3EJCA

Full length receptor binding protein from lactococcal phage tp901-1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
163
structure length
163
Chain Sequence
ASIKKVYRGMKNGAETINDDLEAINSELTSGGNVVHKTGDETIAGKKTFTGNVEVNGSLTLPTKSWSGELGGGIILSLRKKGTTVEYSIGGEISSSILANSNLVNRSVPNEFCPRNRCSLVGHMVGGWNAFHIDIPSSGVCQWFGPTASSGTPRGTGTYPIDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Baseplate protein (BPP)
publication title Structure and molecular assignment of lactococcal phage TP901-1 baseplate.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Viral protein, sugar binding protein
total genus 26
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ejcA02
2F0CA 3D8MA 3HG0A 3U6XA 2BSEA 2X53A 3DA0A 3EJCA 4IOSA 2WZPA 2BSDA 1ZRUA 4HEMA 4HEPA
chains in the Genus database with same CATH superfamily
1KN4L 2MJWA 5I71C 2XIDA 5K9JL 2A73A 2VDQL 4AIOA 5EC1A 3ULUF 1NFDF 5D1XC 1OCWH 1U3HC 3HG5A 1QFWI 3OHXB 3CDYA 4MHHG 3S2AA 1DYZA 1IGML 2B16A 4HPHA 35C8H 2ATPB 4GLRI 1YY9D 1YYLH 2P8LA 3ATAA 2WBXA 3VW3H 1H3WM 2AJSL 4AQ1A 4XE5B 5CHNA 4PJXF 2Z64C 1D6EA 3IJHB 4FMKA 1XGYH 5A2JH 3N06B 5IF0A 2OP4H 3WEAA 3KGUA 2NY1C 4U3SB 1A14L 4UT9L 1AYRA 3OKNA 3O3BB 2HJFA 5DJ2A 3B4NA 5MEPA 5EBWB 3FRUB 3L3KB 1VEOA 4G9FA 4FXKC 4RBPH 5J1AA 4YFDB 3UPRA 3QWOA 4OCSH 4I18C 5T1KD 3OXRB 3QIBD 1D5BB 1JTOA 4UMSA 1PYWA 1U6AL 1AY1L 2NDFA 1QW9A 2BP3A 3BEWA 2C1PA 1BD2D 3QPXL 4GFXA 3C09C 2G9KA 3CHQA 1S9YB 2UY6A 5DC0A 2R1WB 4JUTA 3ILDA 1JZ6A 3PE9A 4PTUB 1CUOA 3FQYA 3UJIH 5F7WC 3TBTB 5IHHA 2IQAA 4YZFF 1NEUA 1G0YR 1FZOB 1IFGA 3H6JA 3BO8A 4N0CC 3VFMA 4ACTA 1KBGH 2H47C 5ESAB 1VJSA 1MRCL 2PCPA 2NRDA 3OGCB 4U33A 3UZQA 1RIUL 3QUXC 4LBEB 2EO7A 4GI9A 5CLYA 5IW6B 3RZCB 5F7DA 1MHPL 4G9DA 3V6OC 2BFVL 1AIFB 4AKOA 2XHNA 5DZVA 1RLBA 4AX3A 3R8BB 3TJPA 1XGQB 1TITA 1YO4A 2AJYH 5FHBH 1IFHL 2WXRA 4JO3H 3ECBA 3CVHB 3FB8B 4N0UA 5L4IA 3SBWA 3BAIA 3QXAA 5CO1A 3IDYB 4PBWD 2G3ZA 1G6VK 3QWNA 3MFFB 4PJ5D 2EVGA 1MAJA 1P4BH 3K2UL 4LL9A 4GG6B 2VM4A 2ZXGA 5IEHB 2JJTA 2IGFL 12E8H 1XCWA 4HIXH 1ZA3A 4LPCA 4OLVL 3SGEH 2N7AA 5G4NA 2YEZA 2XI9A 2IQ9H 5FCSH 2EYRA 4YPGA 2A6JA 5CILH 3RWCA 5FYLH 3R8QA 5I1KH 1JDAA 3GK8L 4PV9B 1M3JA 4DKEL 3P9MB 4WTXA 3MRPB 5TQ2H 4ZBJA 4QTIL 3P3UA 4LLWB 3AM8C 4OGYH 4AJYV 2UZXA 3WJLA 1TZIA 5CSZB 2UWEE 1MCOH 5JHDE 1MEXH 1HXMB 3ETTA 4RMWA 5D2NE 1VFBB 2YMXH 4LSPL 5E6YA 4XP1H 4I4WA 4WNSA 3KPPA 1UKTA 1INDH 2XVGA 1I1YA 4OCYH 3F05A 4J4PA 4NQEB 4X6CE 3VJ6A 3RVUD 2DTML 5KVDE 4P2RE 2B0SL 2F7RA 4CU6A 2X1WL 5C70A 2NY6C 4X80L 3VXSA 2IF7A 1FL6A 2QDWA 1EV2E 4Y2DB 3WIHA 1FUNA 2FZ3B 4NENA 2AJXH 5CLWA 1MKFA 1KV7A 3LPGA 1O5DT 3L3IA 3TA3A 4Y4FD 5C0FB 3RFZC 4OLWH 1J9TA 1MFAL 4FA6A 3GSNH 4DP1X 1QI4A 4JY5H 1M1XA 3WTWA 3MLPA 1LE9B 5F88B 3CUPA 2R56H 1BVOA 2BJML 1SXNA 4X9FA 4ODHL 1R3HA 1CICB 3GKWL 2FTAA 3VG0L 4Q9RL 4H88L 2GTZB 4OFYD 3U83A 1JPGA 1HWGB 1JPFA 4OLEA 4J12A 1OCZB 3TT3H 4Q9CA 2BCKA 5GSRA 2CA4A 1JPEA 2R29H 1KGYE 2VDNH 3F7LA 3PHOA 3SJVA 1NEZA 1BQSA 3CH1A 1TU2B 4PGBB 3SY0A 3BVDB 4PJIA 5KJ7E 2ZCLH 1BGXH 1IKNC 4G1EA 5CFHA 1BQHB 4KJPD 4WW1A 2R0LL 5CD5C 1DLHA 5CCGE 1HK6A 1NMBL 1GZHC 5IK3B 1U36A 1NUFA 3GXFA 3NIDE 3BWZA 4XNXH 5EHFA 1PQZA 3OB8A 2DM7A 3PXLA 4MDJB 2DD8L 5AW6B 1SUJA 3HMXL 5ILTH 2OQJA 4R2GD 4XP5H 5C6PB 3PFQA 1EBPA 5H94A 2I60H 1PLGL 3RQ3A 1QHOA 3F7QA 4YWGL 3GXDA 2WYIA 5KSVA 2WMPA 4U1KB 1N9PA 3MJ9L 4ODSL 4NQDA 2RTTA 4NQED 2V3DA 4BK5A 4QRBA 2CHXA 6CGTA 1FSKC 2LR4A 4YXLL 2GBVA 4KI5C 5AVUB 2YPLE 3U4BH 1XF3B 2YJQA 4MAYC 3GZQA 4FI6A 3U0TB 4M61B 4J28A 2BH0A 1PZ3A 4Y2DD 4LHUB 3AWEA 1FCGA 1XCTA 3BZEA 3N1QC 2QADD 4M7JL 2FHBA 5EU4A 2FATL 5KWYC 5IB3A 3SDXB 1CWVA 3LRSB 3UG4A 4FZ8L 5MI0C 5EEZA 1ILSA 1MLBB 2IV9A 3ARUA 4YHOH 2H2PD 1RIVL 3W56A 2FGWH 4JO4L 5GGRY 5KVEL 2H3KA 5FO7A 1E28A 1PZ5A 2TSBA 4PJ8D 4XVSH 1RJZB 3T8XA 4AYGA 4PGCB 4G43A 2G75B 1EVTC 3HG1E 4UOW0 1CICD 1RKRA 3L1FA 4BUQA 5CZXD 3O9WA 4Y5XA 5E5RB 3EF4A 3L3JA 2WSPA 2YD3A 3MUGA 4G59C 4LDEB 3FT4A 4JG9A 5DVNA 1IIKA 3BZ4B 3NK3A 1S9VA 5IOPB 4UTAA 5EOTB 1S7TB 2HVBA 3TN0B 4DN4L 1UEMA 2LV4A 3I2CH 3MLZL 3S5LG 5T1MB 2ADJA 1UKQA 5AB0A 4HPYH 3U0WL 4YHIA 5I0YA 1B3IA 1IGIH 2IO5A 4JKLA 4UQBA 5EEVA 4AQEA 4FHBD 4WWKA 2QR0B 4JPIA 4HIHA 3QXUA 4KK6C 5DYOB 3X14A 2HRGA 4HJUA 1CLOL 1ES0A 1F4YL 5A2KH 5DD0H 5AYTA 5EWIH 1C12A 4XXWC 5GGRB 2X4TA 4PJEA 4E41D 1PKQE 1VADA 5EO9A 4M62L 4M56A 5EOCL 3TC9A 2VITB 4D8OA 3TEWA 1IAOA 1ZV5A 1I9RL 2KBGA 2Z8RA 1DP0A 2R1YA 4FQHA 3L5IA 4GIPD 3V4PH 5K9OB 4C4UA 4XCEA 1UOLA 1A1OA 4AZ8B 5EZLA 2J5WA 1DSWA 3ZRCC 3SGDI 2AEWA 1LO2H 1ZDQA 1WBXB 3D85A 4JM2D 3MUHL 2GSIB 2W38A 2YUWA 3QO1A 3QWRA 5DHXB 5HHPA 2AQTA 5JQ6H 4XXDA 5DQDL 4KX9A 2P4AB 3VRJB 2XXMB 4FQIL 4G3YH 1J1PH 4N2HA 5EA0L 4C83A 4JPWL 1IAKB 3KDMB 3L1OH 5D1XB 4ZFZB 5BRQA 1QBML 1YECL 3OSVA 3D8MA 1A1MA 4ZMAT 3NOIA 3HNVL 1AQKL 5J1TC 5ISZE 1E4KA 2PYEE 5CIPA 2NQDA 3DKHA 4XMPL 3Q43A 4FQXA 3D25B 2MOGA 4MAUH 4AVKA 1RK0B 4Y5YA 1UJ3B 1NM4A 4MAZA 1V55B 1SM3L 1SJXA 2QKIC 4Q0XL 1J10A 4XR8C 5DUML 3OWEA 4D0CA 1N4XH 4IQHA 2VISA 4G80A 1FIGH 2NY1B 1P84K 5B1AB 1IC0A 2J3SA 5CJBA 4BFIB 1UC6A 1XF2A 1VKXB 3MYJB 3QORA 3ARSA 4JZJA 4OQTH 5I19H 1OP4A 3A6CH 3SCMD 2GB2A 4JFDB 4FXKB 2EE6A 1R5VB 4U6VL 4KK8C 1P5UC 5I82A 2B1OA 3BWAB 1W72A 2NW3B 3SYQA 4LL1A 5IY5B 2R1XA 2OTWA 3K4DA 1M71B 1CE1L 4QLWA 2JB6B 2OPCA 3I3DA 2H5UA 4D9LH 2E7LA 4PN6A 1ECYA 3C09B 1IBBA 3CC5A 1PZCA 2D8KA 3H3PL 2VDPL 3M1OA 1CYWA 4A7QA 2W9DH 4YMPA 5JQIB 1RZ8B 1BMGA 5LO7A 4N2MA 1KBKA 5EEXA 3S37H 4HA1A 3RP1A 3PDOA 4E9TA 4W4OA 2WWOA 3TPUA 1CL7H 2OMUB 2QPUA 3MV9E 2VLJB 1MVFA 1MLCA 2H0EA 5KBMA 1DCEA 4GG8B 5C0AA 2BP8B 2X41A 3QUXB 4WK0B 5HVHC 4Y9CA 2IBZX 3M7FB 2CDEA 1E9PA 3D51A 3D07A 4QHPA 4R9HA 1ASQA 1NAMB 3LX9A 1F6LL 4MNHB 3MRBA 3EYOB 5LXGL 3US0A 1DVFD 1UFUA 2ZYRA 2DQIL 1NOLA 4A7UA 1SHWA 4MD5A 3F7VA 4GXVH 3K6SA 2WXKA 4N68A 5BQ7B 1CBVL 1VHPA 4Z77A 5ITBH 5M7QA 5KS9B 3LH9A 4Z95H 2ZPKH 3RPIA 3SD5A 4EBQL 1D5IL 4BA0A 3B5TA 4ZPTB 1B2WH 2RB8A 1EO7A 3ECVA 4JDZA 1IAMA 1ZOXA 4OZHB 5F7UA 2J8UA 1RPQA 3GI9H 1DO5A 1N0LB 1I9IH 3T4AA 1ORQB 2C3XA 4YOKA 2O5XH 3VXRD 1I8UA 3DBXB 2H0FA 4A2GA 4MVBD 2OA9A 3GMMB 4PRAA 3AY4A 4XZUA 3FTSA 1AXTH 1SJHB 2EYTB 3NAAL 5BNXD 4OJDH 1MCSA 5IJBC 4AT6B 3PGDA 2BOBA 1BJ1H 5JMOC 4HQQL 4AENB 2ZUYA 4JHUA 1RUAL 2MCPL 1RUMH 4IOFD 4JFDD 7PAZA 2X4SA 3UOAB 1IC5H 1KIUB 2E4TA 3EGXA 3P11L 5IR1A 2NY6B 1NFIB 3BHBA 1VFAA 1DBML 2VSMB 5HYSB 2ED6A 4X7CC 2Q87A 3VE0A 3M46A 1WCBA 3QVAA 3FN0H 4O51B 4CN6A 2A73B 1ZHLA 4M29A 4PJBF 2BRQA 5KN5A 3MRFA 1PGRB 5AENA 4L1HA 5JO5B 2ILLA 2WZ6A 5DVKA 5DZ9A 2W07B 2X2UA 3HI6L 1LQSR 1MOEA 2F53D 4Z7VF 4YDZA 2XICA 5F97E 4EZJA 3C2AL 2P5EA 1S9XA 5GIRB 2JJSA 3FU8A 4N0YH 4AQ1B 4PY7A 5EDSA 3NVQA 2E7MA 2IPUK 2OX5B 1YNTF 3OV6A 4HG4J 2D2OA 4OLXL 4DW2H 3AW5A 4X8XA 3CJJA 2AC0A 5DA0B 4GO9A 4G5ZH 2FQDA 2WWKT 3MAWA 4MA3B 1OF0A 3RVWC 3H9HB 4QXTA 3RWHB 3BP7A 3U6XS 5DJ2B 3BT0A 1XZWA 3KYKH 4P0DA 5I23A 4FLQA 3HAEB 5J1AB 3UPRB 2WV3A 3MGOB 3O0RL 4XOAA 1A3ZA 2WLHA 4PJAF 4FABH 1PYWB 4N3UA 1J5IA 2PF6A 3OSKA 3AS0A 3VQMA 4DZBB 5HDRA 3TBSA 3B37A 2C1PB 4NT6B 1E9OA 2NXZC 4P3WA 4PCTA 5G55A 4B9JA 1EXGA 5C3IA 2V17H 1I8LC 2XWRA 4KNSA 4NN5C 4WHYH 5IMOA 3TO2B 3G3LA 1BFVL 1IARB 1CLYH 4KO9A 1HKLH 5L88H 3JWNG 2Z0UA 1QFUL 1P53A 3T6XA 1L9RA 4LKCA 1NH6A 2XWBB 4GUPA 4Z7OF 4KNTA 2J20A 5HHXL 3IYLW 3JWOC 1E4XL 4LNVA 2ADIB 5HGBA 3OB0H 1N6UA 1OAKL 1FRGH 2DQMA 4LMQI 4NN6B 1ZE3C 5AW9B 5FF6A 3QB7C 1QNZL 5K1VA 3ZDYF 1RZIA 4GBXD 3BP5A 4G7VH 2NY6D 4H13C 2A6DA 2Q2LA 3NIFF 2VQ1A 2B39A 1C16A 1N8ZA 3QXAB 5T5NF 4F7PB 4H26B 3H9SB 3B6SA 1K2DA 1FH5L 5C09B 1ZLWH 2TRHA 1R47A 4ORGA 4YO0B 4PLJD 2H1PL 4AYEC 3L8QA 1JGVL 2C8NA 3U79A 3Q1SL 4YPGB 5MI0B 1LILA 2GK0B 2VZVA 4CA4A 3RWCB 4UF7C 4I88A 4KX8A 4QXUL 4BFNA 2AS5M 1NIBA 3APMA 5TTRA 3V0VA 4WUKH 1X5YA 3NCWA 3BZFA 3UERA 3GTNA 5I15H 3DWTA 3MA9L 4FMVA 4U7KA 2CKNA 5IHZA 2WVTA 4AUYA 3RAJL 4GP8B 5DHYA 1MQKH 1ECZA 4FQLL 4PJDE 1G84A 1AJ7H 3NFPA 3PWUA 3NIGB 3MNZB 4UT9A 3KPPB 2DQDL 4DHLA 2MRYA 3TV8A 1C8QA 4G9FD 4ZW8A 4YXKL 3MREA 5E2TL 2QQKH 1SUHA 4D3CH 5CJOH 3IKCA 2QZ5A 1AP2A 5HI4D 4PJGB 4ELME 3PUUA 4TV3A 1X5ZA 3JUZA 3V0WH 2R0ZH 2R8SH 3VI3B 2CE6A 1F56A 2EDNA 2LVEA 3EYQC 3QEQA 4BK4A 1IBDA 2BNUB 3L3IB 3TA3B 4NI6A 4BFGA 4FHJA 3FN9A 3UTSE 1G7MA 2GTWB 3EYFB 1FZJA 3FFCB 4N8PA 4U1MA 3UTOA 2EKSA 5K9QI 3MRRA 2G60L 1M1XB 4MMYB 2CM5A 3CUPB 4HAKA 2P42B 4LDOB 1BYOA 3VH8G 1KYUA 2GUOA 1RSYA 2NW2B 2VLLB 3E3QC 2VE6A 1AMYA 3AB0B 4LOUD 3AREA 2XXCB 3K72A 2BMKA 3FRPG 3L4XA 5LBSA 1EJFA 3L3GB 4M4PA 2C1OA 4UYPA 3LKQA 1BWWA 4XPFL 3ALXA 5DVOA 4PSRA 3BP6A 2BCKB 4ZUUB 4HWZB 4IKJA 2JKRM 2YFNA 1J86A 3BEVB 3U82B 4JG0L 1MRFL 2E7BA 2MSPA 3P4OA 1EZVY 5G4OA 1TZHB 2VXTL 5CN3A 3PWVB 2KC0A 3SY0B 4K73A 2V5TA 3PGFH 4JANA 4F80A 5CEZE 4DUXA 3H7BA 5GGSY 1JHKL 4OY9A 2G2PA 4RWYL 2Z1PA 4HUMB 4TQIA 2DYPA 4HIPA 1T7ZA 3NJLA 1MJUL 4L8DA 5IFJB 4XI5D 5ESQB 4WJ5A 5GS2H 3I9GL 3ARWA 5ID1A 4Q2ZB 5GGUA 4OIFA 4IBSA 2NUTB 3BOVA 4JFOA 1TO5A 1QNIA 2WAHA 3DXAE 4JFEA 4HUVA 3P3RA 2AXHA 2Q10A 3TNNA 2WMPB 2AFNA 2FD6H 5TH2A 1NCBH 4NQDB 2MPAL 4J4PD 4TXVB 5GS0D 1F0LA 2BHFA 5EEUA 5ALCL 1P5VA 2EIKB 1XH3A 5TDPA 4EI6B 3LIZH 4R3SA 1NCWH 4PAZA 1KLFA 3SE3C 1EXUA 3VXSD 3WJMA 2YARA 4ZOAA 1WIPA 4QJ5B 5KSAA 1W6WA 1B2YA 1E67A 4IIZA 5TE4H 4LNRB 1NC4B 4HUWA 1GKEA 4KK6D 4U1HB 1RZJH 2GIMA 3KG5A 4L4VE 5D7LB 4RIRB 5GZOC 2DEYX 4DO5A 1RFDL 3N0PB 1RZQA 4H20L 3TA3D 4L5FH 2E47A 3ATFA 2LT9A 3LEVL 4DGUA 4JG5A 5FB8A 1SF3A 1IMHC 4UAHA 4KKNA 4OAWB 4WI0B 3BKJL 1TQTA 4JL1A 3VFUA 3QEGH 3T8XB 1N0XL 4U3CA 4CAGA 3Q0HA 4TF4A 5ELIA 1DQTA 1WEJH 3V4VA 1SY6H 2BIPA 3FXIC 3QZBA 4Y5XB 4DCQA 1KEGL 2X4QA 3NP3A 2UUDH 3S34H 4ZOEA 3MUGB 5EZIL 3CTTA 1KIRA 1F11A 3T09A 5KSBA 2NNFA 3AC0A 4RAVB 4RH4A 3BAEH 4ZS6D 4TTDC 4N2AA 3VRLF 3WS3A 4PWGA 4KZCA 1TYJA 3NTCH 5AYQA 3LXBA 1ZWIA 4JG1H 3SJVD 5GRJH 1QSFB 4YHIB 3N85L 1R3JA 5E2UL 5TPWH 1F6FB 1IC7L 4YHPB 3QJRB 2BHYA 5SX4I 3ROOB 1CFVL 1KTLB 4N5ED 4JPIB 1CN4A 4JRLA 1CPUA 2F1EA 3CFKB 2K3TA 4OI8A 1ES0B 1ZRUA 3DX2A 3NJNA 4WU7B 4EI5A 2OZNA 3P30H 4G7YH 3TBBA 4ZFFB 1JZ8A 4L23A 1ICTA 1ZT1B 3MGAA 1IAOB 1I3VA 3HFMH 3QFJB 1G7JB 3RUGB 4LDCA 4XNUL 5BPPA 5IVZA 1R3KA 1GY1A 2FO1A 4AV0A 1XGRA 1QLFB 4H25B 4JN2B 3C8HA 3GSXA 3IM1A 2AITA 3OJMB 2D73A 1XV8A 1A47A 4PW9A 1KXTA 4NQDD 3QO1B 3X12A 2XWCA 5SWQA 2GPZA 3VDCA 2IOMA 1W0WA 5CGYC 3U6XA 5K69A 2H6OA 3O6ML 3RWDA 4RDBA 1G94A 1HYRC 5LN4A 3OC5A 4HCFA 4MA1C 5GRYA 5AALA 5DT1L 4HOMA 4BEIA 5I1EL 2XLLA 4YDIH 1XGUB 3X1NA 1NC4D 3W0WE 1HXKA 1IBHA 3LZFH 3LQZA 5CIPB 5FLVA 1LD9A 5B4MC 1OLLA 1PL3A 4N2BA 1ZTXE 4Y5YB 4OJEH 4LLYA 3HE6A 5CR8A 3QULB 1A7OH 4LIQE 2GCYA 1U2HA 3DVNB 1JI1A 3UIYA 4POZC 1KJMA 2C7UA 2CRIA 1M9SA 3VFNB 2VZSA 1HNFA 1HYSC 1WCQA 1YMME 4PJCE 2W0LA 5JW3H 2RAMA 4BHUI 2ALAA 3ECUA 3I6GA 2ZSVA 4GSQA 3C5JA 3RVVC 1KPVB 4UQ9A 3QUKB 3DIVA 2DBLH 2XQYK 2DLIA 1RZFH 5EIQA 1UWGL 2YAFA 1WICA 5DVLA 4NHCL 4P9HL 4NN5B 4KQ3L 2VC2B 1DUYB 2WQVA 4L0ZA 4KAQL 4NRXA 1EUTA 2E46A 3GSWA 3D05A 4JREC 3MRLA 1FWXA 4ZW3A 1AQHA 1BXAA 4WWKD 3PDOB 1UVQB 5AG9A 1XR9A 4UDTB 2FWUA 3KPLA 1G7HA 1S5HA 4XXCC 1NLBH 3RURA 3EIFA 3KJ4C 3ZQ9A 2YD2A 3HC0A 2ZXQA 1S78C 3QHZL 2WTRA 1G0XA 4PRBA 5EPMA 5AZ2H 1OTSD 5FM5M 4GP4B 4R7NA 5I30H 1DVYA 1H19A 1T04A 2CDEB 3QFJD 2BO0A 3S3BB 1QLEL 2YRZA 3DX7A 5KZCB 1LWRA 4M8VA 1CDHA 2HFGL 2BDNH 3NN8A 5CP7B 3L17A 3MRBB 2V4LA 2GHZA 2B2XL 3D85D 4JDVB 2LTQC 4OFVA 1S7VA 3IRZA 3QWRD 1URLA 3VXUE 4OD3L 3US1A 4BXVA 1OE3A 3K6SB 3WHXA 2WWMC 1WFOA 1YNLL 3IEAA 2VDOL 2C3VB 1OVZA 1CFQA 1MCNA 2BLFA 4RDQG 2C9QA 5DO2C 5HHQB 4L8SC 5FAAA 2Y6TE 5TF0A 1X4ZA 4FQXD 1DJGA 1GJIA 4I3SL 5DZLA 3BSZL 1JZ2A 3ZDZE 4O9HL 2FJFA 2W8CA 1Q0YL 1QA9A 1J0YA 3DLQR 4JHAL 2YQGA 5KUKA 3DO7B 2O5NA 3D87B 4ZXBC 3UAJC 3TV3H 4WWID 4YDVA 3VFOB 3LN5A 2DQHH 1WLHA 1MHCA 4FGMA 2X4SB 4PG2A 5KBKA 4JQIL 3CFJA 1MJ8H 2WYHA 5JOFA 2HG0A 3D4YA 4YSQA 5M95B 2ZCKL 2IC2A 1VFAB 1IC4H 3CH8A 4ALAL 2OMWB 3B2PA 3HKZA 3Q48A 4R5VA 1JGDB 2NNCA 3ZYIA 3HFFA 1KXVA 2VGLM 4UNVA 3NRFA 5B38B 5K9QG 1M2VA 2HJLA 1AQDB 1BAGA 3OPZH 1HHKB 1A7QL 3QNXA 4QWWC 1BIHA 4FAAB 1Y6NR 1FBIH 1P6WA 3DOSA 3OAUL 4TVPE 1VZHA 4QF1B 4Z7WF 2IPKA 4HX1A 3KZ8A 2WK2A 4QXVA 5C0AD 3T0AA 3LS4H 2IDSA 2YEQA 1G9NC 2OS7A 4MLSA 4P57B 2DLEA 5CEZL 4H4NA 4HPOH 6TAAA 1N64H 2QPDB 3B9DA 3CFIC 4BZ1L 3KVQA 3L6FA 4QXTB 3TPKA 2DF3A 5ADPH 3N41F 3Q8CA 1CLCA 1MF2L 4OTXL 4TNGA 4UQIM 2CRYA 5L8JB 1DEEA 1FH2A 3ULVF 4FFYH 1UENA 3JV6B 3R4RA 1LO0L 2UWEA 3TFBA 5JHDA 5D2NA 3ML8A 3KGTA 1IQWH 1AGEA 2H1LM 4HUNB 5AZEL 1LO5B 1UM4L 4X6CA 5J9PB 1OT2A 2NY0C 3T3MF 1F1GA 4PUBL 1M7IA 1MPAH 4I9WE 5J89A 1WT5C 2CUAA 1WH0A 3N42B 5FOBA 3DPDA 3P4MB 1ETB1 2O5ZL 2FEEL 1KBVA 1YHPA 5DJ6A 5FUOL 3TYFB 4LKCB 5SV3A 5JLZB 4HKZB 3JWDL 4ODTL 4ZX3A 2V5YA 2HH0H 5BV7H 3DC0A 4WUUE 5I1AA 4DFHA 2XYBA 2Q8BL 2DQTL 2YRLA 1OGTA 3CFNA 2N1TE 4GS7C 4W9ZA 3M88A 4F2FA 1FG2B 1B4TA 4ORZC 2GT9A 3STZA 3B7TA 2B5IB 2Y7NA 2HKFL 4E0RA 1KN4H 3A21A 1KTKE 4JFQB 5F9OL 4P2QE 1KB5B 2HXAA 1N8ZB 1ULVA 5KBNC 1AS6A 1IGMH 3PPEA 4NO3A 3ZE2B 4ZK8A 1K2DB 1IB5A 4O02A 4PEEA 2CO4A 5ICXB 5K39A 3MCKA 1KFAL 2AJSH 4RZCB 2QHLA 2P5ED 3MHZA 4F33A 4NQUA 5K33A 3G5YA 4GSRA 2EEFA 3CG8A 5EZOL 1M2OA 3EHBD 2OMVB 2ZKMX 1SDDA 2DL9A 5HDBE 5IB1A 4I0PC 1A14H 2EUZA 1UH2A 4ODUA 4UT9H 4L9DA 1BIIB 4PV8A 2FE0A 4TVSa 4BSVA 4BK8A 1RK1B 4IRSB 3NFPB 1Z2KA 2IOIA 3SDDC 3M8OH 1YEFL 1EEYA 3MREB 1U6AH 1AP2B 1AY1H 1JNLL 5I5JA 1SHXA 3UP1A 4O2FB 3VGAB 3H8NA 5F96L 2IDTA 3CLFL 2PW2A 3J2PA 2H6PA 4FLSA 4CVWA 3FPYA 4AG4L 3EYVB 4L3EE 5JUEH 2PWDA 3BAXA 2YPLA 3ESMA 3SGKC 1Z9SA 1I8KA 1FZJB 2Z3FA 1AE6L 3BVTA 2EDBA 1RIUH 3DTXA 4MX7A 2CCWA 4LP5A 1MHPH 3WIAA 2BFVH 3PP3H 2B4CC 1UXSA 4E42A 3APFA 1JWMA 2R2EA 2VE6B 3EJYD 4FEMA 4QT5A 4X7TB 4LKXA 2IH9A 3K72B 1IFHH 2BMKB 3MLYL 1MFEL 3K0WA 1ZTXL 1L9MA 1YCSA 3QWQB 2LU7A 1UURA 1AGDA 4W70A 3RWFA 2WXHA 2C9SA 3CQFA 4BKLB 5HJ3A 3DUUB 3MUJA 4MA1B 4FQ1L 3K2UH 2J4WH 5ANMB 2ZOLB 4OLVH 2MH4A 2FGZA 2XX0A 1AFVL 4X5PA 3ZHKA 4DKEH 4MB5A 5C0DA 3HC3L 2FVNA 4QTIH 1G1YA 2EDOA 4LRNL 5IQ7L 3QE5A 5FECB 4WI2A 3BVXA 5HHOE 3KJ6L 2FT8A 3VWKC 1PS3A 1YYCA 4LSPH 2YPKA 4A38A 4B50A 1BOGB 3KL5A 2X2YA 5I6MA 2ZUUA 4X9IA 1J5HA 1U8JB 4E36A 4Z7QB 3FBKA 4IRSD 2DTMH 3KPSB 3TNNB 2B0SH 1XZ0B 4HLEA 5CCKH 1LEGA 1PKQA 2I24N 1P5VB 2HLEB 3BVNB 4WDIB 3LKSA 4X80H 3VFVB 1HQ4A 1UUSA 1BQ5A 4DUWA 4UV4L 1IBZA 1KLFB 4ES8A 4M8RA 1USQA 1L7TH 1ZDSA 1S9WB 4JREB 4PRHB 2F54B 3JWNE 1P4LA 5KSAB 4PD4J 3IFNL 2CKBL 1W6LA 3Q2NA 3MOBL 4W93A 2AMGA 1AZNA 3QEQD 3RG1C 4OUUB 3P3SA 4F27A 1JRHI 2COQA 5J3HC 3VFPA 4A66A 3IJYB 4NNXA 1E5CA 2VDLL 1J9SA 4V1DB 4EXKA 4YHKL 2ROXA 2O6FA 1EX0A 4J3WA 4P23A 5IROA 3WFDH 4E9WA 5E8OB 2DEXX 4X5QA 3GKWH 2XTJC 1R3LB 3VG0H 1WZAA 2ETWA 5C0IA 5H4ZA 1GCYA 2ATKA 2Y7MA 5ISZA 1J0HA 2PYEA 4Q9RH 4YSDA 2LTQB 4OD2A 3C87A 3SGJA 2X4QB 3KLDA 3RL2A 4JHZA 3ABLB 5E8EB 1QMUA 4Y9FA 2YFOA 5KSBB 4KZDH 3LS5L 4GRWB 2YZ8A 1GOHA 2L0DA 4Y8AA 1C5CL 5EIIA 5KSUB 3FFOA 3CU7A 1CDCA 3B7YA 1NGPL 4B96A 1D6VH 1FO0L 5IBLC 2VLME 4XVUD 3HZ3A 4ATTA 1R3JB 1UA7A 2CK0L 3B3BA 3LB6C 3LQAC 4X7DC 3PPSA 3W9EB 2R0LH 5IT2L 3OBAA 2EZ0C 1HSBB 4Y19B 1NMBH 4ATWA 3ZGIA 3JZYA 4MFHA 4WI7A 4KO5A 1JXJA 2Z7YA 2DYPD 2P52A 2EECA 1BG9A 2DD8H 2OR8A 1T83C 5E9DE 3HMXH 3CLEH 3X2QB 3DMMC 4MKMA 1YC7A 4ZYKA 4KXCA 1PLGH 1G7LB 1P1VA 4XC1L 4YWGH 1NUGA 1W16A 1DO6A 3GMOA 1IRAY 4PJ9A 4TVPL 5IVZB 2HPTA 3SPIA 3MJ9H 4E5XA 1CXEA 4ODSH 3GSVA 1KELL 4YGVA 3MV9A 4JFED 4NPJA 3KPSD 2WXNA 4YXLH 3VFTB 1KXTB 1U4EA 2EH8H 2X44D 3MODL 4YDJA 2Z7ZA 4FE9A 3X12B 5EFIA 1QFWL 3L3HA 4RISL 2WUBL 3DVFA 4PCSA 4ONOA 5DLMH 3RHWK 4M7JH 2ZUWA 3VG9B 3IDIB 4JY4B 3MLRL 4X5LA 3UMNA 5KSAD 4PRNB 1QABA 2FATH 4YLBA 2CBMA 1XXDC 1E8YA 5AB9A 1TXKA 3U2SB 5GSVB 4DP2X 1J0IA 3HG3A 3LMJH 3LQZB 4LOVA 4M9PA 4NBXB 4FZ8H 3ZMRA 5CZVL 2FO4A 4XCFL 5CBEB 3MJ6A 4HBCL 1RIVH 1XDTT 4JO4H 1T6VN 3B5GA 1I3GL 5A6MA 1NUNB 2Y2TA 3I3EA 5KJRL 5DC9B 4OCNC 2V9TA 4QRUA 3A4FA 3Q9PA 5J6HB 5KVMC 1RD6A 4TULL 2C7UB 3RHWF 5C0JA 3CD4A 4OJCA 1W2KT 3DRQA 1Q4NX 2P45B 2Q2EB 3EH1A 3PABA 4PRDA 4DN4H 2RFXB 5G4MA 1L6XA 2E75C 2ZSVB 3MLZH 1HNYA 2D0HA 1SVCP 4ZPVB 1I8MA 2WM0A 3FO1A 3L7EB 4UV7L 5DVMA 1N12A 4FADA 15C8L 3HN3A 1BF5A 3FCUB 4HJ0C 4KDVA 4NRXB 1CGUA 3FBQA 1F4YH 4Y19D 2D31A 1OF2A 3OR7B 5D4QA 5FO8B 2BNQE 3HLAB 1S7XA 1JVOA 3IDJA 4F9PC 1RZKL 1S5HB 4UMGA 4X6EA 1MFVA 5EOCH 3SKNA 4Y1AB 4IRZL 1I9RH 4L1LA 4EI5D 3WI9A 1EAPA 2ITEA 1PDKB 2WTRB 1KY7A 3AROA 2NZIA 1QZ1A 1RURL 1KBWA 4GS7B 4JJ5B 4R7DA 2CAKA 5B1JC 5CAYB 4CVZB 1V3KA 5DO8A 3B9EA 2IAMA 1JZEA 4MTMA 3RTQC 5DQDH 2QTEA 4FQIH 4X98B 5E94A 5IKCA 1DBAL 3FFDA 5EA0H 4JPWH 3NCYP 4NZ8A 3CZEA 1USZA 1WF5A 4XPHH 4TLUA 1UZ8A 1YECH 2HFEB 4AVHA 2DQGL 2QVFB 3B8SA 3FN3A 4EUPG 1CFQB 3EGDA 3HNVH 1AQKH 4S1RL 4W9GC 4CVUA 2CD0A 3FO2A 2A7BA 4KITB 3H2WA 1NGXB 3NABL 4L3FA 3H4FA 4XMPH 1BQKA 3WGUB 2BIOA 2PLTA 4OB5L 1TQBB 2EVFA 3I02A 4IS6A 4PVBA 5F0LB 4NSKB 5D70L 5DDHB 2HP4A 2ZXAA 2Z91B 4Q0XH 1CIDA 4IDJL 4XMXA 2DQFB 5DUMH 5FKAB 1QTPA 1ZSDB 4L2LA 3IK2A 5DUPL 4I0PB 1FAIL 1H9DA 4Q97A 5LUMA 1ET8A 4ENZA 2ZX7A 2NUPA 5JW5A 1OE2A 4U6VH 4WQOA 3IPBA 1U8HB 3SIKA 4DUVA 5LVEA 1YUHB 1A6PA 3PWJB 5D2LE 4MJ5A 4YIQA 4N1EA 3CFJB 2YGPA 3EAKA 3MNVB 5ICUA 1G1KA 3FQ2A 3S35X 3H3PH 4BKSC 2VDPH 4EQ3A 5G5DB 2Z34A 5F7AA 4J3XA 4Z0XA 2F9BT 4TNVK 1M2VB 3VYNA 2G5BA 4L8CB 3BIBX 2W94A 1FC2D 1LO3L 3B7UX 1JSYA 1XGPB 5JIIA 1YQ2A 3Q6FB 3KBEA 4ZTOL 2NYZA 4PJFE 1B4JL 3OQRA 5HD8C 2HAZA 3O6FA 2WSDA 3DSFL 5C0GB 4EXPX 3UDWA 4NC1E 2ZWLT 1CZ8H 4K3EL 2ZF8A 4OI9A 5LXGH 5JOEA 2WD0A 1JCVA 3LKRB 5TDOA 1AZRA 2DQIH 4ZO9A 3K91A 4TNVF 4OFPA 3QUML 1Q9WB 1GGUA 5C3TA 3DX1A 3NEOA 3BZ5A 4F8LA 2KQMA 1DEEB 4GW4A 1IE5A 1RJCA 4EBQH 4TUKL 2VO5A 1H3XA 1XH2A 4GINA 4A7GA 4YHZL 2AEQL 4PBVC 5F3HA 3ZKQD 5CEXB 4Z7UA 5KYXB 5J7CC 5D2NB 4PJDA 3T0EC 3WSQL 2V2TB 3LRHA 2A4ZA 5DJ0A 2VYRE 5D7IE 4Z76B 2YKKA 4UCFA 3GSNB 3Q2VA 5IQ9B 3UROR 3VWJA 1K4DB 3BSZA 1DSYA 5FOBB 2FBOJ 2NYKA 5DHMC 3VWKB 3UGUA 3EOBA 3NCJL 4RA3A 5DJ6B 4FKEA 4HQQH 2FSEA 2XRAL 2P8MB 1RUAH 3EDKA 4A6YL 2FWSA 1WDAA 3NPSC 2I7OA 5I9QC 4F8QA 1TUPA 3P11H 4MXQD 1QAWA 3KLKA 3UTSA 5HI5C 5DUJA 5ERWA 4A67A 4J3UA 5KVGE 4JQIA 3JV4B 3MZGB 1H15A 4KJQC 3RYMA 2XIBA 4WU5B 1GAFL 3OHMB 1RPKA 1VFOA 3DX8A 2WLZA 2EDXA 3HI6H 1T21A 4LMQE 3QRFM 3ENEA 2QBWA 4O2EB 4OZ4A 2WUCL 4YE4L 4Z1PA 4O02B 4QRTA 2EAEA 5C0EA 3MCKB 5L0QC 32C2A 4DKFH 5L7XL 4OZIE 2AQRA 1EPFA 3WTYA 3Q8EA 4N2GA 1FNHA 4F33B 2AAVA 5IESL 4OLXH 2OULB 1UWFA 1BQHG 4BH8A 4TQEH 4IBZA 5AOZA 3ZHNA 4HCGA 4MJ6A 4R4BB 1QUNA 2AF2A 4N28A 4ODUB 4NHUB 1RLWA 2OTPA 3BT2L 4BSVB 4BSJA 2YD7A 1UA6L 3ZZLA 4JM2F 3TGXA 3G6AA 3QR2A 1KYAA 3Q2WA 3O0RH 2OJEA 1D2PA 4M1CD 3RTLA 2JTDA 4ODWA 2GI7A 4HJIA 4LK4A 4DVRL 2CO7A 3AWFA 2OW6A 3DXAA 3AG3B 4R4ND 1I53A 4TLTA 1DN0A 1OB0A 3MR9A 1BFVH 2PW2B 3B56A 4ELDA 3VI4F 1Q1PA 3A6OA 1U41A 2FWLB 3FF8A 3GMNB 4UU9B 4LHUG 4N87A 2D0FA 1QFUH 1YG9A 4KVCL 4NUGL 3QO0B 2CHNA 1ZEAL 1T4KA 1D5XA 1XMWA 3MPCA 4XRCB 3DMMB 4FNTA 3RE0A 3VXTB 4DH2A 2X42A 2A9DA 4HT1L 3A47A 2C3GA 4NQSB 5HHXH 1EZLA 2X88A 2PUQT 4WHTB 5T3ZE 4A2FA 1EEUA 1E4XH 4ODXB 1OAKH 3IU3B 1UXSB 2OMTB 4MJIB 4A2MA 3NJXA 4B9GA 4LKXB 1QNZH 4B60A 2Q7YB 1NINA 1ZPUA 4MBRA 3GPEA 4CW1B 3RWFB 2BINA 4AV5A 4HZLA 4JBSA 4MD4A 3DROB 5HJ3B 4J6IA 3UBXB 2WQAA 4HVBA 4ABVA 3TJHC 1MUJA 5E1AA 3G5ZB 6FABL 1G9ML 1ZVNA 3POCA 1IGCH 1JGVH 3Q1SH 1VEMA 5DGRA 3STLB 1UM5L 3HVNA 4TSBL 4PH8A 1BV8A 2NYYD 4QXUH 3WS6C 2JCCE 2ENPA 1U8NB 1JF6A 5AOMA 4QRQA 1GGBL 3DBSA 3PL6C 4IBTA 4QHNA 3L4ZA 3MXVL 3ARDC 4DT2A 2WINA 3MA9H 4MDRA 1F3JA 1E9QB 2QTVA 1F6AA 1YPZE 1LO4L 3RAJH 4WIQA 3FQ1A 3RVTD 5IJVB 3B7SA 3CHOA 4Z9KB 2DQDH 1E3XA 2JK5A 4E68A 4YXKH 4WKZB 2WVUA 3PU7A 3QJFA 1EHLL 1MIEL 4KV5E 4OF6A 3UXFA 1O9ZA 2FH6A 1R24A 3ILEA 4LGPB 4TYUA 3ELQA 3NFNA 1A6TB 1EAJA 4U6XA 1MG2C 1MFNA 2LU3A 5HY9B 1DZBA 3GIZL 2BIIA 3SE4A 2K8MA 3D3VA 4KKQA 3SHSA 3VACA 3GRWL 1R3IH 1EMTL 5EO1B 2PO6C 5F8QC 3JXAA 4ZOBA 3UBHA 5HHMB 4P3DB 4N1CA 4PRIE 3GDBA 2YPLD 5CN1A 2G60H 5E24E 2CGRL 3O8XC 3FU7B 1PY4A 2UZIL 2HTKD 4FXLA 1E27A 5ABDE 4PJ7E 4P23B 5FOJA 3MX0A 5E03A 4DEPC 1SMDA 2BVUA 2F8IA 2WN2A 3ML9A 3U9PH 2ATKB 1QEWA 1XF1A 1AGFA 3HNTH 4N0FB 5AVTB 4BK5C 2J55A 1S7SB 2P9RA 1Z5HA 1J7VR 3EH5B 1FVDB 4G6AD 1N3NA 2CLVB 5FA3A 1QR1A 1RXLA 1W15A 3WFHB 1UA3A 3LNEA 2IPTL 2X28A 1MRFH 1NBZB 4JG0H 4L4TB 5EMYA 3U4EA 2J6EH 4FNQA 4JPSA 4YDLB 3QI9A 2CUIA 2XN2A 2G9HA 4PJCA 1JHKH 3T1FB 3H0TA 3D30A 1T0OA 2XWTA 1DJSA 3UGXA 4OZFH 1MJUH 3GFUA 2ZNWA 2ZP8A 2IALB 3I9GH 3RX5A 1HZKA 1A7BA 4NQVB 1SQ2N 4L8BB 2XOTA 4CGUB 5D8JL 3O9WC 2XTSA 4FDWA 4KKBD 4F24A 5E7BA 4GMTL 2IFFH 5FM8A 4XHJC 2MPAH 4MNGA 4P5KA 4YGVB 3UFIA 2AV7B 4X6DB 3W81A 5LXVA 2JCWA 4W6WB 1UZ6F 1IGTB 4DK6A 3H42H 3L3HB 2OZ4L 1TZAA 4NKMB 2YKLL 4GQQA 3OLEA 1F1AA 1V3MA 3TOPA 1RFDH 1V54B 2XXFA 4F2EA 4HGKC 2CKBA 2A1WH 1RJLA 5EU5A 4K7PL 3VXUA 4YBHA 2BHZA 2J1WA 4UZGA 2WLKA 3BPOC 4R4FL 2DQEL 2GEEA 3X13B 3BKJH 3T8VA 2ZUVA 4ESKA 3A24A 1N0XH 3OAZH 4NZDA 3S3JA 4P23D 4Y4HC 3VXNB 5IROD 4FFZA 5C6WH 3GMQA 4J23A 2R0WL 5ISZD 1QRNE 2PYED 2TAAA 2VDKL 3GB7B 3KS0H 5DMYA 4UZUA 5EZIH 1GVIA 3QUYA 4C56E 4B41A 1CGSL 3C5XA 1TQSA 3RWEA 3U48A 3C60A 3SKUD 2JLPA 4PRDB 1DQMH 2EVIA 2NX5E 2BVPB 3B9KC 5EBLB 2HT3D 1LP9F 4ZS7L 3F62A 1MAKA 3FO1B 3T0EB 2Y72A 1KTRL 3GMRB 3N85H 1E42A 3POHA 4LCCC 1TEGA 1H8OA 5E2UH 4OFQA 1IC7H 4FG6D 1R19A 3S5LA 5HYSG 1CFVH 2FIKA 1DN2A 3DIFB 1O75A 2X4PA 4L1DA 2B9BA 4NFCA 3GIVA 4KROB 4OKDA 1OF2B 1W9XA 1NL0L 1KTCA 5F7YC 4B9KC 4MDIB 5EU7C 4YL9A 5ID0B 2AK4E 4P4KA 3QORC 1N5AB 1T20A 2GC7C 3LZPA 2APXA 2P28B 1WPCA 1U8LB 1ZLEA 1ED3A 5I9QB 3UYPA 4R7DB 4PJ9D 3ULSA 3HI1A 2RBLA 3DGGB 3M86A 1HOEA 3WXVL 3MMEB 5IVXB 5IOKA 3MV9D 5K1NA 2PTVA 3BZDA 4LPTA 1QPKA 1FN4A 1X4XA 3QT2A 3FFDB 4HUKB 4B5EA 5MENE 1EANA 4X4XA 1KJVA 3NCEB 4WSJA 4Z18A 4F8NA 1CU4L 5DT1H 2CIKB 5I1EH 5ECJE 3IE9A 3NG5A 3EGDB 3HAEG 4BRVA 2OI9C 5L0QB 1MFDH 2F5AL 5EC2A 1GOGA 5EUOE 3TS8A 2FYVA 3OB0K 3IXAA 1U95A 4P8QA 4P5MA 4CGTA 4NO5B 5C8JA 3E2HC 4NUQA 3FSWA 4MYWB 1JV5B 5CZRA 4K5NA 1IM9B 1ODUA 2XN9B 2K8QA 5GZNC 3N91A 4JJHA 3AUWB 3KGRA 3PS6A 5DRZB 1F90L 4U05A 3BN9D 1OL0A 3RU8L 3FQNB 2NUPB 3HG0A 3I6KA 3MKGA 3UC2A 1ZLWK 5TFSH 1A22B 2ARJB 4UQEA 4XNMB 5BS0E 2WQRA 3CXFA 2Y7QB 3BGAA 3KGSA 1DQDL 1CI3M 1NJ9B 2Y6SC 5IHWA 1UKSA 1NWPA 3GM0A 1BPVA 4HSQA 4KMTL 3QHFL 4NQXA 4JQXA 5T3ZL 4PR5A 1UWGH 1LQBC 3EUDA 3K5SA 4NHCH 3Q3GB 4P9HH 4ANWA 3K1DA 4KQ3H 4WUUA 1LEIA 1CXFA 3MRJB 4KAQH 3DUSB 5KOVC 4B7IA 4HCRL 3MV8B 3FQXB 5AVRB 1EJOH 3FUNA 3II1A 3KPTA 3TEXA 1E7VA 1H3TA 4KROD 2G3MA 1O6SA 4JCMA 4P2QA 2AQ1A 3G04B 1P9MC 2VSKB 4X42A 4X5WA 3IVKA 4NI3A 3GLAA 3DUHA 4YLCA 3O6FB 1QLEH 1QQDA 1TZGH 2HFGH 3F7PC 1KN2L 4UINL 2B2XH 3GSOB 5TDOB 3BDYL 5J11C 2BSBA 2IAMD 3HHRB 3L3OC 2YAOA 2VDRL 4NYLA 3AS2A 1VENA 4JFHE 4PIBA 1YNLH 2VDOH 2R9HD 3JVGC 4M8QA 2WIIB 4GW4B 4ADIA 1AGBA 4Q6IC 5FKPB 5EZJA 4AMKL 2K9FB 5F3HB 5J5EA 4Z7UB 5HGDA 2ICWB 4AMWA 5BMFH 1ZANL 2AQPA 3VNYA 1UWXH 3ULVL 1IGYB 1F86A 4NPKA 3RGVB 4L0YA 5L4FA 5HHNA 3HS0C 3D4CA 3ARDB 3VD3A 3C5SB 4K07A 4BQ8A 1Q0YH 4MNQB 2R15A 1IM9D 4GW1B 1DBBL 4JHAH 5FYJL 1NBYA 1UD4A 3ESUF 2E74C 4HUUA 4M6ML 1IO4C 1I1RA 1NANH 2WSKA 2BSRA 2FLMA 3RKDD 3V5HB 1KSRA 4PMEA 3N44B 3OKMA 5I2IA 3IPFA 2YXFA 4L3EA 3V52H 4JQIH 4N2KA 1P7KA 3O41A 1O9WA 1U8PB 2XZZA 1KGUA 3MRCA 5JZ7C 2ZCKH 3Q01A 2XWDA 3PHSA 3EOAB 4ALAH 1JGLL 3O3AB 4WKXA 4HOZA 5MERA 2GAZA 3BUQA 3TEUA 2VMEA 3FONA 1A7QH 4GI8A 1LDPH 4UQCA 4S1DD 2YXMA 4CJ1A 4JLRB 4QXGL 1HCYA 3OAUH 2BSDA 4QRTB 4AL8L 3PYCA 1QEXA 4LDLB 4PJIF 32C2B 3O8XB 1OWWA 4LSVL 3DURA 4HU2A 3KMDA 3PCYA 4AYFB 4LASH 4U1LB 5BXFA 2IH1B 3WNMA 1VLXA 4DEPB 1WTLA 5G2NA 4JQVC 1QW8A 3O6FD 5EDXA 4BH8B 2FJGA 5CEZH 3TFKC 5BV7C 1R4XA 4BZ1H 1OK8A 1WITA 4ISVB 5A2AA 3RJOA 1QUNB 3ZT5A 4KWUA 3BN3B 4KBPA 1MF2H 4OTXH 5J0BA 2O61B 2FL5B 3L2LA 4N9OB 2FJHA 1LO0H 2XA8L 2ZP9A 4P06A 4WVRA 4CVXB 5HHOA 4DO6A 1CJYA 3HRZB 1NMAL 3UCQA 4KTYA 3P2BA 4MWFA 3UG3A 1OW0C 2D4DA 5AZEH 3L4YA 2L8AA 3QJUB 1AS7A 2XV6B 2QMJA 4NM4L 4OD1H 2D9CA 4PUBH 1SXCA 3RGVD 1D5MA 5I66A 1AZZC 1XAKA 2UUDK 3C8DA 4K3JL 1LE5B 1F4XL 2H3NA 2O5ZH 3H6AA 5EZPA 3T2LA 4KVNL 1I4FB 4UTBL 3VWJD 2DWDB 3JWDH 5GRWA 4GXFA 3K8MA 4J2XA 4C58B 4ZMXA 5GGTL 2Q8BH 2DQTH 1YEKL 3QZWB 3V6ZA 4A6YA 2KKQA 3GXPA 1KB9J 3CSBA 4EN3A 1D7FA 2HKFH 2IEPA 3UTSD 1RUPH 5F9OH 1OV8A 2HVJB 1Y18A 2CDGB 1E8WA 2NLJA 1JN6B 1TJXA 4LLDA 1BM7A 5I8EB 5DI8B 1DANU 4GG6E 4U6HA 3QXTA 4J3VA 4MQ7A 1MCPL 1SRDA 3TWCL 1KFAH 2V7NB 4KKCC 2V33A 5IG7B 3T3PB 4IBQA 2BHUA 3NH7L 4EDXA 3EJJX 3TVMB 4KDTA 4QRQB 5DEFB 2ZYHA 5EZOH 4Y4HB 4K7FA 1LK3H 4PJEF 2WINB 3AREC 5C7XL 1AI1L 2JJUA 4JEGB 1F6AB 4RGNB 4WJKB 1DQJB 5IHBA 3HRPA 4HCIA 5B3SB 2A6IB 4RMUA 4AH2A 3HE7A 1FNEA 5BUGA 4KKAC 1BDYA 5CKGA 5CEZD 1CD1B 3S36X 5HYQB 2BY1A 2A4CA 4F15C 2VIRA 2CMRL 1BZ7A 2HN7A 3DI3B 1YEFH 3KL3A 4GKSB 5ETUB 3B9KB 1G7PA 2WBWB 1U8CA 1JNLH 3QQDA 4ZAKC 5E9DA 5F96H 2EACA 3MRQA 3K3QA 4LCCB 3V4UL 1DQQA 4XWOC 5KBDA 3IF1B 1DZ0A 3REVA 2W1NA 1G7IA 3DI2B 3ZUCA 2OR9L 1SMOA 1THCA 1ML0A 3GJFH 3D3VB 3DXAD 1HZLA 4AG4H 1DFBL 2RCSL 3K2KA 1A5FL 2FCBA 1VF5C 2G3NA 1EH9A 5ICZB 3QFDA 4MD0B 3RDTA 1A7NL 1AE6H 2YXVA 3SE6A 1KNOA 3DJ9A 2PETA 2R39A 2XZAL 4M4RB 4M1DL 3VXPB 1KEML 2NCMA 3GBDA 5JIPA 4G8FA 2KZBA 3DV6B 5E5MA 4EIGB 3MLYH 1MFEH 4MRBA 1QEWB 4MQXC 3V5DA 1U93A 1ZHNB 3VH8A 3H3BC 1ZPLA 3WN5C 3UGEA 3QAZC 1N3NB 4FXGA 4RQQA 3FRPA 2A0LC 2V0AA 1B0GA 4JY6A 4K2UL 4FQ1H 2W9LA 4PY8I 3UTQB 1JWUB 5DJZA 5CJXA 4LCUA 2OI9B 1HE8A 1C5DB 2V9RA 4IU2A 5J13C 1LK2A 3OGOE 3CZSA 4O5LL 2J21A 5FW7A 1FV1B 4KRNA 3E2HB 3HC3H 3H0TB 2RH0A 1ZHBB 1TCRB 4ZMTA 3ZZQA 3TVMD 4QKTA 4LRNH 1ONQA 3ZOAA 3BGFB 2WXIA 1ZIAA 3KJ6H 3TCXA 3EFOB 2WLNA 1DJXA 1Z5LB 1N7ML 2YSSB 3MRGA 4RGND 4IMLA 2Z4QB 3IDNA 3AG2B 4OLZL 1M7DA 3KPMB 3RZWA 4XMWA 4ZT1A 2BNQA 5LG1A 1H5BC 4S1QL 2R2BB 4MNGB 4P5KB 1MWAL 5I5IA 4A1RA 3DX6A 1PZ2A 2IVFC 1ZVSB 4UV4H 4IOSA 2J2ZB 4HLZG 2OMZA 2PMZA 2Y7LA 4LSTL 3TCLA 5EO0A 1CQKA 1U58A 3IFNH 3TZVC 2CKBH 1S7RB 3BIKA 3HZMA 1SFDA 4URTB 4QRSB 3D3VD 3IJSA 1D9KA 3GRWA 1OSPH 2W88A 1RJLB 5LDUA 5EU5B 2J8UF 4G70B 3QK0A 3K0YA 2WNXA 2VDLH 2PTTB 1MJJB 4GI6A 4YHKH 2FEDC 1I3UA 1Y6MR 5JOPE 2HT4C 3HBPA 4MSWB 4JK0D 1Y0LA 1U8IB 3SDCC 3QQ4A 2V8MA 3ZE1B 1L9OA 4K8RL 3FW6A 4YSAA 4W6YB 3GZPA 1AVAA 1YY8A 5J11B 5HP5A 3L3OB 4HFWA 4M3JA 3QEHB 1A9EA 3OKYA 1KIPA 2LU5A 2BVYA 5DHVA 1UFGA 3LS5H 1ZGLA 3KBFA 2ZUQB 5CEYB 1C5CH 1SBBA 4EPSA 5I76A 3OJDA 4ZODA 1NGPH 1ETA1 3FB7A 2JTYA 2BFGA 1FO0H 4N85A 2AXWA 5HVGB 2CLZA 3QI9D 2X6UA 3QXDA 3E1F1 3HR5B 2FIKB 2HLFD 3GXNA 1IM3A 1VACA 5D2LA 3B9VA 5L4JA 5E56A 3HE6C 4KNUA 5A1AA 5B38G 4HOXA 1U8QA 4XO4A 3WY2A 4H1LH 1SXZA 3JTSB 4LVOC 3IMUA 2FHFA 5DD6B 4P4KB 5FEBA 1ZVHA 5IEKA 4XC1H 3S5YA 2IWEA 4TVPH 1UT2A 4YNYB 1IIIA 1XEDA 4C4KT 2W0KA 1C8PA 4LEBA 2WLLA 1JI2A 2MFNA 1L0PA 4PHZA 2Q8AL 3TO4B 3VGGA 2KDGA 3T2PA 5JHLA 4PJFA 2WB7A 3QCTL 1QFWH 2UX7A 4RISH 2LLLA 3GWJA 1A21A 2WUBH 2NSQA 2I5YH 3NA9H 3QH3B 4XMVA 5D1XE 3S2CA 4ZFGH 5BCAA 4U6YA 5DD3L 1QOKA 2VUYA 1DJHA 3CSGA 4OBSA 2XY2A 4UNTA 3LKOB 4IRJA 4EDWL 3B83A 3WLBB 5ITFA 3OXSB 3DETD 4F58L 2VR3A 1PNDA 5CZVH 5EC2B 4KRPC 4XCFH 1CDBA 2CO2A 4Z7NB 3CNKA 3I3BA 5C86A 3VXUD 4WW2C 4P5MB 3ZE0B 4GFTB 1I3GH 2VDMH 4U1JA 3WNIA 1NCIA 2DTSA 3HMWL 3BXNB 2BSEA 4TULH 1U92A 4G6MH 4JVUA 4YDMA 3C6LA 3FQ4A 4U4IA 5D7IA 1CDJA 4HAFA 2YAMA 5MEQB 4ANVA 3SQRA 1OTUC 4PG9B 5LBGA 2ZE0A 1TG8A 4L9LC 3U0PB 3QUYD 1CTNA 4V11A 4J3TA 3C60D 5JW4M 1QO3B 4UV7H 2HLAB 4KMQA 2ED9A 3UYOD 3FT1A 5T1DH 3FTWA 1NTDA 2AJZB 2VOTA 15C8H 1R5WA 5IW3A 4WUUB 1LEIB 1YN6B 3KNBA 2EKJA 3CVHL 1FNSH 2BNRE 2F15A 4G7SB 4I3RL 2D7TL 5E7FA 2AI0H 1N6QH 4JFPB 4P46C 1OSZA 2VLJE 4N2CA 2H2SD 1FVCB 3NJFA 5AOKA 1H8LA 3WJJA 4IRZH 1AD9B 5C97A 4P5TB 4IGBA 4YLQT 5D6DA 1JK9B 2EDQA 3G9AB 3GHBH 4AQOA 3IGAB 1J5DA 5FFOA 4X5WB 1ZLVH 4N2FA 1NGZB 2APSA 2YN5A 4P4KD 3V6OE 4N9GB 5D7HA 5E51A 2XKNB 3EH4B 4NUPA 4J5VA 5C7ZA 4CL7A 1G7QA 1MW1A 1UYWL 1A1NA 2Q6WB 2KLSA 1CK0L 2M83A 3KW7A 4HIIA 4XMZA 4TVPD 3TO4D 1DBAH 4OZIA 4JFUA 5AW8B 4EI0A 5E08L 1HHHA 4NCC1 2DQGH 5KS9E 1I8IA 1HQRB 1SJEA 2ADFL 4S1RH 4HKXA 3KPOB 3KYNA 2DW5A 4HS3B 2Y0SA 3VSTA 3NABH 1SBSL 1JNNH 1F97A 5IMKB 4OZHE 3PP3K 4HK0A 5D70H 4KU1A 4QCIA 1YEGL 3CN4A 2BVOA 4P2OA 3RY6C 2KYIA 1IT9L 4IDJH 3LV3A 4NXSA 1MH5A 1I9EA 3L95A 3FH7A 1GGTA 5DUPH 3C9NB 3ABZA 2WWKO 1FLRL 2UY7A 2WXJA 3QJVB 4KC3B 3SGEI 4IOIA 4JKMA 2Y69B 3BSHA 1MWOA 2CXKA 2EDJA 3E0GA 4YS4A 5DVPA 3THML 4AW4A 3HPLB 1NIAA 4RSYA 4ZAKB 4I9WD 1P7KB 2EO1A 2PYFB 3MRCB 1U2YA 4OCRL 2K1MA 3CFUA 4U2YA 3MRIA 3S3DB 1XMEB 4FXTA 3TYGH 2Q5BA 1JL8A 5MERB 1JZFA 1UUNA 2C3HA 1PSKL 4WUUD 3CFDB 1UCBL 4RRPM 4OGAD 3W1ZA 2G4EA 1X7SA 4X5XB 4PGEA 1LO3H 3QCVL 2VW6A 1JRHL 3N0AA 1VB9A 3K2IA 3KXFB 4ZTOH 3SDAC 1B4JH 1S5IL 3BC9A 5KG9B 4DWHA 4P2QD 3DURB 4P5TD 3GDCA 4UBDC 3DSFH 4OSUL 2AHIA 5E0QA 2PXYA 3DV4B 3O6KL 4PB9L 4TUOA 4OFKA 2EIDA 3LD8C 2OSWA 4MQTB 4K3EH 4YHML 3DHMA 1S3KL 3L5XL 5I1CL 3PHQA 2B20A 3U46B 1FFPB 3WN5B 4EE2A 2JCCA 5BOPA 3DARA 4P3CL 3QUMH 4DVBA 5IREA 3B2UC 2PNDA 3TNMB 5BJTA 4BFJA 4YHZH 1T22B 2AEQH 2JELL 5JDSA 1YPZA 4KRLB 4AQZA 1XGTA 2AEPL 2JJVA 2IDQA 4QHUB 4RAHA 2JIXA 3WSQH 5J13B 4AGLA 4PWIA 1XVSA 1NDMA 3TBWB 2VABA 5DF0A 5AVWB 2QL1A 4J3OD 1IAIL 1CG9B 3IGUA 2W0FB 1YMHA 3GJEB 4G8IB 1G6RL 3DA0A 5D5MB 5F1IB 4YFLI 3NCJH 1EDYA 4JE4B 4AK2A 4CC4A 3HG4A 7FABL 3QUHA 1SYSA 1DJIA 1E5YA 4A6YH 3Q5OA 3BSGA 1FZMA 1NSNH 1ZIBA 4R83A 3RWJB 1QFPA 3NCFB 3PAZA 4ZUSB 1H5BB 1RZPA 4K5MA 4NERA 3GSUA 4L3ED 4KI5E 4PRIA 5B3JF 2B1HH 2WNWA 1KCVL 1T7YA 3HS9A 2FJUB 2Q20A 2VMDA 3QR1A 4NO2B 4AM0B 4PJ7A 4R84A 2A9NL 4MXWH 1GAFH 5TGBA 3KLAA 2R51A 3TZVB 2CBPA 3IGKA 3H9SE 2PKDA 4OZGB 3PAYA 5AVSB 2D7PA 4W9JC 1T0MB 5C09E 2WUCH 1EZVX 3OTTA 4YE4H 4YEFA 1CD8A 1RJYA 2PCFA 3QRBA 4ICXA 2QVTA 5L7XH 5LGJA 5PAZA 1JE6A 4DN3L 4JN1L 5IESH 1V8HA 3SDCB 5I1HL 1HESA 5SWZB 2IG2H 1TFHA 3PNRB 3WYRA 2A74A 4X2UA 4X50A 5L2JB 3NGBC 2XZQL 2O72A 2C9PA 2RHEA 2AGJL 4NZJA 3WE6A 1VCAA 2N7SA 3OR6A 3BT2H 3FB6A 1FNEB 2XBDA 2AAAA 2X4NA 3NIGE 4WI5A 3TIEA 4M3HA 5FCUL 2EILB 3VVVA 1BZ7B 4ZW7A 2A2QT 4I9XA 4N20A 3VAEA 2DQJH 1TPXC 1XBRA 4PJGE 4YBQC 4N5UA 4NRZA 4EVNA 2ZX8A 5HHOD 3EJZC 2GJJA 1OO2A 4N2OA 3S7GA 3W5NA 1E0OB 2X70A 4N2DA 2WLIB 3VI3E 5MEOA 4GAGL 4DNLA 1IEHA 3WLWC 2I32A 2IOOA 3CFEA 3QDME 1EEZA 1GYVA 4KVCH 1C7SA 2ARJQ 2LGNA 1ZEAH 1JK8B 1SYVA 3FFCE 3W11C 2G3XA 4HT1H 4Y1TA 4ZFQA 3SE8L 1KNOB 4LL4A 2WCPA 3MOAL 4NOFA 4CMMA 1HX0A 4NOBA 4UTBA 3MRMA 1ZA6B 1TTRA 2XPYA 4LLMA 3UBXI 3CSYA 4ZUWA 1AR1D 3O2DL 4V2CB 1ITCA 2E7DA 3QYNA 5AEAA 3DX0A 1XCQA 1IILE 1BOYA 5SV4A 1PFOA 2NY2C 4NBZB 3V5DB 4EN3D 2YR3A 4Y5VA 2I9TA 4NEHB 2CO6A 2EIJB 4U1NB 4QRAA 4F7TA 2KT6A 5IWLC 5I74B 1B0GB 3R0NA 2HX8A 3P73A 4ELKA 3CN2A 4PWFA 1A4AA 4ZNCD 6FABH 1G9MH 1HEHC 1KBPA 1UXMA 1PNCA 4U1SA 2WBJC 1QRNA 4NRYB 1ACYL 1UM5H 4TSBH 3Q8FA 4DP9X 5A2BA 3GHEL 4Y4KA 5H2BA 4XCNB 3RWIA 4C56A 4P9ML 1V7NH 4WW2B 2EO9A 2ZKYA 1KXHA 4G42B 3W57A 5F7FA 5BVJA 1BZ9A 1P1ZB 2DEWX 4YSOA 3SKJH 3ZMEA 3ZR5A 4HG4K 2NX5A 2BIMA 2EINB 3MXVH 5H35A 1WAAE 4PP2A 4BZ2A 1ONQB 1PX8A 1LO4H 3PQYB 4L29A 4XNQB 4H5SB 2IADA 4W9KC 2ZUXA 1AR2A 3V6FA 2VLMD 4L9LB 1L9TA 4BHUA 1NBVL 3HE7D 2O93L 4FQCL 3DK2A 4YEEA 3FNKA 4FD0A 3T71A 1CDIA 1OARH 1MIEH 2AVGA 1EHLH 4NQDE 3BPCA 2BVEA 4RVBA 2ICEC 4ONHA 4X6BB 2AK4A 4JDTL 1C08A 2ZCHL 4FZEL 3KBPA 4GEJA 5E9DD 4A37A 3FT2A 4Y9EA 2WHVA 1NAML 4BE6A 2CNZA 5EO0B 2ZP0T 1LMKA 3GRWH 5EF3A 1EMTH 3BIKB 5D7LE 4P46B 3D52A 1J9RA 3KCPB 2X1OA 3UL4A 3V9FA 2QQLL 4JAMA 5MENA 4XPTL 2CGRH 5FYKH 1A2YA 5E4EC 2V5SA 2UZIH 3RDTD 2W81C 3EO1A 3R19A 2XYCA 5EH1A 1W8NA 3VX0A 1NFKA 1U8KA 3VNZA 3B8YA 2X9WA 2B59B 3K71B 3ALWA 3E6FA 2P8PB 1NUDA 5SWSA 4Y7MA 1DE4B 3IDGA 1FNFA 4ZTEA 1KUMA 1CL7I 2OJZL 3AXLB 4HFWB 5GS3A 2JQAA 4LLVA 4HULB 2CUMA 2X7LB 4JZOA 2IPTH 4DFIA 1HINH 1GSMA 5EF1A 5ICYA 1T03H 4PTTA 2WPGA 1NLDL 1KOAA 1QSFE 1JXKA 5BS0A 1DANT 2YEVB 1KCBA 1IM3B 1ESOA 4PJHB 3MRDA 4FFVD 3VU1A 4WJG3 2Q1EA 1QI3A 1N70A 3MA7A 5DRWA 5KYNA 3ZRSA 4JE0A 1H3PL 4I2XB 3WHE0 2H32H 2VLKE 5D8JH 3HS8A 1SGKA 2F08A 3BJLA 3CK0L 2O4EA 3QFJE 4GMTH 2KH2B 4ILDA 4NKDA 2NT1A 4XBGB 5EBMB 3RUGE 5IEKB 1S7UA 4HUCA 2RA1A 5CU5A 3WNLA 2APFA 5DYFA 2BY0A 2VN4A 2UX6A 4ZUTA 2AEOA 5HGGS 3X1FA 1VESA 3FUHA 2BNQD 2ZKXA 5IB2B 1AS8A 3MO1A 4PJFB 5CUSL 1MWAA 1A6VL 1E6OH 3GI8L 1JUFB 4U1GC 1DBJL 2OZ4H 4MXVE 1Q9LA 3PJNA 2DWEB 4IOSD 4NKOB 1Q0XL 2FECL 2YKLH 3EADA 2UWEF 3NQKA 5HI3D 2ZOKA 3KWWA 4OLYH 5I0ZA 2WLJA 1LYQA 3K7UA 5TK2A 1OZUA 3SDAB 2DLGA 4K7PH 5C9KA 1J8HB 1D9KD 2CA3A 2K0RA 4R4FH 4MMZC 4X6CF 5JW4Q 5DJAA 2DQEH 2EIMB 2FSDA 5HDWA 2QGEA 4HIEA 5TDNA 5TK4A 5CM1A 5L9DL 5D71H 1EHAA 2GSGA 4U1JB 5AD0B 1AHWC 2Y36L 3F5WA 1YDPB 1PZSA 2O6CA 2R0WH 3GRBA 3MRKB 3OKEA 1T4WA 2VDKH 1U92B 3IMWA 4B9ZA 1CGSH 2ADYA 4PVLA 3ZO0A 3WDHA 2YC1A 3BLKA 5DK0A 5AAWC 1I7RB 2OSLB 4ZS7H 2VXVH 4N2IA 3GZOA 4EF3A 3N1PC 3FT3A 3PNWA 3MBEA 4PGJA 1RZGB 3NA4A 5INCA 4D0DB 1BREA 2GG1A 3B2VL 3CPUA 3FTZA 4RMVA 4O4YL 5ESVB 4UUJB 4AQAB 3RVXD 3CX2A 3AXHA 1IM3D 2MHAA 2UXFA 1NL0H 2WQ8A 4GKNB 1OSZB 5CSGA 3QPQC 4KPHL 3VSVA 2D3JA 2VKXA 1QSZA 4XO5A 3ZIYA 2E8ZA 3QHTC 4RAUB 4P59L 2AW2A 3F6JA 3QCUL 4PJXA 4XCYB 5DZNA 4G8EB 2ATPA 1BPLB 2FYYB 3GSQB 1CYGA 3QUZC 3WXVH 1G7QB 4KK9C 4OQ1A 1IEBB 2UXTA 4OUOA 1QTYT 2DMCA 1BWMA 4DPBX 2DWXA 3UG5A 4YUEL 4M7LL 3RDJA 2APTA 3IJHA 1CU4H 3IFLL 3NIDF 1IBGH 2OYLA 1I8IB 1FVEA 4UQ3B 4H8HA 1VPOL 4P9HC 1F3DJ 3BRFA 4U3SA 2N7BA 1T2JA 2F5AH 3O3BA 1FORL 1AKJB 4IRJD 3CHPA 3FRUA 3L3KA 4EUPA 5GS0L 3LIUA 3EO0B 3ZGHA 3FU5A 5IQMA 3OXRA 2XN1A 2EEAA 4NWTL 3LV3B 1D5BA 3L95B 1AD0B 1GS6X 5C0BE 2VJ0A 1K5NB 1TVHB 3NCYS 2UY7B 1F90H 2XWZA 5CINL 5D1QA 2OYKA 3RU8H 1S9YA 1DLFH 5K5YA 2BSED 2B1AL 1X5HA 2O6EA 4L48A 2CPCA 1EHKB 5C2BL 2G2NA 3D0VB 3HW7A 3TBTA 3RIKA 1DQDH 1FZOA 3GSRB 2PPAA 5BW7C 4KMTH 4M7KH 1TPXB 3LOWA 5T3ZH 3SY6A 4URKA 4XT1C 5ESAA 1YAIA 1F8TL 4LHQB 4MB4A 4HK3J 1UD3A 5IW6A 3RZCA 1AIFA 1NGQL 4X7EC 4HCRH 4HAGA 1XGQA 3ZKMC 3CDGB 5TJWK 3EFDL 4GQ9H 4AIZB 4GRMB 4K71C 5FPIA 3CVHA 5D7EA 4XAWL 3UBXG 1BF8A 3FB8A 2YA1A 3H2QA 3RL1B 3WNNA 3C08L 3N3EA 3NZUA 4HEME 3VMPA 1J9QA 1P69B 2YGOA 4X9YA 3MFFA 2GC4C 4IGBD 3K4ZA 1EZUA 2C3WA 5IEHA 3E3QE 4XP4H 4GG6A 2PXYB 5E8PB 2WO2B 1J0ZA 3GKZA 3L4CA 1KN2H 1PJWA 3M45A 2ICWI 4UINH 4DETA 3BDYH 3PHQB 4HWUA 2NSMA 4PV9A 2VDRH 3CFMA 3MBXH 5TQ0L 2B08A 1BQLL 1ZSHA 3KYMB 3MRPA 3P9MA 1ADQH 4DVBB 3KDPB 4LLWA 1A02N 4ALAC 3DTDA 3FTVA 2QDVA 5A16B 4AMKH 4A04A 5AAMC 4GQPH 3Q8BA 5JXEC 1VFBA 3KWVA 1XGTB 1A7PH 1ZANH 4YHLL 2VMCA 4K5LA 3ULVH 3FPXA 3ZN6A 1P4UA 5IVOA 5JR1L 4B0MB 4EIZC 2AERT 3ULUC 3N43B 5CJ8A 2OXGB 1KMGA 1XCXA 3ARGC 1HSAB 1H6TA 2KZ1B 5FYJH 1DBBH 3U36A 1XSIA 4IMKC 2E3VA 4M6MH 3NJKA 1T3FB 2FZ3A 1SYSB 4OVUA 4QLRA 4R7VA 2QQQA 2VXUL 3CAFA 2DDQL 4HS6B 5D7JC 5C0CA 1QPPA 5C0FA 1DEDA 1X44A 4ZRGA 4PS4H 4CBPA 4YR6B 2ICEB 3BAKA 1BFOB 4K0OA 3VFSB 1LE9A 1SXBA 3GMPB 5HYEA 1WZ1L 4HC1H 3QIWC 1E4HA 5TGBB 2VAAB 1CICA 1U9KA 5CGBA 2O6PA 3QDJB 5DD1L 1O7VA 3IJEA 2GTZA 4QXGH 3ZE2E 3QZOA 1WFNA 4AL8H 4IBYA 4OZFB 1UGNA 1KPUB 4LSVH 3OQ3B 5E4EB 4TM9A 4UTAL 4JPKL 2J88L 3P9LB 1XD1A 4F2MB 1DVXA 3BPLC 3N6YA 3TTSA 3BUYB 1FL3B 1PG7X 3JWDC 3IETB 4HH9A 3U1SL 2PXYD 5I6XC 3FC8A 3HG2A 3HNSL 4PGBA 1TU2A 1L5GA 2YMTA 1EO8L 1UOWA 4ETQB 2CU9A 2YUZA 5EIVA 3OR6B 1AHKA 1BQHA 1NBQA 3BD5A 4FX5A 4HMEA 3VXMB 1BX2B 1HCVA 3WBDA 1OAZL 1RU9L 4JKNA 1JZ4A 5IK3A 4PIRF 1ET5A 2XA8H 3O45B 1ACCA 2WCSA 2YK1L 4BGLA 1NMAH 4MDJA 2LAAA 4DP6X 1FI8C 1FFNB 2BP0B 2C26A 3UPAA 1T5XB 4GNKB 5J6GA 4OV6F 2OMYB 2A83B 3OAZK 5EUKB 3RWGB 2JIXD 2JH2A 2LLNA 2R2CA 2V7HB 1JXDA 2AJUL 1SQMA 1Z9PA 4R26L 1ZLSL 4U1KA 3LVTA 4KY1L 1F4XH 2QHRH 5E00B 3U4AA 4KVNH 4UTBH 4FNLL 1ID5I 1XF3A 4RESB 2J1KA 1KT2B 4MCZB 3U0TA 1L6ZA 4M61A 4CMMB 4LHUA 4NC0B 2XX1A 1BYNA 5GGTH 1T0NB 1A3QA 2GFBA 1YEKH 2UXGA 2VXSH 2WXQA 5FX3A 1E5AA 3CSYB 4WSGA 4ZUWB 1W8OA 4LVEA 2EEXA 3H1ZA 2DLFL 1I1AC 2C9RA 2FDBP 1WTGT 3LRSA 3S8FB 3LNFA 43C9A 1MLBA 2EE2A 4GQZA 4S0SD 4Y5VB 4CC0A 3MU3A 3IGLA 1DDHB 3CBKB 4X4YB 1GYCA 1HILA 1A4CA 1HOCA 1MFBL 2CIIB 1MCDA 4PGCA 4RWHA 5ANME 5E70A 3S9DB 2HUEA 3TWCH 4U1SB 1KYFA 3EJCA 1SN5A 3HB3C 3VU2A 1KZYA 4PREB 4QTFA 4MMZB 4JVWA 4KKRA 4Y4KB 3BZ4A 3NH7H 3BDXA 5IOPA 1Q1JL 2X6BA 3DYOA 3TN0A 2NTSP 5HSFA 1AHWB 5T1MA 1GPOL 4A39A 2DQCL 5C7XH 1AI1H 4PP2B 1FAKT 4MGXA 3TXAA 2FBRA 1ZXKA 2VC2L 4ZTPL 4L29B 1NAKL 4F20A 1MZYA 1AANA 3E9UA 3SPGA 3QR0A 2QR0A 3V6FB 5DYOA 4ZMNA 2CMRH 4Z7QE 3P77B 4BGDA 5CCHE 3KPSE 5D7KE 1C1EH 5GGRA 4BQBA 4BRJA 2K7PA 3O4LB 4UYQA 4AE1A 3JWOL 1CXLA 3V4UH 2VITA 4BCYA 1CFNB 5INDB 1FNLA 4BKTC 4ZMPA 3FT2B 2OR9H 5EU3A 3C8KB 4AZ8A 4HXBL 1ZK5A 4PRHE 1KYDA 2F54E 1WC7B 4XC3L 1WBXA 4CU7A 2KLTA 2RCSH 3G08A 3UACA 1A5FH 3N1GC 2Z4TA 3VRJA 2X4UB 4YVNA 1A7NH 1IAKA 1J88A 3KDMA 4WHYG 5D1XA 4ZFZA 3VRIB 5T3XE 1U3HA 4R5TA 2XZAH 4V1DE 4M1DH 2DJ4A 3C12A 3DJTA 5IVNA 1KEMH 1QHQA 1KIQB 2RQEA 4K94H 1U8KB 3QUZB 2HT2D 2NNAB 5K1JA 4DEUA 3LZQA 3VYOA 3FAXA 1URIA 3O2DA 4XN7A 4NKQB 5SWSB 3ATDA 3ERXA 3IDGB 5GJTL 3D25A 4TS6A 1RK0A 5GQBA 1UJ3A 3R7QA 4HV8B 4FERA 3FTXA 5E6IC 4K2UH 3BWSA 5KSBE 1WFUA 3C6SB 1WYJA 2J1YA 2KZKA 4KKLD 4GRWE 4JZOB 3ZIMA 4C54A 4BFIA 1VKXA 3NJGA 4JCWA 5D72H 2OMXB 2NR6D 5DS2A 5L6YL 1B9KA 4ZO8A 1SVZA 3AGWA 4FXKA 1R5VA 2QEJA 1QRND 1YEEH 5HBBA 1QLRB 4O5LH 3QG7L 3QIUC 4I18A 5BS0B 3BWAA 3PWLB 1QZNA 4Y4KD 4C56D 5CU9A 5HYJB 4Y19E 1I7UB 1OHQA 3R06B 5LCVH 4U1IB 4FQPA 1M71A 3SE9L 1IVTA 2JB6A 3M1BB 2NX5D 1UCTA 4RNRB 3DIDA 5JIQA 2GKIA 1QPXA 2CLRB 3MKKA 3ELAT 3WU1A 1XSOA 4L0PB 1RZ8A 5I1DB 4P4RA 4EZLA 3KR3L 4Z8FL 1S7UB 2BNRA 3LHPL 3BKCL 1TTGA 4RFEB 1EK3A 1MWAH 1UWXK 2OCCB 2VLJA 4ZUTB 4DPAX 4GG8A 2VDOB 1GA2A 2BP8A 3QUXA 2GIXA 4PLOB 1JZ3A 2AKRB 1WFMA 2AK4D 3V6OA 2FIRT 3G6JB 3SOBL 2FHCA 4NDMB 1NAMA 5DJCB 4A7GF 3ILQC 4MNHA 4K71B 3WFZA 5ALBH 1XB3A 3VFWA 3ZDXB 1P4IL 2ED7A 4J3SA 4BXSV 4PJDF 1XR8B 3QDGB 5DJAB 5DJYB 1UEYA 5KS9A 4B0MM 5MEND 2KL6A 1CLVA 4KK5C 3LDBB 4ZPTA 4R97C 4ELMF 4K8RH 2BIHA 2GSGB 4UAOB 4AM0Q 5HPMB 3QJHB 4OZHA 5EOQL 4MJ2A 3U4KA 1LNUB 1ORQA 2Q76B 5SWSD 2E0PA 3DBXA 3KWUA 1F5WA 1N10A 4KXBA 1T6BX 3AM8A 3GMMA 1CS6A 2NXYC 3PREA 2DIJA 1SJHA 2K4WA 2EYTA 3FZUC 1U4FA 2F74B 2P80A 1SOXA 3FKUS 2YUXA 1F00I 1ZCRA 1OAJA 4AT6A 4LAJH 3SYCA 4AENA 3LZRA 2VR6A 4LQ1A 3FF7A 5INCB 1TJGL 5AB1A 4WK4B 1NFDB 5E99H 5BS0D 1KIUA 3ARFB 2A9AA 4H8WL 1UH3A 1F4HA 3QZMA 4M7LT 3ILPB 2IWKA 5HYSA 4QOKB 4Y1AE 3IPEA 3C75A 4O51A 4B95C 1WJ3A 1BEYL 5JO5A 2JKLA 5D7JB 3UTPE 3PJSB 4F92B 4PJXB 3HZKB 3WKML 2W07A 1JV2A 3RFZA 4XMLH 5DZPA 3MTRA 2Q8AH 3Q9QA 5GIRA 3KM2A 3QCTH 4JQXC 2B3IA 5EB9A 3L16A 1TIUA 3RBGA 1Y7VA 2EXWC 1HHJA 2OX5A 5DD3H 3EZJB 1IVLA 3U1PA 1UQSA 4JGNA 1COBA 1FVEB 5HJBA 3U25A 4XBEL 4BFKA 3NJMA 4MA3A 5H8DA 3VX1A 2NY3D 1QBAA 3H9HA 3RWHA 2V2WA 4XHQA 1BXXA 5IV2B 2J5LC 2ZXDA 4I48B 2IAAC 4B5ZA 4EUPB 4I13B 1FJ1B 3HAEA 3MNWB 4W9HC 4HUXB 3RA7L 3MGOA 4JFHD 5SX5H 4DGVH 4LOEA 3CXHK 3IU4L 5F72S 3U9WA 3V9EA 1OAXH 5I6XB 3CXDH 3EJSA 3BCFA 3CVIL 3HMWH 2ED8A 1CTOA 4YAQB 4B9FA 4Z0BL 3DJRA 4DZBA 1RUKH 1IKNA 4NT6A 5D1QB 2W95A 2AZUA 4K8RD 3TO2A 2FX9L 3PP4L 1CGYA 1E4WH 4E9RA 1GZHA 5I8OL 2J8OA 1M1SA 4XAKD 4Y1SA 1NC2A 3T65B 3TBVB 2H45A 4HISA 3P02A 1OOWA 2KUTA 3QZWG 4OF5A 2XWBA 5IZ7A 1WA0X 1EDHA 4ZMWA 4QYOB 5L4MA 1ZT4A 2ADIA 1HKFA 3MBED 5LBSL 3LVEA 4XWGL 1BAWA 1EBAA 3CVHH 5IM7B 5FYLE 2X3BA 4I3RH 2D7TH 4I1RA 1QWNA 2F7QA 3ARFD 4MAYA 3MBWB 5CSBA 4M43L 4DGYH 1SJVA 4DSYA 1RQ5A 3QAQA 4JKWA 4F7PA 2E59A 3AMLA 5I0WA 2P7TB 3H9SA 2D3VA 4H26A 5IJDC 2FQGA 5FUZL 4DP7X 2VCOA 3ZXAC 5C09A 4ZX6A 3CZJA 4YO0A 1TYEB 1DFXA 1I1AB 4OJFL 1CK0H 2XJKA 2V37A 2GK0A 4U2ZA 5D7SL 2CJSA 2FLBT 3D39B 3GJFK 3UEZA 2CHZA 1DQLL 5JMRA 3DX9B 3EOTL 5E08H 3ZT7A 1Z9NA 4A2EA 3N50A 2A9MH 4LXFA 2ADFH 4JHBA 2AXFA 5A3ID 3HLKA 1T1XB 2DIBA 2LQRA 2WGNB 4F3FB 1SBSH 2JKJA 2MTAA 3GJFB 4AQ8C 2EH7L 1IZJA 2D03L 2MQCA 2XVKA 2NPLX 3MNZA 4U4BA 4M5YL 2CQVA 5DD5L 3CX5J 2W65B 1K3IA 1IT9H 3DHPA 4GRLB 3S98A 3WXWL 4Z3EA 2H9GB 2HTLC 4PJGA 4BFRA 3MXWL 4R7XA 3OMIB 1FLRH 2IH8A 1IGFL 4MRCA 3U36B 4YC2C 3LNGA 3VI3A 4MASA 3EDDA 1SFHA 1YVLA 5D1QD 5LG6A 5BUPA 2YA0A 3THMH 3QDMA 3O3UN 4X4ZA 5C0CB 2BNUA 3ARBC 1DTUA 4LSRL 2P48B 5H37G 4HALA 5T3XL 2GTWA 3EYFA 3FFCA 4OCRH 4AGPA 4W68A 1SLWA 1AIZA 2YZ1A 4MMYA 4XO8A 3KLHD 4HETA 1PSKH 3HCVB 3MRNA 2VLLA 2NW2A 2VXQL 1TVBB 1UCBH 2IXQA 4ZSOA 3R1GL 4UIMB 3V4VL 3RZCD 3CPLB 3QCVH 3V9CA 3IJEB 1HDMB 1JRHH 3L3GA 3U7YL 3DRTB 5BVJB 4C59B 4WO4B 1P7BA 2GJRA 4RRPG 3M17A 1S5IH 1L3NA 5LLIC 4PJCF 3B3IB 3BW9B 4W9FC 4YHNB 4BWWA 2DRUA 4ZUUA 4HWZA 4OSUH 4MMXC 4BINA 3BEVA 4YHMH 4N6RB 5I6PA 1S3KH 3L5XH 5I1CH 2HPOA 1TZHA 4DQOL 3PWVA 1L5GB 1B6UA 5DTFB 4P3CH 5E6IB 3D09A 4CRPA 1LVEA 2QKIA 2WQUA 1SLVA 4OI7A 1GW0A 1PLAA 5FO9B 3Q7JA 4HH8A 3UO1L 1WAAA 2ZF9A 1XB8A 2Y5EA 1RMFL 5IFJA 4BDVB 5ESQA 4FYTA 1FHNA 4LF3A 4I5BB 1EGJH 1ZT7A 4QJ3B 4Q2ZA 3LYRA 3QIUB 2NUTA 5J6GB 4XVOA 1GHFL 4G6JL 1BP3B 3H54A 1IAIH 4AXWB 5L8LB 4GRLD 2VDLB 1F4WH 1PAMA 4N0RA 1G6RH 1BQUA 3UJTL 4HHWA 4D8PB 4EI6A 2WYTA 2DIAA 4P99A 1SEBB 4JB9L 3EFFB 3L13A 7FABH 2PPDA 3J27A 3S6CA 4JDEB 2YJLA 4PLKC 4CADB 1KTJA 3OZLA 3MCYA 2LVCA 4LNRA 1NC4A 5ABZA 2GFBB 1INQB 4U1HA 2EC9U 3MOQA 4Y9GA 5D7LA 5GGSA 4RIRA 4MJIE 5C0CD 2EE0A 4YDNA 5FA4B 1J1XL 1KCVH 4Q9BA 3SYAA 1E2VA 43C9B 2RMNA 1PTZA 1ZJBA 2A9NH 5AOLA 1QUPA 3HC4L 4OAWA 4WI0A 1GGCH 3Q2LA 3T6WA 3ZDZF 1HILB 1HOCB 1HE7A 4UOW1 5EEWA 5AW2B 2R4SL 3FTYA 5AW4B 1MVUB 4EOWL 3DYPA 1XF5B 4OIIL 2E56A 4WO4D 1X9LA 2FO8A 3ESVF 4DN3H 1IGJB 4JN1H 4RAVA 4U0QB