1X5XA

Solution structure of the fibronectin type-iii domain of human fibronectin type iii domain containing protein 3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
109
structure length
109
Chain Sequence
GSSGSSGPSMPASPVLTKAGITWLSLQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCPDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Fibronectin type-III domain containing protein 3a
publication title Solution structure of the fibronectin type-III domain of human fibronectin type III domain containing protein 3
rcsb
source organism Homo sapiens
total genus 10
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1x5xA00
2ADGA 3B83A 2DQIH 2GKIA 1OTTC 1UVQB 1HSAB 1Z9MA 2NZ9C 1FGVH 4XCCH 3MRJB 2CRIA 3V0VB 5E8EB 4M6NH 1LWRA 4KHTH 4NC1E 4WW2F 1NCBL 1BFOA 1OP5K 4Z7VA 2CKBL 4KHXH 1J8KA 3GMRA 3BDXA 3DX6A 4UMGA 4PIRF 4LDOB 4P5MA 2ZWLT 1EEYB 2HLFD 3EYFB 3SOBH 3VXMB 4JZNA 2HYMA 4LCCB 2V7NB 5JXED 4JM2F 2DJ4A 4GW5B 4F9LA 2H9GA 5IVXF 1F6LL 2Q8BL 1RFDH 3REVB 5AD0A 5C0RH 4F7MB 2A1WH 2EYSB 4X9BA 4OLUL 3LN4A 3H9SD 4N9GA 3ZE1F 3K2UH 1CDYA 2GK0A 3ARFB 2OXHA 5EIIB 1ZVYA 2C4FT 4K7PL 3MRNB 2DAVA 1ZE3C 2FHBA 3CFBB 4PJGB 5INDA 1BX2A 1YEIL 1ZHKB 4O2EB 4XXDB 1YYLH 4ETYA 1UZ8B 4OLVL 4AM0B 2CKBH 4WWID 3AS2A 5JO5A 4JRYE 3MGTB 3OX8A 2DMKA 3B2VH 1HWHB 5B4MD 2R1YA 2LV4A 3L3IB 1R3LA 3VD5A 3CX2A 5KSVA 4XPAL 3EO1B 3DARA 2Q8BH 2O5XH 4U1MA 4BFGA 3U0PB 4PB0L 5CKAA 3HLAA 3FQUB 1KJ2B 4UI2A 4NN6C 4BELD 4KROC 3THML 4PG9B 1H15A 4FQXB 1DBBL 5GSVB 1AHWB 3JWNC 5F9OL 1MELA 1N6UA 1U3HC 1SEBB 1J10A 3FRUA 4U7MA 5FHBH 4K7PH 2AKRB 4HW6A 1NGXA 3SO3B 4K8RC 4Y16D 3BWUC 2OYPA 1V3JA 3DXAD 3GUTA 1HOCA 3D5OF 4A2LA 2ZSVA 2OP4L 3U36A 4EUPG 4KV5F 5IW1A 1GIGH 2Q6WB 2FD6L 4YHZL 1ZWIA 2J6EH 3HC0A 5FO9B 1ED3B 1FIGH 2KDGA 5AEAA 4Z7NE 4LSVL 2UVFA 5I1JL 2P8PA 2Y4SA 3RKDC 2XN9B 3K8MA 4LHUD 2HMID 2ZUSA 4I18A 3V0WH 1K5NA 2HRPL 3STBA 2VH5L 5KSBE 3WXVH 2ZCHH 4H25A 4LVOC 4GAGH 2Y06H 1DVFA 1LO2L 2E8YA 5A43C 3DYPA 3QPQC 5IVNA 5GZNC 4YR6A 1P2CA 1JCKA 4FFWD 1AC6A 1UJTA 3MV7A 1MLBB 4XVSL 3RY6A 3VD7A 4DZBB 3UCRA 3DSFL 2VRAA 1W0VA 5F6IC 4Z9KB 2HT4D 4HH9A 4NZRL 1TXKA 4UILH 2AK1H 2FEDD 3F7VB 3GSNA 1HEZA 5D9SA 3MUY1 3IFPB 4XH2A 5BVPH 1KG0A 4PJ5A 1RU9L 1IQDB 5JQ6L 1D5IH 1BJ8A 4NFDA 1F6AB 2JB5L 5C0EA 1XGRB 5FGRA 2D7PA 1IEBB 1FNSH 3ZZ1A 3QG7H 1QFOA 1MIEL 4WUKH 3PL6C 3B9KC 2IJ0C 3PGDB 1RK0B 2BNQE 3MX0A 4I3RL 4X99B 1JI1A 3F8UB 3L3KB 1JGDB 3M17B 5I8EB 4CDGC 5J0BA 2ZG1A 4U6HB 4RWYH 6FABH 3LZFH 4CU6A 4XCNB 5GRJH 5J6GA 3ES6B 5DFWH 1FVCA 4HGKC 4WW2A 1VCAA 5C08B 1RK1A 3QHTC 3DX7B 1RIUL 5HYJA 2VQ1A 2P42B 5CJ8A 2R0WL 3RU8H 1FSKB 2WBJD 4KMQA 5B3JE 2YRPA 2FHCA 5BXFA 4JY4B 4KZDL 1A1OA 2OTUB 3FB7A 1WWBX 3MRDA 5F7HA 4W81A 1JL8A 3U2SB 5E56A 5J8OA 1RMFL 3MRJA 1N64H 2BJML 2HKFH 4JQIL 1L4IA 3QIWC 4HFWB 5E8EA 5B8CB 1UC6A 2A6KB 3JVGA 1S5IH 5E00A 4JZJA 2ATPB 3VFSB 2IGFH 2WANA 4DUWA 4JFZL 3UAJD 4G8IB 1EUUA 3MLXL 4JO2L 1S7VB 1V8HA 3EHBD 4E5XB 2VIRA 3TF7C 1NH6A 4PJIE 1KELL 2V7NA 4CNIA 2P45B 1MSPA 4OV5A 5FDWB 3MOAH 3REVA 4TNWF 4F7MA 4L4TE 4EVNB 5D2NC 2EYSA 1S7WB 1RIHL 4YHPB 1QPPA 3MGOA 5HHVL 1SJVA 2CQVA 1AD9B 3P30H 1JN6B 4L5FH 4HDIA 1ONQA 5SX5H 5EIIA 3TN0B 4P0DA 2X4OB 3SKOA 5GGVH 5ICXB 4FZEL 4YDVB 4YDKH 4PJGA 4OGZA 1J8HA 4XXDA 4EUPB 4JM4L 2ZKHL 1UZ8A 2PETA 3UTZB 3LCYA 3RJQB 1G7MB 1W72H 1EEQA 4XCEA 5ALCH 4OQTH 1Q9WB 2QR0A 4CRPA 3HA0A 1FNAA 1J88A 1MAJA 4WTXA 4U33A 3P4MB 4K9EH 3O2DA 4X6CF 4MQTB 3ARUA 3PWPE 2JELL 2G9HA 2EIZB 1NGYB 4WFEE 5DD0L 1I3RA 4HWEH 4N1EA 5TJWK 1WAAE 2QADC 3EGSB 3RNKA 3ZYJA 1SEBA 2CIIB 3O11B 1Q0YL 3RKPA 3HC4H 2VDPH 2NY6C 1YEKH 3G08A 2PO6B 1U8PB 3QQ4B 3P4NA 3HI5H 3HPJB 5E2UH 1A6WL 2VN4A 4PP2B 1H3VA 4FQHA 4LSRL 3LEVL 4V1DB 1ED3A 3CLFH 4YGVB 3ARDC 3WO3B 4HKBB 2WMPA 1IJ9A 1L6ZA 3F65A 3PIQB 4LKXB 4PUBH 3KPRE 3M1BA 3MPCA 5KG9A 1YYMH 4KRPC 4KROB 3VXTB 4BUHA 5ANMB 2VXSL 3VWKA 2JELH 3C9NA 3GJFK 4G9FB 3MXVH 1FBIL 5DUPL 3IU4L 5CCKH 5GZOD 2I9LA 2XQYG 2YPLB 1N5YH 3AUVA 4DZBA 2VXUL 1E0OB 2R23B 5F21B 5SWQB 1KUMA 4HLJA 3LSOA 4YXKH 5C0CE 1SM3L 5F71A 4WY7H 3NTCL 4AG4H 3LKRB 3DURA 1TQBC 4OZIF 1OQXA 1R6VA 5I1IH 3IFPA 4ELKB 4X4ME 3OKEB 4JANB 4OCSH 3FAWA 1M1SA 3KHQA 1KCSH 1UEYA 5CZXC 3RVUC 3GSXA 3I6LE 4EXKA 3L5JA 2XWBA 4LP5A 5LKNA 1KCLA 1AKJD 4QGYA 2IH3B 1CN4A 5IWLA 3L5WB 2F8VA 2VXSH 3UPRA 1S7SB 4FQQA 4OLEA 1A5FH 3ZHDA 5I1LA 4FTVB 5J1SC 3B3IA 3IDXH 4IOFC 4JHBA 5HJ3B 5CBEA 4Q9RL 4X8JB 3CXDL 3HUJB 4X99A 5D71H 2OTPA 3JXAA 3TBYB 5I8EA 5HHMD 4U6HA 1IC4L 1C1EH 1M7IB 3I02A 2UZXB 3OF6A 2F19H 2YEZB 2EH8L 1UA6H 3DX7A 5HDOA 1F4YL 3KWWA 4HQQH 5DRZB 4QTIL 4MSWB 3O6MH 5I30H 1N5AA 1U93A 1JMXA 5FYJE 2HTKC 1FORL 3KHOA 4Y5XA 2DQGL 4K71C 4G7YH 4MVBC 4NSKB 3EZJB 4ZFOL 1U3YA 1DLFL 2E8ZA 4ONHA 1D9KD 5D5MB 2GCYA 4R2GC 5KW9H 3RVXD 2YK1L 2OR8A 4JFFB 4HFWA 3MBEA 3ROOA 3TJEH 3B9KB 2A6KA 1FDLH 3K1DA 4C83A 3VJ6B 4F2MA 1UYWH 5DRWB 1G9EA 4F9PA 5LAXB 1KCRL 4GBXD 3VFSA 4YHML 4QNPE 2FX7L 5HDLA 2AGJH 3QDGE 5DQ9A 3LRSB 1IE5A 1IC4H 4NQEB 4Y4KA 1UWXH 1X5IA 3HNTH 1PVHA 5EU4B 1MFAH 2BMKB 1X9QA 4M6MH 2XTJD 2ESVA 4LHUG 4NYLB 4JVPA 1DQJB 4EVNA 4YIQA 3KG5A 4X5WA 4YHPA 4M61A 1HE7A 2BRQA 3NABH 4CW1A 3LB6C 1IGYB 1MHCA 3QIWB 4RBPK 5ICXA 1YEDB 4E0RB 1QNZL 2OR9L 1FLTX 3QO0A 2FR4A 4D0DA 5EBMA 5GGVY 3MRFA 1HQ4B 1QHPA 2VITB 1CGTA 3JWOL 2OZ4A 4ZFZA 1JMZA 3VW3L 1MWAA 2XFXB 1BJ1J 2HT3D 2P5EB 4WUUE 4HV8A 5D2NB 1U2CA 4ONGL 4DKEL 1ND0B 2DQDL 3OAYK 4HC1L 4NZTH 3K4ZA 2RHEA 1DL7L 1TNMA 2DI8A 1FJ1B 3QXWA 3VFGH 4TSCL 3CSYB 2CIIA 5J06A 4UAOC 3B8YA 3RQ3A 4KMTL 5I8OL 3SDXF 5JTWA 1U8PA 3FQXB 4Q0XH 4JFEA 1QRNB 1E6JL 4JVWA 1B0GA 3ZE0F 1YC7A 4PP2A 5GGRY 2R0KH 4OI7A 2E9WA 3JWOH 1B4JH 1T03H 1Q0XL 4LCIL 4UTAL 2PCPA 1KC5L 3F7PC 4J3UA 4QHKJ 2FECI 4ETQB 2GY7B 1FZKB 5B3NA 2R1WB 4X6EB 1T2QL 2P8MA 5E2WL 3CVIL 3WDJA 2VAAB 1CD1B 3NCJH 1QFUL 2XZAH 2PKDA 3JUZA 1G7LB 5F9AC 7FABH 4Y4HB 3G6AB 2R2CA 5HGAB 1KPVA 43C9A 5IB3A 1FE8H 2QADB 3CC5A 1U3HA 3PQYA 3QCTL 3RL2A 4P3WA 5HY9A 3HHRB 4BZ1L 4G6AC 1IAKA 3VWJC 2X4TB 1VADB 3BGMB 4NQDD 1SVCP 3QNXA 3QI9D 1LP9B 1PKOA 2R23A 1T20B 3F58H 5ACLA 3U79A 5FECA 1RI8A 5GRVK 3RPIB 2AJYH 4X80L 5HYJD 1UH4A 4U6VH 4YHOL 4JANA 2BNRA 2OTWA 3EZ8A 5FHAH 3TA3C 2VLKE 3MLUL 4KRPB 2LTQC 5TPWH 2CXGA 1QACA 1QFUH 4JM2D 3BD3A 1TNNA 1Z2KA 1T4KA 3L3HB 4NWUL 5C07B 3RX8A 3VGAC 4R4ND 1T7ZA 3BZEA 4P48A 5JQHC 1NUDA 3L7EB 3UJJL 3VXNA 4X8JA 4BZ1H 1L7IH 2KZ1B 3ARYA 4G6JL 1OTUC 2F53B 2YD6A 3LHPL 1J11A 4RX4A 5E8DL 2W65B 4LHUB 5MENE 1P53A 5LWYL 2V17L 5ILTL 1AXTH 4LCWD 1JHLH 5KOMC 3LVEA 3MJ7A 4MSWA 5CEYA 1KCUH 2QQNL 1X5JA 5KANG 4RRPG 3IJYB 4WHYG 1WT5C 2VNCA 1LO3L 3HMWL 4JPWL 3B5TA 3FQTB 1J8HD 5MI0C 3TV3H 1JZ5A 3PL6A 2YR3A 3B9KA 2FZ3B 2GTWA 4XNXL 1KB5A 4LSPH 5ADOL 5DRWA 5LAXA 1GGYA 3WE6B 2X1OA 4LPUA 4ISVB 2WP3O 5DYOA 1NJ9B 4PJ9D 3VXSE 4LLUB 3WFHA 3LDBC 1JRHH 4ZOCA 5HHOE 3MREA 4G6KH 2W9EH 5HGDB 5CJBA 1DQJA 2AK4E 3TO2B 4APQD 2QQNH 2JK5A 2VZTA 1NSNH 4K71B 1GC1L 1XGUB 4P5TD 1NFDA 1SY6H 4OI9A 4XHQA 4K94L 1MRDL 1IGYA 2EXWC 1M05B 1YEHL 3W39B 2ERJC 3QIWA 5E1HB 3FL7A 2VABB 2V2TB 5F9JA 4G6MH 3P73B 2OLDA 5SWSE 4IIQC 2VITA 3MLYH 4FMKA 4GXUM 1I4FB 2HJFA 3BMVA 3QRGL 5IMMA 1RAMA 1JZ2A 1RJLA 2XFXA 3HR5A 5DLML 3R1GH 3ULVD 4BSVB 1ND0A 2GITB 4JDTL 3VWKD 3GI8H 5C0DB 3QFJE 3NA4A 1NMBL 2AXJA 3EDEA 4U7KA 3RAJL 2MFNA 3V6OC 1BBDL 2OS7A 1I1FA 4JFQA 1P1ZA 2LU3A 2I07B 4XPHL 3VDCA 4MWFB 1LVEA 3B5GA 1RQ5A 5E08L 2OX5A 1FZOB 2BHYA 2YA0A 5I66B 3QCVH 1MHPL 3DECA 1QRNA 3N0PB 3O3EA 4KDVA 4M03A 4OZGF 4QCIB 5DUML 5DD1H 1M71A 1G7QB 3F5WB 4X7SH 3OWEA 3VGEA 2R1XA 5F44A 3VRJB 1EEUA 3I3BA 2Z4QA 1AGCB 1Z0MA 3AS3A 1PY4A 4OZFH 2XG4A 1SJEB 4X6EA 2VXQH 4IDJL 1BD2A 5D6DC 3EYUH 1GZPB 4MGXA 2VAAA 4OGYL 2UVEA 4K3GA 5HGAA 5IJVB 2CKBB 4KVCH 2OL3L 5GHWH 3RVWC 5D7LB 3KPTA 2Q87A 1IT9H 2I26N 4LPTA 4Z7UE 4UAOB 3WO4B 5IEHB 4M02A 4EKXA 1UXSA 1I8IA 1MLCA 3U48A 2BSSA 4RZCB 3FB5A 3HKFA 1CQKA 3CMOH 4FG6D 1LP9A 1MCCA 3WFCL 5KANI 5F70A 2QV2A 5CKGA 3H3PH 1IL1B 1D7FA 4A6YL 1MHPH 1RZKH 3OF6D 2FNBA 1DANU 3RPIA 4TSBH 3GMLA 3ARDA 4HKZA 4RGND 4E41E 4QRRD 5F3HA 5FGSA 1AXSB 2YUXA 4X4XA 2FEEI 3BHBA 5IF0B 2YBRB 4WTZG 1JYNA 3MBED 1A7OL 3GSUA 4OSUL 3PWUA 3GFUA 4NBZB 2Z0BA 1IEAA 4H20L 1TTGA 5F96L 1JWMB 1GJIA 3ULUE 1OGAE 1X4XA 2BXZA 1X5ZA 1ZLUK 1IBGL 1LK2A 2F53A 1KIRB 4Y4KD 1CF8H 4JRWA 2RFXA 4PV8B 4L4VE 4S1QL 1IC5H 1SJXA 3GK8L 3I50L 2ESVD 2ITCB 3X11B 4PLOB 5DJ6A 4HAFA 3LH2L 1ES0B 5DT1H 2DDQH 5JXAL 2NZ9D 4X7DC 5IG7B 4BM7A 4GQPH 3MJ8A 1FG2A 1ZT7A 1FNGA 1X5GA 1HHKA 5I1DB 1KCKA 2LVCA 2FJHB 4IRZH 3BIBX 5I1HL 3UZQA 4OGAD 3AAZB 3RA7H 2CLZB 1CDUA 4WO4C 1X3DA 3MUHL 3LN9A 2VLLB 1HZHH 3D0VB 4PR5A 2Q20A 1OARL 3D25A 5L88L 3VFVB 1QRKA 1V7NH 3NPSC 3LQMA 5DRXB 4V2BA 3BIKB 1CZ8L 3HG1E 1EGJH 2FWOB 1JUFA 3HZVA 2VLRA 3T1FB 3EO0A 3U4BL 5HGDA 4FA8A 1R0AL 4YDJB 5BOZG 4XCYA 4LFHD 1X5AA 4NFCA 4YUEL 2J4WH 3G5ZA 1XGUA 15C8L 4YHIA 4BSWB 1K2DB 3CCHB 5IHLB 5ACMA 1U3JA 3IVKA 1XGPA 1SHMA 1M05A 3W39A 4XX1E 3C8HA 3SEPA 3WFBL 4FXKA 5I1AA 3M8OL 1ZAGA 1A6VH 3P11H 3DYOA 2V2TA 4NZJA 4JFED 4PYHA 2AJVL 3U30C 4ELMB 3RY4A 4N0RA 2WZPD 4ODWA 2VXVL 5I18H 1F3JB 1UM5L 3CXHJ 2Q8AH 1CVRA 1YQ2A 3LDBB 1QR1A 1FZJA 4GUPB 2V9RA 4ZS7H 1BREA 1AGEB 2PYFB 3FO9B 5DJ8A 3S5LB 1ACYL 3KYKH 4BSVA 1EH9A 2GITA 4EI6B 5ITFA 4DAGL 5C0DA 4UQ3B 1FLRL 4TULH 5T3XE 2GY5A 5HHXH 2ERJB 1DSFH 1G9NH 1D3CA 5JOFA 2KBGA 4NGHH 4K8RD 4KK9C 2MOVA 1PKQB 3RWJB 2PW2A 4GBXB 3VRIA 1YY9D 4XGZA 4MWFA 2MNUA 3MNWA 2FX9H 1F11A 2H26A 2VOTA 3I2CH 4NUJB 5J56B 8CGTA 1HXMA 2ICWA 1J0IA 1QSFB 2D03L 4QCIA 5FM4A 1G7QA 3C5ZC 1B0WA 3DI3B 3RKDD 5E94B 2BNRD 4HS6A 1MRFL 3O8XD 4R96A 3BPOC 5DR5L 4P2CG 1E4WH 1GZPA 1K6QL 2QKIB 3BXNA 1CTOA 3DX9B 2CIKB 3QPQD 1OAUL 3Q1SL 2IWGA 1XIWC 3OL2A 2GIYA 4JHWL 4K3HA 5K9QI 1W72B 1D5MB 3GIZL 1M7DB 2UWEF 5E2TL 32C2B 5EUOB 2XZQL 5D70L 4OT1L 2AEWA 4LPXA 4ZXBB 3JWOC 1ZTXH 3D6GA 4PRHB 5SWZA 3UJIL 4RX4D 3T3PE 4AYFA 1OD9A 2NW3A 5I17A 4R26H 3DVGA 4D9RD 4N0FA 4PJCF 3LKPA 3KXFE 5C0AE 1YNLH 1DN2A 3VCLA 2CRMA 3GSWB 3S98A 4GKNA 4MAUL 5DR5H 4NUGL 3UTTB 2A6IB 4WHTB 4L8CA 4HUWA 5GGRB 3K0WA 1P7KB 4OF7A 2W38A 4M8QB 3PL6D 1IGIL 1BM3L 2HFTA 3VWJA 1CD8A 4OJFL 5K93A 1CXKA 1Q38A 4NP4H 5JW4R 2B0SH 2IPKA 5IK3A 2XV6B 1CGYA 5D70H 1LEGB 4HHAB 2NTFB 2DQCL 4P3CH 4UDTA 4FFZL 3IFLL 4LLWA 4MYWB 4PV8A 4X7TA 1BVKA 3H8NA 4PFEA 4G8FB 1HI6B 2CGRL 1F3RB 3BAEL 4MCZA 4AEHL 4U1HB 4P2OD 2AW2A 1FC1A 5B22A 1FQ9C 5IBTH 3TA3A 4XTRC 4XAKE 5F1SA 5M95B 2C3WA 4PJDE 1YDPB 4NNXA 3ILPB 2AXFB 3BD4A 2GJ6E 3S9DB 1WIPA 5I1DA 3SJVE 4E9LA 3MGAA 5E9DD 3UP1A 3V4UH 3AAZA 5DVOA 4JPKL 3FONB 1CGVA 4YQXL 5IB2B 2A9ML 2D2OA 3HNVH 5HXMA 5IMLA 3H0TB 2VLLA 1FAIH 4JB9L 1JGEA 3QUMH 2BOCB 5LGKA 1A1NB 2CDEA 2FATL 4KGJA 4XP5L 4GRWE 3RHWF 1E4KC 5DRXA 5ITBH 1Z5LB 3BYYA 3BIKA 4YC2C 2F5AH 4Z7OF 2Q7NA 1M6OB 2Q3ZA 3PP3H 2DI9A 1ZHBA 4NZUH 1WCBA 3HE6B 3IDNB 4JPVL 1KTLB 2YD7A 1TTUA 1CBVH 4KJYA 2F58L 4M48L 5IVXB 3UTQA 1WT5A 4BSWA 1K2DA 3CCHA 4BSJA 1MVUA 2AJZA 5H37H 5IOPA 2VYRE 1S78C 4RGMB 1KN2L 1T3FB 4WO4B 1YQVH 1NGZB 4G42B 3GMPA 5DO2C 4M6OH 3QUYD 1NC4B 2E27L 3GNMH 1OAKL 2VWEE 4NOBA 1BOGB 4Z8FL 1D5XB 1X5XA 4IHOB 3FCTB 3L3GB 2V7HB 4H0GA 3T0AA 4HFUL 3RUGF 4BQ8A 3BVNB 1KYOK 4GUPA 4IJ3C 3MBXH 4LPVA 1BD2D 3S5LA 1JNJA 3KPLB 3E3QE 1LDPL 4HUUB 3IRPX 4EI6A 5EC1B 4CVZB 4PJ5E 1MCHA 3H6JA 5JLZB 4M48H 3HPLA 4S1DC 4PRPD 4F15C 5C09A 2R2HA 2NY6D 1H3WM 1OP9A 4Y19D 1PG7L 5EOQL 2CJUL 4XZUB 3SDYL 4PJAA 4XP4H 2H3NA 4XB8A 2ED8A 4M93B 4IIQA 1M7XA 3EKCA 4JKLA 1BJMA 4Q9CA 4Z8FH 4UU9B 3NGBB 3ARDD 1IGML 1SBSH 4OZHA 1YEEL 3O2VL 4M1CD 4J3XA 4APQB 2VDMH 1RZJH 5E94A 1A6PA 1UJ3B 3IFNH 3NA9H 1GC1C 1CFTB 4U49A 1EO7A 5J1TC 5DUBA 4K94C 4R97C 4NKQB 4HIXL 4HUKB 1PQZB 3WIHH 1CE1H 4XBGB 4ZTOH 3VG0L 3IS1X 1FL6B 4GMTH 2GJZA 1ZHLA 1JGLL 2AJ3B 3V6OA 5HDBF 4XMLH 4TUJB 3V5DB 4XC3L 1NCWH 1JPGA 3C60C 3U82B 2EC9U 4JRXA 3QISA 4NNYA 1S7RA 2CJUH 1RZ7H 3TGXA 4MAYC 1TFHA 2NLJB 3JV4B 1H0DB 1RUKL 3FOLB 4AT6B 3WN5C 1TZHB 2YD5A 3UTSA 4I2XA 5TDNA 3BKMH 4U7SA 2FBOJ 4URTB 3VXME 3RVUD 1NAML 5CZXD 5D2LF 5D7KE 5D6DA 2HP4A 4LFHG 1G9ML 1QKZL 2B5IB 1KIQB 1S9VB 5IHUH 3BH8B 4WHTA 4WFFD 4LOUD 1MAKA 5FYKD 3GSOB 4OBRA 4GS7C 2VMFA 4XMPH 3RWIA 1RV6X 1JVKA 1E6OL 3TO4B 3QHFH 1KEMH 5L2KB 3MR9B 5FYJL 4PJGE 5KS9B 4EIGB 3BIAX 3S88L 4DEPB 4I77L 3GHEH 2ZG3A 3UJTL 2ZNXA 4P3DA 1UZ6E 1RZFL 5MEPB 5C0JB 2JCCA 2SEBB 5BJTB 4GRLD 1G6VK 1G7JB 1HI6A 1NCNA 3AC0A 2OJEB 4KQ3H 4MVBD 4F57L 4ZTPH 5GGSY 2EDRA 5H2BB 1QKZH 2AXFA 4R2GD 4FFVD 4RAUA 5GSRA 2ARJA 5DSCB 3VD3A 1VPOL 3CFDB 4LCYA 1GZQB 2JB6A 2BVPA 3FONA 4GQ9L 4KFZC 3W82A 1QLEL 1S9YA 2Y36L 3N50A 4F37F 1A1NA 4AEIH 3QEHA 1F4AA 1ZT1B 4QRRB 5J57B 2MHAA 1QZ1A 2X1QA 5AYUH 3NZ8A 3OAZK 1CLOL 2P5WD 2YD1A 1M6OA 4OZFG 2H2PC 4Y2DD 3T8XB 1XFPA 2AI0H 5DXWA 5JW3L 3IDNA 1TZGH 3FO0L 2XN9E 2HKHL 4LLYA 4P5KB 4KK8C 3OGCB 4KKNA 4OAWB 1IAIM 3OJDA 4FHBD 4MA8H 1JGVL 5ACZA 4EQ3A 1RHHB 1SMAA 4LU5L 3SGEH 5KSAC 4YAQB 5ICZA 3IDJB 4WO4A 4JZOB 4YHYC 2X9YA 4Z95H 3VFNB 3FO2B 4NHUA 4Q9QL 5CP7A 1ZGLA 4PJHF 4NC1C 4BFEA 5CEZH 5J9PB 4HPOL 3DV4A 3FCTA 2NY5L 1TTFA 1XF1A 1I9RL 1MFDL 4K3DH 5DDHB 1Q9LA 1MCWM 4WNQA 1N6VA 4X6FB 4CVZA 5JORA 4NM4L 4X6CB 4LLDB 1EHLL 4XAWH 2VUOA 3QA3B 1LE9A 3QUXD 1JRHI 3M45A 4LU5H 5IHZA 1VERA 4MNQD 3Q5YA 12E8L 3S37X 4IDLA 5EO0B 1A3LL 5DF0A 3FN3A 3DWTA 5HYQB 4OFVA 4Y4FB 2AJXL 4E42A 1FYTA 5SWZD 5C8JB 3SDCB 5TDOA 2XPGA 3UXFA 4DOHB 3A67L 5E5MB 3QQ3A 4IJ3B 4PJBA 5AZ2L 2NY5H 3VFRA 3NCFB 4QRPD 4CN4A 4ZFOA 5F7DB 5C08E 1MFDH 4UIMA 4U1IA 3MLTB 3C6LD 4XBGA 3NN8A 3QEQA 1RURL 1FL6A 4ZPVA 5EPMB 1DR9A 3MV9D 1D5BB 1FFOB 3NIFE 2AJ3A 3VWJD 3V5DA 1JZ4A 1B6DA 3QDMA 1R24B 1J1OL 4Z0XA 3VXUA 3HMXL 2DL2A 3T2OA 5CINL 3BP4B 4NQCB 4MD5A 4R4FH 3U9UA 3WHXB 1QSVA 4MDJB 5C1MB 3JV4A 1UB6B 3VXRD 3C08L 3FOLA 4AT6A 4BUGA 5C0ND 4MB5A 3C5ZA 4DCQA 3LKOB 4M62H 1R3IL 3S97C 4I9WD 2IFGA 5LGJA 4D0CA 4QOKA 1AI1H 5IB5B 3TA3D 4GG6B 4OFDA 4OZIB 4P4KC 5DC9B 4N0UA 4O2FB 5CUSL 2ATKA 3WNPA 5ETUB 2ZUTA 3BH8A 3MLSL 4HGWB 3H3KA 5MP6L 4LLVA 1XF3B 1XIWA 4JAMA 5M7QA 1VEOA 4WU7B 2VXTL 3FQRB 4KTYA 1WFOA 5TGBA 2IANB 4P2RD 1L0XA 1J1OH 1T7WA 2VDOH 3S36X 4L9DA 3T0VA 4J23A 1DQQB 2D7TL 3MR9A 2WIMA 4MAYB 5KS9A 1UENA 2DJUA 3QDJA 4U3XA 2VDNH 5DQDH 1H8SA 2AJSL 5FYKU 5DVLA 2SEBA 4HPYH 1KEGH 5BV7L 1KOAA 3NCMA 3QDAA 4HC1A 2Q3AA 1V7MH 4JO4L 3EYSL 4G43A 3EOBA 2RR3A 2YUZA 4MJIA 2P8LB 3ULSB 2J3SA 5H2BA 4HUNB 3ZDYE 2H6PA 4LQFL 3QIUC 2DQTH 1C12B 3CFDA 4N5EC 4KTEH 5D1QD 4M7JH 1HH6B 5JIKA 5DJ0A 1P84J 4P4RA 4HK3J 1DZBA 1YECL 3GJFH 3TZVC 5IM7B 1RSFA 5ISZB 1CE6A 4M9PA 1LK3H 1T66D 3QQ9C 4LEXL 4XPTL 1B0RB 3ARBC 4AIOA 4UB0H 5BV7H 1HSBB 1KTDA 1MJ8L 2G60L 2OSLB 2BFVH 4K3JH 5DURD 1AP2B 2OL3B 4X7CC 2EXWD 3PGCA 2JJUA 1NBYA 5C09D 3BN3B 4NDMA 3F7YB 4OZ4B 5ANME 4YAQA 5IP4A 5DD6B 4G9FE 4B0MM 2M2DA 3IDJA 3NACL 3A0OA 4GKSA 4JZOA 2J7LA 3FO2A 3RNQB 4OCRL 4B41A 4PP1D 2YPLE 2BC4B 1QLFB 3ARXA 3I84A 3SE8H 1E4KA 2F15A 3T0BA 3CPLA 4XCFL 1U8JB 5FKPA 5I71C 1DQML 4MJ4A 5D72H 5EFIA 1RZGA 5DDHA 4N9OB 4QXUH 3T77A 4XPFH 3WL9A 2N56A 5E4EC 2R2EA 3B6SA 2HRLA 4LVHB 5D8JL 1J0HA 2FDBP 2GQHA 4HX1B 3B9EA 3D18B 1EHNA 2ITDA 3D39D 3FZUC 3I6GB 1BEYL 4YHYB 3MLWL 3MV11 4MXVE 4FTVE 3UYRH 5DEGB 2RCSL 5HYQA 1T1WB 3C8KB 4QTHA 5ICYB 3ORJA 3MUGA 2Z9TA 5DHXB 5FO8A 3HUJE 4CU7A 4FQJL 35C8H 3IFOA 1NBZB 1HCFX 4U1SA 1WZ1L 5BRZB 4O5LL 5GIRA 3PXHA 2CRZA 1KN4H 2KUTA 3D9AH 3O2WH 1HILA 1OAQL 2XNAB 3P77B 1XR9A 4AEEA 3HAEB 1GPOL 1NCAL 2JTDA 3KPSD 3ARQA 1CXEA 3TNNB 1T1YA 4K3EH 1I8LC 2B2XH 4G8GD 1MAMH 1DBKL 4GKZA 1FFOA 2EO1A 2ZG2A 3V7AG 1JYXA 5D5ME 4WHDA 2C4FU 3BP4A 4XP6H 3NFSH 2NNAA 4J12A 3WHXA 4JFFE 5KN5B 4YE4H 2WLYA 3GBMH 4M5YH 4P59L 3O9WD 2O5YH 1EX0A 1ZHNA 4TOYL 4RBPH 1WK0A 4OCMC 3S3PA 3GSVA 3WEXA 3ZL4H 3NIDF 3RGVD 1Q9KA 4NQEE 4Z76A 4ZUUB 1FNLA 5FOBA 3WIIH 5HTSA 4DGIH 4GG6A 4OF0A 1ZVHA 3ULUL 4OIIH 2QJDA 5D1ZC 3OXRA 4OUOA 4O2FA 3OMZA 1KV3A 5FYLE 1AGFB 1IM3A 4MDIB 1IM9A 4NCDA 5H37G 2MCPL 1KTKE 5EU5A 1P4LA 1EERB 1XF3A 3QUZA 2ADFL 3TESA 3C60A 3BKCL 4JJ5B 2IANA 5MEOB 3OKKB 4LLMB 3OAYH 5DJAA 5DJXB 4I13B 4Q9BA 3BQUC 1JHKH 4MAYA 4YEFA 4QEGA 4CUCA 3AROA 3ZT5A 5EZIH 4MQXC 1DQDH 3QAZC 5IEKB 3WN5A 1MQKL 1NDMA 1DBML 3B43A 5DFTA 2A73B 1BQLL 2B4CL 3R0MA 4O02L 3T09A 4NKIL 2XKNB 4L1DA 1MFCL 3IETA 3L5IA 3LKNA 5EIQA 2HAZA 4UT7L 5GRVL 5I15H 4JFHD 2P5EE 4XPGH 5D2NE 2BY0A 4ZUSB 1MFEH 2L7UA 4ZO6A 2W91A 5DMGC 2G5BA 2MSPA 3E1F1 4QHNB 1F4XL 3ARGD 4UTBH 5TFSL 1I9JL 5CZVL 3O45B 5EOCL 4K2UL 2HN7B 2I60L 1VFOA 5IM7A 4GXUN 2GSIA 5ISZA 4Z7NF 4OD3L 3DMMC 2H32B 1QRNE 1INQB 2X4QA 2CH8A 4MS8D 4LGPB 4YHNA 4CMMA 1G9MC 3BPNC 5EZJA 1JWUB 1HSBA 2AEPL 5CIPA 3FRPA 3K8KA 3SCMC 1TIUA 4O00A 2FO4A 4HZLA 2OL3A 5IMKA 5KBNC 4NM8L 3D1MC 5A3IC 1MCBA 4L29A 1PZUB 3C5JA 4ESKA 1FFNB 3A6CH 3S37H 1FHGA 3ZDXE 1WC7B 4IRSD 1RUML 1AJ7H 4S10A 5CZVH 5JHLL 1FYTD 4M6AA 4IM8A 4A6YA 5EOCH 1MY5A 4M7ZC 4NPYA 3BEVA 5GGSB 4K2UH 3QRFM 2XQBL 5CJQH 2BC4A 3UMTA 4WVRA 1N0LA 1LP9E 3GEWB 1YMMA 1A6TB 3ARBB 3MLVH 3MRPB 5EBWB 5FM8A 1FNEB 3L7FA 1JPTL 5B38G 5I2IB 1ZOXA 1KJVA 3HCVA 2LVEA 1OHQA 4JDVB 1IAIH 4KJWC 5TDPB 3QEQD 2DD8H 3RIFK 5K59E 2HFGL 3I6KB 4G6FB 2QLVB 5KSAA 2NY1C 4HX1A 3QDMD 1JZ8A 3VXUD 2QBWA 3QUMB 2ZCLH 4OTXH 2XA8L 2WINA 5C07E 2AXGA 4LVEA 5DMYA 3NH7H 4Q2ZB 1NGPH 4ONOA 3LS5L 3IJSB 4L8SA 3C8KA 3EDFA 3T4AB 5ICYA 1TZIB 2VDLH 3C5ZD 2A0LC 3SGDI 3VFMA 3U7YL 5FOJA 1AGDA 1AFVH 1NLDL 5BRZA 1A8JH 5I71B 2F53E 3PWVB 3D0LB 3DTXB 2NPLX 4PB9H 5MHSD 2XNAA 1GAFH 3F7QA 3HAEA 4GH7B 1K8DB 3TNNA 4MQ7B 1XIWD 2JIXB 1DEDA 2XY2A 2VZVA 1QYGL 3T4YA 1FO0L 2XI9A 4YFLI 1ADQL 1EFXA 1XCTA 2VQTA 3HI1A 5D7JD 3PDGA 1LO4L 1DFBL 5H35B 4DGVH 3O4LD 4GSDL 5LJYH 1EMTL 2F54A 4N5UA 3ZKMC 3IXTB 3HNSL 2UYLB 4X6BA 1A14H 4XI5C 3RDTC 5BS0D 4PJIF 1T0PB 3KJ6L 3O4OC 2NY5C 4DWHA 2FJGB 5EUKA 4EDXA 3QULB 4WEBH 4JRYA 3P9MA 2VQUA 1PBYA 3CFEB 4XBPB 2V5SA 4MJID 4PGDB 1S7XB 2VLME 3QYCA 3QUXB 1Z6JT 3NCYS 2WM0A 5LG1A 3W5NA 1LMKA 1MH5B 5E6IC 5C0FB 1IQWL 4KJQC 5I19H 2E3VA 1DDHB 4X7FC 4JHAH 3MZGB 1CFQA 1DE4A 1T83C 1CD9B 3GKWH 3VI3E 4G7VL 4AQ1B 4D0BB 5DJXA 1RVFL 2FGWL 2DYPB 1PFCA 4Y5YB 4F7CB 2VB5A 1J12A 5I1GH 2HFEB 4QRPB 5CEXB 4GMSL 4D9LL 4WU5B 3OJMB 2AEQL 1K3ZA 4RISH 3NIGF 4XTRD 2CRYA 1IKNC 4BH7B 2R8SH 4JG1H 2YWZA 4P4KA 5D1ZB 3DJ9A 2NY0B 1IC7H 3U9PL 3MV9B 4GAJL 4ZAKD 2H2SD 1WAAF 2AV1B 4R7DA 4KUZL 5HYSA 4ZOBA 4JJHA 4KH2A 2NXYC 2K7PA 5IQ9B 4I0CC 2Y6SC 1ZKAA 4UDUB 5DWUL 3WDHA 5KSBA 1QLRA 2YMXH 3O41B 1GOHA 1PG7X 4X9FA 2OR7A 2PNDA 3BKYH 4NJAL 4FQ1H 4UT6H 2JE8A 5C9KA 3WUZA 3PWNA 3EFDL 4UQ2A 5D93B 3MUJA 3GJEB 3MCLL 2H32A 4XRCB 5HGHA 4NKOB 4RMSA 3VFUB 4D9LH 1A1MA 3X3GH 3V4VH 5FM5M 1R5IB 3QXAA 3BT2L 5AG8A 2WLZA 1X5FA 5IFJB 2NX5D 4GAJH 1PX4A 3CU7A 1S5HB 3WNNA 3QIUA 5F72S 1FFNA 1TVDA 4PJ7F 1MHEB 5D7LE 2C3VA 1N4XH 5MERA 3X12B 4LRIC 1U6AL 3C09C 3TZVA 4X9IA 4WV1B 1UG9A 4PGJA 5C7XH 3F12A 3BW9A 2F8OA 1WTLA 4EOWH 3CLEL 3DMMB 5BV7C 4XBEL 2AS5M 2E9JA 3LN5B 3SKUD 4WCYH 5EB9A 2BNQA 3MCLH 2DLTA 4JY5L 5KVMC 3ARBA 2D0HA 1E28B 1FNEA 1H3UA 1TJHH 1J7VR 4JDVA 4C56D 4PRID 4UBDC 1ZLUH 4WW1A 4M7LL 4M7LT 1KBGL 2DQJL 1MJ7H 1CU4H 4KKAC 3G5VB 5ESVB 4H88L 3LEXA 2BVQA 4WDIA 4DVBB 3EOAB 5CD3B 5HSFA 1HXYA 4LNRB 2B1HL 2W59A 1S7QB 1WWWX 5EU6D 3MJ9H 3NZHH 1U6AH 4ENED 1TZIA 3QHZL 1I8KA 1DEEB 3SGEI 4EN3C 4PBVC 4XBEH 2WWMC 3UC0H 5J3HD 3BPLB 4ZD3H 3DGGA 3D0LA 2Q86A 2X4UB 3CGTA 3NFNA 1WZKA 1IM9D 2DBLL 3MRQB 1I3GH 4JO3L 3IXAB 1K8DA 3WFDL 2ZP0T 2DQJH 2NY1B 3QUZD 1JK8B 1P7QA 4U2ZA 2VZ3A 4L4TA 1NGQL 1AQDB 3VDBA 4NO5A 3S4SG 1MF2L 4QNPF 1TPXB 1YA5A 2X4SB 4OCXH 1OAXL 1JTPA 1MJJB 3CVHH 2UWEB 5IVZA 4L3ED 2FJGA 1R5WA 4WI3A 4IRJD 3A6OA 1H3PH 4MNHA 3H9HB 3TJHC 5K9OA 1JNHB 2J5LC 2BNUB 1BPVA 3CFEA 5EULV 3T3ME 3WYRA 4MA7H 1QFWM 1S7XA 25C8H 2V5MA 1KXVC 4KKLC 1HDMB 4Y2OA 2DOCA 4WI2A 5TH2B 1UFUA 3GI9L 4PJCB 1I8LA 3D39B 3JTTA 4XPBL 2IFFL 1YNKH 2W60B 5IKCB 5BZDB 5C0FA 3BI9X 2NXZC 5H94B 8FABB 1LO5A 2DTML 3MRMB 5GS0L 3RDTB 1D6VH 2J8UB 5T3ZH 4KJPC 1KLGB 1F58H 4GKOA 4TQEH 1DQLL 3DLQR 1IGFH 1KJ2L 4ELME 5CEXA 1U8MB 3F62A 1AQKL 1C5CL 3MACH 2DKMA 3GM0A 4NQVA 1WF5A 4QXGH 5KAQF 1P69B 1IGJB 1AO7B 5D1ZA 4G8GB 2YRZA 3NCEB 5E4IA 5HHQA 4R3SA 4OB5L 4Y1AB 1JV5B 5C70A 3HFMH 2AJUL 1P4BL 5LCVH 1VEPA 5IQ9A 4JGJA 4LCUB 1BBJB 2E7BA 2PXYB 2VE6B 3KPRA 2XWJB 1AD0A 3LEYL 3ESUF 1MCPL 2R0ZH 3O9WB 5GS3A 3BQUA 3QEUA 5I9QB 1PKQE 5GS0H 1H5BC 2ADJA 1RUPH 2CO7B 2Z93B 5GJTH 2CLRB 1VDGA 5HD8D 2LU4A 1ZANH 1REIA 1YMMD 3RGVB 1DQLH 1JTTA 3WS3A 4XC1L 2H2PD 3R06A 2VC2H 1AQKH 4H5SB 1QSFE 3ULUC 1J5OH 1DBJH 4ZUWA 5C0CA 4QWWD 4HIJA 3QG6B 1KT2A 4KK8D 3UEZA 1XGYL 5T1KB 4JKPH 2R39A 5KSAD 3M07A 2XXMB 5GGTH 3U0WL 4NNPH 1BIIB 3V6OE 5E8OA 2I5YL 4HKXB 4OLXL 4CADB 4TVPL 4M4PA 5ESAB 1FVEA 1E27B 1OSZB 2B4CC 4M43H 5EUOE 3TWCH 3DMMA 4XWGL 4NZDA 1NAMA 3O3AA 5LBSH 4PRHE 1ORSB 1F4WH 2UUDK 5DJ2B 5C0IB 4LSUH 3SCMA 3RUGB 2DQEL 3DHJA 3UBXA 5AUMB 5T5FH 5JNYA 3BWAB 2FRGP 2W0FA 3ARGB 3HC3H 1XGYH 3VH8A 1WV7T 3G5VA 1TJIH 1OSPH 2F5BH 4NFBA 3ZDZE 1EFXD 3UTTE 3ZE2E 2C1PB 4DVBA 3TVMC 3GJFB 4ZDHA 2V5TA 2GTZB 5TF1L 5HVHB 5GRZA 4LNRA 4OFIA 1PAMA 1S7QA 2VLJB 2HFFB 4QRSB 1CD0A 3GO1H 5IFAL 3IDYC 2NR6D 3K1KC 4U6YB 5BV7B 3RIAF 1U95A 1B9ZA 2YD4A 1DEEA 4JRYD 3QO1A 1WFUA 5B39B 2PR4L 3KJ4B 3GSRB 4LVNC 2OM5A 3RFZC 3OKNB 4ODVH 1VFAA 4JREB 4CAGA 1F6FB 3QDGA 2LAGB 1QBML 4K55A 3REWA 1MRCH 1VGKB 4RAVA 3MRQA 2DQEH 1WFNA 2EDTA 3IXAA 4JFYB 4POUB 3L9RB 2BY1A 5FUZL 4B50A 1QVOB 4I48B 2EO9A 1XZ0A 4O9HL 1UB5A 3FT2B 3PHOB 1MQ8A 2F74B 3DRTA 1BQHG 2DQHH 2PYEB 2Z31A 1D5ZB 4AIZB 3NAAL 3P0VL 4ODTL 4P23C 3EIFA 1WLHA 4EN3B 4IMKC 1F97A 1NLBH 1KPUB 3W9DA 4KI5C 5DHVB 4AY0A 3WFZA 3IDGB 3SY0A 2IBGA 4Z0BL 3ZTJH 1U8NB 2BNUA 4DTGL 1CICB 2PW1B 1N6QH 4FNLH 2VKWA 4NRYA 5I74C 5FUOH 1WTGT 3BX7C 4NO2A 5D2LB 4WUUA 5IVXE 3GRWH 4YJZL 3S34L 2HVKA 3MOBL 1WBZB 3E8UL 3O6FC 4O9HH 4JY6B 4P49A 1TVHB 5HHPB 3ZE1E 3G6DH 5FCSH 1IKFL 4MD0B 4O58H 1UM4L 2X4RB 4W6WB 4X9GA 2IQ9L 5A2FA 2ZCKL 1CL7H 4AENA 1F8TL 5F1OB 1CS6A 1CTNA 1PSKL 3WD5L 3TH2T 1LD9B 3STZB 4S2SA 1NBVL 1SMOA 2J5LB 3CFCL 1JNNL 1SYSA 2EKSA 4HWBL 1N59B 4DTGH 3PG2A 4QHMA 4PRNB 5EO9B 1CLYL 1WBYB 3DO7B 2A74B 1JV5A 2PTUA 5E6IA 3BDBA 5CP3A 4P46B 5D1XD 1BBJA 3CDFA 2NXZB 3CD4A 1ETZB 1T83A 5HVGB 4N8CH 3LMJH 3U83A 1MCNA 2OK0L 2K7QA 3UPCA 1MNUL 3TZVD 4JG0L 4PJFB 3FOMA 3H7BB 2LAAA 2R29H 4PGEB 1JFQH 3TC9A 5IGXL 3KYOB 2BNQD 2X4NB 1XH3A 1H8OA 3PV6A 2M1KA 3T2PA 1G0DA 1IKNA 1OF2A 3RTQB 4L8BA 4N8VB 4KV5E 2IG2H 5J11B 2P7TB 3IU3B 4KGLA 3UO1L 3LS4H 4Z7UF 5T1KA 3NFPB 5FO7A 3HMXA 2BRRH 3BE1L 5DD5H 4LRNL 4IS6B 4G9DB 3Q5OA 3PP4L 1VHPA 1VENA 2QHRH 1U41A 4LBEB 5KZCD 4CADA 5HGBB 4TUKL 2B1AH 3WFEL 2UZIL 3MODL 4LARL 1PZ5B 2R4SH 4ODUA 5DVMA 4JCMA 4ONFL 4PS4H 4MJ6A 1BAFH 4XHJC 3P4LA 2ORBL 3WJJC 2NY4C 5C0IA 4PJHB 4TSAL 3W0WB 2P44B 2RB8A 5D7SH 3WLWC 1E4XH 3HZYB 5GGQH 5EWIL 5FA3B 1KNOB 4PRAB 1FVDA 5MENA 1P7QD 5LGHH 4N0UE 5DZLA 4L4TD 5KTEH 5SX4H 2E7MA 4ZFFB 1OLZA 3A6BH 3TYFA 2Z8RA 1BQHB 4LLQA 4OCYH 1S3KL 4J3OC 5FB8B 4Q6IC 1JPSH 1WICA 5DMJB 4TRPL 1FRGL 4LRIA 2FJFB 5GS1C 1I7RB 1A7RL 4YBQC 3HRZB 5L2KE 5DTFB 2EEDA 43CAB 3WFEH 3LQZB 5KS9E 3O6KH 3QDJE 3V6FB 1ORQA 5DEFA 3CNKA 1S7UB 3GSRA 3I75B 3GHBL 3RBGA 3WNLA 1FPTH 1Q72L 2HWZL 4C58B 5DJDA 3VXSA 4UOJA 5C2UB 4YNYB 5HHOA 3PWPD 1OTSD 4F7PB 4D2NA 4DGYL 3OAZH 5IESL 5F88B 3GB7B 3TVMB 4IBLT 2EH7H 4I48A 1JF6A 4OKVB 4WFED 3VI4E 4HCRH 4U0QB 3FT2A 3PHOA 1TQCC 1S3KH 3CSPA 3RZWA 2Q7YB 4NN5C 2BZDA 4XNYH 5FYLL 1XGTB 1LE5B 2PYEA 5E2VH 2WWKT 3VGFA 2EICA 2YA2A 4EN3A 1U58A 3EYVA 3K4DA 1CDJA 3VFPA 2G75B 3JV6B 5DHVA 1J1PL 1L0YA 3MLZL 4NWTH 4QRRE 3IDGA 2IQAB 3Q6GL 3HTLX 5E99L 4ZUTB 1WQVT 5ID1B 3RY5A 2DKSA 2WNGA 2YSSB 3RZCB 3L1OL 2XG5A 4MA3B 4XNMB 1SJHA 1CIUA 2BOBA 1OL0A 1VA9A 3S35X 4P9MH 5DA4A 5MEQB 3KPRD 1I7ZB 3GIVB 4DKFH 4HIHB 4DGYH 2B7DT 1YEGL 4GRMB 5EU6B 4ZS6C 1I3VA 3S96B 3EO9H 2APTA 2IADB 2IH1B 3BQUD 4IOIA 3QFJA 4LPYA 3FFCB 3QSKB 2BVOA 4MLIA 1NAKL 5DRNA 4H8WH 4MQXD 3OHXB 5KVGL 3QFDB 5IBLC 4YXHH 4JFXB 4OD1H 2DIBA 4AH2B 5DEZA 4HK0B 2IMNA 3L6FB 4TTDC 1R3HB 2YUVA 3BYTA 3GGWB 1QFWH 5C0CD 1CG9B 3HZKB 3MRKB 4JGUA 3FN0H 1MFBL 5JZ7D 4PGCA 4PRNA 1JJUA 1WFTA 2V9TA 4F58L 3DO7A 1CT8B 1FH5L 2C9AA 3BO8B 3FKUS 3DX8B 4B7IA 3TM6A 3C6SA 4LCCC 3I6LD 2P24A 3CH1B 4WJ5A 4X6CE 4DVRH 2ZUQB 3T65B 3R4DA 4PJXB 3H9ZA 4GFTB 3CUPB 2MPAL 1GGUA 1A7BA 4L3EB 1NL0L 3ET9F 5JPNB 2EEBA 4IRJB 5SV3A 1GSMA 5HI4C 3DUSA 3FTGB 3PNWA 3ARFC 4NRXA 3KYOA 1AR1D 3HRPA 1DQTA 1UCBH 2AXHA 3LIZH 4YH6A 2NZIA 1L7TL 3SCMD 2XWTA 2NY2B 4DOHE 3TFKD 3B2UC 1MHHA 2JJVA 3MFFB 3AS1A 4HT1L 4OUUB 1FO0B 3IAQA 3QWRA 4G3YH 3NFPA 1NPUA 1T04B 4UV7L 1F90L 1ZT4B 4M7KL 2C3XA 1O0VA 4G9DA 3HR6A 5GS0C 1DBAL 1JWSA 1QPXA 1V3LA 4FP8L 5F8QC 3SKMA 2MPAH 2FYYA 3WJLC 2JKXA 5TE4L 1H5BA 2HVJA 1CGSH 3DYMA 3P4OA 4NQCE 3TCLB 3O3DB 1PZ5A 4FQXC 4ODSH 5TQ0L 2DBJA 3CK0L 3DHMA 5I1EH 2MQCA 4QT5B 3SO3C 1SYVB 4I4WA 1MREH 3QDGD 1OY3B 3W0WA 2EDWA 4XVJL 4I0PD 5FA3A 3IYLW 3EOTL 4GG6E 1KNOA 5FK9A 3VMNA 3G04A 3V5KB 4OZIE 3D3VB 5F1IA 1XF5B 1AXIB 3DIFB 4U2YA 3QJFB 1CXIA 1CLZL 4UV7H 3LQAL 4M7KH 4PD4J 3O3BB 5GRUH 4M1GL 2ADIB 4R90H 3K3QA 2Z31D 2IANE 1I7RA 4ZYKA 2EXYC 2YPVL 4ORGB 5DK0A 1XR8B 5DQJB 5DTFA 5CWSA 5HI5C 3BP7A 43CAA 3V6FA 4U1JB 1XF4B 2XACC 5IBUG 3TBWB 3DVFA 1L9MA 2NY4B 3CK0H 2M8XA 4PJDF 1VFMA 3I75A 1NCDL 1YEJL 4DQOH 4MA1B 3RP1A 5L6YL 1JNLH 3Q48A 1T1ZA 3HG1A 5BO1H 4WUUD 1LNUB 2X42A 1PLGL 1YC8A 5F88A 3TVMA 4RIRB 5E8NB 3ZKXC 4JPIB 1AGBA 3LQAH 4OKVA 2WIIB 5AWNL 3R8BB 4XI5D 3ZYIA 5GS1B 2E7HA 3E6HA 3GMNB 4GRWF 3SKJL 2EE6A 4EI5B 1GGCL 5EA0H 1OM3H 1KJMB 4G8EB 1RUQL 1U91B 2Z35B 2QSCL 1MCJA 1URLA 5J12B 3EDDA 4KQ4H 4JR9H 2DM4A 1INEL 5ISZE 4ZUVB 5DJYB 2H1PL 2HG5B 3N9GL 2ZOLA 3BKJH 5F7FA 4C59B 1KENH 4XNMA 5E6ID 4L8DB 4MX7B 4NC0B 3VXOA 3ZSSA 4WGWB 1RUAH 2ZPKH 5MEQA 4OM1H 4UINL 1I7ZA 5D7IB 1GGBH 5A40E 5JDSB 3V4PL 3OXSB 1PLGH 2XRAH 4GRMA 4HIHA 2A2QT 1TQCB 3TBSB 2IH1A 3QH3B 1KIPA 2DQIL 1U92A 4O51A 1WBXB 1FGVL 3OPZL 4P23A 3SKJH 2FIKA 4DUVA 1V5JA 4BYHA 1PW3A 4IMKA 4M6NL 4KHTL 4AH2A 1YPZB 4KHXL 4HK0A 4U3CA 3L6FA 2ICES 2W9DH 5B8CC 3GGWA 5FCUH 3MYZA 3U6RA 5ID0B 1MCRA 1UM6H 2ARJQ 3L3DB 4LMQI 4KKCD 3SOBL 2BCKB 1KLFA 3BN9C 2CPCA 4GW1A 1PYWA 4HKJA 2Y6SD 3EYQD 4GW4A 2QEJA 4J6RL 3EOYG 2VLKD 3CH1A 1RFDL 4JKKA 2IEPA 3T65A 2A1WL 1G7IA 2VO5A 3O6FA 1LDSA 3VD4A 3BPCB 2FL5A 3RVVD 3SKNB 1A3RH 3K2UL 4JN1H 1N3NB 2OMBA 5JPNA 2NMSA 1X6LA 2A6DA 2FSEB 4XNQA 4QYOB 5F7WC 2VL5B 3FTGA 3OPZH 5IQ7H 3HE7B 4B7LA 5IW6B 5EU3B 3TN0C 1YYLL 1QQDA 1U2HA 1U8OB 1Z3GL 5BRZE 3B2VL 2X7LA 5MEND 4K7FA 3MRGA 1FO0A 1ADQA 1D6EB 3KXFA 4M5ZH 4P2QB 5C0AA 4RFEB 4J6RH 4JFDB 2O5XL 3IAGC 4RQQA 2D7OA 5C0GB 1T5WB 3QXDA 2WWKO 4PGBA 4PLJC 2F54E 3FFDA 3BZFA 5FYJU 5FHBL 3TCLA 3RWHB 4FQPA 3QZWG 3D85B 2IALA 5T1LA 3L95B 4KDTC 3RPKA 3X3FH 5IFHH 3ZTJG 1I8MB 5D96B 4W70A 3EYOB 2V2XB 3ZLQC 1OB1B 2H8PB 4XWOC 3VXSD 1Z3GH 2Y07H 2PO6C 5C2BH 4D94A 2DQFA 1GIGL 2FEEL 5D1XB 4KKAD 1FC2D 1CK0H 2J6EL 4HJJH 3AU1B 1HHGA 1FIGL 1XF5A 1T7XA 1U8IB 2AK4D 2CR3A 1I1YB 1JPFA 4U1GB 4PJDA 4BQBA 2GUOA 2R15A 4PJGF 4LDEB 1UXWB 3TP4A 3V0WL 2E9IA 2NY3C 3T0XA 3MNVB 2BSRA 2GJ6A 4YO0B 3WXVL 2ZCHL 1IAOB 4GAGL 2IPTH 2Y06L 3SJVA 5JMOC 2I9TB 4P57B 4WWKD 4WHYH 4QHUB 4AK1A 3VFTB 3QIBD 4U1JA 5EO1A 5HHNB 3TBWA 4MXQC 5SWSD 3WJJA 4BZ2L 2P46B 1NFIB 1MI5B 4H1LH 4MJ5A 5JHDB 3S35H 1A6AB 5DK2A 4UILL 4Q58C 3PDOB 2AK1L 4L3CA 2A6JA 4NHCH 4XVTH 3GMMB 4KK5C 1JI2A 5F7EH 2V6HA 1BECA 5BVPL 5KZCB 2C7UA 4QXTB 3IKCB 3IDIA 3QFJD 4JPIA 4Q6IA 1B2WL 1D5IL 3K46A 3DV6A 3LPFA 3MV8A 5T3XH 5GS1A 4OCWH 3GMNA 1K8IB 3TNMB 3MCG1 4TUOB 2C1OB 4UUJB 3OKDA 1EAPB 3BDYH 3BSZH 1FNSL 4G8EA 2V2WA 1DUZB 3QG7L 3TJHD 5C0BD 4WUKL 3VG9C 4KPHH 3T0ED 1G6RH 5DJYA 4OBSA 4HUXA 2VL4A 3OR7B 4HH8A 4BZ2H 4KKLD 3UBXG 1LEIB 3ULVF 4CMHB 4RWYL 6FABL 1KB9K 3VH8G 3LZFL 4IMLB 4L8DA 1S8DB 4MX7A 5GRJL 4FQ2H 3EUUA 2AERT 5JOPE 2XA3A 4Z7QF 1B6UA 3SDAD 3ZKXB 1FFPA 3AREB 3RU8L 3Q3GA 1FV1A 1I1AB 4Z18A 3QH3A 3DRQB 4WFGE 1B2WH 3CDGB 4KJPD 1GGIL 5HPOA 5IVOA 2X5PA 2NY7H 1N64L 2HKFL 3RWCA 1ZSDA 5DS8B 3ALPA 4KKBC 3KS0H 5JOEA 1YPZA 2DWDA 2P1YA 1S5IL 3WKNA 3EFFB 1T21B 1IAMA 2IGFL 3ARZA 4MMXC 4U1LB 4S0SD 4E41D 3QWRD 4TVSa 1H9VA 2BP3A 3OKLB 1CFNB 3D2UA 3MOAL 1TVBA 1QA9B 3CFKB 5F3BB 5FDYA 5IB4B 4HUVA 5EOTB 4RMWA 3BPCA 3CDCA 1I1RA 3P30L 3MRLB 1BFTA 4L5FL 1P4IH 3QZWB 5AYQA 5CILH 1GGIH 4DK3A 1UVQA 1HSAA 4MZ2A 3W81A 4QYOA 3STLB 5GGVL 4YDKL 2FIRT 3MROB 1OGAD 3V0VA 1WGOA 2DN7A 5IR1B 3TYGH 4TYUA 1S9WB 5I0ZA 3MRCB 3MRBB 4L4VD 1W72L 1EAJA 5ALCL 1HYSD 1EEYA 4OQTL 3SHSA 3EYFA 1A7QH 4R4BB 5E03A 1CL7I 3VXMA 2ZUUA 4LCCA 4P2QA 1X44A 4K9EL 3G6JB 1AIFB 2EYTB 2E5EA 4GW5A 4JFDA 5C3TA 5KAQG 1ULVA 1EFQA 4X6DB 1MVFA 3AXLB 1KCVH 1I9EA 1EEZB 1A21A 5EZOH 4XP9H 1NC2D 3CZJA 2BSTB 2APBA 1HINH 4HWEL 1KFAH 4PJ7B 4C55A 1QSEB 4JN2B 3ARFA 1XCQB 2R56H 4JE4B 3MRNA 1CFBA 3N06B 4NCC2 3HC4L 2VDPL 3CFBA 4LDLB 1I8MA 2DM3A 1YEKL 1ZHKA 4HMCA 4O2EA 3UZEA 5DD3H 2HLFC 1JF1B 1UWEL 4AM0A 3KPQB 4BJLA 3HI5L 5E2UL 3MGTA 1NEZG 4GRWH 3HG1D 4TPRH 2QHLA 5JXEC 3L3IA 4S1SH 1RD6A 4O2CB 3MLRH 3RHWK 4ZFGL 5I76B 3CLFL 1I1YA 4PJ8B 3B9AA 4PUBL 3EO1A 3C2AH 3HI6H 2P49B 1Y18B 1YYML 4O4YH 5A1AA 3U0PA 1HHHB 3U46B 1VACB 3FQUA 3WJLA 2OMNA 1PX3A 1KJ2A 3MXVL 4JKMA 4GXVH 4PG9A 4Y4HC 3OKMB 4M1DL 4FQXA 5GSVA 5CCKL 1AHWA 1KXTB 4YFDB 3QJHB 2DQUH 3SDDD 2AKRA 1BVLB 3MCKB 2MWCA 2D4DA 1N5YL 4QRPE 4MMZC 5B4MC 4GJTB 5TF0A 3ZDYF 1UWEH 1G7HB 3IJHB 4YXKL 5JHDA 4WY7L 1A6AA 4JVUA 4PY7B 4AG4L 2A83B 2Q6WA 1E4JA 1IZKA 3GSNH 3MV9E 5I1IL 2R4RH 1KXQE 5FO9A 4ZFGH 1UH3A 4OCSL 4I3SH 2NY3B 3RWEB 2VR9A 1F13A 2XN9A 1KCSL 3FT4B 4HUMB 5T3XD 4PTTB 2DF3A 1E4XI 2W0LA 2A9NH 1KLUB 3BGFB 3JWDH 3HS0B 2AABH 3TNMA 4TUOA 2XZCH 2HJKB 3OTTA 1A5FL 4UUJA 4ODHL 3W2DH 3IDXL 5SX4I 4HJ0D 4M1DH 3SN6N 1IVLA 1YMHB 4LF3B 3SQBA 1MCOH 3RL1B 3O6LH 4LPCA 1IGTB 1MLBA 2J2ZA 5D71L 2R9HD 1YY8B 3OR7A 3H9YA 4UNUA 1Y0LB 1C1EL 1BF2A 3ARTA 4PV9B 1B88A 4IMLA 3D69B 1EVUA 1N0XH 1VFBB 1QBLH 3LQAC 3F7VA 4UV4H 5ERWB 2F19L 4BFBD 1UA6L 2HMIC 4HQQL 2APVA 3O6ML 5I30L 3KR3L 3OAUH 3QQNA 1Y6KR 1IQDA 1OT2A 3DRQA 5FGCB 4G7YL 3KLHD 4KRNA 3IGAB 4LP4A 4JFOB 3CDGA 3H7LA 4LASH 5C6TH 1BQSA 1CFSB 1F6AA 4J1UB 5KW9L 3LKQB 5F7NC 1JYVA 1J1XH 4P9HH 3P2TA 1XGRA 4ODHH 1IEBA 3VG9B 3TJEL 5DS8A 3TPUB 1FDLL 4JDZB 1T0NB 4YDIH 1UYWL 5I0DA 3SQOH 1X4YA 3PGDA 1P9MC 1RK0A 3EFFA 1A22B 1T21A 3L3KA 1JGDA 4U1LA 2AGJL 3M17A 4FQLH 2IAMB 5C0AD 3HNTL 1MFAL 3FT3B 4XCNA 4QO1A 3ES6A 3OKLA 4M6ML 5C08A 2EYRB 4XP1H 3KR3H 3HUJF 3NABL 2RAMA 4JY4A 3MRLA 2YC1B 4CJ1A 2ED7A 1R3JB 2OTUA 4WFHD 3MRHB 2GT9B 2R0LH 2XTLA 3U2SA 3STLA 3JV5A 5ENWB 1BZ7B 2FB4H 2X4PB 1NEZB 5B8CA 4GOSA 2YS4A 3N85H 1OQOA 3MA7B 4H26B 4JLRB 2ATPA 4J8RB 1VGEL 1XGQB 3KDMB 3AB0B 4G8IA 4NQXB 4FQCH 1S7VA 4E5XA 4XAKD 1OWWA 3ECBB 4UZGA 4Q7DA 3TT1H 3DROB 3G6JA 4NN7B 4D9QE 2WBJC 3O2DH 4NO0B 1C5BH 5FDWA 4X6DA 3AXLA 4LQ1A 1EEZA 2W92A 5FIEA 1S7WA 3SJVD 5L9DH 4NZTL 2V5YA 2X89A 5C92A 3AGVA 5CEZE 1AD9A 1JN6A 3VFGL 1XCQA 4YX2L 4HWZB 3TN0A 4XHJD 5EORH 2X4OA 3E0GA 4X0KB 4YDVA 1NMAL 4OIAA 4EUPA 5BQ7B 4KTDH 4Q0XL 4NKDB 2WV3A 3UTZA 4CVXB 1IFHL 1G7MA 4PLNC 1VGEH 2R0KL 4F37K 1NFDF 4QY8B 1Q9WA 2C26A 1B4JL 3RX5A 1T03L 5I76A 3AMLA 3D39E 3P4MA 4HG4J 2ED9A 1X7QB 5I6XC 3NCJL 1MUJB 2XZAL 3U46A 7FABL 3ULVH 4HF5L 1DVFD 1NGYA 2EIZA 3DUUB 1FE8L 4HXAL 3LKSB 2Z91B 4PRBB 5H8DA 3OKMA 3KPPB 5IMOB 3BESR 1MCWW 4KAQH 3EGSA 2J8UE 4YX2H 3MV7D 4KDTA 4HWBA 3L5XL 3W11C 3O11A 3WO4C 4NJ9H 1BVLA 2ZJSL 4YBLC 3MCKA 1NMAH 2PO6A 1RZIB 2FX8H 4AMKH 3F58L 4OGXH 1G7HA 3QQ4A 1IFHH 4GLRH 1A7PH 3HPJA 1BIHA 2AJYL 5E7FA 1AO7E 1KSRA 1K9TA 4G8GE 1MCQA 3DVNB 4HJGB 4U6VL 4Y1AE 4V1DA 2B39A 5I8CB 4PJ5D 4YGVA 5FHAL 5CJOH 3H9SB 3RWEA 4HKBA 4XNUH 4PTTA 3PIQA 4LKXA 3QCUH 5TPWL 1IMHC 4YBHA 4HIEB 5TE6H 3WUWG 5KVFH 4NQTA 4MCYB 1AH1A 2O61B 2GAZB 1KLUA 3VXTA 5ANMA 5K9JH 4HF5H 4G9FA 3JBG7 4S1RH 4ODXB 4HXAH 4ALAH 3OR6B 1FL5B 1L7IL 4OQ1A 3L5XH 2ZJSH 2CMRH 2YPLA 4R8WH 4P2YA 4I8DA 1JIBA 3P0YH 4NQSB 5SWQA 4A2MA 5K33A 2VTFA 4KK6D 1UACH 1HCVA 3D69A 2WK2A 5T5NF 3LKRA 1OAYH 1VFBA 4Z7OE 3PWJB 4ZS6D 1YUHB 2UUDH 5F1NB 1AXTL 1JHLL 4OLYH 3EDKA 3K80A 1IGCH 4ELKA 1KCUL 3OKEA 3ZT6A 3JZ7A 1HKLH 1N2RB 2YD8A 3IGAA 4ZQKB 1LP9F 4PY8I 3QIBB 5IBLD 5L2JB 2IH3A 3L5WA 4J1UA 4Y16B 3IT8D 1S7SA 5GZOC 4X7EC 3DXAB 4FTVA 3WSQH 3TV3L 1QTYT 5HJ3A 1MEXH 4LSPL 2CUHA 5J1AB 3X13B 3HUJA 4RMVA 3KYMB 1QEWB 4R7NB 2WQRA 4HK3N 3TBYA 1GXEA 3ZTNH 2XKUA 2YD9A 5D7KD 1XMWA 3RUGE 1M7IA 3MNZB 1JRHL 4G6KL 2W9EL 2YN3A 1WIOA 4EBQH 5F97E 2YEZA 4J4PC 5DRZA 1NSNL 4IEFB 4XX1G 1SY6L 2OQJB 3ARFD 1EZVX 4D8PB 4NSKA 5I73B 5C0BB 1BF8A 3FJTA 3T0EB 5D5MA 1C08B 2VLJE 1MOEA 5E1AB 4KVNH 3Q6FB 5J89A 1BZ7A 4JFFA 3B2UD 1UWGH 4H1LG 3VJ6A 4G6ML 3EJZC 2BSED 4JLRA 4J8RA 5AZEH 3WS6C 3KDMA 3ISWA 3MLYL 3SDAB 4NQXA 1TCMA 3LRSA 2OZ4H 2WUCH 3SE3C 2PTTB 4NQEA 2MTPA 3ECBA 5EU4A 2BMKA 3DROA 3WHE0 1BMGA 1MWAH 4NO0A 3R1GL 1MCLA 4Z7UB 4NYLA 1OPGH 4YWGH 1FCGA 5BMFH 1TENA 3GI8L 4U6XB 3L3OB 4J3TA 1D9KC 4HS8H 3K4AA 4FQXD 1TCRB 2VISB 3RWFB 5HDBE 5JIIA 2Y5TB 4HWZA 2PYEE 3PHQB 3WLBB 1YEDA 4JO1H 4GBXC 5BQ7A 4QRTB 2Y9RT 4E0RA 2ENYA 3PWLB 2EZ0D 4NKDA 3QCVL 1C5DB 3IDUA 4CVXA 1NANH 4BFIB 1NFKA 1HQ4A 5DD1L 3BD5A 1H3GA 4X7SL 4MQSB 4MD4B 5D6CB 3C87A 2XTJC 3VI3F 4DFHA 1B4RA 2WBJB 5HVFB 2XN9D 5D2LE 2VXQL 2P5EA 5E0QA 5D2NA 3EYUL 1Q1JH 2X1WL 1MUJA 2EXYD 2HJLB 2YN5A 1AE6H 2QSTA 4QF1B 1U8KB 4KVCL 5GHWL 1QUNA 1IT9L 3NCBB 3BEWB 1FJ1A 2NW2B 1LILA 3CSYA 3GBNH 2D31B 4K8RH 1T0MB 2COQA 2DL9A 3WKMH 5TQ2H 3CMOL 2G2RB 4MNGB 2FH8A 3FQXA 3H3PL 5ALBH 5JXEA 4ZXBC 1RZKL 4K9EC 1A64A 1FG9C 3GMOB 4PYGA 4TSBL 4MXWH 5I16B 1N8ZB 2YKLH 3U0TB 2HT3C 3PF2A 4LGSB 5CMAB 5DMKB 3H9SA 3SGKC 4ETQA 1FZKA 2R1WA 5I6XB 2QQKL 5DJCB 1GOFA 2O5ZH 3MXWH 1CFVH 1CD1A 2O61A 1G7LA 4Y4HA 2Q76B 3G6AA 5CSZB 5I1KH 5FKAB 4PJFE 3OR6A 5CD5D 2X70B 4YBLB 3MA9H 5EDXA 2X4TA 2UY7A 1VADA 3BGMA 1BQUA 1LHZA 1UQSB 5ADPH 5JUEH 4EQ2A 4YHLH 1EJOH 1CF8L 1T20A 1IC5L 4OM0H 3PWJA 3JTSB 1CR9H 4MHHG 1YUHA 4FFYH 5DMIH 4BQ6A 1I9IH 1MIMH 3FO1B 2FLBT 5DT1L 5BZWB 2DDQL 3INUH 2QQKH 5T1DH 3V52H 3SE9H 4ZQKA 4IRZL 4K7PX 4LIQL 3FB6B 3L3HA 3C8DA 1JBJA 1FGNH 5C07A 3RA7L 4I5BB 3WMSA 3CJJA 2EIDA 1AC0A 3L7EA 1W8NA 1HZHL 3QI9C 4X98B 2BVTA 1KB5H 3X13A 4CVUA 4S0TD 4Q6YA 2W1NA 3PGFL 1T5XB 5IT2H 1V7NL 4PJHE 4WW2C 4Z7WB 3W0WE 2W65A 4LHUA 1EGJL 1HHJB 4KY1L 5FA4B 4FN0A 4LKCB 2CR6A 2X89D 3HE6C 4JM2C 2J4WL 4PLKC 1OTTD 3IJYA 1G6RB 3ZKSD 4ODBD 5F7UA 4NC2B 3S3SA 3TN0D 4LIQH 2UV3A 4PJEB 4X83A 5E1AA 1NUNB 1RIVH 1A6VL 3E6FB 3FQTA 3P11L 1DUYB 3Q6FA 4RGMC 3AM8C 2YUWA 2FZ3A 1P9MA 4RGOH 2KPNA 3AY4C 5I18L 3WE6A 3PGFH 1BLNB 1YN7B 4ISVA 2Q8AL 2ILLA 3FQNB 1NJ9A 3FMGH 2FO1A 3CFIC 2FBJH 4ZS7L 2PTTA 4LLUA 4Y0GA 4OD2B 1VKXB 2C5DC 2NTSP 4KY1H 3KYKL 1AKJB 3N1QC 5GJSH 3TO2A 3G9VA 3TBTB 5F9WC 2HA1A 4TULL 5HHXL 4Z7VB 1BFOB 1DSFL 1G9NL 3LD8B 4NGHL 1SEQH 2VISA 4XXCC 4DN3H 4P5MB 2VDKH 2VDRH 3L5HA 1KJ3L 4ZOEA 2PO6D 2VABA 4QRTA 5HHMB 2FX9L 3I2CL 3PWLA 1C5DA 4OLZH 4PJ9C 3P73A 2H9GB 3IB4A 4M93C 5AD0B 1TLKA 2IBZX 3NGBC 1WSST 3LN4B 1JGUL 2YD3A 5GRYA 5KJRH 2CK0H 2WBJA 4LSSH 1A6UH 1I4FA 3QR2A 1BFVH 1TETH 4APQC 1UJ3C 1E4WL 4P5TC 4KROD 1D9KB 5FXCH 4ZNEE 3RBSA 1UT9A 4ELMF 5INDB 4G9FD 3TH4T 1BX2B 4RDQF 3FFCE 1U3HD 3PQYD 4UIKH 5JO5B 2D31A 2R1YB 2EKJA 2CDGB 5DC4B 2YPLD 2I07A 3J7HA 4KI5E 1INDH 1R3LB 1KJ3H 5E95B 2J88H 1FZOA 4ZSOB 1ZTXL 5KSVB 5I66A 3U1SH 1J05B 4HBCH 5KVDH 4R0LC 1CXHA 2XTJB 4U1MB 4QLRA 1X5LA 4KK5D 3HLAB 3F5WA 4JQVC 4R26L 3SPVB 5I16A 4YPJA 3VRJA 1JGUH 1A7NH 1YNLL 1AGCA 3VWKC 4FXLA 1H15B 4LSQH 4PBWD 5DZNA 1SJEA 4PJAF 4CGTA 3FRUB 4PJXE 3MV01 2B5IC 5GZND 4L3EE 5IJVA 4FTVD 3GUTB 1HOCB 2CKBA 1LO0H 5FKAA 5D7LA 4H0IA 4OZHF 4GO6B 4N0YH 4QGTA 5T33H 5IEHA 5IW1B 4NP4L 2B0SL 4LLAA 5I75B 4RZCA 1ZWIB 1FZMB 3TO4C 2EECA 3HC0B 1GHFH 2XZZA 2LU7A 1XT5A 3LAFA 4P3CL 2P8PB 4LAQH 1IL1A 4DEPC 4KZEL 4I18B 1K5NB 1RY7B 2ARWA 1TJGL 1QR4A 2YRLA 4FQIH 4H25B 5IBTL 4RRPA 2BDNH 1AXSA 2G5RA 4OCLC 3WXWH 1UGNA 5EUOF 4YR6B 1P2CB 3CFJB 4N90D 3MV7B 3RI5K 5IF0A 2YBRA 4KKBD 5IW3A 3V4UL 4JFFD 3B9KD 1W0VB 3HNVL 5FYKH 4FG6C 1FAIL 4HH9B 1JWMA 3QUML 2DS4A 1WEJL 2J6EA 3GSNB 1L0QA 1HEZB 3OZ9H 4J3VA 2HH0H 5C6PB 4L4JA 4XH2B 3ZE2F 1KG0B 5ITBL 1KIRA 4NQED 1CDHA 4DFIA 2F5AL 1MPAH 4KZEH 5I8KH 1ZGLM 1HHJA 5FYLD 1N7MH 2E7CA 4NZUL 1TJGH 3D3VE 4Y5XC 2ITCA 3X11A 5FA4A 1WWCA 3U7WH 1CBVL 1ES0A 4LKCA 4RFOH 5C0EB 5EIVA 1EDQA 4ZPTB 5EN2B 5IG7A 1ZXQA 4HXBH 2VKXA 4EDWL 1Q94B 3FHQA 4DN4H 3QIWD 4JHZA 2JCCF 2FJHA 4NQDB 2DLFH 1XEDA 1YQVL 4PJEA 3E6FA 1KGCE 3VFWB 3QI9B 4M6OL 2CLZA 3GNML 3D0VA 5J6GB 3D87B 1OVZA 3BRFA 1FVCB 1WEJH 4WW2B 1BWMA 2J1KA 5A16B 1RK1B 3VFVA 5HYJB 2VQ1B 1YN7A 1A0QH 1F3DH 4ERSH 3FQNA 4KDWA 1RULH 1HKFA 3MBXL 5BXFB 5HDQH 4OD2A 5M94B 3CAFA 1A1OB 1ZEAL 2P5ED 1EO8H 3FB7B 2FWOA 3CXHK 2A77H 3BP6B 3MRDB 4J4PA 1AKJA 3T1FA 4UNTA 4JM2B 3O0RH 4YDJA 3TBTA 3ALXA 5BVJB 3QPXH 3BUYB 2X10A 3MV8E 3H2WA 4OGAC 4RMQA 2BHUA 5E00B 4EDWH 3ROLB 4JZJB 2EDYA 1MJUH 5HYIA 4U0RB 4XP4L 5TE7H 2VIRB 4CNIB 4NCC1 1QRND 4Y4FC 3WS6A 1QBAA 4G5ZH 4ELMA 3SDCC 1HNFA 4OV5B 1F3JA 1SBSL 4LCWB 3SE3A 2VDML 1RZJL 1ZLSH 2WUBH 3NIDE 3MGOB 3IFNL 1AGEA 3NA9L 1EXUB 1ZEAH 2PYFA 3FO9A 3IAPA 5D7IE 4HDIB 1ONQB 3AVEA 5F9WB 3WIHL 4DUXA 1CE1L 2D4FA 4ZTOL 1D9KA 3ZYZA 4Y4HD 3SKOB 3CDYA 1J8HB 4UQ3A 4GMTL 2QADD 1NCBH 4XMLL 1Q8MA 2W0PA 1NCWL 1CGXA 1PKQA 4XCEB 4M00A 3RWJA 3ARWA 1T89C 2CDGA 4GBXA 2E7LC 2QR0B 1RZ7L 1YPZE 4PJ9B 1U3ZA 1NKOA 4ZSOA 4NUJA 2GYSA 1J05A 1QSFA 4F8QA 3BKML 1QFPA 1U36A 3SPVA 1QHOA 2Y1VA 4OLUH 2G9HB 4TTGA 2DIJA 2QTEA 4AIXA 3K2MC 1I3RB 3ZHLA 4KRPD 4P5TB 5IHUL 3FB8B 3RNKB 4LMQE 4WTZA 2QKIA 4WGVB 4TNVK 1CWVA 3DX9A 2CIKA 3IKKA 4G80B 5C07D 1YEIH 2L4OA 4BQCA 3G08B 1YY9C 4OLVH 1JZ3A 2D7MA 5IV2B 4XMPL 3P4NB 4PJBF 1DN0B 3OKYA 4LSTL 4OF5A 1W72A 1D5MA 3QHFL 1KEML 1M7DA 2EE9A 2OXGA 4FQHB 4QRQB 2IBBA 4OQTA 1FZMA 32C2A 3QNYB 5EUOA 2D9CA 5JW5B 2BX5A 2F53D 3GHEL 4ZXBA 2GHWB 4PRHA 4R0LB 5EBGA 5CS7A 1IEHA 4XPAH 2DICA 1BWWA 3M1BB 2GW5A 3O8XC 5KG9B 4PB0H 3MQIA 3TBVB 3VWKB 3C9NB 3SGKA 4KQ3L 1X6NA 4P2QE 2JLLA 3THMH 4JFDE 2EDNA 3GSWA 4ZTPL 1DBBH 4GLRI 5T3ZE 5JW4Q 3CFJA 1BZQK 5F9OH 3UTTA 2I9LB 2A6IA 2VAJA 1T1XB 5F7LB 5GGRA 4IOFD 1P7KA 5FAAA 1EZVY 4M8QA 3VRLF 2CUMA 3PJSB 2OP4H 3LSOB 4LSTH 3DURB 4OF6A 1RZKC 2FD6H 4YHZH 9CGTA 4AEIL 1QD0A 1LEGA 4HHAA 2NTFA 4LSVH 5I1JH 5AYUL 2AQ1A 3GSXB 2XWBB 2VLMD 4G8FA 4L3AA 1P6AB 2HRPH 2VH5H 2VLRD 4U1HA 2AI0L 1I3UA 1TZGL 2HTKD 3UPRB 4FQQB 2LE9A 5I1LB 4DJMA 1LO2H 2FCBA 3B3IB 5KS9F 1YDPA 4ZPTA 2YHGA 5EN2A 4OFPA 3ILPA 4MA8L 1F42A 4RA0C 5CBEB 3MZTA 1Q94A 2KQNA 1F2XK 1ZS8B 1OAZL 4XVSH 4EIZC 4NQDA 3VFWA 3QI9A 4Z95L 3DSFH 5IB2A 5EG6C 3H0TA 4YDLC 3I02B 4NZRH 4I3GA 2IF7A 2BOCA 5DHYB 5CEZL 4OIBA 5A16A 3N1MC 1TMCB 3KWWB 4RGNB 3TIEB 1MI5E 5JHDE 1N5AB 1U93B 4M8VA 3VI4F 1A9BB 1Z5LA 4P2OC 1RU9H 5T1MB 5JQ6H 4Y5XB 4CU8A 3ARRA 4K3DL 3ABZA 2EE3A 3BP6A 2K9UA 4ONHB 3KLSA 3MTRA 3HE6A 4JM2A 2GCYB 2ZSWB 3I3DA 3VU2A 1KTLA 1WIUA 2JB5H 3LB6D 4XAWL 5BVJA 5IVXA 3MBEB 3ROOB 3BUYA 4C83B 4LVHC 1MIEH 4I1NB 4BA8A 4F2MB 3ROLA 1OAZH 4R6UA 4I3RH 1T3FA 3AM8A 4JQXC 1NGZA 4QKXB 4G42A 1NC4A 5DQ9B 4Y4KB 1BOGA 3AY4A 3F7RA 4JEGB 2EDOA 1D5XA 1ZGLP 2ESVB 4IHOA 1RIUH 4LCWA 1S7TB 3L3GA 2V7HA 4YIQB 3BJ91 4X5WB 2R0WH 3EAKA 3VGBA 3BVNA 4M61B 3ZO0A 4CW1B 4KZDH 1EXUA 1WVZA 2XOTA 3KPLA 3VXQB 4TVPE 1MHCB 4F7EB 4HUUA 5EC1A 1RMFH 2BJMH 4K23L 3V8CA 5CFHA 4JQIH 5JLZA 4WHCA 5FFLA 4RMRA 4XXCA 5D7LD 1W0WB 3W11D 3QO0B 2FR4B 4D0DB 3QUYC 3MJ6A 5EBMB 3MRFB 3FHAA 3CX5K 4R4FL 4JFZH 1OP3K 4XZUA 3MLXH 4JO2H 4PJ9A 4ZFZB 1KELH 1MWAB 3G9AB 4M62L 5EC2B 4HV8B 4UU9A 2RJMA 3NIGE 1AI1L 1MCFA 3RVTC 1RIHH 4APQA 4K07A 1A4JB 4NRZB 5HHVH 1UJ3A 1CFTA 4P5TA 3GM8A 1II4E 1G9NC 1NANI 2JJTC 3DNKA 3FB8A 1A2YB 3U4AA 1PQZA 2CD0A 1VESA 4FZEH 4K23H 4G80A 4OCNC 4JM4H 2ZKHH 4G6AD 3QUKB 5JR1L 4RFNC 4TUJA 5IV2A 4JFEB 1DN0A 4K7PY 2DKUA 2VDOL 1B0GB 4QRQA 3QNYA 2O93L 2VDNL 2WP3T 3K8LA 5JW5A 4LK4A 3BP5B 3MSPA 5DQDL 2NLJA 1H0DA 2X05A 2PCPB 4J3SA 1EIBA 4R0LA 4M1CC 1KEGL 1TZHA 4HPYL 4JQVA 3RIAK 2DLEA 2P8MB 4CL7A 4NN6B 3ETBF 3TBVA 1V7ML 1W0YT 1KPVB 2Y23A 43C9B 1KTRL 5IB3B 3G6JE 5DD0H 3CC5B 1U3HB 3PQYB 3ARPA 3RL2B 5HY9B 4X6DE 3GZKA 1KIQA 1S9VA 1IAKB 5BW7C 1Q0YH 2O26U 1T1XA 2DQTL 3QNXB 1GVIA 4KTEL 4PJ7E 4M7JL 1QSEE 3GSOA 5JR1H 3PJSA 5FECB 1A6WH 3TO4A 2Y7QB 5L2KA 4GG6F 4J3WA 1OTUD 5JIPA 3WNOA 4LSRH 1LK3L 3LEVH 1HHIB 2BNRB 2FLRT 2OTWB 4OZFB 5C0JA 5MEPA 3O8XB 2DWEB 2C4XA 4UB0L 5BJTA 4J4PD 3S6CA 1G7JA 1PEZA 3ZT7A 4LVOB 1HK6A 2BFVL 2OJEA 4K3JL 1T4KB 1FBIH 5DUPH 3SO5A 4NBXB 4LOUC 3IU4H 3BZEB 5T5NG 3VXNB 4YFEA 2XKSA 2W0KA 1NCTA 1UKSA 5DSCA 1ZS8A 1GGTA 5F6IB 2VXUH 1GZQA 5EH1A 4F7TB 3EJZD 5CSGA 1SM3H 3NTCH 1PEWA 5DHYA 3SE8L 3B4NA 1Z9LA 4GRLC 3TIEA 3MJ7B 5EOCJ 1ZT1A 5CEYB 4QRRA 4KXZH 1A9BA 5T1MA 5JPMB 2GJJA 1B90A 2IBZY 5D72L 4QXUL 1KIUA 5IHBA 1T7VA 5GPRA 3T8XA 3WDIA 4XPFL 4OF3A 4V1DE 4FFVC 2ZSWA 5J6HB 1ROWA 3PL6B 4P5KA 3OGCA 2GTWB 5ABDE 4OAWA 1J0JA 4Q9RH 1KB5B 1RHHA 2J8HA 3CXDH 2JJWA 4HWUA 4EZMA 3UYRL 3QBTB 4NOFA 5DYOB 4YDLB 3VFNA 3WFHB 5D4QA 1QSFD 3MREB 35C8L 2EH8H 1P5VA 4P2OB 1F4YH 5J9PA 1S7TA 4QTIH 1KN4L 3D9AL 3O2WL 2JK5B 4Y2DC 1S9KC 2DLHA 1JE6A 1NFDB 1FORH 2DQGH 3VMPA 1OD7A 3VXQA 1DLFH 4F7EA 2CDFB 4X6FA 4K3EL 1M4KA 2EDBA 2B2XL 4Q74A 1FN4B 4X6CA 2YK1H 1MAML 4LLDA 5E9DB 5HI3C 4RMTA 5FGCE 3QA3A 1I7TB 2ZUWA 1W0WA 5F9JB 4JRXD 1CCZA 4Y5VC 2AVGA 4XP6L 3NFSL 1KCRH 4YHMH 5EO0A 2FX7H 4YE4L 3GBML 4Y4FA 4M5YL 1V3KA 4ZXBD 2O5YL