2A6DA

Crystal structure analysis of the anti-arsonate germline antibody 36-65 in complex with a phage display derived dodecapeptide rlliadppspre
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Germline antibody 36-65 Fab light chain
publication title Differential epitope positioning within the germline antibody paratope enhances promiscuity in the primary immune response.
pubmed doi rcsb
total genus 52
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2005-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6dA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6dA01
4K2UH 3FCTA 3RRQA 4HGWB 4Y4KA 2VLRD 2A2QT 1F3DJ 3AREB 4HIJB 1T04B 1CI5A 3CFKA 1M1SA 4DZ8B 4LNRA 3VMOA 4PJ9A 1QKZH 3N1QC 2FATH 4BJLA 1FPTH 4XCEA 4G8GD 4I2XE 4NKMB 1QPPA 1A64A 2EDDA 2YPKB 4WV1A 3SE4A 3R8QA 4M61B 2CH8A 4JQXA 4N0UA 5JXAL 3HRZA 4QHLB 2R8SL 2FSEB 4IIQA 1C12A 3MV7E 1H3UA 4YHML 2A83B 3O8XB 1S78D 2W9EL 5CLWA 1KCSL 3QDJA 1JRHL 43CAA 2HLFC 2X1XR 3MLSH 4YWGH 1GGCH 4ZYKA 4P4KB 5JOFB 3PNWA 5H35B 3HI5L 1E27B 2MJWA 3MSPA 3GSUA 3QI9B 2NTFA 1O0VA 4NHUA 4PYHA 5EO9B 1C1EH 5CHNA 5HJ3B 2VQTA 1NCDL 3RJDA 4HXBH 2NY4C 1F6AB 1FORL 1KCVL 5D7LE 3HI6H 2KDGA 1FVEB 4UV7L 1FE8H 3ZLQC 3P30H 2YEZB 4JFYA 25C8L 4YJZL 3BP5B 4TOYL 3HUJA 4EBQL 3TT1L 2H2SD 1AGBA 1RZFH 3EYOA 4G9FD 4K9EC 4JY4A 3D6GA 3HMWH 2YKLL 3EYQD 2R69L 1CK0L 4PJ7A 5DUPL 2E9WA 4MDJA 4LVEA 1HHJB 2J4WL 1KTLB 3RVUC 2EYSB 3R0NA 3VFUB 1F4WH 5EBMA 1U8OA 1N26A 1X5GA 1X5AA 5EWIH 5HPMA 1CE1L 1IEAB 4X80H 3BPOC 1AP2A 2VDOH 3C6LB 3P4OA 4LPTA 4GOSA 1BJ8A 4Y4FD 4PTUA 3PWVB 1FL5B 4UI2A 2BVPA 2FIRT 2ZSVA 4ZS7L 3ULUH 3MO1B 4NRYA 2FZ3A 3AS0A 5K59E 3LKSA 5FA3A 4N0UE 1VESA 3NACL 4N9GA 1UT9A 4X4MA 1KIPB 3PGDA 4C83A 2WUBH 4E42A 1D5MA 1U0QA 2W92A 1JWUB 4ZXBB 2R23A 5K9JH 3QG7L 3WO3B 2WZPD 3HLAA 4P5TA 3H3KA 1U93B 2X44D 5FO8B 1Z3GH 4PLKC 4FQJH 4QXWA 4YHNA 3CZJA 5B39B 3MJ9A 1MHEA 2X42A 3CMGA 5HHMB 1BZ9A 5JLZA 2FGWL 4M6MH 4YDIH 3UC0H 4P2OC 4W6XB 2VXQH 4KDTC 3G6DL 4X6DF 3FN0H 5HYJA 4O4YH 1X7QB 1XGPA 3FZUD 3I9GL 4X7EC 3HCVA 2R0LL 1R3IL 3CMOL 4U6HA 4YAQA 4R7DB 1FNLA 1HKLH 1U92B 3N1GC 4KJQC 3ZDXE 5JORB 3VG9C 4KJYB 3HUJE 3O2VH 4JHWL 2ZUTA 2PO6B 1SY6H 4J23A 4PJ7E 1NMBH 3AY4C 1S7RB 4F58H 3WS6A 4I0PB 4IHOA 4DKDC 4TVPH 3K7UA 1W0WB 3D3VB 3GIVB 1PSKH 3MRRA 15C8H 1L0XA 4KVNL 4R8WH 2GCYB 4DW2H 5JXED 2Z91A 1XGYL 3VMPA 1L0QA 1DQJB 3VRIA 5HHPA 4GAYB 4LPYA 1TQBC 4KI1A 1AI1H 3HZMA 5J12B 4HIHB 3GKZA 5ESAB 3I02B 4PJAB 4X4ME 3NABH 2UZIL 1YN7A 3T2NH 5F6IB 3DURA 2I07B 5EBLA 1L4IA 3NCFB 3LD8B 1P9MC 4MQSB 3VFVA 3P9WB 5T3XH 4XMPH 4PRNA 1A6AB 4HWEL 5C0JA 2NNAB 3LVEA 3PHQB 2GQHA 2YD4A 1RZIA 1ZA3B 2WBJD 3WUZA 1Q72L 4K07A 3D9AL 3MR9B 3FMGH 5DQDL 2D7QA 1U8HA 5CSGA 4H0GA 4FQLL 1A7OL 5EZJB 4Q97A 4BH8A 5HYJE 4JZJC 1RJYB 1GC1H 3D0VA 2D0HA 2H26B 2XN9D 1S9WA 1G0XA 3NIFE 5CWSA 5DJYA 5I73B 4HS6A 5IMKB 1TZIB 4R96B 1KEGH 1EAPB 32C2B 2OTPA 4NWUL 5FUCE 1EGJL 8FABB 3AAZB 2V2TA 1CQKA 5JDSB 1AD0B 1DBML 3FHQA 1JIBA 1Q9WB 2YA0A 3KLDA 1KPUB 3WFHB 3ILQC 4MD0A 1ZLVK 5DD3H 3DTXB 1FNGB 1A6WL 2YD6A 2X9YA 1X4YA 3SBWC 3U82B 1NGWA 3V5KB 1DN2A 4ELMB 2D7TH 1QLRA 1ZT1A 5ADOL 1LDPH 1KLUA 5CZKA 1IILE 1CD8A 3MLZL 1DEEA 3MNWB 5DJ6B 2FHCA 5GISL 3GM8A 4IRJC 4PJXF 4JJ5A 3OG4B 4KY1L 4CVUA 1IGYA 2BSSA 5DJZA 4FXGB 3UDWC 4ZUSA 1A14L 5M95B 5C9JB 2R2HB 1YQ2A 2H32H 3FB6B 3U0PB 3H42L 4PJFB 3NBNA 4ZFFA 1DANT 1GPOH 3S4SA 4MXWH 4Q2ZB 1CL7L 5GS1A 4NO0A 5ICXB 3VDCA 3RZCC 4QRPA 1IAII 2BNQA 1XR9A 2HWZH 3CFJB 3BI9X 3RL1A 2BHYA 1TZGL 4CU7A 4LLMB 5DEGA 1DVFB 5LG1A 1A6TA 5GGUB 4TNWK 2DLTA 5DUBB 2EXYD 5CJ8A 3MLVL 2HJKA 2VDQL 2P7TB 5DZOA 3L95B 1DLFH 3WDIA 5C1MB 4WWID 1IZJA 1P7QA 4N5EC 4NRZA 4HG4J 5JW5A 3TESA 4F3FB 5GGTA 3ZL4L 1JMXA 4ODUA 5KOVC 4UTAL 2HAZA 2DQDL 5ELIA 3OZ9H 3D69A 5DMKB 1SM3L 4X5LA 3TIDB 5HVGB 2YD2A 4YGAB 1PY9A 1RD6A 1ZMYA 3DXAB 4MA3A 1AJ7L 1RZGA 2KKQA 3ARFC 1KC5L 2ERJB 2Z8SA 2X4RA 5D72L 2EE9A 5EU7C 3WN5B 5I8OH 5GSRA 4FTVD 5JQHC 3D85A 1PZ5A 3DVGA 5KSAA 4MZ3A 5IW1A 1IGJB 2OTWA 4HJGA 4ZO6A 2D31A 4F2MA 3F62A 3AMKA 3RX5A 3DX9B 3VFOB 4NGHL 1G7LB 5EOQL 2OYPA 3PQYA 3SE8L 4OQTA 1RJZA 4L8SC 4CMMB 3OXSB 1W72B 5CP7B 3EYUH 1UACH 5I1EL 1WEJH 4RGND 4FNLH 3SGEH 3HE6C 1FAIL 2HFEB 1EX0A 1AKJD 2EDFA 3OKDA 4DN3L 1IQWL 4HC1L 3SDXF 5EDXA 5I0DA 4P23B 3NH7H 4DVRH 5B38A 3L3IA 4OLVL 3LIZL 2H1PL 4UNVA 3MRHB 3MFFA 4EVNB 3B9KD 1OM3H 4WW1A 4QRPE 4APQA 3GJFH 4ZUUA 2BNQE 5ALCL 3K4DA 4F57H 1WZMA 4LCIH 4YDKL 2HH0L 3ZKNC 2PKDA 4NQVA 4XH2B 4X5WB 4RWYL 3BN3B 3PL6A 2X10A 5FHAH 4Z7WF 4OLWL 2OCFD 2ADFL 4Y5YA 3E2HB 1V3MA 1CBVH 2K7QA 3T0EB 4LCUB 2EH7L 5IM7B 1WFUA 3KYMB 4DGVL 1ORSB 1XGRB 1BLNB 3TNNA 3WE6B 3VWJB 3C5JA 3Q6FA 1NGZB 3GMPA 4EEEA 1WIPA 3RHWK 4JDVA 4GH7B 3ZO0A 1R3KA 4G8EB 3PHOB 4PJEF 1NCCH 1FZJB 1G9ML 1PG7W 5ERWA 2XFXB 4ODHH 4LRNL 2JE8A 3QEHA 1T20B 2APVA 3SQOL 1H3PH 4LIQH 4JQVA 3PWLB 2PF6A 3FRUA 4K7FA 4M8VA 4J4PA 2C1PA 1MCOH 4WY7H 5T1MB 3PQYE 3QEQA 3X3GH 2NY6D 4POUB 4WWKA 3DX6B 1AGCB 4TPRH 2Z0BA 4AK1A 2CDEA 5C07B 2IEPA 3S36L 4L4JA 4KDWA 1OB1B 3QRGH 5AAMA 4DZBA 4HBCL 2CMRH 3HFML 1INDH 2YMXH 5KS9A 3ZYIA 1IGIL 4OCYL 4TNWF 5L2KA 1M4KA 4EN3C 2VSCA 3FQTA 4R97C 3EDFA 5I8EB 2VAJA 4LKCB 2ADJA 3T4YB 4OLZH 4XMKL 4CN6A 1EV2E 4Z0XB 4OKVA 4R6UA 1OF2B 4R0LB 3WXVL 5HY9B 5BRZD 1A1NA 1I1AC 1HXMA 2RIKA 4K71C 2JCCB 3BQUC 2X9WA 3BE1L 2F5BH 1JPGA 4K8RC 4TSAH 3G04B 4XT1C 4JVUA 4ELMF 3UZVB 1A9EB 2CR6A 1YEKH 3B3IB 2ZKHL 5K9OA 3Q5YA 3ARRA 1JL8A 3GSOB 5I17A 4PJHF 4ODWA 2BXYA 2V9RA 2XIDA 5E8PA 3UCRA 5IFHL 1YJDH 3DVIA 1KTRL 5INCA 2NY5L 5FOBB 4NDMB 4I77L 4IOIA 1R3JB 1FFPA 5IIEA 1CU4H 3QPXH 4BQ6A 3W39B 4RIRA 5FGCE 2X4NB 2AJUH 3D87B 4U6XA 5E2TL 2R1XB 3QDGD 3VXNA 3LV3A 3DOSA 1SEQH 1J0JA 1H5BC 2Y36L 4P3DB 5IT2H 3IF1B 5FYJH 5T33H 3SDCC 1MHCB 2NX5D 3QHFL 5F6HI 3QEQE 2XXMB 3D2UD 5IJVB 3QPQD 1D5ZA 5FYKH 3FTGA 3LN9A 5CJ5A 4RZCA 5IG7B 1LO0H 4F15B 1HCFX 2W65B 3F58L 1HNFA 2GSIA 1FFOB 1LO2H 1KB5H 1KFAH 1X5HA 4TQEH 5KG9A 1HKFA 5TQ0L 2ZJSL 5I1HL 2O93L 2BRRH 2IALB 2UWEB 3IT8D 4JRYB 3UYOD 2E7LA 4KI5F 4DGIH 4LQFL 3HR5A 2AXFA 4QY8A 2BVOA 1SHMA 2VITA 4I4WB 1PVHA 5KS9E 5DFWH 1A7BA 5L2KE 4P9HH 3MV9D 4UUJB 2GEEA 5D71H 5FEBA 5F6IC 4FXLA 3KJ4B 1GZQA 1MCBA 3O6FB 1SY6A 4EDWH 5BS0D 1V7ML 1VA9A 4UT9L 3EHBC 2OQJB 3QEGL 4FZ8L 5ISZA 1S9VA 3QXAA 5TE4L 3O2DL 5DLMH 1HH9A 4NKMA 4XMLL 4OLEA 4AM0B 1MFEL 4NN7C 4HV8A 4PJGF 4QXTB 3P40A 4U05A 1QFWI 1S3KL 5SWZB 3VI4F 3UJIH 4O02H 4WFFD 4Y16D 3STZA 2JB6A 2QQQA 4HJJH 3KYOB 1CFTB 4LAQH 3ULUE 3O8XA 3IFPB 4GRWF 2HMIC 4OZIB 1DJSA 3WFZA 3ZE0E 5I73C 3IS0X 4CADB 5BVPL 2IAND 3RGVB 1KENL 3GBLA 2C7UB 3EBAA 2MFNA 4LOUD 4RAVA 3MGOB 4PRPB 5BVJA 2XA8H 1MCHA 1MJUH 1W8OA 1HHKB 4B5EA 1EEQA 4WFGD 4XXCC 5F89B 5JHDD 4NQXB 3DUUA 3R8BB 1WT5A 5JNYA 1NAML 5E8OA 2XZAL 5ILTH 3FKUS 1X9QA 3R1GL 2V5MA 4W68A 1N5YH 5T1KD 5ID1A 2BCKB 3CFDB 4A2MA 2NTSP 1NAMB 3TH2T 1NC4D 4Q9BA 2AJVL 4U7MA 1RZKC 4ESKA 3KPLB 4PB9H 4QGTA 5SX5K 2CGRH 4XTRC 4X8XA 1BQUA 4DCQA 4KJPD 5FCUL 1IGFH 5E5UB 3U4AA 2LTQC 2EYSA 1TLKA 1UA6L 3HNSH 2OS7A 2WNGA 5E2UL 4G9DB 2R4SH 1UWGL 4FFVD 4NCC2 4LGSB 1AR1C 5JDJA 3EJYC 4NQTA 1VFBA 4PBWD 4KC3B 1RMFL 4LSQH 4YNYA 1ZWIB 5ISZE 3BKCL 4RDQF 5K9KA 3MMEA 4XP5H 1N64L 3OPZL 1WIUA 4X6EB 3QXUA 4U1SA 1JZ5A 2XQBH 2MCG1 3GM0A 4YC2C 1QNZL 2R0WL 2PW2A 4NIKB 3TN0A 3FB7B 1IT9L 5FUZH 5BW7A 1VGEL 1CVSC 1WICA 3LS5L 2E27L 4KKCD 1UZ8A 5F1SA 1DL7L 3O6KH 4PRBA 2H32A 2QADB 2R9HD 4PLNC 4KI5C 4M3JA 2Q1EA 1UVQA 2JIXD 4ODTH 4P57A 4JFDD 4NKOB 4MGXA 4Z7UB 3VRLE 5GS0H 5I1AB 1ZAGA 3F12B 5FHBL 3GRWH 4YHIA 3CJJA 1HK6A 1OWRM 3P9LA 5F7LB 3UTZB 5LKNA 1AY1H 1GHFH 2VLKA 3RA7L 2XKNA 2WMPA 3PJSB 4NP4H 5LBSL 5DURD 3TJEL 2XWTB 2AJXH 2NY3C 2EE3A 3V5HB 4EUPH 5IJKC 1WBXB 4I3RL 4PR5A 1FL6B 4ETQB 4KJYA 1T1YA 3HZYA 3BIAX 5FB8B 5FECB 2J2ZA 2QHRH 4M7JL 2PO6A 4WO4B 2PNDA 3BP6B 3O6MH 1KIQA 1YY9D 5EU6B 5GGQH 2A77L 2R1WA 1U3HD 4DTGH 5AEAA 3FOLB 1S7RA 4R4ND 3L5JA 4R3SB 4D8PB 2EYRA 5LGHL 1TVDA 1IM3B 5MEOB 3HAEG 4LU5L 1CXIA 3MRPA 3BKYH 5ECJE 1JTPA 1CGTA 1BFSA 1YNKL 4I0CC 3OKLA 4MCYA 4PGCA 2XZCH 4L4VA 4XP6H 5E0QA 5I0ZA 4GAYA 4U0RC 3BAEH 4X4YB 4JFOA 2ZCHH 3IU3B 3SPVA 5DJAB 1NH6A 3F7VB 5GRUL 4GXVH 5IK3B 4M1GL 1T4KA 2X70B 5DHYA 3VFSA 4LVOB 3NMEA 3QO0A 5GIRA 4W6WB 4PRAB 4G80A 3ZDXF 5KVDL 2AK1H 3L3OA 3HUJF 3KDMA 1ONQB 4XGZB 4HPYL 3DGGA 2CJUL 4LNVA 3QNZB 3NGBB 4P59H 3SN6N 1A0QL 1KXVC 1EHLL 2Q8BH 4FZEL 4AEEA 1Q8MA 3GJFA 4LARL 4WEMB 1D3CA 2FL5B 2HLFD 3DX7A 2VLKE 4OZHA 3GK8H 5E4IA 3A6CH 4P5KA 1T1WB 2YBRB 4KRMB 4WFED 3GMOB 4JJHA 3KWWA 4TTDD 4Z7VA 3VCLB 2H8PB 1W0YT 2NY4D 5JDSA 1WBZA 4NQDD 2DKSA 3MRKB 1G84A 1NGXB 3O3UN 3RDTC 1MCJA 2V9QA 2HVJB 1KNOA 1FGNH 1T6VN 1JWSA 1ADQH 3VXQA 4F7EB 3TA3C 3UAJC 2CRMA 1N2RB 2AV7B 3HS0B 3BO8B 3ULSB 1KTDA 1DN0A 4Y19A 5HBBA 1VPOL 2X05A 4LSUH 1JGEB 5DJ2A 4Y4KC 1NCWH 1HQ4A 2X4OA 4L4VE 4U3CA 3REVA 2R2BA 5HSFA 3FT4B 5D1XB 3NZHH 1JV5A 4GW1B 4MS8D 5T5NF 2A6JA 3QIUB 3ARWA 3Q3GA 1QHOA 4PJ9C 1BD2A 3UBXB 3NIFF 4HK0B 2UVEA 3DV4B 3OJ2C 4L1DA 1MLBA 1NEZG 3MLYL 4HT1L 4QTIH 1NBZB 1CFVL 3OSKA 4N8PA 4PJBA 4WV1C 5F88B 1RJLB 2ZUYA 3O4LA 4XB8A 3SE4C 3B5HA 5JA9A 4JQXC 4YIQA 3X12B 1F3DH 5IFJB 1H3XA 4MNHA 3OHXB 1E4XH 2WM0A 3U1SL 4QCIA 2OX5A 4J7RA 3K1KC 2P5WB 4AMKL 4GW4A 4XPFL 2NY2B 1D5IH 4OZHE 3MJ7A 3WJJA 2I60L 1FVCB 5I1CH 2OR9L 3QXTA 3CDFA 3EYVB 4HMCA 5D9SA 4X7SL 5L7XH 4LF3A 4KQ3H 4HWZB 2EIZB 1WVZA 2V2XA 4UQ3A 3KYKL 1DANU 2IBZX 3OJDA 4Z7VE 3SOBL 2I27N 1T03L 3WN5A 3RFZC 4NBYB 4HUNB 1L6ZA 1J8HB 3C2SA 4OF5A 2FJHB 5SV3A 3TM6A 4PP1C 3IDJB 4NZTH 4KJQD 3LB6D 5I2IB 5FK9B 5DRZA 1NC2B 1A6ZA 2LVCA 1E4WL 1G7LA 4YXHL 2ZZUT 4K3JH 2C1OA 2A74A 3RWIB 1UB6B 4CMMA 1MNUL 2ZUSA 3ARXA 4OF6A 5T1LD 2DS4A 4Y19E 3SE3A 1HIML 4LIQE 1PBYA 3HPJB 1UXSA 2OXGA 1NCBH 2VWEE 5ICYA 4PRIA 1J8KA 1OAQL 2EYTB 1QSEB 1RY7B 4P5MA 4ODSH 5D7JA 5C0AB 3BKMH 4OD3H 3TWCH 2ATKB 1FE8L 4ETYA 4F8QA 1DUYA 2GT9B 2VZSA 2A6KB 3VFPA 3QJHB 1KCKA 2COQA 4YX2H 1F4XL 3HE7B 3RBSA 1OT1A 1BD2E 2F5AH 5I18H 4JFQA 4J6RH 3RNKB 1KB5A 2J88L 4PJBE 2IG2H 4KAQL 1CLZL 3O4LE 2QR0A 2VXUH 4YK4C 1VCAA 3W81A 1NLBL 3NCYS 1P5UA 4CJ0A 4QRRB 2LAGB 4PGZA 1F4WL 4NQCD 4OUOA 5E8NA 5ITFA 2FRGP 1P84K 5CJOL 4P5TC 1GJIA 3U36A 4NT6B 4ONGH 3KYMA 5HHOA 4OV5A 5JMRA 4NO2A 2Z4QB 5FIEA 1CFNA 3MRGB 4YHOL 3M17B 3WKNA 4W4OC 5CEZL 4HF5L 1RUAH 1D7FA 4MCZA 5F3BA 5ADPL 2IFFH 3T2PA 2RQ8A 5KTEH 4ZFZA 2Y1VA 3KNBA 4QRTA 3BIKA 4JM2B 1EK3A 3SO3C 1I7TA 3H3PH 1YMMB 3TH3T 3IKCA 2AKRB 3LHPL 4XNXH 3UTPE 2ARJA 4YE4L 1DUZB 3BD4A 3HMXH 4QHMB 1IARB 2AERT 4ENEC 1FZMB 3FN0L 4ISVB 1DQDL 4FQPA 3WS6C 5C0RL 4XWOD 1B90A 5A1AA 1ORQA 3MRNA 1DQLH 5ITBL 4ZMAT 4WVRA 1MAKA 4I13B 1P4LB 1FC2D 4MJID 4LEOB 2ORBL 1RIUL 2G5BB 3U6RA 2A6IB 4LSSH 1JZ3A 2W9LA 3VFRB 1CF8H 3BDYL 4FQIL 2YXMA 4TVSa 2YZ8A 1FVDA 4TSBH 4GAGH 3VFMB 4I48B 3NCJL 3VXSA 2FO1A 2HT2C 5J6HA 3ARGB 3VGGA 1C5BH 3RZCD 2FX9H 2QADC 5MENB 3G04A 5IEKA 3TZVA 1ZS8A 1JPTL 3VXPA 2Q76B 4JB9H 2AVGA 5F72S 4YHZH 2B4CC 2AS5M 5GGVL 1CLOL 5HHOE 4A6YH 3VH8G 2Y07L 5HGAB 2DMBA 3S7GA 5LWYL 4BYHA 1MRCL 3N1PC 2GITB 4ZNCD 3V5DA 5J6GB 3C87A 3GMRB 4WU7A 2CD0A 3QHZL 2YZ1A 3HPLB 2PETA 4Y5VB 3PGCA 3RWFB 2PYEB 1AQDA 1D6VH 1BAFL 5I30L 4UTBH 4C4KT 4N9OB 5C08A 3ARFD 3GSQB 1MHCA 1GVIA 1B4JL 1B6UA 3BSZH 2O5ZL 5IJVA 2C26A 1QBBA 1KCLA 1OTTC 4KVCL 3GRWA 2BZDA 1FSKC 4NHCL 4FFZL 2BOBA 4YHKH 3SEPA 3TBVA 5JMOC 3ARUA 3JWDC 4N0CC 4OD1L 3CFCH 4U1GB 3NFNA 4FMKA 2YUWA 3AMLA 3CFBA 4GS7B 3FQNA 2IALA 1G9NH 2ZCKL 3EFFB 1JK8A 4JPWH 1EFQA 5TE7H 2N7AA 3TO2A 1XF3A 3ZT5A 3MQIA 3BYTA 3MA7B 1UFUA 3AVEA 4EKXA 1CDHA 4HS3A 4GAJH 2Z93B 3ARED 2J8OA 2BNRD 4PGDB 1KEMH 1A1MA 4M8QB 2IGFH 4YBQD 4J12A 2VDKH 4WFHD 1CXLA 1N7ML 5GS3A 1MREH 5LQBH 2IPTH 2OBGA 2DWDB 3UX9B 1SVCP 3OX8B 4LPXA 3VXSE 3O6FA 1BBJA 2W91A 5GS1C 5D93B 1ACYL 4HK3J 5E5MB 4JPKH 4XBEH 2IPKB 3O0RL 1D6EB 2R1YA 2BVQB 5HTSA 3ZKND 4M6NL 1A7NL 3JZ7A 5LJYH 2KL6A 1IBGH 1KJ3L 2M8XA 5GZOC 4QXTA 4GMTL 2DBLL 3O2DA 3U46B 3BW9A 2DN7A 4XHJC 3V2AR 2J6EH 4JFHD 1MIML 4TUKH 3QXDA 3S3PA 2BERA 3OXRA 4PJIA 4U1HA 2PTVA 3ZTJG 4ZOEA 5C8JB 4LCWD 1CGSH 1MLCB 5C08E 3FFDB 5J7CC 5IMOA 4NKDA 3MRQB 2JJUA 1J9CT 3FFCB 1DP0A 4LVNC 1SBSH 1QBMH 4IJ3C 5KSAC 2E7CA 2XI9A 3RWJB 3IXTA 2Z31B 3HG1B 1JUFB 1ZTXL 4S1RL 4Y8DC 2CDGB 4C57C 3EKCA 2NXZB 2FEDD 4LSDA 2BCKA 4YZFE 4CW1B 1IM9B 1LMKA 1FNSH 5HYSA 4XNMA 1ZT4B 2ITCB 3B8SA 4KZEH 2I5YL 3W2DL 1P4BL 5GQBA 1QFUL 1YDPA 4ODBD 2GTWA 1G7IA 1QLFA 2EO1A 3IDYC 3VFGL 1T6WA 2BX5A 3NFPA 5IB3A 5DJ0A 4N8VA 3IVKA 3VGHA 1IC5L 5IHUH 2X4PA 3G08B 1RK1B 2KQMA 4O9HL 3ULUF 5BJTB 4AG4H 4XCFL 4R26L 3SGDH 3L6FA 4J3WA 4X5XA 3GSRB 4G6KH 3TIEB 4HWBH 4GMSH 1WCBB 4JZNA 3MJGX 2IH3A 3V4PL 4EN3D 1EFXA 4P2YA 1T1ZA 1KJMA 3T4AA 5DDHB 2AAVA 1ADQA 4JKPH 2SEBB 4ZDHA 5TFSH 4C56D 1T5XB 1PG7X 1GOHA 1CVRA 3AM8A 1I1AD 3TO4A 3PL6C 3LSOB 3EDEA 3BQUD 1A3RL 4RGMC 4K8RD 2Q3ZA 5ENWA 5ANMB 1V3KA 4MZ2A 2FWOB 2QSCL 1LEKA 2VXTH 1IAMA 3NH7L 5BMFL 3SKMB 2M2DA 4AT6B 1AE6H 5HHMD 1I7UA 1MPAH 4PJIE 1QFWH 5EU4B 1ZLSH 3IKKA 1A6VH 3A67H 4RAUA 5LGJB 4OCRL 1E6OH 4M62H 4M5ZL 2NY1B 3HC4H 4K7PX 3VGDA 1IGTA 4HKJA 4HUKB 5FO9A 3MZTA 1HILB 3ARDA 1A8JH 5IHZB 3QUYB 3TVMB 4F33B 4N90E 4X6FB 2DRUA 1S7QA 5A2JH 3O3EA 1KUMA 1P6FA 4MVBC 4PREA 1I1RA 2FBJH 3ZKXB 4JQVC 1AFVH 3EDDA 4Q0XH 1Y18A 2YC1A 3Q0HA 4QXUL 3UROR 1FRGL 4J4PC 2AI0L 2XTJB 4ZQKA 1ETZB 2HRPH 4FFYH 2HT4D 4WWKC 3LRSB 2HJLB 3GSNH 5LVEA 2BDNH 1KPVA 4WO4A 5J1AA 3D5OF 3MA9L 5EBWB 3W0WA 3MOBL 5L9DH 1AXIB 2GSGB 3EO1A 1U3JA 4XP4L 3RX8A 4N1CA 4WDIA 4JREB 1U8KB 2HLAB 3QCVH 2VIRB 4LLUA 1UYWH 3CCHA 5IR1B 3KHOA 4DOHB 4YQXH 2HFGH 3WHXA 3DV6A 1HEZB 1G7QA 1RU9H 2X4SB 5CGYC 5J8OA 4K94H 3VRLF 1DQML 3QIBB 1OD7A 1TMCB 2XYCA 1ZOXA 5DUML 4UB0L 2XQYK 4HJ0D 1M05A 3EHBD 1Z9MA 4HIXH 3DRQB 3C60C 3EYSL 1CQYA 3FQXB 4V1DB 4WHTB 3WO4B 3ZYZA 4OFYD 2FJFB 4HX1A 1IGMH 4CUCA 5I1DB 1FG2B 1VEPA 3QDMB 2OSLA 4UNUA 3UJTL 5D7KE 3QIWA 2OI9C 4POYA 1T22B 3FT2A 3ULUC 3QQ3A 5E70A 3IJSB 1RFDH 3KPQB 1QOKA 4GKOA 2DQGH 4XPBH 1GIGL 1T1WA 1G7PB 3PDDA 1FV1A 1UGNA 3ARBB 3CH8A 5DQJA 1YPZB 3V0AC 3GMOA 3RP1A 3JV6B 1B6DA 3FQRA 3LOWA 3O11A 3LY6A 5SX4I 2D03H 2VXSH 5CSBA 4QRQB 3W0WE 5EORH 2FR4B 5DHVB 2MPAL 3V52H 1A1OA 4OZFH 1FJ1B 1UADC 3B2VL 1WFOA 2E7LC 2X4QB 5MP6H 2EDTA 3B5GA 4D9QE 3BWAB 1ZA6B 2X7LB 3MCLL 1CDBA 3UP1A 1HHGB 5DZLA 3BP7B 1AO7A 4F7CB 3PWPA 4XBPA 5FYKL 3EJYD 5TDPA 4JDTH 5BZWB 3RGHA 1OARH 5I74C 1VFMA 3ARGC 3MRCA 5E4EC 1K3IA 3LAFA 1MY5A 3HMXA 5AUMA 1BBDL 3I6LE 2R39A 4OCXL 3S35X 2APFA 5GJTH 3UTSB 4GG8B 1ES0A 1BQSA 4OGXH 1WCQA 4MAUH 1CDJA 1YEIL 1KXQE 4H1LG 3QUXB 4P9ML 1RJLA 3D39B 1DBJH 3HB3C 4MQ7A 4WCYH 1AXSB 2ZNWA 2AEPL 3LKPB 3INUH 1CICA 4CU6A 1KB9J 1ZVHA 1AXTL 2LU3A 1BFVL 1A47A 4KRPB 1CTNA 1A7QL 4N5UA 4OM0H 4UILL 4CU8A 4KKNA 3CSPA 1I8KA 2P5WA 3SGKC 2A73A 2JB5H 2Q7YA 1WIOA 5DYOB 4FQ1H 2QBWA 4PRDB 4KKBC 2OJZL 4N8CL 4JZOB 2BJMH 3MTRA 3GUTB 4RMUA 4HWZA 3O2WH 2EIZA 1N5AA 2DLFL 3C5ZB 1RHFA 3T3ME 1MQKL 5D1ZC 2DTML 4IS6B 4PG9B 1ZGLA 3O41B 1WT5C 2CXGA 2NY3D 5DFTA 5KW9H 3S96A 4KROC 4OSUH 2HG5B 3SE9H 3V4VH 5FFLA 5AYQA 5E6ZA 1HE7A 1B2WL 1KYOK 5FK9A 1NUGA 1L7IL 3O3BB 4D0DA 3UTTB 2Y23A 4N0FA 5E99H 3QEUB 2OXHA 3QUZB 1GC1C 5AZ2L 3MLUL 2F9BT 2K7PA 3KLAB 4KHTH 3MBEB 4O58L 5KVEH 3RWIA 1UB6A 3BXNB 5IWLA 4Q9CA 1CR9H 2AJSH 4K3DH 3QQ4B 3K4AA 3NOIA 3L5WB 4YDJA 1JPSL 4LSVL 4U1JA 1NL0L 5F1IB 1AO7E 1T1XB 3PWPE 1UXWA 1BJ1J 4P3CH 3OKKA 1EMTL 3FL7A 5H8DA 1N5YL 5AD0A 4E41D 2AJYL 2GT9A 2VDLH 2EH8H 4OGYH 3U4BL 1JN6A 3D0LA 4P2QB 4EXPX 4PJDA 5KVFH 1J0KA 3NPSB 1GSMA 1W0VB 1MI5B 1A2YB 1ZLWH 2O5YL 1EA9C 3VE0B 3MLWH 4Z7VF 3MOAL 4G43B 4LLDA 3LS4L 3TN0C 3T0ED 5BW7C 7FABL 5DVLA 1Y6MR 4QRRA 3QFDB 2FEEL 1UEYA 1LK3L 4R2GC 4L8CB 3VWJD 5AYUL 4HZLB 4LHUB 1I9JL 2ZOLB 4UQ2B 5IOPB 3U79A 4HPOL 3ARZA 4EI5B 3NZ8B 1AGDB 1J0IA 1ZHLA 3X3FL 1XGUB 3QT2A 3QG6A 3NN8A 2OJEB 1MRDH 5CIPH 4ZPTB 5IFAL 4XC1L 1T5WA 4PJ5E 3RAJH 1SBBA 2P8LB 4RMTA 1XZ0B 1NUFA 4GKZA 1Q1JH 5DFVD 5JA8B 5E1HB 5JQ6H 1ZVSB 3MUY1 3SKUD 2KPNA 4JY6A 5INDB 1J5OH 3A6BH 4GG6B 1BVZA 1JWMA 2FBOJ 3DX8A 3F65A 3IDNB 4M7LL 5D7LD 3TV3L 5C07D 4PJBF 4LPUA 3IDXL 5CFHA 1JGVH 2R29L 4XB7A 3I85A 2IQAA 5DJXA 3OAZH 1ZVYA 4WEBL 1RSFA 3ISWA 1S9YA 1CIDA 2ADIA 2Z8RA 1VADB 3N9GL 3BZ4B 4LCYA 1RZJL 1I3RB 1NGPH 5MERA 4P99A 3NCYP 1YQVH 1HSAB 3MXWH 2G9HB 3TFKD 5F7DA 3FB8A 4PJDE 3M1BB 4EUPB 4F7MA 1YPZF 5KSVB 3Q1SH 2P24B 4WNQB 1JHKL 4FQXB 5CILL 1D9KB 4ZAKC 2VAAA 3DRTA 2Y5TB 1WTGT 3W9DA 4GRLA 3FRPA 5MI0B 4PLJC 3VFMA 1YYMH 3OJMB 2BSED 2I9TB 4RISL 4BFIB 2EEBA 4L9LC 4GKSA 3PWNA 3ETBF 4IMLB 1NFDB 2XWBB 3BEVA 3P73B 5IMMB 2DI7A 3F7YB 3ECBA 5J13B 4NNPH 5DVKA 1V8HA 4BH7A 4X7FC 3Q5OA 4Y4FB 3MRLB 1HZHH 4HWBA 1X6LA 4JO2H 4IRZH 5L2JB 4IRSC 5GRXG 2FD6H 3QUYC 1EXUB 4XI5D 5MEPA 5E8EA 4L3EA 3GMRA 5LXGL 2WWKT 1Q94A 4JY5L 4JPIB 4G3YL 4LLQA 5D7SH 4M6OL 3HPLA 1I3GH 3MCG1 1X3DA 1GRWA 1U8MB 1FYTB 2PYEA 3CZFB 3GDBA 4GXUM 1NFIB 3VD4A 2GJZA 3H0TB 4NNXA 4L3CB 4DKFH 4UDTB 4JE4B 4GSDL 1N0LA 4NO3A 3AS3A 4KGJA 4PP1D 4UIMA 2DYPA 5E5RB 2R15A 4NYLB 1P7KB 2E8YA 5IB1A 5F9WC 4JRYD 1FZKB 3DVNB 1JCKA 5ACZB 4JN1H 1T2JA 3RWHA 4YBLB 2EDQA 4TULH 3C8KB 3O3DB 1GZPA 3SJVA 3HAEB 3W11C 2X09A 1YEFH 3LQAL 3GBNH 3Q48A 2VQ1A 3F6LA 5IEHB 2VWEC 2Z93A 4ZFOL 2ZSWA 4M93C 4TSCH 2PTUA 3CSBA 3OAYK 1KLGA 4JRXE 3P0YL 4ZFOB 3GSNA 2HFFA 5HHNB 1HINL 4OLXL 1OW0C 5D2LA 4JCMA 1WWBX 2VERN 3QWOA 1R5VA 5EZIH 1FZOA 5C0CA 2N4IA 4BZ2H 5CEXA 4IM8A 3KPNA 5BO1H 2O61B 1AD9A 1RZ7L 1NGYB 5TDNA 2BVQA 3NA4A 4QF1A 3PGFH 3H8NA 4WUKH 4ZUWB 4XCCL 2VISA 2KH2B 5DJDA 3RIAK 4KK9C 1DFBH 2QQLH 2BHZA 2R4RH 2BY3A 3VDBA 3UZEA 2QKIA 2P1YA 4L3EE 1MRFH 2GHWB 5FV2A 5DO2C 1RULL 1T3FB 2VC2H 1PG7L 3RWCA 4MAYA 1A6PA 3GMQB 1KJ2H 4LRIA 4KZDH 1Q9LA 1RK0A 3QWRA 3V6OA 1G7HB 3VMNA 3LCYA 1PKQA 3UO1H 1S7VB 1SYVA 1GAFL 3AGVA 4KJWC 1WWWX 4M7ZC 3OGCB 1KBGL 3MRQA 4DN4L 2P5EA 3DIFB 3C09C 3WNPA 2IAMA 2XPGA 3GEWB 1KOAA 3MBXH 1RUPH 2OL3H 1IAOA 2VJXA 5DK2B 5DI8A 3MUJA 3TBTB 3BP4B 3RUGB 1JYNA 3HI1B 3LEVL 3NFSH 2NR6D 5EFIA 2IBGA 4NZUH 1I1FB 2XN9B 3SJVE 5F9JB 2EC9T 4ENED 5IHBA 1J0YA 5I1IL 3B2UD 3SE3C 1A7RL 3BGMB 1A4JA 1CZ8H 1BVKB 1NSNH 2B20A 1QO3A 3QA3A 1F97A 4R4FL 3U9UB 5D7JC 3QH3B 4G8FA 3UPRA 5C9KA 2UYLA 4GBXC 3WXWL 1KG0A 3DARA 5D2LE 1DBKL 4XCNB 4DQOH 5FKAB 4EI6B 1TQCB 1WUNT 5C0CE 1TTFA 4F9PC 5C86A 1Y0LB 2YN5A 4MQTB 1F11B 4OCWH 1NEZB 4OZFA 4OTXL 5CINH 1OP9A 3C5SB 2HT2D 3LH2H 1VGKB 3MRJA 2QADD 5C71A 3D25A 4LFHD 2IBZY 4P9HC 4XNUH 1ZKAA 1J1XL 3WFCH 2G75B 3T77B 5FGBA 4DKEL 1OP3H 3BH9A 1QBLL 1ED3B 2B39A 3DSFH 1UKQA 3V6OE 2X4UB 1PKQE 3F7QA 5F7UA 3FO0L 1CYGA 1R24B 4ORZC 5FDWA 5KANG 4U31A 3BOVA 3QNYB 2ZG1A 2IMNA 4O51A 3BPNB 1XF1A 2P5EE 5TF1H 2DQFB 5T3ZH 4D0BB 1SEBB 1SYSA 5A40E 1IAIL 3GSXB 3E6FA 1EUUA 3SKJL 3ALWA 3P4MB 3G9VA 4Y5XB 3L3JB 3MBEC 4NZDA 1MJJA 4X7TB 1NFDF 1T21B 5EU6D 5HYQB 3KVQA 3VXMA 4L29B 4AYFA 5BXFA 43C9A 1TVBB 4JG1H 1J7VR 3W5MA 1Q0XL 2FLRT 4PJCB 3KLSA 1U8KA 4G6JL 2B0SH 4LL9A 4RX4A 5H37G 2XRAL 3DYPA 4BZYA 4BQCA 2BC4B 4HCRH 4G6FB 3NPSC 5GRJH 3JWOL 2B7DT 2X4SA 3BGFB 4NJAL 2EIEA 3RIAF 2CIIB 1TNMA 4JN2B 4JQIL 4MNGA 5JZ7D 3AS2A 1ZANH 5FM8A 1DLHA 2F19H 4I18C 3BZEB 3MV8B 4NO0D 4H26B 2W1NA 2DWEB 4WENB 1C7TA 4ZPVA 1EEYB 5E03A 3K3QA 2A1WL 1R3LA 4YGVB 3B9EA 3ZMRA 5ACLA 1AKJB 3TZVC 4B53A 1H15B 5JPMB 3QNXA 3WUWA 5GZOD 4HXAH 3BJ91 5JW3L 4QEGA 3MYJB 5DSCB 1YECH 1AQKL 3EAKA 3I50L 4JFZH 3IDGB 4XHJD 1LE9A 5ETUB 4OT1L 2YPVH 4EIGB 3GSWB 1IKNA 4U1KB 1I1CA 1YNTB 1OAZL 3AXLA 1Z5LB 5IVZB 1I4FB 3CU7A 4K7PH 4CRPA 4XP1H 1G0DA 5E24E 4LSRL 3SDDB 1QA9B 3IFLL 2NZIA 1BF8A 1I7ZB 1HH6A 3RY6C 3R4DA 4QTHB 1VKXB 2VZ3A 3NPZB 5I1JH 4MNQA 2VDRH 3VWKA 4RAHA 2IJ0C 3D85D 1IGCH 1A4KA 3VXUE 2PN5A 5I75C 3QZWA 3O6LL 5KSAD 4Q9RH 1K4DB 1K5NB 2CO7B 4U6YA 3VXME 1MCKA 5GS0C 4A6YB 4KTEL 5F8QC 1XF2B 2F53A 2AEQL 1JZ7A 3NA9H 2B2XL 2M26A 2GFBA 5IGXL 2B5IC 4XP9H 4X4XA 4EJ1C 5GZNC 5HGBA 4FQ2L 12E8H 5FA4B 4JFFA 1RUML 1QSFA 1LD9A 5DR5H 4I5BA 3OG6B 4MNGE 1MAMH 2DQTH 3ARYA 4Z95H 3QIUD 3TBSA 1QTYT 2EDRA 2DJUA 4RRPG 4XVJL 2A9ML 4D0CA 3U30B 3IETA 3W9EB 4QXGH 2J8UA 2XNAA 1U95B 2AEIT 3KJ6H 4OCLC 4D94A 4NJ9H 1J1OL 1LO3L 2NW3B 2UUDH 3ZDYE 3C9NB 4S2SB 3RL2A 3MODH 1QRKA 1INEL 1YEGL 5FM5M 3RWEA 3PL6D 1HQRA 5DMGD 3VH8B 2AV1A 4RFNC 5FYLL 1ZT7B 4Q74A 5H2BA 2BOCB 4XNYH 2OLDA 2ICWB 5SWSE 2NY2D 1OGAA 4KKLD 4ALAH 4XWGL 5KVGL 1C5CL 2X5PA 2ZP0T 1F42A 5ID0B 3SDAA 1S5HB 5CZXD 5E2JA 3PV6A 2NLJA 3K80A 4LCCA 3WIHH 5IESH 4MNQE 4XVSH 3L9RA 3NVQA 5TGBA 4QHNB 1J8HD 5IB4A 3S5LG 1ZSDB 2HKHH 2Q86A 1BQLL 4C54A 4Z77B 4MVBD 3ULVL 3H9SA 1IKFH 1TJIL 1MFAH 5ICZA 1U2HA 1BOGA 1JGUL 4P2RB 3PV7A 5I8KH 5IBUG 2F53E 4K3HA 1OHQA 4PYGA 1WFTA 2G5RA 2YUZA 4WWKD 1P1ZB 4Q9QL 5SX4H 3JV4A 4TYUA 5IROC 5L8KB 4HH9A 3L7FB 3QDGB 3Q6GH 4O5LL 1QSED 3QFJA 2WK2A 3BDBA 3PE9A 4OLYH 3NCMA 4JFFE 4KMTH 2HKFH 3ZTNL 4ORGB 3MV01 1JHTA 1QSFE 2YD1A 5CJBA 1YEEH 1RUQH 2NX5B 4NSKB 3D2UB 5T5FH 1NGQH 2ZCLL 1HHIA 3GIZH 4CNIB 1QEWA 2J8UE 4NNYB 4I0KA 5J11B 3N85L 2DQJH 5CBEA 4P2QA 3EYFA 5C0BB 1A5FL 1URLA 3GMNA 3ORJA 4XPTH 2BSRB 3S35H 1U8JA 3ZSSA 5LAXB 1KCRL 1G7JB 3AM8C 3ROOB 3TO4C 4CGTA 3S88L 3C60D 1RAMA 3LKOA 4U1MA 2JF1A 1TJGL 3CSYA 3MRBB 3PWUB 1OGAE 2VLRA 4WW2B 2EKSA 3ALXA 4J1UA 4NUJA 1T0NB 3H3BC 4NZRL 4WU5A 1TJHH 1UM4H 3QUKA 1FCCA 4JO3H 4XAKD 1FDLL 1XCTB 1I9IL 5EN2A 4PP2A 3CFIC 4G5ZH 1CFSA 5BS0B 4UV4H 3G9AB 3OQ3B 2V7HA 4DJMA 1JGLL 3U9PH 1N4XL 4G8GA 3ULUD 4FQQB 4KWUA 3ARDC 1ND0A 1A7PH 4NN6C 3WDJA 1GOGA 3L1OL 1V7NH 4PS4H 1BEYH 3ZE1F 2ID5A 3C2AH 2BFVL 3H9SE 1CGXA 5E9DA 2X41A 3GI8L 3WYRA 1LILA 2VN7A 1HXYB 1MY7A 2CIKA 1FFRA 1YMMD 4JFEA 3AU1B 3DO7B 4H5SB 1MPAL 1BMGA 4Y2DB 5D7IB 4ELKA 4R4BA 4NM8H 3IB4A 5TPWL 4TRPL 1OSPL 4ZODA 4L5FH 4JO4L 1A6UL 3QFJE 4EIZC 3BMWA 3QXVA 4X98A 4LLYA 3DSNA 4NN5C 4D9LH 1CLCA 2YSSA 1FFNA 2DDQH 2Y25A 3NAAH 3RTQA 5JHDB 1N0XH 4Z78A 5C6WH 1MCPH 2EIDA 4ONFL 1F6FB 1JNLH 2OL3A 3L3KA 2AABL 4NC0B 3KYNB 5T1KB 2HTKC 1K8DA 3BVNA 4NUGH 4EXKA 3KPSB 4GQPH 3NIDF 5HVWA 1H8OA 1NC4B 2EE2A 3ARGD 4JHZA 5C0IB 3GI9L 4G9FA 3WD5L 3CVIH 2VKXA 1DQQB 3SCMB 2OMNA 3SKOA 1OSZA 5ISZD 4K7PY 1F3RB 5FF6A 3HTLX 1QVOB 5I19H 3V6FB 4TVPD 2VLRE 5KJRL 2NXYC 3EW3B 3E8UH 1A22B 1YY8B 3HB3D 3P73A 2BRQA 1BQHA 4OCSH 4OGAC 1DBBL 3HNVH 4AJ0A 5GJSL 1UQSB 1JNNH 2OK0H 5I1LB 4AL8H 1YMHB 1ROWA 3GO1L 5DS8B 3PP4H 4G8GE 3QIWC 5I71B 1KGCD 2RFXA 3TP4A 5BZDA 2GUOB 3L5IA 4KKBD 2FO4B 4CBPA 5E9DE 1HHHB 1YZZA 1NLDH 1RVFH 2I9LA 1F4HA 5C0GA 1WZ1L 1MVUA 1MHPH 5T3XD 4JFEE 3U4EB 3BZFB 2X4TA 1U58A 3R06A 2CDFA 5GHWH 3IFNL 4PJDF 3STBA 3TCXA 2VDPH 4NWTL 5D1ZD 3BKJH 1F13A 4YR6A 1TETL 4KROD 4UINH 3B6SA 2IADA 3BFOA 1ZHKB 2F58L 5BV7L 3FQWB 5A2LH 4NQEE 1E28B 1L9MA 2C3VA 1R5IB 2VXVL 1FZKA 1U9KA 2DQUH 5BV7B 5ACZA 1FBIH 1S7TB 3CH1A 4B7IA 5DJCA 4KPHL 4RFOL 5I16A 4Z0BL 3LDBC 4UIKL 3HAEA 1NMAL 4F7TA 5HI3C 4PY7A 5I66B 3ZDZE 1QLEL 4NM4H 3H9HB 4OZGB 4Q6IB 5JIHA 4MXVE 1JFQH 5E00A 4G9FE 3GBMH 1IL1A 1R5WA 2FX7H 1U3HB 2VE6A 4OFVA 3T0DA 3FB5A 3WSQH 3QRFM 2FX8H 2Z35B 4U1IB 1NMCB 1UEMA 2DQCL 1MWAL 5I9QB 4M43H 1CLYL 5AZEH 5TH2B 3TBWA 3GB7B 5JXEA 4HFWA 3BESR 4HCRA 1MWAB 4LSTH 3TYFA 3WFEL 4OZ4B 4DGYL 5C09A 4MDIB 1QYGH 4U33A 5K93A 1KSRA 4Z8FL 2RB8A 3TJHC 2WBWB 1FFQA 1NKOA 4YDLC 1G7HA 3FFCD 3QDAA 5D70H 3FONA 5IQ7L 1CFQB 5DWUH 1F8TL 2ICEA 1PX3A 2VLKD 5SWQA 1CG9A 1B0RA 5CEYB 2Z31D 2EE6A 3HG1D 1E4JA 4BKLA 5HGHB 3MUGA 1MF2L 2WBJA 2NXZD 5EZOL 5A16B 1IFHH 3QUMH 5I15H 1JHLL 1I7RB 4BSWA 3C08L 2VH5H 1MFCH 2BMKB 3RUGA 1MUJA 2ARJQ 2QQKL 4CVXA 1BVLB 4WW2F 3I6KB 2A0LC 3L7EA 3Q5TA 4MJ6B 5IWLC 1J1PH 5T3ZE 4PGBB 5IVXA 4WUUA 3S3JA 4XXDB 3VXRB 3T65B 1N6UA 2DMKA 2BSTA 2VDML 1U41A 5T5NG 5GGRY 3LMJH 5EH1A 3OV6A 4KK5D 2B1AH 1E6JL 2NY4B 3MJ8B 5HVFB 3QULA 4HHAA 2MCPH 3V0WH 5D6CB 3M8OL 5BOPA 1C5DA 3SGEI 1MEXH 5E6IA 3RVVC 4BSVB 1FLRL 4DVBA 4K9EL 1YEHH 1G7MA 4XCYA 5KN5B 1S9XA 5DRNB 2QTEA 1SVZA 4MX7B 1AGEB 4YXLL 1F58L 1PW3A 4ZAKD 1G9NC 1M7IA 5EOCL 4H1LB 4M5YH 1G9EA 3BPCB 4F80A 3DROB 5K33A 3EFDL 4PLJD 3MRMB 1BJ1H 2FDBP 1FGVL 3G5YA 3RWGA 1XIWA 4NO5B 4GT7A 1IC4H 1WAAF 5C09E 2EC9U 3CK0L 3IFOA 3BPOB 4JO1L 4S0SD 5IB5A 2AXGB 2DL2A 1BX2B 4DUXA 1FIEA 1G1CA 3KPMB 3EOAB 2VMFA 1K6QL 3TBYB 4Z76B 1KELH 4G7YL 4KMLB 2QQNL 2BK8A 4IRSD 5EZLA 3QUYD 3TVMD 2ATPB 2AK4B 5B8CA 4H88H 4NC1E 5IBTH 1CGUA 1CT8B 1UM5H 5D1QA 3ILPB 4Y1AB 1LNUB 3MROB 3TNMA 3WS3B 1NBYB 4KHXL 1P69B 4OBSA 4LFHG 4PRHA 2HTLC 2AJ3A 4UT7L 4NOBA 4OJFH 1T7XA 1EVTC 4XHQA 2OM5A 3V6ZA 2Y72A 4X6BB 3IAGC 3MLXL 4NBZB 3WFDH 4R7NB 1EBPA 2PR4L 5E2WH 4MSWA 4L29A 4P2OB 2CRYA 5IVXE 4WUUE 3VGFA 4OIIH 3VW3H 5DD1H 3CUPB 1GGIL 1ZV5A 3K4ZA 4AIZA 3PP3H 4AEHH 4MLSA 4X9GA 2R0ZH 4PJCA 2RAMA 4FTVA 4YXKL 2FHBA 3KPRB 5HGDB 5KSBB 2E6PA 5GS2H 3G5XB 3QIBD 4NKIL 3L3HA 4U2ZA 3VG9B 1JBJA 1L7TL 3F8UB 1CL7I 4CN1A 5CJQH 1Z2KA 4RA3A 4JR9L 3LN4B 2IH1B 3JBG7 1JNHB 2X1OA 5T1LB 4GRLC 4K3GA 4MB3A 5F1KC 3BN9C 5I76B 4LASH 2AGJH 1TCRB 2E6QA 1AKJA 1A9BA 1HI6B 2G60L 1ZLWK 3QDMD 1H15A 1YQVL 1FNEB 3RPIA 1RUKH 5IBLC 3BT2H 4KU1A 2JJWA 4FP8L 2NY7H 3NCEB 2G2RB 1TQBB 2ZUXA 4O2EA 4PTTA 2EDKA 3B9KA 3FO9A 3KXFA 5DO2D 1UB5B 1BFTA 5DD5L 4WI4A 3X11A 3S4SG 4BZ1L 3F5WA 2BY1A 3ARBD 5MEQB 3WEXA 4L1HA 3JTSB 5ESQA 1F4YH 4PRHE 5J3HD 2MQCA 2YOCA 3MRDB 1VKXA 1RPQA 1IRAY 3U2SB 3WL9B 4QOKA 3OKOA 4D3CL 4HDIB 3MNZB 4KTYA 1QQDA 2VLLA 4GJTB 5F7FA 1OAYH 1TENA 2FD6L 3JWDH 4OLUH 1B0GB 3WKML 3ZKMC 3IDIA 4OB5H 1HOCB 1FH5H 4NQSA 4OF7A 2GK0A 4FTVE 4LLVB 1T2QL 4X4ZA 1XAUA 4PV9A 2KBGA 4M1DH 5E2VL 3BD5A 3OAZK 5FYJD 4XRCB 5CZVL 1K8IA 1WISA 1OTUC 4UDUA 5KSUB 5D7JD 1RIVL 1N8ZB 1J88A 1U36A 1SJEA 4GBXD 5CBAB 3SCMC 5FYKD 1U91B 2OZ4L 3OB0K 3CDGB 1Q0YH 2O5XH 4RGNE 3EO0A 4ZO9A 4E0RA 3D39D 2NW2B 4K3EL 4PV8A 4PGEB 3G6AA 6FABL 5C7XH 4LDEB 1P2CB 4Q6YA 2UY6A 4IRJB 1WWCA 1UCBH 4UAOB 5E1AA 5IB2A 4H8WH 2BVYA 2FB4L 2XWJA 2L0DA 2ESVB 4L8DB 4RFEB 3MRFA 5F9OH 3UPAA 4CDHA 1HSBA 1QD0A 4K94C 5FO7A 5I71C 2DQEL 5KBNC 3U0TB 3VFNA 2V17H 4J3SA 1DZBA 2CLZA 3KXFE 4MA1C 3BMVA 3I6GA 5B38G 2X40A 3GHEL 5HHOD 4WI5A 4MAYC 4LRIC 5D5MA 4X0KA 1TIUA 3U7YL 1UCTA 1UJ3A 5JR1L 1N3NA 4O2FB 4X6CE 4QHUA 3V6OC 2P44B 2GJ6A 2F54B 4I9WD 2LABA 5BRZA 3C5ZD 4JFPB 3RZCB 1GGBL 1I8MB 4ZFGL 4ZD3L 2RR3A 5HHQB 3OAUL 3EGSB 1M7DA 4EDXB 4HIEA 4QOKE 1G6RL 4WRLA 2IAMC 2W60A 5JPNB 3EOYG 1HDMA 4MA8L 1UH3A 1OL0A 2Q87A 3V6BR 2VABA 3IJHB 1LO4H 1KT2A 1X5IA 1G6RB 1H8SA 1LK2A 2JJSC 3CVHH 4OQTH 4EOWL 1IVLA 3STLA 2FLBT 4YH6A 3MBED 1NJ9A 4LKXB 3V0VB 4QRSA 4OI9A 3ZDYF 4U6VH 3S36X 5EUOA 3MACH 1KJ2B 1FNFA 1JF1B 4XPGH 3OR7B 4TUJA 1SMAA 1AIFA 5CSZA 5B4MD 1JPST 5DMIH 5H94B 1FO0L 4Z18A 3HZKA 2NX5A 1R0AH 4P46A 3IAPA 5TDOA 3RWDA 3S34H 5CGMA 2VL5A 5HDQL 1FO0B 1MI5D 4ZTOH 1U8QB 3QR2A 1OAKH 1OAUH 4JHAH 3FHAA 2Q6WB 1C16B 5F7HA 1F02I 3GMLB 3BWUC 4L8SB 3RX7A 2V5SA 2L7UA 3V4UH 4BELD 3CC5B 1WZKA 3VXSD 4I3SL 3FOMB 3LN5B 3GJEB 3ES6A 2PW1B 4Y88A 3HE6B 3I2CH 4HKZB 5MHSD 1XGTA 1YNLL 1OTSD 2BNRB 4X9BA 4LHUD 2ADGA 4RMSA 3CXDH 4JAMA 5LCVH 3QAZC 3MV9A 4YUEH 1PQZA 2QSQA 3WLBB 1MOEA 4EI5D 1JZ6A 4C58B 4MMXC 1U8IB 5FGBC 2P4AB 5D5ME 5KSBF 1OT2A 1RHHB 1HN1A 2APWA 2P46B 2GJ6E 4WI9A 2IQ9H 5BRZE 2PYFA 3EZJB 4JFXA 3G6JA 4KUZH 2MHAA 5HYEA 3IDMB 5F7EH 4AEIH 3J8F7 1J05B 1PYWA 4HFUL 1S8DA 4TUOB 4S1QH 4BK4A 5L8LB 2X2YA 2E3VA 4X9IA 1D5XA 3NTCH 3TH4T 4Y16A 2J8UF 1DBAH 1PY4A 2DD8H 4YFLF 2JK5A 4PJXB 2D4DA 3VG0H 3OKNB 4M7LT 2K3TA 4LDOB 4HUUB 5EUOE 2EDHA 4LCWB 5C0EB 2IANA 4NCDA 1JP5A 4JGMA 3PDOB 1BM3H 2P8PB 3O9WB 3X14A 5FXCH 1IQDB 1XFPA 1OCWL 2XZQL 4K23H 4ZOCA 5TQ2H 1XCQA 1AH1A 2W59A 3TT3H 1A3LH 4O2CA 1LE5A 3B8YA 4PB0H 3WIFA 4YHLH 1U8PA 4H0IA 2ITDB 1LO5A 1MCDA 2FYYB 4JGJA 3WLWD 3WIIH 5FM4A 1WQVT 3K2UL 2DQIH 3EO9H 3QUMA 4QYOB 4QRUA 4FQXD 1D9KD 1N59B 3B9VA 3JTTA 1I75A 3WHE0 1QR1B 5DQ9A 5D96C 1M6OB 2FIKB 3OGOE 4ZSOA 4GQ9L 2UZYB 5EU3B 4XAWH 1MIEL 2RCSH 5D8JH 3OMZA 4P4RB 2ZPKL 2R0KL 4JG0L 2ZUWA 3V7AG 3LEYH 3MV9E 3UJJH 5IMLA 1INQB 1FNAA 1P5VA 2BHUA 3MX0A 4HIIB 5DD0L 4OF3A 1BFOA 1YEJH 3VFWA 5IQ9A 4M4RA 1UM6H 3IJYA 4EN3B 4R97B 3OKEB 3G6JE 2GTZB 5DRWA 1IKNC 3MGTB 3THMH 1FG9C 3PF2A 4R90L 4G7VL 1U8NB 4C56B 4K8RL 1FYTD 4AENB 3RVTD 4HS8H 1OP3K 4YO0B 2FJGB 3DBXB 2V7NA 5T1DL 3MNVA 4K71B 1I1AB 3BQUB 1S7UB 3QDJE 4M48H 2Z92B 2VN4A 3CLFL 35C8L 2GI7A 3DI2B 5GGSB 2CLRB 2JIXA 4O00A 5HHXH 3DUHA 2HVKA 3LZFH 4HZAA 2WUCH 1IAIM 4JFDA 4OFKA 2IANE 2DLHA 4ERSH 4LEXH 3SDXB 2YK1H 1VFAA 4XPAL 1E4KA 1IC7L 2Q8AL 5DGQA 5J57B 1X5YA 4KK8C 2C9AA 4CVZB 4WFGE 5CMAB 5L8JB 3RU8L 3HC3H 4PG2A 4RBPK 2VZVA 2VDNH 2CK0L 1H5BB 2Q7NA 3SDCB 2VLMD 3K8LA 3HC0A 2YXFA 1IZKA 1K2DA 4FQCL 4QT5A 4Q9RL 4OI7A 5DRXA 4Z7WB 1KPRA 4ZUVB 2ZUQC 1R3HA 4HUVA 1MFBL 3BRFA 4HKXA 4Y4HC 4ZSOE 1EFXD 3T3PE 3ZYOA 4KXZI 4MXQC 1QRNA 4IMKA 4X99A 5GRYA 5SV4A 1OGTB 5IV2A 3C8DA 3TO4D 1O5DT 1LP9B 4YDVB 4OAWB 3GNML 5JXAH 1Z6JT 1WV7T 4OM1L 4G8IB 4PJEB 2R8SH 4OCMC 1CWVA 5EO0B 2VUYA 4YBHA 5EUKB 2GYSA 3DJ9A 4GLRH 4YHMH 1FN4A 3SDAC 1TZHB 2W9EH 1KCSH 1JRHH 1E4XI 2YR3A 3CPLB 4U1NA 3RNQB 1H3TA 1CN4A 3TLRA 1XF4B 4Y89A 3HI5H 3ZDZF 4NN7B 4ODVL 4TN9A 4MJ5B 5FKPA 4WTZA 5C6TL 2R56L 2ED8A 4FQHA 5C0DB 4RNRA 5CKAA 3MCKB 1ITBB 1ZHNB 2VLJA 1NCDH 1PDKA 4MXVF 2F74B 4JFDE 3LKQB 4RMWA 1FORH 1PGRB 1KCVH 2CKBL 4XVUC 5ALBL 4KQ4L 4G6ML 4HUXA 2PTTB 3T1WA 4UV7H 4WHYH 4HD9A 3SDYL 1M71B 4GKNA 5EOTB 2CKBB 4TOYH 4H25B 4EBQH 1L0YA 4MJ6A 1FL3B 3TT1H 3SKNB 2EZ0D 2JELL 1XH3B 5IF0A 2CPCA 4WI7A 2YKLH 5HI4C 2R69H 3PABA 3RVWC 4XXDA 5DUPH 4EQ2A 4DEPC 5EIIA 2J4WH 4NQDA 2IC2A 1CE1H 3GGWA 5E08L 3IU4L 4D9QD 4Z5RA 4YHPA 3KPPB 1IEBB 1RZKL 4PUBL 1D5BA 1QRNE 4MA7L 5FUOL 4UAOC 3GHBL 5DMJB 4ZS7H 4PJHB 2V9TA 1RURL 1RIHL 1VEMA 2X6MA 2ED9A 3FJTA 3BPCA 1F90L 3CSGA 3I6LD 3NACH 3E6HA 3MRMA 4LLWB 2P8MB 2LTQB 3PIQB 4WJ5B 4OUUB 3ROLB 2UUDK 5CS7A 3QG7H 4KUCF 1JGDA 1BX2A 4OGAD 3VI3E 5HYFA 4MD4B 3KPMA 3EOAA 5D2NA 3L3DA 2CQVA 3FO1B 4UU9B 1TVHA 2FGWH 5F7YC 3EOTL 3REWB 1FIGL 3H7BB 3G6DH 5CD3B 4YC2B 3HZVB 4AH2A 3S5LB 3ILPA 2VLJE 2R0LH 2CLVB 1R3IH 1Z0MA 3CMOH 2CXKA 2WIIB 2BNUB 4J3XA 4L3AA 3FQUB 4NKQB 4RQQA 4LMQE 5IBUB 1XR8A 2H9GB 2QV2A 5DD6A 1DCLA 1S78C 2DIBA 2XQYG 4S1SL 4OD2B 5E7FA 5M94B 4HQQL 4JHWH 3BEWA 3BHBB 5F97E 5DTFB 3CUPA 1NEUA 1T0MB 5DK0B 1A02N 2A6DB 4JHBA 4WFEE 1NDMA 2Y6SD 3RTQC 2AP2A 4G6FD 4NQDE 2XTLA 2NY3B 5I6XC 1W72L 3N0PB 1ZLVH 3WBDA 3T8XB 4KVNH 4X7DC 3DMMB 1Q9KA 4PJGB 2UV3A 2W0FA 1XGYH 3CVHA 3P4NB 1CE6B 2E6JA 1NDGA 3QJFB 3MREA 2HJFA 4KTDL 3BUYB 1EO8L 3MV8D 3U7WL 4JDZB 4NCC1 4ODXB 3G5VB 2UZIH 4MWFB 4GRWB 4OIAA 2D7PA 1YUHB 3FT3A 4XZUB 3LEXB 5J9PB 4LBEB 4HWEH 4L4TB 1NCAL 1SJHB 2AJZB 3GMMA 5D2NE 4E41B 5DXWA 4YPGB 4JKMA 1JYVA 5BQ7B 1S5IL 1N6VA 3O45A 4G42B 1Q9OA 3UZQA 1Q72H 3DUSA 1I8IB 3D9AH 5EPMA 5DQDH 1OAXL 1CS6A 4U0RB 4FQLH 1A7OH 2YHGA 1DDHB 1UB5A 4JANB 2Y9RT 3SDDD 3SY0A 1EJOL 3TJHD 1LEIA 5MEQA 5EIVA 4I2XB 1KIRA 1P9MA 1XMWA 2EEDA 5DEZA 4Z7NF 4NQCA 5EO1B 2H6PB 3P77A 4NRXB 5E95B 3KR3L 2PXYC 4NWUH 1EGJH 4PJ5D 1DBMH 2WINB 3O9WC 1LP9F 3RQ3A 4ONHA 3QO1B 4PJ8A 3MV7B 1MFNA 5F1NA 1A6WH 1WC7B 5IW6B 1BZ7A 4JZJA 5FAAA 3LKRB 1HOCA 3P9MA 5ADOH 3U7AA 3MLZH 5GISH 3D18B 4KY1H 4JPVL 2H3NB 4NPYB 2W07A 5CUSL 2W0LA 5EU5B 1A14H 1EEZB 4HUWB 2IPUG 2YPLA 3SHSA 3LQAC 5D7LB 4ZTPL 3H42H 4LSPL 3P11L 3RDTB 5DVNA 4XPHL 4H20L 1I3VA 3B9DA 3L3GB 1BIIB 1TNNA 4XBGB 1F3JA 3MRIB 1CL7H 5DEFB 2ZOKB 1OLLA 1YN6B 3TA3B 4L8BA 4MJ4A 3TPUB 1KCUL 3EOBA 4N0YL 1TZGH 3R0MA 5C0FB 3ZT7A 1U8LA 5JXEC 5ESVA 3FCTB 4MJIA 4X6DA 3VDAA 4Y4KB 5DMYA 2XG4A 5FYLD 3MLVH 2VDQH 4XC3L 2JKXA 2OP4L 2EIBA 4ZUTA 3CFKB 1MCNA 3ZL4H 3L5XL 3MLTA 2OTUA 4LNRB 4UTAH 4PJ9B 1PEWA 2DQDH 4XCEB 1SM3H 3C6SB 5GSVA 1ZHBA 1S7SA 4NQCE 1JMZA 1AHWA 4NC1C 4WV1B 1AJ7H 4N0UB 1KC5H 3HRZB 5D72H 4P2RD 1H0DA 2XACC 2WBJC 1E0OB 4IIQB 3VXOA 1C12B 3ULVD 2HTLD 1FLTX 1PLGL 1CD1A 1U6AL 1VHPA 3PWJA 4NGHH 4QWWC 5E94A 2WP3T 3V0VA 5EOQH 4ZYKB 5EC2A 5EA0L 3SE8H 2C3HA 3PNWB 3OR6A 4FN0A 5IKCA 1MJ8L 4ZG1A 3GSUB 5CAYB 3CIQA 2NTFB 3ZE2F 4NHUB 4TNVK 5I1EH 4RMRA 3ARFA 5CHNB 4OFDA 4POZD 2YPLE 2DIAA 1FAIH 1ZXQA 3VJ6A 4DN3H 1IQWH 4HC1H 3B9AA 5C2BL 5CCKL 5C0BD 4G6AC 1I9RL 5E6IC 4HKBA 4JFYB 4OLVH 2J5LC 4X6CF 3CFEA 3LIZH 2Y7QA 1FO0A 2H1PH 5IP4A 2B1HL 1YYLL 3IRZA 3VA6A 5JW4M 3HUJB 1UWEL 1AGBB 3EYOB 4JRXD 4CKVX 3SGDI 4V2BA 5ALCH 4JY4B 1BWWA 3UYRL 4WI3A 4GRLD 3RJQB 4YDKH 2HH0H 4PJ7B 3CC5A 4MDJB 4HGWA 3FOMA 4MJIE 3BN9D 4X6DE 4RWYH 1XIWC 3AREA 4HIJA 1U8OB 1T04A 4BFEA 4OLWH 2ADFH 1Z9OA 2P42B 5HPMB 3OWEA 4DZ8A 2EH7H 5IBLD 1CGVA 4DGVH 4PTUB 2BVPB 2ZSVB 3QYCA 2W9DL 4GXUN 3K2MC 5TE6L 2YPKA 5B8CC 3TYGL 4NRYB 4M61A 2FZ3B 5F71A 1F00I 4YK4B 5D1QC 2CUIA 5FA3B 4QHLA 4N9GB 4BQBA 3WFBL 1KN2L 3MLRL 3PGDB 2FSEA 4IOSD 4NFDA 4C83B 3S8WA 1F5WA 1G9MH 2I24N 4E42B 1D5MB 4LRNH 3HA0A 3GKWL 4LHUG 2EXYC 2R23B 2A83A 4Y2DD 2LU4A 2NZ9D 3CNKA 3MJ9L 3SQOH 3HLAB 3QCUL 4P5TB 1KB9K 4PJXA 5D6DA 3DHMA 4P4KA 1MCLA 4YHNB 5JOFA 5J56B 3CXHJ 5H35A 1J0HA 1MHEB 2DYPD 1BZ9B 1E27A 5JLZB 4LGPB 3QI9A 3CLEL 4LCWA 3WNOA 5AWNL 5EO9A 5HJ3A 5HYJB 3NCBB 1FYHB 5GRVL 1XGPB 3S36H 4UNTA 3HCVB 1F6AA 4U6HB 4YAQB 1FVEA 3VA2C 1OPGL 2YD3A 3KLHC 3S3SA 2YEZA 4HBCH 3BP5A 3KPSD 3HFMH 2CRZA 1OTUD 9CGTA 3SO3B 1IGIH 4OCYH 5ACMA 3SCMD 5CD5C 1NUNB 3JWOC 4XMKH 1HHJA 1FAKT 1KTLA 2FIKA 3VFUA 2QL1A 4DFHA 4RGNC 4IHOB 3WXVH 3KAAA 3DHJA 1IEAA 4M1CC 3BE1H 1MFDL 3MRRB 3C6LA 4WFHE 3PWVA 1FL5A 2Z91B 3HNTL 4EUPG 2ZKHH 2NCMA 4GO6B 1NUDA 4XNQB 4HGMA 3DNKA 5HHPB 3VRIB 5EUOF 3MO1A 4EN3A 1CCZA 1MJ7L 3B9KC 5IFHH 3BYYA 1KIPA 2NY5H 5DT1L 3MXVL 1YN7B 4I77H 3QWRD 3DURB 5EBLB 3K46A 4YO0A 2B4CL 5I1GL 1JWUA 4ZXBA 3VFVB 3BQUA 5E2TH 4PRNB 3O81A 5C0JB 1U93A 4JM4L 5FO8A 4DAGL 3IS1X 2Y36H 4FG6D 4TNVF 1RZIB 1NBVL 2DKUA 4UT6L 5FOJA 5GRVK 5B39A 1CD0A 2D3VA 4N0RA 2Y06L 4ZO8A 5GGSA 2NY7L 3QHFH 1KYOJ 1U8HB 1ZEAL 5A3IC 1X7QA 4J3UA 4BH8B 1WFNA 3F58H 5JO5B 3D0VB 4R7DA 1U92A 1NQBA 1S9WB 2ZJSH 5TQ0H 5I1HH 5CWSB 3DMMC 4HS6B 2XG5A 5JORA 1L9NA 4LQFH 3T09A 2V2TB 1P7HL 3PP3K 4RGOL 5K59F 1DSFL 3S37L 5A2FA 1NAKL 4MD0B 3T0BA 2YUVA 4M6AA 3U0WL 5HHVL 4I0PA 1FSKB 4GW5B 1NGWB 2YS4A 1V7MH 3P0VL 4UT9H 1ZT1B 5HYSG 4FZ8H 1W0WA 3D3VA 3GIVA 3VD7A 1KLUB 1DEEB 5TE4H 2GCYA 3O2DH 4XMLH 4KRNA 1MFEH 5L88L 3V79C 4JJ5B 1IGYB 2BSSB 3DETC 5DJZB 4ZUSB 1DQJA 2Y5EA 1RQ5A 1S3KH 4N8VG 4PJEA 4HIHA 5L6YL 3MUHL 2VZUA 3LRGA 5ESAA 3I02A 4PJAA 5E8DL 4ZFFB 2I07A 1UJ3C 3S4SB 1PZUB 5GS1B 4NO0B 1KN4L 5BVPH 1KENH 1A6AA 1F6LL 4QRPB 2BNQB 2NNAA 3PHQA 3RL1B 4FABL 3QISA 1KIUA 4ZOAA 1ZA3A 5JUEL 5DEGB 1A6TB 4OFYA 5HHME 3N50A 3ZKQD 3MR9A 5GGTL 2E7BA 1BGXL 4PJ7F 4L9DA 5GRZA 2HJKB 4J3TA 1J12A 5EZJA 1NAMH 2XZAH 5JW5B 1RJYA 3R1GH 4M7KL 4NRZB 3HKFA 3T3PF 1V05A 3VXUD 4ODUB 2H26A 2DM3A 2CKBA 3D69B 5IMKA 2DJ4A 1T7VA 3VXRD 1N6QL 1TZIA 4R96A 2AJVH 2A9NL 1EAPA 4MA3B 32C2A 8FABA 3AAZA 4HAFA 4HLZH 3E3QE 1AD0A 2X4RB 5FCUH 1WSST 1Q9WA 4LVNB 2HFTA 5GSRB 3D85B 4IJ3B 1KPUA 1PZ5B 3DVGB 3WFHA 5KSAB 1EGJA 1UA6H 5IW1B 5E2UH 2OTWB 4P46C 3DTXA 1UWGH 1FNGA 5I1KL 2CO6B 3QPQC 4F2MB 3V5KA 4ELMA 1RMFH 2NPLX 3D3VE 3J7HA 1GYAA 3PQYB 3BKCH 5DJ6A 3MNWA 1RJZB 5F3HB 5C3LD 4WGWB 1N64H 4FXGA 3OPZH 3RVUD 5C92A 5L0QC 5HYIA 1KACB 5C9JA 1QNZH 1XF5B 2R0WH 3IDYB 2R2HA 4KXZH 1IT9H 4MHHI 3FB6A 1VGEH 3U0PA 4PJFA 3OKDB 3LS5H 2E27H 5F96L 4XNZB 1SJXA 4PJAE 2DQHL 4D2NA 1DL7H 5B38B 3L3IB 2LQRA 4Q2ZA 2AK4D 5ICXA 3MFFB 2OMBA 1B9ZA 2X1WL 5SWSD 3CFJA 3SO5A 4APQB 5FHBH 4FHBD 4ZUUB 1P4IL 4Y1AD 1JI1A 5HVHC 4LLMA 1DVFA 1U3YA 4K2UL 4NQVB 5CLTA 5GGUA 5HGGS 5DUBA 3N1FC 4IIQC 3IAQA 3PL6B 4P49A 2P7TA 3RA7H 3L95A 4RGMB 5LBSH 3TJEH 3HRPA 4Y16C 4PLKD 4F3FA 4HBQA 3BPLB 1QKZL 2FATL 3TNNB 5DMKA 1T7YA 1FPTL 4I3RH 4P2OD 3C5JB 3TIDA 1HWHB 3GMPB 2JJVA 4WIQA 3I3EA 3DXAA 4JDVB 4M7JH 1R3KB 5DTFA 1ITCA 2A77H 4KK8D 1T0MA 3ZHLA 3KPRD 1IGJA 2O26U 5ERWB 3KYAA 5FGCB 3QEHB 4YFLI 5LGHH 1MH5B 3DX9A 4LU5H 4IDLA 3VFOA 3VI3F 5J06A 3MLSL 4JFFD 4YWGL 4ELME 1GGCL 3FRUB 4K7FB 1QSFD 1YNKH 2C1PB 2ED7A 3OXSA 3QEQB 1W72A 3TC9A 4WWKB 5CP7A 1C1EL 2CDEB 4Y4HD 1X5FA 1MVFA 4HXBL 3D48R 2HFEA 4JDZA 4MXQD 5GRUH 3RY5A 4M1GH 1UZ6E 2I26N 3G5VA 2VR9A 3HI6L 4PJFE 1CDCA 3PXHA 1L6XA 4P23A 3P30L 4WI6A 4PB0L 2EDBA 5KVDH 3LEXA 4HC1A 3MRHA 4EVNA 2VOTA 5KS9B 1RZFL 4HPYH 2CJUH 5L2KB 3OF6D 3FQTB 3HMWL 2ADJB 1A0QH 1EHLH 4XH2A 4FZEH 4X5WA 3SDAD 4OKVB 4LARH 1A1NB 3ESVF 1HXMB 5EWIL 4X80L 3T0EA 3C60B 1JPGB 2OR8A 2VDOL 4LCUA 4I2XA 5IM7A 3PDGA 1EERB 1I9EA 1ORSA 1XGRA 1BLNA 3WE6A 3VWJA 1NGZA 3H9SD 1QPXA 3ULUL 4ODWB 3DXAE 2YRLA 4HEPG 2RJMA 2BXZA 5E8PB 4G8EA 3PHOA 1PX4A 1E4KC 1FZJA 5INCB 2OI9B 5B3JE 2WUBL 4IOIB 1F2XK 2XFXA 5IIEB 1WWAX 4RIRB 5K9JL 2WANA 4FXKB 1T20A 1YC7A 4F7PB 4U6XB 4PG2C 3VXNB 3LV3B 2HYMA 5FUCC 3PWLA 3QFJD 1Z3GL 5HI4D 4FQJL 3RVWD 5DVMA 5T1MA 1VPOH 1SMOA 4M6ML 3ILQD 5EU5A 4YDIL 3UC0L 2VXQL 3T2OA 3DX6A 1F45A 3BH8B 1AGCA 3VI4E 1HYSC 1D5ZB 3FTGB 4MQXC 4RZCB 3I3BA 5C07A 3UPCA 1EZVX 2FH6A 4O4YL 5DC0A 4PRIE 1YY9C 1JPFB 1HKLL 4LVHC 5KG9B 1OB1A 4IRJD 4IMKC 1CXHA 2FEEI 2JTDA 1OQOA 2AW2A 5F8RC 4HT1H 3MLYH 2ESVD 3HR5B 2AXFB 1CFVH 4QY8B 1JF6A 2BVOB 3O2VL 2MOVA 2VITB 5I8EA 4LKCA 2DLEA 3T4YA 1SY6L 1NMBL 4Z0XA 3U1SH 1X5ZA 4I8DA 4F58L 1OF2A 5I74B 2F54D 1GZQB 4R0LA 5E4EB 5HY9A 4AMKH 4XPFH 4TVPL 2JCCA 1PSKL 5ISZB 1S9VB 3T0EE 2I60H 15C8L 4KKAC 3QXAB 4R8WL 2OR9H 1A9EA 1HH9B 4DW2L 2F15A 3C6SA 3B3IA 3H2WA 4HV8B 4X7SH 1VENA 5HDOA 3KYKH 3GSOA 3SOBH 5E9DD 1T03H 1AI1L 1DR9A 4N5ED 3STZB 2JB6B 4PD4K 1OQXA 4JFED 3M07A 5FOBA 3NABL 4NDMA 3T2NL 1R3JA 3W39A 3ABZA 2X4NA 1E4WH 4UOW0 5T3XL 4XMPL 4YXHH 2R1XA 3N1MC 2LU7A 1MNUH 4P3DA 2DTSA 3IF1A 4RAVB 5BVJB 4NQED 1WGOA 1HIMH 3FMGL 5D1ZB 3RTQD 4TTDC 1OAQH 3DUUB 1EH9A 3GSVB 5IG7A 5JNYB 5HI5C 4KROB 5E8OB 5JOEA 5C07E 1GC1L 2W65A 4HMDA 5ID1B 1FFOA 1GL4B 4YHYC 1F4XH 4X9HA 4YFDB 2DICA 2UWEA 3OKYA 4JRYA 1KEGL 2J88H 3HE6D 1OVZA 4I4WA 4KAQH 1CLZH 4DCQB 1NLBH 4UUJA 5DD3L 4U1LB 2GK2A 1UKTA 1VFBB 7CGTA 5CJOH 2ZUUA 1WITA 2D7TL 4YNYB 2OQJA 2JCCE 1LDPL 5D2NC 4ZS6C 4MS8C 1OP5H 5K9KB 3MMEB 4AM0A 2IWGA 4I3GA 5IVOA 4YHOH 4U1SB 1TPXC 2CSPA 1NANH 5SWZA 1T0PB 2IBBA 2PW2B 3FRPG 3TN0B 5CEZH 1SJVA 4MJ2A 4HF5H 1EO7A 1VEOA 4H8WC 3ME0A 1QR4A 5ADPH 3KYOA 1CFTA 1UZ8B 4R2GB 2J12B 4PRBB 1GPOL 2H32B 3IFPA 2PXYD 3QP3A 4OZIA 1UVQB 4MXWL 2VB5A 5DVOA 4P57B 4CADA 3O4OC 5KAQF 3RGVA 3O9WD 2YD5A 4XX1E 2C7UA 2HWZL 3MGOA 4PRPA 3LHPH 4PBXA 4YHIB 5KS9F 2RHEA 4GFTB 3P9LB 4YE4H 4Y0GA 1WBYB 1HHKA 4KUCD 5F89A 1DQDH 4W4OA 4NQXA 5C0RH 2VLKB 4KH2A 2XKNB 4W4NA 1DLFL 5T3ZD 5ITBH 3CFDA 1GOFA 5JOPD 3OZ9L 1NAMA 5IHLB 3LB6C 4PR5B 2UWEE 2DB8A 2ORBH 1RIUH 1T1YB 3HZYB 4JRYE 2K1MA 3LPFA 3KPLA 4PFEA 2V5TA 1KIQB 3BDYH 4FQIH 5I8OL 2R1WB 3NCJH 4XNZC 2EYRB 4G9DA 1FC1A 1Y6KR 2DJSA 4AIXA 3ZE0F 4AY0A 3MRPB 1JPTH 1ZWIA 5GGVH 1CLOH 4APQC 3OKLB 4MCYB 4PGCB 2Y07H 4XNQA 1FP5A 4L4VB 5LWYH 1JF5A 1LVEA 4X6EA 5C09D 1JTTA 3EYUL 1UACL 1MRCH 1MCWM 1WEJL 2E9BA 4FNLL 4JFOB 3FB7A 5SWZE 3SPVB 4ZAKB 2VR5A 3T08A 4Y5YC 3LQZB 3QHZH 1T4KB 3WHE1 3EDKA 5DHYB 1AGFB 3VFSB 3QO0B 5GIRB 4DVRL 4L9LB 3BPLC 1BAFH 2V5RA 4G80B 5I30H 3T0VA 4B0MM 3L3OB 1G1YA 4OZIE 3RY4A 3KDMB 4NKOA 1OM3L 4Z7UA 3DGGB 4OGZA 5I1AA 3F12A 4F57L 4LCIL 1B4JH 4PRPE 4IRSB 2WIMA 2O5ZH 5CP3A 4PJ8C 3UEZA 3UTZA 3CX5J 3GJFB 4KVCH 5FHAL 3DX7B 4NHCH 4QWWD 4FFZH 4YFEA 3PJSA 4OZHB 5JO5A 2WP3O 2XWTA 4OD1H 1CBVL 4P5KB 5JHLH 3V5HA 1CXEA 3SDCD 2ZCKH 4WUUD 2XY1A 3ZYJA 1T83A 1WBXA 2APXA 1FL6A 4ETQA 3KWWB 5FB8A 4Z7VB 5FECA 1WBZB 2ICWJ 4WTXA 3BP6A 5EU6A 3MLPA 1N7MH 1CTOA 1NCCL 4G6AD 5E6ID 3MOQA 3FOLA 1M7XA 4UBDC 4R3SA 4D8PA 2QEJA 4ODHL 5B22A 4GW5A 5F9WB 1KNOB 2W0PA 4B7LA 1JWSB 1IM3A 5MEOA 4NOFA 3VXQB 1ACYH 1H3PL 4XWOC 3RIFK 4LIQL 3RPKA 3O0RH 4QGYA 1KTDB 4UOJA 1DN0B 4M6NH 1A7NH 1MCOL 1KJ3H 4WY7L 4Y19B 3A6OA 5DJ2B 3T1FB 1XIWD 4OFPA 5J4MA 4GMTH 3X3GL 1HQ4B 2X4OB 4OCNC 5HDBE 2DBLH 3REVB 2R2BB 4M93B 1XT5A 4TPRL 4X4YA 3IU3A 5DJAA 1MIMH 4OIBA 1JV5B 3F7VA 1A21A 5IK3A 1BIHA 2A6JB 2X70A 4JVPA 3Q3GB 3QRGL 1BD2B 3GJFK 1GXEA 4PRAA 4V2CB 2CMRL 1INDL 1MLBB 4OZFG 1AHWC 1QUNA 4PJBB 5D1QD 2YMXL 3O4LB 1RV6X 1ONQA 4XGZA 4YIQB 4Z7UE 3QNZA 4OI8A 3UXFA 4OLZL 2GY7B 4MNHB 4PRHD 2F8OA 2HMID 4QCIB 2FL5A 2UZXB 1I8LA 1ZTXH 4S1RH 4GW4B 3VRJB 3D1MC 4CMHC 2F5BL 4TSAL 3MJ7B 3AB0C 1YEKL 2I5YH 2YBRA 2ZNXA 5D9SB 3W2DH 1P4BH 4LF3B 3KPOB 5F6HJ 1QFUH 2V2XB 4UQ3B 3VCLA 2H8PA 3OJDB 4M7ZB 5HPOA 5FGRA 3VFGH 3C09B 3MRKA 1NGXA 1YJDL 3WCYA 1GH7A 1IC5H 5EU6E 3KLHD 1JE6A 2PCPB 1KF9B 4PGJA 4O9HH 4OBRA 1CU4L 2HVJA 3QPXL 4R26H 4XCFH 4OKDA 5DRZB 1A6ZB 1NCUA 2AJUL 4F7EA 2E8ZA 3V4PH 1SEQL 2C1OB 1N2RA 2AV7A 4XTRD 2A74B 3HS0A 3BO8A 3ULSA 5CD5D 5F3HA 5IT2L 5FYJL 5T33L 1GCFA 2EDXA 1JGEA 1EJ6A 2WLYA 3V7MA 4BM7A 1XF5A 5ICYB 1UXSB 3FT4A 4PRIB 3HHRB 1AR1D 3AREC 4M1CD 1A3RH 1LO0L 4P5MB 5D7JB 5D1XA 4YBQC 3DLQR 3JUZA 4EQ3A 2HT3C 2QSCH 4GBXB 4GUPB 4GW1A 5BMFH 1LO2L 1DUYB 1KB5L 1KFAL 3QIUA 4TQEL 3VFPB 4M02A 3UBXA 2BRRL 1MCFA 4HK0A 2AEWA 3DGCR 3DV4A 4JFQB 5A2IH 4DGIL 1IMHC 1KB5B 1NBZA 3KXFD 5F88A 3CAFA 4OCRH 4M5ZH 4D9RD 2QR0B 2DIJA 5FCSH 3X12A 1O7SA 5IFJA 4P9HL 4HSQA 2VZ1A 5D71L 3OKMB 3OHXA 5F7NC 4KI5D 2MQ3A 1QZ1A 3O8XC 5E8NB 5ITFB 3WUWG 2IPUK 2I25N 4EDWL 3U36B 4GRMB 4M9OA 4QOKD 5D6DC 4ZNEA 5HHOB 4P4KC 1FVCA 1FRGH 4QXUH 2AI0H 4OV5B 3A0OA 5DLML 1QG3A 2XKUA 3EYVA 4NO2B 5HXMA 3QI9C 1H8NA 5A3ID 2EICA 1CFNB 4MHHG 3MA9H 3UJIL 4O02L 3MOBH 1EAJA 4MCZB 5F3BB 4XP4H 1J8HA 2FJHA 3MV11 4HJJL 5FDYA 3IDJA 4U7SA 3RIFF 3DMMD 4PJAF 4LAQL 4ZFZB 4N1HB 1MH5A 3KNBB 5I2IA 1NC2A 3DO3A 4QRTB 3BIKB 5GGVY 3QZWG 1UH4A 2FEDC 2VO5A 1I7TB 3CU1A 4QNPE 3IKCB 1DQMH 5JW4Q 2XA8L 2ARJB