4LMQE

Development and preclinical characterization of a humanized antibody targeting cxcl12
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
220
structure length
195
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFSLTVYSVHWVRQAPGKGLEWVGALWGSGGTEYNSNLKSRFTISRDTSKNTVYLQMNSLRAEDTAVYYCARDQGLNYGSLFDYWGQGTLVTVSSASGPSVFPLALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system
molecule keywords Stromal cell-derived factor 1
publication title Development and Preclinical Characterization of a Humanized Antibody Targeting CXCL12.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 195
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lmqE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lmqE01
2IFGA 2AEIT 1BIHA 2YZ8A 4OUOA 1UWGH 3DSFH 3HZVB 3QO1A 5F1OB 3CVHB 5JIPA 4F80A 1ZT1B 4P2CG 5JHDB 1R24A 1KGCE 1Q9KB 2HT3C 5BVJB 1DUYB 1AR1D 4F7EA 4OV5B 4OGAC 4Y19A 4GAFB 5IMMB 1BVLA 4N0UA 3PV6A 2FSEA 3QDGA 1MCHA 3I6GA 1YZZA 1N6VA 3LQAL 4GKSB 2AQ1A 4Y4HD 5F89A 3OWEA 1A3RL 3KYMA 3QIWC 3C6LC 5IF0B 5I8CA 1WBZA 2HKFL 1S5HA 4OGYL 3NMEA 1VPOH 5DQDH 3FRUA 2BZDA 3IXTB 3ULVE 4RBPH 2JELL 4WW1B 3RTQB 2NY3C 4FXGA 4K23H 1KTDB 3QWQB 4RSVA 5C86A 5DJ0B 1U8MB 3TFKC 3I2CH 2GIYA 1MCKA 4X99A 3OZ9H 3S5LA 4L4VA 2CLRB 2OZ4H 1OTUD 1NUGA 4QWWD 1XGQB 4KKLD 3OAZH 2W9EL 3DX8A 3CDFA 3RWFA 5B3JE 4GBXD 4MS8C 2ZSWA 3JTSB 4NO0A 1QD0A 1AFVH 5DURB 4JRXE 4NCDA 4RGMB 5DD3H 1KIUA 3BKCH 3KPNA 3MRRA 4KZDH 4WUUD 1UWGL 3DSFL 3PABB 1IJ9A 2EDFA 1PZ5A 3FQTA 3FT2A 3HZYB 5J3HC 5F97E 4M7LH 3RVWD 2GJ6E 4OD2B 3SBWA 5IB4A 1NBZA 3T0AA 2OTUB 1NQBA 4AZ8A 4L1HA 3VWKB 2PCPA 5DMGD 2JB5H 2Y7QA 2CD0A 2YPVH 4V1DE 4ACPA 3B3IB 5KZCB 5C0GB 4XGZB 3JXAA 3QFJE 3QCTH 4NNYA 4M1CC 3ULUC 3O11A 4EXPX 5FO7B 2P8PA 4LCYA 5FUCC 5EZIH 1VPOL 4OSUH 2GITA 3ALPA 1ZLUH 4FA8A 3LMJL 5IQ7H 8FABA 1V7NL 2AKRB 2NR6C 2XZCH 1SY6H 1YEFH 4BSVB 3V6ZA 1EEYA 2L7UA 5I73B 3OZ9L 4J4PA 2OZ4L 4J12A 4QGYA 2FO4B 5BV7B 4YX2H 1Y6MR 3PQYD 1AFVL 2EXWC 3UTOA 1RZ8B 1LNUA 5F96L 5ETUA 2A73A 3QZWB 4M6NH 5E94A 3ROOA 5F9JA 5DD3L 6CGTA 3BKCL 1A7RL 4KV5F 4RQQA 1U8PB 3BEWA 4WFFD 1HE7A 5C0DB 2GHWB 1UFUA 3FO2B 3S37X 3T0ED 4Y4FD 4APQC 4TUOB 5JXED 4M7LL 3VWJC 3CX2A 1FNFA 4H0IA 2X5PA 3AY4C 4CVZA 5DI8B 2RB8A 5I1CH 1OQXA 4M93B 5SWQA 1KN4H 2ZSVA 1VKXA 2BVUA 2JB5L 2Z91A 3WFCH 4XCYB 2DI8A 2YPVL 1H3VA 4NQXA 5D1QA 2VLRB 4PJEE 2M8XA 3I85A 3T8XB 1Z3GH 4Z7NF 1J87A 3DPBA 3QCTL 3ARBD 4MB4A 5F7DB 5ACZA 1KCSH 3L3HB 3U46B 4WI5A 2K7QA 2BVPA 4S2SB 2DQGH 4FHBD 5EZIL 4X4ZA 5E8OA 4OSUL 5TGBA 4CDHA 5CJBA 3AS1A 4XWOC 5AD0A 1INEL 4OUUA 4X6CE 3HE6D 5SX4I 3ZYIA 4WU7B 5EU3A 5IQ7L 2IBBA 4P57B 1KJ2A 4LK4A 3QUZC 2XZCL 4PJ8D 1SY6L 1ACYH 1YEFL 3MV9B 4PV8B 3VFRA 1K4DB 5HHPA 3GGWB 1T04B 2UYLB 5DD1H 4JFEE 4FQLH 4YX2L 5TFSH 1NGWB 5IFHH 1EHLH 3CC5B 1FSKC 2HT2D 5JPMA 3KNBB 1CICA 1QSZA 1ZK9A 5J13B 2FZ3A 4M6NL 2B5IB 2JCCE 1VFMA 4PRID 4J1UA 4LCUA 4UIKH 2EXYD 1T03H 4EI5A 4LHUB 4JDVB 3OR6A 3X13B 3G5YB 2X4SB 2I07B 2HLFD 4PJ5A 4OLXH 5EU6E 5C0BB 4C56A 3QQ9C 5CEXB 4M03A 3QI9A 3PQYB 4WCYH 3QA3A 1S5IH 4FABH 4QRSB 5DD0H 4AK1A 1OGAA 2APTA 1YEJH 4U1SB 4EEEA 1E28A 3VFWB 1WTLA 4GO6B 5I1CL 3KWWA 1BF8A 5JZ7C 1KN4L 3WFCL 1IAOB 3ULVF 3CAFA 1Z3GL 3NBNA 3DURA 1MJJB 3G6JF 3T0EB 1XF4A 4EDWH 3DVNA 4PYGA 1TZHA 4CNIA 5L2JA 3C60B 3U79A 1RK1A 3WLBA 2VLME 2KL6A 4ZO9A 5GGTA 2HJFB 2DQGL 3X3FH 3NZ8B 1VA9A 3V7MA 3Q48A 5LGJB 3QRGH 4FTVD 1A22B 5GS0C 4IBLT 3CIQA 1YY8A 2Q7NA 1ACYL 3ARBB 4H25A 3SJVB 4ISVB 4ZPVA 4YHNA 2VXQL 4JN2B 4FQHB 3RI5F 3VXQA 2BSTB 1UXWA 4J23A 4Z7UB 5T1MA 2EDDA 3VXRE 5C0CE 3CMOH 2F8OA 5TFSL 5IFHL 3U30C 4U1KA 4U3CA 3GI9H 5E00A 5L8LB 1MLBB 5F9WB 4IRJD 4JFYB 1YC8A 3MBXH 2R2BA 5JA8B 1TPXB 2FO1A 4LEXH 4G80A 5BOPA 5B8CB 3NGBC 1OTSC 1T03L 4Y5XC 4HAFA 3MBEA 1UT9A 5ANMA 2VISA 1UZ6E 1A4KB 2IBGA 3BE1H 3KLSA 3V5DA 1A1MB 4WCYL 3VRLE 1YN6B 4BM7A 2DLTA 5FYLH 1FZMB 1G9NH 1S9WA 3CH8A 5DD0L 3S7GA 4FABL 2I24N 1YNLH 1MQKL 2Z92A 1YEJL 1HILA 4PJ9D 4KK8D 2HA1A 1IT9H 3HUJE 1RZFH 2AVGA 3EJZC 3UAJC 2ZUSA 4I18B 1FPTH 4D94A 1S9VB 2H2PD 1IKFL 2XWJA 4NQDD 4ELKB 4EDWL 3I84A 4H1LG 5C09D 1FVCB 1MUJB 2GSIA 1JF1B 43C9A 3X3FL 5HI5C 1FO0A 3VFTB 4LSPH 3S3PA 4LCWD 1VFAB 3O9WD 3QRGL 4OCSL 4MXQC 5FF6A 3IJYB 4KJWD 4P2OD 3F7VA 4Z7QF 3W11C 1KSRA 5ECJE 4K8RH 3U0PA 3SOBH 3I02A 2H9GA 5CUSH 3HCVA 5FAAA 4DKFH 4TTDD 3TH3T 4QXTB 1NH6A 3TNNB 1JRHH 1A6UH 4OZFB 3CMOL 3ARPA 4JFOB 4JZJB 5HHNB 5T3ZD 1CXLA 1I9JH 3GI9L 3S36H 5BXFA 1JYVA 3NCMA 4PRBA 5JLZA 5JDSB 4LEXL 1ZHKB 2EDEA 1EEUA 4PRHA 1LEKB 4XNZB 1I8IA 5EIVA 5C71A 1RJYB 2DICA 4GOSA 3U0WH 3FB8A 4ZFFA 2A77H 3NCYS 3LDBB 3BE1L 2BVQA 2AEWA 1FG2A 4X98B 5FYLL 5LG1A 1G9NL 2IPUK 4PJEF 5ISZA 3T77B 1B4JH 1YNLL 1AI1H 1BBJA 5ABDE 3RWJA 3T0WA 2ZG3A 4ODWB 1IT9L 1G84A 4IRSD 5L0QC 1RZFL 3MRFB 3WEXB 1SYVB 2Z93B 3BZ4A 3BH8A 2HTLD 5D2NE 1CGTA 4X6CF 1RUMH 3ZHLA 2R4RH 1WAAE 5D2LA 3EYFA 4PLJC 5EU7C 2EIZA 4NWTH 4WI8A 5DA0B 4R9HA 3RVTD 1FNAA 3HAEG 4NQVB 3GSWB 4XX1E 1MAML 3M1BB 1OAZL 3WYRA 3ZO0A 4LSPL 3NH7H 4JPIA 3GB7A 4M61B 4KROD 4ZD3H 3UDWC 5IOPA 5FO8B 5IKCB 4NZRH 4M1DH 2ZWLT 4K8RL 1JWMB 5C09B 3SOBL 3X14B 2UZXB 1A21A 1CE6B 1CQYA 3DUSA 5CUSL 4DKFL 1IFHL 2W92A 1JRHL 1A6UL 4PBWD 2VH5H 4LCWB 1IGTB 3BGAA 4QF1B 4R2GC 1I9JL 3S36L 1ZAGA 4JLRB 4PGBB 5TDPA 4P2OB 1JZ3A 3MJ7A 2XWBB 2HJLA 2ICEB 2JIXB 4UTBH 4XCNB 3HC0B 4L3CA 3WDIA 2AK4A 5LWYH 3OXRB 5DC9B 4GRWF 2J6EH 3FMGL 3O6KH 2A77L 5F21B 1CGUA 3G04A 1FL5A 2I9TB 3BP5B 1JNJA 2VAAB 1NFDE 2N56A 4X5WA 3AUVA 3K1KC 4G7YH 3RZCA 1NDMA 1B4JL 1AI1L 4UINL 3GRWA 1F11A 2VDPH 4LOUD 3ULSA 1F4YH 3L7FA 5ERWA 3KLDA 2NLJB 4Y5YB 3GNML 1RUML 5EFIA 2R4RL 3FO0H 5I1DA 5E6IB 4NWTL 1A6PA 3CUPA 1T5XA 2NW3B 3TA3D 2D7NA 1FE8H 2EC9T 1LP9F 1QO3A 3AREA 3NH7L 5K93A 4HIEA 3O41A 4ZD3L 4U7KA 1IE5A 5C0FB 3N85H 3QAZC 1F3RB 1NCUA 4WWKD 4NZRL 1MCWW 1U91A 4Y16B 1XGPB 1CXEA 3H9YA 2BXYA 3O6FC 2LVEA 3VGDA 4LIQE 2E8ZA 3LV3A 2Y9RT 4YHMH 3RJDA 5KVGH 4PR5A 1JHTB 1UZ6F 3T1FA 1YPZE 4HF5L 4EN3B 5C1MB 2XTJD 3MV8B 3U4EB 3OJDB 4XNQB 1UM6H 5GGSY 2NY0B 4V2CB 4QKXB 1YQ2A 3OAYK 4HIXH 1L0YA 1E6JL 2HVKA 3FFCE 3SE4A 5LWYL 3RVVC 3FL7A 5HYIA 2J6EL 3HUJF 2FJHB 1U8OA 2V5RA 3A6CH 1F6FB 2E9IA 4I9WE 4JAMA 3P30H 1VSCA 5IB5A 1I8KA 4XNUH 3NTCH 5D70H 4OV6F 5D7LA 5BOZG 1KLUB 2X4RA 2VDPL 1U8JA 4FQQA 1F4YL 4X0KB 1IM3A 1WLHA 3RGHA 2YA0A 4ZQKA 4NQEB 3DO7A 3LKPB 2E7LA 1BF2A 1VGKB 4JCLA 1D7FA 3KHQA 3ME0A 3O8XB 5HGHA 5L7XH 4G6MH 1IAKB 1PYWB 2NY6D 2FD6H 4NKQB 4YO0A 3OKNB 5DHYA 1NKRA 1R3JB 5IGXH 3MACH 3BT2H 1QNZH 4HXAH 2AJ3B 1BQHB 2D0HA 1OSPH 3R0MA 4LSSL 3RL2B 3G5XA 1CBVH 5TH2B 1Q8MA 1F58H 5LGKA 4YHML 1MVUA 5KVGL 3RX8A 3IFOA 3G5VA 4POUB 1YEGH 1FIGH 1UM6L 1FFOA 2H8PB 1LE5B 1U95A 3QUMH 1UH2A 1MVFA 4YDJB 5EBGA 3SDDB 2XZZA 3H7LA 4HIXL 3THMH 1I3GL 4ODUA 2NPLX 3FKUS 1A6TB 3FN0H 4OLYL 1A6AB 1CU4L 4P2QB 3V2AR 3B4NA 4YNYB 1Z9LA 3FHQA 4QHMB 3A6CL 5CILH 2P5WB 4MLIA 2XI9A 3P30L 4KI5C 5B21A 1WAAF 5J6HB 3NTCL 3QDJE 4YFEA 5FK9A 5FHBH 1BJ8A 1JE6A 3MNWA 1MHEA 1X5JA 2IBZY 5DMKB 1CVRA 4HW6A 3N9GL 3IXAB 3WIFA 1HOCB 5CFHA 3MLVH 1H9VA 3ES6B 2AJXH 4HK0A 2CIIA 5F7UA 3LD8B 1CDHA 1T7XA 3C6SA 1GYAA 2UZIL 4JFXB 2A74B 2D7TH 4G6ML 1VADB 3GKWH 4J8RB 5DFVD 3U9PH 1JWUA 4HC1H 2FD6L 4HV8B 3FB7B 5DJXA 4M7JH 5IGXL 5GS1A 2AJYH 3BT2L 4D9RD 1QNZL 1P1ZB 4HXAL 2Q8BL 4MA1B 5EBLA 5IEHA 1MH5B 4X6DE 1OM3L 5EIIA 5LKNA 1OSPL 4HPOH 3TBVA 4HMCA 1CBVL 4WO4C 2Y06H 1F58L 4U1HA 4YXLH 5CGMA 4K71B 2VLJB 4QRRB 3OGCB 2Q87A 3O3UN 3FQNB 4TPRH 4UAOB 1FIGL 3ZKXB 1NFDF 3CVHH 3ETBF 3QDMA 5KSAA 2EDNA 3THML 4BUGA 3S34L 5FO9B 4HWNA 3FN0L 4JFFB 4Z77A 4W6YB 5CSZA 1FVEB 3CFDA 4PJXB 3FO1A 4NSKA 5I66B 1RUQH 4O00A 5CILL 1L6XA 3PJSA 1CFVH 2ICWI 3B9KA 1FZKB 1IEBA 3MR9A 1TJIH 2XV6B 4QTIH 2DIJA 5FCSH 3EO0A 4QCIA 1T2XA 3MLVL 1YNKL 2NY2D 5DJAA 1G7PA 4NJ9L 2IF7A 4MNGE 2N7BA 3T09A 2Q86A 2EDHA 1KB5B 1N2RA 1OP3H 2B0SH 2VABB 3L5WA 4DK3A 3NOIA 2D7TL 1ZLVH 3GKWL 3DECA 3L9RB 3U9PL 1G0DA 4HC1L 4YC2C 3TN0B 2YR3A 3KPPA 4Y2DC 3S3JA 5FB8A 3MRJA 2W65A 1X5XA 4Y8DC 2QADC 2AJYL 5CWSB 5GXBB 5CZXD 4PY8I 5JQHC 2I25N 3DRQA 1NDGA 3WFZA 3KPSD 2YPKB 2O93L 1W0YT 3MLRH 4X9BA 2Y06L 2ED7A 2R39A 3DTXB 3P77A 4Q7DA 1F4XH 4YXLL 3UBXB 2GAZB 3IDIB 5T3XH 4XI5D 1AP2A 4TPRL 4AT6A 4EUPG 1CIDA 3MA7A 3KPOA 3BQUC 4JRXD 5D1ZC 2FX9H 2P49B 4O58H 3KPQA 4V2BA 4MA3B 3EOTH 4ZDHA 2PNDA 1UB6A 4PRNB 5DUMH 4DZBB 4ELMB 1OF2A 2P44B 2IADB 1MCWM 1RUQL 3QUMA 4FZEH 3VXMA 4XXCA 4ZODA 2FR4A 2GJ6D 1JCKA 1CFVL 3ARTA 2R2EB 3GKZA 1T22A 3STZB 3MUZ1 4RMRA 3GMMA 1VDGA 1W72A 4IMKC 4P0DA 3SDXE 3ZYJA 1TJIL 1U8IB 2J4WH 5KVEH 1K4CA 2OR9H 1MHCA 4ZSOE 2C4FT 2F54A 4FFYL 1SYSB 3DVGB 4D0DB 1HH9A 5KG9B 3E6FA 1IEAA 4IRZL 4QGTA 5J06A 1I7TA 5EPMA 4KUCF 4I0PB 4WFEE 1ZA3B 4GSDL 2YSSB 3QPXH 1XF2A 3QISA 1WCBA 4OLUL 3D48R 5T1KD 5DRZA 1NC4B 3OG6B 1KPRB 1I3UA 3WS3B 5K59E 4O2CA 4HGMA 4KWUA 2JJSC 4XAWH 5BV7H 4WI7A 4OD1L 5ESQA 4D9LH 4Z7VA 1J18A 4BH8B 5EBWB 1G7HA 5D7JD 3CH1B 5ICXA 2EYTB 2J8UE 3CFBB 4UIMA 4U3HA 5EBMB 3MLRL 3KXFE 4JY4A 1MIMH 3HNSH 1F4XL 3LKOB 5C07D 2FJFB 5HHOE 1WIPA 4W6WB 2JJWA 1OAKH 5IJKA 5IG7B 3OKOB 1P69B 2ESVD 3LQZA 4GAYB 3X12A 1QSFB 3JV5A 4FMKA 2F8XC 4CRPA 2FX9L 4S0TD 2CDGB 3NCJH 5DC0A 4O58L 1A64A 3ARDB 4M9OA 3QEGH 3VMOA 4XNMB 1H3UA 5DUML 5I1LB 1IGIH 4RGND 2CIKB 1IKNC 2QR0A 4LQFH 4Q9CA 3CVHA 1EO8H 5ESAB 4PTUB 4FZEL 4HS8H 1V3JA 5IVOA 1RIUL 1KLFA 4OLVH 2F53D 2G5RA 1DUYA 3GJEB 1U8QA 4LSVH 4U6XA 4GW5B 1CDIA 4HD9A 5J11B 1ZLSH 2J4WL 3BKJH 3CVIH 5IMMA 5KVEL 4CKVX 4ESKA 2OR9L 4LDEB 5DHVH 4NDMB 1ZANH 2LVCA 1KB9J 4GQPH 3QXVA 5DEFA 5FIEA 3DOSA 5I6XC 1I3RA 5GHWL 3JVGA 3HLAA 4D3CL 2GJ6B 4FOMA 3QPXL 2AXFA 5D1XC 5IF0A 3MLTB 1NFIB 4X6DF 4QHNB 1FG9C 2HT4C 1CD1A 2HWZH 4G8FA 5EO1B 2FYYB 4GS7C 4TNVK 3T2OA 2FLBT 3IXTA 3PUCA 3ULUE 4V1DB 2JK5B 5GISL 2UZYB 3N1GC 1KTDA 3QFJB 3EIFA 2OMNA 2MQ3A 1OL0A 5DJ0A 4D9LL 4GRLC 1WJ3A 1U8MA 3U36B 1N0XL 4JZNB 4AIZB 1HHHA 4MJIE 1KV3A 3GDBA 1B2WH 2CLRA 1XGQA 1MIML 1TZIA 3HNSL 4MA8L 3GBMH 4N90D 2V2TB 2HG5B 2SEBA 3KYAA 2YOCA 5CBAB 1AGBB 5JNYA 1OAKL 1QR4A 4QRUA 1AHWA 2JB6A 1S3KH 3EYOA 5K9OB 5TQ2H 1WV7T 3PHQB 3DO3A 1A0QH 3NCJL 2PYED 2PO6C 4HS3B 4Y1AD 4ODSL 1G6RA 1H8NA 3W9DB 1IRAY 1IGMH 4RFNB 4F3FB 4A2MA 4F2MB 1TQBB 3QEGL 1A2YA 1LO5A 2VITB 1IGIL 1D9KC 5D7IE 1J9CT 4LQFL 2D4DA 4N9GB 2DQCL 4OF6A 1EO8L 3PABA 4HS8L 2W0PA 2G9HB 2EYRB 4OLVL 5EU4B 1I4FA 3HZYA 5LGHL 1MSPA 3R4DA 3MGOA 1ZLSL 2OTUA 3BKJL 3CVIL 3JV6A 1KCKA 3RGVD 3VD5A 3ZSTA 3VWKA 1AY1L 1Q38A 1LILA 1ZANL 4HJ0C 1ZSDB 4I5BA 4XGZA 3NN8A 1H5BC 4L8BB 2VLMD 3MRIB 1J0KA 3ARZA 2DWEB 5FO7A 3CXDH 2I5YL 5I2IB 3TCXA 2HWZL 1ZT4B 3DX9B 5A3IC 2W9LA 3VU2A 4PJEB 1EHAA 4XP1H 3WN5B 1BPVA 4E0RB 2V7HA 4WGWB 3IJSB 1NMCB 2BVTA 2AKRA 3JZ7A 3MJGX 4I2XE 4MXWH 5LQBH 4HG4K 3BUYB 2VAJA 4I0KA 1V05A 3DWTA 3O3BA 4Q74A 1B2WL 3IFPB 5DJCB 2R23B 4X6CB 3GBML 3VFOA 4JANB 4WFHE 3Q6FB 4N0UE 4ODBD 2FHFA 4TUKH 5TDNB 3RY6C 4PJIE 3QDGE 2VZTA 1Q94B 5E4IA 4NFDA 5JHLH 4F7MB 1S3KL 5TQ2L 1A0QL 2H6PA 1WWAX 1NL0H 1BFTA 1RFDH 4L3ED 1IGML 4JFEB 4IOFC 1IAIL 4UQ2A 3SDXF 3TLRA 4ETQA 2NYYD 1U8LB 1I85A 4K7PX 5C0DA 2X7LB 3MV11 1LD9B 2WQRA 3ZE1E 1U3HD 4GBXA 3FO2A 4ZTPL 2JCCB 4TUOA 4PRDA 4WI6A 2NZIA 4KHXH 3P40A 5DI8A 2B2XH 2EEAA 2WUBH 5EU6B 4WUUA 4YBLC 5K59F 3OAUH 2VXSH 3DRTA 3GMRA 5D6CA 3SCMD 4XCYA 1QBMH 2JJTA 5F8QC 5D7KD 1MFBH 5HGDA 5IBUB 3RWIB 5F7DA 3L3HA 3U46A 2J8UF 4J7RA 3CXDL 2EZ0C 3FONB 4S2SA 5JR1L 3MRHB 5GZND 5GIRB 1VB9A 3WKMH 3L95A 4WV1C 4O51B 4XP1L 3UTSD 4OZFH 3GSRB 2VXTH 3B2VH 3MV9A 4XB8A 2ZPKH 4MXWL 5LQBL 3MROA 2ED9A 1K4DA 3GGWA 1T04A 3FFDA 3OTTA 4JQVC 3MREA 4OZIE 4TUKL 1NGWA 3IETB 2VL5A 1G7IB 5EWIH 5JHLL 3KNBA 1CFNA 2BJMH 3HS0B 2NY5C 4P4KC 4NNXB 1NL0L 3D0LB 1RFDL 1AKJB 3UTTD 4MAYC 5MEOB 3VXRB 2IWGA 5C0CB 4RAVA 4LHUA 3VDCA 3X13A 2PW2B 2X4SA 5CEXA 4YHIA 5C0BA 3PQYA 5L2KD 1LDSA 3K3QA 1K6QH 4ONOA 1DQJB 3BDBA 4YK4C 2BNRD 4U1SA 4AM0B 3VFWA 2B2XL 2WBKA 2WUBL 4WW2B 2OYPA 2MNUA 3S8WA 3OAUL 2HMID 5FYJH 1YMHA 3PGDB 3VI3F 4Q9QL 3ULUF 1PEWA 4NP4H 5SV4A 4H5SB 4EIZC 1LHZA 3OR7A 5DR5L 1EH9A 4CVWA 3H0TB 4Y4FA 3T0EA 3QH3B 5JXEA 2CRZA 3BX7C 1ORSB 1PG7H 3MLXH 1N4XH 1EVTC 1AIFB 3HUJB 2DI7A 1UA6H 1ZHNA 3NZ8A 5HGGS 3WKML 2GYSA 1DTUA 4MYWB 3BPCA 1Y18B 2O61A 2VXTL 3ARBA 3B2VL 4XNYH 3SJVA 5BCAA 4ISVA 4X7FC 5GRZA 1MF2L 2D9QB 3PDGA 4NKOB 4Q6YA 1A47A 1BBDH 2VIRB 1CD0A 8CGTA 5D7IF 3ZDYE 3ARXA 1MLBA 4JFYA 3BSZH 3OHXA 2BJML 3AFLA 4PJ8A 5DFTA 3VH8G 5B8CA 1HYRC 2O5ZH 4IIQC 3T65B 3A67H 3NAAH 1FGVH 2JKXA 5HGAA 5F7EH 1HHKB 2YD8A 1CL7I 4GW4B 2QLVB 4LF3A 4NYLA 1Q9WA 2R2HB 1R5IB 3GMNB 4X4YB 1GC1C 5C2UB 1K6QL 1V3MA 4PJDE 5AAWA 4PRIA 4OCMC 2CKBA 3RAJH 5FYKH 2GT9B 3RIFK 4PLNC 4XNXH 2M1KA 3GSXB 2J8OA 5FYJL 4BELD 1SMAA 1CXFA 3CSYB 4NP4L 4I18A 4ETYA 3EYQC 1S9VA 3DV6B 4R90H 1LGVA 1GXEA 1ZGLB 1FVCA 1QKZL 1MUJA 3EBAA 1N4XL 2DYPB 4NCC2 3SDCD 5HVFB 5ADPH 2ID5A 1R5VA 4H0GA 1UA6L 5D2NB 3VFTA 1RIHH 4EJ1C 1VFAA 1LEIA 3HN3A 3BIAX 1XAUA 2XKUA 4PJ5E 2BMKA 3BGFC 3IJYA 2Z31B 1PEZA 4XNYL 5INDA 3ARFB 5ID1A 2HFFB 2R9HD 4WU5B 3VG9B 3IDYB 2H32B 4Y89A 3F7RA 2W91A 5CP3H 4JFOA 1BBDL 1DBKH 4JZJA 3MRGB 4FTVA 5LJYH 4TUJB 4AH2A 3BSZL 1ZLWK 1IC4H 3CSGA 1E27B 5JDSA 3T08A 5IB2A 2QSCH 2B39A 2J5LC 3IYLW 2O5ZL 3FFCD 4L8SC 3OKMB 3LN9A 1SEBB 1BD2D 1FGNL 3A67L 3S3SA 5E95B 5F7EL 1DLFH 1SJHB 4FRWA 1F4HA 3KGRA 5DYOA 4PGDB 4HUWB 4KRNA 2DM2A 4DUVA 2NY1D 4X98A 3HHRB 2W9DH 4U3XA 4GXVH 3BPOB 3R06A 2F19H 4J3WA 5GS2H 3QRFM 2ZG1A 2EDQA 4PJ7E 4ODWA 2P5ED 4XNXL 1SYVA 3OJMB 3GJFK 2NQCA 1ZXQA 4HSQA 3TC9A 1A1NB 1NFDB 5ADOH 4RX4D 4P46D 3VJ6B 1CGXA 4R90L 2FBJH 2ITCA 3HE7C 3HI1B 5ITBH 4QEGA 4FQ1H 2A6IA 3M1BA 1RIHL 4I4WA 5E2UH 3FQRB 4Z0BL 4OZIF 4P3DB 2IEPA 1NKOA 4NQDA 4TSCL 5DEGB 1UB5B 5C09A 1JWMA 3X14A 4AYFA 1EHNA 3I6LE 1NBVL 3U1SH 2BFVH 2DKUA 3SDCB 3GHEH 3O2VH 3IF1B 2D3VA 5FOJA 1OP5K 4LCWA 1IGTA 4RGOH 4QF1A 3O9WA 1ZE3C 3V0WH 3WNLA 3LQMA 1K2DA 4JLRA 2GK2A 4PGBA 3CSBA 2VN4A 3C5ZD 1T5WB 3MLYH 4JDZA 4P2OA 4XBGB 2QSCL 3MRQB 2ICEA 5CP7A 1JBJA 2E8YA 4XCNA 9CGTA 4LBEB 1EBAA 5KSUB 1DLFL 3OXRA 3K4ZA 2WBJB 3CDCA 4WHCA 4YDKH 4OD3H 4KK9C 3FJTA 1XIWB 5GGRY 3BP5A 1S7QB 5FDWB 1S7RB 3SHSA 3E3QE 2W9DL 4FQIH 4GXVL 1EJOH 2F19L 1SEQH 3LQAC 3HE6C 4YGVA 3ARQA 5E4EC 1FZJA 4S1QL 1E0OB 2BRRH 4IOIA 5MI0C 5ADOL 2NLJA 2HFGL 4K07A 2MHAB 4JQIL 3QHFH 4UOW0 5E6IA 2FBJL 3ZMRA 4OFPA 4P5TC 1MFNA 2NW3A 3WNNA 2ADFH 4FQ1L 1PQZB 4IRSA 1FNLA 3UPCA 4DFIA 4X6EB 4M7KH 5E8NB 1FN4A 3QIUB 1JP5A 5DJZB 3BMWA 1WFTA 4OT1H 2AV1B 4ZTOH 4ODVH 2XQBH 4KJQC 3O2VL 3P4OA 3BVNB 4RGOL 3V0WL 3L3GB 4RA3A 4M7ZC 5DJYA 4CDGC 3MLYL 5IIEB 3QJFB 3SGDI 5J6GB 3AS3A 3OJDA 4PJDF 4OZHA 2WZPD 4KJYA 3MRMB 4W4OA 1IC5H 1UM5H 4WHYG 1ZS8B 1RZIA 3QNYB 5AUMB 5D1QC 4QRPD 4YDKL 4EXKA 4OD3L 2FJHA 2L7JA 2EO1A 1RAMA 3RIAF 5D7SL 5KJRH 2C4FU 3FB5B 2BSED 4FQIL 4P5MA 1NC2D 2XIDA 5GZOD 3BMVA 1EJOL 1KB5H 1JK8A 1KLUA 3OMZA 3KHOA 2BRRL 4X0KA 3ARYA 3QWRD 4A2LA 3QO0B 3I75B 4NQEA 1MREH 3QHFL 1Q0XH 3QDJB 4WGVB 1KCLA 3WV0A 1AQDB 2LE9A 2ADFL 1NEZB 5IMLB 2HRPH 4GMTH 3QQ4B 4U0QB 4U7SA 3OKNA 1JFQH 1R3JA 4M7KL 3HI5L 4F58H 3BP6A 1D5ZA 2FDBP 4OT1L 1BQHA 5C6WH 4P23B 4LSUH 4ODVL 3LKRB 1PX4A 2QSQA 5TH2A 1NBYB 4LGPB 1FNSH 1X5LA 1KG0B 2Z8SA 4KUZH 2H3NB 1QRNE 4HFUL 5DQJB 4I77L 4PJ9C 1I8LA 3LIZH 2EDBA 4X6DB 2IH1B 1HHJA 2WSKA 2QBWA 1EK3A 3TO4B 3T3PE 3BPNB 1KTKE 1IC5L 1UM5L 2LFGA 4K94H 1A6TA 2CLZB 1A6AA 2F5BH 3PWPD 4P2QA 3BEVA 2IPKA 2VDQL 4PRAA 3MLPA 5JIKA 2EH8L 2HLAA 4QHMA 32C2B 1I8MB 1QHOA 4QOKE 5A2JH 1Q0YH 4YHYC 5I19H 2GK0B 1FNGB 5J6HA 1KB5L 3CCHB 1PSKL 5JO5B 1DANT 3UJJH 2HT3D 5HVWA 1ZV5A 5DMKA 1QTYT 1HOCA 3S35X 1KJ3H 1EGJH 4LPWA 4OGAD 3TNMB 3LAFA 4IMLB 1MREL 2F15A 2B8OT 1AJ7H 4JFXA 3BWUC 2FJGB 1VADA 5AAMA 3IS0X 2HRPL 4GMTL 2LQRA 5C0EB 1VACB 3CZFB 3QIWD 3C6LD 4WJ5B 3VXSE 4KXZI 5BS0D 3ULVH 2RQ8A 1P1ZA 4U49A 3LPGA 2NY3D 1I1RA 1MH5A 4LSUL 4M02A 3WJJA 2H2SC 2P7TB 3TFKD 4Q9RH 5HHOD 1UJ3B 4YDLC 1I7UA 4KUZL 1KIQA 4K7PY 4QRRA 3FQNA 4DOHE 1RJLB 2C26A 4XAKE 1EJ6A 3LIZL 5IW6B 3O6MH 1U8KA 4MS8D 5A43C 4NWUH 3SKJL 3U6RB 4GT7A 1TMCB 4NUJB 4BQCA 4NM8L 2F5BL 4YPGA 5I1IH 1JGUH 1FVEA 3KYNB 1F42A 4PJXA 2VLKD 1YEEH 2OMBA 3KR3H 3U48A 3MRBA 1IM9B 2X4NB 5CHNB 1Q0YL 2VZ3A 5I19L 4GH7B 5C08D 2N4IA 2VWEC 3NPSB 4PIRF 5JW4Q 1A4JB 2NXZB 1JGDB 5IMOB 4XP5H 5J3HD 4S1RH 4Q2ZA 1EGJL 2GTWB 5J4MA 4HKBB 3UZQA 3OV6A 4F37K 5HD8C 2ZCHH 2RR3A 1KJVB 4HUUA 5FECB 1AJ7L 3SDXB 2WK2A 3K2UH 2XQYG 4HKJB 3IAGC 1EZVY 4BFBD 4PGZA 1WISA 1XF3A 3ALWA 4M1CD 4ZSOB 3A6BH 4MSWB 2ZKHH 4LNRA 2P8LB 4MCYA 3QIBC 3ULVL 1EHXA 5IFAH 2AJZA 1A6VH 3HZMB 3ARSA 4MJID 4X9HA 4UDUB 2VE6B 4HCRH 2AJSL 5D2LF 2XY2A 3RBSA 5JORB 2FWOA 2NR6D 1RK0A 4Q9RL 3S88H 3NPZB 3PXHA 2GAZA 3C6LB 5IT2H 3IDIA 3QUKA 1H15A 3SKNA 2DKSA 3IAPA 1P4BH 3WNPA 1A9BA 2J8UB 4M00A 3O6ML 2QSTA 3KXFB 4NWUL 4MA3A 1QFWH 4OI8A 2AJUH 4ZYKB 4NJAH 2EXWD 5AG8A 4PRNA 1CDBA 3BJLA 5I1IL 1JGUL 2OTPA 2XPGB 1XH3B 4DZBA 4ELMA 5K9KA 3P4NA 3PDOA 4GXUM 1YEEL 5JPNB 3KR3L 4RAUA 3JV4A 3NACH 3R0NA 5DXWA 2QQQA 4H26B 1EX0A 4XP5L 4XP6H 4APQD 1H8OA 3VWJD 4PTTB 1C5DB 2ZCHL 1BZQK 5DK3A 3OKEA 4XPTH 3BP4A 3OKLB 3PL6B 5FM5M 1ZA3A 3K2UL 5FOBB 2BXZA 3S4SA 1QVOB 1EERB 2FH8A 5KSVB 1BM3H 3MC0A 5HVHC 2DLEA 1KPRA 3O3DB 3WS3A 5E6YA 2AQ2A 1WBYB 1B0RB 2R8SH 3HR5A 1NLBH 4XWOD 5IFAL 2ATPB 5D9SB 5EBWA 3U4AA 3UTPE 1TJHH 3CH1A 2XYCA 2EYTA 4LPYA 4HCRL 2GCYB 1K8DA 4Z5RB 5JW4M 1VEMA 3CFBA 4ZO8A 5I30L 3QUZD 4HKZA 5EBMA 5LBSH 3S88L 4WFHD 4PGCB 3LKOA 3P9LB 2FJFA 4FFZL 1W0VA 5IT2L 1GGCL 2ZNXA 3OKOA 4GAYA 3LH2H 3ZT5A 3UROR 3EOBA 4DQOL 1T6WA 2AEPH 3FRPA 4PLOB 2YD6A 4MJIB 2LV4A 2CR6A 3ARGB 2CDGA 1OW0A 4R97B 1H3WM 1E4KA 5IW3A 4K9EH 2AJUL 3HC3H 4NJAL 1JZ6A 3LRHA 1OWRM 1F2QA 1S9YA 4XNMA 1G9NC 5I1LA 3KLAB 2ADJB 1F4AA 4I8DA 2YEZB 2CIKA 4GAJL 4XHJC 3A0OA 4PTUA 4RFOL 5E1AA 1FLTX 3NACL 4JRXA 4MJ5B 3QQ9D 5SWZD 3BO8B 1JYXA 4GW5A 2VDLH 4XP6L 2Z35B 1YY9C 5D7IB 4BH7A 2E9BA 3U83A 4GRWH 1ORQB 3VXOB 3IRPX 4XPTL 5JZ7D 2P8MB 4Z8FL 2GJ6A 1P84K 1X4YA 2RJMA 4R7NA 1YECL 1BM3L 1D6EB 4CADA 4QHNA 5FA4A 1BX2A 3MZGB 5EO1A 2HVJA 4K8RC 5IW1B 2R8SL 2I60H 2CKNA 1NLBL 5J89A 3QFJA 4CN6A 4F9PC 3VXME 3U36A 1QFHA 2P42B 1I7ZB 1MLCB 1A1OB 5GS0D 4FNLH 4UB0H 5LBSL 4N1CA 5T1KA 1PKQE 4UNUA 2V2TA 2HG5A 5EC1B 3QO1B 5B3NA 2BSSB 3ZE2E 2WLZA 1MPAH 5E08H 3LH2L 4ZFGH 1ES0A 3KJ6H 2AEPL 1VFUA 2DTMH 4I2XB 4TVPH 5D7JA 3PHQA 5MEPB 4F7EB 3C9NA 1QG3A 2OI9C 2Q20A 2F5AH 4RAHA 3HC3L 3BAEH 3QUZB 4F3FA 5DJ2B 1FBIL 4N0UB 5C07A 5DS8B 4PJIB 3QDGB 4A6YB 1MCOH 3PP3K 3E0GA 2MWCA 2BY2A 5I74C 2ESVA 4HFWA 2VZVA 2G9HA 5F89B 3WO4B 3ZT6A 3LS4H 3DMMC 5I8CB 1S5HB 2VDLL 4MJ6A 3EO9L 4HAGA 3STLA 3H3BC 5EOCJ 4FXGB 1EFQA 1F4WH 1CN4A 3IVKA 2F53A 2JJUA 1CDYA 4XPGH 3EJZD 1WC7B 2X4UB 2YXMA 5DVLA 3F5WB 1FC1A 4X99B 3UAJD 1Z6JT 1FFNA 3PWLA 1HDMA 1ZT4A 4W6XB 3DX9A 1PY4A 4LEOB 3RWFB 4KHTL 2I60L 4PJEA 3WN5A 4E0RA 3WIIH 2ZSWB 4R0LC 2NXYC 3IJSA 5D96B 4Q6IA 4R8WH 4JG0H 4MXQD 4FNLL 5HXMA 3D5OF 1GGIH 4UB0L 5AZ2H 3W0WD 3KPNB 3W11D 4RMUA 3MRRB 3S4SG 2R23A 4X6CA 3HG1D 5FDYA 1QSEE 4AEIH 5F9DC 4LVOC 2A9ML 2AP2A 1Q94A 5EZJB 5E08L 4HG4J 4ZFGL 3FQTB 4F7MA 4JGUA 4JFDE 4TVPL 2JF1A 4OQTH 2YD4A 4EVNB 2F5AL 3DUUA 3BAEL 1IMHC 3UTZA 2PCPB 4OZIB 4NN7B 1D5XA 2X7LA 1LD9A 4JM2C 5CIPH 1T89A 1BJ1J 2JCCA 2EIEA 3LS4L 2PYEA 4GKZB 3ILPB 2P8PB 4LCYB 1DDHB 4WHTA 4FQ2H 5CZXC 5GS1C 4MQ7B 2APVA 2DQHH 2X42A 3K1DA 1F4WL 4TSAL 3P0VH 5EN2A 5B39A 3RWIA 1E4JA 2ADGA 4PLJD 2CRMA 2ZOLA 4R96A 4U1GB 1S7TB 3RGVA 1KTRL 2UUDH 3MRHA 2KUTA 4O51A 4Z76A 2H32H 1MRCH 2FEEL 4JG0L 2A73B 3MNVB 3X11B 5F9JB 1GGIL 2WP3T 5AZ2L 3VFGH 2LU7A 4J3OC 4R26H 4RQQB 1HQ4A 2NZ9D 1W0WA 4AEIL 2FCBA 1QLRA 3MRCA 4H1LB 3IETA 1G7IA 5E99H 4R2GD 3HS0A 1D6VL 4NZTH 4OQTL 4NNXA 3D0LA 1AKJA 3DYOA 4CVZB 2CJUH 5FKAA 4KC3B 1C1EH 4HEPG 5BMFH 3M07A 2ZSVB 5C0JB 1P4IH 2PW2A 4NQXB 3RP1A 4XBPA 1FYHB 3WJLC 1DQJA 1F6AA 4JFPA 5ACZB 2NY4B 3T04D 4JE4B 4L3EA 1JRHI 4XXDA 2BVPB 2DMCA 3UYPA 4Q97A 5E8OB 4WW2A 1Z0NA 4FQ2L 3M8OH 4OUUB 3D39E 2RCSH 3KPLA 4M62H 3PGDA 4LKCB 5CZVH 1U3HA 4M5ZL 4HLZG 4PJDB 1KJ2B 4H5SA 2PXYC 3P0VL 2GFBA 3V4PH 2Y6SD 3VFRB 3SO3C 1MAJA 1AIFA 3GMLA 5DWUL 3V95A 3QXUA 3SCMA 1EAPB 5H35A 5HPMB 5JPMB 1HYSC 1Y18A 2YUXA 1CICB 1MRCL 3NA9H 4OLWL 2BERA 3I6LD 4KH2A 4MHHI 5GJTL 2FZ3B 4WENB 4TRPH 3EJYD 1R3HA 3VFGL 1IBGH 4EI5B 4R26L 3GSVA 4K3JH 4CVUA 3OR6B 2R56H 3O6FD 5J12B 4LIQH 4PJ5B 3MODL 4WUUE 3QI9B 3UTSA 5HSFA 3QA3B 4LVHB 5E99L 1MFAH 2DMBA 1FAKT 3HAEB 1QSVA 2W0LA 5E1HB 1E28B 4K2UH 2CJUL 3T65A 1C1EL 3MGAA 5A2KH 1IEHA 3KWWB 5BMFL 1CCZA 1DL7H 1HIMH 5J57B 4GW4A 4EDXB 1P4IL 3CU1A 3RU8H 1R5IA 3GMNA 3O2DA 3RVVD 4X4YA 3KS0H 4F57H 3DURB 5CLTA 1TZHB 4CNIB 5L2JB 2GJZB 3M17B 1WCQA 3UTTA 2GT9A 5DHXB 4ZAKB 3M8OL 3GSXA 2RCSL 2Z0BA 4M62L 4JO4H 2P43B 5CZVL 4DZ8B 1NLDH 4UOJA 5EUKB 4UT9L 1UWXH 5L2KA 3RX7A 1HK6A 3HMXA 4JDTH 3OXSB 1ZGLA 4ZPVB 2WINB 4NKMA 2BNRA 4PJ7B 1J1PH 2VN7A 2DYPA 1UXWB 5T1MB 1IAMA 5F44A 5D2NA 4OCYH 3PP4H 1DBBL 4U1KB 5E8DH 5DJ6A 1PJ9A 3GUTA 2R2BB 5IK3B 2BHZA 5EO0A 4G80B 4U6YB 4TRPL 3NCEB 2HFFA 1IBGL 3MBEB 5B39G 5ANMB 2VISB 4K3JL 4MD4B 3BH9A 2R56L 4YUEH 2D0GA 1ZWIA 4LIQL 5CJOH 5IVZA 3W2DH 4KY1H 4JJHA 4PGEA 4TUJA 1FL3B 4YHPA 4M8VA 1MFAL 4PV9B 1S9WB 1M7IB 1Z9OA 1YEKH 4NQSA 2ICWJ 4OF7A 4K2UL 3OAYH 3GSQB 2EO9A 2WQ8A 1UEYA 3OKMA 1SEBA 4N5EC 2J7LA 4EOWL 1U36A 1D5IH 1DL7L 1HIML 1T7ZA 2Y5EA 3O6FB 4F8TA 1DANU 4PGDA 5BZWB 2ZUTA 4XCEA 4F57L 1ZA6A 3C8KA 2GSIB 3QCUH 3TV3H 3MRDB 4KI5D 1MI5D 4HWEH 1FO0B 1MFCH 3RTQC 3J8F7 4LPTA 5MHSE 1RVFH 4JO4L 1A1NA 1NLDL 1NFDA 3N06B 2A38A 4I3RL 3QUXB 1I1AC 4HBCL 1J7VR 5F6HI 3F7VB 4PY8J 5HDQH 4JDTL 4DW2H 3U0PB 3HI1A 2YPLD 1J1PL 3GJFB 3HCVB 4B53A 1FZOA 1HHGB 2VMFA 3QHZH 4LRIA 4YHZH 4X5LA 4JFQA 4CMHC 3B2UD 4HUNB 1T3FB 3PP4L 4OCYL 3D3VE 5E8DL 4DTGH 3WXWH 2BC4B 1FCGA 4P3DA 5BXFB 5KVFL 3ZE0E 4PRBB 2XN9D 5JLZB 1UCBH 3BIBX 5B38A 1UB5A 2EIDA 3RRQA 4LLWB 4E42A 4PRIE 3SDCA 3VA2C 1G9EA 3V5HB 1IILE 2OK0H 2G75A 4LKXA 4JGJA 1CWVA 2ENYA 4WO4D 3WO3B 2VKXA 3W2DL 3WNMA 4H0HB 1DQLH 1T5WA 5ISZB 1YEKL 2X1OA 4XBGA 3EKCA 3LSOA 1BBJB 3MRQA 2JJVA 1CT8A 5IJVB 1T0NA 4G9DB 4LBEA 5CINH 3C2AL 4EI6A 5KSUA 1OAXH 3DARA 1D5IL 3BZ4B 2IQAB 3BH8B 1YPZA 5EULV 2CK2A 1XIWA 3EYFB 3UXFA 5E2WH 1S7QA 4G8EA 4HXBH 3T4YA 4ZO6A 1TVDA 3VXUD 3QCUL 4FQXB 3VXTA 3FFCA 1BD2A 2GSGA 1DSFH 5HHVH 1DBAH 3GB7B 4Y88A 5IOPB 2P1YA 3Q0HA 5L8JB 1T1ZA 2MHAA 4FTVE 1HI6B 5HDQL 5I73C 1XF5A 5KS9E 3TVMB 4J3TA 1YMMD 5BV7C 4AL8H 2FECL 3REVB 1MY7A 2LABA 3H9SD 1PQZA 3QHZL 4YHZL 1JVKA 5IFJB 2ZUVA 3WXWL 4X6EA 5E8NA 1ZLUK 4RX4A 4P46A 2ZOKA 2K9UA 3QIUA 4GJTB 4Y2DD 2HJLB 5CMAA 1R3IH 2QADD 4L3CB 3MV7D 4XMLH 2OK0L 1J10A 5C0NC 3N1MC 4LPUA 1HKLH 3MCG1 3QEUA 3BVNA 2C3VB 1FL5B 1X5FA 2OTWA 4X5WB 5F72S 3RZCB 1DQLL 3PF2A 4UV7L 4OGZA 3MXWH 5J6GA 1NDMB 2V7NB 2VC2H 3MA9H 3SY0B 5F9OL 3P73B 3QG6B 2WAHA 4M93C 2HMIC 3I50L 5C7XL 3MRMA 1F11B 3BQUD 5D1ZD 5KVDH 5CINL 2E9WA 1T1XA 4ZFOL 1OAXL 4XX1G 1QRNB 5AUMA 3ULSB 5ERWB 3W81A 4WO4B 4ENEC 5I1DB 5E2WL 1WIUA 3MV01 3C5ZA 4HXBL 3CUPB 2M2DA 1T5XB 4NQDE 3FB5A 2FBOJ 4OFYD 4LAQH 3Q6GL 1J05A 1DSFL 5HHVL 5BW7A 3AREB 1DBAL 5T33H 4HIEB 4G6JH 4F9LA 2BP3A 1CGSH 3QO0A 4QOKB 1F3JB 1F6LL 1ACZA 3BN3B 1X6NA 3UTQB 2P45B 4N8VA 4KRPB 1JNNH 2DIAA 4XHQA 3I3BA 3GFUA 5DD6B 4AL8L 2G60L 3LPWA 5IMLA 4JKMA 3LV3B 3ZDXE 5C0RH 3NA4A 1HWHB 1JNHA 4PR5B 3T1FB 4AQ1B 5J13C 4WWID 4KAQH 5T3ZE 3ZHDA 2B5IC 1K3IA 2IPUG 1YNTA 3KPMA 2XQYK 1R3IL 4CMMA 4Z95H 2HVKB 2WWMC 4KDTC 3CFKA 4XMLL 1NBYA 4JG1H 3VXSB 4FZ8H 2AJVH 3VGGA 5DQJA 4YC2B 3SE3C 4JAMB 4KUCD 4AEHH 3B8YA 3MXWL 5IB5B 2BHYA 2IH1A 2VC2L 2DKMA 3LEYH 3MA9L 3AXLA 3P2TA 2IGFL 5KAQG 3HZKB 2W07A 5KVDL 5B38G 2OQJA 1A9EA 4LFHD 1U8JB 4FQQB 3K4AA 4DOHB 3ZKND 3DO7B 2LU3A 3OKKA 1KXVC 32C2A 1U6AH 4NKIH 3C60C 4NQUA 5HVGB 5HGHB 1DVFB 3RWHA 2GK0A 1UKQA 3F7YA 4Z9KB 5I1GL 3CCHA 4NCC1 4LAQL 3ZZ1A 4YO0B 5DHYB 4LLAA 5T33L 1ZEAH 2XKNA 5IHBA 2ED8A 4EUPB 4JFHD 4G6JL 1I7RA 1CGSL 3H7BB 4YQXH 1FFQA 4D0BA 1R0AH 2DM4A 3ZE0F 4MLSA 5D93B 2FJGA 4OZHE 1CDJA 4KMTH 5C0EA 5C0RL 4MD5B 5D1XD 3CZFA 4NM4L 3WHE1 4WJ5A 3IFOB 4MNGA 2DTSA 3OX8B 3QWRA 4UT6H 4KAQL 3ULUH 1H0DA 1T83A 1TPXC 5B8CC 4MQXC 4PUBH 1FFOB 3N1FC 1U95B 35C8L 1X5AA 3K4DA 4Z95L 4IHOB 4ODUB 4GRLD 3MYJB 4XP4H 4JG1L 1RIVH 4FZ8L 1WFNA 1JTPA 1RJLA 4AEHL 4F7PB 2YBRA 4U1JB 1M1SA 2HP4A 4FS0A 5E56A 3LEYL 2C3HA 4U6TA 5J9PA 5FK9B 1NCCL 3MNWB 1LDPH 1MHEB 3BIKB 1S7VA 4AENB 3S9DB 3U6RA 2PO6D 3TO2A 3KYNA 1RUAH 5F88A 2KH2B 4HK0B 4AIOA 1U6AL 5CHNA 3ZTJG 1MWAB 1D9KD 2A9NL 4QTHB 4NKIL 3TPUA 4PRPD 2GQHA 2DQTH 3ECBB 1JGDA 5I75B 5IMOA 3MX0A 1ZEAL 5DJXB 5E03A 1KTLB 1ADQL 3VGEA 1BFSA 4JRYD 1R0AL 5FECA 2ZCLH 1AE6H 2PN5A 5EIIB 4HJ0D 4HKJA 4ONFH 1FNHA 4U1HB 4JZJC 3QUYB 4KMTL 2LTQB 4MSWA 1JGEA 1F02I 5SWSE 2CUHA 1EIBA 3AS0A 3DI3B 4UT6L 3B5TA 5A3ID 1HCVA 5TF0A 3SE8H 3HZMA 1CXKA 1P9MA 1GPOH 2YXFA 2VE6A 3GSNA 3TZVC 2XTJE 5KSAB 5JORA 4P59H 4N8VG 4POZC 1EO7A 1CK0H 4XP4L 4LU5H 4Z77B 3LDBC 1RIVL 3MO1B 4RZCB 4CAGA 3CFDB 5L9DL 1S8DA 3QIWA 3C6LA 2BVYA 2A6KB 2WUCH 4I3SL 4TNWF 5BS0A 3F65A 1B6UA 1PLGH 2CDEA 4LLYB 4A6YH 2J8UA 4HKXA 4U6HB 4D0CA 3MR9B 1IGFH 4ZYKA 2AXHA 1LO3L 4MCZB 5HHOA 4XC1H 2A6JA 1CI5A 4QCIB 1YEHH 3QCVH 1XH3A 5CEZD 4IOFD 1A8JH 5JW5B 2Q86B 1N2RB 2AW2A 5J1AB 4O02H 5I76B 4QHUB 3IJHA 2HJKB 2DQTL 4IEFB 4H26A 3C08L 2V2XA 3K8MA 4EQ2A 3KPPB 4HUXB 3DGGA 3ZDXF 3ZKSD 4NC1C 2VR4A 2MFNA 1MFDL 2ZCLL 3S37H 3PL6A 3DRQB 1NDGB 5C08A 2PTTA 5FOBA 5HYJD 4ZUUA 4ONFL 1ONQB 3QEQD 1QVOA 5KSVA 4KQ3H 1OY3B 3P77B 4PY7B 5F1NB 1HSAA 3RNKB 1OB1A 1BQSA 1WBYA 1B0RA 2EZ0D 3IU3A 1AP2B 4AT6B 3Q1SH 5DUPH 3R8QA 2VXUH 2ATPA 5D9SA 5T1DH 3SE8L 1GPOL 2COQA 2GCYA 1IGYB 4XBEL 4P59L 3GMPA 5C2BH 2X4OB 1CK0L 1UB6B 1QSED 4LU5L 4JN1L 3JUZA 1BZ9B 3P9LA 1OF2B 2CK0L 4G8GD 4DK6A 1YYLH 4S11A 3VXMB 5GZOC 1PLGL 4JFDD 5HI4C 2FR4B 3WUZA 1T7VA 4QRTA 4MJIA 3GMMB 1W72B 3QULB 1IGFL 1OSZA 2BVOA 1PKQB 5C0AD 1LO4H 1MIEH 2O5YH 3MGTB 3MJ6A 1K4CB 4P4KD 3ESUF 4XC1L 4Y5YC 1MHCB 5T1LD 3QCVL 4MAYD 2FATH 5E7FA 2X4QA 3E6FB 3RWDA 2K3TA 5DEZA 1I7TB 5EPMB 1C08A 1PAMA 4O02L 5TQ0H 1LK2B 5E24E 1TQCB 3BO8A 2W59A 5DRZB 2Z35A 5MEQA 4OZHF 2V9QA 4O2CB 1ORQA 3NFNA 3VXOA 4RIRA 4PB0H 4NHUB 4Y16C 5ESQB 3S98A 2P8MA 3MUGA 4G43B 2MSPA 4M3JA 2HAZA 2DJ4A 2FB4H 3JV0A 4D9RE 3QNZA 4UIMB 3SGJC 3SN6N 4KQ3L 5E8PA 1D6EA 4JY4B 4APQA 5HHMB 3VWJA 2WANA 3IDMB 4C83A 3L7EA 3AY4A 4MAUH 4ZUTB 5IW1A 4CVXB 4EN3C 4G8IB 3Q1SL 4AY0A 4BQ6A 5B4MC 4ZXBC 2VXUL 4QYOA 3SDAC 2NY0C 3MRLA 2XTLA 1P84J 5T1DL 5CSGA 2E7HA 4ZMAT 1W2KT 1MLCA 2A2QT 5C2BL 5M94B 4WI3A 1RURH 1JGLH 4DN3H 3CZJA 1T80A 2QR0B 2YD3A 5EC1A 4NIKB 3GSUB 1Q72H 2YD9A 2BSSA 1JHKH 3EHBC 3CPLA 1HSBB 5DQ9A 1QFUH 1KB9K 4I2XA 4FFWC 1XCQA 1HXYB 1CFQA 2BY3A 1U8QB 5MEPA 1Q9LB 2DIBA 4U6XB 3DXAD 3GIVA 3QUZA 1LO4L 2O5YL 3WFBH 4R6UA 1QSEB 5DJ2A 5KSBE 5DS8A 4PJIA 5DMIH 4A6YA 2MCPH 4YWGL 4NT6A 1X7QA 3PV7A 5DEFB 1I3RB 3O8XC 4JFDB 1AXSB 4RFEA 3HLAB 3CLFH 1NCBH 5TQ0L 1B88A 2AXFB 1KJ2H 1EV2E 5GRJH 1VEPA 2YUZA 1CD1B 4G8FB 3D39D 4CU6A 1JZ8A 2X9XA 1RMFH 1AGDB 5T1LB 1CLYH 3K80A 2PTUA 5B22A 3JWDH 1CLZH 5JTWA 2AS5M 5GRYA 5BO1L 4G6AC 5MEND 2FB4L 1QQDA 1HHHB 1WC7A 2X4UA 4BZ1H 3F5WA 3EYQD 4CU8A 3KPSE 2ZUQB 3TBTB 3BD3A 1TZIB 1BFOB 4PPTA 1N5YH 2SEBB 4P3CH 3LHPL 5E2VL 3UMTA 4MAUL 4YHKH 4LEOA 2APFA 5JNYB 5FFLA 4QRUB 1AHWB 3DX7A 2JB6B 2UVFA 3EYOB 3HPLB 3T4AB 3SDDC 1HINH 3BKMH 4G7VL 2DQIH 1G6RB 3V6OC 2V9TA 4JO2H 1A2YB 1LO5B 1IARB 5F6IC 1RURL 1QYGH 2BSRA 4DN3L 4UDTA 2APWA 3CDGB 5E7BA 4HH9B 2XACC 1RZJH 4P2RD 2CO6B 5EC2B 5EZJA 2XA8H 1I4FB 2AV7B 5EUOE 4EVNA 1FFPB 4JO1H 3H9HA 3MGOB 1B0WA 3JV6B 3WFBL 3IDNB 4Y19D 4OZIA 4DCQA 1T21A 2Q8AH 5DMIL 4ZS6C 5GGTH 3LD8C 3MOQA 4PJAE 2MCPL 1WEJH 4I5BB 1N8ZA 2AK1H 3C2SA 3RA7H 3NN8B 4EIGB 1NCBL 1WIOA 1Y0LB 4NNPH 4OZGE 4KJPC 1JPST 1KJ2L 3ILPA 2IBZX 4GKZA 4OFKA 4M6AA 5GRJL 2JLLA 5DQDL 1DDHA 1RMFL 4BFEA 1J5OH 1CLYL 4MQ7A 4Y5XA 5JW4R 4K23L 1L7IH 3VH8B 4MA1C 4YFLF 3JWDL 2V7HB 1CLZL 4PJXF 4Y4HB 1P5UA 1KN2H 1P2CB 5J1SC 3I2CL 4DGVH 4BZ1L 3E8UH 3O3BB 5J0BA 1UKSA 1FVDB 2CXGA 5DTFA 4K71C 3U7WH 4L4VD 1S7TA 3D39B 3VFOB 1BOGB 1QZ1A 3HE7D 1N5YL 4P3CL 5DO2C 4XH2B 4UAOC 4YHKL 5C07E 3GMQA 3MXVH 2X1XR 3ZKXC 3QEHA 1QOKA 2DLGA 3HI6H 4UMGA 5IR1A 2ESVE 2H6PB 4HWBA 1HINL 3X11A 3BKML 3MNVA 2OJEA 2BNUA 2H45A 4UNVA 4ETQB 4UQ2B 4KZDL 5HGBB 1QYGL 4F8QA 4HJGA 2MPAH 3Q2CA 5EO9A 4KKAD 1RZJL 1IC7H 1AQKH 4RGNE 4H1LA 4GBXB 2QKIA 1ZVYA 3NCCB 2XA8L 1JMZA 3QP3A 3QG7H 4DFHA 2F53E 2ORBH 4W81A 4HH8A 4PRDB 4JO1L 1QHPA 2BK8A 2HN7A 4OKVA 4RMTA 2Q8AL 4WUUB 5C70A 1CDGA 5C0JA 3DRTB 5GGTL 3GMRB 5D6CB 1WEJL 4MWFB 1FO0H 2AK1L 3MOBH 3RA7L 1EDQA 1RHHB 4YBHA 5HGDB 3BW9A 4KK9D 4URTB 4BKLA 4NNPL 2VQUA 5C3TA 2ZUYA 3QWOB 4G9FD 3TN0C 1L9MA 5MHSD 4YXKH 2DQDH 1DE4B 1J5OL 3GJFH 5CEYA 4P9HH 3L95B 2GKIA 5BRZD 1L7IL 4LKCA 3ALXA 4ELMF 4S10A 4PJDA 1A7OH 1T2JA 1KN2L 4NZDA 3MROB 1OP3K 3E8UL 2HFTA 2DB8A 2G2RB 4J4PD 3B6SA 2YA1A 3FFDB 4P5TD 5C6TH 1TCRB 5IEKA 3MREB 3D3VD 1RD6A 4ODTH 3RX5A 4N90E 4E9LA 5F8RC 3MTRA 1HH6B 2VL5B 1EAPA 5HPMA 3MLSH 1NAMA 3PGFH 5ID0B 3F8UB 1CFNB 3HI6L 2WP3O 4KZEH 5JQ6H 2PYEE 4Y1AE 1SJEB 3ZYOA 4RAVB 1CE1H 2VERN 3UJIH 2MPAL 4OBSA 5KSBF 3CFEA 4RWHA 2AXJA 4YHIB 1AQKL 2R1XA 3EFDH 4KJQD 2Q6WB 1INQB 4K94C 1OAYH 1C7TA 3WIHH 3HAEA 3QG7L 1NSNH 4LASH 2ORBL 5JHDE 3UDWA 1UVQA 1JZ2A 1NCWH 4MDIA 5DDHA 4X8XA 1A6WH 4ONGH 4N0CC 4I1NB 3WDJA 1YMHB 4EDXA 3D25B 2AAVA 4F15C 4G5ZH 1FO0L 2DMKA 4I0PC 5EOTA 3MOBL 4YDIH 3OR7B 5F1KC 5D1QD 1T1YB 1LMKA 4Y4FB 1N6UA 3P4MA 4LPCA 2GJZA 1KCSL 3M17A 5F7NC 3N1PC 1F45A 5IM7B 1JI1A 1XGTB 1ZHNB 2DQDL 4ZAKA 4YXKL 4P9HL 4HLJA 1REIA 3BPCB 4DZ8A 2O61B 5IWLC 1A7OL 5EUKA 4XVTH 2AXGB 5B3JF 3Q5OA 3OXSA 4HK3J 3FT3B 2WINA 1NCTA 4OZ4A 4PJ7A 3ULVC 4WI9A 5DD1L 3RVUC 5C6TL 1B6DA 1IGJB 2X89D 4FQLL 4ODTL 1EHLL 2EEDA 4OJFH 4JFZH 3HE6B 4LQ1A 3MLSL 3PGFL 3OHXB 1UCTA 4HS6B 5IK3A 4PJ8B 1M6OA 4KZEL 4L1DA 5I1JH 3ARDC 5JQ6L 4JHBA 4U6YA 5EUOF 1JF5A 2J12B 4UIKL 5IB3B 1CE1L 4L3EE 3RJQB 2NX5D 3UJIL 5HGAB 4MD4A 5C9KA 3CD4A 2B4CH 4NRZB 3D3VB 3GRWH 4LF3B 4NYLB 1Q9WB 4OLXL 5T5NF 4G6FD 3JWOH 2YZ1A 1FL3A 1S5IL 4PV9A 3KJ4B 1M7IA 5J11C 1NSNL 4LASL 1SBSH 2ICWA 3FT4A 3V9FA 3RVXD 2XG4A 3B5GA 3AROA 4PRIB 1OGAD 1FORH 2CKBB 1NCWL 3GSQA 4BFGA 3MFFB 1A6WL 3B8SA 4ONGL 4NZJA 3O6FA 3PNWA 4F7TB 2X9YA 4L8CB 4G5ZL 4LCCC 5BZWA 4YDIL 1DCLA 2EDTA 4P2YA 2V2WA 5D7KE 1J8KA 2PW1B 4NUGH 2YRZA 4XC3H 3IFLH 4GW1A 1C12A 2DBJA 3MRDA 1U3ZA 3AAZA 3MUY1 1R5VB 5FM5O 3SKOA 4DKDC 3D18B 2IG2H 7FABH 1LEIB 3L5XH 3WMSA 1MRFH 2BMKB 3QUXA 3UTSE 4IOSD 2WIIB 5INDB 1F3DH 1OQOA 5ID1B 4L3AA 3GJFA 1QP1A 3VDAA 4PREA 1HHGA 5JOFA 5DRXB 1ZGLP 2CH8A 1J0HA 1T3FA 3QXAA 4NRYB 4OJFL 3TESA 4JFZL 3KPTA 3TIDA 2BC4A 3EDKA 4FTVB 4X5XB 4AH2B 5TF1H 3MBXL 2EYSB 5FXCH 4RFNC 5IB2B 4L4TD 5I1JL 1CGWA 2BVEA 4LLWA 1EVUA 3FCTB 3UTTE 1T7WA 3V5HA 2B4CL 3GRWL 1G7MA 5DYOB 2CUIA 2H2SD 3LEXB 3JWOL 5KVMC 4IRJB 1W8NA 5F7MC 2OBGA 5L2KE 5DK2A 1SBSL 1VEOA 4ZUVB 4M8QA 1FORL 3R06B 3VGAC 4E41E 5IJVA 2BNRE 5DJDB 3BDYH 4G9DA 3D1MC 1VESA 4Q0XH 2IQAA 4XB7A 3UBXI 3WIHA 4G6FB 1FPTL 3HC4H 4JHWH 2ITCB 1I1YA 3BZDA 1MRDH 3PWUB 1E6OH 4FQXA 4NUGL 4XC3L 3IFLL 4PJ9B 3BZFA 3O4OB 4LSQH 2A6IB 1H3TA 4I4WB 2IG2L 7FABL 3L5XL 3O3AB 1MRFL 1NMCC 3WD5H 4M43H 4NQDB 1HI6A 2J3SA 5HD8D 2NZ9C 3TVMA 3JSSA 1F97A 2C5DC 4CJ1A 2JCCF 2G5BA 3REVA 2FEDC 1WQVT 3O9WB 5IFJA 1K2DB 4HDIB 4NGHH 4C59B 2I26N 4JDZB 3WFEH 2EECA 3QIBD 5CP7B 1IVLA 3PDDA 2X9WA 2YPLA 5TPWH 4PRHD 3U0WL 1NCAH 4JPVH 1BQLH 1KENH 3ZL4H 1T89C 2C3VA 3MRPB 4D9QD 4FFVC 2XN9A 2V7NA 3SY0A 4U7MA 3P73A 3QG6A 1Z5LA 4YGVB 3BDYL 4MDJB 4Q0XL 1FZJB 1QRNA 1JYWA 4ALAH 4IOIB 1NGYA 5A40E 4WO4A 2Y6SC 3HC4L 4JHWL 3IB4A 3L3OA 4Z6AT 3IDGB 1KF9B 1RZKH 4U1LA 4OCWH 1MRDL 1E6OL 2FH6A 1ZTXH 1Z0MA 1URLA 4X6FB 5A2IH 4LSQL 2UWEA 4IRSB 1MCEA 3UPRB 2FIKA 3MSPA 4ZOCA 3WD5L 4M43L 5IVNA 1FN4B 4QOKA 3EJYC 1F3JA 4QXGH 3UTQA 3VFMA 3P0GB 1F5WA 3VFSA 4M1DL 3OF6D 3DNKA 1RV6X 5DD6A 2WBWB 5D4QA 3HPJA 5SWSD 3P4OB 2VH5L 3D6GA 1OHQA 2RBLA 1WICA 4JM4H 3RQ3A 4Z7UE 5K33A 4KROB 4WW2F 3N50A 1UKTA 5EA0H 4NGHL 2YC1B 2H1PH 5DJYB 1XGRB 2X1QA 3VRLF 3V52H 2XZAH 3WFEL 4OZHB 3U7YH 4UTBL 4KJYB 5TPWL 3CFCH 4L29B 1I9EA 4LHJB 4WIQA 2BNQD 1OD9A 2A1WH 1RZIB 5JUEH 1BD2E 3H9SA 1NCAL 2XA3A 4JPVL 3O6KL 1I1CA 2AK4D 4WUKH 3VXSA 1B0GB 4MJ4A 3ZL4L 1K8IB 5GPRA 4GRMA 1G6VK 1MELA 4OIAA 1J0YA 4HIJA 4PD4J 3FHAA 1OTTC 4G7YL 4C4KT 3RKDD 1OGTB 2QEJA 4P5MB 1YQVH 3VGHA 3DHMA 1JK8B 3HZKA 4FG6C 3LKNA 3MV7A 2P5EE 1WT5C 5E9DE 4PB9H 4UUJA 5FYLD 2VDKH 3FO0L 5DJ8A 1KOAA 4MQSB 1OAUH 3WE6B 4OCWL 1DVFA 2P24B 4XHJD 4CUCA 1FE8L 3BQUA 5D1ZA 1WFUA 4X7SH 4XRCB 2NW2A 4EUPA 1YY9D 3H7BA 4P49A 3PGCB 4R3SB 3BP6B 1D5ZB 3N85L 4QXGL 4L9LB 4QNPE 1QFWI 1J8HD 4UBDC 4YHOH 3TA3B 5F9AC 5IV2B 4OFYA 2EDXA 1VERA 4MD5A 4JM4L 1YUHB 3D87B 1S7SA 3KLHC 3OX8A 5EA0L 4XMPH 2H1PL 4K8RD 3S96A 1G7QB 2AEQH 3I3EA 4WWKB 1LE9A 1HHJB 3V52L 2XZAL 3U7YL 3EGSA 3CFCL 2DAVA 4IHOA 3MYJA 1W72H 5SWSB 5I1EH 1LEGA 3BEVB 1T6VN 2IPKB 1S9KC 4PRAB 1GZPA 5HVHB 1BIIB 4HWZA 2HLAB 4NO5A 5I1AB 1U92A 5GRUH 1A3LH 4F7PA 2YKLH 4UU9A 2XTJB 4U1JA 4XNUL 5D70L 1YQVL 1YYMH 2JJSA 4HT1H 5D7LD 3BIKA 5I71B 4AENA 3TH2T 4LCIH 3GM8A 4LGRB 5HYSG 2VDKL 1JV5A 3GSOB 1MWAA 4QTHA 5DF0A 1MAKA 1TDQA 5L7XL 3B2UC 3ECBA 5D2NC 4KK6C 3EOAA 2P48B 3CMGA 4X7SL 1O7SA 2DOCA 3LB6C 3DMMD 4X7CC 1KTLA 2Z31C 3MACL 3ROLA 3ZHKA 5GSVA 3IT8D 3ARFC 1IKNA 4YHOL 1PDKA 3RDTC 3IDYC 4UILH 2KKQA 3OB0H 2CRYA 2NY6B 4PJFA 5KOVC 1I7UB 1BQUA 3QUYA 4LAJH 2OJZH 2VZOA 4TN9A 1KIQB 5JA9A 4G6KH 2E27H 3O3EB 4XMPL 5C0IB 5K9JH 2VZ1A 4Z18A 1YEGL 2AEQL 1U8KB 2Y36H 3QUML 1EA9C 1CTNA 4GG6E 3L3JA 1ZT7B 2NXYD 5GGRA 3ISWA 1PX3A 4HGWB 4DKEH 1W72L 4YPGB 3MO1A 1ROWA 4RZCA 5F3BA 5D1XA 2C9AA 1QEWA 2A6KA 4QRPE 1VGEH 3MRBB 5DZLA 5GRUL 5TJWK 1A3LL 2YKLL 4LLYA 2YD1A 1JZ5A 1JPGB 3BHBB 3BPOC 5CS7A 3REWB 4HT1L 5FKPB 4U6HA 4MVBC 4Z0XA 5FHBL 5KAQF 4MB5A 3CJJA 1U58B 4MCZA 1JZ4A 4LCIL 3O4LD 4Q2ZB 1FJ1B 4LLDB 5JW5A 5CBEA 2AJXL 4HUUB 3QPQC 5J1AA 3TCLB 5I76A 4QHUA 3MJ9A 1G0YR 2HJKA 2R29H 4JM2D 1UZ8A 4JZOA 3GMOB 1XF3B 4M1GH 3MLZH 5DSCA 2PO6A 12E8H 1KXTB 4LNRB 4HUXA 2IMNA 2OI9B 4MCYB 4M7JL 5D6DC 4IM8A 4OCNC 2AJZB 2X40A 1D9KA 1YPZF 1PVHA 4J6RH 1Q1JH 2YWYA 4O2EA 1ONQA 5BQ7B 3H8NA 4HPOL 2FWOB 1RK0B 5CJXC 4XVSH 4N9OB 1WZMA 4PY7A 1G6RH 4CW1B 2W1NA 2OJZL 4LLQA 2NNAB 4NO3B 5F1NA 3RNKA 4ORGB 1AGEB 3QUKB 1H15B 4G6KL 2E27L 4F7CB 4L8DA 3SKNB 5K9JL 5IHLB 2Y25A 4LRNH 1A9BB 3CFIC 3DJ9A 3CVHL 3QB7C 1UH4A 3LKSA 1IGYA 3GM0A 3QDMD 2C7UB 2VKWA 2X4OA 1NUFA 2WBJC 1H5BA 4DKEL 1YA5A 2EKSA 4EZMA 1CTOA 3HRZA 1JWSB 1BZ9A 4BSWA 3QQ3B 5K9KB 3P4NB 3PWPE 2XWTB 1NGXB 3PDOB 1VGEL 4RAUB 3JV4B 1UWEH 4QHLA 2D03H 3QULA 1E4XH 2NXYB 4TTGA 1PKQA 3WFDH 2V5YA 4QTIL 3MGTA 5GSRA 4HUMB 1X5KA 5IMKA 4PJBE 4CL7A 2FEEI 3OKEB 3BP4B 3WL9B 4GKNA 3RY6A 2B0SL 3BUTA 1LK2A 2R29L 3S4SB 3U0TB 3VFUB 3RY5A 1ZVSA 5KSBB 4O2FB 1KT2B 3HMWH 1HKFA 3MLZL 12E8L 3IKKA 1DQMH 3QIUC 1UXSB 2NY2B 1PBYA 3HR5B 1SM3H 3NZHH 4NHUA 1C5CH 5BS0E 4G43A 4J6RL 4AEEA 1Q1JL 3FZUC 1K8DB 3B9DA 1YEDA 2DLFH 4ZPTB 4ZS7H 4E5XB 4HKZB 3LVEA 2PXYD 3E2HB 1G6RL 2VOTA 3IDMA 1W0VB 4TULH 4ZUTA 2EDOA 5T3XL 1CXHA 4CVXA 4G8IA 4LFHG 4NPYA 2D7QA 4LRNL 3EOBB 2CDFA 4RMSA 3V8CA 1GGYA 4IS6B 4OCRH 3KPSB 5F71A 1HYSD 2HH0H 3EOTL 3ZKNC 1S9YB 3HR6A 3U82B 2YRLA 3GSUA 5KN5A 2UY7A 5E1AB 5KANI 1HSBA 2VLKE 3HTLX 4Y5VB 1HNGA 4JRXB 4GFTB 1JN6A 2D03L 1HXYA 1IGCH 3TWCH 5C08E 1Q9LA 2P5WE 1DLHA 3VGFA 3WS6C 1QSEA 4BH7B 3I6KA 4WHDA 2XY1A 1CG9A 2F54D 1N59B 5EUOB 4JQVA 2EICA 4JFDA 3FO9B 1AXSA 5F6HJ 2OLDA 5A16B 3ZKMC 1U93B 4R7NB 4J3UA 4CADB 5FA4B 1BX2B 1MJ8H 3HMWL 3WUWG 3DBXA 3GO1H 3WXVH 2HVJB 4PJAB 5JOPE 3FB6A 1AGDA 1DQML 1S7UA 5T1LA 3TM6A 4MAYA 4UZGA 1SM3L 3NABH 3NZHL 4XAWL 5BV7L 3V7AG 1C5CL 5FUCE 4P23C 2IJ0C 1KPVA 4OZGB 4JPKH 4ZS7L 5HI3C 1XR8B 5T1KB 3GBNH 3TBTA 1BFOA 5DRNA 4TULL 4M6MH 1PGRB 3RL1A 5IB1A 2R1YB 1T1WB 1ES0B 1MEXH 3HPLA 3TO4C 3T4AA 5D7JB 3BPNC 4D2NA 3LY6A 5GRXG 4OCRL 3C9NB 2HH0L 5I0ZA 4LVNB 3S6CA 1FL6A 1T20B 5C07B 3SO3B 3CDGA 1HQRA 4HH9A 3AC0A 4AG4H 5EC2A 2ESVB 4QRQA 3UO1H 4HFWB 3PHOA 2AV7A 2CMRH 2KZWA 5JHDD 2W60A 1IGCL 3TWCL 3TYFA 2VR9A 3U9UB 3MLUH 4ONHB 4LSVL 1FFPA 2D9CA 2IMMA 5I9QB 1QA9B 3IDNA 4MJ6B 3VD7A 1X4XA 3STLB 4RGNB 3FQWB 4YR6A 4N5ED 2PETA 2ERJC 3IVKB 2OR7A 2F53B 1Y0LA 1QBBA 1FFNB 1S9XB 3PWLB 3SDYH 1HDMB 4X80H 1RSFA 3WXVL 1JGVH 4IIQA 3PXJA 3NABL 5JIHA 3VH8A 1I75A 4TYUA 3RTQD 3DIFB 1ZOXA 4Q6IB 4Y4HA 1P2CA 1EBPA 1L0XA 1UJ3C 2V5TA 4DAGH 1I1AD 1FVDA 3BN9C 3VA6A 3GBNL 1G0XA 2GEEA 4C54A 3D39A 1BOGA 4BZ2H 4XH2A 4M6ML 4ERSH 3BGMB 4PG9B 2JELH 1MCSA 2D31A 3ORJA 4ZOEA 4DVBB 5ESVA 4PBXA 4OAWA 5DURD 3DUUB 3K7UA 5FA3B 2DF3A 3UTZB 3CX5K 1D5XB 5T3XD 5HGBA 3BYTA 2CKBH 2Q7YA 4PG2C 4HUVA 4AG4L 3UO1L 5DRWB 1DZBA 3ZSSA 1UADC 3NPSC 2NXZC 4IDJH 2PYEB 4Y1AB 4NBZB 3MLUL 4J3VA 4QT5B 2DN7A 5SWZE 4YH6A 3RI5K 4OGXH 4WHTB 4PLKC 2IQ9H 2NMSA 4K55A 4KKBC 4MNHB 4RWYH 3VWKD 2EH7H 4MA7H 5C6PB 2IAMC 2UV3A 4MWFA 4P2RA 4BYHA 2AI0H 1RHHA 1OARH 3V6FA 5KZCD 5EN2B 3FOMA 5B39B 2ADGB 1L7TH 3VD9A 5IVXA 3QWOA 2ZOLB 4R96B 3SDYL 3I3DA 4WHYH 3ARUA 4UQ3B 4X80L 3RGVB 3RWCA 1FDLH 3D69B 3BKYH 2AQ3A 1DE4A 5F7WC 1JGVL 4L8SA 3SGKC 4Z76B 1P9MC 5EOQH 1IL1B 1DQDH 1EZVX 3ARVA 5A2FA 2YD7A 2QQKH 2Z9TA 4DAGL 3C5SA 1PFCA 3TJHD 2G2RA 1HQ4B 3H3PH 1GGUA 1TCRA 4BZ2L 1W0WB 3C5JB 2VL4A 4JEGB 1QLRB 4ERSL 2M26A 3MRCB 1HH6A 1LVEA 3MUJA 5DGQA 3LMJH 5ID0A 4NZUH 1CXIA 3G6JE 3QXTA 1KNOB 1CDCA 3TBYB 4KDVA 1V7NH 4XZUA 1QSFE 3SPVB 5FKAB 1I1AB 3V0VA 5I15H 1SJEA 1TFHA 2EE3A 2VB5A 3AB0C 2C3WA 3HE7A 2CKBL 5IBLC 4X6BB 5ELIA 1FHGA 3UPAA 1OLZA 2Q6WA 4XBPB 5C0ND 1INQA 4CMHB 1G1YA 3JBG7 3V8OA 1F6AB 1FYTE 4IDJL 4JFPB 2FECI 4E41D 2YUWA 5F96H 4L3EB 4KHXL 1CDUA 4XXDB 1O0VA 3V4VH 3WLWD 4OGXL 1A7RH 2IQ9L 4NN5B 4RWYL 3KPLB 2VXSL 2EH7L 3D25A 4MA7L 3PL6C 1U3HB 1QBML 1UQSA 5I8EA 4H8WH 4Y4KC 1MFBL 2AI0L 2VLRD 1ND0A 1OARL 2NY7H 1T1YA 5EZLB 3N0PB 4ENED 2GFBB 1RJCA 3AU1B 3QDAA 1L7TL 5IROC 2VQTA 3GMLB 1ETZA 5IM7A 1M7DA 1FDLL 3BKYL 1XGTA 2QTEA 3VDBA 4LSDA 3LRSA 5E5MB 3SCMB 3L6FA 5H35B 5EOQL 2AXGA 4U0RC 1DQDL 3C87A 1WUNT 2ZPKL 3FT3A 3MV9D 1TIUA 1R3HB 2QQKL 4LP5A 2ARJB 4G9FA 4IJ3B 3GSVB 1BGXH 3H3PL 1MNUH 3W0WE 1IGJA 1SHMA 3HG1E 3HE6A 5BRZA 1INEH 3SGEI 3UTSB 2DQFA 2J88H 4NFBA 3ARGC 5EWIL 4R97C 4HS6A 4NZUL 5T3ZH 2E7BA 1VHPA 1HEZA 2NTFA 4M48H 4ZFZB 5I15L 5IB3A 5DVKA 3L3KA 4P5TA 5HYQA 5SX5K 4LHUD 4NRZA 1ZHLA 3D3VA 3PWNA 4K7FA 2Q1EA 1G7JA 2WWMD 5IHZB 2R4SH 1D5MA 5C0BD 4Z7QE 3WHXB 4U1MA 4LL9A 2EE9A 3PG2A 4P5KA 3UTTB 5I16B 1XZ0A 3V4VL 3WHE0 3MFFA 3SQOH 1SVCP 3EDJA 4TNVF 5FGBC 3EO1A 4F7TA 4L8CA 2BCKB 3Q5YA 3WNKA 4ZNCD 4H8WL 3MZTA 5L2KB 2NY7L 4NKMB 4BA8A 4E41B 1XGUA 2ZZUT 2BNRB 1PG7L 2PW1A 3VXPA 3MLXL 2R1WA 5BVPH 3C60D 3VRJA 3MLWH 4PJGA 5EU7E 5BZDB 1BVKB 4ORZC 1WSST 3P9WB 1WK0A 5GGVH 3L3IB 3D18A 5DJ6B 2ZJSH 3GUTB 1DN2A 1AGFA 4PJIF 1NUDA 1GOFA 2WIIA 5EO0B 4WNQB 3GK8H 2V5SA 3SJVD 3RWEA 1BGXL 5DHVB 4L9DA 1MNUL 5K9QI 3BH9B 1CD8A 2EKJA 5DRXA 1CQKA 3S35H 1ZWIB 4NRYA 5IVZB 5DVNA 3W9EB 1P6FA 1FAIH 2VNCA 3INUH 2J88L 4PGEB 4X5XA 3ZE1F 4Q58C 4YHPB 1AGCA 5KS9A 4G42A 2EYSA 5T3ZL 3VFVB 4NQSB 1TCMA 3NIDE 3V4UH 5HHQA 4M48L 3ELAT 4MQXD 3FCTA 3NAAL 2VXQH 1FGVL 2X89A 2A6DA 4YIQB 3LEXA 3WO4C 4HGKC 2R4SL 4XCEB 1DEDA 4IRJA 2VXVH 1ZA6B 4MNQE 3C8KB 4HBQA 4B5EA 4ZNEE 2OZ4A 4ZUVA 1BAFH 3RAJL 2VUYA 3BPLB 4KKCC 5FYKL 5DJDA 2I27N 2NX5A 3SQOL 4HIIB 5E9DD 3SEPA 4DEPC 4U1NA 3S5LG 4X4XB 4POYA 4KTEH 3WDHA 4DJMA 3PWUA 5BVPL 1MQKH 4PJ9A 4MX7B 3MLWL 1FZOB 1EXUA 5ADPL 4JFQB 5GGVL 2OSLA 1QUNA 4GRWE 2CQVA 4JVWA 3O3AA 3DX6B 5D96C 2ZJSL 4F33B 3QDHA 1FIEA 3TJEH 1BP3B 3VGBA 3MJ8B 4B41A 4AQOA 1IKFH 5B38B 3GK8L 1T0MA 4E42B 1CFTB 4KKAC 1B3JA 1TLKA 2Q3ZA 2G75B 4LKXB 3S35L 5CZKA 1OVZA 4OM0H 1DBKL 4DN4H 1FAIL 1OWWA 1SJXA 3INUL 5DK0B 5KTEH 4HDIA 4OCSH 3SBWC 4M7LT 2BOCA 5TE4H 1IC4L 2OP4H 3LSOB 3V4UL 4P99A 1CT8B 4NN7C 4U1IB 1T0NB 4DGYH 1LP9E 1QPXA 4EI6B 3OJ2C 3TZVD 5HHXH 1EUUA 2QQNH 4POZD 1YPZB 3MRPA 3PWJB 1SY6A 3Q3GB 4PS4H 2DBLH 4G8EB 2VXVL 4TVPE 3T4YB 4L4TA 4CU7A 1BAFL 3VXTB 3FFCB 5CJ5A 1BD2B 1HNFA 2GSGB 1LO2H 4GLRH 4MDJA 2BOBA 1P5VA 2OS7A 1T1ZB 3IDGA 5CKAA 4PBVC 2NY1B 1XF5B 4J4PC 4KTEL 3MRKA 2VUOA 5ITBL 1T66C 1TJGH 4U1GC 4X6FA 2HTKC 4KDWA 1BZ7A 2P5EB 3LKQA 5FYJD 3UPRA 3HB3D 2IANE 5E2UL 4AIXA 5E9DB 5MERA 3OJVC 4P46B 2ZOKB 4JQXA 1BLNA 3TJEL 3MCKA 3RPIB 3ZDYF 2C3GA 4RNRA 5CMAB 1WITA 4I13B 3U1SL 2BFVL 3GHEL 4GXUN 2V9RA 3KDMA 1MAMH 3QEUB 1OAZH 5AYQA 1I9RH 4OM0L 2UUDK 5DT1H 4DN4L 4QLRA 2OTWB 5KTEL 1U8NB 2YC1A 1TTGA 1XGRA 5TE4L 2OP4L 3PIQA 1G9MH 3EDEA 4XVUC 4L29A 3AGVA 4DGYL 2JIXD 5ILTH 1DN0A 2RIKA 1GVIA 1T1XB 3MFGB 3QNXA 5HHXL 2H26A 2QQNL 1JPFB 5E2TH 1B0GA 4J3SA 1IFHH 3CK0H 1K8IA 1H3GA 1QR1A 4PS4L 2DBLL 2HFEB 3C5ZB 4PJCE 1EAJA 2NY4C 4RDQG 1OGTA 2KBGA 3B9EA 3QIBA 5HI4D 1SEQL 3UX9B 1ULVA 1J05B 5JMOC 1LO2L 4KI5E 3BRFA 3TZVB 1MI5E 3C09B 3FMGH 3EDFA 1QACA 5E8EB 2EEBA 5JW4N 2R0KH 4N8VB 4LLMB 5E6ID 3WE6A 2P24A 2VDNH 1TJGL 5FYKD 3JWDC 2C1OB 1KXQE 3C8HA 4UINH 2YPLE 1NANH 5FHAH 3DETC 4XRCA 1JNHB 1CICC 1BECA 3PGCA 4R3SA 2EDWA 1SBBA 3GNMH 4L9LA 1M05B 1YNTB 3KPMB 2XN9E 1WF5A 4EI5C 4ZTOL 4CMMB 4Y16D 3TA3A 4OM1H 3NIDF 5IV2A 4U05A 2XQBL 3CFKB 5J12C 5KBNC 3QI9C 3QR2A 1I9RL 4KVCH 5DT1L 1YUHA 4LVHC 1CD9B 3RVXC 4XVJH 1G7QA 4UV4H 1NUNB 4NN6B 4WWKA 4IDLA 4GUPB 4EN3D 4PJHA 1G9ML 5B4MD 3MV8D 5CD3A 4ZXBD 3AXLB 3SDAD 1RZJC 2NY0D 5I0DA 3OF6A 3RIFF 5ILTL 2OQJB 1A9EB 3OPZH 4Z7OE 2UWEE 5SWSA 2P46B 4PJ7F 2Q3AA 5E2TL 1MCBA 1U9KA 1D5BB 3CK0L 4C4KO 3OKKB 1BIIA 5I1AA 5GRVK 5CAYB 3KAAA 4GG6B 1V7MH 3RWHB 4HF5H