1X5XA

Solution structure of the fibronectin type-iii domain of human fibronectin type iii domain containing protein 3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
109
structure length
109
Chain Sequence
GSSGSSGPSMPASPVLTKAGITWLSLQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCPDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibronectin type-III domain containing protein 3a
publication title Solution structure of the fibronectin type-III domain of human fibronectin type III domain containing protein 3
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 10
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1x5xA00
3L3IA 4WTWA 5IG7A 3P4MA 2PW1B 1W0WA 5C07B 5T33L 2V5SA 3AY4A 3QUMA 5ICZA 1CF8L 3VJ6A 2IALA 1Q0XH 1J18A 4X80H 4TNVF 5EC2A 4QF1A 3T4AA 3D0LA 3FHQA 4M4RA 1MCBA 3NACH 3IYLW 3B2VL 4ZS6D 5FGRA 3RJQB 4E41B 2L4OA 4L3CA 4P0DA 2F5BL 1ZLVK 2WBWB 4ALAL 5D8JH 1JWMA 3LKSA 3PJSB 5E99L 1NKOA 4BQCA 5B3JF 4Y4KB 1AD9A 1B2WH 1UWXH 4WEBH 1SEQH 3V6ZA 5C1MB 3ZT7A 5KSAA 3N0PB 4IS6A 1E0OB 4R3SB 5D96B 1JHTA 4NOBA 1DBKH 3M17B 5DLMH 3QWOB 5AZ2L 4X4ME 1PKOA 3UJIH 1C12B 4HWBL 3B2UD 3WO4B 3MRGB 1JF5A 5L2JA 1QD0A 4MNQA 5J1AB 2CDFB 4ZO8A 2QQQA 2UZIH 4D0CA 3OR7A 2XFXB 1P7KB 4NZUL 4OD3H 4PJGF 1WC7A 1U93A 3E3QC 4ZXBD 5IR1A 1QOKA 1TMCB 4XVUC 2Q76B 4KJPD 5TE4H 4PJHE 4WFFD 5GGRA 4G7VL 3KPRA 3GMMA 1ZVYA 2ENSA 3CSPA 4EI5A 4MAYC 4WNQA 2GJ6B 4LP5A 1INDH 4M61A 5CBEA 4JDTH 3FT4B 4TUJA 2CLVB 5C0CE 4CAGA 4HKZB 1Q1JL 1U8LB 1SVCP 4XNUL 5D2LB 2VJXA 1BD2A 4J4PC 3VD4A 4HUWA 3GSQA 1CYGA 1ED3B 4WRLA 5J8OA 4F9LA 2J1KA 4L3EE 1W8NA 1YZZA 1MRFL 4HCRL 4P46B 3U83A 4PRBA 1U8HB 3NCJL 3RWCB 2NY0D 1IGML 3QEGH 4G6FD 5C7XL 1PEWA 4PB0L 4IJ3C 1T2JA 5LXGH 1KACB 4WV1A 3VFTA 1A7RH 5AUMB 4DK3A 3HE7C 3UZEA 3H9SB 1RVFL 4PJBB 1U3HC 4RMWA 4PJXB 2H8PB 4LL9A 1LILA 4M7LL 5HVGB 4UAOB 2V2TA 4JN2A 4W81A 4P2QB 5DTFA 5E24E 5CJOH 5IEKB 5JQ6H 1ZLUH 5I73C 4ZMAT 4PTUB 1LE9B 4JKLA 2OXGA 4OCYL 3CK0H 1NDGB 4U0QB 5DJZB 2ZOKA 4PJGA 5A1AA 2NR6C 1BQHB 3T0EA 4X6DF 5IBTL 4ZTPL 3VWKA 2B5IC 3B9VA 2AJSH 3R0NA 2PXYC 2VZTA 3AREB 3OG6B 2IPKB 2GCYA 4YHIA 2YA2A 4KKNA 4YZFF 5B4MD 5I1GL 1RUML 1AH1A 5CMAA 1PKQB 5F3HA 1CLYH 4KKCC 3P4NB 2G5RA 3OXSA 2CD0A 2HAZA 2JJTA 2R2EA 5F1IB 3KXFB 4JHZA 4LCWA 3HC4H 4XBPA 1C5DA 2W07A 5SX5K 5A2KH 4BSJA 5IB1A 3GMOA 3S5LA 3UTTA 2D0HA 2WWKT 4BA8A 1HHJA 4JRYD 4XMLH 4XNZC 4HIXH 3VXMD 3RVTD 3V0WH 3W39B 2OM5A 1U41A 5TQ2H 2DD8L 3DSFL 5IM7B 3V4UL 3LH2L 5C07D 1VA9A 4C4KO 3FMGH 3HUJE 3VD9A 3GMQB 1HCFX 3KLSA 4NOFA 3LEXB 1DLFL 2A38A 5EBLA 1D6VH 3ARBB 2DQIH 3AAZA 3T65A 4NKOA 5KVGH 3MLYL 5JUEH 1QLRA 5L88H 3AROA 3Q1SH 2ITCA 5HHOA 1I8LA 1J0JA 2ARJQ 2M8XA 4GLRI 5FO8B 2WBJB 3IDNB 3ZSTA 2ZP0T 1ZWIB 3LKPB 4YX2L 3LKNB 5TE7H 1EAPA 4MZ2A 4WY7H 1IAOA 4TSAL 4XB8A 4X6DA 2OI9B 5F44A 2WK2A 1F4YH 4AT6A 3S96A 4WFED 5GGSA 2DJUA 4XP1H 3QHFL 4MJIE 1BQLH 5F9WB 3TT3L 2EXWC 1NLDH 5B21A 2B1AH 4Y7MA 3IAPA 4KI1A 5E2VH 5C0JA 5M7QA 3O6LL 1BF8A 3OG4B 5DFVD 5K9QG 1F90H 3ESUF 2OYPA 4HH9A 1REIA 2EDXA 4G8FB 3IJYA 3I6LD 3MYJB 1E4JA 2EZ0C 1AGCB 3RIAK 4LNRB 5TDNA 1BMGA 4L8BA 4H88L 1KPUB 4YXHH 4UIMA 4PS4L 5DEGB 4J23A 4Y4HA 4PV9A 1NLBH 4OCRL 1LE5A 3SGKC 1WWAX 4P5TA 4Y1AA 1B4JL 3TV3L 2IAMD 5E08H 4Z7WB 4R7NB 3RWGB 4HUXB 4MJ6A 3QNXA 1MCOL 1YYLL 3CU7A 2AV7B 3VFOB 4P3CL 3ZL4H 3PDGA 4KROD 1Q9OB 1R3LA 4JANA 3QIWC 4YHMH 1DQMH 2CJUL 4FQ1H 1S8DB 4R4FH 5BO1L 2BVPB 1IM3A 1IEBB 3EOYG 3IKCB 1NUFA 3GI8L 4PLOB 1NCBL 4OAWA 3O8XC 5D1ZD 4LAJH 1G7PB 2QJDA 4K3HA 5GSVA 3CPLB 4ZFZA 3QRGH 2PXYB 4UT9H 4P2QD 2Z31B 1UQSB 2ZPKL 4A2LA 3QDME 2BNUA 1PYWB 1QLFA 3L3HB 4J8RB 1FFRA 2R29H 1SQ2N 3AVEA 3U7WL 3DI3B 4RFEB 4EUPH 4N0YH 1G7JB 5HD8D 1H15B 3MRJA 1IAKB 1HWGB 3IS0X 3D39B 1MHHA 1UVQA 1G7HA 5BV7L 5K59E 2W0FA 1TCRB 2AEPL 3O3BB 2IQAA 1RUKH 4H20L 1LP9E 1J12A 4PRHD 4YHOL 1CLZH 4YHLH 3QEQE 2JTDA 3JV5A 1MJUL 3RUGE 4HPOH 2QQNL 4H0HB 4P23A 1CD8A 1RUPL 4U6HA 4EUPA 3NIDE 5FECB 3D6GA 2Z93A 3KXFD 4ZS7L 1Y6NR 3SO3B 1U3JA 2D7TH 1CE6B 1KCUH 2X4RA 2X4SB 4MNGB 3PGFL 5L2KE 2P7TB 4XPHL 3S34H 1IGTB 4FQQB 4Y4FA 1I9IH 1FYTE 5D1XA 4BZ2H 4CADA 3TYFB 3UDWA 4PUBL 2AJYL 4HS3A 4OFVA 2YS4A 4DN3L 2VDLH 5GZNC 1KIRA 4FZ8H 4EQ3A 3B3IA 5KS9F 1KN2H 4Z8FL 4JFFA 1JIBA 4OLZL 1AKJB 1YPZF 3RI5K 4U6YA 3ARDA 4PBXA 3MREB 3UBXA 4AG4L 1INQA 2FIKA 3GIZL 3MX0A 3BO8A 4X6CF 1N3NB 4MQSB 4NQDB 3DX9B 4CVWA 1KXTB 4N8CL 3C08L 5F6HJ 3A6CL 2WBJD 3QXDB 4U0RC 4GRLC 5I1EH 5FYKE 3GHBL 3MRPB 1Q9LB 2PCPB 2FWOA 5D6DA 1L9NA 4JFQB 4HWNA 4OZHF 3HE6A 4PIRF 3O3EB 4XVUD 1N59B 4GFTB 1EX0A 4NNPH 4GAGH 4TUOB 1MI5B 3QUXB 4GAYA 5C09D 4MAYD 1UYWH 2XKNB 3QAZC 4JO2H 2NY3C 4I3RL 3PDDA 3KPNB 5EUOE 3QEHA 1KB9J 1LK2A 4GRWB 1CFSA 1NBQA 1CZ8L 1N5AB 3MV11 4J4PD 3ILPB 1FZOB 3GK8H 3LEVH 5T3XL 2YKLH 3TH4T 5E5RB 3MRHB 3DUUB 2ZUXA 1ZLVH 3O11A 3IFNL 3IETB 3DO3A 4HJGB 3EOAA 4NQVB 3QIWB 1FL6A 1S7RA 3P9LA 4LIQE 2JIXB 3KPOB 1VGKA 4XC3H 4P5KB 4QRQB 3HE7D 4M8QA 3KYOB 1J0KA 4MAUL 1YDPB 5EFIA 1QKZH 2VQTA 1P4LB 3JTTA 4TYUA 5KS9A 3H9HA 4NQXB 4ZUVB 3BD4A 4HQQL 1BQSA 1YPZA 3RWEA 3X3FL 2XZAH 4N1CA 2VLME 1HE7A 4X6CA 3ARSA 4OF6A 1R3JA 4M6NH 1S7WB 4YDKL 3T2PA 3ZE1E 1BWMA 3TIEA 4EXKA 1DLHA 3WKNA 2F53E 4QRPA 2NR6D 1A22B 1EUTA 2JB6B 1P7QA 4P5MB 1SJEB 4OZHA 1R5VA 2ICWB 4NGHL 3C8HA 4NN7B 1RK1A 2PXYD 3SJVE 2JE8A 3LB6C 2Z31D 4WHDA 4KZDH 1QSFA 5HGBA 2XTJB 1BOGA 2OR9H 1NGWB 2ZCHL 4ZFOL 3KPTA 4F2MB 3ES6A 1YN6B 1G7QB 4Z76B 3RY6C 3PNWA 1A9EA 5ETUA 3D39D 5HVFB 5I74C 1OB1B 4NHCH 3FFCE 1RJZB 3MLZL 4OZIE 2E7HA 5E1AA 3OAZH 1K4DB 3ELAT 1CBVH 3DECA 3GSVA 4PJCF 1JF6A 3TIDA 5FF6B 1ACYH 3VD3A 3HG1E 3UYRH 4FZEL 1CDHA 5T1KB 1H3GA 1JPTL 3ESVF 3UTQB 4POUB 1DN0A 5GS1B 2ICEA 4JM4H 5E70A 5FDYA 4GXUM 1S9VA 1R5WB 1T6WA 3LQAH 5EUKA 2J8UB 5FK9A 2N56A 3CZJA 1CXHA 2EDNA 1F4XH 1Q72H 2IBZY 1JYXA 3E0GA 2PYEE 3IDXH 2RHEA 4G9FD 2ICCA 4QHNA 5KSUB 1DVFB 2EDTA 4KAQH 4OLEA 3BIBX 4XNMA 2YD1A 5BRZA 4O58H 3DTXB 5ALBL 4EDXB 3X3GL 1W72H 4U0RB 5M95B 5IFAL 2OR8A 3HI1A 1FFOB 2VABB 4XP9H 3EYFB 2DJ4A 1QR4A 5EOCJ 5E9DE 1JN6A 5GGTH 1HHHB 1WEJH 2H26B 1SHMA 1QFWI 2YC1A 2D9CA 1XF5B 1J05A 4AM0B 4BQ6A 4J1UB 2A6KB 4W4NA 4I48A 2A77L 2BY2A 3PWPB 4YGVA 3LPGA 5F21B 4NHUB 2IH3A 3QUKB 1YYML 2JLLA 4NQDD 4X4YA 4M48H 4X8JB 2EXWD 4JG1H 1OQOA 2AK4B 2NY3B 4M5YL 4HFUL 5ACMA 5BV7C 4G8IB 3C6SB 4AMKL 2EEDA 1W72A 1YEEL 2LE9A 5JOFB 2C7UB 3L3OB 4KU1A 5SX5H 1UCTA 4FTVD 5GGTA 3T3ME 2VLKE 2OL3B 2A6IB 4YXKL 1WIUA 4GMSH 4IRJC 3BHBB 1NMAH 3MO1B 5GSRB 3QUXD 2EZ0D 3M1BB 1YNLH 3X14B 4PJCA 4MSWB 2OLDA 3BYTA 3BGMA 1AGDB 2R23A 2PNDA 3WEXB 3K80A 3WUWB 4BM7A 4KDWA 1RJLB 3O9WC 1PFCA 4MCZB 5H2BA 1FZMA 4NSKB 4CJ0A 3GRWL 4RX4A 5DVNA 3RIAF 1GCFA 3GI9L 2V5YA 3MROA 1GZPA 1FAKT 4ZNCD 4XPTH 1AO7D 4DCQB 3QIWD 3QUML 3KYAA 8CGTA 2VLJE 1JNLH 2Z4QB 2PR4H 2JIXD 5D2NE 1NFIB 3DV6A 2C1PB 4OTXL 3VGHA 5J11B 4PJAB 4IRSA 1KEML 3O8XD 3VFGH 2V2XA 1KB5B 3QFJB 5BVPH 1T4KA 2BNRB 1ZHNA 4Q6IC 5HVHC 5GRUL 2ARJA 5ENWB 2Z91A 2X41A 4GS7C 2HLFC 3PQYD 3DVNA 2JCCB 4L8SA 4X80L 2IFFH 1T1WA 1WZLA 2VDPH 5ANMB 1UH3A 3FB5A 3NACL 1J0YA 4PD4J 1G6RH 5B3NA 4H25A 4XVJH 3KLAB 4NPYB 3F7YA 1QFWM 2H3NB 2R1XB 4RMRA 3NPZB 5D8JL 5E8EA 4D0BB 4RZCB 2BVUA 1MHPH 4YIQA 2MSPA 1U8PB 3C87A 5IP4A 3CDGB 1IE5A 1B2WL 2YPLA 3U9PH 4RA3A 1UM4H 4WEBL 5ID0B 4J3OC 1SEQL 4J7RA 3HMWH 3VGAB 2A74B 2XQBH 5C0GA 4O5LH 2YUWA 3OB0K 1DBKL 5DLML 3ROOA 3GGWA 3UJIL 5ESQA 2GYSA 1G6RA 2HRPH 3QG6B 1UB6A 3TN0C 3FT3A 4QHUA 1MJ8L 4QCIB 4QTIH 1HQ4A 1WSST 3MR9B 2UZIL 4DN4H 4OZFH 4OD3L 1P1ZA 1S78C 3VD5A 1Q9KA 4YDLB 4PGEB 1X6LA 5SWZB 3BJ91 1YQVH 4HUKB 5FFLA 3BEWA 4ETYA 1NAMB 3UCRA 3BD3A 5CZXC 2ARWA 5TE4L 3WL9A 1OP5H 2EKJA 1MCHA 3IFLH 4U31A 1B0RA 1P2CA 1XGPB 1INDL 3ARZA 4JDTL 1IGJA 1BZ7A 4UV7H 1MFDH 1OWRM 4FXKA 4RDQG 3SN6N 3L5XH 3P4OB 3IXAB 1A4KA 4GRLD 1F5WA 1ZLSH 2VLLA 3MV8E 3MUGB 3PHQB 1YEDA 4HFWA 4PLKC 2EIEA 3RI5F 3UJJH 4IRJB 5F9JB 1M71B 1SVZA 5BJTB 3MNWA 5HGDA 3PWPD 4YH6A 4CUCA 3QEGL 2GHWB 2D4DA 1U8JA 2VTFA 4WCYH 5LXGL 3RDTC 2NY3D 3OJDB 5C6PB 3EYQC 1A7RL 1RZJL 4P4RB 1RZ8B 3RPIB 3SBWC 3I6KA 3BZFB 4GW4A 2NXZC 1S7UA 4GKNA 1VKXB 1SM3H 1UWGH 4MNHA 3VXUE 5DYOB 5J06A 5JW4Q 1NANI 1GGBH 5CJOL 5JQ6L 4HUUB 3EYSH 2APFA 5F1SA 1M1SA 1NJ9A 4Z7QE 5FA4A 3CK0L 3KHOA 4APQA 3LN5B 4XXDA 1JGEB 3ZYOA 1NQBA 3ZLQC 3SGJC 5D6CA 2D7MA 3OX8A 4NCDA 4PV8B 1N5YH 2AJSL 3RL2B 4MHHG 5BZDA 5IKCA 4G6AC 1BEYH 5B38G 5FOJA 4G9DA 3FQTB 2H1PH 1CLYL 3P9WB 1S7SA 2ADJA 4YDIH 3CH8A 2OJEB 3V6FB 3STZB 4BUGA 2C4FU 3BP5A 3HC4L 4X4MA 4L9LA 3HZMA 2WIMA 1Y0LB 1KIPA 2VIRB 4QRSB 2MJWA 2P46B 3BPLC 3BYYA 4PG9B 5GISH 2BNRD 4XMLL 1KXVC 3LB6D 4J2XA 4ERSH 4HIXL 4P9MH 4NO0B 3V0WL 3QWQB 3RIFK 3ZDZF 5TQ2L 1YMMB 1A1OA 5DD1H 5CLWA 3B6SB 1MCSA 5IT2H 1Y18B 3WHE1 4FQXC 3P73B 4ELMB 1YEHH 4K2UH 1XF4B 4JM2C 3EHBC 4ZO9A 5AAMA 2ENYA 2R39A 4ZAKA 3FQUB 2IANB 1FG2B 2DQIL 4M93C 3EUUA 5SV3A 5KVGL 4XWGL 5JUEL 5L88L 1KIQA 3Q1SL 3M45A 4ZTOH 3QUZA 1CXLA 1TLKA 2MOVA 1A3LH 5EZLB 3T4YA 4LLWA 1DQDH 5TE7L 4L3EA 5IESH 3D0VA 2O5ZH 1S9XA 2HMID 1FIGH 3AY4C 5FAAA 1F4YL 4PJDF 2ERJC 4PJFE 1DQLH 4XCCH 1RZKH 1QPPA 2AJ3B 2OSLB 3C5SB 1WISA 1BQLL 2VR5A 1CLOL 4MQ7A 1RZ7H 1QLEH 1NLDL 1FVEB 3LSOA 4V1DB 3G04A 5E2VL 2AXGA 4GG8B 3INUH 1F90L 2HKHH 1RULH 1H3PH 4IMLA 4RGNE 5KZCD 1YNTB 4XX1G 5HYSG 3G9AB 1Q94A 3BE1H 4ISVB 5KSBB 4AIZA 2GSGA 4Q2ZA 4QHKJ 4YXHL 3V5DA 2VNCA 5FIEA 3EDFA 1CIUA 4QKXB 5GJTH 43CAB 1GSMA 5EOCL 1NLBL 5KANI 3CXDL 2W60A 1PEZA 1R3IL 5E08L 2HT2C 3H6JA 5KG9A 5I66A 5FKAA 5C0AE 3HR5B 3SDAB 2GJJA 3K8KA 4IRJD 4TTGA 2VITA 5JIPA 3MRKB 4RAUB 4YHML 1DQML 3QQ4A 3T8XA 4MJ5A 5CP3H 1OSPH 4R4FL 1NGZB 3CFEA 2BMKA 1Z9LA 1U91B 3VXME 4N8VA 4QOKA 1F58L 5C07E 3WLBB 2A9MH 4ORGB 3EO0B 3O9WD 3QRGL 1XCQB 4UT9L 2P8MB 4NO2A 5HI3C 4CU8A 4F9LC 5DRZA 1FNFA 2UZXB 3CFIC 5GPRA 3ZDXE 1K85A 2R29L 3QFDA 2HFFB 4E41E 5CP3A 5EB9A 1CTOA 3TC9A 1AGEA 1JUFB 4HUMB 1J1XH 4PLJC 4JGUA 3CVHH 3U30C 3HAEB 4XCFH 1T21A 2CH8A 2GAZB 2VO5A 2C1OA 4M3JA 5I2IA 4RISH 3JV4A 1DSFH 1A7OH 3QO0A 4X9HA 3IDMA 1NSNH 2R0KH 4OFYD 1JZ3A 3G5ZB 2GIYA 2A6DA 2VXSH 5EO1A 1O7VA 4HPOL 2FL5A 2HLFD 2AJZA 5IB4B 4U05A 3QNZB 4IBLT 3J8F7 4LDLB 1BBDH 4JFEB 3BN9C 2D7TL 3CGTA 4JM2B 1CFQA 1J9CT 4LSDA 1QRKA 3HHRB 3BH8A 2BVOA 3CVHA 1KCUL 1ZAGA 3SKNA 3K8MA 3MLTB 3X11B 1RZJC 5CILL 3EO1A 3MZTA 2WINB 4S1RH 1AXIB 3S34L 2WUBH 2PTTB 4TN9A 4RAHA 5DMKA 3ULUC 3VWKC 4HG4J 4YXLL 1I9IL 4QLRA 4NO0D 4RDQF 5INDA 3RWIA 3WV0A 1T0NA 5T3XD 3QQ3B 3O3DA 4BZ2L 2GJ6E 3LHPH 4ZFGH 1IGCH 2VDLL 5EH1A 4H0IA 4TVPH 4FZ8L 4HT1H 1I7UA 1ZK9A 1A6VH 4G7YL 3T04D 3TH2T 1KN2L 7CGTA 5D2LE 1JZ7A 3LVEA 2IALB 2IAND 2ERJB 3ZKXB 4QF1B 3T4AB 3D0LB 2R69H 2P8PA 1CD0A 4JCMA 1GYAA 4O2CA 3QB7C 4KV5E 5E94B 1S78D 3NPSC 4YFLI 4L3CB 1H5BA 4J3WA 1QBBA 1RZFH 3QCVH 4PGDB 3LKSB 3EIFA 5HBBA 1IL1A 2ZOLB 3G5VB 3UTSA 1AD9B 2FLRT 4NNPL 2X4NA 5CZXD 3V6ZB 2Q1EA 3H9SE 3THMH 2FGWH 4PJBE 5GRXG 4PJXE 5KSAB 4IS6B 2GT9B 1JHTB 3D69A 1EEYA 1UYWL 4NO5A 4PRAA 2PUQT 1FFPA 4DK6A 4JO2L 3QQ9C 4NJ9L 4LBEA 3IDYC 4P2QE 1DANU 2IC2A 4V1DD 4WI6A 5DJDA 1T20A 4DZBA 2EE2A 3O6FA 1NGXB 1D5ZA 1I8LC 2B0SL 4NBXB 3ULSA 1ND0A 3UXFA 1A6TA 3LEVL 4OLXH 4PLKD 4QNPF 5DQ9A 1U93B 3QDMA 4PGCA 4R0LA 5IR1B 3K46A 2QHRH 3R06A 4RQQA 3U7AA 1FP5A 4XGZA 3SKMA 4O02L 1XR9A 3RDTD 3KPRB 3GMMB 3EYQD 4EI5B 4PRHE 4XC3L 3U48A 3LEYH 5CBEB 4TUJB 1PKQE 1LNUB 2NXZD 1QKZL 3VE0A 2E9WA 1IZKA 3KXFE 4XPGH 1FSKB 2X44D 1BD2B 4EN3A 1QEWA 4LLYA 2XZAL 1NCDH 4KRPB 3EJYC 4NZJA 1F02I 4M6NL 1K9TA 3A67H 3BW9A 2GEEA 5IOPA 4PRBB 3GMRA 1FNEA 4PRDA 3B5TA 5DURD 1HN1A 1KTLA 2H9GB 4LLAA 4PRIA 4WV1B 4Y4HC 4I3SL 3VFTB 3DBXA 1ACZA 1R6VA 4FA8A 4P5TC 4QHLA 5F6HI 4KZDL 5BS0B 4G6AD 5GRJH 2RB8A 3RAJH 2V2TB 2OR9L 4JN2B 5J3HC 1WAAF 2CRZA 5I15H 3TH3T 1KCSL 5DTFB 4DFHA 1HILA 2I26N 2JJVA 1CU4H 4JRXB 3AGVA 1C5BH 4NHCL 1ZLWH 1A2YA 3ARXA 2ZOKB 4KDTA 4PJGB 5E7FA 1I75A 4X5XA 1CBVL 3MFFA 3T0EB 2BX5A 1IFHH 2UY6A 3VWKB 4EVNB 1ACYL 4U6XA 3UYRL 2BSSA 1UH2A 3MBXH 4BSWA 2GCYB 4YHIB 5DJCA 4JM4L 3EJJX 1QBML 1ZS8B 2D7QA 4DKDC 3LQAL 4FQXD 5DMGC 2AEQL 1VGEL 4JM2D 1F4XL 1Q72L 3EHBD 3GB7A 4I5BB 4ZOCA 1KTDA 1XGTA 3CDYA 3IDGA 3IDXL 1BZ9A 4JO1L 4LCWB 1GOGA 4KUCF 4X6FA 1ZMYA 4KAQL 4XBPB 1C5DB 4XT1C 3VFMB 5MEPA 3MCKB 3RIFF 2YUVA 1XCTA 4O58L 5IB1B 3GMOB 3L7EB 1W72L 3S5LB 3UTTB 4X7FC 2J2ZA 3VWJB 1HHJB 1LO5A 4XI5C 4XP9L 1EHLH 5E56A 1T22B 5GGTL 3CSBA 2VSCA 5IB5A 4ZPVB 2CK0H 4P23C 1JTTA 3NFSH 5DJYA 1XZ0A 2EDBA 4EIZC 3GSNH 4J6RH 2HG5A 4JY4A 1TVDA 2OP4H 1CN4A 2LVCA 4LDOB 3RZCA 3SE8H 4Z7WE 4M48L 4JG1L 2CR6A 4OZGF 5EBLB 1WAAA 3T65B 4NKOB 5HDQH 1L4IA 1TZHA 1QLRB 2A2QT 4JFPB 5HHOB 5IJKC 4Y4FC 5JOEA 3IFPA 5I19H 4U6VL 1UXWB 5D1XC 4YFEA 3DMMA 5BVJB 3I2CH 4N0UB 1MWAA 3UDWC 1F2QA 1NMAL 4OI8A 3GSNA 1EAPB 1YEIH 1FZKA 4JLRA 4D3CH 5KSAD 2XZCH 4HKXA 1IAOB 1YNLL 5IHLB 3C8KB 4X6DB 2UVFA 3SDXA 1FFQA 3MLPA 1VERA 3S96B 3ARDC 4XZUA 4MNQD 4NQTA 5DRWA 4K71B 4C54A 4CW1A 2DICA 5B39G 3WIFA 1D5IH 3W0WA 2HT2D 3D25B 5HYSA 3QPXH 1CK0H 2BK8A 2VDMH 5C0JB 3N85H 3RTQC 2BOCB 3D39E 3PWJA 4MQXC 4HH9B 4PJIF 3HE6C 3OKDB 4XPTL 1V7MH 3IJYB 4KMLB 4HWZA 2CLRB 5I1DA 2PR4L 3KPRD 5GS2H 1RU9H 4GG6F 5TDNB 5ILTH 4L8BB 2VB5A 5F70A 4FMFA 1XGYH 5FUCC 3VFGL 3UPRA 4HGWB 4PV9B 1JJUA 3OXRA 5FYJH 3I6GA 3QJFB 1BD2D 1JPSH 4I4WA 5DD0H 5HI3D 5GQBA 4MJ6B 2Q86B 1OLLA 4G9FE 5GIRB 4MNGE 2ZCLH 3TGXA 2HT3C 4G6MH 4XNQB 2IFFL 4MCYB 4JN1H 1I1AC 1R3LB 4JANB 1GGCH 4PLJD 3E6HA 2A1WH 2OK0L 4F15B 1IM3B 4XVJL 1NCCL 3QIBA 1I3UA 4M7ZC 1CWVA 1MHPL 1YUHA 5GRWA 2WP3T 2YZ1A 3O2DH 4ZFZB 2YRPA 3U9PL 1UM4L 2F8OA 5CKAA 4ODWA 2KQNA 3ZE0E 1SMOA 1S9WA 3HMWL 3TVMB 3WE6A 2BNUB 2XQBL 4NQDE 1QLFB 4O5LL 5DHYA 3LV3A 3BN9D 5GRZA 1MELA 5AWNH 2FLBT 3FN0H 4AEIH 4J3XA 4HEME 4LF3A 5ACZA 3RFZC 4QTIL 3QR2A 3T0ED 25C8L 1UVQB 1G7HB 1Z5LB 1OAYH 4JFXA 3VWKD 5AD0A 3O2DA 5J9PA 2W0FB 1MI5E 2IQAB 2ICES 3B9AA 3RWJA 3CFKA 2LV4A 1SJXA 2VLKA 1GGUA 1YQVL 3TNMA 2DBJA 1VADB 2KBGA 1P84K 4MMXC 2Q8AH 3IFLL 4JAMB 4EUPB 4GRWE 2Z93B 2FEEL 5J4MA 2FJGA 4LCWD 5A2LH 4UV7L 1MFDL 4XB7A 4C4KT 3V95A 3HZKA 2X4RB 3L5XL 3QUYB 4AIXA 2EEBA 1LO4L 1H3WM 3UTTD 4PJ8A 1ZLSL 4Z7UF 3BPOB 2FHBA 1UADC 2FECL 4FQLH 4NN6B 2E7BA 3FO9A 2UUDK 5D1XB 1RV6X 1TJHH 3MSPA 3UJJL 4CADB 3DV4A 1ZVHA 5DD6B 5DJ0A 5JDSB 3LIZH 2LTQC 3QXWA 1KIRB 4Y19B 1OARH 1H8OA 3B3IB 3R1GH 5EU7E 4WCYL 3QQ9D 4I0CC 4LSRH 1P69B 4Z7VF 1GPOH 4U6YB 4QRRA 3ARDB 3GSUA 4G80A 1PX4A 2FIKB 3BO8B 1K8IB 4I9WE 2Q20A 2MPAH 3S6CA 5HHOD 5JLZA 1SM3L 1UWGL 3LKRA 3PQYE 4JFOA 2FBJH 5IW6A 5KAQG 1WIPA 3PGDA 2FWOB 1C1EH 1GGBL 2L7UA 4O2FA 4Y5VC 5EBWA 4MS8C 3ZYJA 2VH5H 3KHQA 4JZOB 4NDMA 3LQAC 3Q6FA 4GO6B 3GSWA 4LPTA 1TCMA 1MRDH 2ZKHH 2GITA 1ZVSB 2XTJE 5GJSL 3LS5H 4JHWH 4KGJA 2P45B 3QEHB 3ZTJG 4X7CC 5HDOA 3KR3H 5ITFA 5IWLA 1BEYL 1ZE3C 5I8EA 2H1PL 1FLTX 3TBYA 3EJYD 2R0WL 4YDIL 1FNGA 1WWBX 4XPBH 4UT7H 3WNPA 3SCMA 4OSUH 1IKNA 3EOAB 1KOAA 4UT6H 3FAWA 4EOWH 1FL6B 2EO1A 1ORQA 5BXFA 4Y4HD 1VGKB 1U3ZA 4F9PA 2MNUA 5GISL 4EI6A 2CIKB 5FCUL 2LVEA 4P5TD 2J8UE 3P77A 4M7ZB 4Y1AD 3WNOA 5EFIB 4ERSL 4P9ML 1JI1A 1EHAA 5KS9B 1F42A 2FYYA 2P5WA 5J3HD 1EXUA 3KS0H 5DD1L 3OKKB 1YPZB 5C08B 2WNGA 5IT2L 4AQOA 1DL7H 2C3GA 4X6CB 4DUWA 1YEHL 4K2UL 4LSSH 1K8DB 1ZT1A 3TIEB 1DLHB 3MV7A 1T04A 1TQCC 2WBKA 3MJ6A 4PRPD 3WKMH 5DUBA 3CZFA 4QRPB 2C3VA 2MCPH 3BJLA 4M9OA 1BVLA 3CFJB 1P7QB 3VFPA 1AIFA 3N1MC 4OZHB 4YHPA 2ZG3A 4ZTOL 3T2NH 2Y25A 5I8CA 1A3LL 2Z8SA 1BJMA 1Z3GH 3PWPE 4OCMC 1VFBB 2DBLH 2FO4B 1QSFB 5IESL 2O5ZL 1UACH 5J13B 1BOGB 5FXCH 2AK4E 1FIGL 4P2OB 5DMGD 1UWEH 1HKLH 4OKDA 3W9EB 5E6ZA 3ES6B 1DQLL 2ZNXA 4XCCL 4OBRA 1RZKL 1HI6A 3GIVA 4U1IA 5CJ8A 3PNWB 3S35H 2JK5B 5ESAA 4HD9A 1RZ7L 4MA1B 4PRNA 4WFHD 5I17A 1YEJH 1IAIH 4U3HA 5E1AB 1CD9B 5JPMA 3H42H 1SYVA 1N26A 3GSVB 3INUL 4XI5D 3ZKSD 3TIDB 1RULL 1H3PL 1AXTH 5DQJB 3F7RA 3FT2A 2XY2A 1TXKA 3BE1L 4HV8B 1DN0B 4P23D 4G8GB 3HS0A 3QCUH 3NN8A 1MIEH 4XP4H 3Q6GH 2D7PA 1N6VA 4NRYA 2JJSA 5GJTL 1F4HA 2J5LC 2I24N 1YC7A 5DZLA 3LRGA 4DUVA 2GTWA 3FRUA 3MBEA 3SQBA 1HH9A 5T1DH 4HUNB 1U8QA 5BRZB 4Y4FD 4EEEA 3MZGB 4LCUB 1MQKH 4FQJH 4E0RB 1INEH 5D1XD 1LK3H 1I3RA 5I30H 1MCCA 4F58H 1JN6B 2VZUA 5JIIA 1F4AA 4PJAE 1J05B 2X40A 3MRBA 2CR3A 2Q3ZA 3QFJE 4YHYB 1RAMA 2KQMA 4JFFD 3HB3D 4I48B 3CUPA 4AEFA 3NZ8A 3ARDD 2BNRE 4S1DC 1FORH 1EIBA 1F3JA 2B8OT 2APWA 2IH3B 4GAFB 1NFKA 3AUVA 4LCYB 3NMEA 2A9ML 3W9DA 4JY6A 2JCCE 3DXAB 5D7JA 1HHIA 3AB0C 3HLAA 1XFPA 5CIPH 2Z8VC 2DYPA 3CVIH 4KRMB 5ANME 3QZWG 3RTQD 4MQXD 4WUKH 3BPCA 3HE6D 1IBGH 4OLWH 4HIIA 4HWEH 3QEUA 5K9QI 2WWMC 3L3DB 1A3QA 5DQDL 4WIQA 1J1XL 4XXCA 4PJCB 5EOQH 2IQ9H 3CVHL 2B4CL 5B39A 4BFIA 1WZ1H 3BGMB 2JJWA 4RISL 2DKMA 1DSFL 1A7OL 2PKDA 1NCAH 2BVEA 1NSNL 1R5IA 2G2RA 5E4IA 4LKCB 1ZT7B 4FQHA 2VXSL 2GY5A 1XGQA 3JV6A 5H2BB 1E27A 3HNVH 4JFZH 1MF2H 2Y7QA 3UYOD 2HT3D 4W6WB 3PGCA 4OD1L 5IV2B 1BBDL 3MROB 1I1AD 1GZPB 1A14H 3MXWH 1SJVA 4APQC 3F6IA 5JQHC 1IMHC 5SWZE 1FE8H 1U8OA 2K1MA 2WUBL 1NFDF 2P4AB 3PWVB 1RUAH 4IRSB 1KCVH 5DJAA 4R7DA 4OZ4A 5GHWH 3C09B 1NEZA 1GRWA 1E6OL 5LG1A 3LHPL 4ZFGL 1CE1L 1IGCL 3TYGH 3TT1H 2ARJB 1FGVH 5F3BA 4TVPL 4OLUH 4HT1L 4K3JH 3D5OF 1A6VL 3DVNB 3JWNC 5IW3A 3C6LB 4L8SB 1ZA6A 2R69L 2VWEE 3IDJB 3FB5B 3CX5K 1D5MB 1P7QD 2GFBA 3LZFH 3P0YH 4H25B 5LCVH 4F7PB 5JHDA 1T1ZA 2C4XA 3ORJA 2HTKC 3X13A 2YD4A 3QCVL 5KTEH 4PY7B 1KELL 5E03A 4X83A 1I85C 4L8DA 2H32H 4YIQB 4G8EA 1T1YB 3CD4A 2YPLB 5KAQF 2UWEE 3GJEA 2DM4A 1CICA 1QUNA 4TRPH 4PPTA 2BHZA 3THML 2FGWL 2ZJSH 3D18B 5MP6H 3ROOB 4ZAKC 3GGWB 1TTUA 5ESQB 1G6RB 2J5LB 2NY7H 3DX8A 4JFDD 3FT3B 5DJ8A 2P5EA 2PW1A 1HQ4B 3CLEH 3RWFB 2H32A 3QUZC 4UQ2A 1Q9KB 5JNYB 4HK3N 1CL7I 4HZAA 4M1GL 4WUUD 3CU1A 3QP3A 5EPMB 5F1OB 2QHRL 1YY9C 2VLRA 2VDQH 1NCTA 4E41A 3BEWB 4P2RA 1KG0B 3MV9A 2A0LC 3PJSA 1B0RB 1FVCA 3LEYL 1IGJB 2EYSB 4JKPH 1CFNA 4FXKB 3PWLB 1EDQA 4XPGL 3T3PF 4RNRA 2FEEI 3M17A 2VLLB 3BDYH 1JZ5A 1C12A 4MS8D 2X4UA 3Q0HA 1NCDL 2C3XA 4HFWB 3MRGA 3E2HB 5J1AA 2FJFA 2CDFA 3A67L 3ZDYF 4P2CG 2UYLA 5EWIH 4Q9QH 1D6EA 1P7KA 1RZKC 5HGDB 3KS0J 1TFHA 2FECI 1U8JB 3WD5H 1YMME 4P2YA 4PTTB 4PG2A 2RAMA 2OMBA 4LAQH 3MJ7B 2HVJB 3I6KB 2Q76A 3D2UB 3DVGA 1S7UB 4ELME 1DP0A 5FYKL 5GRJL 3RAJL 4MNHB 3PP3H 3NIGE 5I15L 2IANE 5CSGA 3FT4A 4A2MA 1F45A 4HKZA 5AEAA 1U8LA 5JZ7C 1W0VB 3SDYH 3ME0A 1CU4L 3RBSA 5L7XH 1NJ9B 2X1QA 1C5BL 5H37G 5FA4B 1WZMA 1ED3A 3NGBC 2XWBA 4XXDB 2XNAA 2YBRB 4AEHH 5J6HB 4U1MA 1EGJH 2KL6A 4YC2C 5D6CB 4QO1A 3OX8B 1UM6H 1CDGA 3MBXL 1E28B 1U8HA 5BZDB 2BY0A 4FFVC 5IKCB 2QSVA 1DQJB 4XBGA 5AUMA 1BAFH 1HSAB 5DJ2A 5DC9B 3U4EA 4V1DE 1KJ3H 4PJBA 4PJXA 4RIRA 1I3VA 3BGFB 5ADOH 4L9LB 4GRMB 3HZMB 4M02A 2I9TB 5SWSB 1EGJA 1X5FA 2ZUQB 1DBJH 2W91A 5F6IB 5KSBE 1MEXH 5D7IF 1LE9A 1EHLL 2XT1B 3C5ZC 4K9EH 1EHXA 1NDGA 2MQ3A 5DJZA 5GGQH 3TPUA 4Z7NF 2EDFA 1A1OB 2CK0L 3B9KB 4LVHC 3NFSL 1JTPA 4U1JA 1XGRA 3GSNL 4J6RL 5D71H 1B4RA 5GGUA 1V3JA 1LHZA 3SE8L 3AREA 2IPKA 1LDSA 4ZAKB 2B4CC 3AMLA 3O4LA 3WBDA 5HDQL 1OCWH 3P4NA 1C16B 2F54A 5F1IA 2APVA 4JPIA 5I19L 5GRYA 2YPLD 3I2CL 5EORH 5BQ7B 4LLWB 4KKAC 3OBAA 1JHKL 3RVWC 1YEIL 4D3CL 3D0VB 2XZCL 1U8NB 1EFXA 1S9XB 2R2BB 5JIKA 4H1LG 3D85B 5C0BA 4HMEA 2HJKA 2Y5TB 1CI5A 5KOMC 1RI8A 3H9ZA 4NRXA 3UYPA 4LHUG 6CGTA 2E27H 1D5IL 3G04B 1IARB 1TVHB 4LEXL 3SPVA 4BH7B 3QPXL 1CK0L 1H5BC 2VDML 3DYMA 3N85L 4FQPA 4JHAH 3TO2B 3ARBA 4S0SD 5FUOH 1V7ML 1B6DA 1MJJB 4OIIL 4DGVH 1FV1B 4G42B 4NFBA 1Q94B 1Z0NA 2FBOJ 1Y6MR 4KTEL 2C3WA 2GSGB 4Q2ZB 5D7IA 1Z6JT 5ILTL 5EDXA 2CUIA 4XCNB 2CKNA 3LKPA 1HXMB 1XGYL 2EDDA 3GO1H 1QSEA 3LKNA 4W6YB 5J12C 3TM6A 1CIDA 5FYJL 3O6FC 3EDEA 1WFUA 2W60B 4WU5A 3EDJA 1JPSL 1BX2A 2EEAA 5DD0L 2M2DA 3MOBH 5CZVL 5EG6C 3F7VB 5FKAB 5I66B 5JR1H 1AHWC 2ZCLL 1S7XB 1AXSA 4G6ML 1A3RH 4R0LC 3GNMH 4MDIB 4JN1L 2WWMD 4JFHD 3VMPA 4JZJA 2GUOB 1WV7T 5C0FB 1JNHA 1GGCL 3T8XB 2X09A 4MJ5B 1TJGH 3HUJF 3DETC 2BMKB 3NBNA 4G8FA 2WV3A 4N8VB 5E00A 4QOKB 3OGCB 3QZWA 3O2DL 3MRIA 1AGCA 4M4PA 5FO7A 2DMCA 3GJFK 4PJDB 4EN3C 5DEGA 4NO2B 5DRZB 2NW2A 1FPTL 3QFDB 1A21A 5IJVA 5AWNL 3FN0L 4AEIL 3K81A 2LABA 4KJWD 4APQD 2QSQA 3BPNC 2VQ1B 4Z7WA 4R7NA 4F7CA 1AGEB 3E6FA 5A3IC 3QIUA 1OAYL 2XV6B 3TLRA 2PO6A 2YMXH 1T21B 3WFEH 2C1OB 1Q9OA 3L3GB 3JV4B 1YJDH 3ULVF 1P4BH 3IDMB 1A7PH 4JO3H 4S2SB 1QBAA 1IEBA 2VR4A 3SQOH 3DX6A 2EC8A 3IKCA 2FL5B 2Q8AL 2XTLA 3V8OA 4FFZH 1BGXH 2YZ8A 4MNQE 1M4KA 2JB5H 3CPLA 3BH8B 3CVHB 3ROLB 4KDTC 4TPRL 3UP1A 4NBYB 4RGMB 3EO1B 1D9KA 3KPLA 2HTKD 5DMKB 1HSBA 2QV2A 4FQLL 4LEOA 3TBWB 4BZ1H 5INDB 2BCKB 3C60A 1TJHL 3KPRE 3O3DB 4N1EA 4TUKH 3TBTA 3MXVH 3LIZL 4LK4A 3A6BH 1WCBB 2FIRT 4F57L 3CSGA 2F5AH 4DZ8A 1OARL 3R1GL 5IFJA 4ZAKD 4LSRL 3RP1A 1GPOL 3QNYB 4OCXH 4OJFL 3AS1A 1BD2E 2RIKA 2O93L 1O5DT 3G6DL 2P8PB 4ONFH 5TF0A 4KWUA 3UJTH 4HX1B 2MPAL 1GOHA 4O2CB 4PP1C 4X9FA 5FECA 4O2EA 3S4SG 3QUZD 2GJZB 4R8WH 1OTTC 1C1EL 1CE6A 2JKXA 4PJ9B 3E8UH 4L3ED 2VH5L 2X4SA 1IL1B 1YY9D 3UTSB 2P7TA 2XN9A 2X4NB 1IGTA 3K2MC 3FQNB 2A0LD 4FQQA 4NP4H 1XR8B 2ZUUA 3D69B 3RZCC 1FFPB 3LS5L 1A64A 4LBEB 5CFHA 4MXQC 1T20B 4DZBB 1EEZA 2ITDA 3KR3L 1D5ZB 2W38A 3ULSB 1ND0B 1AKJA 5K59F 2AV1B 1EO8H 2AEIT 4JRXE 3ABZA 3DMMC 5DQ9B 2IH1B 4NZDA 4PJGE 4PGCB 4XPBL 3NFPA 4UT7L 3DHJA 1V05A 4JFYB 3T0EE 3QXDA 3R06B 3GBMH 4OSUL 1JTOA 1DBMH 3SKMB 2YEZB 1Q9LA 2PCPA 3T0VA 3I9GH 4POZC 1CDIA 4F80A 5BCAA 3R8QA 3D48R 1K3IA 4NZTH 4TUOA 2X70A 4FXGA 1SEBB 4NKMA 4QRTB 4LCWE 5AAWA 2XKNA 4FQ2H 1QEWB 1DL7L 1XAUA 3AFLA 4LLYB 3KPNA 1KJMA 5HJ3B 2EECA 2BXYA 5JZ7D 1ODAA 4LSSL 5JPNA 5H37H 2NPLX 4EZMA 3UTTE 1OPGH 5DD3H 5IOPB 4TOYH 1UKQA 2NYYC 3ILPA 4NN5C 3WKML 5HHMB 2AQ3A 1HINH 2YWYA 2BHUA 3QO1B 3GMRB 3MRHA 3VDBA 2NW3B 1LMKA 4ZFFB 1KTLB 3DUUA 4P99A 3T2NL 2IBZX 3DBXB 3O2VH 3CC5A 5T3ZE 4NQVA 1Z3GL 4MQTB 2COQA 1L6ZA 2DBLL 4FFVD 1UACL 5A43C 1J87A 1UWEL 1HKLL 3VI4F 1RSFA 3MRQB 4GW1B 1YDPA 1HILB 3S35L 1S9KC 2LU7A 5HHOE 1IGIH 5F97E 5CBAA 4ZUVA 3BQUA 1OGTB 2YPKA 3PL6B 4M6OH 4MVBC 4N0UE 1IAIL 1Y6KR 4X5XB 3ET9F 5TH2A 2D0GA 3MFFB 4HDIA 3OKOA 3QIBC 3GM8A 4XPFH 2XXMB 1S7WA 1J0HA 4F3FA 3C5ZD 5B38B 4X6DE 5EUOF 1AXTL 4U6XB 1BBJA 2BSSB 1G0XA 4BSWB 5LQBH 2XACC 2QSCH 4PREB 2JB6A 3QCUL 1FLRH 1MIEL 4XP4L 3Q6GL 5ID1B 5JW5B 3BDXA 1SJEA 4YZFE 3VXRA 2ICWA 1FFNA 4DW2H 3GB7B 4YEEA 3BOVA 1XGTB 3MRNB 1BF2A 3P9MA 5TQ0H 1BZ9B 1J11A 2YD9A 3FOMA 5T1DL 3RY5A 3RNKA 4YWGL 2Q8BH 5J7CC 1MQKL 1YN6A 4FQJL 1G7QA 1PJ9A 1INEL 1LK3L 5F7NC 1LO5B 4CL7A 1MRCH 5I30L 3RVWD 4KKAD 3ZE2E 4F58L 5C6TH 4DQOH 1RJZA 1QSZA 4LLMA 5IB5B 1RMFH 3U82B 5GGSY 4EIGB 5DJYB 1XZ0B 2HG5B 1FORL 3WIIH 2AI0H 5LVEA 5T1KA 1J1PH 3UTQA 5GS1A 4P59H 4C83A 3OJ2C 4I0PA 4PJ8C 2AS5M 4KH2A 1TZHB 3TA3A 2X2YA 2ESVB 3CVIL 3IFPB 4TVPD 1IBGL 4OLWL 5KSUA 1MWAB 4HWEL 3LKOA 1FZKB 4JLRB 4Y5YA 4HKXB 1X5JA 4P4KB 2G60H 4LHUA 5EOQL 2IQ9L 5D2NC 3S3PA 2VABA 4R6UA 5C0RH 1WZ1L 4U1KB 1CGSH 2X4QB 4ONGH 4XZUB 1XF3B 3DRQA 3EYVA 2OL3H 4HPYH 4EQ2A 3O6FD 5DRWB 1J1OL 1XF5A 3LAFA 4KK6C 4AM0A 2P48B 1NCAL 3ZTNH 4J1UA 3OAUH 4PBVC 3L7FB 5I1KH 3WIFB 4J3UA 4OZIF 5F9AC 3W0WB 1MLBB 5JW3H 4WI3A 5HYSB 2DDQH 2LFGA 3L3KA 2KH2B 3HNVL 3QDMD 4JFZL 4M62H 1MF2L 4X8JA 1OF2A 2I07B 2AK4A 3PWJB 4G8IA 3S37H 4WFHE 1A14L 3MXWL 4OCLC 4LCCB 3VRIB 5JOFA 2C7UA 1G7LA 4HWZB 3WS6A 3DETD 3FONA 4NN5B 2F74A 1FE8L 1SY6H 2OL3A 1NC4A 3KJ4B 5C86A 1RUAL 1KPRA 2ED7A 3UPRB 1KCVL 3SE4A 3MO1A 3OXRB 2MTPA 3I6GB 2OZ4H 1YA5A 5IQ7H 1F2XK 3TYGL 4I4WB 3TT1L 4EN3D 5IWLC 1FGVL 3EOTL 4OLUL 3KYNB 4K3JL 4U1SB 5I1CH 4YQXH 3VFVA 5I9QC 4OZGB 5HY9A 5IUSA 3BISA 2HYMA 4K94H 1RJLA 4AL8L 2NZ9C 1KB5H 3SCMC 5HHMD 1IKNC 4MCZA 5JW4M 4NSKA 1AFVH 4WHYG 5A3ID 4JQXA 5H35A 4PRID 4U1HA 2HWZH 3P0YL 5LCVL 4F9PC 4I0KA 4H8WH 5IB2A 3CXHJ 2OZ4A 3BP7A 4Y19E 3SE9H 4Q9BA 3ARPA 4G6JL 4TQEH 1R24A 3H0TB 4TRPL 1XEDA 4PJAA 3NAAH 3WE6B 2ATKB 1IC1A 2ZJSL 1JBJA 1KB5A 3QFJA 5DHYB 2Q87A 3LV3B 5HHNB 2VZ3A 5DK3A 5IVOA 5MP6L 2BC4B 2ZSWA 3G6AA 4LF3B 4JY5H 3LOWA 2NY7L 1TETH 4N1HB 5J1TC 4M1DH 3CLEL 5JXEA 5KW9H 2E9IA 4PJIB 5FYKD 5J9PB 3FQXA 1VACA 5B8CB 4U1GC 3RWJB 3CFKB 3O4OC 3RU8H 4LP4A 4DVBA 4GG6B 2VDQL 3Q3GB 5HYJB 4I1NB 5FUCE 4JVWA 2SEBA 4NPYA 2H3NA 2R1XA 5D7SH 2R9HC 3K3QA 5EC1A 1MREH 4N5UA 2FJGB 2AKRB 2YSSB 5ID0A 4WI2A 5K33A 3HZKB 1TQBB 4PP1D 2VSDA 3LD8B 2A74A 3RQ3A 5IVXF 1OTTD 2DLEA 3BDYL 2FCBA 3SDCB 3QG6A 4OB5H 3FO9B 1T89A 3FOLB 4WU7A 1B6UA 4K3DH 1C7TA 3DV4B 5EWIL 1WTGT 4QCIA 5DJ0B 4Q9QL 3F7PC 3GJFA 5FYJU 3REWB 1WITA 4CJ1A 5F89A 2JJSC 3RZCD 2E5EA 1J86A 1RJYB 1WZKA 4JRWA 4NWTH 3WD5L 5KS9E 4PGEA 5SWZA 5F93C 3FCTB 4ZO7A 3DUSA 4QRRB 4G80B 1T2QH 4LAQL 3T0WA 1YPZE 5C08E 3MLUH 4MXQD 5F7FA 3MBEC 4X6CE 2XKSA 5JLZB 2QR0A 3LKRB 4JFOB 3SGEH 4EDWH 3DMMD 1B88A 4NC1E 4HIEB 4LSTH 4WO4A 4QRPE 1RK0B 1A5FH 3Q6FB 3DPBA 3SDYL 1IM9A 3GSWB 2X6MA 4KVCH 4OZHE 4RBPK 5L7XL 4AZ8A 5BOPA 2F53D 3PHQA 3N9GH 4POZD 1AI1H 1UZ6F 1BJ1H 1QSFE 4AEHL 5EIIA 5E2JA 3FB7B 4Q0XL 3W0WD 1UM6L 4Y2DA 5D7JC 3SJVD 3ZMRA 4UB0L 1IGFH 1A02N 4ODTL 5ITFB 2L0DA 5I8EB 1BAFL 4W6XB 3TBYB 1RZ8A 1OAKL 1FNGB 4X7EC 5H8DA 1Z9OA 2UZYB 1VKXA 3JSSA 3SCMB 4CN1A 5IVXA 1EO5A 1MCRA 3WN5C 4Z7UB 4R4BB 1NGPH 1R3HA 1ORQB 4IMKC 2OJZH 3UPAA 1DBJL 4HUUA 4G8GE 1MEXL 4X0KB 4EI6B 4ZQKB 2VDNH 1I8MB 3P77B 3U9UA 4K9EL 5D9SA 3HG1D 3BRFA 3MUHL 3MOAH 1NCWL 1LVEA 1MJ7L 5GGQL 2FYYB 3LN5A 1BVZA 4Z7VB 4Q9RH 2RFXA 5D71L 4PV8A 5GS2D 2DWEA 4BKLB 2NTSP 3MLXH 5C0IB 3MGOA 5BRZE 5LGHH 1L7IH 1BM3H 1MVFA 3RL2A 1ZT1B 3P11H 3MV7B 1T04B 4R97C 32C2A 4MVBD 5DUBB 1X4YA 3CZFB 1OCWL 5FYJD 1KIUA 3QIBD 4AEEA 1BVLB 1U0QA 5K9KB 3V6FA 1AIFB 4YHPB 3QULA 4HIHA 5EORL 4RWYH 2ED8A 4K07A 4RGNC 5AYUH 1H8SA 4PG9A 1LDPH 1JZ8A 3OKLB 3DXAE 2RCSH 2W9EH 4U1IB 5ESAB 1FH5H 5ECJE 2FH8A 4NIKB 4HZLA 2E27L 5I17B 4DKFH 2MQCA 1Y18A 2XWTA 5JPMB 2VISB 4Y5XB 4JHAL 2VLKD 3T0BA 3FQUA 4PJCE 4NNYB 5FUOL 4V2CB 1EFQA 1IAMA 4DGVL 1IAII 1OSZA 1IC4H 1BQHG 1OAUH 3HS0B 2MFNA 4NRYB 4MA3A 3GO1L 3C2AH 2NX5B 1BFOA 2GTWB 4PJ8D 1AGBA 3GHEH 3U2SA 1HH9B 2XXCB 2VXQH 1U8QB 1A6UL 3MOBL 1HEZA 3G5XA 3HNTH 5JR1L 2AJ3A 2OSLA 3VFWB 4OV5B 2CLZA 3TWCH 1A3RL 1MFAH 3GNML 1HQRA 1FVEA 3CFBB 4FMKA 3ZO0A 1JGUH 2VLJD 3MRBB 2MQ0A 2D0FA 4GG8A 1TJGL 1ONQB 1QRNB 3CUPB 3FKUS 3MUY1 3FN3A 4NQCB 4QRRD 2HJLA 1KCLA 4Y4KC 1X3DA 1VEPA 4KK6D 4ISVA 3DSNA 3ETBF 3VGEA 5D96C 3HLAB 2DMKA 2ZUVA 2DYPB 1MPAH 4ZUTB 5TJWK 4U1LA 1OAQH 3WO4C 5IHUH 2IBBA 3BPCB 3NCCB 2P8LB 5DZNA 1QFPA 1C7SA 3QEUB 1DUYA 1CDYA 1L9MA 1KYOJ 2ZG2A 1H3TA 2J12B 1KXQE 3SDAA 2YPLE 4UQ3B 5B39B 1F00I 2YMXL 4M9PA 4BFIB 4H26B 3WFEL 1T7WA 4KJYA 1YJDL 5FGBA 3JVGC 5J6GA 1P4BL 1ULVA 1A7PL 1HYRC 1GAFH 2NQCA 4HF5H 4JO3L 4TSCH 4FQHB 4KHTH 4ONOA 3SQOL 4B7IA 1RQ5A 1RIUH 4JZNB 4FFZL 1BGXL 2Y7QB 4KK5C 3OJMB 3PGCB 3HAEH 3WLBA 3EO0A 2NZ9D 3SCMD 4YBQC 5ALCH 2W9LA 3O3UN 5DFWH 3K0WA 4KPHH 4OF8A 4Y16B 5I18H 1U8OB 3RGHA 3BT2H 5DUMH 3TZVB 1IAIM 2VYRE 3BUYA 4P46C 4R7DB 5DJAB 4BZ1L 5TFSH 1IILE 2P5WD 4TUKL 3MXVL 3A6BL 2Z8WC 4BQBA 3HAEA 2F5AL 4MXVF 2XG5A 3MV7D 4OCXL 1ZA6B 5KVFH 1WWCA 5KVEH 4ONFL 5CGYC 3UJTL 2BJML 1NC2D 4CU6A 5JHDB 4JFEA 1T5XB 4R8WL 5HDBE 3W81A 5F9DC 4WTZA 1FC2D 1JL8A 5GGVH 3E8UL 3QXAA 4L8DB 4YE4H 2NY6B 3AS0A 1QVOB 1WBZA 3GJEB 2WINA 3ALPA 1CICB 1KFAH 4NP4L 2R9HD 3F62A 3ZDXF 3U0WH 3AREC 4NYLA 3QQ3A 1UJ3B 3DX8B 4M43H 4OCWH 4O00A 4FNLH 5DJ8B 2P5EB 3RZWA 3VXUD 4K9EC 1BJ1J 2H32B 1EO8L 2X4OA 4HIJA 4UQ2B 3IVKA 3L3JB 5F7EH 5TE6H 1A7QH 2VLRB 3GBML 4UDTA 4CN6A 5E94A 1NFDB 1DBML 1G0DA 4P2RB 3I9GL 3MV9B 4PGDA 1JVKA 2BVQA 1FVCB 2ZOLA 3G5VA 2IG2H 3GSXA 5FDWA 3MBED 4DJMA 5I1LA 2EH7H 3J7HA 5IGXH 4NZTL 1CFNB 2QKIA 3F12A 2V5MA 3L5IA 3B43A 1QG3A 2GT9A 2WLZA 4PGZA 4HS6A 3S88L 4RNRB 1T6VN 4FQ2L 4WJ5B 1TIUA 2YA1A 4S1SH 2X4UB 5SWSE 3ARBC 2N7AA 2FJFB 2UYLB 1OPGL 2G9HB 1NGXA 5DD3L 4TOYL 4X4XA 2VUYA 1D6EB 2I5YH 2WBJC 1JP5A 3W5NA 1KEGH 1HINL 1OAZH 3WS3B 3V6OA 5E2TH 3QCTH 1MY7A 3O2VL 1G84A 5D7JD 1WF5A 2W1NA 2OI9C 3DVGB 2DYPD 5CWSA 1BLNA 2OQJB 4R90H 5F9OH 3VGFA 3K7UA 3VH8G 2NY5L 3GMPB 5F9WC 4Z0BH 1LNUA 2AW2A 3WNKA 3WMSA 4OT1L 3NZHH 3TJEH 1XMWA 2VC2H 4FRWA 2YPVH 4XVTH 3RNQB 2GTZA 3ARFA 3IRZA 4LSPH 5T1LB 5FCSH 3MLSH 4QTHA 5CAYB 3VCLB 5JA8B 1I8IB 1OL0A 1A6AB 2XWBB 2XNAB 4MD0B 4XPFL 4U1MB 4LVOB 2BNQA 3MTRA 4ZG1A 1JFQH 2F8VA 2PW2A 4LRIA 5LQBL 2QSCL 2FATH 5EN2B 4FQIH 2H9GA 3U0TB 4GT7A 4XBGB 2HLAA 2P47B 3QI9B 2CSPA 4DW2L 5DJ2B 5F71A 3U4EB 2MKLC 5TQ0L 4B5EA 5BS0A 1AJ7H 4OQTH 1CDJA 2QSTA 4RIRB 2AQ1A 2QHLA 3NA9H 1JPFB 4YPGB 3IJHA 1U92B 4YDJB 4RBPH 4NT6A 1FNHA 4Z77A 1MRCL 4MA8H 4JRXA 2EDLA 4RGND 5C6TL 4DQOL 4XBEL 4XNXH 3TPUB 1RMFL 3LY6A 3L1OH 2N4IA 3ZDZE 3UEZA 1H3UA 3VRLF 5CS7A 1BZQK 1TZGH 4D9LH 4U1JB 1KBGH 1XGRB 5JOPD 4OQTA 4EVNA 3IKKA 3WIIL 1KULA 5EU3A 2AI0L 5GGUB 4MB3A 3BZEA 1J1PL 2Z31C 4P59L 3RJDA 3O4LB 1ZS8A 2DL9A 5JHDD 3TCLA 4WWID 3PABA 2F54B 4I5BA 4JPIB 4N0CC 5T3ZH 2WUCH 5C0AD 3UAJC 1QR1B 2VZOA 1T7YA 3V7MA 3VFMA 5DJXB 3TF7C 2FHFA 2Z9TA 4XTRC 1QFWL 3MCKA 3WXVH 4UIKH 4XAWH 4JDVB 2NXYB 4QOKE 1EFXB 3L7EA 4NQUA 4D0DA 1LEIA 2G60L 4X7TA 4BJLA 3V7AG 3VWJA 3V2AR 5C0RL 5C0BB 1BJ8A 3GZKA 1CVRA 3QPQC 1CGSL 2NY2B 4ONGL 1T22A 2HJKB 3BN3B 2OL3L 4HPYL 4NRXB 4ZPVA 3ZTNL 2P5ED 3PUCA 2BSTB 3OAUL 5I1KL 1OY3B 3SO3C 5JW3L 1T03L 3SPVB 2DDQL 5IIEA 4URTB 1EMTH 3WO3B 4FHBD 4ZUWA 4M62L 2AGJH 5CZKA 5TF1H 2VLRD 5E8PA 3S37L 4E41D 5D1QA 1CDCA 2DTSA 2FX7H 3MV9D 2YRLA 4JFPA 2H45A 2ZCKH 2Z35A 5D7IB 1SY6L 1UXWA 5BVJA 2V7HA 4Y4KD 4N0UA 2IPUK 1QSEB 2H2SC 1WCQA 5MENA 1JWSB 4LQFH 1OTUC 4WDIB 3C8KA 2OZ4L 4WU5B 5IQ7L 3KYMA 1UA6H 1BX2B 4OLVH 1KENH 5FM5M 5C6WH 5I1CL 2P24B 1U58B 2DQCH 2BDNH 4QRUB 1AXSB 4NO3B 2OBGA 1VEMA 4K94L 1KB5L 4JQVA 4PJ7F 3FQWB 4JZJB 3D25A 1AFVL 4YUEH 2XWJA 1JNHB 3KAAA 5A16A 4NKIH 2MMXA 2HWZL 2BOCA 5AYQA 4I2XB 1FVDB 3OKDA 4QEGA 5E00B 3SE9L 3QZWB 3QG7L 1FRGH 2CLRA 4TQEL 3QUXC 3MRIB 5FO7B 2GJ6D 3NAAL 4U3CA 4KK5D 5CUSH 5BZWA 4HGWA 2NW2B 2YN5A 4YBQD 2X5PA 5IJVB 3QJFA 4JY5L 1OW0A 1T0MA 4L4TB 4WI4A 3OAYK 1TETL 2EDWA 4F7CB 2Q86A 3E6FB 4OKVB 5GIRA 4TVPE 3QIUB 3UTSE 2VDOH 1ITBB 5KW9L 1F3DJ 2W92A 2PO6B 4XNQA 4MCYA 4P46D 4DGIH 2QBWA 1A6PA 5C09A 2I60H 5FYLE 4MAYA 3RU8L 1U95A 3BAEH 1MHEB 3UROR 5D93B 2IPUG 3DX6B 3H9SD 5D7SL 3OKEA 3IDIA 2Y07H 5EU7C 1MREL 1DR9A 1WIOA 2FR4A 3WUWG 4KXZH 5CGYD 2GI7A 4NUGH 4RMQA 3TVMA 3F5WB 1FGNH 1D9KB 1NAML 3KPLB 1HSBB 4LEOB 4PJ7A 3Q2CA 3MUJA 4LCIH 1RIHH 3C60B 4K3DL 2AK1H 3VFNB 2DM7A 2NY5C 3HUJB 3HE7A 3TBTB 3NABH 1QBLH 4OF0A 5D7LA 1U3HA 1Z5LA 3FN9A 5ICXB 4DZ8B 5D72H 4NN7C 4EJ1C 4PJ5A 5IFJB 3ARED 4NWTL 2WQRA 1JF1B 3K4DA 1WFOA 3MCLH 1T2QL 1QACA 2XTJC 3O4LD 4DWHA 1VADA 3MLUL 5F88A 1KTKE 2F54D 1AC0A 4JAMA 4O2EB 3QXTA 4EDWL 5I76A 2FX8H 1I7TB 4NUJB 4LSTL 5HHME 4WGWB 3VXNB 4PB9H 1A5FL 1EFXD 4GKSA 5DJ6A 1OP3H 3QUYA 4PRIE 3SHSA 1K4CA 4KVCL 2XN9B 4GOSA 3ZE0F 1ZOXA 1EPFA 3N9GL 5C0BD 1AI1L 3BKJH 4MJIB 4U7SA 4HGMA 2WMPA 2E6QA 5DD6A 4P9HH 5FOBA 5GS1C 5F1NA 5JDSA 1J5OH 1UJTA 1MNUH 2PN5A 4P49A 5CJBA 4Y19A 1EEZB 2ITDB 1IGFL 2IMMA 4KQ4H 3ARBD 1DVFC 1K8IA 1IEAA 2Q3AA 3KJ6L 3NFPB 1YEGH 1KT2B 5IMKA 4HXAL 3WFDH 1Q9WA 1NGPL 2OJZL 4PR5B 1QSED 4JZOA 3HPLA 3AMKA 2VDNL 1X7QA 4JVUA 3LRSA 3MOAL 2X70B 4FXGB 3FFDA 5BMFH 1WICA 4NKMB 5IHBA 1ZVSA 3Q48A 4Q9RL 3U36B 1KJMB 1S9YB 5LWYH 3MLXL 2OR7A 2HFEA 5LGHL 1L7IL 5JPNB 1BM3L 3STLB 4LOUC 4HKBB 1N2RA 1EA9C 3WS6C 8FABA 4HJJH 4W4OA 3IF1B 5DEZA 5EULV 5L8JB 4OFDA 3DROA 1CF8H 2DMBA 3NH7H 1KF9B 3CC5B 4RMSA 3SDDB 1NUDA 5AYUL 3NCMA 2XI9A 3B2VH 2E9BA 2X4TA 3VG9B 1LDPL 3VXOA 1WAAE 2CIKA 2V5TA 2RCSL 2W9EL 3CAFA 1FL3B 1Z9MA 3EOBB 2ESVE 5JDJA 1FH5L 5HDLA 5CBAB 3KLHC 4JQXC 3LDBB 5CEZH 1NUGA 3BQUB 3OKKA 5C08A 2YPKB 2ID5A 4TSBH 1XF2A 1R3KA 5TH2B 4HDIB 3OKOB 1CXFA 5TPWL 1I1FA 1K8DA 1S5HA 2ICWI 2VL4A 4F3FB 5AZ2H 1CFTA 3SDXE 4BFBD 5SX4H 1BBJB 1UKTA 2R56H 5EIVA 5J11C 2VDRL 4LQ1A 3DYPA 1IC4L 2A83A 2GY7B 1OAUL 3SGKA 3CFJA 1VENA 4K94C 1RY7B 4POYA 1OVZA 3VXRB 5LGJB 1FFNB 4NZUH 5FA3B 1MCEA 3W0WE 3S3SA 3IT8D 3DOSA 1VFBA 3LMJH 2FO4A 3C2AL 3P9MB 5L2KB 1I1YB 1DZBA 4P2OA 3GHEL 1FCCA 3FOMB 5JXEC 3UTPD 4NQEA 2DLIA 2VXQL 3RNKB 3W9EA 3MRFA 4N0CD 3HNTL 3VU2A 2B2XH 4RFNB 3UAJD 1LD9A 2JK5A 1MFAL 4EBQH 3QWRA 4XTRD 3JTSA 1CDUA 5DVKA 1IVLA 1JGUL 2DIAA 4LLMB 3O0RH 1G0YR 4PY8I 1TNNA 2I27N 3BESR 4MXWH 3QPQD 3I50H 5DQJA 3LKQA 3REVB 3RL1B 4OUUA 5MEQA 3HKFA 4XPAH 3BEVA 1LEGA 4HV8A 4G8GA 1MRFH 4C83B 3VGAC 3FZUC 4YR6B 3DURA 4I0PB 2HMIC 1UC6A 2YA0A 4HCRH 3TA3B 3KPSB 1J0IA 1FZJA 1MPAL 5IW1A 3U1SH 4JHBA 3QSKB 3VGBA 1OAQL 4PB0H 1P4IH 5IHUL 4H1LB 4XMKL 1U6AL 3LKOB 3FO0H 5FYJE 3AXLB 4M7LH 4Y5YB 1OTSC 4LCUA 3N06B 4E0RA 2V2WA 1XIWA 3KPPA 4LHUB 4YDLC 4C55A 2HN7A 1A7BA 5ESVB 2H2SD 3DRQB 3EYVB 2O5XL 1HDMA 4HCRA 3WCYA 1PDKA 1OTUD 5E6IB 5I16A 3C9NB 2AJXH 1GAFL 3O45A 1AKJD 4TSCL 4KHTL 1MCWW 4KC3B 4ETQA 4X6EB 1RIUL 3L3KB 2R0LH 4WO4C 4LCYA 1OF2B 5IBTH 3BI9X 5E8NB 2NY4B 3DXAA 2BHYA 2X89A 5ALCL 1QFOA 1G7LB 1RD6A 2VWEC 3V79C 4KPHL 3X12B 3FONB 1ZT4A 2F74B 2R1YA 5I18L 1A9BB 2E8ZA 3QDGB 1NC4B 3BT2L 5DUML 1T1XB 5HYJE 1KPRB 2GK2A 1MI5D 3BP4A 3F8UB 2FJHB 5TFSL 2Y4SA 3L3DA 2JELH 4X99A 1CGXA 4TNWK 3WFCH 3K4AA 2CK2A 2VAAB 2BVTA 2IMNA 4LLUA 3VFVB 5HY9B 4U6TA 4ZO6A 3BD5A 1PQZB 1PG7L 4LKCA 1K3ZA 1ZT7A 3JBG7 3FB6B 1JE6A 3HNSH 4C56A 3WJLA 5H35B 3MJGX 3OKNA 4U1HB 4N9OB 1WQVT 5IV2A 4PLNC 4IRZH 1U3YA 1IZJA 5IB2B 5GGVL 3BP7B 4X6BB 3QH3B 3OJVC 4YE4L 1R24B 5DI8A 5DUPH 2CMRH 4QRRE 5HGGS 3P0GB 3WFBH 3PWVA 1CFVH 4JPWH 3HZYA 1F97A 4U3XA 3RKPA 2ZSWB 4OZIB 3BQUD 1NMCB 5F7DA 2HFTA 3G6AB 5E5UB 15C8H 4I9WD 4M43L 4OCWL 4FNLL 1N7MH 3SGDH 3ZHLA 3DIFB 1Q0XL 4I8DA 3C6LA 4KTDH 3FQXB 1VACB 2CUMA 4Q7DA 3IDJA 5TE6L 4WWKB 3QHFH 2MWCA 2BY3A 4DVBB 3TT3H 1D5MA 4F7PA 1F4WH 5IF0B 2SEBB 1PW3A 1K2DA 4PY7A 3MRLB 1QO3B 4ODVH 5EC1B 1PSKH 2XTJD 2IG2L 1T1YA 3RGVB 2EH7L 5IGXL 4U1NA 3SY0A 2I9LB 5MEOA 1WBXA 2CUHA 4L29A 3D18A 1BOYA 4NWUH 4S1SL 1CL7H 4Z7UE 4E42A 1UEMA 5GZOD 1UWXK 4WU7B 4JG0H 4OCRH 3RWFA 3GJFB 4NJAH 2I5YL 4IHOB 1MHCA 1KEGL 3BWUC 5F89B 2AAVA 1OAZL 5JNYA 4LRNH 5T1KD 1MFNA 1S7TB 2P5WE 3IXTB 5E2TL 3DUSB 5EPMA 2FZ3A 4I0PD 1X5KA 3RY6A 2YD2A 2YK1H 1KG0A 1QZ1A 1QSVA 2QR0B 4R90L 3HC0A 4AENA 5F9OL 3MV7E 1G9MH 3TO4A 4GJTB 1CXIA 1DVFD 4Z0BL 1O7SA 2EIZB 2EYSA 4WO4B 3BKCH 3BKYH 3EAKA 3PWLA 3NZHL 2VC2L 2YPVL 4XVTL 1IM9B 2UWEF 4OCSH 3SGEI 4LHUD 4LSPL 1C08A 3MLSL 4DEPB 3QXUA 1GOFA 1UM5H 5EIIB 1ZHLB 3VI3E 3MV01 1JFQL 3AM8C 1F6AB 4Y2DB 1FL5B 2FATL 4FQIL 3ALWA 5IMMB 2AK4D 4PTTA 4CVZA 1B9ZA 3BZDA 3WFHA 3MJ7A 1UCBH 2HVJA 3D2UA 4LOUD 5F7HA 1AQDA 4X5WB 1AJ7L 4OQTL 3NA9L 4FG6C 1VSCA 5IVXB 1PX3A 1NC4D 1JYWA 3SDAC 4KI5F 4ZD3H 1R3HB 5CP7A 2E7LC 1RUPH 3QXVA 1CS6A 5K9OA 1W0VA 1NCNA 4N8PA 5FGBC 4MA8L 1MOEA 3U9UB 1ZSDA 5D9SB 4XNXL 1VPOH 3L1OL 2CRIA 3PGFH 2NX5E 2YBRA 5J6HA 1TZGL 4D9LL 1KBGL 4XPHH 2RFXB 1MH5A 4R26H 3TBSB 2DWEB 1MCFA 1KB9K 3MGOB 1E28A 1RHHB 3ZT6A 3WHE0 3BP6B 4F8TA 3KLHD 4CVXA 32C2B 1AD0B 2VXTH 1DQJA 1UH4A 1HSAA 1I9JH 2B20A 2O5YH 4JJ5A 2FNBA 5T3ZL 4YEFA 2WUCL 3QULB 4HIHB 3BFOA 4GRMA 5F7WC 2I9TA 5SWSA 1EJOH 4UIKL 4XAWL 2HTLC 3NIGF 3QFJD 3C08H 3STBA 4M8VA 3O9WA 3BKMH 2M1KA 2X1OA 4QHMB 3B9KA 1FIEA 4HZLB 5INCB 5JXED 3FMGL 1E6JH 1YN7A 2VN7A 2M26A 4JJHA 2XWTB 1EMTL 1DFBH 3GSOB 3G08A 1XH3A 5TF1L 1D6VL 4NKDA 4TTDD 5J89A 3H3BC 1EUUA 1FNSH 4D8PA 1C16A 2DQTH 2FX7L 1OSZB 5ICYB 1R0AH 2OMNA 1C5CH 1N8ZA 4MA3B 1FG9C 5BQ7A 1VESA 1MCIA 4Q97A 3FZUD 4LASH 4WY7L 1U8NA 4X4ZA 1BFOB 4LQFL 2R2BA 3MNVB 3IB4A 3MV8B 1AGBB 1UA6L 3U2SB 3D85A 1KENL 2N7BA 5HYEA 3ZKXC 1HEZB 3G5XB 2Y5TA 4OIBA 2DQCL 4XP1L 2BDNL 5DGRA 2CLZB 3CFCH 4KKBD 3WHXA 1HQRB 4OI9A 2B1AL 3MRMA 4MAUH 3PV7A 3JUZA 3EKCA 1TVHA 1OTSD 3GKZA 1KTRL 4LSVH 4YUEL 4BH7A 1E4WH 2FD6H 2H6PA 1KN4H 1YQ2A 4NKIL 5SWZD 2BVYA 3TO2A 4HQQH 3X3FH 2HJLB 1O0VA 1MJJA 1KV3A 1FV1A 1I8KB 4G42A 5KSVA 1FRGL 5KSAC 5JHLH 3D1MC 5JOPE 3V6BR 5KOVC 3TN0A 4XCNA 1HXMA 2D31A 4WO4D 4U1LB 5CUSL 3KGRA 2YWZA 2APTA 3MMEA 4XP5H 2CDEA 5JHDE 1DUYB 4PJEF 3F7VA 1T2XA 2VDOL 3B5GA 1PY9A 1S7XA 2VAJA 4MDIA 5JORA 2NTFA 4XRCA 3ZL4L 4DGIL 3N50A 2I60L 2GUOA 1EO7A 4KJYB 3TFKC 5F7MC 5C0FA 5J6GB 3BAEL 4FQ1L 1MUJB 4EI5C 2DQGH 5E2UH 3VFUB 4LVNB 2J7LA 4ZSOA 3OGCA 4JPVH 3S36X 2P5EE 3QT2A 4GBXA 3DGGB 1FSKC 4PJDA 2BRQA 5IVNA 4NUGL 5CJQH 4ZFOA 3MUZ1 4ZXBB 2HJFA 4KRPC 4TNWF 4IEFB 3T2OA 2QLVB 2VLRE 4I18B 1T5WB 4N0YL 2DM3A 3BUYB 4P2RE 4LCIL 2CXKA 3RDTA 3MV9E 2VQ1A 3VA6A 1RIHL 4LRIC 2AK1L 4HBQA 1QBLL 3CSYB 3DX7A 4WV1C 4M6MH 5D72L 2QL1A 5ITBH 2B7DT 4ZYKA 1RUKL 3L3GA 1Z9SA 3MCLL 4TVSa 4S2SA 1CLZL 3V4PH 3L9RA 4YHLL 1QA9A 5FB8A 4CRPA 5IVZA 1WUNT 3UC0H 2J6EH 4LLVB 4JGJA 1V3MA 2NY0B 2FX8L 4G6FB 4NRZB 4PJEA 3U0PB 3QXAB 4PB9L 2QQKH 3ROLA 2DQFB 4CMMA 1VCAA 1WBZB 1KJVA 3T0EC 1QYGH 1D3CA 3NTCH 3BKJL 3TBWA 5I1HH 2BCKA 2DWDB 1YMMD 4NYLB 1V8HA 4P9HL 4DAGH 1J5OL 1MNUL 1WCBA 4FFYH 4UNTA 2ADGA 1J88A 2J6EA 5C2UB 2JJTC 4KQ4L 3L5WA 2GSIA 3GMNB 4X9BA 3QNYA 2X4OB 4HIJB 5FYLH 4KMQA 3IVKB 2YUXA 4X98A 4HX1A 1YEGL 5E6YA 4PD4K 4XCYA 3O6KH 3O3AB 4UDTB 2DIJA 2GJZA 5I1EL 5CD5C 3WFDL 1L7TH 2IJ0C 3VWJC 1HHGA 4PJ9A 1U8MB 2BVQB 2VL5A 3I3DA 3K1KC 3GSXB 5FDWB 3RWDB 3FL7A 5I1LB 4GAGL 4IIQB 3P3YA 3FQNA 5BMFL 2QKIB 3F12B 4OCNC 4UBDC 4OF7A 1XR8A 4HS6B 1T0PB 3T3PE 4OTXH 4LKXB 5D1QC 4Z9KB 3QA3B 3L6FA 3BIAX 1GZQB 2I25N 4JRYB 3ZDYE 4X4XB 5DFTA 1NH6A 1BVKA 3GK8L 4HJJL 5GRUH 2AV1A 2YKLL 2IH1A 2B1HH 3IU3B 3W5MA 3NH7L 4JFYA 5F1KC 2YEZA 1BLNB 5CWSB 3HMXH 3O4LE 4K3EH 3UBXG 4K71C 4Y8DC 5HGHB 1ZANH 3OB0H 1L0QA 1ZXQA 4K7PY 2XOTA 2F54E 4JQVC 5DGQA 4FG6D 2EXYC 1SEBA 2GTZB 4QRTA 3ARFB 5CEZL 3SDAD 4QTHB 4TSBL 5EU6A 5KVMC 5HJ3A 3P2TA 3S36H 1VB9A 2IEPA 2BNQB 4JE4B 3FO1B 2LU4A 1J8HA 3HMXA 2R56L 2PW2B 5C0BE 3FQRA 3M07A 4NNXB 3QO1A 4QXTA 2NW3A 1X9QA 1MJ8H 4ZFFA 5AG8A 2QEJA 4K23H 2HLAB 5IMOB 2YRZA 4CBPA 3LMJL 1OW0C 4UNUA 3OZ9H 2WSKA 4OGXH 3ULUF 3IJHB 2W9DH 3D9AH 5BOZG 4MD4A 3MRQA 1MLCA 4GW1A 4NT6B 4Z77B 1UB5B 2B2XL 4ACPA 4M5ZH 1EHNA 2IADA 4EBQL 5D7IE 1FNLA 4ZODA 4X9GA 1OGTA 4F15C 2HTLD 3PL6A 4R2GC 2Y72A 3O0RL 1QSEE 2PTUA 4UUJA 4Z7NE 5FHAH 2O26U 1CR9H 5B38A 4MXWL 2VERN 3I50L 2IAMB 5EU3B 3BZEB 4YK4B 4XPAL 3TVMC 1S7VA 4PREA 4JB9H 2ADIA 3PHOA 4UINH 5E5MB 3OAZK 5ID1A 1SYSA 5JW5A 4JFED 3TCLB 4KROB 3PABB 1KJ2B 5L0QB 4OFKA 3U1SL 1URLA 3CX2A 1P4IL 3MRNA 3DVIA 5ACLA 4MGXA 4MLIA 1RZJH 4I2XE 3FO0L 3K2UH 4N0FA 1ORSA 3IJSA 5D1ZB 2YD3A 3ULUH 3B8YA 4D0DB 1LEIB 2IBGA 4X7TB 4D9QD 5ADPH 4G5ZH 3PDOA 1WEJL 4OM0H 2ZG1A 3MGTB 2W65A 3T77A 2OCFD 1MWAH 5HPOA 2AJXL 5DRXB 1LEKA 5D70H 4HBCH 1FO0B 3GFUA 5IIEB 2WP3O 2R0LL 4L4TE 4ZUWB 5HHQA 1JPGA 2CXGA 2YUZA 3L95A 2EYTB 3JXAA 5E8PB 3QUYC 5D1QB 3FHAA 4U2YA 3BPOC 2ESVA 3SOBH 5HHXH 3GUTA 1G9NH 4NN6C 4PRHB 2Z35B 2HFGH 2V7HB 3KNBA 4Q58C 4GMSL 1AY1H 5MENB 1HNGA 2JELL 4P4KA 4OFPA 3KYMB 3WFCL 3HB3C 4YAQA 4U1KA 2X4QA 1XF3A 2MHAB 4NQSB 3NVQA 4FFWC 2DQJH 1YMHB 3G6JF 3ZE2F 3L7FA 3UTPE 4G6KH 1MLBA 1MFBH 3HNSL 2XWJB 3O41B 1H3XA 4ODXA 4P9HC 5A16B 5D6DC 2I07A 1Q0YH 3PIQA 3V4VH 2Y06H 4IRZL 4ODBD 4FP8H 3TFKD 4LCCA 3LQMA 3VRIA 2DN7A 1ZHKA 3KWWA 1JNLL 2EE9A 5DUPL 2CMRL 4F37K 1SBSH 4EI5D 2DIBA 4XWGH 3WFBL 1XT5A 3VXTB 5BZWB 1CFVL 1YY8A 4JPWL 1MIMH 5BVPL 1WT5A 4FABH 3ARFD 3GM0A 3DARA 2CQVA 3GEWB 15C8L 1T0MB 2V5RA 1N7ML 4W4OC 1NBYA 3KYNA 4U1SA 4KRPD 4WHTA 5I0DA 4UNVA 4L9DA 4OZGA 2BNQD 2XN9E 1QP1A 4KTDL 1CVSC 2VDPL 1X5AA 5C09B 4MAYB 4EXPX 1CLOH 3T1FA 1U95B 1TTFA 2DI8A 1G6RL 3ULVE 2EIDA 4R2GB 1MFCH 4RCAA 4F8QA 1F4WL 2UY7A 5HSFA 3I02A 1JRHH 3OKEB 3IDIB 3VRJA 4HAGA 4ODVL 1OGAA 5BS0D 1PSKL 5SWQA 3MYZA 5IBUG 2FR4B 4MB4A 1WFNA 3F7QA 1W8OA 3H0TA 3BMWA 2ATKA 3HRZA 4X7SH 1JMZA 3CFDB 4MD5A 5HHNA 5FO9B 3G6JA 2BC4A 4NWUL 4JRXD 2MCG1 4KXZI 1CL7L 4PJ7B 1OHQA 2HRPL 3DNKA 2KZWA 4IJ3B 4NC1C 4JG0L 1B0GB 1LWRA 5EOCH 3HE7B 1VEOA 3CXDH 3ARGA 5D7LB 4DN4L 1U3HB 4NJAL 4PJIA 3RWHB 1R3IH 5F8QC 5B8CA 4PJ5B 4LRNL 1CGTA 2W59A 4Y89A 4GG6A 5J13C 1I4FA 3Q3GA 5F88B 5HYJA 4MX7B 1FQ9C 4P2OC 1SMAA 5I73B 3PF2A 2YK1L 3NA4A 5EO9A 4LU5H 5I76B 1G9ML 3Q5YA 4BELD 4GKZA 2AKRA 2CRYA 4MA1C 4PRPA 3QDHA 2YSSA 5C0NC 3BKCL 3BKYL 1F58H 4GKSB 3OKMA 5DJ6B 2B5IB 1K4CB 4OCSL 3VGDA 1ERNA 4Y8AA 5CD5D 1OP5K 3VWJD 1UXSA 1PZ5B 3SDCA 5I75C 4HG4K 1UM5L 3FOLA 2FB4H 4Z0XA 2NMSA 5D7KE 5FOBB 5F1NB 3P4LA 4WI8A 5T3ZD 5DO2C 5CCKH 4XWOD 4AH2A 3REWA 1YC8A 4UBDD 3ZT5A 1RJYA 5CSZB 3FCTA 2PTVA 2Y36H 5E8DH 5D1QD 1UCBL 1IEAB 3R4DA 1VFAA 3BVNB 4UU9B 5HYQA 1JZ6A 4XNZB 1NUNB 1XIWC 5IMKB 2LQRA 3BZ4A 5IROA 4YGAB 1Q9WB 4HIEA 4ZD3L 5DMIH 1RK0A 5MEND 5DHVB 3EYSL 2OXHA 4MZ3A 1AP2A 1KC5H 3HPLB 1AC6A 3VXRE 4YHYC 1X7QB 1EBAA 3LRSB 4WW2F 1U42A 3FFDB 1HCVA 1MAJA 2Q7NA 1VPOL 4G9FB 3TPKA 1AE6H 5CILH 1JZ4A 4KRLB 4R26L 3FB7A 1N5YL 5IJKA 4YXLH 2NLJB 4OZFG 2HFEB 2EXYD 4M7LT 1CTNA 3BMVA 5MI0C 1N2RB 3MNZA 2VXTL 8FABB 35C8H 3OB8A 3PG2A 1I9JL 2XRAH 2HVKA 2O5YL 5DMYA 3SKJH 1UZ8B 4G7YH 3DROB 1ZGLA 3VH8B 4UI2A 1H3VA 4L4VA 4Z7UA 1EJOL 1I7RB 4R4BA 5I1JH 1FN4B 2X4TB 4X0KA 3BKML 4ZQKA 1A8JH 3VXOB 5L8KB 3W2DH 3FO2B 5TDPB 4LPCA 3VI4E 1I8MA 3W82A 3KPSE 5CSBA 1OM3H 3RTQA 4FTVB 1OWWA 2DLTA 4WHCA 4MDJA 1LGVA 3VFRA 3WJLC 4Z7VA 2AXHA 2LU3A 1E6JL 2X10A 2EYRA 2VXUH 3ZKNC 1AQKH 1XF2B 2D7OA 4G43A 4BKLA 3QISA 4YHZH 1R3KB 1DFBL 4QYOA 5C0IA 4U33A 1I1FB 1S5HB 2DQDH 1CFTB 1G7MB 4NJ9H 1HKFA 4OBSA 4QY8A 1NAKH 4R2GD 2ZSVB 1FNSL 2DQTL 5IBLC 2A83B 4IRSC 3N1QC 2Y9RT 1R0AL 5K9KA 1C5CL 2B0SH 2IFGA 3C09C 5SX4I 4WW2A 1DQDL 1LO2H 4FXLA 1GH7A 2P44B 3TVMD 3MJ8B 4LASL 1I1AA 4OGYH 1AO7B 3OKLA 4NQEB 3C6LC 4L8SC 2VN4A 3IDUA 3P40A 4LGRB 3MRFB 4HSQA 4O02H 3V0VA 2YXFA 3WDHA 4X5LA 3VXSA 1LD9B 3FTGA 3CFCL 1QLEL 1J10A 3QDGE 5D7LD 3JTSB 1U3HD 4NCC2 3O8XB 4NM8H 4LSVL 1E4WL 2FD6L 1KN4L 4PJ5D 1DBAH 2VISA 4Y5XA 2HKHL 5I75B 2W0PA 3MA7B