4LMQE

Development and preclinical characterization of a humanized antibody targeting cxcl12
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
220
structure length
195
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFSLTVYSVHWVRQAPGKGLEWVGALWGSGGTEYNSNLKSRFTISRDTSKNTVYLQMNSLRAEDTAVYYCARDQGLNYGSLFDYWGQGTLVTVSSASGPSVFPLALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromal cell-derived factor 1
publication title Development and Preclinical Characterization of a Humanized Antibody Targeting CXCL12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 29
structure length 195
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lmqE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lmqE01
4BSVA 4Y5YB 2VL4A 5EFIB 4ZTOH 5HXMA 3WFDL 3MRHB 4U1KB 3RDTA 5F6HI 4ZSOA 1GGYA 2XTJD 5F7FA 1DLHB 1JI2A 1JIBA 4MNQA 3BP7B 2DOCA 2D7QA 1YN7A 4JFFD 2ZOLA 4YDVB 1MCKA 1QR1A 1KJ2L 1PW3A 3RNKA 3TYGH 3QIUC 1KB9K 1P7QB 1RUQH 4I2XB 4GW5B 4PJDE 2BRRH 4OI7A 4A6YL 4EQ3A 4QRPB 4NN6B 4HJJH 4M62L 3LKSB 5DLMH 2X4OB 3E0GA 4XMPL 5E6ID 5JW3H 3IJYA 2PTVA 3P9LA 3ARGB 5I71C 4CW1A 1NDMB 4ZPTA 2D03H 3BDYH 2F8OA 5ESAB 2VLME 2W07A 5BMFH 1JTOA 4ZSOE 2WBJA 2IJ0C 1MJ7L 1NAKH 4Z7QF 5FYKL 5JIKA 3WNKA 4MNQE 3SE8H 3MGOB 5IM7A 3G6JF 4O02L 4XWGL 3RPKA 2R29H 3DTXA 4RBPH 1FZMB 2A6DB 3TCLA 1MWAH 5EA0H 4U2ZA 1BWWA 4BSWB 1NJ9A 5F88A 3TGXA 2NQCA 2QKIB 2VLRA 2DYPB 3QUZA 1NGQH 2VL5A 1H15A 5JR1H 2ZUSA 4MCZB 2LFGA 4ZS7L 2RFXB 3S97C 5DR5H 5EOCL 1LO3L 4X6BB 4Z76B 3NABH 3RIAF 5KTEL 4M93B 1E4XI 3OR7A 4NNXB 1CGVA 2AXFA 1KJ3H 4JO3H 4P9HL 1EEZA 3LV3A 1GHFH 5E2JA 4I8DA 4N90D 3GK8H 5D5MA 4LSTH 4ODVH 3SDCB 1OAXH 1RIHH 3SQOL 4PLJD 1JYNA 2VITB 5HGGS 3V5HB 1D6EA 3GHEH 2PCPA 2EEDA 2A6IA 1BD2D 3JV4B 5AUMA 1XEDA 3MUGA 2VLRE 3T0EB 1XAUA 3NA4A 3WFZA 2VDNH 4GQ9H 3TNNA 4NO3B 3CDCA 6FABL 2O5ZH 4IJ3C 4X7SH 1N5YH 4LCUB 1NCAH 4PP2A 1VFAA 4PD4K 4AM0A 1SBSH 3EO9H 5ICXA 2DTSA 4EKXA 5TQ0L 3PWVB 5D5ME 1ZHKB 3GSUA 2VE6B 5E2WL 1XF3B 5JW5B 4F7EA 4ALAL 1A7OL 3O3EA 1MUJB 4YE4L 2J6EL 2E7LA 5B3NA 5CMAB 1HKFA 1TTFA 1YEKH 4KFZC 2XWTA 1LO0L 4U1GC 4PREA 2VXUH 1JGUH 1MNUL 4L8DA 1NGPL 5KAQG 1NCWL 4P3DB 2QTEA 5HVGB 2C1PB 3ILQC 4B41A 5HPMB 3V95A 2BHUA 2DLTA 4NZTL 2AQ2A 3SCMA 3LKQA 5D70H 4QHMB 4KKNA 1B0GA 4UI2A 1OQXA 4FTVA 4U0RB 5HVHC 3T3PE 1OSPL 3MJ9A 2OYPA 3QULA 5DYOA 3EO0A 2ICWB 1P9MA 4J7RA 1U3HC 4NBZB 1IAIL 3KPQA 3PJSB 2HLFC 1U8MA 2EC9U 1FAIL 2X4QB 4J4PA 4Z7WF 2NXYD 5IT2H 2B4CL 4RISL 1CZ8H 4H8WH 4JPKH 3O8XB 1RJZB 4EVNB 3B9KA 5EFIA 4D0DA 1XFPA 3DI3B 4HUVB 1WT5A 5IQ7H 3KLDA 1E4KA 4MAYC 4POZD 4L8CB 5DRXB 5JUEH 1IEAB 4QRQA 3DO3A 1KCRH 4ZG1A 5DRZA 5CJOH 2NY0D 3BP7A 1DANT 4FTVE 3WNNA 5DD0H 1FYHB 1IBGH 4PJAF 1ZGLM 4ZFZA 4FZ8L 1KB5L 1R5IB 4X8JB 1N7MH 4GW5A 1ZK9A 4ZUVB 2R8SL 3EYUL 1GGIH 4JN1H 4F3FB 4QRPA 4Q9CA 3EFFA 2VDQL 1KLFA 2IAMC 2X4OA 4ERSL 3ARRA 1UM5L 3ARGA 5I0DA 5J6GB 1QBMH 4QEGA 4XP5L 5ESAA 2OQJA 1JNJA 3CU1A 4RSVA 4GRMB 2RB8A 4M4RA 3WXWH 4C59B 2GEEA 3RTQD 3LCYA 4I9WD 2ITDA 4P2RD 1MFAH 1FZMA 4HJ0C 4YJZL 1G9MC 4HWEL 4Y16C 5F7UA 2NTFB 4BSWA 3FO9B 4IRJA 4EI5C 4OB5H 5FYJL 1DSFL 5E1AB 5I2IA 4F37F 4AEHL 3O2VH 4QRPE 3RI5K 3BPCA 3IYLW 4U05A 4MCZA 2RFXA 1G6RL 4L4JA 4X6BA 4R3SB 4Z76A 1WWWX 5F7YC 1DVFA 3IDYC 4ODHH 3BWUC 4RQQA 1J12A 2IGFL 3KPOA 4XB7A 3PDOB 3SDCA 2DWEB 4PRBB 2VITA 5F9WC 5AYUH 4ZFFB 3L3IA 4MA7H 1JZ6A 3D69B 3JV4A 1S7RB 3ARPA 1JP5A 1I9IH 1NBVH 3BW9B 2YR3A 1LWRA 4LPWA 3CC5B 4X9BA 1XCTB 3GO1H 5ICZB 1TVDA 3QEGL 4YR6B 1N2RB 4DEPB 3Q6GL 4LVNC 4KZDL 1OP3H 5LJYH 4JR9L 2MJWA 4GMTL 3PWVA 1ZHKA 1A1MB 3BZFB 3MRCA 3EIFA 2VE6A 1XF3A 5JW5A 5C08D 3QNYB 5IWLA 4IM8A 5TH2B 1PGRB 4U7MA 1MUJA 1CFQB 3IRPX 2QQNL 5CHNB 4NM8H 3RWHB 5EULV 4IDJL 4L9DA 1Q94B 3C9NA 5IFAL 4YZFE 3MA9L 4HXBH 4POYA 2W9EH 2FBJH 4I18C 4J3SA 2Z4QB 1OW0C 3WHXB 1JGVL 2EKJA 4P3DA 2C1PA 2WLZA 5CSBA 5I15H 3LDBB 1E6OH 2WMPA 4G9FD 2CJUL 3BQUB 4QHMA 2P4AB 2YZ1A 4OF6A 1LDSA 1AE6H 5L9DH 2ICWA 4NQXA 1TZGL 5JNYB 1BFOA 4P2OB 3VWKD 2D3VA 2I24N 3KLAB 3LY6A 2X4QA 2Q7NA 3MRLB 3EJZC 1FO0L 2JELL 3V4VH 3NACH 4KTEL 3VGEA 4Z95L 1V3MA 3O8XA 1RJZA 2OTPA 4HUVA 1KOAA 5DJDA 2GJZB 4NJAH 4MXWL 4Q9RH 1XGTB 4QLRA 4JKKA 1QYGL 4WENB 4X6DF 1T1ZB 3ZL4L 2B5IC 5DRXA 2D7OA 1OARL 5CGMA 3EO1B 5JOPD 1U8PA 1KGCE 4CKVX 1OY3B 1YDPA 5D96B 3OV6A 4IRZH 1JCKA 1Y6KR 4OTXL 1R5IA 1VGKB 3CIQA 4OZ4A 2Y25A 4ZUVA 1CXEA 4HDIB 4KRPB 3QWRD 3EDEA 5LVEA 4JQXC 4CDGC 4IEFB 1KB9J 3WHE1 5J6GA 3PGFH 4G42B 5EU6D 3CFIC 4GRMA 3VXMB 4KRMB 4TSBH 2YRPA 3LAFA 3N1GC 3VRIB 1E27B 2D9CA 1ACYH 1EGJL 3MV8D 5F1KC 3I9GL 5T3XD 3C09B 5CJ5A 3O3UN 2VLKD 3VXOB 3BX7C 2GY5A 3N1QC 5DJAB 5EZJB 4F9PA 2D9QB 1P1ZB 4JHBA 5C0BD 3CFJB 1IM3A 3GKWH 4HIJB 3FO9A 4LSQH 4WY7H 1MFCL 4KK9C 3HC3H 2B1HL 4HF5L 1IKFH 5E1AA 3GI9H 3DXAB 1PKQB 2ADFH 1AY1L 3GSQB 1JYVA 2CPCA 4FQJL 4R3SA 2H32H 4K2UH 4KDTC 2D7PA 1P84K 2H2PC 2LVCA 3VFTB 4PTUB 4OCNC 3BKCL 1LEKA 5DWUH 2PR4L 2A6KB 3OB8A 3V5KB 1FPTL 2QSTA 4IIQC 5EU3B 1C5BL 3PDOA 5C0AB 5D1ZC 2KQNA 4S10A 2DWEA 2HT4D 4PRBA 4HK3J 2W38A 3HAEH 4HBQA 4ZS6D 1GZPB 3LEVH 3ZHDA 2FZ3B 4ZFFA 1KJMB 3D69A 1S7RA 5KVEH 3VXQB 5AWNH 1ACZA 2HYMA 4LSRH 5DJ2B 1KEGH 5IFHL 2RQ8A 4ZQKB 1NBYA 4M3JA 4X7EC 4HIIB 3G6DH 3CC5A 1XCTA 5ICZA 3BGMB 4DQOL 4YR6A 3T0WA 4C4KO 2A1WH 1N2RA 2QHRL 4K8RH 5C0GA 5I1CH 3S37L 1UCBL 1YEIL 3S37X 3NIDF 4X6CB 3AM8A 3HNSL 1D9KD 1A1MA 5JHDB 4WU5B 2AXGB 3QNYA 4ZO8A 2I5YH 3MACL 5IEHB 5TH2A 2V7HB 1CFQA 2AABH 3UYOD 1HYSC 5CHNA 4N8VB 3RWHA 3KJ6L 4NFDA 4DGIH 1Q94A 4Z0BH 3NZHL 5KAQF 1J1OH 3RVUC 1XH3B 1EHNA 2Z4QA 5EU4B 2GJ6A 2ICCA 3VJ6B 3V7AG 4YBQD 2PN5A 2C3VB 3K81A 3HI1B 3BQUA 3THML 3F65A 4O9HL 2ADJB 5DEGA 4YC2C 1LP9B 5D9SB 2VISA 1QZ1A 2AGJL 4LDOB 5BS0B 4GRWB 5E8EB 3GHBL 4H20H 4F8QA 4S1QH 2PKDA 3KLAA 1CFVL 3MRLA 1QLRB 3LHPH 5GRUL 1NBZB 1KNOB 2ITCB 5JORA 5JXEA 2QSQA 3T2QA 3WS6A 1T5WB 5IG7B 1IGTB 1RU9L 4OQTH 1KIUA 3TLRA 4UB0H 3TBYB 2GJZA 4N9GB 3VWJC 1YEDA 2P8LB 1XGTA 4ZO7A 4DN4H 1ZLVH 2OK0H 3P11L 1JN6A 3TA3C 3RKPA 1TTUA 2WAHA 2QL1A 4PBXA 3FO0H 3EO1A 3LQMA 3NGBC 4CBPA 2WIIA 4NRYB 5F7EL 4QY8A 4IRSC 1MLCB 5JTWA 1G9NC 5D2LB 1HEZB 4KJQD 1MY5A 1LK3H 2HAZA 3IDIB 3QIUB 3OKDB 3IAQA 4HDIA 2FIKA 3VMNA 1I7RB 4X80H 4HFUH 5E1HB 2VZ1A 2CRIA 5E2VL 15C8L 5I71B 2WUCH 5JIHA 3VXMA 2V9QA 3OMZA 1YY9D 3VRIA 2UV3A 3H9ZA 3GSXA 1F42A 1A9EB 4YDIL 4JKMA 4Y4HC 1EBPA 1F02I 2XZCH 3M8OL 1JK8B 4HIJA 3CFDB 1WFOA 5ID0B 1OTUD 4G7YH 5FA3B 4P2QB 4JO2L 3DXAA 3MPCA 1PKQA 3RWGB 1WFNA 2CQVA 4KJWC 3GSQA 3T1WA 2E5EA 3ARFA 2YUWA 3DOSA 1GGBH 3KPTA 3PGCB 4I0PC 3VXME 4X9GA 2ZWLT 2FR4B 4K3JH 3VFRA 4PTUA 1FN4B 4X5XB 1CICC 4KUZH 2A6KA 3KPNB 3V5KA 5BOZG 5MP6H 2VC2H 5EU3A 5C0AA 4LPYA 5F7WC 1NLBH 3NBNA 4OLUL 2BK8A 1YNLL 1JGLL 4X6FB 3UC0L 1GZPA 1QRKA 2R0KH 2FZ3A 4WFGE 1L9NA 1KJMA 5AYQA 5GS0L 3VXQA 1KUMA 5EUKB 4OCYL 3UROR 1TENA 2NXZD 3DXAE 4ZQKA 1PKQE 3RVWD 4HIXL 1V3JA 4HIIA 4AYFA 1IQDB 3BJ91 4WUUB 3A6BH 1RULL 3BN9C 4K94H 4XP6L 3VI3E 2Q3ZA 4IJ3B 3SE3A 1MQKH 2VO5A 3SJVD 2DMKA 1YYMH 1KTDB 2FX8H 1UKTA 4J3OC 5EBGA 3SPVA 5IVXB 5C0AE 3B3IA 3OHXB 3QHFH 4HKJB 1LO4L 4MB5A 5JHDA 4DKFL 4CMMB 4WU5A 3HMWL 2ZCLH 1J5OL 4JHWH 5IEHA 2GFBA 4IMKA 3BSZL 2V7HA 4S2SB 2NTSP 3UPRA 4IOIB 4N8VA 2BRQA 1XGQB 3MUZ1 4Y4KC 4NRXB 3UMTA 4M6ML 3IF1A 4U1GB 5I9QC 5EU4A 3U9PL 3DRQB 1AR1D 2X4RA 3OAZK 4OF7A 1FL5B 3S3PA 5E99H 2BNRB 3HI1A 4ODTL 5EZOH 3QJHB 5T5NG 2ADJA 5JDJA 2I9TB 4PJ9C 1A9BB 1LP9A 5D8JL 4NQED 5BS0A 3ISWA 1AHWC 1OAZH 4XHJC 5DTFB 5HVHB 5E8EA 3BKYH 3QT2A 1F11B 5ANMA 5JHDE 5C2BL 1U3HB 3FONA 3QXUA 1QLRA 1NBZA 1KNOA 2ITCA 2IG2L 1GAFL 3OKEB 1T5WA 4HGKC 1IGTA 5IG7A 4H5SA 3B2UD 3T2OA 1G7LB 2VABA 2CO7B 1LVEA 3BP5A 3TBYA 2P8LA 1FVEA 4LVOC 2JIXD 1JPFB 2VQ1B 1URLA 4MAYB 2H26B 4C56D 1TTGA 3L6FB 1LP9E 5HHXH 1SEQL 1S7SA 2MQ0A 4NRYA 5KN5B 1MLCA 4YH6A 5BS0E 4MXQC 3T0XA 4GRWE 5D2LA 4HFWB 5ANME 2H3NA 3IDIA 4XP1L 3QIUA 4RAUB 3OKDA 5BZWB 1I7RA 3QCVL 5K59F 3JWDL 3QCUH 3STLA 3QG6A 4M6AA 2IAMB 5FXCH 1CS6A 1JE6A 4Y5VC 3D1MC 5CZXD 3WLBA 4EDWH 4FQLL 1FC1A 3W81A 2IANB 1KJ2A 5DC4B 1H8SA 2GT9B 4BZYA 4NZUL 5J56B 1SYSB 1UCTA 2K1MA 4KMQA 1T66C 4A6YA 4N5ED 1R3IH 1DBJL 1X5IA 2E6QA 2VXSL 4NSKA 2P46B 3ULUD 5D2LE 5JO5B 3NOIA 1JK8A 1QSEB 3CFDA 4FQHB 1N6QH 1FV1B 4QRRD 3MUJA 5DD6A 2JF1A 4L1HA 2N7AA 5FA3A 1X5XA 1IM9A 4P2QA 4I77H 1OAKL 4EI5B 5C92A 2APBA 3N1PC 2UZYB 5DMJB 5DD1H 1CGSH 3RJQB 1C12B 3RWGA 1JRHI 4ZODA 4ENEC 4UT7L 5IB2B 3WIFB 1JF5A 1AXTL 5FK9B 1CDYA 1J0KA 4KKBD 3N9GL 4UBDC 3Q3GB 2XN9D 1FN4A 4X5XA 5IB1B 4MA3B 3U9UB 4Z7VB 2QSCH 4R90H 1P84J 1GC1L 1ZT4B 5DEZA 2QQLH 2R0ZH 5E7FA 5CEXB 1J88A 5DHVB 5I8OH 5F9WB 4XHQA 3WKMH 5EUKA 2E3VA 4P2QE 1P2CB 1ZGLP 2OR8A 3O3AB 4HCRH 2F15A 1IQDA 4WUUA 5FYKE 4UT9L 1WTLA 3OWEA 3CDGB 4PGEB 2XRAL 3H7BB 1KTDA 4NWTH 2H8PB 2R23A 4CGTA 4MMXC 4WI5A 5DT1L 1Z6JT 4LVNB 4HBCH 1BPVA 3OHXA 4CMMA 5HYEA 3GRWH 4OCXL 1KCLA 4S2SA 2DMBA 1HXYB 1XGQA 4PV8A 1BVKB 4QYOB 3CMGA 4NRXA 4W68A 4UNVA 2W0FA 4WUUE 4I18B 1X5HA 3BFOA 4P5KB 1FL5A 2E9BA 4WWKC 2BNRA 3OAUL 5AAWA 2P5EA 2BDNL 2YXFA 4DGYH 2I9TA 5L2JB 1A6UH 1A9BA 2UZIL 5FF6B 4ODSL 2V17L 1F11A 2EECA 2HJLB 5J1AB 3F12B 1U3HA 2C5DC 2NMSA 3ZT6A 3VFMA 4URTB 5DMKA 1EERB 4G7VH 2D4FA 5FGRA 4HPYH 4H88L 5FUCC 3TBTB 3FHQA 1G7LA 3FT2A 4BZ1H 2F53D 3SGEH 5KSBB 4G5ZH 5M95B 4GFTB 5C8JB 1JPFA 4LLUB 4XC1H 4MAYA 2BNRE 2H26A 1R3KB 3D85B 4HS6B 3STBA 2B5IB 1P7KB 5TFSH 5KOVC 2P5EE 3DUSB 1VFOA 1OGAB 5KN5A 2DDQL 1TVBA 4HH8A 1S8DB 5BJTB 4LCWB 4JKWA 3CMOL 4HFWA 5L8LB 1FNEB 1MH5B 1W8OA 4PP1D 5D1XD 2BJML 2GTZB 4YWGL 2BVTA 3FMGL 5BZWA 4P23D 3JSSA 3MUY1 3RA7H 1IILE 2DQUL 2R1XB 5KSAC 4FXKB 4Z7OF 1FIGH 2IAMA 3OR6A 1HKLH 3PHSA 3RVVD 1KELL 1JPTH 3C5ZD 4M5ZH 2GT9A 4M1CC 3PL6C 1XF4B 1SYSA 1G0DA 4NPYB 3HN3A 3GIZH 3GSOB 4BK5A 5HYSB 5CEZL 5I66A 1K3ZA 4MJ5A 5JO5A 5GISH 5IBLC 1QSEA 1DCLA 3PWUB 3MLTB 4BQBA 3RDTD 4Y16A 1F58H 5D6DC 3LRHA 4GUPB 3CGTA 3FN9A 4KUCF 4X8XA 4UIKL 1HQRB 2DM4A 4MNQD 1TJIH 4XAWL 1JWSB 4P46A 5IB2A 4HULB 1MHPL 5IW6A 3TN0D 3BEWB 3WIFA 4MA8H 5KVFL 2EYRB 3QISA 5FK9A 2VKXA 3MBEC 3F8UB 1W8NA 3Q3GA 5IB1A 3OKOA 4MA3A 2LV4A 1MJUL 4Z7VA 25C8L 5HYJB 4PRHD 4YHOL 5KANG 3QI9C 2YK1H 4AG4H 4GW1B 3B6SB 1Q0YH 1ZT4A 3GBNL 4IIQB 5EUOA 5FCUL 4LRNL 2F5AH 3QR2A 5D1ZB 3ULVC 3WN5A 2BY3A 4GLRI 2EDFA 4D0BB 5CEXA 2DQCL 2YWZA 5DHVA 1QSEE 4J2XA 2CSPA 3ZZ1A 3Q5YA 5F8RC 5BXFB 2Z35A 1I8LC 4OF3A 1CU4H 4LCCC 2HJKB 3MNVB 3O3AA 2E7BA 2VQUA 1IGMH 4HS8L 3H9HB 2RGSA 1JNNH 1I1AA 4XH2A 5IMOA 2DKMA 4MSWA 2LABA 1XGRB 3H7BA 1NCDL 1BM3L 2H8PA 2YPVL 4Z7VE 5DJ6B 3L9RB 1EPFA 5EUOE 1ED3B 1BJ1J 1EFXD 5EWIL 3BH8B 3RY6C 4JY6B 4KROD 1J1XH 3NCBB 1BVKA 4QYOA 4O5LL 3O6ML 5B3JE 4DW2H 2A9MH 4I18A 3MLVH 2IFGA 1OW0A 1YEJH 4P5KA 1A1OA 3UBXB 5IR1A 4U1JB 5GRJL 2DKSA 5GGVL 1EFQA 1K2DB 5DSCB 3BKJL 3ZT7A 1TCRA 3BH9B 5L2JA 5FF6A 3LIZL 2XQBL 4YC2B 1SY6H 5CGYC 1GJIA 5T1KD 2HJLA 1I85C 4LHUB 5I1IL 5E56A 3F12A 3KPLB 2R1WB 2XTJC 3CFEB 1VFBB 3IU3A 2VR4A 1CFSA 3EHBD 3TBTA 3ARDC 4MNHB 5I16A 4WFEE 3BRGC 7FABL 3S5LG 5E03A 5KSBA 4HLZG 4L4VD 2VXTL 5C8JA 3VWJB 3D85A 1R3KA 3FJTA 1P7KA 2DLEA 3TA3B 3DUSA 4Q97A 3LKNA 1OGAA 3BRDA 3NGBB 5HI3C 1FO0A 1U42A 2ESVD 1S8DA 3CVIH 5E6IC 5BJTA 4LCWA 4IRSB 3KG5A 1RZFH 3SHSA 4LLDB 5IW1B 5JZ7D 1MH5A 1RI8A 1VGEH 2GTZA 5TE4L 2ENSA 1TNMA 2R1XA 2FCBA 3SCMD 5SX4H 4MJ6A 4JQXA 4XPFL 4PJBA 3A6CH 5KSBE 3RVXC 2FGWL 1R3JB 5LGHH 1XF4A 3QWOB 3C6SA 5DC0A 3X14B 4NPYA 3TZVA 5FHAL 1ZHNB 1MRFH 2XA3A 3CXHK 1OGAE 3GSOA 4Q9BA 2BCKB 4Y4HB 4H1LG 4XRCB 2Z8WC 4LCWE 3X3FL 5HDBF 3MLTA 1NANH 2C7UA 4AMKL 1MRDH 2R2EB 2DKUA 1FFQA 4XVSL 5DVLA 2NR6D 3HI6H 4BZ2H 3X13B 4WFFE 2OL3H 1MHEB 1JWSA 3WIHA 1HNFA 4PJBE 1RMFL 1LNUB 3I6LD 1MCQA 3BEWA 1Z9OA 2BY2A 4PLJC 1U9KA 1CDCA 4KDTA 4K7PL 3WNLA 4I0PB 3ROLB 4K7PX 1P7QD 2YD4A 2YMXH 4OI8A 2LVEA 1CICB 3T65A 3UTPE 3B6SA 1MCWM 4IIQA 2HT3D 3S96B 2YZ8A 1DBKL 3NPZB 3Q5OA 1NGYB 5D1ZA 4F57L 4D0BA 3F58L 4PB0L 4RFOL 1R0AH 3EW3B 5A3IC 4JCLA 1MFDH 1KC5H 2P8PB 1CDIA 4HK3N 3VGHA 3MNVA 1DUZA 1B88A 3A67L 4Z7WB 4PBWD 4FNLH 3T8XB 4RAHA 2J88H 5DMGC 4MQ7B 4Y1AB 1XGRA 3ZTNL 1CT8B 3L3KB 2EDOA 2OMBA 5DUPH 5FOJA 2DYPD 5DJ6A 3L9RA 4OCWH 2VZOA 2NY7H 1ED3A 3PWLB 1F8TH 2VR9A 3GSVB 1AI1L 1CFTB 3BH8A 4F7MB 4G6AD 1HE7A 4JY6A 3HC4H 3V7MA 2DJSA 4K9EL 4P57B 3VDBA 4XX1E 1BMGA 1WF5A 3VA6A 4JRYB 5MERB 3LKOB 3FO2B 4FQQB 4MAUL 3DGGB 2IMNA 3LD8C 4X4YB 4HKBB 3CVHB 4Y4KB 2PYFB 4YLQT 2FHFA 1W0VA 3SDCD 5I9QB 2X41A 3T08A 5JPNB 3DHJA 1T03H 1L6XA 3HUJB 2APFA 1K2DA 5DSCA 4OZIF 3O0RL 2J4WH 3BH9A 1BX2B 5FV2A 4ORZC 1CLCA 4LLQB 5BV7C 4NNYA 3T0ED 4PJ9B 4OGYL 3AVEA 2GIYA 3RBSA 1AHWB 5LXGH 3EZJB 3KPLA 1T89C 3VFNA 3QPXH 2R1WA 4LEOB 1AD0A 1BHGA 4POZC 3MRJB 1T2JA 1DQML 4FQ1H 3CFEA 1T0NB 1F6LL 3MXWL 4MNHA 3I3DA 1GXEA 3V5DB 5HHQB 2VB5A 4QGYA 5FDWB 4JJHA 1ETZB 4Y8DC 3KLHD 3L5XH 2HVKB 1ZTXH 3EJYC 3VWJA 4LVOB 3I02B 1N64L 4FRWA 2P5WB 4GAGH 1EXUB 5EOQL 2R2CA 5E2TH 3TA3A 2DQDL 3WUWG 4TOYH 2YUZA 1PVHA 4ZTPH 2BY0A 3EYSH 2V2TB 1JV5A 4IRSA 4LLDA 4XC3L 1AGBB 3H3PH 4YAQB 2F5BH 2F19L 4O2CB 3OF6A 2EC9T 3BP6B 4NM4L 3MTRA 1F90L 3RTQC 4M03A 1BEYH 2ZOKB 5HGAB 4Y5VB 4LNVA 1MCPH 3NFNA 4OZGB 2LAGB 1R3JA 4XVTH 3QWOA 3D87B 3X14A 2ICES 1G6VK 1ZHNA 3O6KL 2OI9C 1KTKE 2BCKA 4Y4HA 3W11C 1PG7W 3HZVB 1CG9B 4JAMB 2X70A 1YECL 1BFTA 2R2EA 4FQ2L 2EE9A 3S6CA 1PKOA 4LCIH 3X13A 1FCGA 4PJEB 1MHEA 3UZVB 1IL1B 4TNVK 1MCFA 1IC5L 1WFUA 1LNUA 4ELKB 4BQ6A 3BE1H 2G2RB 3QUXA 1WBZB 2R0WL 4D0CB 4J12A 4OLVH 3ROLA 3ARXA 4NKQB 3VDCA 5I1HL 4KVCH 1RZKC 1CICA 3CH1A 3CX5K 5ILTL 3F7RA 2DWDA 1NGYA 4LEXL 2OLDA 2Q8BL 3DARA 5F1IA 4BUGA 1T80A 3QXAA 1HZHL 4NGHL 3GI8L 3GJEB 2EE2A 2P8PA 3LMJH 3ULUF 3IVKB 4KXZI 5JIPA 4KKCD 5FGCB 4R4BB 4Z7WA 4C83A 4Z7UB 1PZ5B 1RUAL 2CGRH 1RPQA 4WDIB 4MQ7A 2NY5H 1CT8A 1BJ1H 1UYWH 5BO1L 4KHTL 1CXLA 2IFFH 4FABL 1M4KA 3TV3H 4BH8B 1FE8H 2G60H 2JE8A 5LAXA 3PWLA 3GSVA 3C8DA 1ZWIB 5EBMB 1S7WB 3LN4B 1ZOXA 4FQXD 4P57A 4E41B 4DUWA 3UPCA 3O2WH 3L1OH 5MERA 3LKOA 1HILB 4PJAA 1U8OB 1UADC 3FO2A 4FQQA 4XNXL 3DGGA 4Y4KA 1HSBB 1ZLUH 4Z7WE 3AS3A 2CDGB 2CLRA 5JPNA 3OAZH 3MFGB 4M5YH 4O2EA 4NO0D 1VKXB 5CINL 1D5IL 3WLWD 4WWKB 4BH7B 5GGTA 1BX2A 3IFNH 4O58L 4LLQA 1X5YA 1OSZB 3OPZL 3FFDA 4PJ9A 3QRGL 4HWBA 5E9DB 1YQVL 4F7TA 1ULVA 4HUNB 1AHWA 3MJ9H 4WI7A 2Z93B 1CIDA 3NVQA 2VDRL 2ICEA 4LEOA 3UZEA 5DQDH 3MRJA 2HRPH 3E8UH 3ARZA 4L5FL 1T0NA 5T1MB 3VD7A 4HUKB 3A0OA 5TE6L 5J9PB 3LB6D 5FAAA 3FQXB 5HHQA 2XV6B 1F4YH 4GW4A 2Y06L 3TH3T 4KU1A 1K8IB 3W39B 1MPAL 3REVB 3I02A 3UTOA 4LCYB 2P5WA 4OI9A 4WFHD 1Y18B 5ITBL 3HA0A 4G3YH 4MNGA 3CDFA 3KPMB 4OUUB 2V2TA 3FT4A 1QLEH 1XGYH 1T20A 3Q2CA 1QHOA 1N5AB 4YAQA 2ZUTA 3JUYA 4O2CA 2MFNA 5T3ZH 3BP6A 5ACZB 4B7LA 1UM4L 3ZKXC 3JUZA 4GSDL 5A2KH 1RURH 5KSAB 2ZOKA 3RUGB 4YDKH 3TT1L 5HGAA 3KPPB 4PJ7B 3N1FC 4Y5VA 4QKXB 1FYTA 4FQPA 4P2OD 1QBLH 4LSSL 2P5WE 2C4FU 1IE5A 1TFHA 3LQZB 4KPHH 3PL6B 1TNNA 3HMXL 4MNGE 3HZVA 4RMQA 1GZQB 1T5XB 4JAMA 4MJIB 4WI6A 2Y6SD 3P3YA 5HGBB 5T5FH 4JO1L 4LARH 1X4ZA 3QBTB 1ERNA 3TVMA 1T22B 1KPUB 2NX5D 3O81A 5DMIL 1EHAA 3V0VA 4PJEA 4UV4H 1IL1A 4RRPG 4ELKA 2G2RA 2HT4C 5EBWB 3LQAL 1WBZA 3MFFB 4D0CA 4L4TD 5JXAH 1FYTE 1T7WA 1JZ3A 4QRTB 3G5YB 3MBEB 5GGSA 4YPGB 4KRPD 4WW2C 5ADOH 5HVWA 1FGNL 4D9RE 3K2MC 5AD0B 4V2CB 3L7EB 2WNGA 4RFNC 3QI9B 5TDNA 1LO2H 1J0IA 4PJDF 4XBEL 5IMKB 1X5GA 1NCCL 3BWAB 4LP4A 3M17B 2XZQL 1F4WL 4FZEL 1J9CT 2R56L 1UENA 3GJEA 3L3GB 1MAKA 1VFUA 1CK0L 4LCCB 3IVKA 1I3UA 4PJEE 4YGVB 5ALCL 5DVNA 5HI5D 4M6OL 4R4BA 4QXUL 3WKNA 1D9KC 4KAQH 4Z7UA 1HHHA 3QO1B 2OR9H 2FX9L 1ADQL 3ETBF 5MEQB 3IETB 1FGVL 1G84A 3FOMA 4CL7A 1EJ6A 3QFJA 2V5YA 3PHOB 3HG1A 2ZG2A 2R2HB 1MHHB 4PS4L 4OIBA 4QTHB 4MDIB 4BH8A 3DXAD 5HHPB 3DX9B 4K23L 4G8FB 2CXKA 3EDKA 2IPKA 3EUUA 1ZWIA 4J8RB 2EO9A 1RZJL 3O2DL 1A6ZB 2ZNXA 3LN4A 2MCPH 4YBQC 1A64A 2IPUK 4DVRH 3EOTL 3BYYA 1HILA 1U8OA 2GY7B 2MKLC 1HSBA 2DQIL 3RKDD 2FJFB 2CDGA 4Z7UE 4UTAL 2YD6A 2DAVA 4KTDH 3WSQL 3U7YH 4K3EH 1VKXA 3NAAH 4Q7DA 5IHUH 4GS7C 3HG1E 1OSZA 3U1SL 1U8HB 4WUKH 1NCNA 2XY1A 4HK0B 3SQBA 5E9DA 3GJFA 4LGRB 1OM3L 4LK4A 2XFXB 2DTMH 4EIGB 4NRZA 2Z93A 4XMLL 2MWCA 1V5JA 3CPLB 4ZNEA 5C9JA 4E41E 1GPOL 2XTJB 3BUTA 5C3TA 5J9PA 5LBSH 4HMCA 3UJIL 3WJJC 5A2JH 4NQSA 2EDHA 3ARDB 4JFFB 1K8IA 4KJQC 3REVA 1DDHB 2A2QT 3GBMH 1Y18A 1MVUB 3N85L 4TVPH 3BPOC 5D5MF 3KPSB 4FQCL 3SO5A 3KPMA 4OUUA 5A2FA 4KQ3H 5E9DE 3C08L 1I75A 5E6IB 3W0WB 2HVJA 2YBRB 5I1EL 2ED8A 1RVFH 3FB7B 5GQBA 1Z9MA 4OQ1A 1UACH 5ACZA 3C5JA 5TE7H 2YRLA 3CNKA 5F1NB 2IPTH 4CJ1A 4PRNB 5KSAA 1EMTH 3RUGA 4C58B 4PJ7A 3BPNC 1ONQB 5F7HA 4XPGH 5I30H 4LVEA 3T3PF 3LQZA 4HUWB 3PL6A 4LP5A 1MEXH 3KDMB 1S7TB 2Z31C 3ZYJA 1GZQA 1T5XA 1TZIB 1KTRL 1Q72L 1JPGB 1ZT7B 1B6DA 4LAQL 5KG9B 1A0QH 1BOYA 1H3XA 3O6LL 4LASL 1KPUA 3DPBA 4YHZL 5D6DA 4MQTB 1NGZB 4O51B 3ZDXF 4LLYB 4JQIL 3NCEB 3RUGE 4U3CA 1WZ1L 2L7UA 1BZQK 4NZJA 3MFFA 4PJ7E 1QSZA 3G5YA 3MBEA 3OGOE 1LGVA 5LKNA 4YPGA 3MZGB 4JPVL 1BD2B 3DBXA 5AD0A 2NXZC 1HIML 3L7EA 2Q76B 3RVWC 1FL3B 2DQJL 5HD8C 5DD5H 1JTPA 4JFEB 1A2YB 1UZ6F 5IMKA 4PPTA 3BWAA 3VXUD 4NBXB 2WQRA 3M17A 3FN0H 4FFZL 2AV1B 4HG4K 4DFIA 5D7LA 3VH8B 3L3GA 1I8LA 4LCCA 2Y36H 1X5JA 4YGVA 1HWGB 4WI4A 3O4LD 3SKJL 5I8CB 5EOCJ 3QO1A 3QP3A 5SWSD 1MCJA 3QZWB 4XPHL 4M43H 3MRQA 3B9DA 5MEQA 3IETA 2OS7A 4HH9B 1T1WB 4W6XB 3PHOA 3QEQA 2R2HA 1MHHA 3KXFA 5C0DA 4MDIA 1OP9A 2EH7H 3KHOA 4P2YA 4ZXBD 2EDXA 4QXWA 3S3JA 8FABB 2OZ4L 3ULVE 1AR1C 1BP3B 1DBBH 2AW2A 2JJVA 1K4DB 3ALXA 3NN8B 3RY6A 5FGSA 1CDHA 4LOUD 3S36L 1HXMB 4LDEB 3S36X 1BF2A 1YEHH 3IDUA 5KANI 2FJFA 3LD8B 4HJGA 4U1HB 4XXCA 2HWZL 5EN2B 2CD0A 1XR8B 3NIGE 2ATKA 2QADD 4F9LA 3TT3H 4LIQE 2PXYD 2BC4B 3QEQE 3JWOC 1CE6B 3OZ9H 4OCSH 1U8HA 3KXFE 3DSFH 4DTGL 1E4JA 5BV7B 3B2UC 5GS3A 2XFXA 2JK5B 4M8QB 5IJKC 5TDPA 4YDLC 3CPLA 4NQUA 3X3GH 5CBAB 4EN3D 4BM7A 3SGDH 1AIFB 4WIQA 4EUPB 1YNKL 2AI0H 3HNVL 1B2WL 4U49A 4JFFA 1TJGL 1KBGH 4RMUA 1DDHA 4HQQL 1QFHA 4NHUB 4D3CH 3SE9H 1MVUA 4DKDC 1ORQA 4U6VL 5D7IB 5DF0A 3UO1H 1ZA3B 4FOMA 4HUMB 3ULUL 3MLUH 2B0SL 5GGRA 5E6IA 2YBRA 1INDL 1FG2A 3FB7A 4HGWB 4P3CH 1YEFH 1AGDB 5E7BA 3QUMB 2AJYL 3PE9A 5CIPB 2XTJE 5F1NA 4RNRA 3WL9B 4PRNA 4ODXA 4P4RB 4XZUB 2ARJQ 3RTQB 4N5EC 2X89D 4R8WH 3LEYL 4JFFE 1ONQA 2OTUB 1A47A 1EO5A 2VDKH 4MX7A 1P6FA 1E6JL 4F2MB 4XCFH 4JKPL 2HLFD 4HUWA 4YHML 5IB3B 1MIMH 3KPSE 3KDMA 3T0BA 1S7TA 3T4AB 1HH6B 1CWVA 3VE0B 2O5XH 5E8DL 2OI9B 2W59A 3MGTA 1RIUH 1CL7H 1TZIA 5DK2A 5BMFL 2F74B 3QXVA 3MYJA 1IEBB 3ZHKA 4ZAKC 4GXVL 3L5WA 1XZ0B 1KIPB 4HC1A 4N8VG 1NGZA 4O51A 4LLYA 1MF2L 2AEPH 2HN7B 3GDBA 1X5AA 4X83A 5DFVD 5EA0L 1OAYH 2R1YB 3V9FA 1EEUA 3W2DL 1FORH 2VXQH 2HT2D 2ZG1A 4OSUH 43C9B 4OGAD 3P0YH 4N0UB 4LU5H 5CJQH 1RJLB 3D0VA 3GIVB 1BD2A 3VA2C 2N4IA 2Q76A 3UTZA 1FL3A 3NABL 2IAMD 4JFEA 2XG5A 1A2YA 2ZCKL 5I1JH 1JYWA 3WNMA 4A2LA 2GSIA 2IAND 3GSNL 2AV1A 3ARSA 3VH8A 4NN5C 2EEBA 1A6VL 4JG0H 1G0XA 1BAFL 5I8CA 2R4RL 4N90E 3LEXB 4RIRA 2D0FA 1I8MB 5M94B 4YHLL 1FFPB 1T1WA 4ELMB 1U92B 1NMBL 3TJHC 4EI5D 1BD2E 4UQ3A 4OD1L 2O5ZL 3QWQB 4JFEE 5IP4A 8FABA 5I1AB 4M6NH 3TBSB 1FHGA 1YEEH 5E94A 3U4AA 3QIWC 1HXMA 5A2IH 1ZHLB 4M4PA 4JJ5B 4UQ2B 3QIBC 2WV3A 3QO0B 1SMAA 5IF0B 4JZJC 2OJZH 4U1HA 1BQUA 5EN2A 1E28B 1XR8A 2EIDA 4NT6A 4OZFH 5JA9A 3KPRD 1YEKL 3ARBC 2BC4A 3KJ4C 1CE6A 1IZKA 3BXNA 3G08A 4UZGA 1WCBB 1F4AA 4J23A 2JK5A 4NUGH 4XPAL 3SO3C 1T89A 3QHZL 5HGDB 1Q8MA 2ORBL 2X9YA 3OGCB 2FYYA 2E6PA 5ACMA 2H2SD 2V7NB 4MJ4A 4WEBL 2B1AL 1QO3A 1FC2D 4L3CB 3C2AL 4M7KH 1BQLH 35C8L 3MX0A 1DBMH 4PP1C 4MZ2A 5D1XC 5DJXB 3VMOA 1VADB 3BD4A 4NHUA 3IFLL 4H8WL 4P23C 2OJEB 1WWAX 3MRRB 1Q1JH 1R3LA 4PB9H 4R4FH 1ZA3A 2HG5B 4WFED 4LSDA 4ZUUB 1OHQA 1A3LH 2UUDK 3RVVC 5EU6B 4HGWA 1AGDA 1KCRL 5CIPA 3LN5B 3WFDH 3GUTB 1UH3A 3WL9A 3ZKXB 4GT7A 2W0LA 2O61B 4XZUA 3RTQA 4NC1C 1KN2L 3EYQD 5SX5K 4WI8A 4LSUL 2OTUA 5HHVH 4F2MA 5DVOA 5IB3A 3CSYA 2YPKB 4DJMA 1HH6A 4HPOL 3VE0A 4A6YH 2E8ZA 2Z91B 2F74A 3TN0C 4LFHD 1S78C 4MDJB 4XMPH 1A7PL 1IEBA 2NCMA 1NDGB 3IXAB 1XZ0A 1KIPA 1ZLSL 1HHGB 1F2XK 3DMMD 4JM4L 5BQ7B 3MRPA 1MJ7H 2HN7A 5IIEB 2UWEF 2R1YA 43C9A 3PXJA 1JNHB 2Q3AA 2SEBB 3BO8B 2DQTL 4N0UA 1IC7L 4S0TD 1G9EA 4O02H 3O2VL 5FKAB 3GIVA 5D2NA 5KVDL 4GAJL 5J11C 4WW2B 2FECI 4JB9L 5L2KD 5FECB 4MXVE 4RFNB 3RL2B 3SY0B 2DQGL 3IDMA 1GGTA 4ZS7H 1J1PL 4JY5L 5EOCH 1LO3H 5BW7C 4RBPK 3O3DB 3R8QA 2EXWD 1S9VB 1NAMB 1WWCA 2VH5L 4B53A 3BT2L 5FUOL 4P9HH 3VD5A 5AYUL 1D9KB 1I8MA 1WIUA 1FFPA 4ELMA 4AQOA 1U92A 4N0UE 5DHYA 4DVBB 3SQOH 5I18L 3SGKA 5D2NE 4UDTA 5F8QC 2O26U 5E5UB 2XKNA 4S1RL 2VDLL 1TLKA 3HNTL 1EEYB 3MC0A 5K9QG 5I1AA 3FRUB 3TBSA 1F3DJ 1C7TA 1EBAA 5H8DA 5IMMB 3U0TB 6FABH 5BVPL 2H2PD 2X9XA 1JWMB 4G9FA 1ZHLA 3SKOB 4JJ5A 5HYJD 5IF0A 3IRZA 1YMHB 2W9DL 5D1ZD 2CKBL 1CLOL 1S9WA 1E28A 5ISZB 3B8SA 3VWKA 5TQ0H 4YO0B 4RMRA 4ELME 2DI9A 5E2WH 2FO1A 4ZO9A 1IT9L 1JL8A 1OAQL 4GS7B 2FBJL 1A7OH 4ALAH 3EHBC 4BJLA 3UDWC 4YE4H 2J6EH 1S7UA 1WCBA 2Q7YB 3VXNB 8CGTA 5I15L 3U6RA 1LO0H 4NBYB 4R97C 5HGDA 3K0WA 3U30C 2AERT 3EZ8A 1NBQA 1NCWH 2EO1A 3F7QA 4G9FE 4IHOB 3MLRL 2V7NA 4NZTH 1KF9B 4EUPH 3GKZA 4L3CA 3ZE2F 5AAMA 2E9JA 3CFCL 5JZ7C 1PZUB 4XNZC 5IB4B 1OSPH 3IT8D 4Z7OE 4N0YL 4YEEA 2OJEA 1ZA6B 1IAIH 3MRRA 1L7IL 1MJJB 1HYSD 4R2GC 3QWRA 2EIZA 3BPOB 1FAIH 2ED9A 3H9SD 2B4CH 4ZUUA 2APXA 4RISH 2IEPA 1K5NA 5F7KC 3RVUD 4KV5E 5EU6A 4HEPG 1WCQA 5FM5M 3QDGB 3LN5A 1NH6A 1BVLB 2DD8L 4LBEA 1FDLH 4JM2D 2X2YA 4W6YB 2O61A 4I0KA 3ZKMD 5JOPE 1SBBA 4LHUD 3UYPA 1K8DB 1I8KB 3BPNB 3PIQB 3D25B 3QSKB 1YN6A 3WXVL 4GXUN 4X6CF 2NR6C 2YPKA 4FZ8H 4HLJA 1KB5H 2VDPL 3DUHA 4TSCL 4OLXL 2R8SH 3EYUH 2Z31B 2HKHL 3RY4A 2VDQH 4ERSH 1PAMA 4OKDA 1G7QA 5EU6E 1UM5H 2ZUYA 1LE9B 1NDGA 3DGCR 3HHRB 3LPFA 5DFTA 4ISVB 3P4MA 3IXAA 1WIOA 3ZTJH 4XP5H 3PV6A 1NEUA 3LKPB 1HHKA 5CWSB 3T77B 5BQ7A 2HT3C 2R2BB 1MREL 5T3XE 5IIEA 3ARVA 2PF6A 4LSQL 1N8ZB 1JNHA 2SEBA 3QNXB 3TPUB 5ALBL 5FYKU 5T3ZD 1MCSA 1LP9F 3OF6D 5FKAA 3AROA 4NDMB 3T2PA 3KYKL 1L0QA 4HWEH 4GRWF 1RZIB 5FYJH 1RZKH 3RL1B 2NXZB 5FECA 2Z8VC 1DSFH 4H0HB 4AEHH 3RL2A 3SY0A 4XWOD 5BOPA 5DFWH 2H6PA 1G6RH 2YA0A 3H0TA 2WW8A 3NFPB 3O3DA 3DRTB 1NAMA 3T1FB 1UWXH 4DKEL 3CFBB 3HZKB 3J8F7 5L88L 1T2XA 4KJYB 2IGFH 1D9KA 4XNMB 4G8GD 1S9YB 2AJXL 3S3SA 4G6AC 4W81A 1T2QL 5FV1L 2E27L 1DL7H 3DV6B 1FVDA 4YBHA 3GZKA 1VEMA 3PDDA 2MPAL 3Q1SL 5D2LF 3TIDB 5EOTB 1ODAA 3IDGB 5LWYL 2ZCHL 4X6EB 3J7HA 4KJWD 1DZBA 3FRUA 4YHKL 4JLRB 5J89A 3U0TA 4RDQG 2YXMA 4I0PD 1AH1A 1JWMA 3PQYB 2R9HC 3QEGH 4JZOB 1DBAL 3Q6GH 1YMHA 1HCFX 4KZDH 2J1KA 4JVWA 4JR9H 3SBWC 4GMTH 5HYQA 5K9KA 1JFQL 4LLVB 4YO0A 1ZGLA 4ETYA 4K8RC 1GYAA 1Q9WA 2Z92B 3D39B 4JG1L 4JHZA 3DJ9A 1A4JA 3MUHL 4GMSL 4RGOL 5K9JL 2QQNH 5HYSG 2AKRB 3VXNA 5HJ3B 1OP3K 2UY6A 3KLHC 5IFAH 1IKNC 3MA9H 2YSSA 4G8EB 3RI5F 5IBUB 4YDLB 4Q0XL 2JIXB 1H9VA 5AG8A 4MWFB 4Y1AD 5ETUB 1JGVH 4KI5C 1TITA 4JFYB 4U1MB 1FNHA 4RGND 2DM3A 3UAJC 3WJJA 2CJUH 3F7VB 3MXVL 2EZ0D 2DB8A 1TJHL 2RAMA 3VXTB 1FFRA 3HRPA 4U6TA 5IB4A 5ISZE 1CQYA 2OSLB 3TO2B 2NY3D 1TZGH 1ZA6A 1MJJA 4JRYD 1MJ8L 1VENA 4L9LA 3VW3L 2CUIA 2NNAA 2JELH 2E7HA 4Y4KD 5DEFA 2GYSA 4KTEH 4MQXD 4Z95H 3RWFB 1AJ7L 1C1EL 4K55A 1BVLA 5L0QC 3M07A 2FHBA 3AUVA 1QYGH 4U4BA 4XBPB 2IH1B 3ZL4H 1QEWB 5HDBE 1F4HA 1HDMB 1OARH 2J8HA 4M02A 1OP5H 1P4LB 4XHJD 1WVZA 1K8DA 1I8KA 4K3DL 4Y7MA 3PIQA 3QQ4B 3D25A 4JDTL 4WRLA 4QRRB 4W6WB 3V6ZB 5IVXF 2YD5A 2FWOB 1DQLH 1A6WL 4OTXH 1DR9A 3H2WA 3UJTL 4EDXA 3VFWA 3KYMB 4LHJB 4R7NB 2UY7A 4NP4L 3OJDB 5ID1B 4Y19B 1MCBA 1LE9A 3EYVA 1CTNA 4ISVA 2DN7A 4XI5C 3H8NA 4TVPD 5AZ2L 3IKKA 4ZAKB 3D0LB 3LKPA 5CWSA 1A7QL 3T77A 5HDQL 4Y5XC 2R2BA 1YY8B 2XZCL 2H9GB 4G6KL 4NYLB 1EGJH 3I9GH 3KAAA 1N8ZA 1H3PL 2IMMA 3QNXA 3TPUA 4OLEA 1I9JL 3S34L 5D6CB 3UBXG 5MI0C 1RD6A 4DAGL 4NDMA 4OFYA 1VDGA 3QQ9D 4JDVA 3ZE1E 1FLRL 5CZKA 3CSGA 1MFCH 2B1HH 4HF5H 4KKCC 5D7JC 1KFAL 4BA8A 2G9HB 5FYJU 4F33B 1KLGB 2UVFA 4LHUG 2PW1A 3MLXL 3C5SB 4S0SD 1CXFA 4XAKE 1MWAB 2EDWA 3U0PB 3DRTA 4BQ9A 3SJVA 4N0CC 1A6AB 2VUYA 4NN5B 4YFLI 3T1FA 5I1DB 4S1DC 4Y8AA 3CFBA 2XYCA 3HZKA 4UT6L 4RWHA 4JFZL 3BKCH 4KJYA 5C70A 2PR4H 4XNMA 3KNBB 1FPTH 1S9YA 5FO8A 4RX4D 1CIUA 4Z0XB 1I7TB 5CUSL 4FQXC 1DLFL 5DA4A 3HTLX 4Z8FL 2P8MB 2CXGA 4M1GL 5GZND 3P4NB 1F3DH 3TIDA 3P77B 3LS4L 1JHKL 1WSST 4WGWB 5EOTA 3IDGA 4X6EA 3I75B 5K93A 2MMXA 5IFHH 5BVJA 1FVCB 5DZLA 4JLRA 5JPMB 2V2WB 4BFBD 1WIPA 4XT1C 5T33H 3QIWB 3SJVE 1NGWB 3UJJH 4DQOH 2ZSVA 1WBXA 2ZUWA 4JZOA 2QHRH 4NQEA 3S37H 3QIBB 1UCBH 4K94C 1YEIH 1FNGB 4JZJB 2FATL 1FNFA 1SHMA 5CAYB 4JFHD 4LLVA 1ZEAL 3ARED 3ARBB 3MACH 3KJ4B 3LB6C 2AKRA 3KJ6H 1PQZB 1OVZA 5HJ3A 2N1KA 2J8UB 3NZHH 3KLSA 1BGXL 4G8EA 4XNYL 5IJKA 4QHLB 4TPRL 1SVCP 2JIXA 1KPVB 3SO3B 4MWFA 5ETUA 3VXSB 1ZVSA 4PV9B 4C56A 4U1MA 1KCVL 1EAPA 1GOGA 2J5LC 5L6YL 2XY2A 4H26B 1S7XB 1JHLL 3LS5L 3THMH 1B4JL 3F7VA 4O9HH 4NQEE 4O00A 5L8KB 2HA1A 3VXTA 1FBIL 2DMCA 5DGQA 2OSLA 2AGJH 4Z7VF 3TO2A 5FIEA 2Y72A 1S9XA 5D1XB 3GHBH 1JPSL 4TUJB 3RQ3A 4E41D 1KEML 4P23B 5J57B 1TMCB 2AAVA 1AGCA 1CFVH 2OBGA 2QR0A 4ONGL 5SWQB 5E4IA 5GRUH 4J6RL 3BGFB 3MJGX 6CGTA 2AXJA 4KK5D 4QXGL 5GJSL 1RU9H 3RWFA 1JJUA 5EZIL 3KWWB 1OD9A 3JXAA 2FNBA 3MJ7B 4WWKD 4XBPA 4C56E 1HYRC 2VZUA 1QEWA 1UVQA 3P11H 1HDMA 5EORL 4NOFA 1JZ5A 2BSSB 4N8CL 1P4LA 1RZ8B 4R26L 2QSVA 3RGVC 3VFSB 4QRRA 3V6ZA 3HCVA 3RWDB 2FWOA 2XZAL 1ZLVK 3T4YB 4ONFL 3WE6A 3CFKA 1GSMA 1KACB 4R7NA 1UZ8A 3OJDA 5IB5A 5ID1A 4Y19A 5E2VH 3TN0B 5EU5B 3HI5L 3DV4B 15C8H 1WV7T 2GKIA 4LQ1A 2XN9A 3PWPB 2I60L 3D0LA 2WIMA 4LGPB 5B38B 5KJRL 4PJXB 3OG4B 2GITB 4PRHB 1YY8A 2H9GA 3MYZA 4YDIH 3RAJL 3EOBB 4NYLA 5D6CA 1YEGL 3U4BL 4JPIB 4QRRE 3S9DB 2C4FT 4PGBA 3M8OH 4JQVC 4PJFB 1YPZB 5J11B 5HI5C 2NW2A 4ZOBA 4JO2H 3OQ3B 4F33A 1KLGA 2BP3A 2EE3A 1WGOA 4Y19E 1XIWC 1MWAA 3U0PA 5FA4B 1A6AA 1MAJA 2X4SB 3ES6A 5I1DA 3O9WC 2YEZB 3ECBB 5KSBF 1OCWL 3HLAB 1PJ9A 2LQRA 4F7CB 4GKSB 4MJID 1EFXB 4Z0XA 4ZD3L 1I7TA 3PV7A 4OLUH 2P8MA 4LVHC 1YNLH 4X0KB 1JGLH 3O41B 3UC0H 3P4NA 4J1UA 1FRGL 4UNTA 3CD4A 3D3VB 5GS0H 1QFWM 4RDQF 4OCYH 1G7IB 3I75A 2Y4SA 4WWID 3FAXA 1LDPL 1FVCA 1UB6A 5JPMA 4HIXH 2V2WA 3SE4C 5I74C 5GS1C 1RULH 5C0CD 4XP6H 5F7DA 4KRNA 4KTYA 2YC1A 2JLLA 5KOMC 1KLUA 5FDYA 3QI9D 3QIBA 5KW9L 4POUB 5T1KB 5KS9B 2QBWA 1Z9SA 4P49A 1LO4H 2XT1B 5DJ8B 4DKFH 3HMWH 3N0PB 1BQHB 4XGZA 1J5OH 3ARBA 1QFPA 3BSZH 1H3UA 1PQZA 2F53A 4ZYKA 2J8UA 1QSFB 4NO2B 3SGEI 2WWKO 4X9FA 4M6MH 3TIEA 3HZYB 1KPVA 43CAB 5JOFB 3U9PH 5F9JB 5FO9A 1N0LA 2FD6L 4R97B 2BHYA 3U30B 1CF8L 2H1PH 4HXAL 2BVPA 4FP8L 4ODTH 1GIGL 4H26A 1S7XA 5E8OB 5FM8A 2ENYA 4AEEA 4B7IA 3B9EA 1RUML 2ESVB 1OPGL 4BKLB 5D8JH 4WV1C 3TH4T 2BVQB 3LRSB 4XNZB 5D1XA 2DBLH 5C2BH 4P23A 1RHHB 5F9DC 5SWQA 5LGKA 4OLWL 4WW1B 4X5LA 3CLFL 4R2GB 3SGJC 4MB4A 3PWJB 4U6XB 2IG2H 1GAFH 2F53E 2J8UE 1TIUA 5EB9A 5HPOA 3KWWA 3C5ZA 3VXSE 3P4LA 2HH0L 3FB6B 5F44A 5JA8B 1VFMA 5I1LB 2CDEB 1QVOB 4JRXB 1J7VR 1ZHBB 1H8OA 4KK8C 2BSSA 4CVUA 4JDZA 3ROOB 1RZ8A 1T4KB 1SEQH 4LDLB 2G75B 1CI5A 3EDFA 2AQ1A 5SWZD 5C7XL 4XP1H 1SJVA 5IKCB 1HKLL 3VD9A 5E2UL 3QCVH 5HY9B 3ARDD 3MLYL 3JWDH 1BZ7A 1YUHB 1H5BC 1CVRA 3TN0A 1DN0A 2QEJA 2JB6B 3DV4A 2Q6WA 1C5DA 3BKML 4FQLH 4GO6B 5CSZB 3SDDC 3KPSD 5B38A 4F7PA 1I3VA 1F4XL 4PJXA 4PRHA 1NFIB 4NZUH 1S3KL 1MSPA 1X9QA 5HI3D 3EOBA 4Z77B 3NH7L 4NC1E 3GB7B 1IZJA 3W0WD 1P4BL 3WDIA 4LSPL 1DBJH 2VXSH 2WK2A 1I1YB 4JPIA 1A3RL 4PJFA 1NC4D 1IGYB 1P53A 4I1NB 3TC9A 3DNKA 3AC0A 4YK4C 1OAKH 2HTLD 4FS0A 2AJ3B 3UTTB 5DVMA 1ZSDB 1IFHL 2CK0L 2QHLA 4UT7H 4OGXL 5FA4A 5H2BA 5TDOB 2X4SA 3RVXD 5BW7A 1AXTH 2GK0A 1UH4A 2YEZA 3PWPE 2P7TA 3N9GH 2F5AL 3HLAA 4PJXE 4PRHE 3QPQC 4ZXBC 5JOEA 3VRJB 1U8LB 2BVEA 4GKSA 2P47B 1MIEL 1GC1H 3QG7L 4CRPA 2GAZB 1EFXA 1QNZL 2H32B 3U2SA 3IS0X 1YC7A 2XI9A 2VWEC 4X0KA 4LOUC 3O41A 3E6HB 3FL7A 3QUYD 1OB1A 1B0RB 1PY4A 4PJFE 4PGDA 2Q8AL 3WUWA 3D3VA 1NFKA 1UKQA 4D9QD 1G7IA 1A1NA 2R0LH 1HHIB 4DWHA 3HAEB 3UPAA 1AXSA 3VD4A 2QADC 2FO4B 4IBLT 4LF3B 2PXYC 4P5MB 4UT9H 4YXHL 4PJCF 2HJFA 2XRAH 3E6FB 1K4CA 4JFED 5T1KA 5DT1H 5ITFB 1E4XL 2DBJA 5E08L 4ZOCA 1K6QL 1OOAA 1BQHA 4OCXH 5A3ID 4V1DB 4GBXD 4EN3C 5DUML 1R6VA 3D3VE 3UDWA 2JJSC 5GIRA 2VAAB 3OAYH 4PR5A 2ZSWB 4NO2A 4JZNB 3HZYA 2ZZUT 4L4VA 4YXKL 2V5MA 4P5TD 43CAA 5JOFA 5DMGD 2CKBA 5F9JA 4L8BB 4QRSB 5JW4R 3G04B 2KZWA 3Q6FB 3OAUH 5E8OA 4JFPB 4U33A 2BDNH 2ESVA 2XOTA 2UZIH 1ZANL 4ODSH 4BKLA 2V17H 5K9QI 2BVQA 3HE7C 2D7TL 2YN3A 4BK4A 1RHHA 1U2CA 4DCQB 2E6JA 4X7CC 3U4EB 4WW1A 4CVXA 2ARWA 1FNSL 3PWJA 5SX4I 3S8WA 4H88H 1KIRB 4LLWB 2WQ8A 3TESA 3L7FB 4L4VE 3MCLL 2O5YL 3KR3L 4MHHG 2I25N 1KIQB 1FSKC 1WICA 2H45A 3AB0C 3CUPB 3U7WL 4C57C 5L0QB 5I1LA 2CDEA 1QVOA 4JRXA 2XPGA 4FFWD 1ZHBA 3R06A 3QXDB 2ESVE 1T4KA 3F6LA 5GHWL 4Y5YA 2BVYA 2DDQH 1L7TL 3ZDXE 3MRHA 3CMOH 4U1KA 4TRPL 1NANI 1QA9B 4HX1B 2BJMH 1BJ8A 1DLHA 4YWGH 2D7MA 3OKLB 4HT1L 5IKCA 3FMGH 1X4XA 2XA8L 3MRIB 2DQUH 5DFVC 2FLRT 4XNUL 1YUHA 4PRAB 2AV7B 4YDVA 2HT2C 4EEEA 2JB6A 4OGAC 3EJYD 2VTFA 4M9OA 1KELH 1P7QA 3S98A 5CSZA 3GMRB 1JNLL 1UZ6E 4I2XA 2VIRB 4JRXE 3V79C 1NFIA 2WUBL 2ZG3A 4OV6F 3LKSA 4Z77A 3HUJF 4Y5XB 4G8IB 2JCCB 4WHYH 5CEZH 1NDMA 1G9ML 1I1YA 4M7JL 3HI6L 1W72B 5MI0B 4OBRA 3I3EA 5DQJB 5IJVB 3UTQB 3M45A 1IGYA 1KV3A 5DJ0B 2BFVL 4CVZB 4DZBB 4XPBL 5D7JB 3MGOA 1ZSDA 3I6LE 4XAWH 1MHPH 2A6DA 1WZKA 5KVFH 1EV2E 5D1QD 2QKIA 4P4KD 4I2XE 4ZOAA 1WJ3A 4OAWB 2DYPA 1Q9OB 2VLJB 4JFDD 1MJUH 4PYHA 3VRJA 1U8LA 2GQHA 25C8H 4YXLL 3ET9F 2GAZA 4YHOH 3W11D 2H32A 5KVMC 3GBNH 5FCUH 4LRNH 2HTKC 3RIFK 1IAKB 4FQXB 1HI6B 1NMCC 2DQCH 1B0RA 4NNXA 3FQUB 2FX7L 4Q6YA 3TO4C 3CXDL 3TBWB 3TBVB 1JGEB 1TXKA 1HHIA 3HAEA 5DC9B 4HS8H 3V5HA 4NO0B 5DO2C 4P5MA 2K9UA 1FAKT 3PG2A 4WO4D 1DQQB 4QO1A 3E6FA 5FYLD 5HHOB 3OB0H 1NCDH 2AJSL 4ESKA 3T0EA 1BM3H 4OZGF 2YPVH 3U48A 2AJVL 4NO3A 3C2SA 2OXGA 4JHAL 3SBWA 2Y23A 3K4AA 4MJ2A 1NUNB 4OM0L 4BFEA 5EWIH 4LCUA 3IAGC 3IDJB 2YD2A 3K46A 2VAAA 2H2SC 1RFDL 1EHLL 2ZSWA 3X11B 3G6AB 4O5LH 4X5WB 1JMXA 1UGNA 4JZNA 1YC8A 3O6MH 1IKNA 2XKUA 4KHXL 1QKZL 4Z78B 4AL8L 4PJEF 2AXHA 4L8BA 5GGVY 5GRJH 2G5BB 4FN0A 3Q6FA 4UOJA 5CMAA 5GS2D 5GGVH 2J5LB 3TNMB 4JFPA 3BKJH 4RRPA 3T0EE 2VSCA 1IAOB 3LIZH 2XQBH 2IWGA 3VI4E 1BBDL 5I1IH 1EJOL 3VG0L 3V4PL 1U8JB 1BZ9B 2UWEB 3D18B 5HPMA 1ORSB 4NCC2 1GH7A 2NY2D 3EYQC 2C26A 4EQ2A 1CE1L 1EDQA 4LLWA 7FABH 3P30L 1KIQA 3PJSA 1UWGL 2VXTH 3VH8G 3EYSL 4Z7UF 1T6WA 1JPST 4CADB 1RAMA 3OJ2C 1MAML 4EVNA 3QZWG 3KYAA 1T7XA 3RGVB 5DHXB 3MRFB 4HX1A 4L8CA 1IEAA 1NL0L 2NX5B 4XBGB 3OKLA 1F97A 5TE4H 3DMMC 3MRIA 3QXTA 5IEKB 5F70A 4PRAA 5DXWA 2AV7A 5DZNA 1M7IB 3VFOB 4XPFH 4L4TB 4Z18A 4XP9L 2ZUQC 3MCG1 3GMRA 4X8JA 1XF2B 5ABDE 2VIRA 4P59L 2FGWH 3ARUA 5D71L 3EOAB 4F3FA 1D3CA 4Y5XA 4G8IA 2JCCA 5FHAH 4Y2DD 2X1WL 3X3FH 5DQJA 2YD1A 3UTQA 2EXWC 4DN3L 3GNML 1QD0A 2BSTB 1I7ZB 5DJ0A 3WIHL 4CVZA 4XVSH 4NZRL 2A83B 4DZBA 4EI6B 2FSEB 3F5WB 1RMFH 2ZJSL 4KVCL 4K7PY 1XIWB 2IH3B 2VQTA 3MODL 2NTFA 3VXPB 4X7TB 4K7PH 3QUZC 3O9WB 3K8MA 1Q9OA 5CBEB 5FHBH 5JLZB 2IQAB 4EUPG 4M8VA 1LK2B 3DX6B 1KN4L 4XCCL 3ESVF 3DI2B 2JCCE 4RCAA 1DBKH 1V7ML 3GSRB 4MCYB 5IK3B 4F57H 1FZOB 1IAKA 4FQXA 3DX8B 2ID5A 2FLBT 3DURB 4LVHB 3HRZB 3H7LA 1A6TB 2GCYB 2XWJB 3F58H 3FQUA 4PB0H 1H3TA 2WP3O 3DVGB 5I17B 3TBWA 3TBVA 2VOTA 1JGEA 5H35B 3EGSB 1RZGB 3UTSB 3CX2A 3DIFB 3IGAB 3A67H 3GMQB 4NO0A 5I74B 5GS1B 1QHPA 4NO5B 3RUGF 2KDGA 3UBXI 4GG6B 3QYCA 1DQQA 4PJ7F 4ZUSB 4YHPB 3ZTNH 1I3GL 4NC2B 3MOBL 4LPUA 3BW9A 4GQPH 4QNPF 5T1LB 2NY5C 1AI1H 1X5ZA 5IESL 4PYGA 1VB9A 3IDJA 4K9EH 4NKIL 4UUJB 2X42A 3BIKB 3G6AA 4X5WA 5HHNB 3UCRA 3BZFA 4Z78A 5EO9B 5HBBA 1NMAL 3ZTJG 5C0ND 4TTGA 3CH8A 3A6OA 3U83A 3TNMA 3O0RH 3EOYG 1IAOA 3IDXL 4OT1H 3WHXA 4OGYH 3H42L 4WV1B 2VDOL 1A14L 1U8JA 2UWEA 4NHCL 1HINL 3BDXA 4JM2C 3D18A 3I3BA 4P99A 3ULVF 1ORSA 2RIKA 1U8KB 1LILA 3ZKMC 1PLGL 1P9MC 3MOQA 3MXWH 5C0RL 5JNYA 5ISZD 2VAJA 4P2OA 4AEFA 1BFVL 4J4PC 1C16B 2YKLH 4OCRL 4WFHE 1CLYL 1XGYL 1N64H 3ZKNC 5EOQH 4CADA 3HFML 3NIGF 1QRND 2DQDH 3BMVA 1G9NL 1ZLWH 2FJHB 3G5ZB 3PP4L 2A38A 5A2LH 2MOVA 1WT5C 2IBGA 5CD3B 4XC3H 3MRFA 1T1ZA 2F19H 1CCZA 2NX5A 2UWEE 4XBGA 3QNZB 4NM4H 5J8OA 1F90H 3VFGL 1D5ZB 4NNPL 1M7IA 3VFOA 2KUTA 1DE4B 1H5BB 4L4TA 2IPUG 5CP3H 3MRDB 1XGPB 3FOLB 3NFSL 2KH2B 5JQHC 3QJFB 1T83C 1U3YA 1VGKA 1XF2A 5LQBL 3EOAA 3SDDB 4FA8A 3K80A 4LARL 4UU9B 3O6KH 3AY4C 3VU2A 3S35L 2AEWA 4YUEL 4G42A 4XWOC 3S35X 3VXUB 3QDGD 1YECH 1BQSA 1W72H 2BSTA 1I7ZA 4JQVA 4M00A 2NX5E 1E27A 5DS8B 4FQ2H 4LLMB 5JXAL 2A83A 4YK4B 3DHMA 3O4LB 4EI6A 2FSEA 5C07D 5SWSB 3NCCB 3F5WA 4HAGA 3VXOA 4MQSB 3CZFB 5LCVL 4L3AA 1IC5H 5DJAA 5EZJA 4L4TE 5HI4D 3EJJX 1P1ZA 3CFJA 4L3EB 4IRJC 3VXPA 2R0WH 4X7TA 5M7QA 2I27N 3F6IA 5JLZA 2IQAA 3VCLB 5I1HH 3DX6A 4GG8B 2Z31D 4ZXBB 3AMKA 5ILTH 3D6GA 1S5IL 3RZCD 4XAKD 1DVFC 3GSRA 5A1AA 4LEXH 4MCYA 5IK3A 3DX8A 2Q8BH 3OSKA 3DURA 3HRZA 1A6TA 2GCYA 2XWJA 3K2UL 4K07A 5FM4A 3VFTA 1HZHH 3CSBA 3JVGA 1UQSB 3SDXF 4NGHH 4HS3B 5I17A 3GI8H 4CN4A 4NQCB 1RZGA 3DIFA 5A16B 3IGAA 3WFBL 3GMQA 1UWEL 5GS1A 1RUAH 4XCYB 2QADB 4MZ3A 4NO5A 4GG6A 4OFYD 1OT1A 1F3JB 3GMOB 2PXYB 4R9HA 1OD7A 4YHPA 3D9AL 4W4OA 5DJ2A 5BO1H 4KHTH 4HCRA 1Y0LB 3I6GB 4FABH 5HD8D 4JPWL 3L5JA 4TTDC 1CGTA 1UFUA 3BGMA 1NGXB 4RAVB 5GJTL 3QEUB 5D7SL 2A9NL 4LMQI 3ZE2E 3DVIA 4RGNC 4C4KT 3CVHL 3V0WH 4EN3B 4UUJA 3BIKA 4XPTL 3RRQA 5HHNA 2EZ0C 4X6CA 3QDJD 3NAAL 5EO9A 3GRWA 4KMTH 4TNVF 2VUOA 2NY3C 2AXGA 5GGTL 1MY7A 4YHIB 4TUOB 2RCSL 4GG6E 1AP2B 1MQ8A 1TCMA 5CINH 2EICA 3MA7B 4HWBL 5GS0D 1OAUL 1D5IH 2EYTB 4O58H 5JMRA 2KPNA 4MQXC 3OPZH 1XH3A 4HMEA 4KKLC 1KCSL 3QRGH 4KVNL 4Q2ZB 1ZLUK 5D7KD 1YQVH 1VPOL 1DUYB 4LKCB 4QCIB 5K9OB 3VJ6A 3MLZL 2C3VA 3PQYD 3HE7B 1HOCB 2VDRH 1INEL 1U8KA 1YMMB 1VEPA 2GJJA 4L5FH 5I8EB 5D9SA 1B90A 3SGJA 1QSVA 4AEIL 1NCUA 5TE6H 4X6CE 2A0LC 1C16A 2Y06H 4EJ1C 1NLDL 5E4EC 2FIRT 4DZ8B 1I1RA 1FSKB 1MPAH 3AB0B 3D39D 2VN4A 5DZOA 3R8BB 5ITBH 2FJHA 1MI5B 3G5ZA 4AQ1B 1F3RB 4AJ0A 5CD3A 3MLPA 4N9GA 3ZSSA 1V7NL 2MSPA 1OWWA 1RUPL 2P24B 1DQDL 1EMTL 1U95B 4R96B 3STZB 3QNZA 1T1XB 2OP4L 1UM4H 1OLLA 3Q0HA 2HFFB 1D5XB 4PRPB 4O2FB 4UINL 4RZCB 4GSDH 2YUVA 2M1KA 1H5BA 1HEZA 2MQCA 5I75C 3TT1H 3MRDA 3FOLA 2AEQL 3QJFA 3QQ9C 3JTSB 4QGTA 4LSSH 4WNQB 3SKNB 3SDDA 4WCYL 4UU9A 2BVUA 4OLZH 4M7LL 3HMXH 2DF3A 3FQRB 2Q1EA 1N26A 1G1CA 4Z6AT 3VXUA 1I3RB 1UKSA 1YYLL 1R5VB 4JO1H 1KSRA 5F7MC 4G6ML 1RK0B 1J18A 1A9EA 5DS8A 5DMIH 3O4LA 1VACB 3WEXB 5SWSA 5E8NB 1CBVL 3CZFA 5I8KL 3U82B 1EK3A 2A77L 3LQAH 4TQEL 5ID0A 3BD5A 5GZNC 3P73B 4OM1L 5J1SC 3HS0B 3I6KB 2OL3B 5I1KL 4MD5B 5DQ9B 1F5WA 4ZXBA 1FGNH 3WFEL 2CK2A 1KENL 2V9RA 4Y19D 3C60D 3VXUE 5D7IF 1AFVL 3PGCA 4XBEH 1NCCH 2FR4A 2NZ9D 3WV0A 5BZDB 1NMCB 4ZAKD 1F4WH 1UQSA 2XZQH 3KPNA 2R56H 4FZEH 1I9EA 3TO4B 1CK0H 3O4LE 4S11A 5ALCH 5ESVB 5SWSE 4M6OH 4QXUH 3IXTB 4X6FA 1CDBA 3CU7A 2FX9H 2JJWA 1ADQH 5F71A 3KPRB 4JN2B 2FEDC 3WFHB 1JRHL 2PXYA 3AREC 3GMOA 2IQ9L 1FGVH 1LE5B 1U2HA 1Y0LA 5I1GL 3V0AC 4PS4H 2OM5A 4JO4L 2CUHA 3MLSL 2H41A 4K23H 1RV6X 1S7QB 1NGXA 4RAVA 5J06A 3QEUA 1RZJH 2VWEE 4MXVF 3O2DH 4M7ZC 4J3WA 3CDYA 4EN3A 2Q86B 4KY1L 3AM8C 3EOTH 3SGDI 3L3DB 2JJSA 1AKJB 4PGCB 5IVXA 1JGDB 3VXRD 4OFDA 2I9LB 4HKJA 4JVUA 2DQIH 4QHKJ 3OZ9L 4UTAH 3KYNB 1K85A 3WSQH 3BESR 4YHIA 4TUOA 4G80B 4HKXB 4IOIA 3TJHD 2IALB 3MA7A 5IVOA 2YA1A 5C71A 2HFGL 2Y5TB 2EYTA 2E7MA 2AEIT 1IGIL 4KK5C 3U1SH 4TUKL 4CU8A 2ARJB 5ADPL 1DUYA 1BOGB 3DRQA 4NFBA 1OM3H 4LKCA 5K9OA 1U0QA 4XMLH 2W9LA 5GSVB 1HOCA 3DYOA 3QIWD 4ODWB 3QJHA 3MBXH 1GPOH 1Q0XL 1SY6A 2DL9A 4WVRA 2X89A 3QIBD 5DTFA 5IVXE 3UJIH 2X7LB 4PJHB 1IJ9A 2HP4A 4PJIF 1JTTA 2OMNA 4DZ8A 1SJHB 4PBVC 3ZKQD 5JXEC 5IHZB 3ARBD 5IHBA 3OKEA 3N85H 4PRDB 2W65B 4FQCH 4ELMF 1W0YT 3HR5B 2F9BT 1CL7I 1GGCL 2GUOB 1A7NL 2P24A 3VXSD 2VQ1A 5I1EH 3EFDL 1KULA 3STZA 3L6FA 1T1XA 1U6AL 4WI2A 2HFFA 3T09A 3G5XB 3DMMB 4O2FA 1YN7B 4RZCA 2ZOLB 1D6VL 3L5IA 2A74B 1MFEL 1C5CL 1CXHA 2ZUQB 4TSAH 3JTSA 4KQ4L 3INUL 4UILL 4RAUA 4WNQA 4K71C 3FTGB 3SKNA 5I19L 4LL9A 4Z5RB 4DUVA 2P43B 2BERA 2FL5B 5L2KB 1Q9KB 2AS5M 3IJYB 1CDUA 2NY4D 4LPXA 1I3RA 2DLFL 2IANA 4I3SL 2VJXA 5F97E 1Q72H 1F2QA 4LAQH 1RK0A 4MHHI 4Y89A 3DX7B 3ORJA 3O6LH 4LASH 4KV5F 4FMFA 1U8QB 4YHZH 4JRWA 2E9IA 1TETL 2PO6D 1VACA 5IM7B 3WEXA 4PRPE 5AZEH 4JQIH 2VZVA 5IBUG 1WZ1H 2HMID 4FQHA 1CGXA 1FV1A 4K3HA 1EZVX 3P73A 4KZEL 2VLRB 4EI5A 2A6JB 3HS0A 5KSVB 3QUZB 3I6KA 2OL3A 1PG7L 1LEIB 4JPVH 4LPTA 4MD5A 4UOW0 1C12A 5DQ9A 3ULVL 2VLLB 1PG7X 2XG4A 1HIMH 2DQJH 1ITBB 1S78D 3UP1A 1QBAA 4OZHB 2IANE 1NEZG 3MO1B 5JW4N 2N56A 5BZDA 3OR7B 1QFUL 3PWPD 4FFZH 3U7AA 5L7XL 3U9UA 1EEZB 2YD9A 5FO7B 5ESVA 3GGWB 3TP4A 2ATPB 5CEZD 2F8VA 3IXTA 1YJDC 4X98B 2J3SA 4LIQL 4XPHH 4NQDD 3L5HA 3MLWL 3KPRA 2Z0BA 3ZDYF 2PCPB 2A6IB 5AUMB 4HMDA 4DOHB 1ZE3C 1WEJL 2XXCB 4KKAD 1P2CA 2EKSB 1S9KC 5EO0B 3ARTA 5JQ6L 3TNNB 3WO4C 3LVEA 2IBZX 4R6UA 3SE3C 1TQBC 1S7QA 2XXMB 1I9RL 2OZ4H 3CDGA 4M9PA 3VDAA 4CN1A 4PGEA 1J0YA 4BQ8A 4PP2B 1VFAB 4PRIB 4AM0B 2Q86A 4EBQL 3S36H 1MRCL 5GRVL 5ICXB 4Z7NE 4PGCA 4KI1A 1JGDA 4JCMA 3UYRL 2I9LA 2NYYC 3GSUB 3RU8L 3VGBA 4IMKC 3KYNA 1E4WL 2HWZH 3KPRE 4HKXA 5ACLA 1HXYA 2Y5TA 3IB4A 3D3VD 3H9SB 1QFOA 2XWTB 1F13A 4DTGH 2ARJA 4XB8A 5MHSE 1KPRB 1BOGA 5T5NF 3V6BR 5I6XC 1IGCL 2GK2A 4WW2F 2AJUL 2M26A 1WLHA 1PX4A 2IBBA 2MCG1 5GSVA 2CMRL 3DSNA 4ODWA 1PEZA 3T0DA 4JM2B 3U0WL 3TWCL 3QA3B 4C54A 5EC1B 1RSFA 4FTVB 4OD2B 2X7LA 3QULB 5DYOB 4PJHA 5J1AA 1YNKH 3SDAC 1D5BB 3HNVH 1NUGA 1B2WH 4XTRC 1SJHA 1XF5B 4PB9L 1TJGH 4M48L 3TYFB 3CK0L 4HQQH 2UVEA 5ERWB 1UA6L 4KGJA 2GTWB 4PRDA 2W65A 3R0MA 3V4UL 3HR5A 4U6VH 3ME0A 1QSFD 4D0DB 1QR4A 5IFJB 3P0VL 3ULUH 4QRUB 2GUOA 2B0SH 4JKLA 4LLUA 5EU7C 4NJ9L 2XNAB 1INDH 3BIBX 4QRQB 4HS6A 5C0JB 3RWEB 2AJYH 5DRZB 3G5XA 5HHVL 3DMMA 2ZNWA 5EBLB 4PUBH 2A74A 4PJHE 1FNEA 4ZFZB 3LEYH 4PJGB 2YD3A 3FTGA 1E6JH 2VZ3A 3KVQA 2CRMA 3EFFB 4R2GD 2DQEL 4JKPH 4YHMH 4Z5RA 2HTLC 4FXKA 2FL5A 5L2KA 1Q9KA 3QDMD 1GL4B 4TNWK 3QCTL 4PJCB 5E8DH 3SKUD 2OQJB 1SYVB 3MOAL 4HC1L 4G6JL 3DX7A 5IV2B 3K1DA 3X12B 4JRXD 1JYXA 1U8QA 3N06B 4GXVH 4YBLC 5KSUB 5HYSA 2ITDB 1MF2H 4G8GB 4I5BB 3PWUA 1IGFL 2C1OB 3W2DH 5EPMB 2ZKHL 3QUYC 2X5PA 4IRJB 3RZWA 2A6JA 5I2IB 2F54D 4GUPA 5KSVA 1LEIA 1U8IB 3BPCB 2VLLA 1HQRA 5L2KE 5GXBB 1G1YA 5DK0B 3K3QA 4HLZH 4LSVL 2VDML 4ZFGL 4OZHA 2EYRA 1DVFB 2ZCKH 3MO1A 1UG9A 2RBLA 5CCKL 4RQQB 4ZMAT 3GSNH 3JZ7A 3FHAA 5DD3L 3T2NL 3GEWB 3KPOB 5HYJA 5GRWA 4GW1A 3MMEB 1A6VH 5FO7A 3GGWA 1JZ2A 2ATPA 1BAFH 1NCBL 4APQD 2R4RH 4X98A 3K8LA 3OX8B 3UEZA 3L3IB 5FUZL 4YHLH 5SV4A 5BXFA 4GBXC 1J8HD 2EKSA 3ZDZE 1NMBH 2HJKA 5EO0A 2VNCA 4P9HC 2UYLB 5BRZB 1G7JB 3HE6D 3UTTD 4OD1H 3H9HA 3ZE1F 1A8JH 1WZMA 4P5TC 2MTPA 1ZKAA 3ARWA 4OZHE 3FFCD 5FM5O 3GSWB 4AIXA 4PRIA 3NCJL 1UM6L 1UJ3C 3PP3H 4RGNB 2K7PA 3BMWA 5HYJE 4H1LH 1OTTD 3MRCB 2R69L 4PJ5D 2VRAA 5JW4Q 1IQWL 2QQKL 2NY3B 4DOHE 5BV7L 1IAII 2X4NB 2FH6A 5B38G 3C9NB 3H9SA 1MCWW 2W0PA 2R4SL 5EIVA 4WHYG 4OJFL 1KPRA 5CEYB 4IOFD 3UBXA 4XPAH 4U1JA 4U6HB 3QHZH 4JM2A 4PRIE 2ORBH 2R9HD 4FFWC 1CD8A 3QA3A 5EC1A 2ZP0T 4KMLB 4OD2A 3V6OC 4C55A 4NQXB 1QFWI 1D5BA 4LHUA 3ZMRA 5FFLA 3ZSTA 1BFOB 5J4MA 4WEBH 2B1AH 1XF5A 4PJ8D 3TYFA 3C2AH 35C8H 4YQXL 5E4EB 5ERWA 4K8RD 1VFBA 4V1DD 2ICWJ 2GTWA 3ALPA 3IFLH 1DN2A 3WIIL 3H9SE 4HW6A 5F96L 4I3RL 1OQOA 3FQNB 5IFJA 4Q9QL 4QRUA 5DJDB 3QUML 5CP7B 1FDLL 2B2XL 4H0GA 2NZIA 2XNAA 1UH2A 2RR3A 5C0JA 4KI5D 5TF1L 3RWEA 3FZUC 1QFWL 2B4CC 1U8PB 1NKOA 3JTTB 3UAJD 5EBLA 1YDPB 3LZFL 2Y1VA 1KN2H 4UV7L 1PY9A 5IW1A 5JDSB 4LSUH 5I75B 4PJGA 4OZ4B 1T83A 1XMWA 1RIVL 3WCYA 3FT3B 5C9KA 5I76B 1JUFB 1CN4A 3MJ6A 3AY4A 4HPOH 3ZYIA 4PJCA 2HFTA 4MA1C 2ZPKL 1SYVA 3T0AA 1CFBA 4M1DH 5IV2A 2YWYA 1A7PH 3NZ8B 1BQHG 5D1QC 4P4KC 3X12A 2Q20A 2WZPD 3ZO0A 5KSUA 4G6FB 2D7NA 2CDFB 5DK3A 1UXSB 4CN6A 1ZLSH 4XRCA 4G8GA 2XKSA 4JM4H 4Q6IC 4I5BA 1M1SA 3RPIB 1IM3B 2C1OA 5T3ZE 4M7LT 5EPMA 4PJGE 1MOEA 1KG0B 1RZKL 5FYLL 5MENB 2DQTH 2J8OA 3BD3A 1IC7H 3I50L 4PLKC 1CR9L 1NC2D 1BF8A 5KVGH 1U8IA 1GOHA 5KVDH 4GAJH 4P46C 1EO8L 4FHBD 5DK0A 4JB9H 1A6PA 2GW5A 4PJCE 1IC4L 3FO1B 4OFKA 4UNUA 4FQIL 3HC0B 2DQGH 4I0PA 4XI5D 2X09A 4WO4C 1J1PH 1LEKB 4FG6C 4JY5H 1TPXC 4WU7B 3MMEA 5DI8B 3S96A 3WN5C 2VH5H 1GOFA 1UEMA 4G8GE 1DL7L 3BT2H 5FUOH 3OX8A 4HD9A 1MFBL 3AREB 3S88L 5I18H 2XTLA 4XMKL 2UYLA 5BRZA 1G7JA 1NBYB 2FB4L 4B50A 4OIIL 5D7JD 5C09D 4S1RH 3WBDA 2VDLH 3NA9L 1N6VA 2BNQD 3HNTH 3T8XA 1I1AC 3DUUB 4Y1AA 4GRLD 3GSWA 1U91B 4M3KB 4NKOB 5C0GB 4N0CD 3L3KA 1WITA 4S1DD 4M7ZB 2RHEA 4NIKB 5BVPH 1BIIB 1Z5LB 2VLJD 4UTBL 2D4DA 1CFTA 2OCFD 3P0GB 4F7MA 3KS0J 2W9DH 2ILLA 5EZLB 1WUNT 4F58L 2CKBH 1CLOH 2NY1D 3OJMB 1FZKB 3LH2L 4U7SA 4JRYA 4ODUB 2X4NA 1P4IL 2AJZB 3MZTA 2NY2C 4X4YA 5BRZE 4HKBA 1IT9H 1OAQH 3CVHA 2PYFA 5TPWL 2GJ6B 5CEYA 4ZFOB 4U6HA 3HUJA 4QHNB 4Y1AE 1VA9A 2NW3B 5DEGB 4RGNE 5HHOD 2VISB 1JZ7A 3MLRH 4QHUB 3U36B 3CJJA 1YA5A 3CFCH 4IOSD 5J0BA 5JORB 4N0YH 4JRYE 4QTIL 1OWRM 1HQ4B 3SOBL 1FQ9C 1L7IH 5J3HC 3V5DA 1IVLA 3FQNA 1KCKA 5FDWA 3QUKB 1ETZA 4PY7B 5CP7A 1YEDB 2HVKA 5GRYA 4HIHB 1OGTB 1JN6B 3RX8A 3SN6N 3HUJE 1EXUA 4AT6B 1NUFA 5T3XL 5E70A 2X10A 2DD8H 2WIIB 4NOBA 3JTTA 1VHPA 2WM0A 4QY8B 4H0IA 1NFDB 4KUCD 1UXWB 4Y2DC 1AGBA 3BUYB 3HAEG 5JDSA 1DQLL 5IQ9B 4YX2L 3BIAX 5J6HB 4LMQE 2FIKB 5B8CC 2VXVL 4K71B 3WXVH 4JREC 3FT3A 5I76A 1JUFA 1U93B 2VDPH 4TSCH 4OLXH 4EZMA 5SV3A 1K3IA 1AO7D 2HKHH 2MQ3A 4W70A 3IU4L 4A2MA 4OZGA 4OD3L 1AD9B 3GSXB 1AQDB 3NZ8A 3TZVC 2J8UF 4TVPE 3QEHB 1CLZL 1FZJB 5DMYA 2CDFA 3DVFA 1UXSA 3VFPB 2DLIA 1CG9A 4U3HA 1D7FA 4TULL 4RX4A 1MREH 4PY8J 3RPIA 4J3TA 2IC2A 1KCUL 1KG0A 2XACC 3RGVD 5MENA 5ALBH 3MQIA 3W5MA 1Z0NA 3KYKH 2OR7A 3NCMA 4N1HB 5CZVL 2Y7QB 2F58L 3ARFB 3FO1A 3NPSC 2BHZA 4ZOEA 3HC0A 1NAML 2DICA