3R0NA

Crystal structure of the immunoglobulin variable domain of nectin-2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
MQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Nectin-2 reveals determinants of homophilic and heterophilic interactions that control cell-cell adhesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Poliovirus receptor-related protein 2
total genus 24
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2011-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3r0nA00
4KPHL 1T0NB 3QIWC 3GGWA 3T3PF 1LP9F 3EYFB 5HPOA 5KAQF 4FMKA 1KTDA 2C4XA 3FRUB 3RVTD 2XZCH 3KLSA 3D39A 1ACYL 1NQBA 4HH8A 5IG7A 3SE9H 5DVNA 1P9MA 4M7LL 4I3GA 4F57L 1FG2A 4UT9L 2P5WE 5HDBF 1CBVL 4LRNH 3TBVA 5D1XD 3D25A 2QR0B 1N7MH 5IKCA 2EDEA 3U9UA 3QCVL 2VERN 1Z0MA 1BIIB 2OS7A 4JFXB 1JI1A 5B8CB 2KL6A 5F6HJ 4BM7A 2NX5D 5D70H 1FE8L 3HE6C 3QDAA 3SGJC 3ARGC 5IFHH 4X4MA 3U7AA 4XX1G 1OP5K 1TVDA 2IEPA 1AE6L 1CBVH 4UNVA 1IKNC 1A02N 1LO2L 2MQCA 4YWGL 4G7VH 1D5BB 3OG6B 1H3GA 2X2YA 4R90L 3U4BH 2HTKD 5JXEC 4HK3J 4PJXA 1U8PA 4MA1B 2A2QT 3MRKB 4I3SL 1N6QH 1NPUA 3RZWA 4GW4B 3ZE2E 2EEBA 3WFEL 5DMGD 2IH1B 3LKRB 2ADFL 2WINA 4ZUVA 2YOCA 5DEGA 5EU6B 4X9FA 4M8VA 5CUSL 3C60A 4OD1L 3SE4C 1ZA6B 3WBDA 2HAZA 3JBG7 1Y6MR 5J0BA 4XWGH 1AD9B 3UMTA 5D7SH 4I2XE 4BA8A 4S1QL 1R3HB 5D4QA 5FHBH 2XQBH 4XPTL 1NANI 4NYLA 5MP6L 4B7IA 5BRZD 1F97A 4JVWA 4LCIH 3CFEB 1MI5D 3S4SA 4YO0A 5DD1L 4DJMA 1XH3B 1EGJH 1MVUA 1YNLH 4XPTH 3TH2T 4TVSa 1I7RA 1CFQA 1ZHBB 3LV3A 3NFPB 1EHAA 3K1KC 5I73C 2YPVL 3BHBB 5D7SL 3PXJA 4K8RL 1FYTB 4O2FA 1X44A 1V8HA 4RFEA 4OCSH 4HXAL 4TPRH 3EGSB 1HXYB 2NY2C 1ZVSA 5I8CA 3GM8A 2D4FA 1KIPA 4NQED 1FV1B 1QKZL 5B38G 1CXKA 2ZCKL 2DQIH 4RSVA 5BO1L 1NFIA 3V0VA 4N0YL 2PYEA 1OGTA 1XZ0B 2YMXH 1KB9J 3GDBA 2COQA 1IVLA 2IANB 4KV5E 5TQ0H 4HGWA 1KCRH 3EUUA 4HH9B 3BXNA 3M17A 3X13B 1A6UL 2DQFA 3N1FC 3VFMA 2J6EL 4PRHA 1F58L 2PXYD 4LSPL 5IQ9B 4HUMB 1DQDL 3GMRA 4YQXL 1EVTC 5ISZD 1FPTL 2JJUA 4HIIA 3WL9A 1I9IH 1YYMH 2AJUL 1J9CT 4RMQA 3L3IA 3JTSA 5EOCH 1YEFH 4L8SC 4ZXBC 2EDTA 3LV3B 1D5MA 4W70A 5F7LB 2Q8AL 4WUUD 4YHNA 3DRTB 4MAUH 2BXZA 2F15A 1OAKL 3ZKQD 4UQ2A 5CGMA 3MRGB 2V17H 4NOFA 3P9LA 2WBJD 1W0WB 3EFFA 4ERSL 2QSVA 2OZ4L 1MCOH 1HCVA 3OAYK 4K07A 4MD0A 5DD6A 4K3GA 3RFZC 4XP9L 1FZMA 1CT8A 2PW2A 1BVKA 4UZGA 3OJVC 2BVQB 4EIZC 2EE9A 2GIYA 3WXVL 5KVDL 3A67L 3KHOA 4M93B 1A0QL 1I75A 4KGJA 1OOAA 3RGVB 3GUTB 4XI5C 2YPLB 4R7NA 3VGDA 5FGBC 1R3IL 3HTLX 4YBHA 3GSOA 2VXTL 1MFDH 2RB8A 3LKSA 3O9WD 4E9LA 3QO0A 1BAFL 3OAZK 4XNMA 4DFIA 4GT7A 3BH9A 3GI8L 4LLQB 1K8DB 5BZDB 1T20A 3U4EB 5FYLE 3TH3T 5D7JC 1S7RB 5GGRB 1AKJB 4OQ1A 4P9HL 4XPGL 4XWGL 1AC6A 3MA9H 5ID0B 1VGEL 2X4UA 1BAFH 1CD1B 3G5XA 1UXSB 2DQHL 3N50A 3STBA 1RZJL 3HE7B 3DXAA 4Z78B 4N1HB 3GMQB 3G9AB 3RTQA 4NBXB 1J5OH 1F42A 4G8IA 1AY1L 3MLWL 1TJHH 2V9RA 4PJIB 5ECJE 5D7IE 1QFHA 3LKOB 43CAA 2JK5B 2SEBA 4R8WL 4PJ8C 1C16B 1UH2A 4PY8I 4K94C 2I5YL 3QNZA 3TBVB 2QEJA 1NUDA 1L0QA 3FQUB 2BNRB 1MLCA 1I4FB 3BX7C 4DFHA 3VD3A 4NHUB 2X9WA 3V6BR 4DN4L 2R4RH 2JELH 5KVEL 3GM0A 5F6HI 2ZUXA 4TULL 4TNVF 3BDYL 1SJEB 2OK0H 4U0RB 2YUVA 3PUCA 4KRPC 1FZJB 4OI9A 3QDJE 3O6KL 1J05B 1FIGL 4HIHA 4G6AC 3WFZA 3LCYA 3B9KA 5A3ID 3FRUA 3QJFA 4APQA 3QDGB 2OL3H 3E6FB 4YXHL 1ZXQA 5C0EA 4F7CB 2ATKB 5IMMA 5EBGA 3IDGA 3E2HC 4JO1L 3NFSH 2I24N 5BXFB 3LEXA 3P40A 2E7BA 1EEZA 4Z7UA 3VFUA 4M7JL 1TLKA 1QR1A 5I1HL 3NVQA 4XHJD 4LOUD 4GBXC 4CDHA 1KJ2A 3CX5K 4QXTB 1RZ7H 4YAQB 4RMWA 3WIFB 4RBPH 2VE6B 1WZMA 2YN5A 4ZOAA 3BKMH 1CFTA 2DQJH 4JZJB 4Z8FL 3H9HA 4GG6F 5MENE 4L4VA 1PD6A 1Z2KA 2E8ZA 3VFVA 1XGUA 2HN7A 1DEDA 2YK1H 5T1KA 3MRCB 1FSKC 2EE2A 1RURH 3QIUC 4MDIA 3WDHA 2EH8L 2CKBL 2CLRA 4FZ8H 4JRXE 1NBVH 5ESVB 2DM2A 1GGIL 5GJTH 3UP1A 1QBML 1DQML 3L3GB 4PJDF 3DUSA 4X7TA 1JWUA 1NSNH 1RHHB 1EFXB 5IROC 4F9PC 5JPMA 5EO9B 1BREA 2R0ZH 3C2AH 1KIRA 4K94L 2ARJB 2A9ML 1OQOA 4OM0L 4H1LH 4ISVA 4JY6A 3C09B 5D72L 5AYQA 5KBNC 5HY9B 3CGTA 1FNSH 4F58L 1XF5A 5IR1B 5J3HC 1ZOXA 3SDDD 5IQ7H 2FHFA 1FYTE 1Q9LA 4UV7L 1S7SB 2HFEB 4AENB 3O6MH 3D69A 2H41A 2MKWA 3MRQA 4AIXA 1VFOA 3U7YL 1AO7B 3ZL4L 4MCZB 3DYMA 1TZIB 5IFJA 5B4MC 3TZVA 4Q6YA 3BUYB 1R5IB 4P4KD 3VWJC 1TNNA 3LKOA 4QHMB 2IANE 3NPZB 2MHAB 3LMJH 5C08D 4LLMB 2YEZB 2X89D 5JOFA 5F7WC 1FFNB 3TO4A 1FLRL 3IFPB 2W38A 1CXEA 1OLZA 4YXKH 4P5TD 5C0BD 3BKYL 2Q6WA 3RUGA 2P8MA 1RULH 2P43B 1A6WH 5I8KL 1OQXA 2F5AH 3L3OA 2OXHA 4JN2B 5EO9A 5CZXD 4BFEA 1I1FB 5C07A 1S5HB 5C0AA 4HT1H 3GSOB 1XCTB 2C3GA 3V6OA 4X6DA 5EN2A 3D25B 5CZKA 3VGEA 1OAXL 5B3JE 1RIVH 2B1AL 1XR9B 4LCCC 1QSEB 1MIMH 4XNQA 2BDNH 2PR4L 4L5FL 4YBQD 2DYPA 3RAJL 5HHXH 4R9HA 1A7RL 4NN7B 2NY7H 4JFHE 4Y89A 2QQKL 4E41E 3HR5A 4ZO7A 2EXWC 1NUNB 3HCVB 1OLLA 2VABB 1JGVL 4WVRA 3FN3A 1IFHL 1W72B 3DI2B 4L8CB 1ZHKB 5TDOB 4Y2DA 4UNUA 4HKZB 2A6DB 2CMRH 2N1KA 4KTYA 2OZ4A 7FABL 1MCRA 1X5HA 1QA9B 1MJUL 2XWTA 1YDPA 2H3NB 3V5HB 1OPGH 4UOJA 1G7IB 2Z92A 3RRQA 3SDAC 4M1GH 3BHBA 1UJTA 3HZMB 1FFQA 5F21B 1AP2B 1IM9A 3C6LC 2DQGH 3FT4B 1INQB 2NY0C 3WNPA 4YX2H 2APVA 3STZA 4JRYE 1T20B 1ZMYA 2D7OA 3OGOE 4UIKH 3MUJA 4M7ZB 2FX7L 4L8DB 5EO1A 3PP3H 2F8VA 3CFJB 1F45A 5KVGL 4E41A 3VD7A 5HHQA 3RPKA 3P0VH 2ADJB 3AMKA 3AXLB 3HS0A 2LU7A 3C5ZB 4ONGL 4KKBD 3GMPB 3BESR 3GBNH 5IVNA 3QDJD 3WHXA 5IB5A 4BH8B 2BVQA 1CE6B 5TF1L 1ZT4A 4G7YL 4H8WH 4WEBL 4XWOD 3MRHB 5B8CC 1R0AH 5B38B 1N7ML 2WMPA 2DDQH 3ZMRA 4NJ9L 5F3HA 4PY8J 4NNXA 3F65A 2AEPH 3NN8A 3MUHL 1A21A 4P2OD 2X40A 1BECA 3DHMA 3OR7A 5DMGC 1WV7T 1OD9A 1Q9WA 3N06B 1XEDA 5F1IB 1NC2B 5FECA 3B5TA 3PWJB 1MRCH 2DQTL 4I2XB 3WFDL 4NQTA 5DHYA 3KPNB 4HXBH 5F7DB 1JPST 1F13A 1CQKA 4PRPD 1Z9SA 4PJ5A 4X9BA 2Y25A 3HB3D 3IFLH 5DD5H 2W59A 1YQ2A 1ADQA 4JKPL 2AJSL 3QULA 3QPQC 1DUYB 3BUTA 1P7QD 3KGRA 3LS5H 4OCWL 2J3SA 4C54A 4JN2A 3VXUD 1FC1A 5D5ME 5CMAB 3Q5TA 3QDHA 1LE9A 2X1QA 3QUYA 3VFMB 5DEFA 1OTTC 3AREB 1I7ZA 4L3CA 3U82B 3HHRB 4KK6D 2YPKA 1J0HA 1OAUL 3LIZL 1D5XA 1EHLL 3E0GA 4OAWB 3ULUE 2ARJQ 1LWRA 1UB5A 4YNYA 2VKXA 1RZKL 4JKWA 1UA6L 2AV7B 3O0RH 3BPOC 2DQTH 4O2EA 4RRPA 1MAKA 1OAQH 1SYVB 4NNXB 1OTUC 3SE8L 1PYWA 1NCBL 4HJ0D 4NUGL 4WNQB 5HVGB 3SKNB 2D03H 1RK0B 1G6RH 4HZAA 4LU5L 2PTTB 3N0PB 3OKDA 1AHWC 1LO5B 3RKDD 1GOHA 4G7YH 1WCBA 5TGBB 5IBLC 5TF1H 3DXAE 4IS6A 5HI5D 2WP3O 3P0VL 4X8XA 1F6LL 3G08A 1JTOA 2HT4D 1F11A 3HG1B 2XWTB 5C92A 2JIXD 3U2SA 5IEKB 4YLQT 1NDGA 5H35A 1YY8B 2VYRE 5T3XL 2J5LC 4M48H 5CZXC 4HCRH 1D6VH 3QUKA 4B0MM 2OJEA 5SX4H 5JNYA 2F54B 4YDLC 1YYLL 4CVXB 4IRSC 5ITBL 1P1ZB 1YEJH 2IWGA 3RIAF 3MO1A 4S2SB 2XRAL 4L8DA 2BNUA 3UJJH 4EDXA 1X5GA 4H88L 2ARWA 3GSWA 4KK8C 1YYLH 3ZHDA 5CJXC 3RVXD 3D3VA 4V1DA 2OMBA 3HRPA 1XT5A 4YK4C 5HVWA 4UB0H 5DUBB 3IDNA 5FFLA 2ADIA 3D2UA 3QEQD 3MFFA 2BY1A 4GBXD 5JIPA 3CLFH 2P48B 1X5LA 2MPAL 2V2TB 5C0BA 4FQLL 5ANMB 5C0IA 5DFWH 2NR6C 4BZ2H 2JB6B 3DV4A 1CDUA 2F53B 3NCCB 4L8SA 4ZXBA 5FYJU 3WO4B 3QO1B 3IDYB 3IU4L 5CD3A 3DJ9A 1KG0A 3PP4H 5JW3H 1MUJA 1FO0A 3RI5F 4W68A 4XNUH 4POUB 5LQBL 3DO3A 2R9HC 4WGWB 1PDKA 1QYGL 1JNNH 4NO0D 2AS5M 2R0KH 1IEAB 3AMLA 1WBYB 5I8CB 1MNUH 1TVHA 2JCCB 3MO1B 4OZFH 4P49A 5D7IB 4ZUWA 4YXLL 2CK0H 4DGIH 4HHAA 2VDLH 4XWOC 4IOIA 4PRPE 4WWKA 3RWGA 5KS9B 2ITDA 3GK8H 3VFOB 1IZKA 2AGJH 4F33B 2BP3A 1HDMA 3ILQC 3T09A 2IGFH 4I48A 4MLIA 2CK2A 3MRFA 4NCC2 4OGXH 4LVOC 2ZCLL 5H94B 3IS1X 2X42A 3ZL4H 1DL7L 2VUYA 1QFWI 4GOSA 4IRZL 3IXAA 4F8TA 3SKMB 3AVEA 2EDJA 5IESH 4L4TD 1YEGL 3UTPD 1IEBA 1BFOB 4MMZC 1A3LL 5F1OB 3BYTA 3LHPL 3FO9A 5B3JF 4LLQA 3KXFB 5EO0A 5D7LE 4XP9H 3DOSA 4N90E 3DUHA 2BZDA 4LAQL 1KNOA 4Y19B 3GSNA 2KPNA 4JPIB 1DE4B 4WFGE 4X5XB 1LEIB 1I8MA 1RZGB 1AO7E 3BIKB 4MLSA 2A83A 2EC9T 4PYHA 3KYKL 1FZMB 4IMKC 3UYOD 2DKUA 5C0FB 4HGWB 4G9FB 1UJ3C 4EXPX 5L6YL 1LGVA 3TA3D 1E4WH 3NH7H 1HH6B 3LS4H 4QHKI 4YHZL 4EBQL 2HG5B 3RHWF 3PDOA 3QG6B 4HS8L 3W0WB 4MXQD 1S5HA 4PJBB 2AK1H 2P42B 3BWAB 3I6LE 1C12A 5KTEL 4Z7VA 1AC0A 4FMFA 4LF3A 5C2BL 1K6QH 2NX5E 5H37G 5CINH 1Z9LA 1U2HA 3BN9D 5J6HA 1SJEA 2DBLH 4UTAL 4KHTL 5IBLD 2DM7A 1AGCA 3NIFF 1JTTA 4MSWB 3ARDB 5TGBA 3GIVA 5IF0B 3HMXA 4CMMA 1ZANH 4U1LB 4QT5A 1A4KB 1BFSA 3L3HB 3KJ4C 4EXKA 3O8XA 1MJ7H 1MJJA 3BW9B 4U1GB 5DT1L 4KZDH 2JELL 4MAYC 4PLJC 4WI7A 4Y2DB 5I66A 5AWNH 4WDIB 3AUVA 5DMKB 1BFOA 1DZBA 5IVXA 1I9RH 4P46D 3FHQA 4CJ0A 3B6SA 3QNZB 3REVA 3B43A 4DN4H 5JORA 3EOYG 2FJHB 3BZEA 3QUMB 3TBTB 3BWUC 4I9WE 4MNGA 4UQ3B 1OSPL 4PB0L 2Z8VC 1X5JA 1CU4H 2GQHA 4D8PA 4BSWB 4XAKD 3OSKA 3LSOA 2GKIA 1K8IA 5DQ9A 3MPCA 4HX1A 4JRXB 3ARFD 4LSVH 3W11D 4WEMB 4X99B 3FB8B 1BJ8A 2H32H 4CL7A 3IDUA 4KQ4H 4MZ3A 4OF7A 1KF9B 2A9NH 5CEYA 4YHPA 2GK2A 2UWEE 4Z7QE 1DBJL 1X5KA 3IGAA 3MODL 3CDGA 2JF1A 5JO5B 3QEHB 5KSBF 5FXCH 1DVFD 1HHJA 2Q86B 3C8DA 3U7YH 4X6FB 4FABL 3TBSA 2Z8SA 5B21A 4GS7B 3PJSA 4P5TB 5FUCC 2Q1EA 3KDMB 5DK2A 3HMXL 3MLXL 4LVHB 4ZYKB 1A3RH 4R97C 4NJAL 4TVPL 3VGAB 3QUZB 4IOFD 3MLRL 3ELAT 5D1ZA 3S88L 2DI7A 2MFNA 1WWWX 1MOEA 12E8H 3TPKA 5HI5C 2V2TA 4HDIB 2IAMC 4ONHB 1F4WH 4PJ9C 4GKSB 4U1JB 1S9YA 2J88L 3MLZH 1I8LA 1FVEA 4WUUA 4YDKL 3G6JE 2DD8H 2I9LB 3V6ZA 4R2GC 4OKVA 4P5TC 3SDXA 2NZIA 3ZE1E 4PBWD 2YR3A 5FOJA 3N1PC 3DVGB 1VKXB 4QOKA 2W9LA 3QFDA 4I3RL 1JV5A 3H7BA 4KK9C 2F53D 3C9NA 1K4CA 4ZTOH 1MPAL 5ACLA 1CDGA 4XZUB 3T0DA 2FBJL 4BSJA 4JDTL 4QCIB 1CLZH 4F8QA 1FQ9C 5GS0C 4CW1A 5DVKA 5D2NB 3P9MA 2XTJB 2XNAB 3BQUC 3T0WA 3P0YH 4FNLL 5DZLA 4LKCA 3MRMB 1EXUB 3I75B 3SE9L 5BOZG 4O58L 4XNYL 4HS8H 3L5IA 4Y4HC 1CR9L 3KR3L 1JPSH 2GSIB 2AERT 2ZCLH 4NUJA 4IS6B 4LPTA 4DKDC 5T3XD 1R5VA 4ZTOL 1UXSA 2EZ0D 2A6KA 4JG1H 4M6OL 1TPXB 4X4XB 5D1QC 5C0NC 5IB2A 2A1WL 3CAFA 3HAEA 4NPYB 1OSZB 4F37F 1V3LA 3BIKA 4M4RA 1QSFE 1AR1D 5SX5K 2P24A 3CXDH 5DJYB 3UYRH 4UNTA 4XP5L 3FO2B 1FVDB 3WN5A 2AEQH 1BHGA 3KLDA 4OZGB 2WP3T 1BZ7A 3EJJX 4MX7A 2R8SH 3O9WB 4CBPA 4YXLH 3JV4B 3EYOA 4J3WA 4F9PA 1QBLH 3T2NL 4UOW1 1I1FA 3QNXA 1F02I 4ZFGL 3QCTH 4D0BA 4KJWC 4L9LB 3SN6N 4OKVB 2CRYA 3GMOB 3FQWA 5T33L 5BZWA 3IDMB 3RGHA 3CH1B 1DUZA 1KN4H 3CZFB 4XPHH 2KDGA 1U8HB 4NKDB 5IBTL 1N4XL 4CNIB 1KXVC 4R7DA 5D1XC 1SBBA 4N0UB 5TFSH 5FF6A 3Q48A 3LD8C 1U6AH 3QHZH 3WYRA 4HUXB 3BH9B 1SY6A 5IFJB 4JG0L 3VXTA 2ZOKA 3OL2A 3K8KA 4H5SB 2VLJD 3Q3GA 1JMZA 4OD1H 4RFNC 5C0EB 4AL8L 2EIDA 4JJ5B 3TFKD 3RWJB 1X5ZA 1A5FH 4BK4A 3AFLA 5KVMC 5LXGL 3BP6B 1QSZA 1KCUL 3UTTD 3QUZA 4EI5C 4OUUA 3BOVA 4M7KL 1MFBH 5ESAA 3QHFH 2C7UA 3WLWC 1T83C 4KTEL 5DWUH 4ZUSB 4JEGB 5ADPL 1RUQL 4A6YB 3ROLA 1BWMA 4QTIH 5DDHB 1T66C 1JL8A 1LK2B 3O6FA 3GSNB 1EUUA 1VFBB 2ERJB 1E0OB 1FHGA 4MCZA 5DJYA 3C5ZA 3C8KB 2EC8A 1YUHA 3HC4L 5T1KD 4PJGF 5LWYL 4PJXB 2GUOB 4LCWD 1JNJA 4GLRH 5SV4A 5KG9B 3VD9A 5T3ZL 4XBGB 2CPCA 2BHYA 1NEZB 3KVQA 4NGHH 2MMXA 3NABL 4S1DC 3SCMA 2BSED 2EH7H 3MRMA 2ENSA 3P4NB 3HG1D 2H26A 5GSRB 3VXOB 2KH2B 4PUBH 1DVFB 5IHUH 4M7LH 1RVFH 3BPCA 1FPTH 4LLWA 3U30C 3VFUB 5D7JD 3QPQD 3MLUL 1HZHL 4APQC 3LKNB 4P3CH 1OWRM 2EIZB 2IAMD 3MV7A 4OF3A 4U1NB 3V4PL 2I9TA 2CGRL 4YC2B 3UTSA 2HJKA 4XCNB 4YUEL 1Z9MA 1XGQB 1RJYA 3LIZH 4H88H 4TVPH 3BP4B 2ZJSH 1BVKB 2HN7B 4M1CC 2Y23A 1T21A 4PGCB 1YEJL 1WLHA 2CUMA 1A7PL 4BFGA 3HFMH 1C8PA 3WNKA 3NTCL 3L3DB 2XT1B 1R3KA 2VZ1A 2VWEC 3S3PA 3P30L 2PTUA 1I4FA 1NBYA 4A6YH 4DZBB 2EH7L 5IJKC 2A73A 2WUCL 3RVWC 4FFVC 3TNMB 5IWLA 1TZHB 2C3HA 5GRWA 3LN9A 1I7UB 1DLHA 4G8EB 4WI9A 5DJ0A 5E8PA 2NY5L 4JZNA 3ZHKA 4DN3L 5ESQB 1CFSB 4LU5H 1T4KA 3SY0A 1G9NC 4GXUM 1D7FA 3ESUF 1JZ5A 3DGCR 4RQQB 5JHDA 3O3DB 3OF6D 4F2MA 3RWEA 2XTJD 3V6OE 5DR5L 5ITFB 3KPLA 2ZUQC 1D6EA 4YFEA 3D9AH 5F88B 1EA9C 5HDBE 3KWWB 5HYJE 1J7VR 1KJ3H 1H8NA 2ERJC 3GHBH 3MJ9A 5F3BB 4XXDB 1F3DJ 4X9IA 4KROD 1NCWH 4KKCD 3CMOL 4JREC 2O61B 3LD8B 3H42H 1Q0XL 4H26B 4P46C 4JFZL 2DS4A 4WCYL 2P47B 2YPLA 4R7NB 2NXZB 2NPLX 4ZUSA 3VXRA 1HQRA 2Q87A 2GJ6E 1G7LB 1FL5B 4PJXF 4U1KB 1IKFH 2VTFA 1QSED 4UUJA 5I74C 3HN3A 5T1MB 3GSRA 4UDUB 2I07A 5L7XH 5F1IA 3MOBH 5FECB 5I76A 5DJZB 3BE1L 1G6RB 3CU1A 3M8OH 3GJEB 3ULVH 1D5IL 4OIIL 4G8GE 5EZOL 4Z0XA 4LARL 3ZE0F 1K4DB 4OF5A 4JANB 3MACL 3MV11 3MRBB 5C2BH 4MS8C 5TE4L 3QIWD 4F33A 4AY0A 4IOSD 4ELME 4FTVB 1QSFD 5BQ7B 1YECL 5CGYD 2YD1A 3DROB 1AHWA 1HSAB 3U0WH 1D5ZB 3QDGE 4ALAL 3X3GL 2BSRA 3DHJA 3E8UH 1SEBB 5TDPB 4NZJA 4XBEH 5A40E 3F8UB 3U1SH 4OJFH 3RPIA 3F58H 4JY5L 3AAZA 3VE0B 3UTTE 4J4PA 2WK2A 1MF2L 1RY7B 1QLRA 1CICC 2Y7QB 3LKQB 4MD5B 3CXDL 5KVGH 3O3AB 4MA7L 3QQ4B 1HHGB 3W39A 1ACYH 4FQXD 2WWMD 1EFXA 5JPMB 3Q0HA 2Z31A 3DVIA 2EYTA 2YXMA 5F3BA 3EO9L 4DGVH 1UM4H 1J5OL 1R3LB 2HT3C 1F3RB 1JYXA 1QRNB 1DEEB 4KHXL 1IFHH 4TVPE 2X4SA 5DQDH 2YWZA 4B50A 2GFBA 4OZGF 4NZRL 2CMRL 1DL7H 4H25A 4HWEL 4OIBA 1UKTA 4R26L 5ABDE 4QRPE 4HIXH 1CXLA 2DL9A 4G6MH 4RDQF 4HZLA 3PL6C 3HPJB 4JHWH 5K9KB 1FNAA 2YA0A 1YEDA 4KQ4L 4FTVA 5ETUB 1D9KA 3EBAA 4JG0H 2F5BL 5GS3A 4WEUD 4CW1B 4MYWB 4R4FL 4WI2A 5F93C 4ODSH 1KACB 3OKMB 2DN7A 3AB0C 1FNFA 1FBIH 3EW3B 5FHAH 4JQIH 4TSAH 1T1WA 3O3BB 1RZ8B 3WS6A 5B39G 4ETQA 4MCYB 4MAYD 4PLJD 1KJVB 5DVMA 3VDAA 4XPAL 5E1AA 2K1MA 2P8MB 1MLBB 2IBZY 4PREB 1UWXH 2IAMB 2R0KL 1MJ8H 3B2VH 4JFEB 2OL3B 1J12A 5C0DB 4ZFGH 4QRSA 4YR6A 4DOHB 4XVTL 4XCEA 3DBXB 1OCWL 4XHJC 4DVBA 4WW2B 1AY1H 1NGXB 5HGHB 1X5FA 1FN4B 2EH8H 3O11A 4DUVA 4HAFA 4GQ9L 3BPCB 4GS7C 1C5CH 4J3SA 3IFLL 1NKOA 5I75B 1E4KC 2EDFA 2PCPA 1JF1B 1ZA3B 1AO7A 3VXQA 2VWEE 3W9EB 4KVNH 1QSVA 4GBXB 1DQQB 4LHQB 5EU7C 2VIRB 3O4LB 3GMNA 2V7HB 5EUOA 4DKEL 5F8RC 2BSSB 4XP4L 1V7NL 4XAWL 3O3DA 4LKXB 4FQQB 1DDHA 4NZUL 2VSDA 2K9UA 4PJ7E 1CD1A 2GUOA 1U3YA 2G2RB 1QFUH 5KG9A 1MHHB 3ZKMC 1T5WA 4RMVA 3PWPE 1CIDA 2DDQL 2XA8H 5KSVB 3BJ91 4JM2F 5DURD 3OR7B 1BZ9B 5DK3A 4FOMA 1UQSA 4YAQA 3KYKH 5CP3H 1R6VA 1OTSC 3ULSB 1JRHH 2VLRD 4XMLH 5KSAD 2YRPA 3O6LL 3NCYS 4ODTH 2DIJA 2FATL 5ESAB 3I6GA 1IJ9A 1JNLH 3QSKB 5J9PB 5J11B 3PGCA 5E8NB 4FRWA 3IDMA 3T3MF 2NNAB 1S7TB 5DS8A 4E42A 3O6LH 1RJYB 1JP5A 2VH5L 3Q6GH 2H9GA 5J7CC 3WS6C 5HYEA 3KJ4B 4JN1L 5AZ2L 5FM8A 1JGLL 4OV5B 1AGEA 1RFDH 2VL5A 4PPTA 4GAJL 4KI5F 4Q74A 3QWOA 2PF6A 2OTUB 4LCUB 1HK6A 3SPVB 1ITCA 3K2MC 4X6CE 1LO5A 4RWYH 4FABH 1ZEAH 4P23C 2V9QA 2XG4A 2UV3A 3V7AE 2X4RB 4PBXA 2FGWH 4NO0B 2DLEA 2H2SC 3LKPA 1KPRB 4QRRB 3SKNA 2Y5TB 3X12B 5JA9A 4KVNL 5EWIL 3H9ZA 4FFWD 2NY7L 3LPFA 1M7IA 2DLIA 1ZGLM 1CDHA 1DBKL 3ARXA 3PDOB 4NWTL 4ENED 2GTWB 3R1GH 3GJEA 5HHOA 2HJKB 1A6PA 4YPGA 1AXIB 4E41B 1NC2D 4OQTL 3SDAD 4JM2B 2WBKA 4C55A 4YDIH 3UPRA 4NQDB 1PKQA 3CFBA 4XB8A 1OP5H 4P2RD 5HGAA 3QUYB 5KVFH 1I9JH 5DJDB 4TOYH 3X14A 4UINL 3HAEB 1C08B 4X5WA 4JQIL 4TSAL 3HMWL 2OI9B 4NZTH 3MLYL 3QNYB 2DLGA 2DWEA 2P4AB 2XI9A 2EDXA 2MQ0A 1LO0H 2QHLA 1FLRH 4LSSL 4HPYL 4AH2B 3QDGD 2JE8A 3HZKA 2J1KA 4WHYH 5JW3L 3BRDA 2W9DH 5CBEA 3BP5B 1CQYA 1I7RB 1U3HA 4I2XA 3DV6A 1R3JA 4LSRH 4O02H 4DW2H 4UU9B 1A6TA 4ZAKB 5FYLH 5HI4D 2EIBA 4Z77B 1UWEL 5J1TC 2VZVA 3MV8D 2YWYA 1VACA 3R4DA 4LBEB 5L2KE 3LRGA 3FO1B 3KPPB 1J8HD 3MV8B 3TO2A 1BQHG 1KEML 5IBUG 4Q9CA 2DQDL 2DQUL 3QBTB 4GW5B 4MA8H 5FO8A 4HJGA 4YHIA 4PV8B 1ORQB 4GRWB 3TO4B 3GBLA 3MQIA 5BVJB 1DBML 4ZUWB 1L6ZA 4QRPB 1XF2A 3SQOL 4DUXA 3EJYC 3EHBD 2J8OA 4QNPE 4JJ5A 4GUPB 2O61A 5T3XH 1GOGA 1T5XB 3VXUB 1QO3B 3X17A 4TTDC 1ADQL 2YC1B 4OLVL 1NBVL 3DX8B 5E6IA 3IU4H 3FTGA 2XKNA 1J8KA 4NQCE 3MRQB 1ZLUH 1K3ZA 3G6AB 2VRAA 5ELIA 3I50L 4NCC1 1X6NA 3PJSB 4HF5H 4BFIA 5CSZA 2AJUH 4XX1E 5T1DH 1ZANL 5D93C 2RCSL 5F6IC 1EGJL 1VPOL 4OFPA 1I9IL 2YA1A 2X44D 1FVCA 2RIKA 4PGBB 2H45A 5EC1A 3DNKA 5DRZB 1YQVL 3HRZB 1KPRA 2VN7A 5GGVH 1OAQL 4RA3A 3FOLA 2Z93B 5I1EH 2BHUA 2PW1B 3OB0H 4DKEH 4S10A 1EK3A 3TVMB 4ODHL 3QG7H 1AR2A 2WIIB 5IMOA 1UWXK 4AK1A 3V7AG 5EN2B 1UCBH 2R1XB 5KAQG 2VLRB 5DO2D 5IVXB 3EYQC 4X5LA 2AJZA 1KT2A 5DDHA 3W0WA 3EYFA 3FO0L 3AS0A 1ZSDB 4JKPH 3VXMA 1EXUA 3IB4A 4JKKA 1F11B 5D5MF 4HUUB 5GISL 1NUGA 1SMOA 3KXFE 3K74B 1G7PB 1RU9L 3BEWA 2PXYB 5DMJB 1B6DA 4JRYB 1NLDH 4PRIA 4XVUC 4OLUH 2ZOLB 4H8WC 4NCDA 1LO2H 4YWGH 1BZ9A 2AEIT 3GIVB 3C6SB 4Q9RL 1NGWA 2XKNB 4FFZH 2APTA 2AQ3A 1KC5H 3C6LA 4CADA 1EEZB 4NN6B 3P4MA 4ENEC 1OAUH 1I1RA 4PJHA 3SBWA 3H8NA 1LE5B 4YFDB 1PZ5B 1B0RA 1QOKA 5SWSA 2IQ9L 4YE4L 2MPAH 4LKXA 1QBMH 4A2MA 2VZ3A 4F7MA 1RUAL 1WBXA 5ENWA 5C2UB 4JVPA 4YIQA 2WWKT 2AGJL 4QRQA 2CKBH 3QEQE 4M61A 3ZZ1A 3MXVL 3MRKA 3HFML 2YZ8A 3KXFD 4GKZA 2MCPH 1T1XA 4ZUUA 1JHKH 5C6WH 4KVCH 4HX1B 4RGOL 2DIBA 3QAZC 4UT6L 3VW3L 4URTB 5C70A 4JZOB 4M5ZH 3W5MA 3GO1L 2M2DA 1YQVH 1F90L 1TFHA 4NO3A 1K2DA 1C16A 3MCLL 3NMEA 3HNSL 4QHNB 1XH3A 1P2CB 1WBYA 5FDYA 32C2B 4NJ9H 1YMMA 2MNUA 4PLNC 3ULUD 3LKSB 1MAJA 3JVGC 4EZMA 3GBMH 2W9DL 3UBXB 3SY0B 4XPFH 3V2AR 1X5XA 4NRZB 5ACZB 1GGCH 4HS3B 3GZKA 4GRLB 4JRYA 5JW5A 4F57H 5MEPB 5IWLC 1ZKAA 1CICB 4LRNL 2X4TB 3MLZL 1KXTB 5ACMA 4JM2D 4M7LT 1B6UA 3MRNA 1BQLL 3DI3B 1IBGL 3B6SB 4MJ6A 4YX2L 2B5IC 4WHCA 1RU9H 1EX0A 5DWUL 3KPRA 1T1ZA 1P7QB 1YN6B 4R2GD 4Y1AD 5EZIH 2YMXL 2I9LA 4XTRD 4LCWE 4AMKL 3OMZA 2P24B 1FL6A 3HZMA 1IM9B 3TN0D 1G7JA 1FO0H 4KAQH 5GRVK 2NXYD 3BIAX 4CVZB 4FXKB 1XIWA 1FORL 3RY6C 4OLZL 1HHGA 1AGCB 3UTTA 5GRUH 1BFTA 1OGAB 3VFPA 3WE6B 2AJYL 3QQ9D 3E1F1 4XVUD 1ZEAL 3BRGC 3J7HA 3SOBH 2HLFC 5DRWA 3QIBA 4IM8A 1JPTH 2FSEA 5GPRA 1RJZB 1OM3H 1OL0A 2Z8RA 4GRWH 4IJ3B 3ALWA 4TQEH 1S5IH 4ZSOB 3OHXA 5EU6E 1FL3A 4OLUL 1CFNA 4JCMA 4MAYB 5CAYB 3GKWH 4MJ5A 3NA9H 1SYSB 4NKOB 2CRIA 4JCLA 3RZCC 5EIQA 2X4OA 2FJGB 5GGSB 1PQZA 1X5YA 1FC2D 5IHZB 1U95A 2VNCA 4MWFA 4AZ8A 3JWDC 4QHUB 5E94A 3FTGB 3MMEA 4ELKB 5DJ2A 4S2SA 1H5BB 2Y72A 5C07B 5CP7A 4ONHA 3CSPA 2GK0B 4BQBA 1P4LA 5IB4A 2XICA 5K9QI 3MRRA 4JLRB 4WU7A 4ZOCA 2G9HA 5C9JA 1T7ZA 5IW1B 2BVEA 3VXRE 1HILB 5FO8B 2IFGA 4HJGB 4YHIB 3RVTC 3T2QA 3KLAA 4K23H 5H2BA 3X3FL 3L6FB 5J57B 4PJDE 4JFHD 4U2ZA 4U4BA 3QFJE 1T80A 1J8HE 4KY1H 4PS4H 3T65B 1NAKH 4WGVB 1U8NB 3L3JB 5F89B 5CHNB 4X6FA 1EEYB 1ZLVK 3QI9B 3S35L 4X7SH 5C0GA 4DQOH 2VITB 2AP2A 1HYRC 1U3HB 3DV6B 4OSUH 2LU4A 3HZYA 3QA3A 3C60B 2GI7A 4Y7MA 3S34H 3RZCA 1C1EH 1D9KB 5JPNB 4LSTH 3W0WE 4LHUD 1SYVA 2HFEA 4AENA 4F9LA 3MRLA 4JZJC 1UWEH 4LOUC 4XVJL 1G7MB 3O41B 1ZT7A 3VFSA 3E3QC 3H0TA 2HVJB 4JRXA 1UVQB 1TQBC 3UTQB 3KYAA 1NGPH 2W60A 5C09E 3WDJA 4U1HA 2DF3A 3P4OB 4HG4J 3DTXA 4WO4C 3CNKA 3EO0A 2DQCL 2WAHA 1U8QB 2R15A 5DJDA 3HC4H 4ZS6D 3X14B 4O4YH 6FABH 2GSGB 1ADQH 1WIOA 5EBLA 4QRRD 2W0FB 5FO9A 5ESVA 1HOCB 3DARA 2JKXA 5L2KB 2MCPL 4NQEA 3MJ7B 4C83B 4KUZH 4U6VH 2VQ1B 3VI4F 1N3NA 1IILE 4LSQH 3KPSB 4FQXC 2BMKA 2C1PA 3CFCH 3FJTA 5FUZH 1ES0B 4EDXB 1EJ6A 1SEBA 4GG8A 3ZYZA 3U9UB 5DEZA 3LRSA 1A5FL 4MXVF 4F7PA 3FT4A 1ODAA 1PLGH 3FRPG 3I9GL 4V1DD 4DW2L 3L5HA 5I15H 4UT7H 1D9KC 4NM4H 5E00B 4PGZA 1I7UA 4JAMB 3LEXB 4G5ZH 2VMFA 4HH9A 5IB3A 4HFUL 1GPOL 1DBJH 1BD2D 3BT2L 4MD4B 1QVOA 3V52L 1NBZB 1NGQL 4DAGH 5A2JH 5E8DH 3P4NA 4JQVA 4AG4H 5DTFA 1NAMH 1NDGB 4GSDL 4G9FA 2O93L 2CXGA 4U1SB 5EOQL 4PGCA 4CUCA 4PRDA 2N4IA 1BVLA 5DEFB 3QJHA 5JXAL 4HUVB 4EUPA 1PJ9A 4LEXH 1FFRA 3C2AL 5KW9H 4HGKC 1J18A 1NAML 4RAUA 3OKNB 4XCNA 5L2KA 2LTQB 1GGTA 1AP2A 2D7MA 3WFCH 1TVHB 2JCCA 4HWBA 5C0AB 1EJOH 2P1YA 5D1XB 3O3EA 4HFUH 4IIQC 4X7CC 3T77A 2V17L 5DGRA 3ARUA 1XGPA 1JPGB 4K2UH 2CLVA 5BV7L 3WIHL 1N5YL 4QTHA 1GOFA 3P11L 1T3FB 4C56E 3C6SA 3T1FB 1K4CB 3HR5B 1LE9B 1P84J 1TJGH 1YEIL 3SDCA 5D1QD 1N0LA 1U93B 2DBLL 4J3TA 4NQVB 1KCRL 5L9DH 1EBPA 1JUFB 4NO2A 4WTWA 1QPPA 3MOBL 3V0AC 2BNQB 2B4CH 4C56A 1F5WA 3BP5A 2W60B 1TTUA 2VAAA 3G9VA 5D1QB 1Q9WB 3T1WA 1GYAA 3RTQD 4K2UL 5FF6B 4RFOH 4N0UE 3QZWB 3IRPX 5J12B 3O6KH 4K94H 5BW7A 4M5YL 4ZTPL 4ODTL 5C0CD 5EORH 1QHOA 4D3CH 5IVZB 4JM2C 1P6FA 5T1LA 2XZQL 1CXHA 2XFXA 1IL1B 2X4NB 1MCJA 4M4PA 4GW1B 4JJHA 3B8SA 5IJVB 3V6FB 2F19L 3G5YA 3P9WB 3ARFB 1BBJB 5JHLL 3TJEL 4R0LA 4JKLA 3WD5H 3O2DA 5IB1A 4PGEB 4H0GA 3LHPH 3ARGB 4Q9RH 1AGFA 3MXWH 1PG7X 4WFGD 3NCJH 2AJVH 5GS0H 2QR0A 5IKCB 3ULUC 3S35H 3DVNA 3TESA 3G5VA 3JTTA 2A6IB 2GK0A 4S1QH 1CGVA 1IC4H 5HDQH 1X4ZA 2O26U 5IHLB 2CKBA 1LK3L 3R0NA 5J6HB 2EDDA 4S1SL 5L2JA 4P0DA 5GZNC 3MA9L 3KPOB 5JDSB 2H2PC 5DUBA 2OYPA 1JZ3A 5I18H 5TDOA 1BF8A 3STZB 2ZPKL 3LS5L 4QLRA 4R26H 2FH8A 1J1PH 1PEZA 3LZFL 4XPBH 4MJ5B 4NQDA 3Q6FA 2FD6H 2G60H 4P4KB 1KLFA 3FFCB 4R96B 1N64H 1N26A 3PHQA 3ZKXC 3T0XA 3B4NA 1VGKB 2VDLL 5KSAB 4QRPA 4Q97A 1I85A 5C08B 1XFPA 3DVGA 1OVZA 2OTWB 1A14L 2A83B 4M6NL 4JO2H 2NCMA 2XWJA 3GRWL 2OJEB 3MOQA 4WFHE 5FUOL 3GSNL 4UINH 1Q94A 3DETC 5CLWA 2DJUA 1T03L 3EYVA 1P9MC 5I9QB 1RAMA 3K2UL 3IS0X 5GGSY 3D0LA 5T5NF 2VISB 3LVEA 1XF1A 1BFVL 3FB7A 1TDQA 2E7HA 5AYUH 5TDNA 4M7ZC 3UCRA 4G8FA 2AEPL 1F4HA 3BDBA 4MVBC 3WO3B 2RCSH 5AZEL 1FBIL 1ZVYA 2ICEB 2CLZB 1HKLL 1A6TB 1HNGA 4ZAKA 1Q9OB 3JWDL 3RX8A 1S9VB 2FEEI 4WO4A 4GRLA 3PABB 5JW5B 4P2QA 3RIAK 1CTNA 3AC0A 1TNMA 1N2RA 3LQZA 4Y5YB 5KS9F 4HKBA 1U8NA 3L3JA 3WJJA 3BMVA 4KXZI 2DMBA 1KFAH 1VESA 3TT3L 2Y36H 2UWEA 4RX4D 4OSUL 4I0PD 1PLGL 4OZHB 1ED3A 1I1YB 1KPVB 1HDMB 1UM4L 4LVNC 3RVXC 1C08A 1BJMA 3T0BA 3IVKB 5HGDB 4KZEL 2E7MA 4KJPC 5CIPA 4Z7UE 4LMQI 3QFJA 1JMXA 4AH2A 1KOAA 3TZVD 4BK5A 5C08A 4UILH 2C1OB 2X89A 4JFYA 4HW6A 3S97C 2ORBL 4L3AA 2CGRH 4JFDD 5F71A 1IGIH 1GJIA 4HUWA 3HPLA 1E4XH 2DQIL 2HT2C 3BH8A 4D8PB 1ZHLA 3KYOA 4ZS6C 3PE9A 3ET9F 3RI5K 3W5NA 1Q0XH 3FB8A 3VXPA 2WIMA 3W82A 4X0KB 4G9FD 4G8IB 4OM1L 2V5SA 4O02L 2XTLA 3ZKSD 4GAGL 1I8KA 5IR1A 3OPZL 4DZ8A 5I74B 3CFDA 3K46A 5IEHB 3VWKB 3IGAB 4IMKA 4O9HH 1R24B 1N2RB 3LQZB 2IPUG 5FA4A 4DKAA 2DYPD 2F53A 1K3IA 1KN2L 4U1MA 5KSBE 1MHEB 5IV2B 3BKCL 2PO6D 3DRQA 3TC9A 2OP4L 1D5IH 2V2WB 3ETBF 1KLGB 1TENA 4JREB 1J8HB 3THML 1I3VA 4BFBD 1NGZB 3MRCA 3M8OL 1YEHH 2R9HD 4JFEA 4NC1C 2D31B 2ZCHH 3MA7B 2R23B 2BX5A 2DOCA 1RPQA 4KH2A 3LZFH 3DXAD 4FXLA 1TCMA 7CGTA 3ULSA 4YHLL 3S37X 5GS1B 5HPMB 1CG9A 2C3XA 4K9EC 5EWIH 1H0DB 2H3NA 4LDOB 3V5HA 2HTKC 5ERWA 2VL5B 2VXQH 4I4WA 3H6JA 5C0FA 3WFHB 4GAYA 4Y5VA 1QRND 4MXWL 3UXFA 3DVFA 4Z0BH 3C9NB 3U48A 1F3JB 4DZ8B 4FFYL 5FK9A 3LB6D 4NN6C 4AYFA 4Q6IC 2HFFB 3WS3B 4B7LA 3IYLW 4HKJB 3L5WB 5C6PB 4EVNB 1S7UB 5CBEB 5ID0A 3R8BB 5HD8C 3U46A 1S7RA 5GGRA 1G7HA 1ZWIB 3MFGB 4NC2B 3TF7C 2NYYD 4KJWD 2JIXB 3SE4A 2WM0A 3Q6FB 3Q5YA 3FO0H 1NGYB 2JJSA 4ESKA 5JA8B 4RMUA 4JFDE 3TVMD 3I50H 4NYLB 4OLYH 3T0EC 5I6XC 3QT2A 5GGQH 1U93A 5FDWB 4AEIL 1OAYL 4OCYL 2FEEL 3LN4B 3QUXA 1AQDB 5DJAB 1IAIM 1KCSH 5DJ6A 4PRDB 2FIRT 4YUEH 2FIKB 1NC4D 5GGTL 4YPGB 5TQ2L 3F7YB 4P4RA 4IIQB 5C6TL 4U6HB 2EKJA 3GMNB 5E9DA 1P4LB 2P45B 5KANG 1Z5LB 1NFDF 3ULVC 2R29L 4L1HA 1U41A 1TZGH 3LQMA 5DK0A 4BSVB 4NN5B 1SJHA 3ROOA 2MSPA 1CLZL 5IFHL 5FB8B 3QIUA 5GRVL 3BGFB 4LBEA 3V4UL 2CUIA 3LDBC 3QDME 4DVBB 2IG2L 3WJLC 4QEGA 1G7PA 3S3JA 1C5CL 1EZVX 1JRHI 4U3XA 1R3JB 1PEWA 1T66D 5C0RL 2VC2H 5C0BE 1A7RH 5LAXB 5I2IA 3RAJH 3MZGB 1Q94B 5DHXB 1HKLH 3KPMB 1BGXL 2X70A 1AGBB 3MOAL 1FL5A 4HPYH 2P5EE 4N8PA 5DJXA 3O0RL 4LLUA 1H3PL 3V7MA 1Q38A 5I1KL 5J56B 2R23A 5EOCJ 4XMKH 3HE7D 2ICEA 2QADB 4GXUN 3HUJE 4JO3H 1FV1A 4QXGH 1KEGH 2WLZA 4R7DB 2AVGA 1VGKA 3DX7B 1WTLA 2D7NA 3SGJA 3VXSE 2F54A 4CVXA 4MQSB 43C9B 4IRJB 1I3UA 3V4VL 3T4AA 2QLVB 4NM4L 1NANH 4PJ8D 1NUFA 5IB1B 4Z7UB 3QXAB 5HGBA 5C0IB 4PR5B 2VITA 1DQTA 4RMSA 4S1SH 3O9WA 1MWAA 3RPIB 4KDTC 5DRNA 3NCJL 2CR3A 3JUYA 4PRAA 4XNYH 4G3YH 4X9HA 4JDZA 5DHVH 3QRGL 3NBNA 2KZ1B 1MFCH 3JZ7A 2HWZL 1FAIL 3G5VB 4PRNB 1WK0A 4F7PB 4MQTB 4EBQH 5EO1B 1OSPH 1K8DA 4PB0H 5BZDA 5J1SC 5T3XE 2ENYA 3V6OC 4EJ1C 1FJ1B 1OB1A 1Z0NA 3EFDL 2VDQH 4KTDH 1RUMH 2E9IA 2V5YA 4DCQA 1VEOA 4Z76B 4HWZB 2FZ3A 1GGIH 1U3HC 3QDMD 3NCMA 4Y4HB 4D3CL 3C8HA 4ZODA 5I8EB 3T2NH 3MNZB 3WUWG 1GH7A 1LP9E 2W0FA 2FBOJ 4M8QB 1NMBL 2ID5A 3UO1L 2UVEA 1DBKH 1SM3H 3AREA 4OZFA 3DWTA 5TH2A 2FATH 4XP6L 5MEQA 2NW2B 5FKPB 3ZDZE 4GMSL 2PN5A 3ORJA 2WANA 2VDNH 3IDXH 1I1AB 1H15B 4EUPG 3SCMB 3S34L 2YXFA 4M7JH 2DLTA 5HDLA 3ULVE 4IMLA 1E6OH 1T4KB 3EOBA 5E08H 4LAJH 5D7LD 3O3UN 5L9DL 1A2YA 2BNQD 4IRSD 4D9QE 4GG6E 2ZUWA 1ZTXL 5FYKU 2ED7A 5IB4B 1U91A 2C3VB 3WUWB 1YJDC 4PJIF 4OF0A 3RWHA 3VFPB 3T0AA 4PJDB 4PJ9A 2DWEB 2IQAB 3T8XA 2ICCA 3TT1L 3C6LB 4R3SB 4LNRB 5IK3A 3STLA 4K7PX 2JJSC 3NCBB 1AH1A 2BOCB 3GJFK 4XAKE 3MCKA 2X70B 2VO5A 2DIAA 1URLA 3WFCL 2Q6WB 4WCYH 1HINL 3H3PL 2DWDB 1T2QL 5J11C 3QXUA 4LRIA 3MNZA 4F7MB 1D5BA 5EU6D 3OB8A 1A6ZB 3WKMH 5KVEH 4JPWL 1INDH 3P73A 1QYGH 4Q6IA 1H3PH 5FCUL 4D0CA 3JV4A 2HRPL 3VFNA 3JXAA 4M6NH 3TEUA 1JBJA 1A3LH 4DK6A 1A1MA 3B3IA 1X3DA 5DFVC 1EFXD 1UKQA 1FYHB 4X4ME 4U1GC 4KKLC 4MNGE 1WCBB 4BQ9A 5I0DA 5JW4Q 4CVZA 1XGQA 5CEZE 4Q2ZB 2GYSA 4AT6B 4K71B 5SWZB 4NSKB 4XP4H 4XMPH 1LP9A 3LN5A 5CZVL 3QWOB 3SDYH 2R1WB 1I8LC 3IT8D 5HXMA 1U42A 3WFHA 4PRAB 1FP5A 32C2A 3WNLA 4Y16A 1TVBB 3ULVF 2F58L 4B5EA 4KDTA 2R29H 4Z7VB 2D9QB 2GJ6D 4ZD3H 3IRZA 2BFVL 3V5KA 2UYLA 4P4KC 4E0RB 1A7NL 1FAKT 5E08L 4GRMA 4RGNC 1C7SA 3NACL 3WXVH 4Z7OE 2JJTA 5FO7B 5CJXA 2C1PB 2VLMD 4FQ1L 4X98A 1U95B 2GY7B 5D7KD 2XN9D 3F12A 5D72H 1BOGB 5IF0A 1P69B 2F9BT 3EYUL 1DANT 3QULB 4Z7VE 1EPFA 2EYTB 4WJ5B 1V3MA 5GGQL 5F7HA 4FS0A 3DX7A 5I1AA 1WC7B 4HK0B 4KI1A 3LB6C 5HYQA 4RNRA 2GY5A 2IJ0C 2QSQA 2C4FT 1DN0A 1IE5A 2UY6A 2LU3A 3HI1B 5D8JH 5D70L 4JFFB 1IZJA 4WTZG 4KZDL 4I5BB 5DT1H 4KI5E 4JG1L 4P3DB 5L8KB 2Z35B 1MRDH 3OAUL 1RHFA 3KNBB 2NXYC 5EOTA 4P59H 1JPSL 3MACH 1QG3A 1NCBH 4OGYH 1RZ7L 2B4CL 2EIEA 1KJMA 5FM5O 1MREH 3D0VB 4GH7B 4M00A 5T5FH 4EDWH 1NFDA 4LPXA 1M71B 1T2XA 4QRQB 1F90H 3QRGH 4Y4KD 5F70A 4XNMB 4LEOB 5F96H 1ZHNA 3RKPA 5GS0D 1K6QL 3F7PC 3MRLB 4PJIE 2O5XL 5CFHA 3VFOA 1ZT7B 3VFSB 1MRDL 2HKHL 3OAUH 3VXSB 3MLVH 3A0OA 4PG2A 2OL3A 3GMMB 1D6VL 4GQ9H 3TJHD 2AQ1A 1ROWA 1AQDA 4TUKL 3RDTA 1S7XA 1JE6A 1T0MB 5F9JA 5IMOB 4OCNC 5ICYB 1S7WA 3QRFM 1BQHA 4ZOEA 1PKOA 1IAIL 1A22B 2E27L 3OX8A 3F7YA 4P4RB 4LVOB 3CH8A 4YC2C 1A7OH 1UWGH 1YECH 3FOMB 1JNNL 5CJOL 4EOWH 2ZUVA 5DD1H 3DMMD 4HV8A 4R8WH 2BNRE 3U30B 4NUGH 3IDYC 1BM3L 4RNRB 1QHPA 1JWMA 1XGYH 5D2NA 3JTSB 5D1XA 5C07E 1NGQH 2CKBB 4Z76A 1XR8A 3J8F7 4G9FE 4OGXL 1MFCL 3MYJA 2Z4QB 3BPLC 4KK5D 5KZCD 4LFHG 1KTRL 1XGRA 1T6VN 5T33H 1WZKA 3KHQA 1Y18B 3IDJB 1U8IB 5FOBB 2ICWI 4Z7VF 1FZKB 1OTTD 5LGJB 1A6VL 2F8OA 4LQFH 4YHYB 5FDWA 4RAHA 1IAOB 1NL0H 5BXFA 4DTGL 4QHKJ 3IVKA 4LLAA 3ABZA 5LVEA 4Y1AE 5EU4A 3K0WA 2XTJE 4PJBA 5LGHL 1KJ2L 3CFCL 2O5YL 4Y16C 1YY9C 4L9DA 2WQRA 4K3DL 3QIWA 3A6BL 1T21B 4OCRH 4PJ9D 5CP3A 4KMTL 4XP1L 5JQ6H 1BQLH 4QRTB 4WU5A 5FA3B 3QCUL 5MENB 2J5LB 1IGCH 2EYSA 4C58B 1MLCB 3OKKA 1A64A 6FABL 4PB9H 1MH5A 1CIUA 2V5MA 1DR9A 1H3UA 5DQJB 2CDGA 2CKNA 1KBGH 3HUJF 1NKRA 3PNWB 1UM6H 1JGVH 3OKLB 4JHBA 2VLJE 2JB5L 3HE6D 1J1XH 2CXKA 2ZSWB 3ARGD 3V4UH 1NDMB 4CU8A 3BPLB 2YN3A 5J13C 3BP7B 3CLFL 3QDGA 2W9EH 4XC3L 3BWAA 4G8GD 3RTQB 4YDVB 1G6RL 2P8PB 4IMLB 5C09A 3DGGB 3VI3F 1OAZH 4NM8L 1Q9LB 3T4YA 4PB9L 1GZQA 4O5LL 3VMPA 4LSPH 5C0CE 1UM6L 1A7PH 1A1OA 2XN9E 1PG7L 1S7QA 5I8KH 5KSBA 4XNZB 3TN0C 3BE1H 5HGAB 3NCEB 3MLRH 3UPRB 4ZSOE 2JIXA 1FVDA 2FX8H 2M26A 3RY4A 1OP9A 2E3VA 1T04A 4Y4HA 1IT9L 3EYSL 3MREB 2CR6A 5I66B 1TETH 3T0ED 4J23A 5GSVA 2B1HH 1KYOK 4JFFA 1XF3A 1UB6B 4G6KH 1OTUD 1WAAA 2Q20A 2J8HA 1UKSA 2CUHA 3FOMA 4P23D 1ED3B 1KPVA 4FQIH 3BZFB 4P46A 1YA5A 4CVWA 3L3KB 4RISL 2D03L 3SDYL 3IFNH 1KC5L 1JGUH 3AREC 2ZUTA 2K7PA 4OLXL 1ERNA 5J13B 3RWCA 4K3HA 4NP4L 2FECI 1X9QA 1BOGA 1WBZB 2IADA 3VXNB 1BIIA 1IC1A 1FAIH 2VN4A 1MFNA 3PNWA 2GCYB 4N0CC 2CLZA 1KN4L 1F3DH 1LP9B 1S5IL 4G3YL 2NY2B 4TQEL 4NP4H 3QCUH 1BEYH 5HYQB 4KQ3H 2D31A 2R0LH 4O51A 1L6XA 5FUOH 3V6ZB 5KVFL 4CN1A 1YPZB 3VFRB 3O8XB 1ZV5A 4QHUA 3PHSA 5E94B 1I8IB 4OQTH 2VE6A 1U8PB 5DUPH 2PYEE 3H3PH 1T7WA 3ESVF 3MBXH 5E2VL 3ILPA 1MY5A 1HH6A 1ND0A 1WEJH 3HAEG 4LP5A 4JQXC 1HCFX 1O7SA 2B8OT 4IRJD 3WJLA 3NFNA 5I18L 4U1MB 5FA3A 4P5MA 4P2RB 4LLYB 2UZYB 4YHKL 1UC6A 1A3QA 4Y5XA 3QR2A 4FHBD 5B8CA 4RFNB 3B83A 3VI3E 3LAFA 4U33A 4OCMC 2WBJC 3D0LB 1JVKA 2VQTA 5GGUB 2VDRL 3L3DA 5EBLB 4OGAC 3B5HA 4PJDA 1QQDB 2BSSA 3RQ3A 3WXWH 5LBSH 5A43C 4EDWL 3NIFE 1MI5A 3TBWA 3IJSA 4LCUA 1KB5L 4RBPK 1WISA 4NKMB 1T0MA 4WHTB 3WDIA 4YGVA 4OGYL 3RHWK 3TBYA 1MVUB 3QZWG 3RY6A 2D7QA 4EI6B 4FQHB 5F9OH 5BJTB 3BDYH 3QO0B 1CI5A 1G7MA 1KELH 3N1MC 1MHEA 5IV2A 2ED8A 3K8MA 5EU3A 4AEHH 3O2DL 1HNFA 1UB5B 3S36H 2OM5A 5IVZA 1BFVH 5I16A 4MNGB 3SO3B 5ILTH 2FDBP 5E9DE 3ZT5A 2A1WH 3NIGF 1ZA6A 4HT1L 3VJ6B 3GO1H 1TIUA 1S8DA 1PFCA 3S5LG 2Y07H 1EMTL 3DXAB 3WFBL 5DUMH 4BUHA 4GXVH 4GSDH 2LAAA 2ZJSL 4X6EA 1FFOB 4UDTB 3S88H 2FZ3B 2GITB 1S9WA 4PTUB 2VXSL 2J2ZA 3OKDB 1Q9OA 3EDDA 4P99A 3ZDXF 4X6BA 2W07A 1AXTL 3CFEA 1J1PL 4IRZH 3QI9A 3Q1SL 1XF2B 2ZNXA 4ZFOL 4JDTH 5JTWA 5EZLB 2HJFA 4L4JA 4XB7A 1JNHB 1HIMH 1ZLSL 5JQHC 5KJRL 4IEFB 4Q58C 5C7XL 5JW4R 4I3RH 3CFKA 3NABH 3WL9B 1DSFH 3EDKA 4OBSA 1F3JA 2Z8WC 3AS3A 4RGNB 3QHZL 3TJHC 4XCYB 3RJDA 3C08L 4JFFE 2G9HB 4ZS7L 4KKLD 4LVEA 4JO3L 4OGZA 1E4JA 4Y2DD 4WIQA 2YHGA 4PJ9B 3TJEH 3K81A 4YGVB 3R06A 2JTDA 2NY0B 2P49B 2Y6SD 5IB2B 5FUCE 2B7DT 2G60L 1IQWH 4HWBL 2P7TB 4QF1A 2VISA 5E8DL 2PW1A 4K3DH 1Q1JL 4OD3H 1G0DA 4Q9QH 3GMRB 1IC7L 4XP5H 1KCUH 4AM0A 4M5YH 2E9JA 1MFEH 4Y5XB 1WJ3A 5DJ0B 2D0FA 4QXWA 3P9MB 4HV8B 2NY6D 4MMXC 4N0CD 5CBAB 3HNVH 1RZIA 2Y5TA 3X12A 5IVOA 4CMHB 4Z6AT 4Y5YC 1OGAA 2X05A 2FGWL 3SDDA 2QKIA 3CUPA 1F58H 1MFDL 4O58H 4XCCH 3KS0J 3ARDA 4POZD 4F58H 3X11A 1N6VA 4MD4A 5C9KA 1YEEH 4DGVL 5GXBB 4X4XA 1HHHA 4TVPD 1YPZA 4X80L 3LS4L 2MTPA 5HYFA 1FRGH 1D9KD 4WFED 3CLEH 5ANME 2WZPD 5FOBA 1T1ZB 2X6MA 5MHSE 1MCPL 2X4OB 3JUZA 3LEYH 3WKML 4C83A 1KGCD 1MIEH 3IDIB 2WWKO 4XP6H 4GW4A 3FB5A 1F4YH 2LVCA 1XCTA 3CK0H 3FQRB 1QBLL 4BZYA 2DQCH 2BCKB 3RA7L 4G80B 1Q0YH 4H0IA 3LEYL 15C8L 2R4RL 4MNQA 4MAUL 2J88H 3K4AA 3ROLB 1S7QB 4NQCA 2DQJL 1MCEA 2C7UB 2HFGH 2NY4C 5D9SB 1F8TL 4LHUG 4Z7OF 4AM0B 4R4NC 1GIGL 3MNWA 4GW1A 5FM5M 2J8UA 1D6EB 1MCPH 1JYWA 1FZJA 1U2CA 2EDRA 1A6AA 5CJQH 4RGMB 1XGPB 1U92A 1DQQA 1T7VA 4UMGA 1U8LB 1UB6A 5EZLA 1A7NH 4CDGC 4FFWC 3HZVB 3Q3GB 3S5LA 1NDMA 1DE4A 3ULVL 4FNLH 3MRJB 5E4EC 4Z7WB 2E6QA 4JZOA 4TRPL 5C0GB 1NGWB 5KANI 2ZUSA 1YC8A 4MJIA 4RCAA 1KTLB 3ZE0E 4I0PB 2C1OA 5HHMD 5KSVA 5JPNA 2W0KA 4PJ5B 4Q9QL 1UG9A 4RAUB 5MEQB 2ICWB 4PJHB 1J0ZA 4MB4A 1G7HB 2CRZA 3BMWA 1GZQB 5JDJA 5TJWK 3DUUA 5JORB 5MERA 2R0WL 3UTQA 3RGVD 5DUPL 2XYCA 4BH7B 3NPSC 1WBXB 5ENWB 1LEKB 5AG9A 4XRCA 5C9JB 5EUKA 1HHKB 1CLYL 4YFLI 2J12B 4XCEB 3MBEA 4G6AD 4KUCF 3HAEH 4DCQB 5E2UH 3H2WA 1ZK9A 1DQJB 1A6WL 3THMH 3ZKND 2VDMH 4NRXA 2HT2D 1BGXH 5D5MB 1BP3B 5B38A 5JIKA 1EVUA 4P9ML 1VENA 1EEYA 2OP4H 3MJGX 4LCYB 4K7FA 3RVVC 5ICXA 3VGBA 4IOIB 5CS7A 3NGBB 5D96B 2PTVA 4GKNB 4CN6A 4YHOH 1AJ7L 5FYKH 3L5WA 1N5AB 1U58B 2PYED 5IW6B 2QSCL 5FHBL 2XKSA 1KLGA 1CGTA 2OTUA 4ZD3L 3ARED 3PHOB 1U8KA 1ZLWK 4N5UA 4GG8B 4PRHD 2AXGA 1DQLL 1VFAA 2EKSA 1QSEA 4XNQB 5DMYA 4OF6A 3DSFH 3O2WL 4LKCB 3X11B 1TZGL 3WHE0 5ANMA 1Q72L 4Q6IB 4ETQB 2YD4A 5FO7A 2YBRB 4J7RA 4IBLT 1DVFC 3SJVE 2FB4H 1AIFB 3UJJL 1UT9A 1JGLH 3ZHLA 5KTEH 5TE7H 5EZIL 2MJWA 5GGVY 2FL5B 1IM3B 4LSQL 4KKAC 2HMIC 1MCIA 1I8IA 3PIQB 5TQ0L 1ORSB 4NQXA 1OPGL 1JJUA 1PG7H 1I1AD 5DUML 3D39D 2YSSB 5HHPB 1P7QA 1YN6A 2BMKB 5FK9B 1QFPA 4Z5RB 1JK8A 1N3NB 2NY3D 4BQCA 3O3AA 5E2TH 1JF6A 3MRIB 5F7DA 3T2PA 2R4SL 4K7FB 4P2RA 5JOEA 1K2DB 1SY6H 3F6IA 4XMLL 3KJ6L 1CYGA 4HUUA 4P5MB 1UZ6F 4OV6F 5M7QA 2OMNA 3Q2CA 4QCIA 3SKMA 2HYMA 3CPLB 4KKCC 3VFNB 1QLEL 3L1OL 2YPVH 1H15A 2GITA 5ALBH 1GL4B 5B4MD 1B90A 1WUNT 5D7JB 4K8RD 3UBXA 4Z77A 3LPGA 3K3QA 1QNZH 1G9NL 4EKXA 1F00I 3I6KA 3OGCA 1HEZB 4N1EA 4O51B 4JFOB 4MQXD 1NCNA 4GKSA 3UROR 1U3HD 3MV8A 1XAUA 2XZCL 1L0YA 1AHWB 5TDPA 4LIQE 1FH5L 3GIZL 1GHFL 1Y6NR 3NZHH 4LNRA 1NAMB 5IK3B 1MCFA 5I73B 1I9EA 5BJTA 2VAAB 3MJ6A 3MBXL 4XT1C 2HT3D 4NO5A 4XPBL 2Q8BL 4MXQC 4HBCH 2P5EB 4J3UA 1B0GA 2BOBB 5I76B 4LLVA 1DUYA 4MA1C 2FJHA 3T0EB 3RWIA 5DD5L 5GGUA 5AG8A 4EIGB 2BRQA 4KMLB 5L0QC 3UPAA 2Y06H 4KFZC 5BMFH 4ZDHA 5FEBA 1INEH 1KULA 2HVKB 4UV7H 1UZ6E 4NNPL 4ZG1A 2QQNH 2NY2D 4OLXH 1BVZA 1JHTA 4X83A 4LHUB 2OX5A 1RD6A 3ZYJA 4APQD 1H3XA 3HC0A 4UV4L 5BS0E 1KN2H 4RA0C 2F5BH 3PGDB 2VDPL 4OM1H 4PLKD 1Y0LB 3QFJB 1RK1A 3N1QC 4OUOA 5D7KE 1DLHB 2DJ4A 4G8EA 3B9DA 3ARPA 4U3CA 2QSTA 2R1YA 1T2JA 1C5BL 2AEQL 4LP4A 4N9OB 5C0JA 1V3KA 3O3BA 2ADJA 1QSFB 1EAJA 3O8XD 4PJAF 1FO0L 3AROA 4BKLB 5GRJH 5EDXA 5JOPD 5IB3B 1YY8A 2I26N 2B1HL 4M1GL 2HJLA 2XFXB 4KUZL 5JLZA 4ODHH 2OQJA 2O5ZH 1FH5H 3WCYA 2UZXB 1GZPB 5DRXA 2CDGB 3VWKA 1T22A 2YPLD 3VFGL 5MI0B 5CSBA 4Q2ZA 3LQAH 3TYGL 3BPNC 5EUOE 4KU1A 5DI8A 5DSCB 3QDJB 2VLRA 1OAYH 2PXYA 4OCYH 5T5FL 3RBSA 3H9SE 1G9MH 3B3IB 3VG0H 1P6AB 3GFUA 1AKJD 5BRZA 1CS6A 1F4XL 3FL7A 1U91B 2C3VA 3ES6A 3WUWA 2Q8AH 2NX5B 4OFYD 4QWWC 1NEZG 3QAZB 4QYOB 3QUZC 4EI5A 3CUPB 2RAMA 3VXSD 4XRCB 3VG0L 3H9SA 1BD2E 2IH3A 4L4TA 1KCLA 1UEMA 3MRPA 4MNHB 1MRFL 3GRWA 1CVSC 1I7TB 4JB9L 5E2JA 1FNHA 3S96B 3G08B 1MHHA 3MRFB 3JV6A 2DTML 1M4KA 4YIQB 1YNTA 1CF8L 4PJIA 1CICD 1RUQH 4X7TB 1RULL 3MGAA 1DFBL 4I18C 4X8JA 1S9YB 4RFEB 4QF1B 4YHKH 1QFOA 2BSRB 1GRWA 4RGND 4K9EL 2ED9A 3O2VL 4PFEA 1NMCB 3MUZ1 2P5EA 4NQDE 2AXFA 4D9QD 3REWB 4L3ED 5D1ZB 4EUPB 4GLRI 2ATPB 4NWUL 1HYSD 2DAVA 5MEND 1FJ1A 1OB1B 2VOTA 4M03A 3HPLB 4M1CD 5DSCA 4LLDB 2MOVA 3OX8B 5I1JL 2X7LB 4DVRL 1KPUB 3D1MC 3L3IB 5TF0A 1YZZA 2YPLE 4QGTA 5HHNB 3WMSA 1CFSA 3B9KC 4Y5YA 4AL8H 2WUBH 3VG9C 1FCCA 1GVIA 1HSBB 1IL1A 2YUXA 3OGCB 4D9LL 3ZDZF 5FM4A 4JAMA 5HDQL 2CSPA 4R4BB 3QXAA 3RWFA 3S4SG 4OZHA 2YEZA 3I6LD 4FFZL 5DMKA 4G6JL 3N85L 4ONOA 1CGSL 1SQ2N 2MCG1 1V5JA 1UQSB 1KTLA 4LSUL 4R0LC 1IGML 1NBZA 5E56A 1LD9A 2NX5A 1NLDL 2FHBA 3QHTC 2WWMC 2R0ZL 3G6DL 5E6IC 4JO2L 4KRPB 1A7OL 1UWGL 4Y4KC 3HR6A 5FV2A 3D3VB 4MNHA 3VRLF 1NH6A 4MSWA 1NSNL 5IMLB 1R5VB 2AK4D 4JM2A 1AGDA 4JGUA 5HHOB 2Z31B 5FO9B 4ZQKB 3LRSB 3M45A 2J8UB 4LGPB 3CH1A 1YNTB 2AI0H 4M1DH 3OQ3B 3DECA 3W81A 5D93B 4NKQB 3DV4B 1C7TA 4LSTL 4DOHE 3WE6A 2QTEA 5ERWB 3TN0A 5IOPB 3QXWA 3ARFA 4Z78A 4H25B 3BGMB 3JSSA 3C60D 1HZHH 2BJMH 3O4LD 1AO7D 4QYOA 1U8IA 3G6AA 4M6MH 5DURB 2XA3A 3RIFF 1KFAL 4WW1B 4B53A 3TZVC 5BV7B 5D8JL 5ICZA 5AAMA 3L9RA 4JFYB 3ULUL 3WIFA 4OKDA 3VDBA 3FFCD 3VGGA 1FVCB 4PGBA 2AABH 5GJSH 3QQNA 1ZLVH 3NZ8A 5C86A 4HFWA 4O2CA 2NY3C 3SDDC 1G7QB 1IGYA 2GJZB 4GW5A 5HYSB 1DQJA 1H8OA 4Y4FA 3QFDB 3EFDH 3MV9A 5CMAA 1A3RL 2BNRA 5D2LA 4PJ5D 2IH1A 3LKRA 1BMGA 3SJVA 1I9JL 2FR4B 4QTHB 1DBMH 4ORZC 4WY7L 3MLWH 3N85H 3MXVH 3BZ4A 4X7DC 4U2YA 5ADOH 1YMMB 3N9GL 3I6GB 2WBWB 4AJ0A 4O2EB 1T7XA 3FB7B 3JWOH 2R2EA 4D9RD 3SE3C 3PWJA 3L7FA 5AAWA 1RI8A 5L8LB 3MNWB 1VCAA 3DSFL 3O2WH 2QSCH 3OHXB 3QH3A 4XMPL 5HJ3B 3MROA 3QQ4A 4PJ8B 3GHEL 1LNUB 4JZNB 4TRPH 1FORH 3VWKD 4MJ4A 1SVZA 1A1OB 4NQVA 3JV6B 4MDJA 5ADOL 2ADFH 3CVHA 5IIEA 5IT2L 4PJFF 5CJBA 1EEUA 3IU3B 3AU1A 3NIGE 5BS0D 4U6VL 2NZ9C 5IQ7L 5ITFA 4XVTH 4MX7B 2XZZA 4Q9BA 4PLOB 1P1ZA 4QRSB 4YR6B 2VLJB 4OFYA 5J1AA 5GSVB 5JNYB 4YDIL 1OY3B 1T7YA 3AS1A 4XC1L 3P77A 4H1LB 3ES6B 4ZPTA 2HFGL 5C0AD 4RGNE 2XWBA 1NC2A 1IEAA 3SGDI 2AXJA 3SJVB 2VZSA 2A73B 4RX4A 4IDLA 3G04B 3UTTB 3RGVC 3D85D 3K8LA 2VQUA 4R4FH 3VXQB 2X1PA 1YEFL 1CZ8H 5J06A 2X4TA 4YPJA 4RFOL 1RK0A 5IOPA 1WZ1H 1RJZA 3WNOA 3H3KA 1O5DT 1JYVA 1KIUA 3IKCA 4IRSB 1QBBA 3SDXF 1ZVHA 2VSCA 2R2BA 3TIDA 5HPMA 4CVUA 2NY3B 1BLNB 4HKXA 4EN3A 2XOTA 3N9GH 2VKWA 1W0VB 1GGBH 2BY0A 4P4KA 5C0DA 1QVOB 4PS4L 4OAWA 1P5UA 1MREL 1G6VK 2B39A 3OKEB 4J1UA 1CL7L 1U8KB 3PHOA 3VRLE 1KXQE 4Z18A 3CSYB 1EMTH 3WFBH 2WSKA 3HG1E 2R2HA 1M6OB 1J8HA 1OW0C 1SM3L 4JHAH 3O45B 3UC0H 4OFDA 3CK0L 4M9PA 2F74A 4XH2B 5C07D 3AU1B 2CO6B 2XWBB 2HJLB 2PO6A 2R2CA 1BZQK 3QIBB 2JK5A 4JO4H 4NQEB 5I71C 5DYOB 4U6XB 1YPZE 3BZ4B 1U8JA 3ZSSA 3D39E 2YD8A 3MGOB 4PP1D 2Q86A 1DN2A 1R5WB 1I7ZB 2E9WA 3L7EB 4L3CB 5SWZD 4WV1B 3AB0B 1YEGH 2QQNL 3HZYB 4X6BB 5FHAL 3H7LA 4J3OC 1W72H 4HWNA 2J6EH 3PABA 2K7QA 4LCCA 5DHVB 1HXYA 2BVTA 4I1NB 5IESL 4LLUB 2B2XH 5ISZB 1FGVH 1OM3L 4NRYA 5EO0B 4PYGA 1X4YA 2ZSVB 3W9DB 4K3EL 4WHDA 3FONA 3T08A 3NOIA 1QLRB 5D1QA 3DLQR 3P30H 5E99L 2A9NL 5DHYB 1IKFL 4OCWH 4YHLH 3Q1SH 4R4BA 2N56A 2CK0L 2FNBA 2V5RA 3QEGH 1W2KT 3SDCB 1EUTA 3GK8L 3T3PE 3QQ3B 3RWGB 2EO1A 4HMCA 4YDVA 3ALPA 4JDVB 2MKLC 4NBZB 2DQEL 4Z95L 4QXGL 4R90H 3U4BL 3PGFH 4AMKH 5TH2B 4JM4H 5T1MA 5I1LA 5E2UL 5CD3B 5FCUH 4LEXL 4NBYB 3A6OA 4OT1H 1BEYL 2ATPA 5K9QG 5INCB 3TLRA 4WW1A 1MCOL 1PY4A 1QFWL 1PKQE 5KS9E 2PUQT 5DD3L 2M8XA 4WW2A 1UENA 1G9NH 4LSDA 3L7EA 2DM3A 2WINB 1LEGA 3VXMD 4RQQA 4PJEB 1XF5B 1NMCC 1RUPL 3FN9A 3WS3A 3DURB 4WHTA 1A9EA 4WFHD 4G5ZL 25C8L 3M17B 2B5IB 1PKQB 3CFBB 1T1WB 3GBML 1AXTH 1YYML 1AGEB 2N7AA 4X7EC 3BGMA 3EO1A 5LWYH 3TH4T 1SYSA 1A7QL 1AIFA 1MY7A 3NA4A 4ZO9A 5DTFB 5LBSL 4PRPA 4DZBA 2WBJB 5DFVD 2RGSA 3WN5B 2VXVH 2X1XR 5HI4C 1E4XL 5GS1A 5L0QB 4LLWB 1JHKL 5BS0B 3KPMA 4ZUTA 4K55A 3QIUD 3SEPA 1EFQA 1QO3A 2OLDA 4XH2A 4PG9B 5GRXG 1CF8H 1XF4B 5FYJD 1MCDA 5BO1H 4P3CL 1MCWM 2IBGA 1W0YT 2OR7A 2EYSB 3BPNB 3O8XC 4V1DB 3X3GH 4KC3B 5GZOC 3PWPD 5E2WL 1HN1A 1NCWL 3MBEB 4F7CA 5IMMB 1MVFA 4FQCL 3F58L 5JLZB 4ZDHB 2IANA 1TXKA 4GRLC 3IETA 4PV9A 3T65A 4UV4H 4HKXB 1L9MA 3CVIH 3RNQB 1S7SA 4HBQA 1X7QB 3UZEA 1B88A 1YNLL 3QWQB 4EEEA 2YKLH 3DMMB 3HG1A 1IGJB 3UTSE 1RZIB 1YEKL 1MWAL 4UUJB 2XIDA 5E03A 1TITA 4XPHL 5C1MB 3F62A 1DVFA 1IGFL 4UAOB 3VWJB 4NHUA 3D85A 1FYTA 1V7ML 3L5XH 4ELMF 2ZWLT 1UA6H 4RISH 2A0LC 5E0QA 3CC5A 2YZ1A 5KSBB 4TN9A 4MHHI 1DBAL 1NCCH 2XPGA 4J6RH 1FNGB 4M62L 3DBXA 2EXYD 4NHCL 4N0YH 1MI5B 4J3XA 2LV4A 5I17B 1UXWB 4PJFA 8FABA 3S7GA 5IM7A 1BD2A 4JPVH 1T04B 2IMMA 3RU8L 5F7KC 5C0CB 5I1LB 4OBRA 1U8JB 3WJJC 4L3EB 5D1ZD 5F89A 2AEWA 4J8RA 4XNZC 1E4KA 3TN0B 2E8YA 1JV5B 3H7BB 3CMOH 5D2LB 3RX7A 1B4RA 3CDGB 5JO5A 4I5BA 1VEMA 4BQ6A 1MEXL 4L4VE 4LCWB 3QO1A 2ICWJ 2NW2A 3B2UD 4RWYL 2VLRE 4UIMA 3U9PH 4I9WD 3P0YL 1JZ2A 4RRPG 4DN3H 5F7EH 2EO9A 2NZ9D 1RVFL 4LCIL 4IDJL 2IFFL 5AEAA 1WFOA 5TE6H 1ZHNB 1MLBA 3GSXB 5F88A 3CDYA 3MRHA 4JHWL 4HUXA 4I77L 1HIML 3TV3H 2H32B 5LG1A 4ZFFA 4MNQE 2Z91A 4HWEH 1JZ4A 3FN0L 1G7IA 1IC5H 3MV9B 2BC4B 5ID1B 4TTGA 5D7LA 4OCXL 3EYUH 3BAEL 35C8H 4XVSH 4PP2B 4NWUH 3TA3A 2Q76B 1ULVA 3ARYA 1LMKA 3RTQC 3N1GC 4CKVX 2ORBH 1CN4A 1Q8MA 2DICA 3QPXH 3QEQB 1B2WH 4PJEA 3VCLB 4MA7H 4NN5C 4HCRL 1CGUA 1QNZL 3MV9E 1JWMB 3I85A 4HMDA 2LTQC 5C0CA 3PV6B 4U49A 4JO1H 1KYOJ 4LCYA 3ARZA 3TV3L 4HULB 4F7TB 4P23B 1FE8H 3TO4C 2J8UF 2AKRB 3GMLB 4QY8B 5EU5A 4BKLA 1KNOB 4YNYB 4IHOA 3DRQB 4KKNA 1KB5H 3BSZL 2FO4A 1J0KA 1BLNA 5KSUA 1RZGA 4P9MH 4ZFFB 4FXGA 5LCVL 1CGWA 5HBBA 1ZS8A 4EUPH 5I8OL 5J9PA 3BP6A 3W11C 2Y06L 5BMFL 1E28A 4L9LC 5E8OA 4O2FB 4OUUB 3TYGH 1F2XK 4Y19A 1KCVL 2ZSVA 3W9DA 1DDHB 2DI8A 1NAMA 4UT6H 1HQ4B 3MRRB 4JLRA 4WU7B 3I75A 4QHMA 4ORGA 3BH8B 2W65B 4PV8A 4OB5L 2R0WH 5IP4A 3K7UA 4LEOA 3QHFL 4KROB 3UAJC 1A14H 3C8KA 4ODWB 1QBAA 3G5ZB 3TM6A 3NCFB 1N8ZA 1S9WB 2OTPA 4JANA 3DX9B 3VXUA 4APQB 5DQJA 2NW3A 2X9XA 3QUYD 3MGOA 3GSVA 1XGTA 2GW5A 5D7IF 3M1BA 2FEDD 3QG7L 2JCCF 2PW2B 4YEEA 2XACC 2O5XH 2LABA 1FL3B 1ZE3C 1U6AL 3LQAC 5GGVL 5HGGS 2OSLA 1AJ7H 1TJIL 3SGEH 3MLSH 5ETUA 1IC4L 5D2NC 1FGNL 5CSGA 3MRDA 1LO0L 4FQPA 4CMHC 4NRYB 4O9HL 4GMSH 1G84A 2R2EB 2HRPH 1HWHB 3TZVB 5BV7C 4X7FC 1HI6B 4OZHE 2VDKH 4FXKA 1TZIA 2E27H 5I0ZA 4HEME 2CLRB 5T1DL 2HT4C 1INDL 2NLJA 4JHZA 4K3JH 3KWWA 3LY6A 4HLJA 2IAMA 5JW4N 2QQQA 4GRWE 2ESVE 4Z7NE 1K8IB 5DQ9B 5DD6B 5ISZE 5B39B 2FSEB 5F9WC 4FQJL 4PJCB 5HVFB 4NQSB 4OZIF 1IGIL 5CEYB 5GS2D 5E5MA 2NXYB 1JRHL 1QRNE 4K7PH 4PJHE 4KDVA 4PGEA 3ARBD 1VERA 4JPKL 3LH2L 3UPCA 1TQCB 3BVNB 1C1EL 1GHFH 1MI5E 5FKAA 1YEIH 2P8PA 3ARWA 3C5ZC 3TPUA 3CDCA 3G04A 1CDIA 1Q9KB 2EECA 2VDRH 2XG5A 1V7NH 1MFAH 3AXLA 4U7SA 4JFPB 1RFDL 4NQEE 5LJYH 3ARSA 1RZJC 1XR9A 2CIKB 3D48R 1A7QH 1X5AA 2Y9RT 1TJGL 4XCCL 5D5MA 4NC0B 1GIGH 25C8H 1PZUB 2FL5A 4RGMC 4LSRL 4ZO6A 4N0RA 5C0JB 1MPAH 5E6ZA 2DD8L 1MUJB 2X4PA 1D5XB 4HG4K 3RUGB 1YPZF 5E24E 1QR1B 3QWRA 4N1CA 4AEFA 2OQJB 2ZUUA 4JFQA 4M43L 5E4IA 1CL7I 4KKAD 2HMID 2B0SL 2CO7B 4TULH 5BRZE 2IBZX 1MJ8L 3B2VL 1HHIB 4PJGB 3VXOA 2VDQL 3CLEL 1LEKA 4PJCA 3H9YA 2F5AL 3S8WA 1J0JA 4Y5XC 2DQEH 2ESVD 5GIRB 2I07B 2EDNA 4QHNA 3QYCA 5K9JL 3VXRD 1MCSA 4MA8L 5IM7B 5JR1L 4X5XA 1LEIA 1I8MB 4P5KB 3VU2A 1UACL 5LXGH 3GHEH 3MRBA 5K9OA 1U92B 1JGDA 4WENB 3TNNA 1YUHB 4MQ7B 4OFVA 4P9HH 4XPGH 3C5JB 3TCLA 4X6CF 3EO1B 1XR8B 3HZVA 4K3EH 1E6JH 1EDQA 3WLBA 3PL6A 1YJDH 3MRJA 1A7BA 1NBQA 3L95B 4FTVE 3TCXA 3MRDB 3SKOB 5F3HB 2FRGP 2AJ3A 2YD5A 1S9KC 4Y4FB 4LSVL 4G6ML 3S35X 5GHWL 5KSAC 3EKCA 2SEBB 2LE9A 5K9JH 2B4CC 2X09A 3BZFA 3NTCH 3SDCC 3B9AA 5C09B 3QUZD 1TETL 2IH3B 2ADGA 1TQCC 2P5WA 3RWJA 5MEOB 2VLLB 1HQRB 3U0PB 4WDIA 2UWEF 4DUWA 3SDAA 5IHBA 5CJOH 4EOWL 5JHLH 1UJ3B 4L1DA 2XPGB 3L9RB 3P4LA 2HFTA 1SJHB 1A4KA 3L3HA 5LQBH 3DRTA 4S0TD 4G7VL 2NXZC 5F9DC 4GJTB 5I1IL 5C0BB 3CSGA 5AD0B 4PTUA 5E1HB 4OI8A 2X4PB 5FYKD 1U8LA 1A4JB 2YD7A 1T2QH 3CSBA 3QQ3A 3TVMA 4PJAA 3ARBC 2BXYA 3KLAB 2X4SB 2FIKA 5T3ZE 3TBTA 3JVGA 1CT8B 2BNUB 1ZS8B 2DLFL 3E8UL 4PJAE 1AD0A 2E7LC 2HH0L 3KLHD 4FZEH 3PL6B 5HHME 1RJLA 1T89C 2VLJA 3BP7A 4S1DD 3LPWA 5EZJB 2V2XB 3TGXA 3MCLH 2HWZH 1KCKA 3INUH 1ZGLP 4GG6A 2X4QB 2QKIB 4ELKA 2BSTB 1IEHA 5K9OB 3FB6A 3MV7D 1M6OA 3WSQH 3BD3A 3U46B 3MCKB 4FTVD 4ETYA 4POYA 1A9EB 4WWKC 3GSXA 5JZ7D 2G75A 1JTPA 2Z93A 1LNUA 5SX4I 1PSKL 3VFTA 3ZE2F 1NMAH 1LVEA 1VFBA 5B39A 2VL4A 1F6FB 1QACA 1U8OA 1IC5L 4HLZG 4MZ2A 5DJCB 2OK0L 1EJOL 2DTSA 1XMWA 4HKZA 2ZCHL 5CKGA 3UO1H 3RA7H 1DCLA 4GAYB 4Y5VB 1GAFL 3TWCL 1ZVSB 3X13A 3E2HB 2AV7A 1IGMH 1ONQB 3WIIL 4LL9A 5JMOC 4K8RH 2FR4A 4GBXA 4N5ED 3GHBL 5EBMA 2PYEB 4DGYH 1EO8H 3BKCH 3UBXI 3OZ9H 3JV0A 3EIFA 4XCYA 5JIIA 5EPMA 1QFUL 3ZE1F 3BGAA 3S4SB 1YC7A 1INEL 3CU7A 3KAAA 5TPWL 3FMGL 4DGYL 3T8XB 2E5EA 4PGDA 5IBUB