC 1KPVB 1MCCA 4YGVB 1ZLVK 3FJTA 3MUJA 1XF3A 1FNFA 5AG9A 4HBQA 4P59H 5SX5H 5J56B 1YPZA 2W60A 4R96A 1QSVA 4JFHD 2A74A 4ERSL 1PQZA 1YMHA 1G7LA 1CFTB 1JF5A 5ISZD 5DD0L 4HCRL 1BF8A 3VI4F 2V17H 4HWZA 5C7XL 2Y25A 4EVNA 3RWIA 2MKLC 2X4OB 3QFJD 1JPGA 4OF3A 3U0TA 1FZMB 1W72H 2I60L 2Y5TA 4K71C 2C1OB 2D3VA 3FFDA 4Z7UE 2UVEA 1MCPH 3CH1A 3GM0A 5IK3B 4XC3H 1HXMB 1NFDF 5LG1A 3AY4A 1VGEL 1EVUA 4Y5XB 4NQCD 2O5XL 1J0YA 4GW5B 5E6IB 1S7QA 1AXIB 2J8UE 2YPVH 3GI9L 4K23H 2CMRL 2NY4C 3MLXH 4N5ED 4OT1H 3BPLC 1KJVA 1S5HA 3HZYB 4UAOC 5E5UB 1HI6A 3MROA 1T89C 3W5MA 4GRLC 5GRVK 1OLZA 1NANH 4UUJB 5EUOA 2FIKB 2DQFA 3WDJA 2P7TA 1MCQA 4ELMF 1OGAA 3PHSA 1SM3H 4M1GH 1DBAH 2VXVH 1I9IL 4WO4A 3LN4A 2YHGA 4X6DB 1YECH 1YUHA 2EYSB 1CIUA 3UTSA 1KUMA 2H2SC 4EI6B 3WFDL 1YNLH 3UC0L 4HAFA 1KJ3H 3C9NA 5EPMA 4IHOA 3NPZB 1KTKE 4IIQA 1UENA 1IGTA 5DK3A 3JTTB 5CEXA 3QNYA 3EO0A 6CGTA 5DURB 2J7LA 5ESQA 3O9WC 4PRHE 3CXHK 3HG1E 3INUH 3LV3A 5IG7B 3HMXH 2A77L 4L29B 3L3JA 2ZWLT 3NFPB 1YEIL 4JLRA 4DVRH 1BQLL 1N3NB 2CRMA 1XGYH 5IB5A 4MMXC 2Y5EA 3T0XA 1Z6JT 5GGSA 4DZ8B 4RNRA 2BVUA 2CKBB 3U6RB 2AJUH 2DJUA 3ARTA 1MFAH 5EWIL 2F9BT 4CADA 5A2FA 3R1GL 4Y5VB 1NUDA 4OIIH 3I02B 4L8SC 4C4KT 4OF7A 5DSCB 4UTBL 1Q94B 4PJXE 5MEOA 4LP4A 4WUKH 2NY0B 1VACA 2X1WL 4F7PB 2B20A 4XPFL 1F3DH 2HJFB 4XMKH 3ZKMD 3FFCB 3WN5C 5E2UL 2VWEC 3DUSB 3S35X 3Q5YA 4P4KD 2VZVA 4LVOB 3QXAB 4Y19E 5BRZD 3H3PH 3PWVA 1HIMH 1UWEL 1DR9A 2EE9A 2ICCA 2R0WL 4JDTL 3QUZA 3TYFB 1PVHA 2W59A 5I8EB 3QEQB 2P5EE 4R0LB 2HA1A 4LCIL 1ZHLB 1NEZG 2R15A 1EHNA 1S9WA 4S2SA 5T3ZE 4YPGA 2JCCE 5HGHB 3IKKA 4MD0A 5DJZB 2F54E 1XGUB 5HDBE 3X11B 3MMEA 2G75A 4NUJB 1J05A 2EDNA 1T83A 3HC4H 2XA3A 5SV3A 2JF1A 4OGAC 1JYNA 4TSAH 5AZEH 5L7XL 3L5WB 3RBSA 3DETC 1INEH 2X89A 1Y0LA 4I4WA 2IAMB 4M7LL 4C57C 3MRPA 1LWRA 5D2NC 3ARYA 3LKNA 3OKNA 5BQ7B 1HXYB 2A9ML 3KDMB 3PV7A 4OBSA 4Y8AA 4ZQKA 5F7MC 4M6OL 4DKEL 4AEEA 1AHWA 5HHOD 1IGJA 5EU5B 1WSST 1Q72L 3U0PA 5E9DB 1RJZB 4NO2A 3PL6A 4OZHE 5K59F 3T1FA 5C6TL 3HNVH 5D7JD 4HT1H 1MEXL 1XF3B 2EIEA 3O6KH 3SGKC 2W60B 4R96B 3Q6GL 4DUXA 1P9MA 5F6IB 2A74B 1YMHB 2X5PA 4ODUB 1G7LB 4OCSH 3GBLA 3RNKB 4LVEA 4DKDC 3RX7A 3IS0X 4HWZB 4EVNB 5CWSA 4TUKL 1JPGB 3DTXA 3U0TB 3CFKA 1PJ9A 4UQ3B 3EOBA 4DGIH 1BVLA 2Y5TB 2VDOH 5IT2L 4JFDD 1LO2H 3FFDB 2DQGH 3CH1B 1HINH 4ZO8A 5F7KC 4XWGL 4XNZB 3K81A 3MLWH 4WWKA 3REWA 1S7QB 4GMTH 2QHRH 4P2RE 5EIQA 3QRGH 2DLFL 3UX9B 2RAMA 3QDMD 2CK0H 5EOQH 1KJVB 1S5HB 3RHWF 4XNMA 3CU1A 2XWBA 5EA0H 5GRUL 3MROB 1FORH 2X7LA 5FECA 1UA6L 2DQFB 2P7TB 1SEQH 1JHLL 1H3PH 4ONGH 1XH3B 3SJVB 3VW3L 4BQ9A 4WGWB 4JO3H 4NNPH 4WO4B 1EUUA 2Q76A 3I9GL 4JN2A 1IZJA 2ZOKA 1YUHB 4MQSB 1ED3B 3UTSB 1LILA 5ALCH 1IKNA 4K71B 2E9IA 3MOBL 3WUZA 4JN1L 3CVIH 4LBEA 5DC4B 3C9NB 3LIZL 1ADQH 1IRAY 5FKAA 1RHHA 2GJ6B 4JGMA 1QRNE 3E0GA 1IGTB 3WFBH 3T0WA 1MCNA 1WAAE 3ALPA 1DFBL 5CEXB 3QNYB 3R06A 3EO0B 4UV7H 1OF2A 1V8HA 2VDPL 4KFZC 3B2VH 4OCRH 1K6QL 5ESQB 3D5OF 5GS1C 5T1DH 1Q1JH 3O3BA 5I1KL 3BAEL 1T20A 3LV3B 3TBYB 3L3JB 5F7LB 3NCMA 4X7CC 3N1PC 4JLRB 4UAOB 4KJYA 4NWUH 4FQCL 3T09A 5IB3A 1JZ4A 1VB9A 4GO6B 5IB5B 1IAMA 2R2HA 4LRNH 5JIKA 5GGSB 3QXWA 4RNRB 1TJHL 3V4VL 4PUBL 1JTOA 4EKXA 3T8XA 2Y72A 2HVJB 2X42A 3ALWA 5DA4A 4XVUD 4L8BA 3MRKB 1PG7X 4CADB 1A64A 5CGYC 3DSFL 2VITA 2CUHA 5HPMA 1XGPA 4K94L 5MEOB 1CDYA 1A6WL 3MTRA 4GAFB 1VACB 2AJYH 2Z31A 1V3JA 4JG0L 5F44A 1BBJA 1XGRA 3I3DA 5KVDH 2XV6B 3V5KA 5C07D 3HB3C 2Y06L 1LDPH 1TJGH 1B2WH 5BOZG 3B9KC 5FYLH 4KJQD 5EB9A 3QUZB 4KMLB 1J88A 4EDWL 2A73A 3B5HA 5C0EB 4PB0H 4ORZC 4I2XE 5J1AA 3PE9A 2D9QB 2NY3C 3FN0L 5FYKH 4S2SB 3VCLB 4Z7OE 4AMKL 5MENE 1X5GA 4PLJD 4G6MH 4MD0B 2GT9A 3WUWG 1CGSH 4L8SB 4U1NA 2G75B 5FYLD 1J05B 1KELL 1JBJA 4I5BA 4LARH 4QTHB 2R0KH 3EJYD 4CBPA 5KZCD 3CDGB 2X4SB 3C5ZA 4QOKD 1Y0LB 3PP4H 4BQBA 5FYKD 4I4WB 1SY6H 2AJSL 3WN5B 5AD0A 4OB5L 4BFBD 4JKPL 4QHNA 3MRPB 1I3UA 4KQ4H 2BOCB 5B21A 1BM3H 3OKNB 3LKNB 4HJJL 3KS0H 2COQA 4IOSD 4ZQKB 3NTCH 3IDYC 1AHWB 3PP3K 3UPAA 4KHTH 4IDJL 1C7TA 4RFNC 1OAUL 2D03L 2HYMA 3U0PB 3ZKXC 5EBLA 3NFSH 1EZVX 1VERA 4NO2B 3PL6B 1EJ6A 3T1FB 3U83A 4AG4H 3IVKA 5EZIL 1VFAA 2PO6A 5DMIH 1QNZH 4EQ2A 2H26A 4Y1AE 2Y07H 1RZJH 2VDKH 4LSSL 2ZNWA 4NBXB 4Y4KA 3KPQB 5E6ID 5CWSB 1UB5A 1QPXA 4JJHA 3DTXB 1X5FA 3CFKB 4X0KB 3FRPA 3EOBB 1BVLB