1L4IA

Crystal structure of the periplasmic chaperone sfae
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
205
structure length
189
Chain Sequence
GVALGATRVIYPEGQKQVQLAVTNNDDKSSYLIQSWIENAEGKKDARFVITPPLFSMQGKKENTLRIIDATNGQMPEDRESLFWVNVKAIPAMDLQFAIVSRIKLLYRPQGLVIPPEQAPGKLEFTRELTLFNPTPYYLTVTDLKAGNKSLENTMVPPQGKVTVNIGGDITYKTINDYGALTEQVRGVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords SfaE PROTEIN
publication title Structure of the S pilus periplasmic chaperone SfaE at 2.2 A resolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 31
structure length 189
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l4iA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l4iA02
1KF9B 1EX0A 4KGLA 4XTRD 5I8CB 1ZA3A 3UC0L 2FBJH 2J6EA 1EEZA 1KLGA 5F1NA 1YY9D 5TE4H 4P46B 1OSZB 5GGVY 3U6RB 3IDNB 3QDJD 5SWQB 2HYMA 3F7VB 4LP5A 1LEIA 3VXMB 1M7DB 2VLJB 3TFKC 1AXTL 3DURB 3KPRB 1MH5B 2X70A 1IQWL 4OD2B 4TULL 1RUKL 1KTDA 2FLRT 3IKCA 4FS0A 4YHKL 43CAA 1UM6L 1FRGH 2I24N 2WQ8A 3N50A 5L2JA 1I7ZB 5F9DC 5C71A 1HWGB 3DUSA 3HE7D 5EFIB 5A40E 5CMAA 1QBML 4QY8B 2NY2C 2Y4SA 5FKAB 4K94L 4L8CB 4LGSB 1WBXA 4OUUA 1LWRA 2FYYA 3QUYB 1BLNA 2LVCA 1T21A 1C12B 5FXCH 5SV3A 5CINH 4M1CD 1FJ1A 4Y7MA 4ODHL 5ABDE 5I74C 3UROR 3E8UL 2VDNH 2WP3O 1NCCH 2ZP0T 4KK6C 4DGIL 4N5UA 4P2RB 4QGTA 2X4SA 4X6CF 3F6LA 1I7TA 4FQLL 2YPVH 4FABH 4TYUA 4RAHA 1VACB 4EUPH 4FG6C 1C16A 4JRXE 5HHMB 4WUUA 5DQJB 5ESVA 3HE6C 4F37K 3WD5L 2BSTB 1YUHB 3K7UA 5AYUL 5L88H 4BFGA 2R29L 1UXSA 2DLEA 1JN6A 3L3JB 5GGSA 5ESAA 5E0QA 4RWYL 2EDRA 2FATH 5EBLA 4F3FA 5KW9L 3GSNL 1B2WL 4MS8C 4WTZA 3PP3H 5DEFB 4PJCA 3BGFB 5BS0A 5D4QA 2DOCA 4OM0H 1FORH 3VXQB 3UTSA 1WBYA 2W0LA 4NZJA 1YYLH 1IGMH 1SY6H 1HKLL 3CUPB 4MSWA 1LO5A 3DGCR 5JQ6H 4FQPA 4LLMB 4G42A 4OZFG 3GJEB 3WSQL 3OKKA 1X5YA 1EUTA 4TUOB 4X98A 4D3CH 3D3VB 2D4DA 4ZQKB 4P5KB 1BECA 1Y0LA 3FQNA 3CSYA 2VE6B 5K9OA 4LEOA 3WJJC 2NY2B 1JZ2A 2A9NL 2PW1A 1EFXB 2IALA 1MELA 1FGVL 4Y2DD 4HDIA 4TVPE 3KYNB 5CILL 1RHHA 1OAYH 1GGUA 5IQ7H 3OJMB 3VH8A 1QLRB 1AH1A 1AXSB 2UZIL 2XWJB 5DGQA 2DLIA 3T3ME 2YPKB 2NY7L 3PGDA 5C0FB 4C56B 2EKSB 3CFKB 3NIGE 3MXVL 1GYAA 5IK3B 2ICWB 2WV3A 4MNHA 5E2TH 4S2SB 3L3HA 4XNUL 5A2IH 4YHZH 3KLSA 1NC2D 2YBRA 4PLJD 4ZFFA 1G7HA 1A6TA 3HE6B 3SGDH 2PYFA 4I0PD 5CZVH 3ROOA 4U1IA 3MLYH 3G6AA 1KEGH 4GKOA 1CE6A 3MA7A 4S1RH 4X9BA 4LCCA 4YHPB 3LKPA 4YXHL 1ZKAA 4ZOAA 4PJ5D 3MBEA 4M5ZL 3OKEA 5BVJA 3O3EA 5ISZA 2CKBL 2P8MA 3RNKB 5HYJD 4BK5A 3IDXL 3SDCB 4MQ7B 2R1YB 1N5YH 5CGYD 1BX2B 3DV4B 4IRSA 3KXFA 1I9IH 5IFAH 2L7JA 3FL7A 4G8EA 4ODXA 1FLTX 2J7LA 2GY5A 2VDLL 1VFMA 4XI5C 4MJ2A 3DXAD 4XT1C 5IR1B 2ATPA 5FM8A 3BP7A 2VXVL 2JF1A 3MRFB 1FO0B 4X6BA 3EUUA 3OQ3B 2AXGA 3TN0C 2I60L 2ED9A 5EO0A 3JVGA 3MRIA 4BFEA 4TQEH 4IOFD 3JZ7A 1L9MA 1DQML 5HTSA 4HC1L 3EDFA 3KG5A 3VU2A 1ZVYA 1GL4B 3I02B 4RMQA 2IAND 3EOAA 1S5HB 1FG2B 3C87A 1QFWM 4WI3A 5TQ2L 4HXAL 1F5WA 2QSCL 5D2NC 4PJIB 1FYTE 3NN8A 2JK5B 2VSCA 5EZLA 1MHCB 5IP4A 3SE9H 5DD1L 3NAAH 4JGUA 4OCRH 5DS8B 4FQHB 5DRZA 2YN3A 4EVNB 1A6VL 4K2UL 2RCSH 3HB3C 2ADIB 1MFCL 4I9WD 5IKCA 3K4ZA 3OAZH 4W4NA 1M05A 5HI3D 1E4KC 4L8SA 3BP4B 1LK3H 2IPKA 3BIBX 4DUWA 4ZAKC 4WWKA 5A1AA 2B4CC 1VEMA 3CX5K 3BKML 5EH1A 1TTUA 5ALCL 4LCWD 3FB5B 5L7XL 4JFFB 4YO0B 2MMXA 3TNMB 3WV0A 3RAJH 5E8NA 3WXVL 5JNYB 4JZJA 3MV11 4LSUH 3STLB 2O61B 4KMTL 4G9FE 4P9HL 5HHVL 1N6QH 3IFPA 1A02N 2DKUA 3EDDA 1G7IB 1UT9A 4PJAB 1CK0H 3EHBD 3NCFB 1MQ8A 3FFCB 1VPOL 4HWBA 3ZYIA 3VXRD 3H3PH 3V0WH 5GIRA 3HUJF 3O4LE 4X99B 1UM4H 1PKQE 1FN4A 5DHVB 4F57L 1A6UH 5L9DH 5INCA 4Z7UB 4C59B 3MUGB 3WLWC 1QFUH 2X4TB 1LVEA 4YHOH 5B4MC 1YN6B 4JVUA 3LPGA 1IGFH 3QCTL 4CJ1A 3BYTA 1KLUA 5I8OH 1DBKH 1DLHB 4RIRA 4ZXBC 4RISH 1ZOXA 2JJSA 5LGJA 2APFA 2JCCB 4K3JH 4LKCB 1PLGH 2HFTA 3UYRL 1AKJD 4WHTB 4M8VA 1E6JH 1NLDH 2H1PL 4R6UA 5JIKA 3MBXH 1T89A 5E2VH 5IHZB 5DD3H 2KZWA 2W0FB 3PABA 4ZAKB 1W0VB 5I6XC 4JQIL 4X0KB 3OKLA 4EXKA 5ENWB 3IDIB 5CD5D 3ZL4L 5EOCH 1RZKC 4PREA 4IMKA 4YXKH 1XGPA 1YMMA 4MA3B 4ELMF 5JW4N 3X3FL 5DRNB 3EFFB 2DQEL 1DQQB 1TJGL 1C08B 5C0CB 5INDA 4N8PA 2AP2A 3G5XA 2BMKB 3PHSA 4OJFH 5DWUH 4BM7A 4XPTL 2DQTL 1QRNA 1VDGA 1LNUB 2FEDC 5IF0A 4J4PA 1MUJA 1EDQA 2NY0D 3QWRA 4GXVH 3WS3B 4M7JH 2F54A 3S37X 3O8XA 4MJIA 2KQNA 1AD0A 4DK6A 1FVEA 5JMRA 1K4DA 3W82A 5TE7H 2ICEA 1QSFE 2XT1B 1S9WB 1XF2B 4TNWK 1K6QL 3MOQA 2COQA 3FJTA 2Q8AL 4QOKD 4KK9C 4YAQA 4YDJA 4ZOEA 3QO0B 3LKQB 1KB5L 2AV7B 2PCPB 3ZDZE 4HWUA 4KKCC 3VFMB 4BZYA 3QHZH 1NCAL 5KN5A 1DZBA 1K2DA 4NQDD 3SY0A 4DGYH 5CFHA 4W6WB 1KJ2L 2EYTB 3MJGX 1NH6A 25C8H 2E8YA 2BNQA 3FRUA 5TQ0H 5E8DL 1NDGB 1QRKA 1CIDA 1DFBL 1RZIB 1U58B 1DP0A 1N2RB 5HDOA 4Y19B 4UILL 3IU3A 4UAOC 5CAYB 1R3IH 1CICD 1JGVL 4NRXB 3UZVB 4OBSA 4JFHD 3V5DA 3FQTB 1S9KC 4MWFB 3BPLB 4QHKI 1UWGL 4R90H 5I6XB 1OVZA 5D1XC 5FYJD 1UZ6E 1IC7L 4OZGF 4FQXB 4PG9A 4YLQT 3C6LB 1XR8B 2WQRA 1RIVL 4OQTA 4OM1H 5KVDH 1K3IA 4KY1H 3LQZB 1ITCA 3PUCA 3WEXA 1PY9A 1MCPL 2XZCL 4LCIL 1J1OH 1DEEA 2W07A 4DN3L 7FABH 2YUXA 1CLYH 1G1CA 3EJYD 4D9RE 2HJLB 3RWFA 1IM9A 1KB9K 3PWVA 3ZYZA 3MOAH 5GS0C 2W92A 3T65A 1DUYB 1I8LA 3GMPB 2M1KA 4LARL 2PNDA 1KN4L 2C9AA 2HT3D 5ITBH 5JW5B 4OKVA 1X5IA 4QT5B 3OKOA 2Q8BL 5JQHC 2NTFA 4G6KL 1OPGH 1KCLA 2ZG3A 4GW1B 4N8VA 4FZ8H 2OLDA 3WXWL 2E9BA 3RPIA 1Z9SA 5J6HB 4WV1A 3MXWH 1FNEA 3A6BL 5FUOH 2YR3A 3BEVB 4NJAL 3FB7A 4CW1B 3V4VH 4Z9KB 4E41E 1MY7A 5EU4B 4ZFOB 1AIFA 5A16B 1R24B 4XAKE 4FMKA 4R8WL 5F1KC 3HNTL 2XTJD 4PLNC 4OV5A 4I3RH 1DQTA 2Y5TA 5DJ6B 1RUPL 5C9JA 5F3BB 2JJTC 4R26L 3IB4A 1P4BH 2OR9L 2HMID 1KOAA 1RIHH 4BSWA 4LSTH 1T6WA 3VWKA 3QRFM 5EU6D 4HCRL 4UAOB 3VXUE 4GXUN 2LTQC 4I18A 2AABH 1NC4A 1JHTB 4JRXA 3RGVA 5DJYB 4Z7VB 3D5OF 3OKNA 2WWKT 2YD6A 3DHJA 1F13A 1TZGH 2XV6B 3MREA 4LNRB 1NGWB 3VXSE 3MMEB 1JV5B 1KGCE 4NKIH 4GRLC 3UO1L 3MRMA 1SQ2N 5EOCJ 4WU5A 2WWKO 3G5YB 1YNTB 4XMKL 4XVUD 3CVHL 4FQQA 3JV4B 1L7TH 1CFNB 2FH6A 2FWOA 2YPLE 4MA8H 1H8OA 5JUEL 4HIEA 2Z9TA 4Y4FA 4PR5B 2ZWLT 3MRCB 2Y5EA 4PJDF 5IBTH 2WIIA 3O2DL 3BHBA 1U2CA 4CVXB 3EYUL 4HWZB 3S88H 2QQLH 3V5HA 1G7MB 2JIXB 4PG2A 2D0GA 2VH5H 1J10A 1QR1A 4V1DD 4F15C 2C1PA 3GFUA 1LEGB 4F2MA 1HH9A 2DL2A 2R1XB 4NQEB 5FO7A 2VDMH 3TCXA 3QEQB 3S4SG 1DQLL 3FFDB 1B4RA 1K85A 3DX8A 2VUOA 3FKUS 4Q6YA 1G84A 1SYSA 1BVLA 1FZJB 3R1GL 1JYNA 3LKNB 5F1IA 4LSDA 1JNHA 4NN5C 2Q7YA 1EHXA 2G60L 3VJ6B 1UXWB 1PYWA 5MENE 3HZMA 3QUKB 3MRGA 4ONFH 5F88A 4GRWE 1ZHNB 4HQQH 4UDTB 2BY0A 2LVEA 4LLUA 4GG6B 4LDOB 5F72S 1J7VR 2A38A 4ZUWB 2LTQB 1J8HD 1FIGL 3EO1A 1RI8A 4YZFE 2F8XC 5DA4A 5FCUH 2BNRD 1FPTL 3MSPA 4W6XB 3H7BA 4QRUA 3WBDA 2AK4E 1PSKL 4PJXE 1PBYA 4GRLB 4Z78A 4OSUL 3T1FB 2AQ2A 4P4KD 4U1HB 4JREC 1MFAL 1DSFH 2P5EB 1OLLA 1TNMA 3CGTA 2YOCA 4L4VE 2R2EB 3VGGA 1DN2A 3TV3L 4EEEA 3SKOB 2I5YL 4Y5VA 5DD5L 1IGTB 2HVKA 4WVRA 2IGFH 1BREA 2BVYA 1UH3A 4H26A 2WAHA 5DMIL 4UB0L 3OG4B 1EEZB 1KLGB 3UPCA 3MACL 2BJML 3BQUD 4LIQE 1IGML 1G7QA 4KWUA 1RUAH 3KJ6L 3NCMA 1RHFA 5E94A 2F19L 1LEIB 3VD7A 1WTLA 4Z95H 2DD8L 2X70B 1KTDB 3IFOA 1U2HA 3IKCB 1AY1L 1XR9A 43CAB 2AJSH 1NCBH 1Z9OA 4PJ8D 1FYTA 1S78C 5L2JB 5FOBA 4R2GD 3CSBA 2X1OA 1QSEE 1MJ8L 4NHCH 4PGZA 5CMAB 3RVWC 1R5WA 3ZSSA 4P2YA 3PIQA 4RCAA 1RURH 3FO0H 3HHRB 1IC4L 1WBXB 1I4FA 4OUUB 2FYYB 1BLNB 5EBGA 4XP6H 3UZQA 3EYOA 4M1DL 3FRPG 4JO4L 4X8JA 1FJ1B 5AWNL 1FZKB 1OP3K 3VWJB 4HZAA 5CEZH 1IBGH 2YC1A 4P23C 1AO7E 3IRZA 4DOHE 3Q6GH 3DLQR 5FGSA 2X4SB 2VABA 1I7TB 1RFDH 3EYQD 4JREB 3OB0H 3NPZB 1EHAA 1C16B 4YHZL 2AJYH 4WUUB 2B1HH 4DUVA 4HJ0D 5D7LE 4G9FA 3WFEH 2VLJD 5ESVB 5CZVL 3MLYL 1CLCA 3OPZH 1BVKA 2IG2H 3MOBL 3N1PC 1KEGL 4H1LA 1NEUA 4WCYL 1B88A 3MNWB 1UXSB 3GSQA 4LCCC 1JN6B 5ESAB 5EBLB 3DYMA 5KZCD 3MJ9A 4WFGE 3HC4H 1BEYL 1M6OA 5EN2A 2XQBH 4H8WL 2OL3A 3O4LA 2PTVA 3CH1A 5BS0B 1WF5A 1PKQA 1R5VA 3UTSB 1WBYB 2PTTA 2V17L 5DSCA 4IRSC 4JY4A 4OD1L 2N4IA 4MSWB 1LO5B 2J4WL 4QTIH 5I15L 1JZ6A 1J0JA 3OKKB 5GZNC 5D6CA 4X98B 2Z8VC 3BP6A 2P46B 3SQBA 1HCFX 4JJ5A 4RGOL 4PPTA 4GAJH 1ADQA 1MIEL 1Y0LB 3FQNB 1N3NA 3CSYB 1BZ7A 3N85L 3PDGA 3JVGC 3TYFA 4R0LA 1NAML 2OJZL 3DMMA 5C09E 4YHLL 2OSLA 2C26A 2PW1B 5E1AB 2IALB 1A2YA 5J56B 4HDIB 3I3EA 2FNBA 4FQ1L 3WFBH 1F2QA 2R4RH 3CFIC 5E4EC 43C9A 1RHHB 4FFYH 4C55A 3MV7E 2HWZH 1JWMA 4XPFL 4LOUD 3VH8B 5C07E 2F58H 5EU3A 2MQCA 4NRZA 3PGDB 2NTSP 5GISL 3O6LH 1T7WA 1AHWA 2RCSL 1KELH 3LIZL 4MNHB 1NLBL 3K4DA 3DSFL 5CCKL 4HKXA 3L3HB 1KXQE 4ZFFB 1G7HB 1A6TB 1OY3B 5FYKE 5GRUL 4L8SC 4U1IB 4EIZC 4GKZA 1Q72L 4WWKC 3G6AB 1S9XA 4UTBL 3DVNA 3VGFA 3MA7B 5D2LF 2APTA 1OGAA 4LCCB 3LKPB 3BD5A 2DLGA 2NR6C 5C2BH 5J0BA 3MBEB 1MAMH 1IILE 1AC6A 3OKEB 3NOIA 5BVJB 3O3EB 4JZJC 5H35A 5ISZB 3HTLX 2P8MB 5F7KC 2YRZA 5GXBB 1N6QL 5HHNA 2DYPA 4DFIA 1O5DT 4DK3A 4MNQE 4S10A 2H2PC 1QSFA 2VQUA 5IHUL 4H0GA 1EEYA 4IRSB 5K93A 3KXFB 4R4NC 3O6MH 3S98A 4P99A 3GSNA 4G8EB 4ODXB 3EDEA 5E9DB 3CLFL 4IDLA 4KK6D 2D9QB 2FR4A 4XPHL 1RZ7L 4PIRF 2ATPB 3BP7B 2EC9U 4UV4L 4X6BB 1RQ5A 4ZSOE 4MAYD 3BESR 1ORSA 3WNOA 5D71L 5L9DL 3VA6A 5SX4I 2C5DC 5EO0B 4L4JA 3M45A 5D96C 2X4RB 4TNVF 4NQSA 3DI2B 2X09A 3GHEL 3BAEL 2QLVB 5TE6H 4M5YH 5C9KA 3EOAB 5E4EB 4OT1L 3WO4C 4NZUL 4HLZG 4Q9CA 5I8OL 3AS1A 3ULSA 3R8QA 2V9TA 3GRWH 1MPAL 2ARJA 2JJSC 3M1BB 1W8NA 2DQGH 4LBEA 3U7AA 1MJ7H 5DRZB 5FKPA 2CXKA 2GY7B 3AGVA 5IKCB 1RU9L 3DGGA 1BD2D 4BJLA 1M05B 5E2VL 3P30H 3C5SA 1T89C 4F33A 4L8SB 4IIQB 2IPKB 3VFGL 4RMRA 1IL1B 3T4YA 3TCLA 3O6FA 1U8PB 4AIXA 4HFUH 4OLUL 4YHMH 2J3SA 3IDGA 3UEZA 5E8NB 4HZLA 4IMKC 1WK0A 1LO4L 4JZJB 2G5RA 5T3XL 3TC9A 5I9QC 4HIIA 5FDWA 1JIBA 2B0SL 3IFPB 4UNTA 3WIFA 4NUGH 4LU5L 5IFHL 5E7FA 4M61A 1YEHL 3FAWA 2VDPL 4NCDA 3EO9H 5C0AB 4E42A 4KUZH 4ZO9A 4J4PC 2X4PA 5HDBF 1RZ8A 4E41A 2AERT 3V9FA 3L95A 5GIRB 2Z93A 3O8XC 2FECL 5TFSL 1FN4B 5KVGH 5INCB 1J0KA 5GGUA 5K59E 3RIFF 1UA6H 5EORL 1RJLB 3BE1H 5D96B 3L3KA 4RMUA 4LNVA 5HDQL 4PP1D 5JW3L 3VXUA 2PO6C 5F7UA 1J5OL 4WEMB 2X2YA 5F6HJ 4M00A 1IGJA 4MNGE 5KVEH 2FGWH 1MCLA 1KLUB 5HYQB 3DI3B 1DBAH 2QSQA 3IJHA 3VXSA 1JK8A 4RIRB 2XZAH 2YD4A 4HC1A 3C9NA 4JR9L 4UOW0 5LGJB 3TO2A 3TESA 1FG9C 1U8QA 3VXTA 3P77A 4L3ED 1T22A 4A6YH 3WCYA 4I0KA 2YPLA 5DMGD 3V6BR 4XBPA 3UPRA 1JWUA 3PABB 4R90L 5CZXC 2K7QA 3IDMB 3U9PH 3OKLB 1F45A 3TVMD 4XWGH 3TN0D 2IAMA 4G8FA 2FCBA 4LF3A 4PREB 5IB4A 3WFDL 4OZIE 1W0WA 2WIMA 1XGPB 4QXUL 1YMMB 4N9OB 3ULVL 5I9QB 4Q2ZA 4NSKA 1BQLL 1MWAA 5CGMA 4LP4A 1G6RL 1G0YR 3IGAA 4MX7A 5INDB 3MOAL 3G5XB 1WAAF 5F9OH 1I8LC 3PWNB 4ZTPL 2CH8A 3VXPA 1QRNB 4M48H 1GGCL 5DJ2B 3RVXD 5GGTA 2F8VA 3OXSB 4GFTB 4K7PH 3RKPA 5LWYH 4IRZH 5FYJU 3O8XB 4MJIB 1AD0B 1FVEB 2C7UA 2E7MA 1K4DB 4OLVL 3QDGE 4MD4A 4ODWA 2FRGP 5IJKA 1IGYA 1WZMA 4JY5L 4WV1C 5MENA 1BIIA 1LDPL 5IEHA 3QNYA 4ZAKD 4NQXA 2VLRE 5DHVH 1PJ9A 4YAQB 5JLZB 3T04D 4YDJB 4WTXA 2ZCLL 5EOTA 1I8IA 2D03L 5KN5B 3QCUL 5B8CA 2AK4A 4PJXA 3JWOL 1U8LA 4QO1A 2BNQB 4ERSL 4Y4HA 3FRUB 5FHBH 3FHAA 2ZJSL 2RR3A 2E6QA 3TJEH 5EU7C 5C0IA 2A2QT 3T1WA 1TQBC 3ZE2E 3VWKC 3ROLA 5B39A 3LN5A 4I18C 5DUPH 2QQQA 3RGVC 2ICWJ 3BZEA 1DR9A 3V5DB 3JV5A 1V7MH 4RRPA 4L4VA 1QBLH 3INUH 3ULUH 5ILTH 5M94B 2QHLA 3ESUF 4WFFE 5A2LH 4U6VH 4LHUA 4PG9B 1D6VL 5GRVL 4Z5RA 3WLWD 4F37F 3FQXB 1NMCC 3NACL 3OAUL 1YJDC 3UJTH 1I8KA 5HHOA 2BSSA 3WEXB 3ZTJH 5EIQA 2XN9E 4AEIL 3RWFB 1IM9B 4G8GE 3PWVB 3T65B 4GUPA 1MRDL 2X89A 4N8CH 4PG2C 3IXTA 4ZXBD 1NUDA 1MRCH 2VC2L 4OKVB 1PZ5B 5FGCE 3OKOB 4Y19D 2OS7A 2EE6A 4WGVB 5K9QI 2UUDK 3LPWA 3OGCA 3TZVA 6FABL 3BIKA 3T08A 1Q0YH 3RPIB 4WV1B 3EJZC 3IAGC 4OLZH 1QSEA 3ZKXC 1FNEB 4PJAF 1XGUA 4ZDHA 4WI4A 3FB7B 4WI6A 1ETZA 3ETBF 1RMFL 1Z0MA 4ZO8A 4WFHD 3FO1A 1AIFB 5TH2B 1T7VA 2R69L 4K3DH 4Y8DC 4Z77B 1G6VK 4L4TE 3RU8H 2Y5TB 5C9JB 4M7KH 4LL9A 2MCG1 1ACYL 1U8OA 1AO7A 4Z7UF 1GHFL 3ZDXE 1LK2A 1KB5A 1TQBB 3VWKB 4MJ4A 3BW9A 5I1JL 3ZDYF 4I18B 1NC4B 2HRLA 4JRXB 3RGVB 4V2BA 2NXYC 2GSGA 3OKNB 3P4OA 5D7LA 3NABH 3O3UN 4Z7NF 1SEQH 3KGRA 3MREB 1I3VA 4WENB 3MRMB 5HVFB 4TUJA 1EUUA 4N0RA 4QHNA 1A1NA 5F71A 4FQQB 2W9LA 4NWUL 5BJTA 1KENH 1Q9WA 4JN1L 1I3UA 2FWOB 4HIEB 3CLEL 5F7WC 4Y4FB 5IM7B 3S36X 3U4EB 4KKCD 3LRHA 3MLPA 5L2KA 1DCLA 5ECJE 1T2QH 2WIIB 4ZYKA 1FLRH 4Y5VC 3KYKL 4NO5A 1B4JH 4K71C 3MCLH 2EDEA 3D1MC 1MHPH 5IVZA 4GSDL 1QR1B 2BRQA 3V7AG 4KK8C 3MUJA 5E6YA 5D5MB 3CAFA 3O0RH 4F2MB 1HH9B 2AK1H 4PJ9A 5FO7B 4KJPD 4L1DA 1VCAA 5ETUB 4CUCA 4U3XA 1CZ8L 2OZ4L 4ONHA 1BAFH 1NBZA 5D1XD 5C09A 2W65A 2DDQH 1BVLB 3MODL 5T5FH 1IT9H 1NCBL 1C5BL 3MV7A 4TRPL 5F1IB 4WNQB 1JNHB 3VG9C 4O9HL 5SWSD 3JWDC 1GJIA 1YQVH 5C07A 2KUTA 3MRGB 4FQ2H 5F88B 3PV7A 4XGZA 3ZO0A 1S3KL 1DBML 3L7FA 4LLUB 4XB7A 4P5TD 1PG7H 3LS4H 3EO1B 2JIXD 2JJUA 2NXYB 4XCEA 1ZLVK 1I9RH 3UTQA 3H7BB 1U0QA 4QRUB 1JFQL 2Y6SC 4MMZC 4GOSA 4MVBC 2H41A 4Z78B 3ARYA 3D39E 4B5EA 5E8PA 4QWWC 3K81A 4U1GB 1DN0A 1DQDH 4XNXH 3SDXE 1M71B 3EJJX 2FX8L 3M8OL 4X6DF 3DYPA 5I1CH 5KS9F 4R96A 1B6UA 3WFEL 3SQOH 1HEZA 1JF5A 5T1MA 3FZUD 3V6OE 5DI8A 1MJUH 1JZ8A 4MNQA 4PJ7E 4POZD 3VFWA 1F4HA 3OWEA 4NZTL 2ZUUA 3U79A 3VFSA 2YD1A 1HQ4A 4YGAB 3TIDA 3BKYL 4Y5VB 1XF5A 3ZZ1A 1KT2B 4K71B 4WO4A 4M7LL 3SE8L 4YH6A 3RP1A 3MYJA 3NFNA 4BH7A 5T1LA 3HC4L 4PJHF 1FFNA 2AQ3A 4FTVD 4H26B 3B9DA 4RFOL 5BO1H 2HFGH 4QNPF 4ZSOA 4DZBA 1I9JL 1MNUH 3UBXG 1G7QB 5DHYB 5HYFA 4JZOB 3CPLB 3QXUA 4HMEA 3SDAC 3E6FA 3U82B 4GRLD 2CXGA 4P2QD 4PGBA 3KHOA 4JKPH 5FYLD 2ZUXA 1JPSL 2CK0L 3J8F7 1UGNA 1A7OH 2DQJH 4TTGA 5F7LB 3IFOB 5E03A 5CKAA 1XR9B 1FYTB 2P5ED 4BKLB 3VG9B 1XCTA 5JXEA 4NGHH 2GQHA 5I8KH 2AEPL 4IJ3C 3SJVB 1R5WB 1RZGA 4R0LC 5BVPH 3DMMC 3P11H 3PIQB 1CD8A 1HHHA 5D1ZC 1I4FB 2HH0H 4X9IA 1H0DA 4QCIA 3WFBL 1DBBH 5F7FA 2F5BH 3BDBA 4X8JB 4LRNL 3CX5J 1QFHA 2FHFA 1AI1H 1VADA 1BQSA 4NQCD 3WNMA 3MLUL 5GS2D 4G6MH 4HV8A 4XRCA 1PG7W 4HPYL 2YC1B 5LJYH 3VDAA 1IZJA 3O6LL 1TNNA 2VABB 3D69A 1AHWC 5A43C 1UH4A 4I48A 4BK4A 3U0WH 3ARQA 4JY6A 4TTDC 3ARGA 3TM6A 4M6AA 2V2XA 3Q0HA 1BVKB 5AD0A 1F8TH 3ZTNL 4R3SA 4ZO6A 4EZMA 1HHGA 1VFOA 4GKSA 3GSQB 2VXSL 4EUPA 4FFZL 1Q0XH 5EUOF 3X3GH 4S1SH 3HS0A 5GRZA 1P6FA 5EN2B 3O4LB 3V6ZA 1U8HA 3CH1B 1JNLL 3T3PE 1PKQB 1R5VB 5DT1H 1GC1H 2X4OA 4PRBA 4WW1A 5DSCB 2NX5E 3Q3GB 1WT5A 5KG9A 4XH2B 5LXGH 5JO5A 5DR5H 4G43A 1E6OL 2WSKA 4AEHH 2P43B 1HHJA 1KIRA 4YEFA 2VLME 1N0XH 3ARFA 5D6CB 3BP6B 1I1YA 1LO0H 4TNWF 4JJ5B 1SY6A 4MNGA 3C6SA 5F44A 5GGVH 4G6JH 4PJBA 1N3NB 3LQAH 3MR9A 1P7KA 5JA8B 1UWXH 3IETA 1EJOL 1BZ7B 4YX2H 4IJ3B 3TYFB 4PRPE 1ZWIA 4R0LB 5C8JA 3V52H 4O02H 2OSLB 3UX9B 3EYVA 3JTTB 1SVZA 2X9XA 3GNML 3IVKA 43C9B 2EDTA 4LSRH 2XWTA 4XCFL 4OCWL 4OGYH 1D5XA 1JWMB 1PY4A 1U3HA 2QQNL 3W39A 5EU3B 1I3RB 3S34L 2DQGL 4NRZB 1A64A 3UTSD 4GW5A 1AHWB 5EBMA 1T7XA 4OZIA 4GG6F 5I71C 4PJGE 4YHYC 4NWTH 2OR7A 4LPUA 4LPWA 1JNNH 1UZ8A 3NZHH 3QUZB 1BQHB 2F9BT 3PP4H 1F58L 3O6FC 3DVNB 4IMLA 1BFVH 1S78D 1OGAB 1KSRA 3BKCL 2VN4A 5I1EL 1F11A 1NMAH 3RVWD 1AQDA 5H35B 3SGEH 4HX1A 2UWEE 3TEUA 5CEXB 5HHNB 2DYPB 4ZUVA 4JHBA 3QDGA 4TSAL 4M9PA 4HEPG 3NMEA 4YE4L 1PZUB 3C8DA 1EEYB 2VDKL 3BT2L 1VERA 3RFZC 3GSNB 2EEBA 2VLRA 2AJUL 1U92A 4O51A 3KLAA 3CZJA 4P23D 2FR4B 1KFAL 3CIQA 3WHXB 4DKFH 3UTOA 4U3HA 3VD9A 4Q0XH 1NL0L 3MFFA 4FZEL 2DWEA 2JELH 2NY5L 1ORSB 5HY9A 4OAWA 1KIPB 4HH8A 2CDEB 1FYHB 4J6RH 2R2CA 3DO3A 1VKXA 2VKXA 4ZS7L 4NQSB 3BPCA 4KMLB 4NJ9H 4NNPL 4JKWA 5DLMH 3DTXA 3MJ7A 4E5XB 1J1XL 1MCKA 1FNSL 2W0KA 3T0DA 4QRPE 3DROA 4UUJB 2AQ1A 2YK1L 3ULSB 2XZAL 3EIFA 4AYFA 1H3GA 2ARJB 4XP9H 3QEHA 2K7PA 4S1QH 4L5FH 2Z4QA 4LBEB 3ALPA 5FKPB 3QIWB 4QRQB 4QHUB 5E6IC 1YNLH 3DGGB 3PGCA 1CL7H 5I71B 3C5SB 4Q7DA 4F33B 5LKNA 3A0OA 5LVEA 4XBEL 4ZFGH 4Z7QE 1KB9J 2HVJA 2XN9A 3T4YB 3O6FB 1UENA 4AMKH 3U9PL 1NCNA 3KYMB 4G8GA 4XCCH 4ODBD 2IAMC 3ZE1E 4HZLB 4JHAH 5J1TC 5GZOD 2DRUA 5JHDA 3QULB 3QJFB 3RZCA 4HIIB 5FDWB 5FK9A 5CEZE 3RVTC 3WIFB 1S7UB 3T0WA 3RA7H 1SHMA 2HKHH 4CGTA 4M61B 3MFGB 1A7PH 2JB6A 1P7HL 3KR3H 3MLZL 4ZS6C 4E42B 1M7XA 3IDJA 4TOYH 5JHLH 4LKXB 2QADD 4P9HC 4K7PL 4U05A 3NCYS 1RZ8B 4E41B 2BSRA 4LDEB 3MCG1 4PJCF 2GAZA 3WNLA 5L8LB 5DHXB 2XKUA 1HN1A 4MDJA 5KSUA 3GIZL 4M3JA 4WW2A 5IJKC 3NZ8A 2FB4H 5BRZE 4L4TA 5JPNB 4JFXA 5GGUB 3U1SH 1JGLH 3S35X 1L6ZA 4WWKD 2X1XR 3L3KB 3WUWA 4R7DA 1C8PA 4NKQB 4AJ0A 2Q86A 3F65A 2CGRL 2VR4A 3VXUB 4J3VA 5GJSH 1UKQA 1A7RH 5JR1L 5GGQH 1IGJB 2EDYA 1FDLL 5HYIA 5B8CC 2K3TA 3IJHB 5FHBL 1JK8B 4Y4HC 5EUKA 3L3DA 4G6AC 3TO2B 4AENB 5KVMC 1WVZA 3VXTB 3SCMD 1T22B 3O2WH 4DVRL 4QF1A 1TTFA 2YPLB 4JGJA 4RFEA 4WTZG 1V7ML 4XAWH 1V7NH 3TPKA 3UPRB 1JWUB 2Q7NA 4TUKL 4HF5L 5ILTL 2P7TB 1OLZA 3BDYH 1JVKA 1LO2H 4GMSH 4J3XA 2R0LH 1JE6A 4N0CC 1MAKA 4OLXL 5BV7H 2IAMB 5C0RH 2Q76A 4G8FB 4LF3B 1W0WB 4PLOB 4WI8A 4Y88A 3ZKQD 4JRYE 3RWHB 4M4RA 2DM4A 1MWAB 4NSKB 5CJ5A 3BN3B 2DQHL 2YD3A 3MRQA 3IGAB 1XCQB 4MX7B 4ZG1A 4EQ2A 2R4SH 32C2B 1VEPA 3EZJB 3HPJA 4X80L 4Z0XA 3L5WA 2OK0H 3VXPB 4P2RE 1G7JA 3CK0L 3QDHA 3FOLA 2GJZA 5TJWK 3NFSL 2GFBA 3PL6D 2C7UB 3TZVC 2LU3A 1HSBA 4L9LB 1OB1A 4MD4B 2VLLA 1IGYB 4I4WB 5MENB 1BIIB 3QG7L 3I85A 3VH8G 3QNYB 4GRWB 3UYPA 4NQXB 1K8DB 1G9MC 3RHWF 1BMGA 2IMMA 3H8NA 5HGGS 1CVSC 1QQDA 4LSQL 3GB7A 4HIHA 4IM8A 5CIPH 5B8CB 2AK4B 2AEQH 4PJXB 3RU8L 2BNUB 3IU4H 3OHXA 5E2JA 4Y4HB 1BOGA 5HGAA 2ZOLA 3D39A 1JPFA 1QO3A 2CO6B 2AJVL 3FQWA 5TGBA 4HT1H 3SDXA 3VFRA 1AC0A 3ROLB 5B39B 3LN5B 3F58L 1QRND 1UC6A 1URLA 3F5WA 2D9CA 5JIHA 4L4VB 3V6OA 2BDNL 1R0AL 1INEH 2F54D 1YDPB 5D7KD 5I16B 3U83A 4PJ7A 4WFED 1CFVL 2YN5A 1FFPA 3O8XD 3PDDA 4M1GL 5DF0A 2X40A 5E7BA 4GT7A 1BFSA 5CJOL 4PRHD 4O4YH 4Z5RB 4Z6AT 4OIIL 2VITA 5IEKB 2R0ZH 1RUML 3QIUD 3HI5H 4YHNB 3LAFA 3FB6A 5HHOB 2BSSB 2CPCA 1GIGL 3FO9A 1I1CA 4YFLI 4MB3A 2PO6D 3B9VA 1A6ZA 3P0YL 4MXVE 1FFQA 2EXWC 1BPVA 4MD0A 4GUPB 4N0YH 5IGXL 2VXTL 4HPOH 4W6YB 1CWVA 3IXTB 4KTDH 1FAIL 3EFDH 1N0LA 4HWEL 4JPKH 4YDLC 5EBWA 2EDXA 2EYSA 1G6RA 2DKMA 3OGCB 2AK1L 1QFWI 1DLFH 4PJ9C 4TSBH 3SDYL 3VG0H 3CVIL 1T7ZA 1H3TA 2FEEL 1QSEB 1W72L 4LSVH 1GZPA 2ICES 5CZXD 2WBKA 4ZDHB 3GK8L 1MFDH 4M6OL 3BZFA 1ETZB 4LMQE 5FAAA 2DDQL 5T5FL 5E5MB 2ADFL 1NAKH 3FO1B 4POYA 3HAEB 3VD3A 5FDYA 1G9NH 1YQVL 1OAZL 1A6AB 1DTUA 2MKWA 3QXWA 5CKGA 4DN4L 3MNVA 1ES0A 2KDGA 3HMXH 1AO7B 3RWJA 1J1PL 1LK2B 1TETH 2WUBL 4DOHB 4JFZH 1KB5B 2I9TA 2GSIA 1RSFA 3BW9B 5EZOL 1IKNA 1FL3A 1MCOL 2P8PA 3P4OB 5D7LB 3U2SA 4HS8H 4ZPTA 3HMWL 4LSPH 3O3AA 1OF2A 3RIAK 3P40A 5DUBA 3CFCH 4QRRE 5HJ3A 4S0SD 2H6PA 2DQUH 4TUJB 1C5CH 4QHNB 1A1NB 5DQDH 1SBSL 3K74B 4OFKA 3RVUC 3LSOA 1MAJA 2GCYA 1Q9WB 2O5YH 3ARDD 4IBLT 1VFBA 1WJ3A 2IFFL 5IV2B 1U42A 4GMTL 1EGJL 4PJIE 1T0MA 4KHXL 4KJQD 5L2KB 5IHBA 2NX5A 5J13C 4ZYKB 4NO5B 2FD6L 4WO4C 4K9EC 4KU1A 5IVZB 4YDLB 4TSCH 3ZT5A 2IPUK 4OD3L 2NLJA 4M6NH 1IAOA 1UKSA 3VWKD 2QR0A 4PJ9B 3D25A 3RGVD 4HS3A 2A77L 3QUXA 4BUHA 2VZ3A 2ZOKA 4G9DA 1OHQA 4ONHB 4H88H 4JFFE 1LO3L 4PRPA 5T33H 1NBZB 5C09B 4APQA 2OCFD 1MVUA 4RZCA 4YDIL 4UNUA 2DQJL 4GAGH 2CDFA 1OTTC 3KPMA 3U4BH 3CD4A 1RULH 3KLHC 4LVOC 3MV7B 4ZUSA 3WMSA 5EC2A 5JXEC 4LQFL 4NGHL 3NBNA 1GPOH 5C07B 1INDL 3BH9A 1MRFH 1LILA 2FECI 1H15A 4RSVA 2ADGA 4PRIB 4HUWA 2PF6A 2NW3A 5IB3A 4KQ4H 2F5BL 4PJGA 1DVFD 4XCEB 4JVWA 1NGXA 4XVJH 5FUZH 4CBPA 2JKXA 3UTQB 5EA0L 3UTTD 4JPIA 2B20A 1KJVA 2PUQT 4NQTA 5E8PB 1XGYL 3EJZD 1DN0B 1IGCL 4AIZA 4KZDL 4H20L 4R96B 2UWEA 4XC1H 1FFRA 1P9MA 4D9QD 1NDMA 3ARGC 4XHQA 5MEOA 4NBYB 5DI8B 2VAAB 4MNQB 2YUZA 3VFWB 4TVPD 2ID5A 3VFSB 1HQ4B 5J13B 5EB9A 3TIDB 3CVHB 4WDIA 4OLYH 2JCCE 5JXAL 1B0RA 4WO4B 1ZEAL 4EI5D 3MYJB 3NFNB 5D72L 4BH7B 5T1LB 1FFNB 4XVSH 5HYSA 3ULUE 4JG1H 3FN0H 4ZSOB 4DZBB 2E7LA 3DHMA 1ZK9A 4JLRA 5TF0A 3EO0B 1AGCA 1WT5C 3WO3B 1MI5E 3CFEA 3O4OC 2A6IA 1N6VA 3E6FB 2G75A 1GZQA 3SOBL 5I1GH 2H32B 1N0XL 2P48B 3X17A 3ARFC 1ZVHA 4W81A 2VDOL 3IDUA 1CDGA 1LO0L 2K9UA 1U8KA 4LVOB 1I1FB 3EGSA 4QRPA 4JQVA 1XCTB 4Z0BL 2A6DA 5AYQA 2DLFH 2YUVA 3B9AA 3HZKB 1RZGB 4ZPVA 5F6IC 3DOSA 2NW2A 4ETQA 1HHHB 5DZOA 1YPZE 4WHYG 1H0DB 3C2AH 3G04A 4I77L 3QDJE 4QCIB 4BUGA 4JFPA 1S7VA 4YFLF 2D7OA 3RL2A 1VADB 4OGYL 1I1AB 3UJJL 2CMRH 4KK8D 1LE5A 1L0QA 4HV8B 5DD6A 1NCDL 3LN9A 4I3SH 1J87A 3EOTL 3D69B 3MLVH 2ESVB 4I48B 3DIFA 3VFVA 1B6DA 4JY6B 3LEYH 3RI5K 4CADA 4KI1A 4J23A 4FQJH 2V2XB 5AD0B 1A7QH 2GITA 3DV6A 1IKFH 5B3JE 2P1YA 3S96A 1FH5H 1WCBA 4N8VG 4R3SB 1T2JA 1FYTD 3TWCL 4G80A 2PYED 4GKSB 4EUPB 2YMXH 4NP4L 1U3JA 1HIMH 5D1QB 1N64L 5EIIB 2DQIH 2UUDH 3LH2H 1NCWH 3QH3A 3V6ZB 1U8HB 4Z8FL 2IH1A 4FQCL 2X4OB 3FQUA 5BRZA 4WW1B 3ULVD 1OW0A 2BVOA 3TT1L 4PRNA 3O4OB 3BDXA 1A14L 5B38A 4G43B 3QCVH 2EIBA 2B1AL 4MVBD 3LS5H 4PGEA 2DQDH 3ARFB 4KTEH 3NVQA 1I1YB 1F2XK 2VLKB 2NPLX 4MNGB 5DGRA 5SX4H 3C6SB 3LZFL 3MLWH 4PJBB 4G9FD 1RIUL 3MR9B 4KKLC 2MCPH 4DUXA 3IETB 3STBA 3I2CL 2R56L 4J6RL 3U6RA 5F6IB 1ZWIB 4NFCA 5C08E 5C8JB 3DX6A 1FAKT 4KPHH 4X4ME 2D0HA 4YWGL 1KCSL 1XGRA 1SMOA 3IVKB 1UB5A 2HG5A 2NY6D 3N1GC 1D5XB 1U3HB 2EH8H 1I7ZA 3W39B 1TDQA 4XBGA 1RZFL 5EZIH 4XC3L 1L7IH 1I1RA 2W38A 4QY8A 2HTLD 3T3MF 4HIXH 1U91B 1JYXA 5EBMB 1OAUL 4IRJD 3K2UH 4KJYA 5FV1L 3U30C 3SDAD 3MV8D 4OZIB 4JRYA 5FYJL 1YECH 1KIUA 5KSAD 2ZSWA 1GSMA 4CJ0A 3MTRA 4Y8AA 5F7MC 3V8CA 5C0DA 1EXUB 4IMLB 1SM3L 4XCCL 2CJUH 1I3GH 1HDMA 1F11B 4JHAL 1F90L 4LCUA 3DMMD 1AQDB 1DL7H 4U33A 4ALAH 4RMSA 5D1ZD 3AY4A 3RZCC 1T66C 4ZUVB 3QDGB 3MJ9H 1NGYA 2HKHL 1YUHA 1A7PL 1CT8A 3D2UA 1U92B 3QWOA 5A2JH 4O51B 4FQIH 3KLAB 4Q9RH 5DJCB 3VI4E 1KCRH 4F7MA 1J0ZA 3B2VH 3X13B 2EH7H 4J3SA 2EDHA 1P5VA 5CJQH 3JTSA 3MFFB 1XH3A 2DWEB 3UC0H 1MQKL 5HY9B 4WW2C 4TTDD 2QHRL 4OAWB 5ESQA 3MX0A 4FFWD 4ZNEE 4OCYL 1VKXB 2C3XA 3EW3B 3TBSA 1F4XL 3KPSD 3BPCB 3DVGA 3ARUA 5KOMC 1XMWA 2ED8A 3GMRA 1AXTH 3GJEA 3DTXB 4TUOA 4C83A 2SEBA 3AS2A 4TULH 1RUKH 4RMTA 1ZXQA 4YHKH 3DROB 1UM6H 4P5KA 2R9HC 3DXAE 3LN4A 4Y4KB 3WIHL 3GI9L 2DYPD 3QEHB 2Q6WA 2VE6A 1AQKL 1QSFD 2Z4QB 3MV9A 2H9GA 1QBMH 1VESA 3O2WL 3U30B 4K94H 2KKQA 4UZGA 5I1KL 2Z8SA 3B2UC 4BQ9A 1V7NL 3GRWA 2OXGA 4ODHH 2HVJB 2XN9B 3T4AA 2Y9RT 5JOEA 2IANE 5ADOL 2CDGA 3E8UH 2XWJA 4G8GB 4HS6A 4M7LT 5BV7L 4DGIH 2YPKA 3GIVA 5C0FA 1X5XA 1V3JA 5IK3A 4HKZA 4FQLH 3TH4T 5D8JL 4CKVX 5FGCB 5JHDB 5FK9B 5BMFL 1MFEL 4I9WE 4O2EA 3HG1D 3WD5H 5J12C 5AYUH 1MCQA 2JB6B 3SPVA 4KUCD 1EJ6A 2JJWA 2R29H 4RWYH 2EC8A 3BJ91 2LE9A 5KW9H 4UBDD 1MCSA 1B2WH 5JIPA 1U6AL 4WUKH 2D2OA 2BSRB 2DBJA 1EEQA 2GAZB 5E2WH 4I2XB 2CRIA 3SDCA 4R4BB 4MDJB 3D85D 5KSUB 1OP5K 4WW2B 2EE9A 3NZ8B 4L4TB 3MLTA 1KUMA 2AXFA 3WNPA 1HKLH 2R0KL 3HI6L 4D9RD 5FB8A 3O6FD 3WUWB 4R7DB 2VZOA 2Q86B 4UI2A 1MY5A 5DVMA 3CSPA 1CS6A 3WSQH 3WS6A 3FN9A 3GUTA 4LHQB 2DTML 3MRFA 2CLVA 2OJEA 3RWDB 3X11B 3GKWH 1HINL 4TPRL 1A9BA 4QRRA 3VE0A 1QLEH 5EUKB 3AREB 3VXRE 4H1LG 3L3DB 3QISA 3O6KL 4N1CA 4LVNC 4EBQL 1T5XB 2Q1EA 3LD8C 4D8PA 5CUSL 4QF1B 1WGOA 3I02A 1FGVH 4RFEB 1JTTA 1Q9LA 5CILH 5TF1L 4K7FB 3O2VL 4UINL 4XAKD 2UZIH 5HHQA 2UV3A 4HH9A 4A6YA 1HH6A 2NY7H 5E8OA 2Q76B 4KV5F 3MXVH 4DAGL 1C1EL 3ARBD 2EECA 4XNUH 1R3JB 3VXUD 3OKYA 2BC4A 1ZLSH 1IC5H 2ZCHL 2XZQL 3MRQB 2CO7B 1WZ1H 4N0YL 2IC2A 4JFFA 3GDBA 4Z0XB 3VXSD 2EZ0C 3L5WB 4YO0A 4KTDL 3TNMA 2FJHA 4YXHH 2GJZB 5GRVK 1E28A 5ANMB 1RK0A 1H3XA 1ULVA 3MA9L 2CKBH 4K7PY 5E6ID 3SGKA 1HSBB 4K8RL 2GTWA 1IZKA 1P84K 2VLLB 1IRAY 1V3KA 2LAAA 1KC5L 2VXUL 4URTB 3L3IA 2EDBA 1UJ3B 1J8KA 3QIBD 4JDVB 4XPGL 2VDLH 3ZDZF 2AJXH 3S37L 1F00I 3GB7B 2Y23A 4ODSL 3NA9L 2VXVH 4P3CL 4GBXA 3B9EA 3LV3B 1NGPL 3OHXB 1BOGB 5HGAB 2I60H 2ZOLB 3RVTD 3D39B 3WJLA 1QO3B 1TETL 1HCVA 4LVNB 4JFZL 4DW2H 3FQWB 5TGBB 5IIEB 1DQMH 3LD8B 3SDXB 3VFRB 3VDCA 4ZS6D 1IKNC 4QOKE 3F5WB 4OCNC 4D0CA 2DJUA 5TQ2H 1FGNL 1KCUL 4PYGA 2F74A 4N0UB 2QSCH 4PJ7B 1EVUA 2ZSVA 1TZIB 1FFPB 3U0PA 2GI7A 5FGBA 2MSPA 4ZUTA 2RJMA 1UZ6F 5DD1H 1QLFB 1L9NA 1BJ1H 1T4KA 2VITB 1YN7A 2FJFA 2X4UA 4K2UH 4WHTA 2WLZA 1MFCH 3V0VA 1Q9KA 3FB6B 2GJ6D 5CHNA 1A6ZB 4JRWA 5A3IC 1J0IA 3VFUA 3BKMH 4I0CC 4MD0B 5ALCH 1MI5A 3GSRB 4X0KA 5L7XH 3QFJD 3IDIA 4PB9L 1S9VA 2IWGA 5FYJE 3O3BA 4U6TA 3WXVH 4P48A 1ZVSA 2EYSB 1FE8L 1G6RB 3QR2A 4ZMAT 4KMTH 4P9HH 5HHVH 1JNJA 5SWZD 3QUXC 2Z31D 1VGEL 4NKOA 3QPXL 4L4VD 5FYLH 2D7MA 1GZPB 4D9LL 1P69B 4EKXA 3PNWA 2GW5A 4APQC 2A0LC 1YPZA 5HSFA 3BZFB 4N0CD 4LHUD 3G6JE 3WS3A 3QDJA 3H9HA 1VPOH 1Y18B 2K1MA 5C3TA 1JGUL 5HHPA 1S9WA 4F57H 3IJSA 2Z0BA 1XF2A 3MNVB 1ES0B 2LQRA 2MKLC 5DDHA 3RWJB 5ITFA 5JA9A 2I9TB 2VR5A 2GSIB 2YWYA 3N9GL 4OCXL 5E9DE 2FX9L 2NMSA 1NQBA 2XTLA 3HE7A 1GOGA 2X89D 1FL3B 4HXBH 2AV7A 3NIDE 1AGEA 5E4IA 3SE3A 3RTQA 3U2SB 4ZPTB 3WKNA 4FNLH 1JTPA 3O3AB 3V4UL 5DUBB 1IAKA 5HJ3B 3TZVD 2H6PB 1W8OA 4HJGA 4YDKL 1FBIL 1RZIA 1U58A 1NBVL 2XTJE 3LSOB 2GCYB 2R2HA 4DJMA 3UYRH 4HUMB 4PRDB 4NRXA 2H1PH 1X5ZA 1P9MC 1FZMA 3FQTA 1T0MB 2W60A 5LAXB 4Z7WE 2E6PA 2AI0L 2NX5B 4JQIH 3RWEA 4FQXA 3C6LA 5KJRL 3ZL4H 5F93C 1XR8A 1NCTA 1AO7D 2NLJB 1IAOB 3OB0K 4DGVL 4X7SL 2QR0B 4ZD3L 5T3ZL 5HD8C 3D25B 4OCMC 4OCSL 3X3FH 2E7LC 4HS3B 4PGDA 2E7HA 2AVGA 3QUXB 2DQEH 4JM4L 5C3LD 5GHWL 2ZOKB 1TJGH 4BFBD 1DBJH 4PRPB 2VAJA 5C08A 4APQB 5I76A 3RBGA 4X4MA 4XPTH 2DQTH 1MVUB 2LV4A 3UAJC 3DWTA 4RZCB 1CTNA 3B5HA 3DSNA 1D9KD 1OAXL 3GBNL 2CDFB 3KPMB 3V0AC 3O41A 3KVQA 1ND0A 2BERA 4ZUSB 4WFGD 2VNCA 4JQVC 5EC2B 3B9KD 5JW4R 4KRPC 2O26U 3HAEH 2ZNWA 4V1DE 2DLFL 4RBPH 2BHUA 3BH9B 2RB8A 3G08B 3CJJA 1K6QH 1G7PA 3BPOC 4GRWF 5C0AE 2Q8AH 4CAGA 2ADGB 2EXWD 4HUWB 5F7EL 3BEVA 5F9AC 2NW3B 5IB3B 1JZ4A 1KB5H 4PJGB 3WLBB 1NGXB 4YZFF 5I75C 1NCAH 5CBEA 4P2CG 4Y2DA 4JPIB 1JGEA 1KJ2H 4HLJA 4KKBD 1KJVB 4PJ9D 4N5EC 5AG8A 1WV7T 1BJ1J 5TDNA 3VGAC 1F6FB 3KPOA 3X14B 3MLVL 4UILH 4AIZB 1QYGL 5IQ9A 5C09D 1JHTA 2UWEB 1JGVH 1FO0L 1A7QL 5K9JL 3MC0A 4K3HA 1J8HE 2IBGA 1BZ9A 1UWGH 1NC2A 3QA3A 3BSZL 2BY2A 2BNRE 3S3SA 3L5JA 4I0PA 5FECB 3QNZA 1B0RB 1YNTA 1YMHA 5EULV 1RIVH 3UJIL 2DQIL 5HYSB 1NCWL 5T1DL 3OTTA 4PD4K 3C08H 2A74A 1MCPH 2XZCH 4LCIH 3MRCA 4JLRB 5FYKD 1AGCB 1OW0C 2AW2A 1KIQA 4ZNEA 4PJFF 3STZA 5HYJA 1A3LL 3CFEB 1AFVL 2G75B 1GZQB 5I1AA 4LARH 2DQDL 1KN4H 3HC3H 2CKNA 1J88A 3VGHA 4PTTA 1BBDL 2VN7A 5DD0L 1U8KB 3BOVA 2Q8BH 2WUCL 4QRPB 4G6KH 4RRPG 4KRPB 4YPGA 3DXAA 4HK0A 2VB5A 2A6DB 1CR9H 4P46C 3UYOD 4MNQD 3C5ZD 4ZPVB 2NW2B 2OI9C 3A6BH 3IYLW 4NN6C 4OKDA 3VGBA 4LHUG 3FMGL 5ADPL 4NJAH 1R3HA 2FHBA 3G04B 4WO4D 1FZJA 4HIJB 1S7VB 4JFPB 1JRHL 4IDJL 3RDTB 3RL2B 5I75B 2CUHA 4J12A 2Z92A 3D48R 1IEHA 4NM4L 1OAKL 1LE5B 1J12A 4KHTL 4R8WH 1HYSC 3HNTH 5DD6B 2IANA 5DJ8A 2IH3A 4MCZA 5HHXL 3JWNC 1RUPH 2P5WB 4R26H 2ZPKL 3VGAB 3QQNA 2HKFH 2OR9H 1P6AB 1U8JA 1EHLL 3DIFB 4U1KA 2E9JA 4ZUWA 4HCRH 4RGMB 2WNGA 1CD1B 1NANI 4CADB 2D3VA 3JXAA 1YEEL 1OTTD 2VYRE 2BVQA 2GITB 3DV6B 2R39A 3S96B 2EYRA 1WCBB 4M7ZB 3ZE0E 3UO1H 5FA3A 15C8L 4G80B 5JXED 1A4JA 2WWMC 2QEJA 3QI9A 4XMKH 3CVHH 3DETC 2B5IB 3E0GA 1DL7L 4LCWA 4ALAL 5ICXA 1GH7A 3QH3B 4LAJH 3QEGL 3AY4C 1TVDA 3GO1L 2IH1B 4GLRH 4CN6A 1CGSL 1QNZL 3T2OA 2X42A 5BRZB 2BVOB 4UTAL 2DF3A 3O2DH 1EBPA 3EYUH 4HBQA 4FQIL 3G6DL 1MFBH 4PGEB 4HW6A 4KRNA 1HZHH 4F9LA 3BGFC 2H32H 5ERWA 2C3VB 3ARGD 3VXRA 1DQLH 1ZA6A 5FM5O 3Q2CA 2A6KB 2OI9B 3DX6B 2M8XA 4NN6B 2FEEI 4Q6IA 1XGRB 5C92A 1MCDA 3R1GH 1UB5B 2HG5B 3BO8A 5DVNA 1CTOA 4LPVA 3ARWA 2C3HA 1EHNA 2G60H 1VB9A 4XBGB 1F6AA 5JZ7C 1GRWA 2VL5A 1U41A 2IPTL 5BOPA 4KJYB 1AGDA 1WIOA 3OL2A 5BQ7A 5GS1A 2WP3T 1FIGH 4JRYB 2YRLA 1OGTB 2ZSWB 4XNQB 1ZT4A 1FZKA 2FO4A 1FPTH 5C0DB 1BVZA 3B8SA 1PSKH 1I8MA 2BXYA 5HDBE 3VWJA 4OSUH 1HDMB 4LSSL 3TGXA 2NQCA 4LCUB 1MFAH 2HJFA 3CMOL 1HQRA 3RWGA 3TV3H 1NGYB 1SJHA 1EH9A 1XIWD 3V79C 3H6JA 3MO1A 3MNWA 1CT8B 2I5YH 2NY1C 3D2UB 4U49A 4RX4D 3QWOB 1BM3L 1MF2L 4YR6A 3KPPA 4MDIB 5DD5H 4WUKL 1U95A 4F7MB 1IM3B 3BGMA 3KJ4C 3VRLE 5E2WL 3JTSB 1XH3B 2NY4D 3NGBC 3SDCC 5DMIH 4UB0H 4EN3D 4LLDB 3NCYP 3MACH 4QGYA 2BJMH 5ESQB 4JCMA 5KAQF 1ODAA 3Q1SL 4JHZA 5DEGA 3WL9A 1RZKL 3TBSB 2OR8A 3KJ6H 1J0HA 1TJIL 3DVGB 2F19H 5HVWA 5F7HA 4CDHA 3QQ9C 3BPNC 3GMRB 2DD8H 1F3DH 3A67L 4QOKA 1KJMA 4C83B 2SEBB 4PYHA 5D5ME 3WS6C 1QZ1A 3GKWL 1AY1H 2GT9A 3LN4B 1QLEL 4L29A 1UFUA 2Q6WB 5ALBL 3MV9B 2H9GB 1MJ8H 4EOWL 5HI5C 2AS5M 5EOQL 1IC4H 5E1AA 2VLRD 2A1WL 1OTSC 3RIAF 3IFNL 3CU1A 4KI5E 4M1DH 4JO4H 4NO0B 5AWNH 3MLSL 1MCBA 4NIKB 5ACZA 3T4AB 3ARXA 2CDGB 2VOTA 2MFNA 4HS6B 5KAQG 3HZYA 4Q9BA 3GIVB 1PEZA 2NXZB 1EMTL 4HKZB 4RFNC 1KPRB 3PV6A 2VZUA 4ENEC 4KRMB 1KCVH 1ZLSL 1IC5L 2ITCA 4G7YL 4U1JB 4LGRB 2E9IA 3P4LA 4JFED 3MOBH 4O2EB 1WZ1L 4WCYH 3SPVB 1CGUA 4NKMB 2NY1B 3MUY1 4WFFD 1MREH 3LRSB 2VO5A 3G6JA 2BRRL 3NH7H 3U9UA 1FNAA 3KJ4B 1BEYH 3SGKC 1QTYT 4H8WH 3NGBB 3OAYK 2QSVA 1BIHA 3MLTB 2AXFB 2V17H 5K59F 4OD1H 5HI4C 3MRDA 5FB8B 4PY8J 5E9DA 5J1AA 2J4WH 4CN1A 3BPNB 3ZKMC 5I15H 2AJXL 1EVTC 4LASL 4BZ2H 3K8LA 2V7NB 5I30L 1CFTB 1LP9E 3GUTB 5E2UL 3U48A 2CLVB 2OJEB 1YY8A 4RGOH 3EZ8A 3FAXA 3PG2A 4GBXC 2B2XL 1A9BB 4QRRB 1Z5LA 3VE0B 1MIEH 3A6CL 5GS0L 3RZCD 2I9LA 4N90D 3WJLC 4DW2L 3N85H 2X4RA 1NAMH 2OJZH 3LB6C 4YHLH 4D8PB 1X5HA 3SO5A 4F9PC 4AH2A 3BISA 5GJTL 4YGVA 2XA3A 1Q9LB 4FQ1H 4G6FB 1TPXC 4WHDA 5F9JA 4N0FA 4OGAD 4Z7WA 3SKNA 4XPFH 5FGBC 2VERN 4PS4L 5HHQB 3M1BA 1S7RA 3SJVE 4HH9B 4A6YB 1WTGT 1HH6B 5E8OB 3MRNB 5GISH 4MCYA 4NFDA 1UACL 4RFNB 5IHLB 3O3DA 3LIZH 2H45A 1NLBH 4OZIF 5CCKH 3DSFH 3ULUC 4CMHC 4L3EE 5E5UB 2BC4B 5DRWA 5GRUH 1OWRM 4P2OD 4IIQA 4EI6A 1IL1A 1Q72H 3MLRL 1VFUA 1U8PA 3PQYD 4UTBH 2R9HD 2X4QA 5HVHC 5HYEA 2KZ1B 2FJHB 1OL0A 1E28B 1RK0B 4MZ3A 5D70L 1HSAB 2EKJA 4OTXL 3Q5YA 2GTWB 5FCSH 2IADA 4WIQA 4OZFB 5FYLL 5IHUH 4V1DA 2I27N 4XTRC 3L3IB 3BH8A 1Q94B 5C0AA 1WWCA 1I7RA 3CLFH 5HPMA 5DYOA 5DC4B 1X3DA 4XPHH 2JJVA 1RZ7H 4PFEA 4MZ2A 1A0QL 1VENA 3W2DL 1NEZA 4UV4H 2DAVA 4GBXB 1U8IB 2CIIA 4PJEE 5D71H 1KG0A 3REVB 4JFDB 1RJLA 5E70A 4OGXL 4D0DA 4HXBL 3ZE2F 3PXJA 3GHEH 3BRFA 3BAEH 3MROA 2NCMA 5CIPA 3E6HB 1S7XA 3SE3C 3RTQC 4U7MA 4D0CB 4FNLL 1TPXB 2CRZA 2J6EL 4OT1H 3RNQA 2F74B 1J8HA 4JFQA 4NZUH 2ZSVB 4UT9L 3U0PB 2HLFC 2HAZA 5HYQA 3SKMA 4M1CC 4ZUTB 2I25N 1MPAH 2BNRA 1JL8A 1WC7A 1T4KB 3RI5F 4NO3A 4G3YH 4OZHE 1YN7B 2FJFB 2X4UB 1H3PL 4WTWA 3V0VB 1RU9H 1Q9KB 1YNKL 2DI8A 4CMHB 4P4KA 5CHNB 3MRPB 3BPLC 3CDGA 3VFGH 3U0TA 4L8BA 5LCVL 3VFUB 3IDMA 5IBUB 1MI5B 5HVHB 4FQXC 1MHEA 3JV0A 2IF7A 3C6LC 4OLUH 1S9VB 1FVCA 4L3AA 3O3BB 1CLZL 1H3WM 3T0VA 5T5NF 5FEBA 1LO4H 2ZNXA 1ZVSB 4L1HA 3QEUA 5T3XH 3WFCL 2B0SH 2GK2A 4NKOB 4LU5H 1DBJL 5IFHH 3BFOA 3VCLB 2PN5A 4NRYA 1OGAE 1YEHH 3PNWB 1OT1A 2VDPH 3PWNA 3BQUA 5DJ2A 1YPZB 3PDOA 3OXSA 12E8L 3GSWB 3QDJB 3H9HB 4YBQC 3MJ8A 1EPFA 1QOKA 4HJJL 5HHPB 4F58L 5TFSH 4WW2F 3IJSB 1QFOA 1JWSA 3CMGA 3CXHK 5KS9E 5DDHB 4X4ZA 4PJ8A 5EORH 1DUZA 5ITFB 3WNKA 5JLZA 2XQYG 4MXQD 3T2PA 3HE7B 5HDQH 5JW3H 2EZ0D 1AGEB 5T5NG 3RTQB 1QP1A 3IAPA 1J5OH 4FHBD 1R5IB 3HMXA 3LRGA 5KTEH 1IAKB 5JOPD 4Y2DC 4LVHC 2IFGA 3K8KA 4HJGB 3ME0A 3VFNA 5I1LA 5I1IL 4JR9H 4OLWL 4RNRA 4YK4B 2R2HB 3N1QC 3UDWA 5E8EA 5FO8A 4U1MA 1FZMB 2H2SC 1ZHBA 3FO2A 4H0IA 2DWDA 4HUNB 2W60B 3PHOA 4V2CB 3CFJB 2YEZA 3RWEB 4XHJD 4I0PC 3SKJL 3QYCA 2XOTA 5CWSA 3WUWG 2ZCKL 3EDJA 3WFDH 5J6GA 1SEBA 3FQXA 4QXUH 3C08L 3V7MA 3ULVH 4BZ1H 3PWUB 5D6DA 1OP5H 3ZT6A 2YD9A 3S36L 1II4E 4PGDB 1BQLH 2DQCL 4U2YA 2ATKA 1G6RH 2QQKL 3NCJL 4ONGL 5DTFA 1S7SA 3PWPE 4F7TA 2HJKB 5C08B 4Z7OE 1A7BA 4JG0L 5I76B 3RWIA 5CGYC 2KBGA 3ZHKA 4ZTPH 1GGCH 1IC1A 3HC3L 3QDAA 3O41B 2ZZUT 3D18A 5I0DA 1PZ5A 4JFOA 3VD4A 1ND0B 3L1OL 4OLVH 1T0NA 3ET9F 1CR9L 1S7WA 1NGZA 4JY5H 1LDPH 4MYWB 5MI0C 1G7PB 2QKIA 3FT3A 1YEIH 3BWAB 1A1MB 4BH8A 3JV6B 4OF5A 2J5LB 1GGBL 2ZCLH 2EDJA 3ARZA 4HSQA 5HGHA 5FYKU 3LKOA 4IOFC 5J8OA 4MQSB 2D03H 2VLMD 5CBEB 5TH2A 1UB6B 3QCUH 3QJHA 1EIBA 4Y2DB 1JGEB 2ADJA 4Z77A 4LVHB 3JWOH 5C0BD 4ERSH 5C0EA 4XP4H 3TO4D 1UWXK 2ZJSH 2CUMA 5TDNB 2HKFL 2X10A 4DQOL 5DJAA 5SWSE 3KPOB 1T04A 1MCRA 4Y89A 5KVFL 5CBAB 3I6LE 2N1KA 4J3TA 3SDXF 3OXRA 5IQ9B 2A0LD 3ZKSD 4R97B 2Z91A 4YPJA 3IS0X 1TLKA 4K23L 1BZ9B 4CVWA 2D7NA 4PJ7F 5HI3C 2VRAA 1NC2B 3QA3B 4OQ1A 4I0PB 4D0BA 3QNZB 2EDWA 2O5ZL 1D6VH 3QI9C 1YMHB 2DIJA 5JORB 2A6JA 5TDOA 1X6NA 4JHWL 1HK6A 3NACH 3OAUH 1FNGA 2ZUTA 3WKML 3U4EA 5IM7A 4OCLC 2ARJQ 2A74B 4AEIH 1KIQB 3G5ZA 1CDJA 4XP5L 3STZB 5HYJB 3VGEA 2VUYA 3FHQA 1MRDH 1MFBL 5I1AB 5LG1A 2VC2H 1HZHL 2VKWA 1SMAA 4F9LC 1GC1C 4PTTB 3EHBC 5D5MA 1J05A 5DFWH 6FABH 4B50A 4YPGB 3DXAB 4HK0B 1IAIL 4FTVE 5ETUA 1IEAA 2CIKA 2V2WA 4QRSA 5MI0B 3GHBH 4MAYA 4U3CA 3N0PB 1TIUA 1R3HB 4Q6IC 3W5NA 1G7LB 1RMFH 3LQAC 4P2QE 2Z92B 5FYLE 5GGRY 5DUML 4WNQA 4HUXA 2R69H 2IANB 3THML 5DJ8B 2IH3B 4MCZB 5HD8D 1K4CA 4JKMA 4XCNA 1JTOA 3ZLQC 1ACYH 1GHFH 1U8JB 5GGRA 1XAUA 4Y1AD 4HWBL 4U1KB 4YDVA 5E95B 5I1JH 3GMMA 5GS1C 4Y16D 1RJZA 2UVFA 2BCKA 2BVQB 4YEEA 3DJ9A 2EYRB 2D31B 4XX1E 4QRPD 3VW3L 2W9EL 5FA3B 3VWJC 1A4JB 4NQCE 3QI9B 3VDBA 2DKSA 4NWUH 1M71A 4LCWB 4B7LA 5ICXB 1T3FA 4JN1H 5AAWA 4RA0C 5DJXA 2P8LA 3CLEH 2XACC 5AZEL 1J18A 1KPVA 1QBAA 3CDCA 1PQZB 2Y06L 3L3GA 3RY4A 3KYKH 3EBAA 1KT2A 3OJDA 4N5ED 4NNXA 2BFVL 1Q9OA 4GSDH 4U1LA 5T1KD 5HHOE 1LP9A 4NM8L 1ZANH 3AAZB 5ERWB 3K2MC 5F6HI 4OF7A 2NY0C 1IMHC 5DHYA 3VXRB 4JZOA 5CEZD 1FC2D 1ZA6B 5H37H 1JP5A 1TZHA 3CPLA 1CZ8H 4K8RD 2OZ4H 1N8ZB 4PGCA 4WI5A 5HPOA 4NKDA 3RKDD 4Q6IB 5EDXA 3U7YL 3AFLA 8FABA 3MODH 2Y07H 4ONOA 4M4PA 3BO8B 3PE9A 1C5BH 1QEWA 4TRPH 4BKLA 1K5NB 1ZT1A 4HMDA 4O9HH 4ZNCD 1C5DA 4K7PX 1F6AB 3SJVA 1MEXL 2VL5B 2Y25A 5BRZD 1S3KH 1DBMH 1EAJA 4M6ML 1AGDB 3T0ED 2HTKC 3GSVA 5DK2A 4OUOA 5BQ7B 5GS1B 4PJGF 3O11A 3I3BA 4L3EA 1ZT4B 4EDWL 1AKJB 2FO4B 4JANA 1NGQL 4XXDB 1E4WL 3SDDA 1I8MB 1JFQH 3RUGE 2XRAL 1DDHA 3AVEA 4KMQA 4P46D 3MRJA 2LFGA 2FX8H 3M8OH 1P84J 3TVMA 1EO7A 5DMYA 4HUUA 1QA9B 3OJVC 2HJFB 1KCVL 4OF6A 4U1SA 3VXMD 1HQRB 3KPRD 3RWGB 4FXKA 3G5VB 1SJHB 1KBGL 3IKKA 4NZTH 5J3HD 1MCFA 4ZUUA 1KTRL 3MO1B 3BKYH 1F02I 1JZ3A 5CSZA 4P59L 4QHLA 4XMLL 2BK8A 4YR6B 3KPPB 5E24E 1MREL 2AKRA 4M7LH 3MBEC 3SE8H 2L7UA 2AEIT 3NH7L 5JW4M 1T1XA 1U95B 4NOFA 3BGMB 2HT4C 4XPBL 3SBWA 4HFWB 5EPMA 3QUYD 2HT3C 2NY0B 2Y36L 4RFOH 2DM2A 5L2KE 1I9JH 35C8L 4KXZI 4PJEA 3Q3GA 4XH2A 5KOVC 3WL9B 5DEGB 1KJ3H 5DVKA 4JPVL 1NFDF 2GYSA 1AP2A 4GW4A 2AEWA 4OQTL 3ESVF 4JDTL 1JPSH 2CK0H 4WU7A 4P2RD 4QOKB 1KJMB 4BZ2L 2ICWI 3DETD 1XGTA 2J88L 4ODUA 5HHMD 2GT9B 2APVA 4L29B 5CGTA 2V5RA 2J8OA 2AEPH 4L8DA 4NQDB 4CU6A 1W0YT 1WLHA 1CLOH 2XTJC 5F96L 2VL4A 2GK0B 2R8SL 4OZHA 1U8NB 3JTTA 3GJFH 2XKNA 3OZ9L 2HMIC 5HYSG 2FBOJ 4LRNH 5ACZB 4Z7QF 3MLUH 3PGFL 1EO5A 4HPYH 1I3RA 3HZYB 1K8IB 3B3IA 3C5JA 4PRIE 5E99L 3ZE1F 2DN7A 3PV6B 1AJ7L 2XIDA 5EG6C 3TFKD 4PV9A 3QUZA 2ITCB 1HWHB 2IEPA 1QBBA 4IIQC 4XP1L 1BQHA 5BV7C 3D3VD 3MZTA 4FP8H 4LHJB 4JO3L 5C1MB 3ZTNH 3OG6B 2YS4A 4L9DA 4G7VL 4LPTA 2VXSH 4FFZH 3QUMH 3BKJL 1QFWL 3G6JB 5JZ7D 1I9EA 2NY2D 3U9UB 5HBBA 1AGBA 2FIRT 5CEXA 1EFXD 1JNLH 1KXVC 3CX2A 2UY7A 1AE6L 3IFLL 4S0TD 5KS9A 5T3ZD 5IWLA 3MRDB 3U7WL 1CF8L 3VMPA 5J1AB 1E6OH 2Q3AA 1UWEL 5EWIL 4KZEL 1YJDL 4C56D 1CE1L 1C7TA 3WHXA 4AG4H 2OTPA 2FHCA 1YY8B 4FG6D 3IDYC 5C0JB 5MP6L 1VEOA 2MHAA 1Z5LB 1KIPA 3HE6D 3TA3A 2I9LB 2A73A 1EJOH 2CDEA 3S35L 5JDJA 3C09C 2XTJB 1T0PB 1LD9A 4AH2B 4YGVB 1Z6JT 3GNMH 4E5XA 1T20A 4MS8D 5IBLC 1T03L 3MGAA 4ODTL 5F9JB 4N0FB 4XCFH 4OCWH 4Z7WB 2EDDA 5FUCE 3SKNB 4UUJA 2RAMA 1JRHI 2QQNH 3SDCD 1S7RB 3S34H 2BSED 4GXUM 3RPKA 4GQ9L 4MCYB 3QIWA 1CDYA 4G3YL 4QRQA 4KVNH 5B38G 4NQUA 3O3DB 1CDHA 4QHUA 2CQVA 5MHSE 4WEBL 2APBA 4TVPL 3TH3T 1TVHA 4P4KC 5DRWB 3TYGL 4EI6B 3ORJA 5BV7B 3LQMA 3HPLA 1PG7X 1F58H 1Z3GH 3E1F1 3KYMA 3PWPA 5EO1A 3BP5B 2X4QB 4QRRD 4TNVK 1TJHL 1G9EA 3BKCH 1UCBL 5I1EH 4JO1L 1VGKA 3L6FA 2ESVE 2X1PA 4OBRA 3QULA 3QJFA 4I3GA 1OTSD 2IADB 1S7UA 4TSAH 3TBTA 5AG9A 4YE4H 4LPYA 4V1DB 1VFAA 2VDKH 4CMMA 3BT2H 3QDME 5IFJA 3BH8B 2YKLL 3EOBA 4PB0L 2AJUH 3BQUC 1I7RB 2CKBA 2X4NA 5HPMB 4DZ8A 4LKXA 5DYOB 5H8DA 1KFAH 1D5ZA 4JN2A 3VI3E 1NEZB 3IDYB 1NL0H 4ENED 4FZEH 1YYML 2XG5A 4LLWA 2NY5H 4ZOBA 2CIIB 5JPNA 4XPAH 1GGIL 1UQSA 1KG0B 3RX5A 4PJ8C 4XXCA 3C09B 5SWSA 4P49A 1A3RL 4ZS7H 3GI8L 4D0DB 4R2GC 3CFBA 4JFFD 2XA8L 5CD3A 3MROB 2VZ1A 4NNPH 5CIPB 1G9NC 1S7XB 4KQ3L 5FFLA 2D7PA 2VLKE 3RNQB 1J1XH 1FNSH 4P5TA 1A9EB 5KTEL 1J8HB 4JFQB 5IVXE 1J0YA 4PJBE 1N5AA 3SKMB 4Y2OA 2YK1H 3LKSA 2BNRB 4AENA 3TH2T 5BXFA 5J06A 1WC7B 1WICA 1H9VA 4X7CC 4NO3B 4PD4J 4DVBA 5HI4D 2RGSA 1ZGLP 3UDWC 1HOCA 1R3LB 4P4KB 1EZVX 3FFCD 5D9SA 4XI5D 3JWDL 3EYQC 4XBEH 3CDGB 2P7TA 1B0WA 3WHE0 3U0TB 4L8BB 2VZVA 4MXVF 4HJ0C 3RX7A 2UYLB 4GBXD 1MHEB 2G5BA 4X5XA 1X5FA 5BZDA 2VDRL 4XCYA 4WFEE 2MQ3A 1FVCB 1RK1A 3GSOA 4LAQH 3OF6D 2G2RA 1JPTL 2R0WL 4PRHE 4BZ1L 3RWHA 3K80A 3QEUB 1D5MA 1T1YA 3B83A 1A8JH 5C6TL 3CDFA 2HLAA 5L8JB 1XCQA 4L3CA 3UBXI 3WNNA 4FTVA 4NCC2 1ACZA 32C2A 2EDKA 4NRYB 5EZJB 1F42A 4OZFH 3I9GL 3MLZH 3BQUB 5D7IE 5IMKA 3TT3L 3PDOB 4QXTA 2F5AL 2OXHA 3MJ8B 3HB3D 4P2QA 2YZ8A 4L9LA 3F8UB 4I8DA 5AEAA 5SV4A 3GIZH 2YA2A 3WFHB 2FZ3A 4I4WA 1JWSB 7CGTA 5IT2L 4P0DA 3TIEA 5C7XL 4PJ8B 1YEIL 1DUZB 1K8DA 3GMQA 5IESL 3IAQA 4R2GB 4XNZC 3QHTC 2CGRH 5IG7A 1JF1A 2OL3L 1ITBB 5CJ8A 5JR1H 3H42L 3AROA 5F1OB 2B8OT 1YEKH 5LGHL 1FDLH 3MV01 2BNUA 4XP4L 4AEFA 2OX5A 1LE9B 5I1LB 2ZUWA 3VFNB 4NQCA 3VRJB 5C0CD 4LOUC 5GRXG 4RNRB 1FC1A 3DUHA 4DVRH 5E8EB 5FO8B 3NTCL 4KVCL 4M62L 4OB5L 5IUSA 2HFEA 4U1MB 1ZHBB 3FO2B 1BF8A 3REWA 2DWDB 1ADQL 2Y7QA 3PHOB 1YDPA 5I16A 4TUKH 4HF5H 1ZHLA 4PJIF 1T2XA 2YEZB 4X7DC 5FO9B 1CIUA 4OLXH 5CJBA 5MEQA 5CWSB 3UXFA 2XG4A 1HHIA 5J6GB 5IEKA 5IB1A 1SEBB 2V7HB 4YXLL 5B4MD 2QBWA 4YHNA 4U6YA 4MA7L 4Y4FC 1LGVA 3OAYH 5KZCB 1V3LA 3RTQD 3OSKA 3DVIA 2DQHH 2ATKB 2VSDA 3GM8A 4HKBA 1IGIL 2F53E 2X1WL 1S7SB 5DTFB 5HGBB 3ZHLA 4F7TB 1QSZA 2D0FA 2HLFD 4WY7L 3RWIB 4X80H 2JTDA 2W9DL 3I50L 1YC7A 3CK0H 2XNAA 4Q9QL 1FNLA 3D18B 3NFSH 1TENA 4JFOB 5JHDE 1UM5L 4M03A 4ISVA 1X5AA 5EU7E 5SX5H 3HC0B 4K3EH 2F15A 1T0NB 5GRJL 1S7WB 1NGZB 2CLRA 1ZTXL 3QG7H 3GHBL 2QKIB 3FT3B 4MAYC 4BH8B 1NUNB 1YEGH 4KAQH 2RBLA 5GGSY 3MGTA 3GMLA 4XNZB 3KDMA 4FQXD 3FOMA 3C6LD 5HGHB 5E5MA 3LKOB 3HAEA 1QPXA 4KI5C 2DM7A 4LEXL 2CR3A 4LSQH 1NFKA 4I2XE 3QJHB 5F7NC 2ADJB 1A6AA 3RUGA 5C0EB 1UADC 2IQ9L 5DJAB 2AJVH 1T04B 2YD5A 4HK3J 1NANH 3LHPL 4UIKL 2V9RA 5C08D 2GUOB 3OXRB 3OX8A 3EKCA 3F58H 2FEDD 1KJ2A 4MJ6A 4U31A 4YUEL 1WFNA 2FJGA 2Z91B 2H3NA 4GQPH 2BDNH 4YBQD 1W2KT 1R0AH 4E0RA 1XFPA 1CFVH 4M1GH 2ZUSA 4D0BB 4LLYA 2JCCF 4U1GC 3UTTE 1YA5A 5CJOH 2DMCA 1GXEA 1YQ2A 4M43L 3KYAA 4OIIH 2A83A 4KK9D 2A6JB 5TDOB 3IT8D 1RUMH 1TITA 3S3PA 3ULUF 1FNGB 2FO1A 5IV2A 1OCWL 1GIGH 2BVUA 4UNVA 3TF7C 2AGJL 2D7TL 3PWJB 4NZDA 3P0YH 3G5ZB 3L5XL 4D9QE 1NMBL 2X7LA 4YBHA 4DTGL 1OQOA 2VXTH 5CP3H 3MNZB 5IGXH 4PLKC 3DYOA 4QXWA 1FAIH 4HWEH 5I74B 5DURB 3LOWA 1J05B 1ZANL 3AS3A 3AM8A 4FRWA 4P23A 3QRGL 3W11C 2H2SD 3SDYH 3CVIH 1IEAB 2CIKB 5ID0A 2V2WB 4QRSB 1W72H 5IROA 4MAYB 4POUB 2R23A 2YXFA 4YQXL 4U0RC 3HI1A 1NPUA 1S7QA 3PWLA 3GK8H 4M6OH 5T3XE 1YPZF 5ANME 4M8QA 4HBCL 2Y07L 2ADFH 2DICA 3T2QA 2IQAA 2DJSA 3DX9A 4LVEA 1WIUA 1UH2A 4PP1C 5GS3A 4HUXB 1OAZH 1V5JA 4DN4H 1QKZH 3MPCA 1K4CB 3CZFB 3D9AL 4XCNB 4JDZA 4CL7A 5IBUG 1J1PH 1ONQA 2WUBH 3HZVB 3VXOA 5GGRB 5GS0D 4PRIA 4YDVB 4QRTA 5EZOH 4KC3B 3GMMB 3JUYA 2IBBA 1MCOH 3GSXA 4DKEL 2OTUA 2PKDA 3ZTJG 3S9DB 1RJZB 2XPGB 3LMJL 3P4MA 3W0WE 1K3ZA 1XF3A 2BCKB 3HMWH 1BD2B 3L3OA 4X6FA 3SDDC 5DMGC 3LEVL 5B3JF 1JHKL 3NCEB 3BUTA 4NQED 2APWA 4HCRA 3QEQD 1SBSH 3ILQC 3BX7C 1LEKA 1T3FB 5IW6A 3TVMC 3QQ3A 5DJXB 2P8LB 3P0VL 2IFFH 4N0UE 4GMTH 2VAAA 1EGJH 3KAAA 3O9WA 1KPVB 4KHXH 4FMFA 3CNKA 3CVHA 3L3GB 4N68A 3MGOB 2FD6H 3OJDB 1FFOA 4NNXB 2OMBA 1Q9OB 2PYEE 3EYSL 1OM3L 4OD3H 4U1LB 4YNYA 3QXVA 3SBWC 1LP9B 3RVXC 3O2DA 1BFOA 4NZRL 2A77H 3EO0A 3WDHA 1TZHB 1KJ3L 1ROWA 3AU1A 3QHFL 1LO3H 4U0RB 4PGCB 4NKDB 4HUVA 3ULVE 3UTZB 1F6LL 1IE5A 2H32A 4N9GA 2C4FT 4YDIH 3MRHA 4NUJB 3SEPA 3SE4A 3QI9D 8FABB 5I1HL 2MPAL 3FT2A 1MWAL 2BVPA 1B3JA 1I1FA 5EC1A 1QEWB 3T0BA 1ZT1B 1H3UA 1C5DB 1T1ZA 4LQFH 1U8MA 1S8DB 4KKAC 1UYWL 5LQBH 1INDH 3HZKA 1L0XA 1CLOL 3OR6A 5F7DA 5GGTL 3P0GB 5LBSL 3SGEI 3GSVB 5DK2B 1CU4L 3SCMA 3O11B 3H9ZA 4L3EB 5JDSA 2CSPA 4F7PA 3BZ4A 4JANB 1I1AA 3ZT7A 2XICA 5EA0H 2YWZA 1OD9A 3SDDB 2J8HA 1F4YL 4K94C 4AIOA 2BP3A 3O45A 1DDHB 3TP4A 1XGYH 2PTUA 3MRJB 2ESVA 3CH8A 1IGCH 3TVMB 4KZDH 3TN0B 4HUUB 4H20H 4U1SB 4FXKB 3QUZC 4Z7VF 3IRPX 3MV8E 1JI2A 3QNXA 4FP8L 2APXA 4ZUUB 1CBVL 1D5IL 2N56A 3QDMA 4J3OC 3H9SE 5CSZB 2X9YA 4QHLB 3PHQB 3QUML 5JXAH 2AKRB 1ZEAH 5CP7B 5D2NB 5D1QA 3V2AR 1EAPA 5D72H 1T1XB 4P57A 3VI4F 5EIIA 5JTWA 3GMOA 5EPMB 5C6WH 1GVIA 4QYOA 3K8MA 2OYPA 4UQ2A 4PJEB 3PL6A 5F97E 5IWLC 1ZT7A 2VXQL 4R4FL 4DEPC 1GAFL 3HNSL 3B4NA 1AP2B 1ZAGA 2AXHA 4GW4B 4ZFZA 2V5YA 3VWJD 1CL7I 5FF6B 3SOBH 4WU7B 1EO8L 1YEDB 1RJCA 4AG4L 2VDOH 4FA8A 1XGTB 2VLKA 4ODUB 1OARL 1KCKA 4WWID 2C3GA 4CVUA 4KV5E 4LIQL 4WUUD 2FSEB 4BELD 5IVXA 4ELKA 3TA3C 2HRPH 1IFHL 4L8DB 4NO2A 4Z0BH 4P4RA 3W9EA 2DI7A 4WRLA 3ZYOA 4OZHB 2VDQH 3V4PL 2NY3C 4I77H 2XKNB 3T77A 2OBGA 3KPSE 5DJDA 2WANA 2O5XH 2VQ1A 3B43A 4MB4A 2AV1B 3UJJH 3B6SA 1NCDH 5BS0D 1G9ML 4HMCA 5E5RB 3B3IB 3C5JB 1U91A 3EOTH 3QIWC 4KVNL 1TQCC 5J4MA 3DUUB 3RX8A 4PRHA 2P42B 3MZGB 4Y0GA 4PV9B 5C6PB 2QL1A 4PRAA 1WWBX 2C1OA 3TBYA 1EXUA 3BD3A 1Z3GL 3QIUA 5FHAL 4GRMA 3GBML 3TWCH 2PO6A 4KDWA 5D7IA 4NP4H 3F62A 3UBXB 1RZJH 3T09A 4HGKC 4X8XA 1WWAX 3WE6A 2XY1A 1KEML 1AGBB 2W0PA 1N64H 2HN7A 3BN9C 1QHOA 2WBJA 4ZXBB 2HTKD 3CXHJ 4Z8FH 2HA1A 1TMCB 1OSPL 2J12B 4FQCH 1O0VA 4JB9L 4X6DB 4LPXA 4XNYL 5KS9B 4JCLA 3TT1H 3L9RA 4DEPB 3D0VA 4X9HA 4OI8A 1A14H 4KJPC 3HG1E 2B1AH 5DJCA 4NC0B 4O5LL 4Q97A 5FA4A 4H5SA 1MLCA 1PKOA 5H94B 5J9PA 2V5TA 3X13A 4O58L 1CD9B 2MHAB 3LZFH 4XPAL 3TA3B 1RIUH 2A73B 1CXKA 4PJHB 3I2CH 2R56H 4JKKA 4XXCC 4YFDB 3ARRA 3QPQC 1CFSA 1IAII 3F7QA 4O2FA 1M1SA 1LD9B 3L7EA 1T5WB 1F3RB 4XVTL 4YWGH 1INQA 4P5MA