2A6DA

Crystal structure analysis of the anti-arsonate germline antibody 36-65 in complex with a phage display derived dodecapeptide rlliadppspre
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Germline antibody 36-65 Fab light chain
publication title Differential epitope positioning within the germline antibody paratope enhances promiscuity in the primary immune response.
pubmed doi rcsb
molecule tags Immune system
total genus 52
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2005-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6dA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6dA01
1BEYH 4L3CA 5GGSB 3B9KB 3WLWD 3W5MA 4OLXL 5L2KD 2ADJA 3SE3A 2MKLC 4RMWA 4Y19E 3LB6D 5HPMB 2C4XA 1BREA 1Z9LA 4WU7A 5ABDE 1AHWB 2LV4A 4C83B 3MRCA 3K7UA 1HEZB 1Z9OA 1F5WA 3FFCA 4PLKC 1U91B 2J4WL 1T7WA 4DUVA 4TSCL 1KXQE 1LO3H 2VZVA 4GS7C 5ALCH 4BH8A 5E8OB 3MRQB 1P1ZA 2EKSA 4J7RA 4L3EB 2YPLE 3UTTD 1KJMB 1MF2L 1XGRB 4J3SA 4JKMA 2Y5EA 3MV9D 2VE6B 3FQXB 4NZUL 5C9JA 4XPBL 3WIHA 1MCWW 1UJ3C 1T04B 1RI8A 1WCQA 1MUJB 1XCTA 2PKDA 3L6FB 2FYYA 1NAMB 3NCYP 1KPUB 4R7NB 2NXZC 3RPIB 4LCYA 1KELH 4Y88A 1MLCB 4JFYB 5FYLE 4D0CA 3UO1H 4HPOL 1RZIB 3ECBA 1T1ZA 3ZTNH 3MRMB 1XR9A 1TZGL 4GAGL 5E6IA 5I1KL 1NFIA 3QQNA 1JHTB 2C3VA 5DQ9A 1GL4B 2XTJD 2P45B 4ACPA 3D25A 1HWGB 1G84A 3MXVH 3RDTB 4XMLL 3I3EA 4G8IA 2X4NA 2DLTA 2J2ZA 5DQJB 4LLUA 2ED9A 3JV6A 1RZJC 2G9HA 1TQBC 3GSRB 3EOBB 3ESVF 4YHOL 1W0VB 3NIFF 4UT9H 1MFCL 3FKUS 5GS3A 4NQXA 4I77L 3DPBA 1EDQA 3IU3A 4MCZA 1BQHG 5HHQA 1FIGH 5F7YC 1X7QB 4Y19D 3GSNB 4QRPB 2YD4A 4PREB 2YXFA 3KAAA 4PJHB 1M05B 2WW8A 5IB3B 5KSAB 5IMKA 3QNZB 5E1HB 1BVLB 4H1LA 5EZLB 5J11C 3DX8A 1YEGL 4K9EH 4HSQA 3SKJH 15C8L 5IROA 3WN5C 3MRRA 4KJYB 3CLEL 3D9AL 1BIIA 2GUOB 2QQLL 3DV4B 4U1IB 4DEPB 5TH2B 2X4PB 2X5PA 1KTLA 2YPLD 4IRJB 5D8JL 4JRXA 4M5ZH 1JPGB 2ZCKH 1DBAL 3QQ4B 3VXQA 2PTUA 4NUJB 1FL5B 4NKQB 4O02H 3RWIA 2P5EA 3MREA 4HUWB 5BW7A 4MB4A 5DJ6A 5H37H 4ZD3H 2XWJB 4OKDA 4R6UA 1KIUA 2DMCA 4X6CA 1AXSA 5FYLD 1NEZB 4PGCB 3MOBL 3BQUD 3LV3B 3O6MH 1M1SA 1OAUL 2WBJC 3VFMB 4Z7VB 3ZDXE 5C0IA 2M1KA 2ICEB 4G7VH 4TNVF 4WCYL 2Y7QB 1PX3A 3QB7C 6FABL 2P46B 1MH5A 4XNUL 3TGXA 2GCYA 4YR6B 4OCWL 5C0FB 3O6FA 3TNNA 4RBPH 3DVGA 2W60B 2D7QA 3RL1A 4F9LC 4Q9QL 4RMSA 2QHRL 1MEXL 3MTRA 2G60H 5DVKA 4P3CH 2EYTB 3X11A 4CAGA 2Y07L 3I2CH 3PWVA 4D9QE 1JFQH 4AYFA 2BVOB 5F7UA 2GJ6E 3P4MB 3MRKA 3VGEA 4HWZB 1L0QA 3HTLX 3NA9L 2P43B 4JO1H 1QA9B 1U3HA 5EOTA 3JUZA 5GSVA 4UNTA 2CDEA 3ZKXC 3QRGH 2P47B 3TO4C 1KYOJ 3FHAA 5JDSB 2NNAA 3OV6A 5CJOL 1U8IA 1YJDL 4ZUTB 1F8TL 2X2YA 3QWRD 3JWOH 1CLOL 3I84A 1UWXH 4NC0B 1EH9A 3LH2H 3QHFH 4R8WH 4FABH 3GB7B 3GSQA 4N5UA 2R23A 3IFNL 5JLZA 1CDIA 1JUFA 2K9UA 4U1JA 4XBGA 3V4UH 4JR9H 1HHKB 3UJTL 3FCTB 1O7VA 1AE6L 1EV2E 3RU8L 5GJTH 1T5XA 3TBSA 3OJDB 5IVXB 2SEBB 2UYLA 4ZUVA 2JKXA 1AR1D 2DQCL 3TF7C 4OZGF 3WNLA 2FJGB 1JZ8A 2XXCB 1H9VA 2QKIB 4CDHA 4TNWF 5D7JD 4EQ3A 2F8VA 2LTQC 1YDPB 4NP4H 5J9PA 5D71L 4WUUE 4X9IA 2NY6B 4UT6H 2VL5B 1UFUA 3NABH 5JPNA 3C5SA 3ZO0A 4D9QD 4I18A 1ADQA 4JZJC 1CXKA 4YHML 5I30H 3B6SB 2GJ6D 4O51B 3MPCA 4FQXA 2DBLH 3MLXH 1A7BA 4Y5VB 5TE4L 3QIBC 3O3BB 1JTTA 3VGAB 4HJGB 1F97A 3NBNA 2XZCL 4Y4HD 2R1XA 3WV0A 2CKBA 4DKAA 2HRPH 1CTNA 2VDLL 2Z91B 4MQSB 3DHJA 1IAII 1E27A 4V1DA 3MRBA 4JGJA 4Q9RL 4J3UA 2AKRA 2AEPL 3SDCA 1JJUA 4HIEB 5CZXC 2H2SC 5CBEB 5ICYB 5E8NA 5I66B 3SEPA 3SKNA 1KJ2H 1FYHB 1JRHI 3U7WL 1A6WL 2X4QB 1SYSA 1QSFB 1DUZA 5CEZL 4HZAA 5JOFB 5E94A 5E03A 1FCCA 1A7RL 2J12B 3L3DA 3L5XL 3PWPB 5HGHA 5I9QC 3H7BA 4TSBH 3ROOA 2NXYC 3PWUA 4RAVA 1S3KH 3F65A 3VGHA 3NPSC 4XP9H 1Q0XH 3AS0A 4MD0B 3V52L 3JBG7 4OUUB 5FGCE 1FYTE 2G2RA 3F7VB 4FQLL 5TDOA 4WUUD 2R1WA 1MJ7H 12E8L 1LP9A 3QFDA 5C2BL 2ARJQ 1YMME 4I3RL 4OZGE 3K1KC 2DQGH 1A4KB 4NZDA 3Q2CA 1SY6A 1S5HA 3U30B 2FX8H 2GITB 4NPYA 4S1QH 5ENWA 4UIKH 4L8BB 1IKFL 3E6HB 2X4TB 5F1IB 5HHOA 5MP6H 4U6HA 4Z0BL 3QIUC 5GS0H 2DLEA 1UACL 5AD0B 3KLSA 3WXVH 1VEOA 4RFOL 3DTXB 5FGBC 2I60H 4L4TE 3TT3L 3BWAA 2W1NA 2FGZA 3FB6A 3D85D 2AJVL 4Y1AB 1DQJB 3MMEA 4HIXL 3GHBL 1AQDB 4I1NB 4HV8A 4NC2B 3CZFB 4P5KA 3QDMB 5FGSA 1OSZA 4MXQC 3ARGD 4BQ8A 2F54B 4KXZH 5F1KC 3QDGA 3SGKC 4ODHL 3TWCL 1IM9D 2HN7A 3MRGA 4HIIB 3S5LA 2X4OB 3VXSB 2BSTA 4NC1E 4PJCF 5C7XL 3FO2A 4AH2A 1GCFA 1WLHA 3TIEA 2VXUH 1EVUA 1OP5H 3ARFA 1JN6B 1LO4L 1SJVA 3QUXC 4BFIA 2AEWA 4HKJA 4NO2B 2DB8A 1FN4A 4JHBA 1FNFA 4PGEB 2IH3A 4HGWB 1A1OA 2BNQB 5DD3L 4ONHA 1BLNA 4NZTL 1DQLH 3WE6A 1YPZB 3QXWA 2BP3A 3HI6H 1MHEA 2DM3A 4S1SL 1OQOA 4NKMA 2YEZB 3TNMB 4XCNB 3TBVB 1FYTD 3SDAB 4EVNA 3T3PF 1NLBH 2YMXH 4WHDA 1XF5B 4I0PD 3VWKD 1YMMD 2CIIA 2F53A 3TJEL 3WBDA 3IRZA 3OAUL 1OGTA 4JLRA 4X0KA 4XB7A 1JYXA 1KENH 1XH3B 3FRUA 1R5VB 4MDIA 1LK2A 3SPVA 1VKXB 1JMZA 1F6AB 1UB6B 2DJSA 4ALAL 4IDJH 1AGBB 3V6ZB 3KYMA 3T2NH 3GRWL 1F58L 5AYUL 3F5WA 5D1XC 1MI5B 2VDRL 4FZ8L 2YHGA 1CICD 1FQ9C 2DIJA 2EDOA 1Y0LB 4RGNC 1T3FA 1NDGB 1E4KC 3HC4L 3L7EB 3PIQB 5I1CH 1G7PA 4LIQL 4KUZL 3VXSD 3OKNB 2UZYB 6CGTA 4LBEA 1C8PA 4PB0H 4ELMB 4XAWH 4N9GA 5ITBH 1LO5B 4LARL 5CP7A 3G6JF 2C26A 3FQRB 1R24B 5HI5C 1N0XH 3WS3B 2DL9A 1BM3H 3DSFH 2GQHA 4F7MB 4YHYB 1KG0A 3ZKQD 5IK3B 4PJCE 3V5DA 1T7XA 2VLJA 3QBTB 2C1PA 2QSVA 3NTCL 2P8LA 1QFPA 1IGIH 3HZMB 1J5OH 4WO4A 1T21A 3FQNB 3JV4A 3EFDL 5F9JA 1KCRL 2HJFB 4GJTB 4PY7A 2VAAA 2EH7H 5D96B 5SWQB 3BUTA 2OTPA 4ODTH 5D1QD 3T2PA 1K4DA 3BIKA 1CFSA 1YYLL 3UTZA 3TVMA 1PG7W 1FV1A 4NFDA 3CFJB 3QCTL 3T3PE 4ZPTB 2XA8H 5C6PB 3GMRA 2VLRA 3UBXI 2VN4A 1IQDA 1OL0A 4X8JB 5DD6A 3TH4T 2DM4A 4G6MH 1K6QH 1WBYA 4KQ3L 5KTEL 1UXSA 2FCBA 4K3JH 3B2UD 2B2XH 3D6GA 4ERSH 2R2HA 3CVIH 3D18A 2IPTH 4HWBA 3VWJB 3WNMA 2QADD 4L8CB 2VH5H 5KN5B 1XIWD 3HZVA 1OTSC 1KELL 1N3NA 3OKMA 3D2UD 5E4EB 4G7YH 5BVPH 3QZWA 3BEVA 4U6VL 5GQBA 1P4IH 4L8DB 1PLGH 1T0MB 3HPLA 3UZEA 5IFAL 4BZ1L 1V3KA 1GC1H 4QHUA 3INUL 2NZ9D 5GSRB 2VN7A 1EIBA 3KHQA 2D31B 1HINL 2R2BA 2EECA 3MXVL 5DJXA 1C7SA 2FDBP 1I7ZB 3MJ7B 5GRVK 2FGWL 1JZ2A 3U9PL 3G6JE 3KYNB 1OVZA 1S9XA 3TN0C 4D9LH 3ULVC 3D3VA 1W72L 1RJYA 4X5LA 4XCCH 3NFNB 4UT9L 2WK2A 1OF2A 2IANE 2YOCA 3QG7H 1BZ9B 2OR7A 1EBAA 3MRIA 4UDTB 3U9UB 1A21A 4OZFB 4UDUB 1CBVL 2XPGB 5B39A 4TPRL 5DA4A 1EGJA 1D5XB 4QXUL 5K9QG 3GSOB 1ETZB 4GW1B 5I74C 3TZVC 5J13C 4MJIB 1QSEA 1IEBA 2J88H 5ICZB 4FTVA 4K9EL 3SKJL 1MPAH 5IEHB 2DYPA 5I8CB 1U8MB 2P7TB 1DQMH 1IGJA 4J3XA 5D9SA 1CU4L 5GHWL 5JQHC 2NY3C 4ZFGL 2D7PA 4Y2DB 3E8UH 3V6FA 2CDGA 3VXMB 5DMIL 4N8VG 2WUBH 2E7LA 3DX9A 3H9SA 3MYZA 1F3JB 4EUPA 3IAGC 5C1MB 3MGOA 3MXWH 3P3YA 1IC1A 3BZFA 4H8WH 1UWGH 2GFBB 5K33A 4BZ2H 4JRYA 1TLKA 1NGZB 1R5WA 4QXTA 1ONQA 1LEGB 3B3IA 3ZYJA 2Y5TA 3RGHA 2FLRT 1DEDA 3D87B 3LQAC 3O6ML 4IOFC 2HVJB 4ONFH 4KDWA 4YDKH 4OCXH 3GBNH 1KLGA 2GIYA 4LCWE 4R97B 4KKLC 5EC1B 4MGXA 4I2XA 3T08A 5EZIH 4X4YB 3VXRB 4YHKH 3FJTA 4LHUD 3OKDB 3QWOB 2NY7H 5EUOB 4ZXBA 4LVHB 5D93C 2WAHA 2YWZA 5E8EB 4I9WE 1XF2B 3QCUL 4LOUD 3BN3B 1ZTXH 2FEEI 4P3CL 1G1CA 1L0YA 1ZHLB 4PJDA 5D7LB 5C92A 3QI9C 4OCYH 2RBLA 3FOLB 2MCG1 1J0HA 4LSVL 4ZFOB 4XMPL 5CKGA 4WI8A 3LDBC 1FORH 3QRFM 4P2RE 3QRGL 1IC7L 1FZJA 3TO2B 1RAMA 2R9HC 3H9ZA 4J3WA 4N0RA 2C7UA 1DR9A 1RSFA 2Z31B 4NQCE 3C9NB 1R0AL 5I8KH 5ACLA 3NMEA 3BGFC 1NJ9A 4PTTB 4FABL 5E08H 5IBTH 1EJOH 3T0EA 4FQ2H 4U49A 3MRPA 4JR9L 5C09E 4OD3H 5L88H 3WYRA 4YPJA 4U1SB 1AO7A 4L9LB 5GJTL 1CFTB 1K2DA 4KZDH 1WWWX 3HZYB 4JFXB 5ERWB 3AGVA 1TVHB 32C2A 3TJHD 4MNHA 1VPOL 4GRWH 4ODSH 4LCWD 5DD1H 3EO1B 4JG1H 4FXGB 1KBGH 4MS8C 4QOKB 4QGYA 3Q6FB 3UYPA 4ZUWA 3WFHB 5EU3A 5C0CA 4NQVB 5I15L 4OV5B 4GG6F 1C5BH 1NGPH 5F6HI 2P4AB 4JY6B 1RFDH 4TTDC 4I9WD 4PTUB 2D7MA 3CFIC 4JPVH 2J8UF 7FABH 1JMXA 3LIZL 3RIFF 2UUDK 5F3BB 2QSTA 4RX4D 3BE1H 2E27H 5CUSL 3CK0H 3QEGH 4JM2A 4PG2C 4WU5B 4JGUA 1ODAA 1CDCA 3MUGB 1ZXQA 1A7QH 4XVTH 5F6IB 3FZUD 4E42B 2DBLL 3ILQC 5J4MA 4H26B 2X6MA 4YXHH 3AU1B 3SJVE 1RUKL 3JWDC 2FZ3A 4P2RD 4Q0XL 4MVBC 4PJ5A 1FG2B 3ZDYF 4Z7WA 1VHPA 2V7HB 1R3LA 3QEQE 4ZYKB 3PABB 4NNYA 5L8LB 3CLFL 1B6DA 1INEH 4NQCD 4OGXH 1IGFL 4PJ8D 4MA8L 5DURB 3FFDB 1VFBA 3L1OH 1UYWL 4YFLI 1ADQH 5H94A 3G6DL 2MSPA 4Y7MA 4BQCA 1E6JH 1X3DA 3QXTA 4KROB 3OKLA 5C09D 5FYKH 1WVZA 3PV6A 1FSKC 1RUPH 3ARED 3STZB 2CKBH 5HYQB 1MCPH 1P6FA 3ULUF 3VXOA 4K71C 1EEYA 1FL6A 3MC0A 4MHHG 4G8GB 2QBWA 4Y4FA 4OTXH 1DBKH 5LWYH 1N8ZA 1RZJL 5CEZD 1HNFA 2D0HA 3L3KB 2B1AH 2CMRL 2ORBH 3CFEB 4K2UH 3D0LA 3I75A 1WEJL 1G7QA 4BQ6A 5I19H 5DF0A 4ZMAT 1MLBA 4YBQC 1P4LA 4PJ7B 5LAXA 4DN3H 4EDWH 2ZJSL 2DQGL 5EOQL 5FXCH 4PG9B 1M7IB 3W2DH 4KZEL 4GG6E 3ARDD 4IMLB 3JWNC 2ADGB 2V2XA 4W70A 5MP6L 2J8UE 3MJ6A 3SJVD 1CT8A 1TZHA 1C16A 5KZCB 3EYOA 3OKOB 3KPNB 1PKQB 4HWNA 5BRZA 4L9DA 4JAMB 3QEQD 3VH8B 1T03L 3HE6D 5TDNB 3T4YA 1YECH 3PGCB 4OD2B 4KTDH 1QRKA 2BOCA 2VXQL 5CD3A 2D0GA 1T20A 3S34H 4OBSA 4P4KC 3WXWH 5C07A 3ZDYE 1G6RH 1RZ8A 5I71C 1FNGA 4KK5D 5TDPA 1ZGLM 2FEDD 5GS1C 5ITFA 1DN2A 3PWNA 4LLWA 2VJXA 1IKNC 3QIWB 5FFLA 4CUCA 5MHSD 2LAAA 4LNVA 1MWAH 3D39B 3QPXH 3V4PH 1KT2B 1E4WH 4Y5YC 2XTLA 4HAGA 4P5TA 1J86A 1XF3A 2FB4L 2ICWJ 2AXGA 1CXLA 2GK0A 3PL6A 3NN8A 1ZHBA 3LEVL 1KB5B 1ORQB 3ULUE 3PWLB 3QPQC 3MOQA 5EBMB 3I6LE 4EIGB 2YMXL 5EU5B 3P11L 1F3DH 2NY2C 4Q2ZA 4AIZB 5HVFB 5AG8A 3OG6B 4RSVA 3VFTA 1L7TL 3KXFB 2Q76A 3DX7B 2OTUA 1OLLA 1T4KB 1WWBX 3REVA 1S7WA 4GRMA 3L3IA 3WNPA 4EI5A 5D1ZB 1CIDA 3N06B 1AD9A 1EEZA 3BHBA 4IDJL 4P46C 1CE6A 4V2CB 5F7HA 4Y4KC 2FJHA 3DETD 3E0GA 2A9MH 4GXUN 1JNNH 4KK6D 1H5BC 3GSUB 2BC4B 2PTVA 4Z6AT 1KV3A 3E6FA 2VDQH 4OJFH 3K0WA 3QA3A 3ET9F 2FATL 1FNEB 4Z5RB 3EIFA 4JHAH 5CSZB 1ZAGA 5I1CL 3CDGA 1HXYA 1P5UA 4P2QB 1RIVL 3S8WA 4XNZB 1UKSA 2UVFA 1X5KA 4R2GC 3P9LB 5DUBA 2NW2B 5J12C 2P49B 2R2EB 4M62H 4KHTL 3W0WB 3U6RA 3RUGA 1CFBA 1I8IB 3VDCA 3SO3B 1EAPA 4LNRA 3H9HA 1TVBA 2QR0B 4D0BA 1DDHA 4P4RA 2QHLA 3MLRL 5T1DH 1H3PH 4QHNB 1Q72L 2FX9H 4NQEE 4YGAB 1IGIL 2WWMD 4Z95H 3ULUD 2IGFL 2VQTA 1TTFA 4Y5XC 1JE6A 1CQYA 3E2HC 3I6LD 4YNYA 5E4IA 4EXPX 2DQJL 4JFPB 3WDJA 2PYFB 4IOIA 4XZUA 3LS4H 5GIRB 4ODTL 4FXKB 2BDNH 2HT3C 3L5HA 2ESVB 2LVCA 5HYEA 4C56A 4ZO6A 1W72B 1P4BH 3KPTA 2E9BA 4BFGA 1S9KC 5DC4B 4JN1H 1I8MB 1QSVA 4Y8AA 5E00A 3CXDL 4WI4A 5GGQH 1H0DA 2EIDA 4QXWA 2IMMA 1YEFL 1JZ5A 3BH8A 3M17A 4HF5L 1IL1B 4MAUL 1F2XK 5EU4A 4NYLB 2MHAA 4HCRL 3SE4A 2NTSP 5JUEH 3ISWA 4ODXA 1GHFH 4IMKA 2AABH 5SWSB 5ANME 3X12A 5HYJE 1J1PL 2B2XL 5GGUB 4ERSL 2W65A 5DMGC 1KACB 5CP3A 2IPTL 5T1KD 5L6YH 2KH2B 1BQUA 3QULA 2CGRH 3PV7A 4GRLA 1I1AA 3QUZD 3ULSA 2IH1A 1KCLA 5D5MA 3TBWA 5IVZA 4MJ4A 1P4IL 2RIKA 3VCLA 1PLGL 5D7IE 3UTQA 1CK0H 2ERJC 2KZWA 4Q9CA 4QYOB 3HFML 1U93B 1GC1L 3WDIA 5HYSA 5TE6H 1OTTC 3PDOB 4OZHF 4KFZC 4G8EA 4XH2B 1YN6A 4JG0L 1ZANH 5D72L 4LLQA 1ZHNB 5FUCC 3R1GL 2A6KA 1D5IH 4NQED 1LVEA 2H26A 5EU6E 3N85L 4D9LL 2B4CC 2F5BH 2AEQH 5ESAA 1YQ2A 2Y25A 2VXTH 4HWBH 4L4VA 4OAWA 1KGCE 1AY1L 4XNXH 4HKXA 1RY7B 3G9AB 5C71A 3QG7L 3MSPA 3QO0B 4X7DC 1JGEA 1ZVHA 5DWUH 4BH7A 1L6ZA 3O8XB 5HHVL 3T2OA 1EO8H 1FGNH 2QSCL 1RZFL 1QFWM 3X3FL 4YXLH 1KF9B 4OCRL 4F7CB 2E7MA 2YD2A 2J88L 2EXYD 4WW2C 1Q9OA 2IAMC 3C6LD 4CNIA 4KK9D 3M8OL 5IG7B 1MJUH 5KSUA 4HC1H 1MPAL 1XCQA 2V6HA 2CDFB 2OX5A 3CCHB 3EDEA 2MPAL 3WFDH 5GRYA 1RMFL 2GAZA 2O93L 1YEJH 2IG2H 4NWUL 4P2OB 5DUPL 5ID0B 1CXFA 2XZZA 4KVCH 1JF1A 4F7TB 5GPRA 1ZLUH 4LLDB 3MXWL 5SX5H 3QXAB 1FVDA 1MNUL 5HYJD 4OF6A 1FZMB 1BBDL 4BZ2L 4YC2B 5I1HH 4ENEC 3MBED 4C4KO 3KPRE 4XBPB 5CLWA 3JUYA 1F13A 2EH8H 3VFPB 1CIUA 5DJAA 3OXRB 4HIJB 5KG9B 3VXPA 4O2FA 3RKDD 2ZOKB 1J0IA 4WHTB 1GGTA 4HFUH 4R3SB 3GBNL 1HQRB 4JDZB 2VKWA 1NC4B 1DVFD 1IAIH 5F7WC 1U36A 1D6VH 4PJBF 2HKHH 4YHKL 5FECA 1Q1JL 2APWA 4X7SL 4RGOL 2R0KH 3QUMB 1J9CT 5MENB 1UB5A 5EU6D 5HHNA 3OQ3B 3MV7A 1D5ZB 3GGWA 1MSPA 2FX7H 1KGCD 4HH9B 3QEUB 4D8PB 1AFVL 4OZHE 2AEIT 5FF6B 1RD6A 4S1DD 1LD9B 4CL7A 4GAJL 5A3ID 4WWKD 2W07A 3CFDA 1Y6KR 4CN1A 4U0RB 2UWEF 1VENA 3IXAB 3MRDB 4JCLA 5L2KA 5GS0C 3NIDF 2EEAA 1VSCA 3GSWB 3X3GH 4WTXA 2R29L 5F88A 2DKSA 2CIKA 4PBWD 2HTLD 3EJZD 1CFNA 2YXMA 4GW5A 3SGEI 4N0CD 3VFVA 3KYOB 5CGYD 3O11B 4CADB 3VA6A 1FGVL 5C0AE 2I25N 4P49A 1T80A 1I1FA 2J6EA 2ZSWA 2VIRA 4X6EA 4ONOA 3O2VL 1NFDB 3FN0L 4GS7B 4PV9B 4K7PY 4TOYH 5E08L 5CJ8A 3SGJA 3MJ9H 2XRAL 5E5MB 1A3QA 3EYSL 1FO0L 4DCQA 4FQ2L 3KS0J 3KPRD 3MV9A 1BPVA 4OD3L 1WT5A 4RA3A 5L88L 1F90H 2A83B 3O6LH 4X98A 5FOBB 1J0YA 5GRVL 4QNPF 2QV2A 3VXTB 1CLZH 3RZCC 4N1HB 1UJ3B 3WHXB 2YS4A 1A5FH 4PJAF 5D2NC 3BAEH 1QBLH 2NXZB 1H8SA 1MHPH 1VACB 3QUYD 1KIPA 5IBUG 3WFBH 1PEWA 4WJ5A 1HDMB 4HMEA 2YD5A 3MNZB 1FG9C 1JPTH 5JXED 3B5TA 1IFHL 5E7FA 2VC2L 4YHZH 4HH8A 4P57A 1C5BL 5HHMB 1CG9A 2ZSVB 1CGTA 4NQSA 4MD4B 2HFGL 1VESA 2WBWB 4YHPA 5BV7H 1I8KA 2F15A 7FABL 4K7PL 1UQSB 4PJBE 2WLZA 3QH3A 3PNWB 4MA3A 3CK0L 1TQBB 3U1SH 1AR2A 1U95A 4JVUA 5GGSA 4OF8A 4XVTL 5FO9B 3CH8A 5IQ7H 4YXHL 2VQ1B 4FQIL 3GJFA 1EZVX 1PY9A 4F58H 4Y19A 4O58H 5CBAB 1RK1A 3HC3H 2YWYA 4TYUA 3IKKA 4WIQA 1HEZA 3IFPA 4U7MA 1LE5B 3VMOA 1SJEB 1FRGH 5HDQH 5J11B 2UWEE 4U1GC 3TV3L 3L3OB 3CX5K 3RWCA 1INEL 3NIDE 3P77A 4JB9H 3WN5B 4OGXL 2Q7YB 4QLRA 2JB5H 3DO7A 1ZGLP 2YPLA 3DGGB 1NC2B 3FTGA 3MFFA 3ZYOA 4KMQA 4FZEL 3UBXG 1GZPA 4MYWB 3PG2A 1DBBH 4UU9A 4JVPA 1JBJA 4LCCC 2ZCHH 1V05A 2VE6A 5T33H 4HUKB 4PR5A 3UMTA 1MUJA 4M03A 4XRCA 4PRBB 4JPWH 2DQHL 5L7XH 2NY5C 3RPIA 3DNKA 1M71A 4HLZG 4YK4C 5J7CC 4DQOL 1QRNB 2OBGA 3BQUA 5EO1A 5FIEA 1DBKL 4XCYB 1NGXA 1TPXC 5HVHC 2AJSL 4Z9KB 2AERT 1G7JA 4NDMB 3MOAH 3MNWB 2WBJB 2EO9A 3ULVL 1B4JH 4HS3B 4QNPE 4L8SC 4K2UL 4NJ9H 5A1AA 1EZVY 3GZKA 2NW3B 4PJAE 1NCWL 4LF3A 5K9OA 2HFFB 3NZHL 4NRZA 1C08B 4Q7DA 4M6OL 3FN3A 4H25A 4X6DB 4FFZH 3RVXC 1N64L 1IARB 4PLNC 5HDOA 2XY2A 1I9RH 1HH6A 1JWMB 4JQVA 3KLHC 3GMNB 1B0GB 1BAFH 2FBJL 4KRPC 1YNKH 2D3VA 2EC9T 2OP4H 4NM4H 1JPST 4MCYB 4EOWH 1D9KD 5DYOB 2WLYA 2EZ0D 2A2QT 5DJ2A 5LBSH 1CGVA 5IF0A 1BVLA 4XMKH 1A64A 2X44D 2HT4C 4NO0B 4HS6B 4CJ1A 1A7OL 1QBMH 3T8XB 4O5LH 4BJLA 3SE3C 3VXUE 3WLBB 1YECL 3ZKXB 5AZEH 2F74A 3TO4B 4KTDL 3BIBX 5DVMA 1IRAY 3CSPA 1T6WA 2HVKB 2DRUA 3AFLA 3HI1A 3QWRA 4G5ZL 3EDDA 3QDJE 3QFJE 5CCKH 4S0TD 3QQ4A 4ZO8A 4NUJA 1F4WL 3GBMH 4GUPB 3LQAL 1CF8H 3P4NB 1K4CB 4FFYH 4ZUUA 4HIHB 3ARPA 2R4RL 1NBZA 4IIQA 5DDHB 3F6LA 3O3DB 4PY8J 1C1EH 4JREC 2LE9A 4L1DA 2PYEB 1P7KA 3VFMA 2ILLA 4Y16D 3SOBH 4GW4A 2HG5B 1ZLSL 4KK8C 4IRSD 3BIAX 4WUKH 1FNSH 3IKCB 4HLZH 3AMKA 1MCOH 4XP4H 1TQCC 4OQTA 5KVGL 3UXFA 5D2LB 4U1HB 1ND0A 5I8OL 5C0FA 5JW3H 5D7JA 2D9CA 3HAEA 5E6IC 2BNRE 3UJIL 1MJ8H 3ARBC 2LTQB 3O3UN 3BMWA 1MFAH 1VEMA 2W0PA 4TTGA 2ADFH 3NGBC 1S7VB 4EKXA 4KKAC 2BVOA 4NBYB 5CEXB 2GJ6A 5IKCA 5IT2L 4HWZA 4JZJB 4WDIB 4LK4A 2PXYC 2A9ML 4JRWA 3QIBB 4XI5C 1G7LA 2BMKB 1NPUA 2DD8H 4Y4HA 2VDQL 1H3TA 1REIA 4NRYB 3VXUD 4H8WC 3LKRA 4JHAL 1XZ0B 1FL3B 2MCPL 3PHQB 1JGUH 5T3XL 3CC5B 2H6PB 3QDJD 3QFJD 4DWHA 1YEEH 1UM5L 3SKMA 3L5JA 1F4HA 3VGGA 1QLRB 4PRDA 5IROC 1R3JB 3DVNA 1XGUB 1KIRB 3OMZA 1OAKH 1JWUB 4N9OB 2DMBA 1HHKA 3W11D 3VJ6A 2DKUA 3OR6B 2MQCA 3C60B 4ZSOE 3WNOA 3OJDA 3CX5J 4QTIH 4LDLB 2NY4C 3U0TA 3LRSB 3U7YH 5I18L 3GHEH 5I9QB 1V7NH 3T2QA 3SE8L 2NXYB 1LEKB 1DE4A 2ZZUT 2G5BB 1HILA 3HG1E 3NPSB 1DTUA 3I02A 3O9WD 5DR5L 5C0JB 3LS4L 3BEWB 2BNRD 4HXAH 4WUUA 1A6TB 4LSTH 4YDVA 1UM4H 5SWZE 2H2PD 3HRZB 3DRQB 4DK6A 1SEBA 1DN0B 2C1OB 1UCBL 3O6FC 5EN2A 3WJLA 1RUAH 4JN1L 3L5IA 2EYSA 3O3BA 4WGVB 1MCHA 5D7SH 2APTA 4A2MA 5GXBB 4YE4L 4U33A 3S96B 3QIUB 2P42B 2YPKB 2Z8WC 1BHGA 5EZJA 3RNKB 5C0EA 2GJZA 3TFKD 3D85A 2GYSA 1N26A 1K9TA 4H20L 5ESQA 1I9JL 1YEHL 2FBOJ 5JIKA 5JIIA 3ARGA 3EOAA 1A9EB 4HIEA 3TPUB 4WEBL 1U3HC 1JHLL 2AK4E 2HKFL 3P0VH 3V0VA 1IM9A 5CZXD 4PRHB 1D5BA 4K7FB 5JHDE 5KSVA 2BSRB 3MCKB 5FA3B 2P48B 4M43H 2AQ2A 4WFGE 1CK0L 1QFWI 2QQNH 3L3HA 5DRZA 4GRWF 5HD8C 4LLVA 5DHVH 3KPSE 4HWEL 5JTWA 1RK0B 1Z6JT 2I9LB 3HMXL 5JOFA 5H8DA 1Q9LA 4MJ2A 4DGIH 4GXVH 4TVPL 4BQ9A 3QUXB 3IF1A 4KKBD 1NANI 3PWPA 5A2IH 1EEQA 1UEYA 2APXA 2IPKB 1D5IL 4FNLL 1FFOA 2H32A 2VXTL 2E5EA 3HG1D 3KLAA 2WQRA 5ISZE 4FXLA 3FB7A 5GJSH 4JRXE 4LRNH 1NGWA 3RNQA 1FYTA 1SHMA 5DWUL 1Y18B 1YMHA 1FJ1B 4R96A 4DFHA 4KJQD 4I0PA 3NFSL 5SWZD 1YMMA 4OZGA 4GSDH 1OSPL 2YUWA 4X8XA 5DJ0B 1CN4A 3AY4A 1OW0A 1YEKH 3TBTA 5L8JB 4JHWL 3LHPH 1FPTH 3TA3D 4HC1L 3N1FC 2VISB 2JELL 5TE7H 2YD9A 1U58B 3KDMB 1I7RA 1OTUC 3WUWB 2IG2L 3BXNB 4QF1B 4L29A 5DJZB 3EYFB 2W91A 3AXLA 3H42H 1DZBA 3NZ8B 4I18C 1TZIB 5CKAA 4PJFB 3H3PH 4FQXC 3HHRB 3H8NA 2E7BA 5D4QA 5I1HL 2I07A 3BX7C 1A6ZA 4CN4A 5B38A 4RGNE 2AK4D 3BRGC 3BPCA 4JPIB 4X80H 4YHIB 2XN9E 4P9ML 5GRZA 3A67H 2EH8L 2DI7A 5KVDH 5JHDD 2XIDA 3VXSA 1IILE 3IFOB 4NCC1 4WFGD 3ZE2F 4OFVA 4TN9A 4HFWA 2GTWA 3ALPA 4EBQH 4N8VB 2WINA 3KPSD 5I0ZA 1FAKT 4H88H 5F1NA 3SDCC 2D7NA 4JGMA 1IAIL 5KOVC 2HKHL 1OPGL 1CI5A 4HGWA 4PB9H 3ULVF 4D94A 4YHNA 1CE1H 5C0GA 1GGCL 2UZIH 4HPYH 3SDDD 2E7CA 2NYYD 5F89B 4GRWE 2GTZB 2FX7L 4RFNC 1QYGH 5MI0B 4G6KH 5EO0A 3V5HB 1JRHL 2PW1A 4OFYD 5ISZD 3VFGL 4JRXD 4JJ5B 1IEAA 5DK2B 4POYA 3UTSB 3T4AA 1A6AB 3OGCA 3D0VB 2B7DT 4GXUM 2PTTB 2F9BT 4CKVX 2CUMA 3FT2B 4ZNEE 2NY0D 4PV8B 1HI6A 1M7DA 4J8RB 3X3GL 1N6UA 1R5VA 3RA7H 4ZTOL 4GKSA 4AENA 4TRPL 1FP5A 4U6TA 1NKOA 5DT1L 4K3DH 3DUUB 3LS5H 5IB4B 1X5YA 1MI5A 4J4PD 1HOCA 5INCB 5D1XD 5F7KC 4MXVE 3QNYA 4BFBD 4H0HB 4LSRL 1TCRB 2DDQL 4RGND 5HGDA 3TYFB 4DOHB 2ZUUA 1F90L 2XN9D 4QRRB 1D5MB 4JQIH 5I6XC 5E9DE 1P6AB 1S7QB 4FFWC 1ZA3A 2DQTH 1FNHA 2YD3A 1JP5A 1XIWA 3IXTB 1HCFX 3IU4L 3MGAA 4DVBA 3HNSL 4XVJL 3HUJB 1MCEA 4L5FH 5FDYA 5FYKE 3K8LA 3G08B 2NR6C 1II4E 3WFBL 1EFXB 5E2VL 4FG6D 2B5IC 5DRNB 2NY1D 2PW2A 1JGDA 4ONGL 4NM8H 1CL7H 3ZE2E 1IAOA 4PJCA 3ARFC 3C5ZD 5IJVA 3PQYB 1BVZA 1U8LA 1LO2L 3QISA 1F3RB 2O61A 2V17L 4YHLH 1NBVL 3TN0B 3ULVE 5TGBB 2OR9H 3U1SL 2ITDB 1BWWA 4PJGF 3ILPB 2DWEB 3SKUD 3IJHB 2R8SL 4PRIE 4C57C 1F11A 4JZOA 4XHJD 1KNOB 1PZ5A 4KGJA 4OD1H 5FK9B 5DJ8A 4FFVD 4PJXF 4UB0H 1I7UB 2LU7A 5I74B 2DI9A 3WO3B 3TZVB 3HS0A 5J13B 3PHOA 1G7IA 4Q6IC 4JFDB 2X4RB 2JJUA 4W6WB 2ICWB 2JB5L 2NY3B 5JW4N 4HUNB 4RCAA 2B1HL 4G43A 1X5ZA 4N0FA 2YR3A 1QQDB 3CMGA 5FYKU 4ZDHB 5ADPH 3IDMA 1N7ML 5E9DD 4ZFZA 2WIIB 4F57L 3AMLA 4GLRI 4CW1B 4OIAA 1MRDH 2XWTA 3E3QE 4Z7UB 2OLDA 1BFOB 1P69B 1T0MA 5FYKD 4OM0H 4X5XA 5F70A 2AXFA 4X5WA 2B4CL 3V4VH 1RIUH 2BNUA 2YC1B 3RBGA 5KW9H 3RI5F 2ICCA 2J5LC 2VITB 4RQQA 4U05A 2HH0H 3R06B 3MRNB 1NEZG 3KPQA 4APQB 3KJ6H 3G6JA 3MUZ1 4PRAB 5IESL 1RURL 4LSQL 4OGYL 3LEXB 3GO1L 1NAMH 1UKQA 2YSSB 5D93B 3EGSA 3FONA 3ULVD 4FFZL 3IDIB 2Y72A 5FYJL 4CVZB 1B3JA 4PGDB 4M1CD 2ZOLB 1WBXB 3S4SA 1LEIB 4UDUA 4PRID 4M7KL 1J05A 3PXJA 4GW1A 3QI9B 4NNXA 4WO4C 3FQWA 3P4OA 1RV6X 1S9WA 5JNYA 4PJGE 1QBML 1UH4A 1VFMA 3LDBB 3OR7A 2BVTA 4MQXC 5ICXA 5INDA 2Z93A 1S7SB 3BRDA 4M7JH 3ZHDA 2PO6D 2OQJA 1LDSA 4LCUB 4PRPB 3TVMC 5DXWA 2J8HA 4PJXB 5CCKL 2DTMH 1J1XL 2B0SH 3RVWC 1RZKH 4UILL 2AW2A 3BGFB 1MCSA 3GSNH 2CRMA 3GBML 3U30C 3ARVA 3GDBA 2R1YB 3OG4B 5F9WC 3CMOH 1GAFL 4H0IA 2WM0A 4BSVA 5I1GL 3GSXA 1BBJA 4WFFE 1C1EL 5ESVA 2A6DB 3UYRH 3RJDA 3MLSH 4JKKA 1KJ3L 5EIIB 4NNPL 5EC1A 1GPOH 2BY0A 4XVUD 1FNSL 5EIVA 4MJ5B 3K8KA 1MCOL 3QWOA 2IADB 2DQIH 1SYVB 4U1NB 1PAMA 1D6EB 4NSKA 5T3ZL 1HH9A 1HHJB 1VCAA 3GI9H 4GT7A 4WI3A 4RX4A 5MEQB 4Z76B 1D7FA 4XPGH 4WI5A 1Q9WA 4YBHA 4EIZC 8FABA 4S2SA 5KJRL 2P24B 4HJJH 2VO5A 3VU2A 4OIIL 1K5NA 5C6WH 2A77L 2Q8AH 3ES6A 5CMAA 2DD8L 5I1DB 3SDYH 4P2RA 3OWEA 3TO2A 1KEGH 4OKVB 1AGDA 2D03H 2FD6H 5JMRA 5HJ3B 1DEEA 4N5EC 4UINH 3WSQH 4WNQA 4MAYD 4NQCA 4ORGA 1YEEL 4PJ8A 3ZLQC 3RX7A 2NX5E 1JPSH 4JFOB 4O9HH 3HC0B 3W9DA 4MNGB 1OAKL 1KEMH 1ORSB 4XGZB 3EYUL 1MIMH 1NCCL 3V8OA 3RGVD 1I7TB 4GAYB 5C09A 4XP1H 4UTBL 4U1SA 2E7LC 4L9LA 1U6AH 5KS9B 3AREA 3NCJL 4WFFD 1FSKB 5DC0A 5CJ5A 2UV3A 2BK8A 3U7YL 1TVHA 4I4WA 3NH7L 4K55A 2W0LA 4OLWH 1KIQB 4FXGA 5HDBF 1TXKA 2DM2A 1V7NL 2IFFH 3SQBA 1U8PB 2Z4QA 1EK3A 4N0UE 3VRJB 1LDPH 2OSLA 3K2UH 4MA7H 2ITCB 4NKIH 3NACL 3PJSB 5DJDA 4M1GH 2OTWA 4HKZB 1Z9MA 3O3AA 5I8EA 2YUVA 3WKML 5TFSH 3TPKA 4HXAL 3C2SA 1GIGL 3JTTA 2ZUVA 1OAQL 4X4XA 1WFUA 4XPHL 3TH3T 3MROB 2CK0H 3EDKA 4PJIB 1UH2A 4WU5A 4ZXBC 2HT2D 2R56H 2EDKA 3MUGA 3DGCR 3ARDA 3U36B 3HPJB 5D6CA 2IQAB 1PG7L 4YBLC 2DF3A 5E2TH 4EJ1C 5D7SL 1G7HB 1ITBB 2FO4A 1GZQB 3GIZL 2H1PH 2YA2A 5BCAA 3OB0K 1KJVA 3U4BH 4GG8B 3EDFA 4MQ7A 4F33A 5E2WL 3VFUB 1ZT1B 3BP7A 1GRWA 5IMLB 1KULA 3EUUA 3W39A 1J88A 2FEEL 3BH9A 3QEQA 1A2YB 3HE6A 3D3VE 1ZT7B 2GSGB 3BKYH 1JF5A 2WNGA 3DXAE 4GMTL 2NX5D 1NGQL 3UPCA 2XZQL 2KDGA 3DRTA 3GMOA 3RL2B 3EYVB 3BUYA 3O4LE 3RVUD 5IEKA 4RIRA 2A6IB 3LAFA 4HAFA 5ETUB 4DKFH 4ZUSB 1U8JB 1MCQA 5I71B 2OL3A 3ZMRA 1BF2A 5DI8B 2DQFA 4LPXA 1KCVH 1WBZB 5GS1B 4UOW1 1AXIB 2YD1A 4DGIL 1T0NA 4FTVE 4A6YA 4YDJB 4YUEH 1HKLH 5IW3A 4AT6A 1DLFH 4NKOA 5HGBB 4GMSH 2Y9RT 3MFGB 4GH7B 3T0EC 3THML 2A0LD 4Y5YB 5AYQA 1RU9L 3UPRA 3JTSA 1L6XA 3RJQB 1R3IH 4AL8L 1BP3B 4EI6A 3CFEA 4OT1H 4QRTA 3L3GB 5D70H 1Z5LB 4LRNL 4K8RH 3BYYA 5HYFA 2ZUTA 5CD5D 1OCWL 4MWFA 1ZVSB 5LCVL 5IFJB 3VFOA 1YEDA 1NEUA 2NY2B 4GSDL 5KSBF 2VLKE 3V7MA 1YEKL 1KLUA 3L9RB 3LHPL 4GG6A 3V5KB 2D7TL 1NMAH 2FNBA 2ADGA 1DSFH 5EOCH 3FB5B 2E3VA 4NHCH 1YZZA 4WHCA 5TE7L 3CUPB 3U4EA 4OZIB 3WHE0 3NCCB 2I5YH 2XYCA 1KCSL 3GBLA 4M6NL 2J8UA 3KPPB 4U1LB 1MELA 1RHFA 4DN4L 5EUKA 1IC4L 5E1AB 1IT9L 3OKOA 3MRLB 3GSVB 4GQ9L 4P46B 4JM2C 4F7EB 4Y4KB 2R0LH 5FUOL 2BVEA 1G9NC 3O6KL 1FBIH 5JORB 3MRHB 4J23A 1MIEH 3QQ3B 5C0DB 1H5BB 1SBBA 4AJ0A 3DXAD 4GKNB 4XC3H 1ZA6A 1J0JA 2F58H 1MHCB 2CLRA 1NBQA 4X7TB 5I1AB 1SM3L 3GRWA 3RX8A 3GIVB 1ZSDB 2CKNA 4PJDE 5GGVY 4PFEA 3O4LD 5F7FA 4P4KD 1BECA 3OKYA 4EBQL 3K3QA 2AQ3A 1ED3A 2ADIB 4LL9A 5EO9A 4LU5H 4FTVD 2H3NB 4R2GB 5K9JL 4KQ4H 4PB9L 5J12B 1ZLWK 1DLHA 4JFEB 4ODWB 4O00A 2XQYG 3LKOA 3I50H 4X9GA 2OI9C 5C0RH 1FDLH 5J6GA 4LKXB 5B4MD 5IOPB 3QNXB 1YUHB 2OZ4H 4E0RA 5CIPA 4ZFFB 3QG6A 4Y4FC 2A9NH 4Y5XB 3E2HB 3LKQB 4XNQA 4Y2OA 4KAQH 4ZS7H 3Q0HA 2VLKD 1I1RA 5GGVL 3KGRA 4QXGH 3O81A 1T5WA 4J6RH 4PJEF 4E41B 2Y06L 3MA7B 2BVPB 5CZVL 1MQ8A 3OAZK 2C4FT 1HN1A 1RZ7L 1TETH 3NFPA 4MZ2A 3QEHA 5KSBE 3W9EA 4PS4L 4OFIA 1NL0L 3TYGL 1MCFA 1T1YB 2GSIA 3CPLB 3W82A 4LEOB 1U2CA 3D48R 2IPUK 3BN9C 2LFGA 2Z35A 4HUVA 4XWOC 4H0GA 4ZQKB 5IB5B 1BFSA 2QEJA 2DQTL 5FV2A 5T1KA 3AM8A 5DMJB 2JB6A 2RQ8A 5BQ7B 1Y6MR 5J6HA 5CHNA 3QUZA 1T1WA 4M6ML 3G6AA 2VZSA 4G3YH 4L5FL 3MLTA 5A2KH 2BSSA 1RJLA 2R2EA 2ERJB 5FA4B 5FKAA 4G8FA 2XKNB 4EXKA 4BSJA 2XZAL 4Z7WE 3SCMD 2QR0A 2J4WH 1EHAA 4NT6B 4TSCH 3QJHA 1IGML 1K8DB 3DMMC 4NQEA 4BSWB 4XXDB 1IGCH 4YHLL 3BGAA 2X4UA 5HGAA 1GYAA 4P5TC 3RVTD 1XF4B 1T22B 3VGBA 5GIRA 5EPMB 2IPUG 1NGYA 4M61A 1V5JA 4BUHA 4NZUH 3C6SA 4IBLT 4RNRB 4XPBH 4XPAL 3DURB 1W72A 2ED8A 1A6PA 1P2CB 2RFXB 3WKNA 3C6LA 4ETQB 4K23L 4HPOH 4WW2B 2IAMB 2G5RA 1NCAL 2YKLL 1HHGB 4GAGH 3SDXB 4ELKA 4OZFG 3FOMB 5I1KH 1K8IB 3QJFA 5EU7C 2RHEA 5IWLC 3RFZC 4P2CG 1MCIA 1S78C 4EI5C 4PJEE 1MVUB 2Z92B 1A9BB 2EXWC 2VRAA 5TF0A 3QHZL 4RGMC 1G1YA 4NN5C 4OLUH 4HZLA 1A1MA 4XMLH 4R4BB 5ANMA 5ADPL 5EDXA 5HYJA 4QRUB 4FQJH 4Z78B 4YHOH 1ZK9A 1MFCH 2Q86A 4NZRH 2AV1B 2H9GB 1HZHH 5KANI 4I77H 1A4JA 4OM0L 4UOW0 4PRNA 1KPRB 3ZTJG 1FVCB 1WAAF 1DVFA 3QCVH 1MAML 5BRZE 3PDOA 4XNYL 1S8DA 1YEGH 1J0ZA 3FO0L 5BS0E 2X4SB 5IMMA 3D9AH 3KJ6L 3ALXA 1BOGA 5EU6A 3U0PA 1NH6A 1VFUA 2VZOA 4MX7B 1MREL 4WRLA 5D8JH 1N5AB 1E0OB 1YNTB 3MLWH 1ZEAL 1RZGA 4WWKA 3EOTL 3OJ2C 1WWAX 3HB3D 5FYJD 4BKLB 2XNAB 1M6OA 4LP4A 1WICA 5I16B 3MOBH 5C08B 1OAUH 4UUJB 5B8CA 3IRPX 3BP6A 4DJMA 4UQ2A 1HHHA 3MV8E 2KZ1B 1SBSL 3Q5YA 5AUMA 4G9FB 5LG1A 1I1YB 3IVKB 6FABH 5BOPA 1BQHA 2HMIC 4XNUH 4OZFH 3LY6A 5FUZL 1JYVA 4K07A 3KPRA 5F7EL 1ES0A 4Q9QH 2QHRH 5E24E 2Q3ZA 3SE4C 4ZAKD 4LDEB 3OXRA 2YD6A 4IMKC 4R3SA 4XTRC 3RZCB 3D69A 4PP2B 1QO3B 2WUCH 5K59F 3MJ8B 5D2NB 5I1LB 3QUYA 1U8QA 5BRZD 3RVVC 4GRLC 1NMBL 3BOVA 1I1AC 1FZKB 5JXEA 5BS0D 5DJYA 2MNUA 3ZTJH 2V5RA 5DJCA 1WZKA 3NIGF 1D5ZA 1RHHB 5CJOH 4IS6B 4XBEL 2GI7A 1WAAE 2E8ZA 3LQZB 1F8TH 3LRHA 3QEUA 1CLOH 5BVJB 2LU4A 4G9DA 4OZHA 1JPFB 3OKKA 3L95B 4X99B 5A43C 1XT5A 2JIXB 3IFNH 2HWZL 4QHLA 5IV2A 3MRDA 5IIEB 4G80B 1CGSL 1VFAB 3QQ9C 1U8KA 1FAIL 3L3JA 4GBXD 2Q8AL 5IM7B 1U92A 1AE6H 3GJEA 3RU8H 4GKZB 4OCMC 3SDYL 5DEFA 1VADA 2X9YA 4XHQA 4QRSA 3F6IA 2CLZB 3PL6D 4YO0B 1OP3H 3MV8D 3PWJA 1RJZB 4U1GB 4DTGL 5I75C 4YX2L 1HQ4A 4PV9A 5A16B 1JPSL 3ZT6A 4O9HL 3T1FA 4NGHH 1WCBB 1X5LA 1KEML 4RZCB 4DKDC 1U9KA 3L7FB 1UXWB 4LCCB 2BVQB 2A6JA 3KNBA 3VXTA 4EN3C 1WZ1H 1E4XI 4O2EA 3WHXA 4JDTH 2B39A 5C2UB 4HDIB 4YHMH 5CINL 1LK3L 4RAUA 3NCEB 1KJ2A 4OLWL 4NQDB 3MV11 2X1OA 5HHPB 3OX8B 4YK4B 4YFLF 1LNUA 2IFFL 1OGAB 4P23D 1YEIL 3REWA 1LDPL 3CXHK 1W0YT 3K2UL 3QWQB 1TPXB 2FHBA 2X70A 1A0QL 2VDLH 2MTPA 4RDQG 4RFEA 5J06A 4L8SB 5H2BA 4XCFL 2FJFB 2P8PA 4RMTA 4Q9RH 3BJLA 5K59E 1UQSA 1RUQL 4JFFE 3A6CH 4PJBA 2AEPH 4TUOB 1WIPA 3O41A 3IDUA 1IQWH 1XR8B 3EDJA 4HK0B 2JIXD 3PGDB 5FO9A 1P7QB 3NIGE 3U7WH 2CLVA 1QP1A 5E2TL 1A6WH 3QXDB 4DZBA 2R39A 3SBWA 5JW4M 1HK6A 4KRPB 5CEZH 1D9KA 5J8OA 1BD2B 4LCIL 3L5XH 5I17A 1I85A 3WLWC 4HT1L 2UWEA 4L3CB 3T65A 2JCCF 3QXUA 3LOWA 3IDGA 4L4VE 3LB6C 1HYRC 3DGGA 2LVEA 2O5XL 3BO8A 4UBDD 1FFQA 2O26U 4WU7B 4FQLH 2YA0A 3MRCB 5DMYA 5M94B 3VH8G 3FFCB 12E8H 1A6VL 5D7KE 3RPKA 1QBBA 5C2BH 4I3RH 2EEBA 4MZ3A 1CDYA 1T6VN 4BH8B 2EKSB 1Q8MA 4NBXB 3SGJC 1DLFL 5JA9A 4GMSL 3G5XA 2ZCLL 3MLYH 1MFBL 4NFCA 3RY6C 1WT5C 1JHKH 4Y16A 3PP4H 4Z0BH 4JREB 3RTQC 5JR1L 1UACH 4HGMA 4IRSA 5C9JB 4RFOH 1R3IL 4F8QA 4OT1L 1XCTB 3TT3H 1JGLH 5D70L 5GGRY 4W4OA 4PJAA 4WI6A 3A0OA 4HIXH 3GHBH 1BQLH 4LCYB 2OYPA 1JGVH 3FAWA 1TQCB 4UIMA 3OAYK 4D0CB 3ZKMD 4JFFD 5DEGA 3Q6GL 2I9TA 3ECBB 1T1ZB 1JNLL 4ODHH 1XR9B 1A14L 5E6IB 4DZ8A 3TWCH 3VFRA 5AAWA 1NFIB 2OJEA 2HJKA 3R0MA 2XTJC 3HMWL 1NMAL 3ARBB 2C3VB 5DQ9B 1JWMA 1DSFL 3RVXD 5T1LD 1G7MA 3HR5A 4Z8FL 4NHCL 5C7XH 3D25B 1NKRA 1CD0A 1YC7A 3AB0C 4Q9BA 3G5ZA 3GFUA 3NGBB 4ZS6D 1LO4H 2X4NB 5DYOA 1U41A 1J8HE 4LLUB 1JK8A 3JV6B 2G9HB 3MNVB 5E8DL 2HFTA 5IHUH 1AD0B 2PXYB 1RPQA 1MIEL 1TTGA 4U2ZA 4IHOA 4NZTH 5DSCA 4NQXB 4HWUA 3VXUA 4XC3L 4N0YL 1JV5A 4L4VD 3DUSA 4MCZB 3TO4A 4CU7A 5HHQB 4S1SH 3IFLH 3CFBA 3RKPA 3QDJA 3QFJA 1FNLA 2EDFA 4XNMA 5IMKB 3NA4A 4H1LB 3AS1A 3DX8B 1QLFA 5D7KD 3ARUA 5K93A 3MRRB 2JCCE 2L7JA 3SE9H 3TJEH 1BIIB 1K4CA 5HSFA 3OAUH 4WENB 4KQ4L 2Y36H 2VB5A 1KTLB 3ZDZF 2PYEA 3MLPA 2ENYA 1TJHL 4ALAH 2V5SA 4UV7L 2NY4B 5EBLA 3TESA 2HG5A 2DLGA 4WV1A 5C0RL 2AQ1A 3VXQB 3RWIB 3GRWH 1F58H 5E8PA 2EYRA 4KK8D 2P5EB 5AYUH 2VDRH 4FZ8H 1S7RA 4GLRH 3BQUC 3O9WA 5BOZG 4X6CB 1AXSB 4PJ9C 4ZS7L 4QY8A 2BNRA 3BZ4A 3HC4H 3U2SA 3IJYB 5JA8B 3EJYD 4LIQH 5C0IB 4KUZH 3WFEH 2W0KA 4GKOA 3QAZC 3HE7D 3U82B 1QSZA 3CXHJ 2ATKA 3B83A 1TTUA 4EDXA 1S9YA 1GOGA 2GCYB 2M8XA 1J8HD 4LARH 3O6FB 1KB5H 3TNNB 1EGJL 3DVGB 3RL1B 3TH2T 2PXYD 3EYQD 4RA0C 1OD7A 1KCKA 3DVFA 5CIPH 5C0BE 3RHWK 4KJPD 3PGFL 4JQVC 2ICWI 4NRYA 3X11B 2V5MA 4QRQA 3NTCH 2VDMH 1TJGH 3MRKB 5J89A 3PUCA 4PJHF 4M3JA 1HYSD 4TUKL 1RVFL 3BSZL 1XGUA 3MODL 3D1MC 1KIRA 1U3HB 5EOTB 2CDEB 1WGOA 2OK0H 5ACMA 4G3YL 1YA5A 4R0LA 3OSKA 2NNAB 5K9KA 4ZSOA 1GOFA 3VI4F 2HFEA 1YYLH 1LO0L 5I1EL 3QCTH 4MMZC 5DTFA 4OLZL 3GSQB 2QJDA 4AY0A 1RIHH 2R23B 4IDLA 1C5DA 1JUFB 4U1JB 4XBGB 4KTYA 4L3EE 1LEKA 1ZVYA 1IGCL 3RWHA 1QFUL 4OFDA 4IIQC 1MCKA 3HG1A 4FQCL 3ZDZE 3TBSB 1T5XB 3O4OC 4L3AA 43C9A 5F71A 3IAQA 4KQ3H 4Z7VF 1AR1C 2UYLB 1IGTA 4ZUVB 5KTEH 1YQVL 2XG4A 4W4NA 5SWZA 4G6AD 3SQOL 1KCUL 3HCVA 3TA3A 4OV6F 4ZOEA 4U6VH 3FQUA 1QVOA 5IW1A 5EBGA 1TNMA 3A6BL 4WW1A 5IFAH 5J9PB 4BZ1H 3MRJB 3INUH 5C0BD 2YPKA 4WHYG 1S5IL 4MXWL 3ZL4L 5JPNB 4OLUL 1HINH 3C5SB 3RX5A 5HVWA 4QGTA 5FGBA 3WL9A 1RULL 1U3ZA 1PZUB 4IOSD 2FGWH 4I18B 1J12A 5L0QC 3U9PH 4FQXB 4FQJL 3TCLA 3UZQA 2QQKL 1W72H 1UZ6F 4Y4HC 2AK4A 2AK1L 5A2JH 5EORH 3SGKA 3B9KD 4NZRL 2R1XB 2CKBB 5JHDA 1HZHL 3MYJA 2XV6B 4U3HA 4QRPE 1OAZL 1CBVH 3QXVA 1E27B 4TPRH 4V1DB 3MRBB 3G5VA 2XFXA 3KPSA 4PJHE 4QXUH 2Y6SC 2VLLB 3QCVL 2BRQA 1BJ1J 3SDCB 2L0DA 3CAFA 1MFNA 5E8NB 2X7LB 5GHWH 1CU4H 3TT1L 4URTB 3SKNB 1C5CH 2AJ3B 4NO3B 3SDDA 4ZFGH 2AS5M 1R3KA 3O2DH 4L3ED 1U2HA 2YZ1A 5DMIH 3N9GH 5TQ2L 3VI4E 2EE3A 1SYSB 5ISZA 4OFYA 5IVXF 4RFNB 1DUZB 3S37L 1CDBA 1W8OA 1A3LL 4YH6A 2AVGA 1AIFA 5E94B 2YBRA 5FCUL 1MQKL 5FB8A 5IB2A 3C09C 3MLWL 3CFCH 3L3DB 3FB8A 5HGHB 3H7BB 3ROOB 3PWUB 4RAVB 2DAVA 1T2JA 3Q48A 3BRFA 2VXVL 1G9NL 2D9QB 5E6YA 1I1CA 4Z7VE 1U58A 3OKEA 3NCFB 2G2RB 5TDOB 3WUWA 4R9HA 4JKLA 4LAQL 1OTUD 4QF1A 3K4ZA 1LP9B 3QFDB 1R3HA 4HUXB 2D2OA 1TZIA 3RDTD 4J4PA 1S5HB 4B7LA 3WJLC 4M4RA 4NPYB 5D1XA 3TEUA 3C8KA 5ENWB 5HHOB 4WHYH 4P3DB 4U6HB 1KTDA 3QCUH 5BXFA 1SEQL 1S7TA 2XN9A 1E4KA 1U8NB 1GJIA 2EDEA 4LGRB 3BD3A 5HI3D 1LE9A 4NUGL 2DIBA 5J1AA 5I6XB 3E1F1 1Z2KA 4QRPD 2VXSL 4QCIA 3BWAB 3RQ3A 3FB6B 1TJIH 1FO0A 1EERB 4N8VA 3ARGC 4LSVH 1JI2A 4P5KB 2WUCL 5KSAD 1WQVT 4XMPH 1OSZB 3CX2A 1UZ6E 3NIFE 3CSYA 1S9VB 3QDGB 4LPVA 2HN7B 5F96L 3MRGB 2EDDA 1IC7H 5DZLA 3S5LB 2B5IB 5JQ6H 2YK1L 2IC2A 3M1BB 3LEYH 1U3JA 2BSTB 3FO2B 3C5ZA 3TIEB 4IRJD 3U83A 4LVNC 3ARFB 1R0AH 1QFWL 4U3CA 1L7IL 1FN4B 2IH3B 3D0VA 1A1OB 3ARQA 1T1XA 3G5YA 3HNTL 5I2IA 2KL6A 3BW9A 2PTTA 5I76A 4ONHB 5EZOL 3T0XA 1BLNB 2Q6WA 5DRXA 3P9MA 4HHAA 2FIRT 3HLAA 4ZNEA 3RWJA 4Z18A 3WE6B 4CMHC 4UMGA 5IVXE 1MHEB 3QUMH 1CDJA 4K94H 4NKMB 4WI2A 1NBYA 2BJML 3RAJL 1VPOH 4OSUL 4EVNB 4I0PC 1AGFA 3VWKC 1PSKL 4KY1L 2VZ3A 4Q6IB 2CIIB 4YWGL 2F53B 3AY4C 4S11A 1OW0C 1UKTA 4X0KB 4JLRB 1OGTB 2IALA 4NWTL 5I15H 4NGHL 3HKFA 1CZ8L 2VUOA 4MDIB 3MR9A 4ZFOL 1LK2B 3SPVB 1BX2A 4U7KA 3LIZH 5E9DA 5JOEA 5CUSH 3KYMB 1B90A 1JZ4A 4LQFL 1WZ1L 5I73C 4JDTL 5DO2D 1OT1A 3F5WB 4UT7L 1CICC 3IB4A 4YFEA 3D5OF 1MRFL 2VSDA 2FR4A 1FFNA 2KUTA 1XGTA 1T3FB 1RUKH 5HI4D 2NR6D 1I75A 4Q0XH 5DGRA 1G7PB 4FQ1L 4NC1C 4XP6H 1NLDL 3SO5A 2OMBA 2J5LB 1Q9KA 4LBEB 5F44A 3PQYA 4NJAL 3CLFH 2A73A 3A6CL 4N9GB 5CP7B 1IGFH 4LAJH 4MA8H 1UYWH 1IQWL 5GZOD 2ITDA 1J1OH 3G6DH 2FECI 1AXTL 9CGTA 4X6FB 3ILPA 3C60C 4HUUB 1KG0B 4PRIA 1YPZF 3V5DB 1QSFE 2VLJB 2PNDA 2C1PB 2P8LB 1CD8A 1D3CA 1I9IL 3STLA 2WP3T 4WO4B 3PWPE 1T21B 3VG9B 1P53A 3JV4B 2DQEL 5F9JB 1ZS8A 1UGNA 4PY7B 1S7UA 1IC5L 2X4RA 4X7CC 5D1QC 1P7HL 1QEWA 1Y6NR 1RZJH 2PO6A 1K4DB 3FT4A 3BIKB 2CMRH 3F12A 3NOIA 1CFSB 1WEJH 3UTZB 3TVMB 3M07A 1FV1B 1XEDA 3IGAA 2NY6D 4XC1L 4ZTPL 1NCNA 3GMRB 2VLRB 4TNWK 3WEXA 2ZJSH 5EOQH 5EC2B 1IQDB 2BY2A 4F37K 2N7BA 4MA1C 3GM0A 5DD6B 5GGRB 4KZEH 1AC6A 3MRFA 5F9WB 5F7DA 1MY5A 3C8HA 4YQXH 3VMNA 1EUUA 4Z7UA 1G6RA 2FLBT 4B0MM 3MLYL 2HLFD 5GISL 1JHKL 3PP4L 3B2UC 1WBYB 5H35A 1QACA 1UXSB 1X6NA 1ZHKA 2P5WB 2QADC 1MWAA 1G9EA 4CVUA 2R2HB 1XIWC 5E70A 1JGLL 4HKBB 3K8MA 2LABA 5CILL 5KVFL 4Y1AE 5JW4Q 4ELMF 4QKXB 3HZVB 1VERA 1T03H 1BQLL 2NLJA 3QDME 3WFCL 1JGVL 4JZNA 3OKMB 1BVKA 1N3NB 4PYHA 5JPMA 4HBCH 2F54E 3QZWB 4O4YL 3BEVB 2DWDA 2VXQH 3HPLB 2NZ9C 4TULL 4CMMA 3VXSE 4K8RD 1IAMA 5DJXB 1QSFD 2BSED 2YRZA 4F9PC 4KKNA 1S9XB 3HR6A 5IHUL 3PWPD 4CRPA 2BNQE 4MD5A 1RJYB 3QUKA 1KSRA 4PJGA 4ZO7A 1DCLA 1OF2B 3T0AA 1EXUA 1YY8A 2FB4H 2AJUH 3K81A 1YPZE 4HK3N 3MRIB 5GRUH 4FA8A 3IFLL 5IMOA 3LEVH 5B39B 4MAYA 4PJXA 2JK5A 3UZVB 2EDBA 4OLVL 1QSEB 1IEBB 1DQTA 4HLJA 3P11H 1BZ7A 4M8QA 1L0XA 3SE9L 1IGJB 5D9SB 1L7TH 1WFNA 1AI1H 3RGVA 1QFOA 3LRGA 1ZGLB 3VGFA 3V6FB 2CDGB 1NDMA 2Y36L 4YAQB 4I3SL 2WIMA 1J0KA 1YNLL 3DX9B 2A1WL 3H9SB 5JO5A 3DHMA 4EUPB 1VEPA 3MGOB 1I4FA 2DJ4A 3BZFB 3C08H 3HI5H 1MI5E 4JRYB 4Y1AD 2OR8A 4BQBA 2N7AA 1FCGA 3QDMD 1R5WB 5JW5B 4QXTB 1ONQB 3B3IB 2FATH 2Y5TB 2F54D 3B2VL 4DGVL 5EA0L 4LDOB 1KLGB 4S1RH 5F9OL 4I2XB 3WFEL 4J3OC 1RIVH 3JVGA 4ELME 3I85A 1CGYA 4ZXBB 1WISA 3EO0A 1KB5L 3WIFA 4CVXA 4LOUC 4MNQB 4DK3A 4YBLB 2BNQD 4PY8I 4KHTH 4K3GA 3ZSSA 1B9ZA 3LN9A 3MJGX 2C3HA 2CJUL 2DQDL 5MI0C 4YGVA 5HJ3A 3MLRH 4FN0A 3AAZA 1Q72H 1JIBA 2VDML 1TJGL 3RWFA 3V0AC 4JKPL 2IGFH 2WP3O 1XGPA 2P8MA 3SDAD 2NX5A 43CAA 3H2WA 3TBYA 2BCKB 1HXMA 2DQJH 5DZNA 3JV0A 3BGMA 2AJYH 2OK0L 5ACZA 1FZJB 1W0WA 1QOKA 5IGXL 2C7UB 3RIAK 1A1NA 1MCBA 2ZUWA 1NJ9B 4FS0A 4MDJA 3MLVL 1DJSA 1X5AA 1RIHL 1ZT4A 2R15A 2OXGA 3CXDH 1YJDC 4LMQE 3T0EB 1HSBA 1MI5D 1YEFH 3MRPB 5BZWA 1H3UA 4HF5H 4MAUH 4N0UA 5B21A 3HMXA 4OLEA 2R0ZL 2FSEA 1AO7B 1KTRL 4HCRH 5DFVD 1K2DB 4JY4A 3WNNA 1OWRM 4I0CC 3TJHC 4O2CA 2QL1A 32C2B 3BWUC 3ARYA 4MNHB 1J1PH 4F15C 4ZPVA 4HJ0D 4NCC2 1K85A 5IJKA 3VD5A 1JL8A 4ZUWB 5EUOF 3U36A 2IBZY 3HPJA 5EU3B 5C0CB 3RWDA 4XP5L 5DRWB 3BKJL 1G7HA 4MNQD 3HFMH 4GAFB 4AG4L 1S7XA 4XWGL 4XCEA 2Z8VC 4OGAD 4HC1A 4JM2B 3MO1A 2Q7NA 4JG0H 5D72H 4KXZI 1ITCA 3R1GH 2CXKA 2DLHA 2BOBA 1INQA 3N85H 4NQTA 5GS2H 2ARJA 3TM6A 3DXAA 4ZODA 2J6EL 3WUWG 4MMXC 1AY1H 4JDVA 5EORL 3DYPA 4M5YL 2K3TA 2FZ3B 2HJLA 3O4LA 1B6UA 4LKCA 4PJ5B 4P4KA 1U8JA 5HHVH 1Q0YL 2QSCH 1RZFH 2W9EL 1CD1A 1R3LB 4PIRF 1VFOA 4NNYB 4YXKH 3X3FH 5T5NG 4MJIE 4PJ8C 4OCRH 5F1OB 1IKNA 1P84J 3M8OH 4U6XA 5EB9A 4HG4J 5HGBA 3FN9A 5H94B 2Q1EA 1C5CL 3VFNB 3P4LA 3O2DL 3VXME 2MPAH 3AREC 1RMFH 3OKLB 1V3LA 3N9GL 5LJYH 3PV6B 4NWUH 4JANA 1R5IA 2WWKO 4JJHA 5DUPH 4D0DA 2OI9B 4ODBD 1JZ3A 4JVWA 1OAYH 1EBPA 3VXOB 1EEYB 1FL6B 3CFCL 2XQBL 1MNUH 1E4XH 1BBDH 3VWJD 1NCDL 4Y4FB 4JHZA 2VLKA 3DV6A 3LKNA 1N8ZB 3PXHA 4R4ND 3V5KA 1F2QA 4P9HC 5LQBL 3BDYL 1N59A 4NHUA 5CFHA 3D0LB 4AM0A 4CGTA 1G7QB 5E1AA 3ZYZA 4P46A 1MLBB 1HE7A 3GSVA 3VXRE 1P4LB 4C58B 4ODVL 1JWSA 5LAXB 5KVEL 1Q1JH 5GZND 4APQC 3H0TA 2OJZL 4X7SH 3ARDC 5EUOE 4RGOH 5C0DA 4XB8A 3X13B 1BWMA 2A74A 2AJZA 3LN4A 4X7TA 5I1IH 1AJ7L 2BVUA 4DUXA 1CT8B 1TZHB 1AFVH 1C16B 2EIZA 3EYOB 1Q94A 1MJJA 5D7LE 4FQQB 1B2WL 4GAJH 2ATPA 3MJ9A 1TJIL 2E6JA 3HE6C 1A7NL 4EEEA 1L9NA 4MJID 5DK3A 4KI5F 1IAKA 3T4YB 5DUMH 2ARWA 3KPLA 3FT3A 5MEPA 2BOCB 5CD3B 1X5IA 2R29H 4D9RE 4AQOA 4Y2DD 4KK5C 5JQ6L 5FYLL 5C07B 1RZ8B 2FEDC 3VXMD 3SCMA 3LEYL 1FGVH 1FNGB 5BO1L 2DQUL 4YPGA 4LKXA 5TDPB 4B50A 5ITFB 3DIFA 1CQKA 4QTHA 3PWNB 3MV01 3QNXA 1C12A 4HX1A 3FO9B 4LLWB 3O2VH 3FN0H 4AEHL 3DMMB 4RDQF 1T7ZA 3N1MC 2B20A 2XRAH 4OF0A 4B41A 4PUBH 3EYSH 1FO0H 4AIOA 4P5TB 1U8OA 1XF3B 5C8JA 2AXGB 1J8KA 1YY9D 1VGKA 2GK0B 2X05A 3QUML 3G04A 4K94L 1ZHBB 1N6QH 1G9MC 1F6FB 3FMGL 1X5FA 1FFRA 2J3SA 5DD5L 3LN5A 2Y1VA 4QOKE 4Q2ZB 4PJ7F 3G9VA 5KSBA 3VXRD 1MFDL 1FVEA 3VFTB 3IDJA 2Q76B 5CEZE 2N1KA 4GQPH 2OTUB 4JY5L 1IFHH 3BKML 2VC2H 3F7RA 1S7WB 3REVB 3VRIA 3BPNC 3SKOA 3CPLA 3BP4A 1OLZA 4GRMB 3L3IB 4JM4H 4LEOA 4EI5B 4PGZA 1AD9B 4HS8L 1EEZB 4RGMB 2HFGH 3BHBB 4NN5B 2KBGA 1I3RA 4JFQA 4K7PH 1CE6B 3DETC 1JTOA 4LPUA 5FV1L 2FJHB 4X9FA 2EDJA 4KK6C 5D7LD 3IETA 1FLTX 5TJWK 3SY0A 1MCDA 4JN2A 3UEZA 5CGTA 2VDNL 3QA3B 1EX0A 5LXGH 4FQIH 4JQXA 1MHHB 4G42B 2C9AA 4WGWB 1CFVL 3X14A 1E28A 4D9RD 5C6TH 3CDGB 3T1WA 1HXYB 4XP6L 3CSBA 3ROLA 2Z31D 4NT6A 5E5RB 3TV3H 4OFPA 4KI5E 4PD4K 3DMMD 5DUBB 3GUTA 4ISVA 1J1OL 1PYWA 4OQTL 4FZEH 3VE0A 1X5XA 4TSAL 3RUGB 3OZ9L 1PQZB 1EAPB 4LNRB 3H9HB 4KMTL 1TVBB 4D0BB 1L9MA 1DDHB 1JNJA 4P4RB 2WWMC 4WVRA 1NAKL 3ULUC 1X4YA 2DQHH 5MHSE 4F2MA 2EE6A 2CRIA 2RFXA 5E0QA 5HXMA 2VDPL 1T66D 1CWVA 1CCZA 4G8GE 2I26N 5EH1A 5MERA 4DQOH 3CH1A 4QOKD 1N5YL 2V2WB 4YNYB 3U46B 5FHBL 5ADOH 1KXTB 4IOIB 2AJSH 4XZUB 3FAXA 3Q5TA 4R7DA 3ULVH 2PCPA 4PJEA 1MCRA 2AI0H 2R0WL 4C56B 2EXWD 5SX4I 5IFHL 1GGBL 4TQEL 1NCWH 3NZHH 3B8SA 2DTSA 3S36H 4PJ7E 2QQQA 3RWGA 4KVNL 4M6OH 5J3HD 5E00B 3ARTA 3FQTA 5FHAL 1H0DB 1OARH 5IBLD 3BH8B 3M17B 1N64H 5AZ2L 4YQXL 4ZAKA 2AV1A 2WQ8A 5EU4B 2EE9A 3ZKND 2MHAB 2ZP0T 5IR1A 5HDLA 3SGDI 2FBJH 4MB5A 1UZ8A 2FL5A 1BZQK 1F00I 5FAAA 3TP4A 5IVOA 4KKCD 3X12B 1GGIL 1PKQE 3UBXA 2W65B 2AV7A 4MSWA 3QUZC 2D0FA 3QULB 4GRLB 1A7OH 2HA1A 1TENA 5BS0A 1I1AB 2IH1B 5D5MB 3GKWL 4HBCL 4KI5D 4JO3L 4LSSL 5IVZB 1X6LA 5F3HA 5DURD 3VCLB 3UTQB 2RB8A 4WI7A 3VXNB 4G5ZH 5HYSB 4I5BA 4KROD 2AJXL 4LPYA 2K7PA 4E5XA 4HD9A 2W9DH 4ETYA 5BZDA 1F4WH 4RRPG 4G8EB 3LQAH 2W38A 2XWBA 5EBWA 2VWEE 4LLQB 1OAXL 2A6KB 4FQHA 3D39E 1XGQA 4GBXA 3LKSA 1YN7B 5ESAB 4LIQE 2BERA 4OAWB 2R4RH 4G8GD 5I16A 4HKXB 3BKCH 1YYML 4R4FL 4UUJA 1FIEA 2UUDH 2AJUL 5GRUL 1ZLSH 1A7PL 1JGEB 1HHIA 3RWEA 4BH7B 2NTFA 4G6FB 4BFEA 3MV8A 4G9FA 2YPVH 1TDQA 3C6LC 4U6YA 4KK9C 4U0QB 5KVGH 2VSCA 1WWCA 3FO1A 5I75B 1Q9OB 4CNIB 5I8OH 1J10A 5KSUB 5L2JA 1X4XA 5DFTA 3KXFE 1XCQB 1H15A 1WZMA 1AI1L 3UJIH 3RRQA 3MX0A 2W0FB 2GAZB 4M3KB 4K9EC 4D3CL 4JO2H 4EN3B 4WEUD 5HY9A 5IT2H 2HLAA 1WC7A 4XTRD 5KZCD 5SV3A 1FVDB 5FM5O 3GI8L 5D2NA 3T0DA 3MBEC 1XGYL 3C08L 4P23A 3HI5L 1CGXA 4BK5A 4C4KT 4AEIH 5IHBA 3I6KA 3TIDB 3RKDC 1EHLL 3KWWB 5DJAB 1DUYA 1G0XA 2MCPH 3F58H 1DANU 1WAAA 5T3XH 3K2MC 4S1RL 1DVFC 1JYNA 5FO7A 1CGWA 4P2QE 1UM5H 1Z3GL 2BRRH 1NUDA 5FECB 5IQ9A 4BM7A 2JIXA 1BIHA 3QIWD 4G80A 1UB5B 5GGTH 3D39D 4KU1A 3UC0L 5HHNB 3MV7B 3GGWB 4POZD 5IB1A 3RY4A 2DKMA 3W0WE 1F4YH 4PD4J 4S1DC 3OPZL 3ZE1F 4QT5A 1MFEL 5A3IC 4BZYA 4CVWA 1H8OA 2CLZA 2PR4L 5I18H 3CFDB 2RCSL 4F7PA 4EQ2A 5LGJA 1RJZA 3KR3L 3SE8H 5L2KB 1CDHA 1A02N 2JJTA 5CEYA 2HTLC 3EJZC 5DR5H 5B8CC 2AJYL 4RAHA 4N0CC 5F88B 2CIKB 3KXFD 5CGYC 1CFNB 3MLZL 4GW5B 3VD3A 3GMMA 3K80A 2ESVE 3VFVB 5T1MA 2BVQA 1NUFA 5D1ZD 3OXSA 5DK0A 1ZWIA 2V5YA 3MGTA 1I1FB 2ZSWB 3BT2H 3GMLA 3JWDH 2Q8BL 2VIRB 4X6EB 5CWSA 5C86A 1UCBH 3V6OE 4NOBA 1KOAA 3UTTB 1EEUA 4UI2A 1VDGA 4DCQB 1GVIA 3JWOC 5DHVA 3MV9B 4YE4H 5CSBA 3DOSA 4KPHH 3RTQB 3V7AG 3UTPE 4X98B 5ID1A 5SWSE 4H20H 1I9JH 1YEHH 2EDXA 3O0RL 3QUYC 3GMPA 4JFFA 4P2QD 1EMTL 3WD5L 1IBGH 4WEBH 1JHLH 5TQ0H 1KIPB 2HKFH 2E6PA 1N2RA 4TUJA 4Y89A 5J1SC 4N1CA 5T1LA 2XTJB 1CG9B 3IDNB 2CR6A 3LKPA 2GKIA 4NQSB 4HWEH 3W0WD 3I9GL 4YHPB 1I8KB 3AB0B 1CLCA 3HMXH 3GNML 5M95B 5T5FH 4TVPH 4U1MA 1XAUA 4YDIL 1U95B 5HGGS 4P5MA 3T0BA 4FNLH 4Z77A 2C4FU 3GJFB 3DSNA 1OB1A 4LPCA 5IHZA 4Y19B 2WANA 1UWEL 2FIKA 4RBPK 2V7NA 4RISL 1RK1B 3BZEA 4DVRL 3ZE1E 3DECA 3IFPB 4DGYH 1IM3A 2HTKD 3S35L 1DBJL 2WBKA 2ESVD 5DHYA 5IW6A 3NFSH 4YXKL 1E4JA 1OSPH 2EC8A 3RWCB 3P77B 1NFDF 4JHWH 3DO7B 3U4AA 1CFQA 2YPLB 5L9DH 3DBXB 3FTGB 3J7HA 3MFFB 5H37G 3WIIL 2JELH 1AGCA 1W2KT 1GZPB 4UU9B 1IE5A 4J2XA 1OM3L 4U1KA 4MHHI 3RTQD 3ZDXF 3FRPG 1TMCB 4PR5B 3UTPD 4XRCB 1OAYL 4RMUA 1IZJA 5SWSD 1UWXK 1UVQA 1M71B 1E4XL 4KJWD 3BQUB 5EO1B 4M48L 3F7YB 2ZKHH 1NGXB 3BFOA 4PJ9B 4P9MH 1G7JB 3TLRA 3ARBA 3VFSA 1FZOA 3HE7A 4K7PX 3QAZB 4LF3B 4QWWD 5K9OB 4KRNA 3L5WB 4NRZB 2EIBA 2EDQA 1J8HA 3MNVA 1OPGH 1AD0A 3DX6A 2OM5A 3BPLC 4H25B 2PXYA 1TVDA 5MENE 3U0WH 1GGCH 5TPWL 3MCG1 1SMOA 1HH6B 5I1IL 3SBWC 3KS0H 3DI3B 1D9KC 2EZ0C 1JRHH 3OHXA 4I13B 2A38A 3VFGH 5JHLH 5MEOB 5DJ2B 5IF0B 3DROA 4UQ3B 1I85C 2XG5A 3O8XD 5F72S 1CGUA 2DMKA 2JCCA 1NCBL 4JPKL 1JNHB 5DUML 1CR9L 1MCLA 4OCSH 1QNZL 2F74B 3Q3GA 4KTEL 3HI1B 1FH5H 4ZTOH 1DBMH 4TRPH 2X89D 5BJTA 5DT1H 4N8CL 2R4SL 1A6UH 4P2OD 3P73A 5E99H 2ZWLT 4UOJA 1NFDE 4OZ4B 4ZUUB 1AKJB 5E95B 1NBZB 4PUBL 4IIQB 1DQQA 4Y16C 4LSRH 2DDQH 1AGEA 4LLYB 4X9BA 1P7KB 2H8PA 4IRSC 4LLMB 4PJ9D 3O4OB 4QO1A 4GW4B 3IJYA 5DD0L 3KPOB 1T2XA 1H3GA 5EFIA 4W4OC 1N6QL 2J7LA 3T77A 3S36X 3LMJL 2DLFL 3IU4H 1BMGA 3HNSH 4XVJH 1NC4D 1ND0B 5D7JB 1J18A 3HAEB 5DMKA 3O3EA 5E2VH 4X6DF 4LPTA 1KPVA 5MEND 5C0BA 4ONGH 5HHME 4JM4L 4LRIA 3EHBD 4LASL 2GJ6B 4P59L 5IKCB 3VG0H 1LO2H 1QR1A 5L0QB 1WZLA 2V17H 1NBVH 4PP1D 5FO8B 1UT9A 1G7LB 3B9KA 4Y4HB 2H41A 2IBGA 1QLEL 5LXGL 2R8SH 5HPMA 3LKRB 1DQDL 3IAPA 1AHWA 4C83A 2VQUA 3BD5A 5C6TL 3SKMB 1U91A 4PRDB 1PVHA 2XOTA 3DVNB 4PLKD 3EO9L 4YEFA 2VDOL 5E8OA 3MRQA 3W11C 2EIEA 2GJJA 2H45A 4L3EA 3VJ6B 1KJMA 1AKJD 4NN6C 5LGKA 2R2CA 1XGRA 5ILTL 4Q58C 2B1HH 3U0TB 4WV1C 3VD9A 3FQXA 1N7MH 1T04A 4HUMB 4F57H 3C09B 3L6FA 1NAMA 1KPUA 4R7NA 1DE4B 1OP5K 1WIOA 5D2LF 1HILB 1MLCA 4JFYA 5E56A 3O9WC 1G0DA 2NXZD 1RZIA 1QRNE 5ADOL 3I02B 3MRMA 2PUQT 4F37F 1NCUA 3MRJA 5KAQG 4WUUB 1JHTA 1A3RH 2B4CH 2H2PC 4YDVB 2AI0L 5HHMD 1U42A 2OS7A 3RDTA 1SEBB 2KPNA 4H5SB 4UV4H 4WI9A 3Q5OA 4GFTB 4M9OA 5DQJA 3S36L 1UM6H 5EN2B 5IESH 1RURH 4LSQH 4OGYH 3GSRA 3LD8C 2EYSB 3EOBA 3GO1H 2GT9B 4X6DE 2WSKA 1W0VA 4RMVA 3MBXL 1OARL 2MMXA 5FYJH 2CH8A 1I3UA 2FWOB 3TFKC 1ZKAA 1WITA 5EZJB 1X7QA 5C0EB 2GJZB 3GSNA 4QRPA 3D85B 3MA9L 4PREA 4M7KH 2GK2A 3IDXH 4PJHA 1M05A 4YJZL 5ESQB 5IB3A 2VLLA 5KSAA 3QNZA 1I8LA 5EZLA 3PE9A 3ARGB 3EOAB 2Y6SD 4S0SD 4KJYA 3V0VB 1IM9B 2X7LA 1D5BB 3VW3H 3W81A 2GUOA 4R0LC 2AJ3A 4NO3A 5KSVB 3DV4A 1TITA 4U1IA 2EDRA 3MUHL 5TH2A 2X4PA 3L3HB 5DRZB 1NC2D 3UROR 4LLVB 2ZPKH 2PF6A 4IRJA 3NVQA 5I0DA 4M1DH 4KKBC 1Q9LB 4MJ6B 2VL4A 4LVNB 1JPGA 1J1XH 3UPAA 2W9DL 4P9HL 4LSUL 4UILH 3IF1B 1FL5A 4HUWA 4Y8DC 5DEZA 2AAVA 1GC1C 1EUTA 1GAFH 1FFOB 2H32B 2XWJA 5DS8B 3CVHL 5I1GH 2O5ZL 1CXHA 1NEZA 3KLAB 4PGCA 1QRND 3LV3A 2PYEE 3BKCL 4CMHB 3FB7B 4HQQH 1KJ3H 2IQ9L 4Z7VA 1NGWB 5FGCB 1FYTB 3RNQB 4KJQC 1CLYH 2WBJD 3MCLL 4NNPH 1YMHB 2ICEA 4R96B 4HUXA 3NCBB 2I27N 4I0PB 4M93C 3VWKB 1YMMB 4OZGB 2Y7QA 5CSGA 4FP8L 4G6JL 2YPVL 5D2LE 3TA3C 5DC9B 4YR6A 3TBTB 4WTWA 2AXJA 5T3ZH 4RMRA 4NN7C 2W60A 4P3DA 1B4RA 5CJQL 4A2LA 5CJBA 1I7RB 1U8NA 2EYTA 4AMKL 5FKPB 3U7AA 4L29B 1IJ9A 3VRLF 4JO2L 4LEXH 3AXLB 4L4TB 3P4MA 3C87A 5I73B 5F8RC 1PEZA 1VA9A 2Q20A 5J56B 5KJRH 2APFA 4KGLA 5HYIA 2NMSA 4OIIH 1CICB 1SMAA 2OL3L 2I07B 4NO0D 2A77H 1A6ZB 1QA9A 1S9VA 4XXCA 4AEIL 5B38B 1LHZA 1TCMA 3BPCB 4A6YL 4HMCA 3LPGA 5JDSA 1DL7H 3M1BA 3TO4D 3F58L 4ZUTA 4HFWB 2GTWB 3W5NA 1MCJA 2WINB 5F1NB 4N1EA 2ENSA 3JV5A 2BRRL 3GB7A 1G9ML 4YHNB 3RZWA 1RUML 3EYUH 3SDDC 2NYYC 5C0GB 1GXEA 1NCCH 4NO5B 5GGTL 3FCTA 4UTBH 3MQIA 4WEMB 1AC0A 3NCJH 5IVXA 4LFHG 1FE8L 4EZMA 1F4YL 2SEBA 5EO0B 2PYED 2PW1B 2FO1A 3EZ8A 1IEAB 3NH7H 3T4AB 1HIML 3OGCB 5BW7C 2FJGA 4Q6IA 3RIAF 1QKZL 2VR9A 1T89A 4W6YB 3BMVA 2NY0C 3ARSA 5D1QB 3S88L 1IGYB 1HI6B 3NACH 5GRWA 1M7DB 2QKIA