2A6DA

Crystal structure analysis of the anti-arsonate germline antibody 36-65 in complex with a phage display derived dodecapeptide rlliadppspre
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
214
structure length
214
Chain Sequence
b'DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Germline antibody 36-65 Fab light chain
publication title Differential epitope positioning within the germline antibody paratope enhances promiscuity in the primary immune response.
pubmed doi rcsb
molecule tags Immune system
total genus 52
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2005-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6dA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6dA01
2AEIT 3BGMB 4JJHA 4MA1C 1V7ML 3D2UD 5LWYH 1T7YA 4U6VH 3DX9A 1NEUA 4X6FB 4OD2B 2B2XH 4P9MH 4NWTH 4MD0A 1BECA 2PF6A 3DRQA 2VQ1A 3BD5A 5J3HC 4HWEL 4HS6B 1T83A 3MJ6A 2ZJSL 4M7ZB 4K94H 1XCTB 4D9RD 1KN2L 4AIZA 3QCTH 1KYOJ 1FBIH 4N0UA 2X4NB 3ES6B 4F9PC 4HUMB 1NLBH 4RQQB 2BRRL 1IGYB 2B1HH 5F88A 2CO7B 1UVQA 4N8CL 3OR6B 4PJGF 2JB6A 5DUML 4JVPA 1R6VA 2IAMB 1FNEB 3GGWA 4OAWA 2N4IA 4OZGF 4DTGH 4M61B 1IILE 3BHBA 4WWKC 5MEOA 5HHVL 2EIZA 3KYAA 1SJEB 3MA7A 4JO1L 4BFIB 3SDAB 5AYUH 5EBWA 5DWUL 3V5HA 2YSSB 3ILPA 3M17B 3QFDB 4M8QA 3ARUA 2C9AA 4K7PX 3CH1B 3D1MC 2CKBH 4ZS7L 1YYLH 1NGQH 4KXZI 4YC2B 3WMSA 3NOIA 5FHBL 4X5XB 5FYKE 2VAAB 4DEPB 1L4IA 2ESVA 1L7IL 2X1OA 1S3KH 3LPGA 1Y18A 4KTEL 3ULUE 3VWKB 3DMMB 1T2XA 3CXDL 3WL9A 2C1PA 1NCBH 5SWSB 2I5YH 4XP6L 2XIDA 4FQLH 3O2DL 4I77H 4XVSL 2YD1A 3WS6A 2R1XB 3JTTA 4Q74A 4GBXA 3CZFB 3C60A 2EE6A 4UDTA 5DQJA 1A22B 3FN0H 2CUIA 1U8QA 3CVIL 3MFGB 4HPOH 3WFBL 4PREB 3WFCL 3QIBD 4XNXL 3KPPA 2EKJA 4M5ZH 2C5DC 3OKMB 1RUKL 5FA3B 4D9QD 1J86A 4C54A 3DUSA 1KLFA 4Y2DB 1ZHKB 4Z7WB 2X4SB 1XF1A 3G08A 5EBGA 1N6UA 2DKUA 2R23A 1G7QA 4QXUH 1JYXA 1A1NB 4IMLA 1RJZB 4OFVA 4PJ7B 25C8H 2DQFA 1VFAA 4DQOL 1U3ZA 1JZ7A 2CUMA 4PJ9C 4U1GC 4CMHB 5CEXB 3G5ZB 5MERB 1KB5H 5I66A 4HDIB 3BPCA 4P5TD 5J6HB 4RZCB 3LEVL 4DUWA 3TFKC 4XNZC 5I19L 4Z9KB 1MVUA 1XR9B 3RIFK 4E41E 1JZ8A 4LVHB 5HGBA 5CZXC 4OIBA 2WQ8A 4N1CA 3HS0A 4OM0L 2BMKB 5I1AB 1VCAA 2Q87A 5I75B 2BY0A 1BZ7B 2A1WH 1JUFA 1S9WA 3BPLB 5KZCB 4C55A 3ULVC 4R90L 1EHXA 3Q48A 1BLNB 1PEZA 2ADFH 5INDA 5D7JD 2VLJA 4YFEA 2IWGA 2HVJA 2NXZC 2DTSA 4L3EB 1FVCA 1KIQB 1BFTA 2QSCL 2YKLL 1G7LA 3SGEH 5BO1H 4KGLA 4A6YB 1R3JA 3MO1A 1DBJH 2HRPL 4TNVF 4BQ8A 4JFFE 3K4ZA 1OSPL 1RZJC 1KSRA 3C08H 3BKCH 4OSUL 4JE4B 1OTTD 3EJYC 3RNKB 1ND0A 3QI9B 1G6RL 3MRFA 2CGRL 4UTAL 1ZA3B 5J1TC 1DBKL 3V5KB 4UOW0 3IETB 5IMMA 1CICC 1LEGA 1O7VA 3H3KA 4P0DA 4IEFB 1B6DA 5D7IB 3HR5B 4I18A 1P69B 4N9GA 2WBKA 3T65A 2P5ED 1MIEH 1QLFA 5JORA 1MQKH 2EXYD 4J23A 1EIBA 1P4LA 3V6OA 4AEHL 1UJ3C 1UC6A 2DQHL 3MNZA 4JO3H 1FO0B 2IANA 4RMUA 5DUBB 4LKXA 3FB8A 4U0RC 4NWUH 1LP9E 5JUEL 3VMOA 5ALCL 4NRXB 3RDTC 1T5XB 3KS0H 5EOCL 1DE4B 1XGRA 3HE7B 3RI5K 3KPRE 2H2SD 5C6TL 3WN5A 3GJFA 5HVHB 3LH2H 1G9ML 1U93B 2V7HA 4XP4H 4XZUB 2W92A 4YWGL 5JW5A 3SDDB 2H41A 5EIVA 3GRWL 1W72B 1VFBA 1INQA 4WVRA 5KS9E 1EMTH 4PJGA 4RFOH 1DANT 2IGFL 4WY7H 4U1JB 1MUJA 5IHLB 4OZGA 4H5SA 2QSTA 4MB3A 2D0FA 3IFPB 4PTTB 2B8OT 4LSPL 2EH7L 5H35A 2J6EH 4GG6E 1PKQA 1I9EA 1IAIH 3MLUL 3MLYH 1AXTH 4E9LA 2JJUA 4UT7L 1WZMA 3WNOA 3BP6A 4N0CC 2DWDB 3TNNB 4HK3J 4MNGA 3SEPA 1KELL 3CX2A 4JO2L 1KJVA 1RQ5A 3VFMB 4QWWC 3DECA 4H26B 3AREA 4HLZH 1VA9A 2VDNH 5FK9A 1ULVA 1HWHB 3ROOB 4X0KB 5L2KE 4ZUWA 4IIQA 2YN3A 5ACZB 4PJXA 4EN3C 4NFCA 3N85H 1PY4A 4Q6IC 3NZHH 4X6EB 1BVZA 1CFNB 3LV3B 4Z7VE 4MCZA 1X5IA 1I9JH 4KTDL 3BZ4B 2GTWA 1TQCC 3PP3H 3BP4B 4EQ3A 5CJBA 1HYSC 5CBEB 1D5XA 2HT3D 3IJSB 4H1LG 3NIDF 2CJUL 3VXNA 2NX5A 3FONB 3J8F7 5E2WH 1Z3GL 4L8BB 1U95B 1A7OL 4NM4H 4HW6A 4YNYA 1K4DB 2Z0BA 2NY0C 3KDMA 4Y19B 2AABL 1FFPB 5BS0A 1YEJL 2V5TA 4IOIA 5JOFB 3NIFE 1EH9A 3TVMC 4ZODA 4MA8H 3PDOB 2CXKA 1SVCP 4G6AC 1KBGH 3K80A 5C08A 2R2BB 5JW3H 3LDBB 1HHGA 2O5ZH 2DI7A 3O3AB 4YR6A 4FQQA 1OAQL 4E41D 5C1MB 1NGXA 3B9VA 2BHZA 1NMCB 1ZAGA 4OI7A 4PJDE 4PRBB 3CD4A 4CUCA 1PGRB 3DARA 3D18A 3SE9L 3ZKQD 4CVZA 2JJSA 4OTXL 3LS5H 3CFDA 4YBQD 5HHXL 2ZOKB 1I3UA 5AAWA 2NXYD 5HDBF 5I8CA 5GRJH 4X9BA 5F1IB 1CU4L 5F1KC 5HYJA 1MWAL 2MOVA 1WAAA 1YPZE 5DK0A 3OGOE 1E0OB 3MUHL 3B6SA 2E8YA 1B0GB 3HNVL 2AJXL 4P2RA 4AZ8A 3ARBB 4J3WA 3RY6C 4XXCA 1U58A 3RTQD 3DHMA 3I6LD 1OSZA 3LRGA 4GRLA 5F6HI 5J57B 1P4BL 4AK1A 4ZQKB 3E1F1 1DQJA 1HQRB 1SQ2N 1PZUB 2AKRA 5CWSA 4HUKB 4NN5B 1RZGB 1AP2B 4X8XA 3VFSA 4HCRL 4H0HB 3F6LA 4FFVC 4WHTA 5EZIH 4JG1H 3RWIB 3ULUC 2ZSVA 5JHDD 3R8BB 4JKPH 1I1CA 2HLAB 4OB5H 2EDWA 1HILB 4L8DB 3H0TA 2LFGA 2Y6SD 5IIEA 3N9GH 3QHZH 4I2XE 3WUWG 2DMCA 4NIKB 1FRGL 5FKAA 3ARDA 3SE4C 2AS5M 1T04B 2FX7H 1N6QH 3QUMA 2H2PD 4FQXB 4EI6A 1CS6A 1S5IL 1PG7L 4HG4K 5BZWB 3H9ZA 3QIWA 2EICA 4LLWA 4X4ZA 3HZMA 4O5LH 3MRJA 2Y25A 1CDCA 1KTRL 3FTGA 5L0QC 4O2FA 5E8NA 4KJPD 4U3HA 3C5ZB 3SE8L 3V6ZA 4GKSA 3QQNA 3RZCA 1RUPL 2KUTA 3RVVD 5K9OA 3BW9A 4EI5C 3IGAA 3LN4B 4WFFD 5EDXA 2HN7B 5F3HB 3F58H 3W81A 2VZUA 3TBWA 3KPLA 4NYLA 4YDKL 2XFXB 3A6OA 4GMSL 4Z7WF 4UB0H 4MNHA 2XTJD 1XR8B 4PGBA 2A6DB 4PJHF 1G7JB 1NBQA 4CN4A 1GGIL 3OF6D 4PJ7F 4L4VA 5AYQA 1T1YA 2Y36H 2ZUXA 5L2JB 3B5TA 1UXWB 4GAYB 3FZUD 3Q1SH 1KJ2A 4XB7A 4H8WC 5IR1B 4OI8A 2VDKL 3WIIH 3GSXB 5GRUH 1INEH 1DVFD 1XCQB 1NDGA 1I7ZB 4NFDA 2YUXA 4R3SB 4M4RA 4F37F 3P9LA 4PJ5A 1IMHC 1I7TA 2W38A 1GOFA 4G42A 4NRZA 4G8EA 2GSGA 1NQBA 4F57L 3PG2A 4LCUB 3L3HA 3NN8B 3GDBA 3ZTJG 2R1YA 4GW5A 4ZTPH 4O4YH 1G7MB 4U6HA 1A6UH 1XF4B 1ZEAH 3I9GH 4BQCA 4IRZL 3U0PA 3CLEH 1A5FL 1U8OB 2QQLH 3MOBL 5IESH 3TBVA 1IGTB 5I1CL 3QUXD 4C56E 5KSAC 1JPSL 3HAEG 4PRIA 3V4VH 4OFDA 4LSSH 3LKSA 4QRUA 5HGGS 5ADPL 5EU3B 4HMDA 4BFEA 1AQKL 5E2VH 4PJIB 4O51A 1FE8H 2HFFA 2FX8H 3QG7L 3RQ3A 3S34L 2G60H 2X4OA 2A73B 4K9EC 5C70A 1U92A 2LTQB 1J1XH 4KJYA 4RAVB 1JMXA 3BQUD 3MRIB 2I25N 3HE6C 1K5NA 4YFLF 4O9HH 1J18A 2W0LA 4JQVC 4RMQA 5I1DB 3CUPB 3PWUA 4XPFL 3TO2B 1IKNC 5EU4B 1AGDB 5BZDB 2R0LH 1ZHLB 2JIXA 2BSTA 5GIRA 2PYEB 2VE6B 4LCCC 5D7IF 3KLHC 2HG5B 1YEKL 2E27L 3EOAB 3BGMA 5C6WH 2QADB 4I9WD 4WTXA 4X6FA 4OD2A 1U6AH 3NGBC 4XAWL 5E9DB 1JF6A 3AFLA 1B4JH 1WISA 3Q5OA 1I9RL 2NY4D 1KLGB 5TE7L 4HS6A 1LK3L 1XCTA 5FCUH 1MCLA 3NTCL 4MA7L 2BNRE 1ROWA 1BFVH 5TGBB 2X4NA 3ES6A 4MQSB 1R5IA 1FYTB 2ERJC 4JPKL 2VDLL 4RQQA 1YMHB 1U91B 2VSDA 1IGYA 4FOMA 4XHJC 3H7BB 5KSBB 3OR6A 3VGBA 5D7LD 4HJGB 3SO3B 1F45A 3OG6B 3QDJB 2IAMA 3BIBX 1FNEA 2JB5H 3HI6H 4V2CB 1R0AL 4M61A 4HV8B 2UZIH 3TYFB 5JPMA 3HCVB 5CILH 1SJEA 4JKLA 2V2WB 1EO8L 3SDAA 4BFIA 4PY8J 4P23B 4KKAC 32C2B 4MXVE 1DBML 1UQSB 2YSSA 1U3HD 1DBBH 3E2HC 3M17A 3QFDA 5CJOH 3S98A 1KEML 3ULVH 3CIQA 3IAQA 3CH1A 2D4FA 1E4XI 2XRAH 2JJTA 4HK3N 2UVFA 1YNKL 4X5XA 2VAAA 4UIMB 2IQAB 1GZQB 3QNZB 4QHKI 1BQLL 4XP1H 3VWKA 1MREL 3DMMA 4Y5YC 2DD8L 3VXUB 2VL5B 5SWSA 4HXAH 2EC8A 1NBYB 4UIKL 4IS6B 3DO3A 3QO1B 3VG9C 2R1XA 1RZJH 2EDBA 3KG5A 3CZFA 4MNQD 2XN9B 3PDGA 2VSCA 4AEIH 4PREA 5J4MA 4PJAF 3THML 1BM3H 3OKMA 5KN5B 1YYML 3V6FB 5FA3A 3SO5A 4Y2DA 1ZHKA 2QHLA 4QRPB 4Z7WA 2X4SA 2W0KA 1KCLA 3T0EB 1FQ9C 4KRLB 4LOUC 1A1NA 1RJZA 4PJ7A 2IBZX 1WWWX 1YY8B 4LDLB 5KBNC 4XPHH 2ATPB 4YXLH 1HYRC 2B1AH 1IEAB 2IG2L 1WWCA 3NAAH 2Z9TA 5CEXA 3G5ZA 5MERA 1WFOA 5JA9A 4HDIA 4QCIB 3GM0A 1CFSB 1T22B 1S7UB 4D0CB 4RZCA 5J6HA 3JVGC 2DQUL 1YQ2A 2FIRT 1EK3A 2YPKB 1XR9A 5F6IC 3H9SE 2OR9H 4LEOB 1FPTH 5I1AA 2BMKA 4JREC 4LPWA 2XG5A 3V0WH 1CDBA 5IW1B 3JWOC 4YXHH 1BZ7A 1G9NC 3G5VB 2OTWA 1T7VA 4YUEH 1G7IB 3VXMD 4HFUL 1BLNA 2FIKB 4XMKL 4I0PD 5IFAL 1MCSA 2X70B 4OZIB 5DVMA 5ISZD 4I0CC 4L3EA 1KIQA 1SEQL 5T1DH 3LZFL 2AEWA 5GRYA 4GRWB 4A6YA 3MX0A 1BOGB 3Q3GB 4N0UE 4LVEA 1EVUA 1NEZG 3I2CL 2AEQH 2VN4A 4GH7B 1WEJH 1Y6MR 5IEKB 5E56A 3T2QA 5LWYL 3RNKA 3QI9A 4RMWA 4U6VL 3TT3H 1CWVA 4KK6C 2NY3C 3MUJA 2B2XL 1UWGH 5MEPB 5B38G 1ZA3A 3V5KA 2A6JB 5BCAA 3ARGB 2H6PB 4P9ML 4NWTL 3IETA 2BSED 5EZOH 3T1FB 1T1ZB 4PRDB 8FABB 2LVCA 4W81A 3IB4A 4K94L 3MRRB 5DFTA 3QCTL 5D7IA 2Z4QB 3HR5A 1FBIL 2PW2B 3IXAA 4KK5D 1NLBL 4Y4FC 2UYLB 4ZXBB 4LSVH 2B1HL 4I1NB 3RWDB 1U8KB 1DP0A 4M6NH 1FO0A 4IOFC 1MNUH 4XT1C 5DUBA 5BMFH 4ZUUA 4DTGL 4B50A 1YMME 5LGJB 2VDOH 5AYUL 4TRPL 3OV6A 1G6RA 4NRXA 1T5XA 4U7SA 1DE4A 5EG6C 3HE7A 5CSBA 4K3DL 4F80A 1T7WA 1U93A 4XI5D 1YYLL 1NGQL 3SDDA 1YDPB 1W72A 1A4KB 1S3KL 1RMFH 4PS4H 4KKBC 2C4FU 4U05A 4U1JA 3KHOA 1NCBL 2I5YL 4YIQB 3IFPA 5MENB 4FQLL 4PTTA 4I77L 3CX5K 4NQED 2HT2C 4JZJC 1JNNH 4OKVB 4KVNH 2NY2C 4UZGA 3FN0L 4HPOL 1F3DJ 3ROLB 2X6MA 2DWDA 3TNNA 4OF5A 4M5ZL 1I8MB 4MB5A 2AERT 4HULB 3VFMA 5GGVY 2ZUQC 2CDEB 4H26A 2A74A 2BVTA 5EU7E 3QPXL 4OQ1A 5T3XH 4RSVA 5DGRA 3ROOA 4X0KA 4QXUL 1Q8MA 5ACZA 3BPOC 25C8L 3OB0H 3H2WA 4OGYH 1VSCA 3CSBA 3LS4H 3T0BA 4X6EA 1CFNA 3LV3A 3HFMH 2FR4B 1MSPA 1BD2B 5CGYC 3BZ4A 1MCQA 1KB5L 1D5IH 3JUYA 3BP4A 4XVUD 5ERWB 1MRFH 2YR3A 5CBEA 3IJSA 3FONA 1H5BB 3FRPA 3FQRB 2H1PH 4L8BA 1U95A 4PJIF 1LEKB 3CDGB 2X1QA 4BA8A 5HBBA 1K4DA 1EX0A 5C07E 4J7RA 3MZTA 4Y19A 2A1WL 1KTLB 1FFPA 3FQXB 3TIEB 4CVXB 5I16B 3S36H 5JOFA 5C8JB 2F8XC 3PDOA 3D48R 2NZIA 3BDBA 2ADFL 3EJZD 2HJLB 1SJXA 1WICA 2R2BA 1WLHA 4NZJA 5SWZB 3C6LC 1U8PB 3O3AA 4HEPG 4H1LH 2W0PA 2GKIA 4YX2H 5EUOB 5BO1L 2ICWB 1OTUD 4PRBA 1OGAE 1DBJL 1HINH 4OD3H 3LB6D 1VERA 3QUZC 2NYYC 2EC9T 3IXTB 5F9WC 1F6FB 1KPVB 4N0FB 4ZYKB 4NCC1 1JZ2A 3C08L 3BKCL 4PPTA 2DLFH 4P48A 2V5MA 5BRZB 1HCVA 1SBSH 3RGVB 2ZOKA 1E4JA 1HNGA 1PY9A 2QSQA 3KR3H 1TFHA 1ZVHA 1UH3A 5F1IA 5IQ7L 1Q1JH 4G5ZH 1OPGH 3EYSH 4A2MA 1B0GA 3ARBA 3UROR 4WI5A 5HVWA 1M4KA 1MIEL 1U36A 1X6LA 1MQKL 1UCBH 4ZQKA 3QUYC 1HQRA 4S0SD 5C0ND 1YJDC 4NC1E 4RRPA 4OGAD 2EIBA 4JO3L 5C6PB 2Z31B 3DETD 2QQQA 1RZGA 5KSBF 1AP2A 3NFNB 4NQUA 4NWUL 4G6FB 5ABDE 2AJSH 2EZ0D 1PKQE 3RWIA 4ZD3H 3KYKH 4TVPL 3S6CA 2HLAA 1HILA 4L8DA 3MYJB 5I74B 2VN7A 3LH2L 2VLKE 3F65A 2OXHA 2LAAA 4XP4L 3IFLH 3VFRB 5IROC 2VB5A 3VW3H 1T04A 1EMTL 1F6LL 4RFOL 2Y23A 4M1GH 1U8JB 4FQXA 4WY7L 1A3LH 3NCCB 3BIKB 3KPMB 2FL5B 5BZWA 1DFBH 2IPTH 1HE7A 1ZT4B 3T0AA 2A6IB 3MV7E 3SDCC 3NPSB 1U0QA 2H32B 5AG8A 2J6EL 4Y16C 1IAIL 4B41A 3MLYL 3C5ZA 3E0GA 2BJMH 5D2NE 1AXTL 2Q8AL 4WFHE 4K9EH 4ZUTB 2HWZH 2FEDC 3LN4A 3RVXC 2HN7A 3LRSB 5E00B 2P8LB 5F3HA 1HHIB 4YDVA 1KPUB 2VDNL 4JZNB 4QGTA 1MHEB 1NLDH 2XFXA 5D1XC 4R0LC 3VI4E 3O6FD 5KJRH 3NIGF 1XR8A 3N85L 2A6DA 3NCJH 1MRCH 1G7JA 3NZHL 1XF2B 4X7SH 5L2JA 1MFEH 3ZDZF 1UXWA 4GAYA 2R8SH 3L7FB 3OSKA 5FYKU 1I9JL 1QA9B 5IR1A 4YHYC 2GHWB 4V1DB 1KULA 2XICA 3GSXA 2ZUSA 2Z8WC 3TEUA 1XCQA 4R3SA 1I7ZA 3KVQA 2A77H 1BBDH 2D31B 3RVUD 3MGOB 3GSNH 1GGCH 4PJCB 1V5JA 4LCUA 4R4FH 3NN8A 5E2WL 2AI0H 1T83C 4NM4L 3V9FA 3OB8A 1G7MA 1XF4A 1F4XH 1U42A 2IPUK 3N1FC 5HSFA 3CFKB 2OL3B 1U8OA 2MSPA 2W9LA 4Y4KD 4NO0D 4OV5B 1GC1C 4FQCH 4MA8L 4NQCD 1IGTA 4MXQC 1KBGL 3QB7C 3EYFB 3WLWD 5JW3L 2ILLA 3BKYH 3S36X 5DEGB 4LU5H 1QUNA 2VDMH 2O5ZL 2OI9B 3T2OA 3UTSD 1GJIA 4OZIF 2MTPA 3ARPA 3ZTJH 5EU3A 4P2RE 1NCTA 1LDPH 5FGCB 5F3BB 4PJIA 3MV8D 1PDKA 2FLBT 4K7PY 2FHFA 3R1GH 3B3IB 2E3VA 3T4AA 4GRWF 4QHMB 3LN5B 3LS5L 4XCNB 2G75B 4R2GD 1RJYB 3RU8H 4YDJB 3B2UD 3QXAB 4OKDA 1JHKH 2ZUYA 4IRJB 5GRJL 1U8IB 4RAVA 5L7XH 1ZK9A 4MSWB 3MRIA 5F1OB 2GCYB 2OR7A 3QJFB 4NM8H 1JV5B 2YBRB 3MJGX 5I1DA 3CUPA 1MCPH 4D3CH 3TO2A 4GBXC 3CDYA 5EU4A 1AGDA 3BGFC 1ORQB 3C60C 5BZDA 1ZHLA 4NQDD 4NBYB 2EDEA 2FDBP 2IMMA 2VE6A 2YXMA 2HG5A 3IDYC 3L3GB 3EOAA 4PRHE 1S78D 3AMKA 1W8OA 5JIPA 3W39B 1N2RB 1VHPA 4P2OD 2KL6A 2P42B 2DM7A 1BQHB 4DKDC 4XPGH 5CGMA 1QHPA 2J3SA 4FNLH 5E9DA 3RUGB 1DQDH 2HFTA 4KRMB 3DVNB 3OKNB 1X5JA 4JG1L 5EZIL 4DGVH 4JKPL 4OB5L 1KLGA 1T6VN 4M43H 1JGEB 3N9GL 3QHZL 1AQDB 4GXUN 5TGBA 1H3PH 1KTKE 2NXZD 2AW2A 1FYTA 2FX7L 1N6QL 1YMHA 2MKLC 4JGUA 1U91A 4QKXB 3MRLB 2NW3B 3H7BA 5KSBA 1EA9C 1NKRA 5EU6E 4HJGA 4WEUD 3QDJA 3SQBA 5EU7C 4O5LL 4HV8A 4S1SH 3TYFA 2P8MB 1JWSB 3HCVA 2V2WA 1UM4L 2UZXB 4P23A 4WUUD 32C2A 3RX7A 2D3VA 1UQSA 1G9NH 1JTTA 2HVKB 3MBEC 1YEEH 3F58L 2CRIA 4AENB 3E8UH 2PKDA 4OF7A 4UIMA 2IQAA 1JHTB 1GZQA 3MRGB 3QNZA 5IVOA 1A7BA 2M2DA 3FFCD 4UB0L 3MGTB 2BDNH 3VXUA 2VL5A 3RKDC 4POZD 5T3ZE 1NBYA 5GS0C 4IS6A 2P43B 3QO1A 2Y36L 3EBAA 4WI3A 1A7QH 3QPQC 1HHJB 3Q1SL 1UM5H 2XN9A 3ZKXB 3WIIL 5GRUL 1INEL 2BFVH 2X42A 5KN5A 4LARH 3V6FA 3G5YB 1O0VA 2ZPKH 4LCWB 3NIDE 4RDQF 4UV7H 2YK1H 4QRPA 1CF8H 5IHUH 5K59F 4ZTPL 1KXQE 2VJXA 5K33A 3T0EA 4O4YL 2P24B 1A6UL 1ZEAL 3ARFB 3ARWA 3GKZA 3I9GL 3LQAC 4HIHB 4QOKD 3VWJB 4Z7NF 3S3PA 3CLEL 4XVTH 2QQLL 3KPSB 2OJEB 4ETQB 1YY8A 5IESL 2Z93B 2ATPA 3V6OC 5E0QA 4B53A 1IEAA 1U41A 3VXRB 2B5IC 1QYGH 2NY5C 3QEQE 4FQHB 1RPQA 3V4VL 4ODBD 4MA1B 2QQNH 1ZWIB 4QCIA 4DK3A 1Q38A 1T22A 1S7UA 4D0CA 5E2VL 3D87B 5EUOF 2YPKA 1FE8L 3B2VH 3IKCB 2FX8L 4JHZA 4LEOA 4OUOA 2G60L 5IW1A 5HDBE 3FOMB 3G6JB 2FD6H 3G5VA 2WQRA 3G9AB 1G7IA 3X11B 3OB0K 2FIKA 4XWOC 4NC1C 1PD6A 3U46B 4DKEH 3D39B 3R06B 1TJGH 2GJ6B 4O9HL 4OZIA 3TWCH 5E8PB 2I27N 3FT4B 4PV9B 2R0LL 5DD0H 1TXKA 3PL6C 3Q3GA 1BOGA 4KZEH 2FHBA 4AMKH 1CIDA 5IEKA 3NCMA 3MRKB 5JXAH 1U6AL 3AREC 3PWNB 5MEPA 1XZ0B 2XZQH 1B4JL 2A6JA 2DI9A 4RFEB 1AR2A 3ARGA 3K46A 3IFOB 5EZJB 5AEAA 1GVIA 3T3MF 4CKVX 3UTTD 3T1FA 5JMOC 2WM0A 4KVCL 3BXNB 1T1ZA 4PRDA 1UADC 4HKJB 2W65B 1S9YB 8FABA 3T04D 2J88H 5FOJA 3B5HA 1DLFH 3MRRA 5EA0H 1R3HB 2YPLB 5FCUL 2Z4QA 1BFVL 5JLZB 5D2NC 4NN7B 2PW2A 4PTUB 1AO7A 2UYLA 4ZXBA 1X7QB 4G8GE 1M7DB 1N59B 5JQHC 3RWDA 1U8KA 4IJ3C 3QNXB 5C0CB 1F6AB 4GKNB 1NCAH 2JB5L 3HI6L 3T3PF 2UZIL 3FT3B 3NCYS 5LGJA 5CILL 1EJOH 1DUYB 1MHHB 4MS8D 4BZ2H 2APWA 1CZ8H 5IOPB 3WO4B 1I1AD 5EO0B 1DBBL 5CZVH 5CJOL 4BZ1H 5HDOA 4OCXH 1E4KC 2YEZB 3ULVL 4NBXB 4XBGB 2XRAL 1P53A 1YDPA 1EFXB 4FG6C 5T3XD 5DRXB 1A4KA 5KG9B 3SCMC 4PJ9B 4XP1L 2Q8BH 3QULB 4PJHE 3GO1H 4U1GB 4HXAL 4YIQA 3EYOB 3STBA 1SEBB 5MENA 1U3YA 3AY4A 5I1IH 1RZJL 4FFWC 5BOPA 2EDYA 3TIDB 4OKVA 1N5YH 3EDEA 1IGFH 3IF1B 3JV6B 4AQOA 4EZMA 4AEIL 4R4NC 3ROLA 1IRAY 5J11C 1I8MA 1BM3L 3RWEB 3OPZH 2HTLD 5LKNA 1MCRA 1BF2A 2CDEA 4LNVA 3QWOB 4L3AA 5KOVC 3C09B 4PJCF 2JTDA 2C26A 2J1KA 5T1LD 4P2QD 3VRJB 2GW5A 4GRLC 2OZ4H 4XPHL 1QKZL 4S0TD 1FZOB 3UX9B 2FR4A 4YXLL 3UTPE 4G9FB 4JFEB 2B1AL 4LSTH 4M3KB 1BD2A 1YJDH 4MVBD 3H9HB 3NAAL 1EAJA 1OB1B 1NC4B 3QQ3B 3VFGH 3VFVB 5IBUG 2BCKA 1T2QL 1VKXB 1TQBC 1H5BA 3FQRA 2OR9L 5HYEA 3CDGA 1FPTL 3V0WL 1CICB 3PWPD 4YXKH 5JTWA 4YXHL 1KTLA 3FQXA 1OARH 4JFDB 4YUEL 3TIEA 3ARDC 4CVXA 3IU3B 5I16A 1C08B 3ELAT 4BSJA 5C8JA 5C0AE 4WFED 2HJLA 4MD5B 1ACZA 5GSRB 5SWZA 1KCKA 1U8PA 3VGAC 1FIEA 5CD3B 5T1DL 3VD9A 3DXAD 5EUOA 4LAJH 2ICWA 5GZOC 1QSEE 3WNNA 4U0RB 1MAJA 3HPJB 4WFGE 2AEQL 1WEJL 3IXTA 1KPVA 4N0FA 4ONFH 4ZYKA 4GS7B 3F7RA 5CJXA 4W70A 3RDTB 5BRZA 3RGVA 3OKLB 3IT8D 3TT3L 1U8NA 5GRWA 1UWGL 2OJZH 2VLRB 3RUGF 5EZOL 3BSZH 4HJ0C 4FRWA 1NH6A 5TPWH 3PXHA 3QUMH 4KHXH 2DJSA 3MOQA 1IL1B 1JE6A 5I6XC 3OAZH 5B39B 2W9EH 4HLJA 4LSVL 4NNXB 1OW0A 1RZ7H 1WSST 4M6NL 1S7SB 2Z31A 2DTMH 1XGTB 1MNUL 1A14H 2O5YH 3NFNA 5BMFL 3VA2C 4GAFB 2R4RH 1CR9H 1D9KD 4WHDA 3TNMB 3GIZH 3M8OH 1YY9D 4P46C 3MYJA 5D7JB 4J6RH 2VLME 1HSBB 4EN3B 5LGHH 1HKLH 2F54E 2ED8A 3VFRA 5FV2A 4BJLA 1A6WH 1U8JA 1RMFL 4PS4L 3B9KC 3BIKA 4OD1H 1WVZA 3KPMA 2FL5A 1RURH 1ZT4A 3L5JA 1AR1C 2A6IA 1FORH 1TQCB 2H32A 4ISVB 2DAVA 1URLA 1S7RB 1GYAA 3RL2B 4CGTA 1FGVH 1JNNL 4ZMAT 4KVNL 4L4TB 2J2ZA 4PJAE 2XZCH 4RGOH 3VRIB 3QNYB 4ZUTA 2UV3A 3LRSA 5E00A 4R9HA 4CNIB 2P8LA 1HHIA 1KPUA 1M71B 3FAXA 4JZNA 1MHEA 3DUHA 5T3XL 3TVMB 3TT1H 5B3NA 4KK9D 1OAKH 2W91A 4O2CB 3PHOB 1BMGA 4N90E 4OGXH 4OGYL 1RZKC 3LS4L 4JN2B 5EBMB 2NZ9C 3L7FA 3NVQA 3GIVB 1QA9A 1K8DB 1MLCB 4V1DA 2BNQE 1D5IL 1G1CA 4N0RA 1MRFL 4N5UA 2D31A 4MQXC 3BGAA 3MGOA 1CFBA 4PJCA 1CL7H 4KGJA 2H1PL 4W4OA 1EGJA 3QFJE 4M7ZC 1CE1H 1T7XA 4WUKH 5DEFB 4XTRD 2OP4H 1N64H 3UTPD 3CFKA 2OL3A 3EDFA 4NP4H 1JF5A 4FZEH 5TDNB 4UBDD 3IDUA 4OV5A 3S36L 4LLQB 4KH2A 2EDTA 3EYFA 5ACLA 3VXTB 2MQCA 2BXZA 5DEGA 1MCJA 3IU4H 1J1OH 1WZ1H 3E3QE 4PJBE 4J3OC 1KLUB 4YX2L 1C8PA 3SDAC 3LMJH 5F3BA 5D1QC 4IRSD 1KB9J 1HINL 4OD3L 3MBXH 3B3IA 4QHMA 3LN5A 3RP1A 4J3UA 1I8LA 4MHHG 1WFNA 1DL7H 2DLFL 4XCNA 1SBSL 5EC1B 3P4MB 2SEBB 2G75A 2OMNA 3SGKC 1RJYA 2P46B 5FCSH 3QWRD 4YDJA 3QXAA 3KR3L 3V0VB 4MYWB 3X3GH 4IRJA 1N7MH 1U8IA 5AZEH 1Q1JL 5CP3A 5HI3C 5T5NF 4MSWA 3RZWA 3VWKC 3DMMC 1IM3B 2GCYA 5L88H 4G5ZL 3QJFA 5IWLA 1OPGL 5KVGH 3EYSL 1JV5A 2YBRA 2F53D 1XF5B 2IH1A 5GS0H 3BRDA 2EYSB 5TE6H 1ORQA 2P5WE 1UCBL 5L0QB 3L3GA 1OGTB 2EO9A 2R39A 3W39A 1N2RA 3O3DB 2DQGH 4YO0B 1BQHA 4Y2DC 3RUGA 4QEGA 4HZAA 4EI5B 2AJSL 4Q7DA 3DVNA 3OKNA 4CDHA 1NFKA 4ZD3L 4JRXD 3KYKL 4M9OA 3ZLQC 3QAZC 4XVJH 1JGEA 2UUDH 1E28B 4DZBB 4FHBD 1AQDA 3RPIB 2JCCE 3IFLL 2CR3A 3O4LD 3DBXB 3OXRB 4E41B 3VW3L 1FL3B 2FECI 4M1GL 4G7YH 3MRLA 1CDUA 2NW3A 1A3LL 4P3WA 1JI1A 2R29H 2IFFH 4WI2A 5IMLB 3H9YA 1DFBL 2IPTL 4KKLC 1O7SA 4LVHC 4L8SB 2P8MA 1JWSA 2XNAB 3GJFH 3PP4H 3WKMH 5DHVB 2FH8A 2BJML 5I75C 4A2LA 4K9EL 2F54D 3O8XD 2I9TB 2HVKA 5FUOH 2HWZL 3AM8A 3O3BB 3BYYA 3WKNA 4AENA 4JFFB 4APQD 1NLDL 3TH2T 5DEZA 1JHTA 3MRGA 4LL9A 3MGTA 5KJRL 3NCJL 5KSAB 1CBVH 1MRCL 4ZFGH 2X10A 3WHE0 2BRQA 1J05B 1KG0B 4X7SL 1MFEL 5GPRA 4WTWA 1HHJA 2R8SL 4LHUD 1BWWA 4FTVD 3QI9C 1T20B 4K3GA 1NANI 5L6YH 4Y4HC 2VZOA 1T03H 2A77L 5JHDB 4WEMB 1BBDL 3G5YA 1T4KB 3RAJH 4LCWA 3GSNL 4TTGA 1GGCL 1GGYA 4EOWH 4RGMB 4R4FL 2AI0L 1ZGLM 3QDME 2P24A 3ARFA 4KKCC 1F4XL 3ZE2F 4HIHA 3EHBD 3VWJA 3HE6B 1QBBA 3FAWA 3KPSA 2OJEA 4JPIB 2L7JA 4ETQA 1LP9B 3VFWB 3DVIA 3IDJB 2Z93A 4FQCL 2YD6A 2BNQD 4QXGH 5CKAA 3K8KA 1FP5A 3BKYL 5F7KC 4LCCB 4LU5L 3VXRA 3KPRB 4ZNEE 4FQHA 5FEBA 4BSWA 5IB3B 5B22A 3PQYD 1ZWIA 3QDHA 1LDPL 3NCYP 3RJDA 3NGBB 4HIXH 5BQ7B 2PYEE 3R1GL 1F3DH 3P73B 3IKCA 1RVFH 1KFAH 5GZNC 2VERN 3MYZA 1RK1B 1EO5A 1I1RA 4E5XB 3FOMA 3G6JA 3RU8L 3OX8B 1JHKL 3X11A 4GG6B 4L4JA 1I1FB 4ODTH 5L7XL 3O41B 4MJIE 3U46A 4F9PA 3D39A 3R06A 1U8LB 2GJ6A 4NM8L 4PYGA 2ERJB 3PIQB 4NUGH 3FQNB 1XGQB 4HPYH 1FJ1B 5E8PA 4DGYH 1MCPL 4D3CL 2YA0A 3MLPA 3FT4A 4PV9A 3O2WH 2Z8SA 4JAMB 2RB8A 1FZMB 3HG1E 3VD3A 4AH2B 4WWID 5L2KB 4RRPG 3MRKA 4C58B 4JZOB 1YEDB 4XPGL 3U48A 4QRTB 3E2HB 4FNLL 3PWNA 2APFA 1XZ0A 2BVYA 1DQDL 4RFEA 5DJAB 4HBQA 2BC4B 5EZJA 3IFOA 4DGVL 1Z0MA 5DGQA 1T89A 4AG4H 3BXNA 1BGXH 3HAEB 3DVFA 4HKJA 4M43L 1CGVA 2W65A 4TSCH 1S9YA 5CP7B 3RGHA 1R3HA 2WWMD 2YPLA 4I8DA 4Y5YB 5E2TH 2CK0H 5JLZA 1H3PL 3C5SB 5IBLC 3L3OB 2VNCA 1X7QA 3VG9B 3CLFH 2VDPH 1M7DA 1N59A 2ZNWA 5D7SH 3IAPA 5T1MB 3IS0X 4ZOAA 5C0CA 3QNXA 3VXSD 1LWRA 2NR6C 4GKNA 3BE1H 3FT3A 4S1SL 2ADGB 2XQYG 4OF0A 1DUYA 2QEJA 5KVMC 1ITCA 1X4YA 1MHHA 3AU1B 5IOPA 5EO0A 1G9NL 3PWVB 4U3XA 2YEZA 1YEEL 1O5DT 4PJDB 4PRPD 2DIJA 4XBGA 2J4WH 2RAMA 3LDBC 4KRPD 3E8UL 1EFXA 2IJ0C 1QPPA 5DRXA 2EIDA 4YHLH 3D85D 5KG9A 1ZOXA 3OAZK 2VQTA 4PJ9A 2BDNL 1NMCC 3QULA 3GMRB 5A2KH 3DRTB 3EYOA 1SEBA 3VCLB 1NGYB 4X9HA 4TOYH 1A7QL 3X12B 5EWIH 2MKWA 3QDGD 2GSIB 1YPZB 3TIDA 3QO0B 1UM5L 3DHJA 3IF1A 3JV6A 3LHPH 4U6TA 5F6IB 1QOKA 2BFVL 1LGVA 2NY1D 3RWEA 4LARL 1QRNE 2ZPKL 4DKAA 4UV7L 3WDIA 2YK1L 3QWOA 4UILL 5INCB 3E3QC 1CF8L 5IHUL 4HGMA 4KI5D 3RIFF 3VRJA 3I50H 3PNWA 2Z8RA 3WFHB 2XY1A 3VFOB 5JW4N 1KJ2H 4XVTL 2ICWJ 4LLAA 4QRRD 3OL2A 1JBJA 5SWQB 2A83B 5HHOD 4M7KH 1CK0H 1HXMB 1FZOA 5DMJB 1R3LB 1JYNA 4G9FA 4JFEA 3LEYH 3H9HA 1QYGL 1OB1A 1NC4A 3QQ3A 4I2XB 2BERA 5I8KH 3VFVA 4GXUM 1KEGH 4IDLA 3IDMB 2QQNL 4OLVH 3TN0C 1VKXA 2NY3B 4GRWE 5AUMB 3B2VL 2WBJD 3O9WC 5HXMA 2D2OA 5F93C 2DWEB 4YPGA 1CICA 1QSFE 4LP4A 3ULUF 1OP3H 2FD6L 4JFDA 3V8OA 3IU3A 3KLDA 1C08A 3B5GA 3LPWA 4FQXC 4HWBA 1S5HB 4LAQH 4DKEL 4MD5A 1TJGL 3W0WD 5GSRA 2QHRH 3TWCL 5CD3A 4Y88A 3ILQD 3C5ZC 2FO1A 2ARWA 3UEZA 4KZEL 3VD4A 4I3GA 3KPOB 3HPJA 1BX2B 4NCC2 4AMKL 4XB8A 3UBXI 1ZLWH 4R4BB 3RDTA 5D2LE 5JXAL 3SBWC 3OKLA 3QQ9C 1MQ8A 3INUH 1BOYA 1UA6H 2XZQL 3TCXA 2ORBH 2VLRA 4Q6YA 3MCKB 4ACPA 3CPLB 5ICXB 3ZKND 2LAGB 4FFYH 3O81A 2J88L 4FXKB 4DN3H 4N1HB 1DLFL 5EA0L 3RI5F 1XIWD 1C7TA 4KZDH 1IL1A 4KKNA 2K7QA 3K4DA 4LCIH 5E6IC 2AAVA 1A9BB 4LSUH 3JXAA 4OFIA 1PFCA 2PTTB 3A6CH 2ZUVA 1PYWB 2NY2B 1S7SA 4L1HA 1XGTA 2VOTA 1SYSB 1NCAL 3M45A 2NPLX 5C92A 1EJOL 1SY6A 1SMOA 3QR2A 2ZUQB 3L7EB 4C56B 1FL5B 1CZ8L 4ZPVB 5DFWH 3TPUA 3TNMA 5CZVL 4BZ1L 5KVEH 4OCXL 5D7JA 2ESVD 4NGHH 2EE3A 1HSBA 4HXBH 1N26A 3BPOB 4EN3A 2IPKB 3WS3B 1NEZB 2VZ1A 2R9HC 4PGDB 4ZAKC 2C4XA 2AP2A 5DVNA 1OAXH 4RMTA 3C60D 2Q8BL 3GO1L 1UXSB 4M1CD 4OQTH 3S96B 3SKMB 4ISVA 4CMMB 4JFYB 5DC0A 5I1IL 1S7RA 4X4YB 3O45B 3RL2A 2QJDA 4CN1A 5EIIB 1N5YL 1IGFL 4L4TA 2VZVA 3VRIA 1IC1A 1UJTA 3QNYA 4XAKE 3OPZL 3BPNC 2HAZA 4CNIA 1OP5H 2R0WH 1VGEH 1CGWA 5E08H 1M71A 5K59E 4C57C 3TVMA 3IDIB 5CFHA 1BQUA 1CD9B 2EDHA 3MJ9A 3AAZB 2RFXB 4O2CA 5I18H 3PHOA 5B4MD 3U4EB 5T1KD 3C6LB 5IW6B 2OZ4L 4OCSH 4JN2A 2DMBA 4XWGH 4OCWH 5EBMA 1LP9F 4LSTL 3GIVA 1MFBH 1B90A 1YJDL 1K8DA 5EPMB 1MLCA 4M62H 1MAMH 3CFIC 3QUZB 4XCEB 2EDFA 2B20A 5F9WB 4OFYA 5GRVL 3VFGL 5I0DA 5I1JH 2BNRB 1IBGH 2IQ9H 2BVEA 1ZXQA 4LDEB 3W2DH 2CPCA 2YXFA 1JP5A 2P48B 3O6LH 3SN6N 4M7LT 4K71C 5DEFA 3CXDH 4YXKL 5M7QA 4WU5B 2VLJD 1BQSA 1OARL 5TDNA 2RGSA 4EXKA 4LLQA 5BW7C 4LRIC 3RY6A 1YN6B 4GG6F 3VXTA 2OR8A 1LEIB 1V05A 5DR5H 5C86A 5D1ZD 2C3GA 4DW2H 5DI8B 4WDIB 4F7MB 4LSQH 3QUYB 1FGNH 1UYWH 4NQXB 4RMRA 1KLUA 1NMBH 4UTBH 3T0WA 1R3KB 1JGLH 4N0YH 1T0NB 5DMGD 5DJZB 5LCVH 1KIPB 3KXFE 4ONFL 5DFVD 4LGRB 3QCUH 5EC1A 3X14B 2SEBA 3P4MA 2X2YA 2R2HB 5KSVB 4PGCB 4RISH 3V0VA 3M07A 4U6XB 3RBSA 2OJZL 1JGUH 4TSAH 3T3ME 3K81A 1F5WA 5FYJE 4KK8D 1IM3A 4K07A 1EV2E 3AUVA 3OG4B 4I13B 1P4IH 1AKJB 5GS1B 3BSZL 4A6YH 1XF5A 5TPWL 1G0XA 3QUML 4KHXL 2EYSA 1ZLVH 4G9DB 2IAND 1IAMA 2MPAH 2W9EL 3SDCB 1S8DB 4JGJA 2APTA 4Y16B 4G6JH 1OGTA 1RHHB 3O3DA 1NL0H 1RZ7L 3C8DA 4HZLB 2DTML 4YO0A 1F90H 2DQEH 1A14L 2O5YL 4ONGH 3T3PE 5B3JE 2R4RL 1CR9L 4EI5A 2A38A 2BVOB 3O0RH 1GXEA 3NIFF 1PG7W 1Q72H 1OQOA 4P3DB 3GIZL 3M8OL 2K9UA 2AK4E 5D1XB 5JNYB 2A2QT 1E28A 4J6RL 5EORH 3LVEA 4DZBA 3RPIA 5LGHL 1HKLL 5IFJB 2CRYA 1HN1A 3DBXA 3OXRA 1FO0H 3H9SB 4PJDF 3SGJA 4E41A 4YH6A 1D7FA 1A6WL 1FL3A 3CAFA 2GITB 1X5FA 2VZ3A 4OD1L 1QFOA 5BVPH 2MWCA 5IMLA 2DQCL 1RURL 3QYCA 2DQJH 1FORL 4L8SA 2XNAA 3RHWK 1FGVL 2X40A 2EDDA 5DHVA 2WLZA 1MVFA 4S1DD 1MJ8H 5A2IH 1YPZF 2XZCL 2AGJH 4Q58C 1ZVSB 1FNGB 1W72H 4ZNCD 2I9TA 3KPNB 1ZMYA 1WITA 3O3BA 1ZKAA 4J4PC 5CS7A 4Z8FH 4JFFA 4P4KD 3TT1L 1J7VR 4BH7B 5KW9L 1QP1A 5KSAA 4OGXL 3BVNB 5IJKC 4GXVH 4OZHE 5E7BA 1J05A 1KG0A 1Q94B 4XAKD 2QKIB 2DI8A 1T20A 3L5XH 4MJ2A 2C4FT 2NX5D 4NO2B 5E99H 5JHDA 2Y5TB 4RDQG 4M3JA 2MCPH 1T4KA 3UP1A 4Q9QH 2C1OB 1CL7L 5BS0D 1BF8A 2R69H 1MFCH 4CVWA 1Z9OA 4QRQB 4RMSA 3C9NB 1SJVA 4Z6AT 1CTNA 1CE1L 4WUKL 2IBBA 2J8HA 3HE6A 5C08D 2OP4L 1N64L 3KNBB 4JPIA 4NP4L 4FZEL 1YMMB 1LP9A 4JQVA 3VFWA 3IDJA 4I4WB 1WT5C 3WNLA 5AZ2H 3BGFB 5F96H 2HT4D 5F1NB 3ZDYE 4LCCA 4LLUB 4Z78B 3IU4L 3KPRA 1J1OL 1WZ1L 4EIGB 5LG1A 2GT9B 3N1QC 5CEZE 5IB3A 4M6MH 4OLUH 1UZ6E 2WWKO 3LMJL 3UC0H 3RY4A 3WCYA 2YUWA 5BQ7A 3MBXL 4JFXB 4Q9CA 3CDCA 2KPNA 3P73A 1X5AA 1BJ8A 1DL7L 2NMSA 1MI5E 2D0GA 3L95B 5HYJD 1NCDH 2GK2A 3E6HB 4E5XA 1GOGA 4M9PA 3OX8A 3PWJB 3O6FB 2XWTB 1N7ML 5AZEL 4GG6A 1I1FA 4F9LC 3WE6B 3L9RA 3Q0HA 5SV3A 5L88L 2B4CH 3M1BB 1U8LA 2HA1A 5KVGL 3JWDC 3PIQA 2DB8A 1ERNA 5DO2C 2ZUUA 1XGQA 3FQNA 3IS1X 1FJ1A 4NKOB 3U7YH 5GS0L 5TE6L 3KXFD 3V8CA 3A6BH 4JAMA 1OWWA 4K7FB 1FZMA 5EU5B 5DZNA 4AH2A 5I1LB 4TTDC 3R0MA 5L2KA 1B2WH 2DQGL 1UG9A 1QPXA 4JZOA 1YEDA 4QRTA 3QT2A 2I9LB 4OLEA 3FO2B 3MBEB 1FFRA 3EYQD 1OP3K 5DJAA 2N56A 2BC4A 3L6FB 4Y4KB 4NQCB 3HAEA 1E4XL 2ZSWB 4XVJL 5CP7A 3GUTB 1BPVA 3HMXA 3WXWH 2Y1VA 3W82A 3IJYB 4Y5YA 4U1MB 1BP3B 4PP1D 3N06B 4HWUA 3L3OA 3QIWD 1ADQA 3NA9H 5E94B 3S37H 4LIQH 4G7YL 3GSVA 1P1ZB 5GGTA 5LXGH 5C07B 3GBLA 4KJWC 2FJHB 2IFFL 2R29L 5T1MA 3SGDH 2E7HA 3RZCD 1NC2B 1H5BC 4KRNA 4WO4C 2ADGA 5GGVH 4JY6B 3PP4L 3WKML 5E8DH 4DAGH 1ZANH 1GCFA 4YHZH 3ZSTA 3AU1A 3PWVA 5FUOL 5DURD 1YEGH 3BKJH 4OV6F 4PJDA 1OGAB 1F97A 1QLRB 4PGZA 1MOEA 1G9EA 3EFDH 4KMTH 2ZP0T 1GGUA 4NQDB 4DJMA 4Y1AE 5F1SA 3LKPB 4I3SH 5I71C 3GMRA 3DRTA 1CBVL 4ZFGL 5BXFB 3DV4B 4P2OB 4Q97A 4U1IB 3VCLA 1NGYA 4PJ5D 3X12A 2FGWH 4NN6C 1IGJB 2GSIA 1ED3B 5CJXC 1SYVA 1YPZA 3QO0A 5E7FA 3O4OC 4B7LA 5L6YL 1T03L 3GSUB 3ZKMC 4Y2OA 3RAJL 4LK4A 4EOWL 1FNSH 5INCA 1WIOA 4RBPK 3VGGA 4XC1H 3BEVB 2PTVA 3UBXG 3VFOA 4DFIA 5DMYA 4KAQH 3MLRH 1YC7A 2A83A 4LLDB 1HXMA 4QXGL 1R3LA 2AJUH 3KWWB 5C0GB 4HWZB 3PL6B 1RSFA 2Z31C 4HKZB 1I3GH 4Z0BH 4OCNC 2DIAA 4I2XA 2VLKB 2FB4H 3IDMA 4TN9A 4ZPTB 4MGXA 2NY6B 4HIXL 3P30H 3EYUH 5ESVB 5AUMA 1OP5K 4JQXC 1WFUA 4DUVA 1RVFL 4MJ4A 2VZSA 1KFAL 5I74C 3UAJC 2DWEA 3WNMA 5DJ6B 2LQRA 3LSOB 4J3XA 3MV7B 4Y5XB 5K93A 1NSNH 1QTYT 3DGCR 3FFCB 3X13B 2DDQH 4UNVA 4ODTL 4DOHE 2PW1B 3LKRB 3TBYB 1S5HA 2ZG2A 5D2NB 3QXWA 4NUGL 1TVHB 4HPYL 4PJ8C 4DGYL 3O2WL 4X6CE 1JPST 4IJ3B 2FATH 5FYLE 4KFZC 3KPOA 3W11C 1BX2A 3V4PH 2VH5H 4MMZC 4R4BA 1VEOA 1BQHG 1LO2H 2VXVH 5DRWB 3I02B 1K4CB 3D3VE 2XPGB 1ZTXH 4N5ED 4F37K 5J7CC 1E6OH 3OWEA 3MCKA 4AG4L 2DL2A 4FQJH 3U7WH 3CPLA 5ICXA 1BGXL 4TSCL 4FXKA 3SCMB 5E2TL 3ZHKA 2CK0L 2IAMD 5BV7B 1A9BA 3CLFL 2VDPL 5CCKH 2PTTA 1BJMA 5D7SL 3S37X 1MY7A 4BK5A 1SYSA 3WFDH 3BE1L 3DGGB 4KMLB 4JDTH 4LASH 3C8KB 5D4QA 2XA3A 1FCCA 3L7EA 1P7QA 4C56A 1FL5A 4ZPVA 4NO5B 2ZG1A 2ATKB 3TYGH 3TA3B 3QA3B 2E7MA 2ITDB 2APBA 3HI5H 43CAB 2HJFB 1T66C 2IPKA 1R3IH 3WS3A 1NEZA 3B9DA 5TJWK 2YA2A 4PGDA 1EHNA 5KTEH 4KQ3H 4M00A 2EDJA 1C5CH 4JY5H 1UXSA 3FMGH 3S96A 4TOYL 3RX8A 3SKMA 4CMMA 4JFYA 5EWIL 4X4YA 3O45A 4Z77B 3ZDXF 2AXFB 1JI2A 5JOPD 5EIIA 3LHPL 4Y2DD 1V8HA 4JG0H 4RGNE 2EXWD 1FH5H 5J12C 1DTUA 1IJ9A 4NSKB 5IB5B 3EO0B 1SHMA 2JELH 1KGCE 2P7TB 2O26U 2FHCA 4PRHB 5D71H 4NZUH 3VDBA 5GISH 3GFUA 3IDIA 3ZE2E 2RFXA 3I50L 3FO9B 1QNZH 1KJ2L 2WP3T 5IW6A 3C6LA 5HPMB 3VGAB 4Q9RH 1D6EB 4M7KL 5GGQH 1CK0L 3ESVF 1FLTX 4QTIH 5F21B 4ZO6A 3LEYL 4K7PH 5H37G 3MRPB 5EPMA 2NQCA 1PVHA 5CIPB 3QUZA 4XCEA 5DVOA 15C8L 5I8KL 1KEGL 4OLVL 2BNRA 3SJVE 3C6SB 5F7LB 2XYCA 2FWOB 3CSPA 5KZCD 4FN0A 4D9QE 5EU6B 4F58H 2YD8A 5HVGB 4WU5A 1QFWH 2E8ZA 5TDPA 2BHYA 5HI4C 4L3ED 3D6GA 5CGTA 1CXKA 1OVZA 1YN6A 1VFMA 2GEEA 1LEIA 2HLFD 4G8IB 2QHRL 5DI8A 4WDIA 4F7MA 3QUYA 2GIYA 2Y4SA 4NQXA 3MV01 3FB7B 4ZTOH 35C8H 5ID0B 1R3KA 2EDLA 4H20H 1CD8A 2O61B 4OFPA 1T0NA 1CXHA 3TO4D 4XNUH 5DJZA 4K55A 1KIPA 4IHOB 3OGCB 3X14A 2YPVH 3PE9A 4M03A 2R2HA 3TLRA 4P46B 5KSVA 5DF0A 5T5NG 4PGCA 1UA6L 4U6XA 3TZVC 2ORBL 3WFZA 5FGSA 5GJSH 5L8LB 4YDIH 5GS1A 1AKJA 4GRWH 4FFYL 1GL4B 4KMQA 3WV0A 1C16B 3JZ7A 5IBUB 4DN3L 3B9KB 4GO6B 4KZDL 3GI8H 4JFOB 4MAYC 4CU7A 4G9DA 4LCIL 3T0XA 3WIHA 3AS3A 4KROC 1WBXB 5FGRA 3SDCA 1S8DA 5T5FH 4LSUL 4Y16A 2WAHA 3D3VD 3IRZA 5DMIH 5HYIA 5JW4M 1QFHA 3A6CL 1RHHA 2X09A 4HZLA 1JZ6A 3OKYA 4K8RH 3HE7D 2BVOA 1Q9LB 2F58H 5C2BH 4PYHA 4FA8A 2I26N 3VWJC 3SDDD 2OXGA 3EUUA 1AC6A 3QEQB 5KVEL 4F8QA 5D1XA 4R0LA 5JNYA 4NGHL 3AROA 2ZUWA 2W9DH 1G0DA 5H8DA 4HXBL 1CGYA 4JPVL 2MQ0A 2EYTB 3H9SA 4FABH 2H8PB 1OAXL 2GITA 2VLLB 3CZJA 3BZEB 2P5EE 1YQVH 1P7KB 4LF3B 3V79C 4DVBB 4OQTL 5GGSB 5ESAB 4HAFA 3MV9D 1OTSD 2OYPA 3H3BC 43C9B 2P8PB 1ZVSA 1FNGA 3KPNA 1RV6X 3QHTC 1WFTA 3MLWH 2R0WL 1VGEL 4X98B 4ZUVB 3RVWC 5E08L 12E8H 3JWDH 5E6YA 4UDUB 4KUCF 3QIUB 4BH7A 1QBMH 5I18L 3PXJA 4G43B 2ZNXA 5IBLD 2C3VB 1QO3B 2X4TB 5F72S 2D7TH 3AMLA 3BVNA 4OCSL 4XWGL 4OCWL 3GK8H 4RGND 3ZE0E 4OF8A 1Q94A 3SKNB 3RPKA 4TRPH 3KYMB 3W5MA 1WQVT 2QKIA 1MFBL 5CLWA 5D1QB 3DURB 1T0PB 4PLJD 1KGCD 4M62L 1MAML 1KTDB 1EDQA 2X4QB 4K3DH 5I1JL 2Y5TA 1D9KB 1IBGL 1UWEH 2IQ9L 1T89C 3X3FH 4Y19D 2C1OA 2E7LC 3W2DL 4G8GB 4KJQD 1CDGA 4QRQA 1ONQB 3C9NA 5I0ZA 3O6LL 5JZ7D 3KNBA 3OKOB 1G84A 4NN7C 2CO6B 1YMMA 3TJHC 4I4WA 3QDAA 4MJ5A 3LQZB 2EDQA 2PXYC 2XY2A 5F1NA 3RVTC 5DR5L 2VUOA 3SJVD 4LLUA 4Z78A 4TQEH 4DW2L 5LQBH 3ARSA 2VAJA 4LSQL 1ACYH 2GT9A 1FNHA 3SDXB 1FGNL 1UYWL 1NMBL 4UTBL 1JGLL 4N0YL 2EECA 3WO4C 3NPZB 4JFXA 3QPXH 4YEEA 1UWXK 5LCVL 3QCUL 3VI4F 2CLRB 2DLTA 4PJHB 1JZ3A 3L95A 3PWJA 4RISL 3QAZB 4NNYB 4JO4H 3O6FA 2XWTA 4TSAL 1JGUL 1ZHNB 5JQ6H 4JHBA 3WE6A 1PW3A 1BIIB 3ARBD 3FHQA 4ZUSB 1HWGB 3M1BA 4OZFG 1P4IL 1CE6B 3U83A 4A6YL 1IQWH 1RK0B 1EHAA 3MSPA 3STZB 5IW3A 3OXSB 4ZO7A 2KDGA 2EKSB 4AY0A 2DM3A 1M6OB 4K7FA 2MPAL 5B39G 5EU5A 2BXYA 1A02N 3UYOD 5I1LA 1MCIA 2JK5B 4G6JL 3WEXB 1MLBB 1NL0L 4PLKD 3KLSA 4JKWA 5JR1H 1UACH 1F90L 2DQEL 4ONGL 5I2IB 2I9LA 3FO2A 3MBEA 1HH9B 1VPOL 3C09C 5I1GH 3O0RL 4AIXA 3U6RB 1Q72L 3L6FA 4Y4KA 4O2EB 4NQCA 3BT2H 2ZSWA 3GUTA 4HUVB 5EORL 1MH5B 3TH4T 2YC1B 3IJYA 3MODH 3P77B 4U1MA 2A9MH 3QISA 1FO0L 3EYVB 4M4PA 4U1KB 5E94A 4D9LH 1P1ZA 4IRSB 5C07A 5F8QC 3I6LE 4Z18A 2FJHA 5BVPL 4Y4HB 2DQJL 4YHMH 4KPHH 1NC2A 2YD9A 5C0AB 4JY6A 5IQ7H 2YZ8A 2W0FB 3ALWA 1MJ8L 1I1YA 3WHE1 3HC3H 2AGJL 3CVHB 5HYSG 1W72L 4GJTB 3SKOB 5JHDE 2I07B 1QSEB 3SGEI 1OGAA 4L5FH 1QLRA 4Z8FL 5DVKA 3MLTB 4XMLH 4ALAH 2PUQT 3QXDB 4PGEB 4NQDA 4G80B 2H32H 1KCVH 5E4IA 3LKPA 4PUBH 4QGYA 4F2MB 5MHSD 2AXJA 3QIBC 5CLTA 5BXFA 3DV4A 4P2OA 4U1IA 4GXVL 3CMOH 3IYLW 1KB9K 4GS7C 1IGJA 4EDXB 4TVPH 3L5XL 2BVQB 1M7XA 4QNPE 5E99L 4JRXB 1A7PH 3GSUA 5AWNH 2MCPL 2HFGH 1JWUB 2GK0B 5FUZH 1D5MB 2Z8VC 3U1SH 2E6PA 4Q9QL 1H3GA 2R69L 1MFCL 4WFFE 3JTSB 3BEVA 4X6BB 2CDGB 3E6FB 4OJFH 1Z6JT 4XNYH 1RU9H 1Z9SA 1CVRA 2FZ3B 1EVTC 1IGCH 4LLDA 2XTJE 5AZ2L 5F96L 3KWWA 5C0GA 2YUVA 4HWZA 3PL6A 4HKZA 2Q8AH 3MRMB 5J8OA 4JM2D 3U7AA 4XHQA 1J87A 2VLKA 1QRKA 4S11A 4M6ML 4GMTH 1EGJH 4OLUL 4ZPTA 2F54B 4UNTA 3O8XB 2DYPB 1CDIA 1EPFA 3FKUS 3UC0L 2OL3H 4YBHA 5ESVA 3HPLB 5D7JC 2BP3A 4S10A 1FVEB 4LFHD 5DJ6A 1NCDL 3LSOA 5F70A 1ZA6A 5DUPH 3MV7A 4Y5XA 4GRMB 3FFCA 4QT5B 1DEEB 1NUGA 3K2UL 3X13A 3LIZH 1ZE3C 2PW1A 2LE9A 3LKRA 3TBYA 1IAII 2B4CL 5D2NA 4PJAB 5CBAB 1TVHA 4P4RB 4LHUB 3U7YL 1OTTC 1X44A 2J7LA 1IM9B 2CRZA 1FFOB 2QADD 2YA1A 3A6BL 1OF2B 3OKEB 3UYPA 4XP9H 5E9DD 1CXIA 4UNUA 1PQZB 1Z9MA 1B2WL 5CP3H 4QO1A 5K9QG 5DRWA 3I02A 1K4CA 1N0XH 2XPGA 2R2EB 1E4KA 4BUHA 5CEZH 4PJFE 1Z2KA 2BNQB 1FYTD 5SX5H 2XACC 3WXWL 3EGSB 2JF1A 3SCMA 4HIEB 1JGVH 1HH6A 5DJ2B 5C0IB 1W0YT 3DI3B 4YBLC 5ICZB 3NA9L 4JHAH 4EBQH 1LO3H 3QFJB 4NKMB 3S37L 4LIQL 5BJTB 3OR7B 5FYJU 3RWHB 5LXGL 2QQKH 4P23D 5IMOB 2H2SC 3HNTH 4HWNA 3DGGA 1MHPH 3P4NB 5GGVL 3C8KA 5E8DL 3BFOA 4RX4D 1ZANL 4DAGL 4I9WE 4WI8A 3ARZA 4YHZL 1JNHB 3S97C 5HGAB 2VMFA 3EZ8A 4PJBB 4NO5A 2ATKA 1HOCB 3FJTA 3TA3A 3QA3A 1EBAA 1YEGL 5J1AA 3BKJL 2ITDA 3MQIA 43CAA 3VXUD 2HJFA 3CFJB 3HUJE 3MRNB 3EFDL 1FVDB 4KMTL 4NPYB 1T6WA 1IEHA 4I3SL 3VJ6B 1L7TH 1JN6A 1BEYH 2XN9D 3GEWB 1AD0B 1EEZB 1U3JA 3TN0B 5D7LE 2FGWL 1HZHH 1BBJB 4Z77A 4HUWB 2AXFA 5C7XH 1MIMH 4QRPD 3O9WB 2WW8A 5KVDH 3T0ED 4NSKA 5IB5A 1F58H 2P5WB 5A16B 2P7TA 1FNSL 2HTKC 4PRHA 3ARRA 3HHRB 4XC1L 2PYFB 3RX5A 4I0KA 1ZLSH 3T09A 2XWBB 3FO9A 3SDYH 4W6XB 2DQTH 2B7DT 5HPMA 1OAYH 3FN9A 4KAQL 3MLRL 3V52H 1D6EA 3VI3E 1AIFB 2AJUL 4LRNH 4ODSH 1UM4H 5IFHH 1RAMA 1BAFH 3MRPA 5GGSY 1I3GL 1T80A 4Z0BL 4ZFOB 5BOZG 5CIPA 3C2AH 1CQKA 1A7NL 2FB4L 4MNQE 2JCCB 3VU2A 1B3JA 5HDLA 3C6SA 3SDXF 4ODUB 2D7OA 5CSZA 3P30L 2FWOA 3EYUL 3NFPB 1IAIM 5EU6A 1VFOA 2FYYB 4KRPB 1GHFH 4PRAB 2G5RA 1JK8B 1MY5A 3QSKB 1NSNL 5H37H 5IB4B 5HI5D 3SGJC 6FABH 4BQ6A 2DDQL 1S9VB 5F6HJ 3BESR 5E6IB 4G8IA 1TCMA 1IKFH 1A6AB 2CLVB 4L8SC 4HD9A 4M7LH 4YBQC 2ICCA 5ID0A 3FB7A 1KN4H 1V3MA 3MXVH 2FATL 2O61A 1SM3H 5D70H 4JVWA 3V4PL 2VH5L 4IHOA 3ARGD 3OGCA 4F7EB 1LO2L 2VXVL 4QRSB 4K8RD 4P46A 4LPVA 1ZLUH 1ZTXL 1LO0H 2EDNA 1L0YA 2F9BT 3RTQC 1E6OL 4LP5A 1H8SA 5C0EB 4FQJL 4QRRB 3U7WL 1MJJB 3VXME 4KY1H 1AO7D 4F8TA 4ZAKB 4ZXBD 4AL8H 1B9ZA 3CX5J 5E2UH 1C16A 1ZGLP 3Q6FB 3B9KA 4E0RB 1SJHB 4JFOA 2VUYA 1HNFA 3S3SA 5ISZE 1DBAH 4PR5B 1WBXA 3QDMB 4D8PB 3FO0H 1LNUB 5CCKL 4HUNB 4NOFA 4L9DA 3FN3A 3FQTB 1CDJA 2YRZA 1NMAH 3WFDL 2Y6SC 4RGMC 3DNKA 2IBGA 1FDLH 3DTXB 1EEUA 4JDTL 4LASL 1GSMA 1Q9LA 3BPNB 1CQYA 4JFZH 2H2PC 3QEQA 5FYLH 1WCBB 3TYGL 3MREB 4Z0XB 3HI5L 1R3IL 5MEND 2EYTA 4JRYD 3I6KB 3VDAA 3GB7B 4KJPC 4GLRH 3ZHDA 2H8PA 4XX1E 5KTEL 4KQ3L 2GTZB 4NHCH 5I1EH 2VLLA 3BZEA 3N1MC 2OX5A 3DX8B 1C5CL 2L0DA 4JY5L 3SKUD 3RVVC 2C3HA 1P7KA 1K8IB 4DVBA 3FMGL 1L0QA 1Q0XH 4MD0B 4MJIB 4NDMB 5GGSA 4TVSa 5ESAA 4HKBB 4KVCH 1J8HE 4BELD 1GZPB 4JG0L 43C9A 3ECBB 2P8PA 1FH5L 4JGMA 4K71B 4OBSA 2JELL 1MJ7H 3PGCB 2D4DA 4X98A 3HG1B 4ZUVA 5ID1B 5D71L 1XIWB 1OLLA 3UPRB 4FQ2H 4NZUL 5GISL 4UDUA 4XBEH 3QIUA 4G43A 1QNZL 1BD2D 2C3VA 1QO3A 2X4TA 3BO8B 4P5KB 1CTOA 3LEXB 3S9DB 4Q9RL 3LOWA 5GGQL 3G9VA 5HGHB 4QTIL 5F44A 3SKNA 4KJWD 3KYMA 1NAMB 4K7PL 3WFEH 2HMID 1A1OB 5D1QA 3DURA 4OQTA 4JM4H 1KTDA 4NQEE 2X4QA 1FNFA 1IVLA 5A3ID 4XPAH 1D9KA 1TJHH 2J12B 4PBWD 3SGKA 2F15A 3UTQB 4G8GA 2NTFB 1ONQA 3BAEH 4IOSD 3RIAF 4F58L 5JDJA 1QFWL 3OKOA 3MUZ1 2CH8A 4Z7QF 3V6BR 4JB9H 3FO1B 2H9GB 5IJVB 3LQZA 4CBPA 1ZGLB 5FO9B 1DSFH 3HRPA 2W07A 4GAGH 3WD5H 2RR3A 3SDXA 1JWMB 4ZTOL 35C8L 5BRZD 5JXEA 4H20L 3RGVD 3ZYOA 2ZZUT 1DUZB 1H3XA 2LVEA 1IARB 4XNUL 3U0TB 3BH9B 1J0YA 3BQUC 2CRMA 2CLRA 4PJHA 4HWBH 3BKMH 3OQ3B 4Q0XH 3RWJB 2YPVL 2D9QB 4RNRB 1L9MA 7CGTA 4NNYA 1X5HA 2A6KB 1QKZH 1ZHNA 2OM5A 1IAKB 4NHUB 5T1KB 1BIIA 4AM0B 5C0RH 4ZUSA 5TQ2H 5GJSL 4GFTB 4YDIL 1CE6A 2I24N 3EKCA 1RK0A 3STZA 1QRNB 1F02I 1T2QH 3OXSA 4DZ8B 1UKQA 3GI8L 2IEPA 1B0WA 2EKSA 1M6OA 4ZOEA 2YUZA 1P84J 4ONHB 3HS0B 5T5FL 4G6FD 5DMIL 1JCKA 1FYHB 3WEXA 1MLBA 4XNQB 2NY4C 4M5YH 2NY7H 5I2IA 4K8RL 1HH9A 3T1WA 2X4UB 2F58L 4GQ9H 3U6RA 4ZS6D 5C2BL 4AJ0A 4QHKJ 3UJJH 3UPAA 4O2EA 1JL8A 3BWAB 4C4KT 4PJBF 4HUVA 2W9DL 2UVEA 1HCFX 1MH5A 1ZT7B 5D1ZB 2YC1A 3G6DH 2AJZB 3P77A 3PP3K 4M7JH 2GYSA 3EYVA 2XA8H 4U1KA 5EB9A 4FABL 1A0QH 4X6DE 1Z5LB 5DJYB 4IRSA 3P0YH 1QSFB 1SY6H 1U3HC 1YQVL 2PO6D 4BH8B 4Y4HA 1CT8B 5C0BE 1HSAB 1PZ5B 2XXMB 5C0AA 1XGYH 3ZDXE 2GI7A 4JN1H 1JFQH 2DQDH 3QWRA 2Y07H 4TVPD 1JRHH 2W0FA 4TUKH 3CVHA 4WI9A 5I8OH 3SKOA 4N9GB 3BN9D 2I07A 1QSEA 3MLWL 5SX5K 3BDYH 1A1MB 3MLTA 3PJSB 2A0LD 3QXDA 3QZWB 1SMAA 12E8L 3JWDL 4PGEA 4E42B 4XX1G 4G80A 1QBML 5D2LB 4F2MA 2D7TL 4V1DD 3W5NA 1J8HD 2PR4H 1YC8A 1T3FB 3GK8L 4EDXA 2BZDA 2BVQA 5I9QB 3ZYJA 3HB3D 1CGSH 4JRXA 4F7PB 2EE2A 3EDJA 3MJ9H 1JWUA 2GK0A 1UWEL 4XZUA 3X3FL 1D5MA 2WNGA 2JCCF 1YNTB 1PX4A 4CADB 2E9WA 5JPNB 2CIIB 4HLZG 1VESA 3JTSA 3EW3B 4X6BA 1XFPA 3TH3T 2CDGA 3E6FA 4FMFA 4ZFZB 3MRDB 5DQ9B 2FZ3A 1MCKA 1RZIB 3MRBB 4ZOBA 2HFEB 5DD1H 1OAZH 4TQEL 5LQBL 3MRMA 2DKSA 4ZSOE 1ACYL 1UKTA 2YN5A 3P2TA 2F54A 3O8XA 2DYPA 4CJ1A 3HPLA 4IRJD 4BFGA 4PJXB 2ICES 3CXHK 1FVEA 4PB0H 1H8NA 4P4KB 2CXGA 4JO4L 4GRMA 4QT5A 1DEEA 3P3YA 4KI5F 5JQ6L 1RIHH 3FQUB 3KPQB 4OGZA 5FF6B 3FRUB 4ENED 4PJAA 3F5WB 5CBAA 1IQWL 4NQCE 4P4RA 5FYKH 4LHUA 1Y6KR 1IM9A 1FFOA 4N8PA 3ULUH 1OF2A 3UTSE 3OKEA 4IMKC 5DA0B 4DKFH 3O3UN 4WO4B 1PQZA 1ZT1B 3MV8E 5JR1L 1UACL 2ZWLT 3QRGH 5ELIA 3STLB 3TGXA 2R2EA 3MNWB 4LVNC 3ZMRA 1PX3A 5I1GL 5IB2B 4KK5C 3L3KB 2BOBB 4WRLA 3JV5A 4XBPB 2BNQA 3BT2L 5FFLA 1RULH 5F89B 3EGSA 5I71B 4HIEA 1YNLH 3MODL 2A9ML 5DJ2A 5C0IA 4W4NA 5DS8B 5ICZA 3QFJA 4NKMA 5BJTA 3OR7A 4D9LL 4NN6B 1N3NB 4NQDE 3RWHA 2XKSA 3QCVH 2CDFB 5IMOA 5EC2B 3O4OB 4EJ1C 5E8OB 4YHML 4KPHL 3P4NA 4XI5C 5EN2B 5F7UA 1JNHA 5HGAA 2MJWA 3HC3L 4PJBA 1HOCA 5F7FA 1C5BH 4L5FL 3CFJA 4PG2A 4H8WH 3HC0B 4XMLL 4NOBA 4ALAL 3MRNA 1FVDA 4NPYA 3KXFB 2O93L 4MZ2A 1OAUH 1KCVL 1WWBX 4L3CB 5C0BD 4PUBL 3VJ6A 1H15B 4K2UH 3GJEB 3I6GB 1RJCA 5DHVH 1AD0A 4LNRB 1EEZA 2FSEB 5J9PB 3CMOL 3N1PC 3TN0A 4HF5H 4LBEB 4NQVB 4ELKB 1BBJA 3DX6B 2HP4A 4HUWA 2PCPB 4LCWD 3BZDA 4PJEB 3BEWB 4QF1B 3BP7B 3O9WA 4R26H 1EAPB 1A7PL 2WUBH 3MCLH 4WUUE 5AWNL 2VIRB 3ARFD 2HFGL 1WJ3A 2KKQA 2P5WA 5FUZL 5A16A 3U1SL 2EDOA 3PGFH 4KDVA 5GS1C 4J3TA 2GJZB 4YHPB 2PYFA 1EERB 3DI2B 3VRLE 2GY7B 2XWBA 3U4BH 4XNYL 4OJFL 3WJLA 4F3FB 1RU9L 1PG7X 4X4MA 3VXRD 4PJ8B 1E4WH 4XVUC 1IGCL 3FFCE 3EDDA 5E5RB 3KGRA 3U30C 1AIFA 1ORSB 1MFAH 2AK4B 4X8JB 4ZFOA 1L6XA 4KDTC 2IH3B 4GMTL 1EGJL 2ARJQ 2JCCA 1MFNA 1SBBA 2KZ1B 1GIGH 1KJ3H 3SBWA 5J3HD 1V3JA 4ODUA 2OL3L 5DURB 3NFPA 4WTZA 4HFWB 1B88A 4BQ9A 1FG9C 1IE5A 2FYYA 4PRAA 2VXQH 3D39D 4WENB 3VDCA 2GJ6D 5DUPL 1N8ZB 5AG9A 5IB4A 2C7UB 2YD5A 4QOKE 3LIZL 1KT2B 1G6VK 1NGZB 1OTUC 3JWNC 1LO5B 1NDMB 5E6IA 3LB6C 3AGVA 4WWKD 1A6AA 2CLVA 3TJEH 5B21A 2H26B 3O6KH 5C0JB 4XP9L 1QEWB 3QH3B 3ZE1F 2VR5A 1DQLH 4JFHE 2M26A 4D0DB 5HHQB 1NFIB 3UBXB 4F7EA 4LPYA 2VR9A 1A64A 4QRSA 1ZV5A 3TBVB 1IAOB 4AT6B 3HLAB 1N0XL 4OZHB 4AQ1B 2AXGB 5CEZL 4QHLB 3DWTA 4PIRF 1LK2B 2YPLD 1I9IH 2M8XA 5C0EA 1A2YB 4QRRA 1MJJA 3DYMA 4U7KA 4EDWH 1ES0B 4ZAKA 2ENYA 1JHLH 1WZKA 4WGVB 5C0NC 3T8XB 4OGAC 4OLWH 3Q6FA 1JGVL 1H0DB 4E0RA 1SJHA 5FM4A 5C0CD 4PR5A 1BHGA 1U8HB 2EZ0C 4JHAL 3QDMA 4BZYA 1LO3L 4EBQL 4D8PA 1LNUA 2R15A 2V7NB 2QQKL 1U9KA 2A73A 2HH0L 3FQTA 1KNOB 3HNTL 1MHPL 3DTXA 5FHAH 5J12B 1D5ZB 3U36B 3HAEH 1FAIH 3H42H 4KHTH 3HMXH 4MXWH 4YDLC 3T4YB 4ZNEA 1NFDE 2YS4A 1EFXD 4N8VG 5SX4I 1ADQH 1WCBA 3MREA 4BYHA 1TDQA 3QXUA 3UTTE 5DHXB 4Z0XA 4PJ9D 5GGTH 1FNAA 2PYEA 3I6KA 2EDXA 3GB7A 1I7UB 3SQOH 4RAHA 1MI5B 1TJIH 5CD5C 4TNWK 2GTZA 1L7TL 1TZHB 3P0VH 1BEYL 3DX8A 5D2LF 3TFKD 1X6NA 4NUJB 1K8IA 3TPKA 5CZXD 3ARYA 1VACB 4MJIA 4NDMA 3B9AA 1HZHL 1NCWH 5C7XL 4HKBA 4P57B 4DUXA 1MIML 3G5XB 3G6AB 1GZPA 1N4XH 3CK0H 4KXZH 3UYRH 3ECBA 3ULVD 3O6FC 5KVDL 3RNQB 5I17B 1YA5A 2Z35B 1R5IB 1F58L 3PGCA 5D9SB 1Q9KB 4J12A 3HG1A 4HGKC 5ID1A 3UTZB 3UPRA 1XIWA 5BW7A 4MB4A 2V9RA 4LRIA 1ZLSL 2IPUG 3SDYL 4G9FD 4JFED 2DQTL 4TULH 4FMKA 5T3XE 5F7NC 3BO8A 4P5KA 3BD4A 5JPMB 3LEXA 4HIJB 3DIFB 4U1HB 1OAYL 1NC4D 1FN4B 3V52L 3RVUC 8CGTA 5HGHA 4LRNL 4ODSL 5C3LD 1CLCA 5IFHL 4L8CB 3EJYD 1NAMA 1A1OA 1BAFL 3EOYG 3JWOH 2QSVA 3C2AL 2JLLA 4Y4KC 1CICD 1FZJB 1MCEA 4JFDD 3UTQA 3VFPB 2NTFA 2IFGA 3TZVB 1IGMH 3WLWC 1IT9H 5DK2B 1GHFL 4WW1B 4PJXF 2XOTA 1RIUH 6FABL 3QRFM 4P2QE 3FO1A 2H9GA 5IJVA 4MAYB 1ZGLA 5FO9A 1ZVYA 4KROB 1CD1B 3GNMH 1IKFL 4Y5VC 3PGDB 4U0QB 4M7LL 1JWMA 4R2GC 1KN4L 3EAKA 3MXVL 3O6ML 3B2UC 3RDTD 4V2BA 1DUZA 2N1KA 4OT1H 4S1RH 4UILH 1SM3L 5D70L 3U0TA 1UZ8B 1QVOB 1MELA 4Y1AB 2ZCLH 3BH9A 2VLRD 2QTEA 4R97B 3RWJA 4KI1A 4RNRA 3PF2A 3UPCA 1LO0L 3R4DA 2A6KA 1DQMH 3PWPE 1IAKA 4NHUA 5T1KA 4AM0A 4NZDA 2MCG1 3W9DB 4KY1L 1S78C 3L3IB 3F12B 4AL8L 4P2OC 5E2UL 4YJZL 4WFEE 3IDNB 1MCCA 1QRNA 3REVB 4JFHD 4R7NB 4DZ8A 1CFSA 1DBAL 1YUHB 4O00A 4ONHA 2YMXH 4N0CD 4XMPH 3U82B 2DMKA 1U8MB 1EEYB 3FO0L 3DXAE 1UFUA 5GGUB 2XKNB 3OKKB 4XNQA 4F7CB 3ALXA 4QWWD 2OTWB 4TPRH 3CC5B 1BIHA 1NMAL 2C3XA 1FDLL 2P4AB 1QZ1A 5GJTH 1BZ9B 2X4UA 2CD0A 1AI1H 2V17H 4EN3D 4J4PA 1S7XB 1WAAF 1J12A 2X70A 4JFZL 3RHWF 1QR1B 5FYLL 3BWAA 4HH8A 1UEMA 4OLZH 3SPVB 5EUKB 1ZT7A 5D1ZA 2AJZA 3LKNB 3HI1B 4PFEA 1PLGH 5IJKA 1C7SA 1Z5LA 5DJYA 1KUMA 5I1EL 4NHCL 5EZLB 3TO4B 1HYSD 1QSFA 4J3SA 4BH8A 4L4TD 2NY6C 2FX9H 1CT8A 5C9JB 4DOHB 1MFDH 1Q0XL 1HSAA 1PZ5A 1JPFB 2H6PA 4C59B 1K85A 2NY0D 3HZYB 3VD7A 5CJ5A 1WTLA 1RIVH 4Y5XC 3TVMD 4NKIH 5IEHB 1WBYB 4PJEF 3D5OF 4G6AD 4X6CB 2J8UE 3IXAB 1TVBB 4POZC 2ZG3A 1MJ7L 1A1MA 3PJSA 3QZWA 4FQ2L 1WT5A 4E42A 4XBEL 1II4E 2PXYB 2E9BA 2BHUA 4WI4A 5D2LA 2AXHA 2YHGA 4ZUUB 3DROB 3D3VB 4Z7UE 2IADB 5B3JF 1KENH 3CSYB 1G6RB 1T3FA 2X1PA 2B0SH 4OFYD 4POYA 3HNSH 1C1EL 3VH8B 3WFEL 4JM4L 4ELMB 5E4EC 4F7PA 4XPAL 3NH7H 4ERSH 1TJHL 3SDXE 4G7VH 3SY0B 1WUNT 1YNTA 3ZSSA 4CADA 4Y8DC 5JPNA 2CIIA 3BAEL 3GMLB 4F9LA 1VFUA 2V6HA 1BFOB 4ZFZA 3B4NA 4XC3L 5TH2B 3MRDA 3VFNB 3HMWH 5DQ9A 3D2UB 1RZIA 4JB9L 5BV7C 3BWUC 2AEPH 4YZFE 3MRBA 1OHQA 2HFEA 3KYNB 1DSFL 3OJDB 5TQ0H 1Z9LA 3MLSH 5F97E 1TETH 5FYKD 4GAGL 3WD5L 5ITBH 3MV9B 4FFVD 3ULUD 1FSKC 1D3CA 2A74B 5ANME 5DT1H 1I8KB 3Q2CA 2PNDA 5FECB 3VXOB 3DUUB 3TA3C 5DD6B 4Q0XL 4HWBL 3BKML 2BSSB 2Y5EA 3T77B 2ZKHH 2GJJA 4J1UB 4P4KA 2HTKD 5DK3A 4OZHF 4WV1B 1QACA 2KH2B 5C0RL 3FQUA 1P5UA 3KPQA 5EOQH 3FRUA 5FF6A 5TQ2L 1HQ4B 2V5RA 1BVLB 3AS0A 1J88A 4MX7B 3F5WA 4XNMB 4RGNB 2BY1A 2YD7A 3DJ9A 3VG0H 5ERWA 2PTUA 2FBJH 4WI6A 4PB9H 3LQMA 2VABB 1UB5B 1MCHA 4EI5D 4WO4A 1LEKA 1VENA 1CVSC 1PSKH 4OCMC 4Y8AA 1WTGT 1ZT1A 2P47B 4M5YL 4XCCH 4U3CA 2NY7L 2ICEB 1EEQA 4OBRA 3STLA 1KYOK 3MNWA 4HC1A 5IB2A 3LD8B 4GQ9L 3T2NH 3L3KA 2BOBA 3UJJL 4XBPA 3ZDYF 4F15C 3F7VB 3CFCH 3WIHH 4UOW1 1FHGA 7FABH 1QFUH 5F89A 3SJVB 3G6DL 2UWEE 3QIBB 5I15H 4M7JL 1UZ6F 2F53E 5DS8A 2XA8L 1JNLH 3MLZH 1A0QL 4MS8C 1N3NA 1OOAA 5D5ME 3P0YL 1I1AC 1SY6L 5J13B 2CDFA 5EC2A 5ADOH 1CLOH 4WCYH 5E8OA 5HJ3B 2D9CA 1WCQA 4YK4B 5EN2A 1XGYL 2VDQH 3P9MB 4JN1L 4XGZB 1FC1A 1JFQL 2DQDL 2Y07L 2O5XH 1FV1B 5DJ0B 1JRHL 4TUKL 4OZFB 4JFFD 3K4AA 2V2TB 5MI0C 5I8OL 4JRXE 3EO9H 3Q6GH 3BDYL 5KSAD 2WIMA 1DZBA 3HC0A 4LSDA 4P5TB 3KXFA 4L3CA 1H15A 1AGEB 3O4LE 5EO1B 3GJEA 4X5LA 1KCSH 3I6GA 2X89A 3TBTB 4LNRA 3AB0B 2XWJB 2FSEA 5FIEA 2HTLC 2PR4L 1JTOA 5J9PA 5JDSB 1S7TB 2E7CA 4LBEA 4NQVA 4ELKA 3DX6A 2Y9RT 3DYOA 2PCPA 4OF3A 4PJEA 2BSRB 4JQXA 1MWAB 3BEWA 4QF1A 3BP7A 4WHCA 2J5LC 1CGSL 1EAPA 5EH1A 1GC1H 2OMBA 5A2LH 2VIRA 4NZTH 4PY7B 3MJ9L 2FEEL 4YLQT 3HE6D 1AHWC 1Y0LB 1B4RA 5J89A 5LGKA 2GJZA 1GAFH 2DM4A 4YHPA 1I4FB 5IVXE 4MVBC 3F6IA 2Q3AA 3FCTB 2YOCA 4JHWH 4F3FA 2DQCH 4Z7QE 1UKSA 2EIEA 3KPRD 3KLHD 1J0HA 4JQIH 4PJ8A 3ZL4H 2ED7A 5DD1L 1ORSA 3K74B 1OAZL 4WI7A 2AK4A 1SVZA 1QQDB 4X8JA 5HYSB 4PP2B 5DHYB 2VTFA 4MA3B 2IH3A 2J8OA 1F8TL 5DTFB 4FTVE 4YDVB 5D72L 3EOBB 3GMNB 2AJVH 4HFWA 1ZS8B 2P5EB 4PRNB 4PB0L 5KW9H 5FM5O 1KCRH 3QEUB 1T7ZA 1N8ZA 2C7UA 1XF2A 3HTLX 5CSGA 4JR9H 4XHJD 1KT2A 1NGZA 1RIHL 3MFFB 4EVNB 1LO5A 1NDMA 4YBLB 5FYKL 3QWQB 5L2KD 3ULSB 4LKCB 2H26A 4KKAD 3ULUL 5C0JA 2YRPA 1QEWA 1TCRB 3QH3A 4ZOCA 5ESQB 1VB9A 4DKFL 3PQYE 2RIKA 2HKHH 3EJJX 4D0DA 3IAGC 5HHQA 1VADB 3IFNH 1PKOA 1DJSA 4Y89A 1NFIA 3UBXA 4N68A 4QY8B 1XF3B 3QRGL 4N1EA <