3WTYA

Crystal structure of the complex comprised of ets1(g333p), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
118
structure length
118
Chain Sequence
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
total genus 17
structure length 118
sequence length 118
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtyA00
5G4OA 3WTXA 1EAOA 2BIMA 3KMDA 1T4WA 5AOIA 2X0VA 1KZYA 4XR8C 4G82A 3US1A 3D0AA 1UOLA 3VD0A 2XWRA 3IGKA 4IBTA 3WTSA 2GEQA 5G4MA 5A7BA 2J20A 3WTYA 2VUKA 4AGPA 3IGLA 1LJMA 4LOEA 3WTUA 2J1ZA 5G4NA 3Q06A 3ZMEA 4AGQA 2RMNA 3EXLA 1TSRA 3D08A 1YCSA 3D07A 4QO1B 4AGLA 2ATAA 2IOIA 2BINA 3D05A 5AOMA 2BIPA 5AOJA 5AOKA 4MZIA 4IJTA 1GZHA 2J1YA 3QYMA 4IBUA 4MZRA 4HJEA 1IO4C 4GUQA 3Q01A 2ADYA 3WTVA 2PCXA 5ABAA 4AGMA 4GUOA 5LAPA 2IOOA 3D06A 1E50A 4L18A 5ECGA 3Q05A 5AB9A 1HJBC 4IBZA 3WTTA 3VD2A 2FEJA 3VD1A 2X0UA 2J1XA 4IBYA 1HJCA 1CMOA 5LGYA 2AC0A 2H1LM 4IBQA 2BIQA 5KBDA 2YBGA 2BIOA 4L0ZA 3D09A 4AGNA 5BUAA 2OCJA 2J21A 4IBWA 3KZ8A 5AOLA 4L0YA 2P52A 4LOFA 1H9DA 3WU1A 3US0A 2J6WA 4IBVA 2WGXA 2J1WA 1HU8A 4LO9A 1EAQA 2IOMA 4G83A 3QYNA 1TUPA 4A63A 3WTWA 2MEJB 3TS8A 4IBSA 4AGOA 1CO1A 2AHIA 2XWCA 4KVPA 1GZHC 2X0WA 1EANA 3EXJA
chains in the Genus database with same CATH superfamily
4JFYB 4M6NL 1NFAA 5HYIA 3ULVD 2DWTA 4YBQD 2GK0B 4ZG1A 1QTPA 3MRLB 3UBXG 1CI5A 3T4YB 2Y72A 3JT2A 2DQFB 1CXKA 4QT5A 2B5IB 5E9DB 1UD5A 2QR0B 1IX2A 3MRMA 1OK0A 5IBLD 2KLSA 3EFFB 1OK8A 5JW4N 5F7EL 3ES6B 2XY2A 3HC0B 2H45A 3OX8A 5FS5A 4PGDB 4F91B 3AG3B 4C57C 1I8MB 1D5XA 1JWSB 1RZ7H 4MQTB 5EU4A 5T5FL 4FOMA 3WS6C 1D5RA 3EF7A 2XTLA 3DKHA 1SQMA 1BZQK 4FMKA 2BJML 2WKLA 4XH2B 1FORL 1OGPA 4XCFH 4CA4A 1Q90A 4TSAH 5GSRB 4PJ7B 1O6SB 4PQXA 1J0HA 4PP2B 3UG3A 2PYEE 1SHXA 1KJ2A 1MI5B 1NC2B 1CICD 2GJZB 2V9UA 3MLPA 1X5LA 2CO7B 3EYSL 1A4KA 3L7FA 4X6CF 3O41B 1MHPH 3FT2B 4GOSA 2EAEA 3NN8B 4M7JH 3ZKNC 4OQTH 3ULSA 2BS71 1AGCA 4G72B 1TJIL 3MNZB 1JZ6A 5INCB 3L3HA 2CK0L 4KTGA 1DVUA 1GOHA 1RPUA 2HT4C 3IGFA 1VPOH 1N59A 5EU5A 5KAQF 4G9DA 4PWGA 4B96A 3ZHFA 3E3QE 5IMOB 4X7DC 3VU2A 3BC9A 4GUOA 2F54D 2ZOUA 4AC4A 2VXVH 3ARUA 1WTGT 3NUKA 3TO2A 4YGAB 3DGGA 1S7VA 4OF5A 4CC4A 3SPVB 2ED7A 1YNLH 5E5LA 3DX4A 2QMKA 4BSWA 4MYPA 1E0OB 1PVHA 1RIVL 1SBBA 1Z5LB 4JGUA 4UQ3B 3IMVA 5C0CA 3QJOA 1IQDB 1DJYA 2WLHA 3SQOH 2Y3AA 4L3EA 2XV2A 1BW8A 1CLYL 2PWEA 4EBQH 4E36A 1E5YA 2LOEA 2OP4L 2E7MA 2R69H 5FUZL 3KPNA 5J7CC 4GKOA 2D7NA 1EXHA 4NFBA 1AO7A 3IF1B 4L0YA 5EEZA 1ACYH 4QHKI 1T03L 4UILL 4NN6B 4ZMVA 4QHKJ 5GHWH 3T65B 1AMXA 2WQRA 5F9WC 4AQEA 3S48A 5DT1L 1BV8A 2R9HC 3P73A 1FQ9C 1KCKA 3HZYB 3ARDC 4ZMYA 4JFEA 4LFHG 4EIZC 4NUGL 1WCBB 3EOAA 3DX0A 4HWZB 3D85D 2IANA 4JREB 3M17B 2V37A 4TULL 5JXEC 2MJWA 2B5IC 5LDSA 1AI1L 3NCXA 1YEFL 2NNRA 3O3DB 4POYA 1OM9A 5FPIA 4M7LH 1W8NA 4PJFA 5BZXA 1CFMA 1NMAL 3NIDB 4MJHA 1KY7A 4PM1A 5I0DA 1ZTXH 2GUYA 1YYLL 5E8PA 1R0AH 4Z23A 3FNKA 4LLDA 2OMVB 5A2AA 1JVKA 1QFWH 1HEHC 3AQXA 3CN3A 4U1GB 4HKJB 3GSQB 3UPAA 5CCGE 4L3CA 3W37A 3IRPX 5HYSG 2LGNA 3DLQR 1UEYA 1HZHL 1ET7A 4RX4D 4MS8D 2VXQL 3E1F1 8FABA 2V7NA 1BX2B 4JFTA 2O61A 1NOFA 3MXWH 1H3UA 5ADPL 3QIWB 1IJ9A 1XGYL 1IC7H 2GSGB 5CHNA 3N1GC 4YIQB 5EZPA 5JXAH 5BW7C 4X4ME 1G0XA 1QMUA 2RMNA 3RZCB 2APSA 3DC0A 1R3JB 2W07B 2W9EH 2DBLL 2Y7QB 3K2IA 2BW5A 1CVSC 4YWGH 3LY6A 3J8F7 3AQDA 4Z7OF 4L1DA 3MJ7B 4QMEA 2NCMA 4AXWB 4HF5L 1JPSL 1HSBA 3QEQD 4UQDA 2A6JB 3DYOA 4XP4H 3BP5B 1MIMH 5E99L 4XNXH 5C08E 3VWJD 4G59C 4HK3N 2ZKHH 3QUZD 3PF2A 1HL9A 4XCYA 3WJJA 4JY4A 4P2CG 3DOSA 1ZKAA 1E4KC 5DTFA 1E50A 3T71A 1RZKH 1IGMH 3DIVA 3H9SB 4U3HA 3JWOL 1IAIM 3C12A 3P9LA 3O3BA 3US9A 1QLRA 1PD6A 4O58L 4GKSA 2E3VA 1F4XL 2P24B 3JVGA 5EWIH 5KTEL 1J9CT 2IDTA 2D0FA 2G3NA 4H20H 1C1EL 4RLDA 1QAWA 3H42H 3I84A 5C3IA 5MENE 3EO1B 4LSVH 1CR9L 1OP5H 4CGTA 4M8VA 4NI6A 2F8XC 1N0XL 4H4NA 1BEYL 4P5MA 1LE5A 2XTJB 4S1DC 2GBVA 4LRIA 5CR1A 4P4KA 4ZMXA 4NN6C 2XG4A 5EIQA 4CADA 1L9PA 2WZPD 5D1XD 3ZZLA 5JOFB 3D2TA 5EBMB 3MRPB 5D7KD 1VACA 5F9DC 1YC8A 3SIKA 5IB3A 3MA9H 5EBLB 4FQIL 4EDXB 4YHKH 4WI0A 2TSBA 3VXSA 3L1OL 3MZGB 1H3PL 1NGZA 5D5ME 4C58B 5AKTA 1TQTA 3DBXB 1QD0A 1MCQA 1KCSL 5KBMA 1Y6KR 3SJVB 1EGJH 4LDOB 4WHTB 1SJEB 3ZL1A 1HYSD 3UYRL 4X0NA 4FTVD 2EIDA 3FTYA 3GBNL 3PGFL 4PAZA 2EVGA 1UZ8B 5IMLB 3BSGA 3FUFA 4KJWD 2MH4A 4E41D 4U1GC 2VLRA 4WK2B 1RZ8A 2Z8VC 3VNYA 4OSUH 4G8GB 3VX0A 4HIQA 2PPCA 1RK0B 1VFUA 1VFBA 5CF3A 4U6TA 3ZT7A 3WTSA 1G9EA 3AM8A 1P4IL 3DROB 1BQUA 1C12B 4P2OB 4TKWA 4UMGA 4UU9A 5C7XL 5T3XL 1IV8A 3L16A 2WCPA 4F7EA 1FSKC 4X7SH 3QIWC 1NAMA 5TD4A 3BH9A 3AREB 2W91A 2ERJB 3ARGD 3RZCC 4YDNA 4R96B 3VMNA 2KT6A 4IKJA 1W80A 5LJYH 4ODXA 4QOKD 1JDDA 4HC1L 1DCLA 4I77L 2ZYSA 4H1LG 3QZNA 1T1XA 2G60L 3IDXL 4ZS7L 2H32B 4ZUSA 1KF9B 4HCRA 2R4SH 4F2MA 3L1EA 1JS4A 2JWYA 1ADQL 2V3FA 2XPYA 1CXHA 3CHQA 2WQVA 1DJWA 4N0FA 4ZTPL 1QVOB 1O5DT 4X6DA 4JM0A 2ZWNA 1YEWA 4NRYB 4LSPL 3CSTA 5HDLA 4HKZA 3V5HA 2AFNA 3JWNC 3WFCH 5L7XH 4F58L 5H2BB 3X1NA 1OSZA 3BUIA 3P77A 4D0BA 2PR9A 4N0UE 4WSKA 3U2JA 1BZOA 2RIKA 3D06A 4KKRA 3EGXB 4JRYA 4F5CE 1JWUA 1ZIAA 1KIUB 2BOCB 3C87A 2OMTA 2XPGB 1BQHG 1B0IA 4BFJA 1WFIA 2YO3A 4XTRD 4JCWA 4JFDE 1BDYA 4U3CA 4M4PA 1UA6H 3FUEA 1ZXQA 2D4DA 5IHUH 4XP1H 4PSPA 4AY0A 2XTJC 4KK5C 1X9RA 2B1HL 2J4WH 2FIKB 3V9CA 4GP4B 3CUPB 3POHA 3FTSA 2CPCA 4JG5A 1GMEA 3GKWH 4WTWA 3TVMA 3ULUL 1K4CB 2YRZA 5FEBA 3OF6A 5JW4R 1R24A 4NNPH 2CH8A 5TK2A 1BVKA 5I1DB 4U7MA 1MFBL 2I9TA 1M2OA 3GMPB 2QZQA 5IBTH 3WELA 2PWFA 4BH8A 4ZTOL 2XN9E 4RFOH 5DJCA 1A64A 3Q8BA 1Z9NA 1RHFA 2Q86A 4KI5E 4R4NC 5K9OA 3QJTB 3MFFA 5IB2A 1HL5A 3MNDA 3WHE0 4DHLA 2O93L 3LEXA 2PETA 3CFBB 3UTSD 1G9NC 1QLFA 2CNZA 2V2TA 2XACC 5BO1H 5D8JL 3B3IB 4IKIA 4AK1A 4HIEA 2XZQL 4U1NA 5JNYB 1GXEA 3JV4A 3ARRA 5KSVA 1WVZA 2A83A 4IMLB 4JLRB 4OTXL 2VXUL 2PXYB 2VR4A 1I7TB 2Q7YB 3D5OF 2IH1B 3KDPB 3HN5A 3S5YA 1UZ6F 2ZOKA 3MBXH 2DZEA 5ISZD 4O51A 5MEQA 1DUYA 2WSKA 3RRQA 4HBQA 2DD8L 2JVUA 4PHZA 1KXHA 1TQWA 4A68A 4XOAA 3AREC 3GRWL 2ERJC 1J1PH 1MSPA 3EF4A 5A43C 4U1JA 3S3CB 3CXHJ 2X4UB 1YMMD 2NX5E 4MQ7A 3RIAF 5BRZE 4P23D 3ZR6A 4OD2B 3ZMEA 1CGWA 1NCNA 3PDGA 4AIOA 3BKMH 1RFDL 2RD0A 3H7LA 3WKQA 2ETWA 5HYQA 4DAGH 4FGMA 5F8RC 3H7BA 4BZ2L 2QLYA 3QRLA 4Q2ZB 3ZHNA 3HUJA 4JX0A 2O6DA 2ZXWB 5IREA 4FNUA 4XB3A 5K9QI 2FQDA 3N9GL 1RUMH 2RCSH 1MFEL 2Z91A 4WJ5B 1PTZA 5K39A 2A9DA 4HCIA 3X2QB 2X42A 3OSKA 4AM0A 1G7PB 5E70A 4H0LC 2DIJA 4N0YH 3D4CA 3T08A 1NLDL 2Q76B 1RKRA 3R19A 5DEZA 1BF5A 3BAEH 4DP4X 5I8EB 5C70A 2VLJB 1IC4L 3TU6A 5I71C 3L9RA 3UO1H 4Y5XB 5IHBA 1YDPB 3FFDA 4XGZA 2YOCA 2DRUA 3D48R 3NA4A 2BZDA 5GXBB 5I75B 1QTSA 3HMXH 1L5GB 1LK3L 5ALBL 4M62H 4HCGA 3SDYL 1QUNA 3BPNB 4NQVA 1EO8L 2ITEA 4JRFA 5LG1A 5EUKB 2JTYA 4KNQA 1O6VA 4P2YA 2FJHA 4V2BA 3B56A 4JO4L 5E2VH 3OJ2C 2RQ8A 3BWSA 2BIOA 3OR6B 4F8QA 43C9B 2ISDA 1GVIA 4A6YB 5CU9A 4NO0B 3DETC 4L3ED 4N87A 1CGYA 4N8UA 5HI5D 1QHQA 3HI5H 2Z4QA 4PJ5A 3WE1A 4ENZA 5C6WH 5CP7B 4OLUH 4AIEA 4QLRA 1KWKA 1M9WA 4DP8X 1F3DH 1ZXKA 3ATAA 1VFOA 1AO7D 1HE8A 1CK0H 4YHIB 3OJDA 1N5AA 1XXFC 2XX0A 5EU7C 2X2HA 1UXWA 3CZFA 1QFWI 3I6SA 5L2JA 1E6OH 5FA4B 4H8UA 1E5CA 3F7VB 3QORA 5CINL 2BDNL 1N64H 4DPCX 2PXYC 3D3VD 4EVNA 3FU3A 3OD3A 4ZD3H 2EH8L 5AB1A 1A02N 3QQ3B 1M42A 2OMZB 2LLNA 2X1OA 4XMLH 5LN8A 5K5YA 4XMZA 3H9HB 4KY1L 3IXAB 5JW3H 5E4OA 2WXNA 5D7IB 4G8IB 5EG6C 3VVVA 3WNPA 1G7MB 1MCOH 3DUSB 2HWZH 1W16A 4K5OA 5DRXB 2AV7A 1RURL 3QO0B 4WW1A 1ZT7B 1IBDA 5CBAB 3QG6A 3THMH 5I5MA 5KSAA 3QUXA 4GINA 3NGBB 3ESNA 1J9TA 3Q2VA 4L8CA 5EZIL 1QTYT 4GSDH 4ZNEA 2BY3A 2N7BA 1SM3L 4Q89A 3D39E 5LAXA 4MJID 4PJXA 3OB0K 5MERA 3VXQA 4PJDB 3GHPA 1R3HA 4M9OA 4C4BA 4NP9A 3HZMB 4YJZL 1YEDA 4EIGB 4UTBH 1CDCA 3KPRE 4ZFZA 4HJGB 3ARBA 2QEJA 3V0DA 1LL1A 1RUQH 2AJZA 3HG1A 4KJYB 1MFDH 4JM2B 3QJHA 4TPRH 2IADA 2R8SH 3CSYB 5K1VA 1V3KA 5B1BB 3QH3B 4FLRA 3PE9A 5JUEL 1ZLSL 3DRQB 5T33H 1MELA 5HJGA 2X4TA 2JK5B 3MFGB 2Y9RT 3GYRA 3Q01A 3QHFH 1WG3A 3LS5H 2H3XC 4Y5XC 4Y9EA 4I0PD 4FFYH 1UKQA 3RAJH 1JZ5A 2E59A 1SLXA 4R7NB 2FGZA 5I75C 4I48B 4IJ3B 1I1RA 4TV3A 2YXVA 1L0QA 1ODAA 3GUFA 3O4LB 5E4AA 4P9ML 3T1FA 2YFOA 3ECBA 2OTUB 3BPNC 4XBPB 2YUXA 3OKOA 3MCKB 1GHFL 4OAWA 3O81A 4FCAA 1RU9H 2ADJA 1I7ZA 4NQCB 5CFHA 3DNKA 2QPUA 4WGVB 4Y19E 4ZMLA 3PPSA 4Z7NF 2Q10A 3OKLA 4Z3JA 5IJVA 4QEGA 1KIQA 4NC1C 4UIMB 1U95A 4UZSA 2C1PB 3BLKA 1JV5B 3G6DL 3T6ZA 1DZ0A 1MPAH 4JFVA 2X3BA 3FRPB 4U6YA 5C0AD 5I8OL 3GIZL 1U3JA 1E4XH 3HI1B 4EUPH 3K8MA 4Q14A 5FB8A 1XSKA 1S9WA 1YY9D 4P4KD 2LU4A 1DBKH 3EJYD 4HZLB 5DJ2A 2DJMA 1BXVA 2RA1A 1OF2B 4ETQB 5CGTA 1HIML 1NGXA 1T20A 4GG8B 3L7EB 1JRHL 5HDBB 4UQCA 1KXQE 3MLYH 3MUZ1 3ZL4H 4AGOA 2ED6A 3EJJX 1WZKA 2W9LA 2DKMA 3BRFA 2VISB 1RZJL 4ODUB 3UBGA 1SDDB 2EDHA 2KC0A 3H55A 1WFOA 4KZEH 3ZDXB 2XG5B 4ESKA 5HSFA 1YUKB 1PQZA 1S9VB 1AZVA 1VLXA 3JV6A 4LEBA 5HGBA 3BMVA 1KB5L 5DUBB 2XRAL 1MLBA 4P07A 1MCKA 2XHNA 5FYLH 4ODHL 3AB0B 4FE9A 1FDLH 5G4MA 3NTCL 4HQQH 4DF9A 2BSED 4MS6A 5I5JA 2VLRD 3V7AG 4B5EA 4N2GA 2A6IB 1IBFA 2GITB 4UDTA 3RPKA 5JIPA 5F70A 1XF4B 3HFMH 4PVMA 5ITFB 2NY6D 5AW5B 1HESA 3GSVA 2BZ7A 2GHWB 4GW4B 1RVFL 4Y1AA 2CE6A 3K2UL 1CXEA 2WBJB 2P5WE 2EYSA 4OM0H 4JM2C 3VGGA 4E9TA 3R1GL 1VKXA 1PAZA 2JELH 4AWJC 3BT2H 1RP9A 4R7DB 4N0RA 4ANVA 1G6VK 1M6OA 2HJFB 2WQUA 3LEVH 4H1LA 3GMOA 2HKHL 5EC1B 3ZQWA 3KLSA 2VDRH 5TQ2H 1DVFB 4W68A 4H8HA 3SB3A 4HJ0D 2IJ0C 3RNQA 1SLUA 2YAMA 1CE6A 4JKWA 3TBWB 5BPPA 2IFFH 4ZS6C 2RFXB 4Q8BA 1TJGH 4ANUA 4GS7B 3SOBH 2I85A 4IJ3C 3UTZA 3OAYH 2QGDA 3KBHE 3L4YA 1DJGA 4NZRL 2EUVA 4BZ1L 3U7YL 3QJXA 3TA3B 3RWHB 4JFHE 1JXJA 4F8TA 5LN4A 3QUKB 4P99A 4KO7A 1SN0A 4LKCA 5ITBH 1IGCL 4HG4K 4KRPD 5IWLC 4V1DA 1BQHA 4XWOD 3GMRA 5I0YA 1URZA 4JRYD 4MMYA 1E8WA 1XCTA 3H4FA 3H8NA 4NQQA 3MR9B 4WWKA 2JQAA 3NFPB 2ITDA 1QSFA 3SD5A 1HXKA 1NBZB 3IJEB 5M94B 4LCCA 1RZIA 1AANA 4XC1H 5B8CA 1H6UA 3N3EA 4JN1L 5HYJA 4ONGH 3CIAA 4LOFA 1MNNA 2O1AA 2IXQB 3F58L 4GRLA 5KG9A 2CRMA 2I32A 4JPKL 3WBDA 2JFCA 3VDAA 1H6FA 1B0GB 1GGCL 2ZYIA 3OF6D 4TSCH 1P7QA 4S1QH 1S7TB 3DX6A 2IOMA 3Q1EA 4NP4L 3R4DA 3D0VB 4DGUA 3PHQB 1MW2A 3O6LL 4GXUM 2C1OB 1FO0A 2VOTA 3LRKA 3OKKA 2CBTA 4NC0B 3A6CL 1K2DA 5DEGB 4D8OA 1B6DA 2OYLA 2DICA 1UASA 3VGEA 1SXBA 5T1LA 5T3XD 3GJFB 1OAUL 4R97B 3B9VA 3KYOB 2D3JA 1T22A 3O2DA 5ESAA 2M26A 4KTDL 3IPFA 2WUBL 3V4LA 5SX5K 3MJWA 3AB0C 1CICB 2DLGA 3SKNB 3P3SA 1L9RA 4Q58C 5EPMA 5I1LA 3V5DA 4X99B 4CMMA 4MAYA 3ILQD 1XO8A 4WUUD 5TH2A 2DQIL 3FN0L 3SQRA 5MEOA 1ZGLP 1DBJL 4KNUA 5AKVA 5BV7L 2BP5M 1WAEA 2K3HA 4FFZL 1BFVL 2QADD 1WD9A 2P44B 2NY4D 4NNYA 1YYMH 4TRPH 3K72A 2YR3A 4AW4A 1U41A 4HUXB 2F54B 1CU4L 1T7YA 4R4FL 2FJFB 1DVFC 3G6JB 4PJ8D 4PGJA 2X4SB 3PGDB 5FGCB 4GS7C 3X11B 3KYNB 1A7OH 4A7GF 5IGXH 1TJHH 3IAQA 1U6AH 3FQNB 3KGSA 3ZTEA 3TA3C 2VZOA 1BAFL 1LP9E 4J1UB 1LTXA 4YDMA 4FL4B 5E6ZA 2RB8A 2XXCB 3T2NH 3ULUD 4AEIH 5IJKC 5IHZB 3CFEB 3C8KA 4BFKA 4PWHA 4NZ8A 3DI2B 3L5WB 3BKCH 5DVNA 2GUOB 2NTFB 4NJ9H 4PJGA 3KJ6H 2F8OA 4OZ4A 4QCIB 5FYJE 4ODWA 3NIGF 3Q3GB 1MFAL 3PQYE 2QPFA 1YEIH 2IPUG 3IMTA 3WIFB 1A1OA 1FLTX 4LSTL 3MREA 1CFQB 1FYTD 4YE4L 4EKXA 1MAMH 1FNHA 3D85B 1E9PB 3ULVC 4N8VB 1F3DJ 2PLTA 4JE4B 3ZYJA 4BUQA 2L7EA 1TCMA 3JZ7A 1EAJA 1UM5H 4AMKL 2VLLB 3TONA 2XWXA 4HIIB 1TU2A 5H4YA 4YSUA 2D3VA 3F84A 1J11A 3FOLB 4XPAH 5B1JA 1LEKA 2X9ZA 1RH8A 4F3FB 1AP2A 2PP7A 2EKSB 4MZ2A 2VDKB 1Z9MA 1T2QH 4F2EA 4PJ7F 4G83A 1UTDA 1R3IH 5BS0D 2B77A 1F13A 3WD5L 3MYJA 2VSDA 4PJ5D 4PJ9A 3WDJA 2APFA 1ZPUA 3KYKH 5KVGL 1I85C 3TJPA 4R97C 3LNIA 4RGMB 5IEHB 3BEVA 1HHIB 1RJLB 3RJQB 5C6TL 1ETZB 3L54A 1JTOA 4HFWB 3MOBH 3PHSA 4K4KA 2VMCA 1CBVH 1CICC 1CS6A 5KJRL 3QW9A 2R1YB 1MFCL 4LFHD 1DP0A 3HR6A 3HRZB 3T8MA 4HXAL 2QPSA 3QORD 5DRNB 1UOLA 1G6RL 1JPFA 1NSNH 3LKRA 5C0BD 1R75A 1KDIA 1Z9PA 3VQMA 2CIKA 4JMNA 1F42A 2ZAHA 1D5BA 3KJ4B 3VGDA 3F7YA 2PMZA 2HX9A 4PW4A 1E4WH 4OLVL 3Q1SL 2H1PH 2X12A 1TVDA 1B4LA 1Y0LB 1AGEB 2VDPH 5DO2C 3VWJB 4OR1A 1II4E 3GSOA 4KKLD 1XX9C 3QUZB 2NW2B 4L1HA 4OD3L 1FL5A 4QHUA 2H9GB 4ZYKA 5KSAD 3AT8A 5CO1A 3QUXD 4JDVA 2G5BA 5FCUH 4IRZL 4OJEH 4KKCD 1L9NA 4HVBA 2RBLA 5I76A 4AH2A 4KXBA 3V6ZB 3FB8B 4XP5L 4Q97A 4IDJH 3C9NA 3ARBD 1I3GH 1YMHA 3HG1D 5C09D 1R34A 1MAJA 2XN2A 2P42B 4FL4C 5GGSB 1X5ZA 2FJGB 3HIZA 3N04A 1RUPH 2C8NA 1IGTB 2UVEA 3CVHB 5HHOA 3JUYA 3PAUA 3KPMB 4YXHL 1G7JB 3PABA 1J9QA 2Z93A 3OLEA 3FTZA 5L8JB 3IXTA 5D1XB 5DHEA 3CLWA 3OHXA 4LEOA 3TNNB 4BQ6A 4P5KB 4N2FA 4FQCL 4QLWA 5D55A 3M7OA 4JQXC 1JNLH 2NY5C 1JZ7A 1E4XI 2BVTA 4ADIA 3NIDF 3HS0B 1U3NA 2MTAA 3AG1B 3PHAA 2DQTH 3NSJA 4GRMA 3GO1L 4P2RE 5GISH 2E75C 5DD6B 4KTEL 5IQ9A 1L7IH 2BFVL 5FKAB 1LILA 2MNJB 3DTDA 3M86A 2TSAA 2YPLE 3QG7L 3TO4D 3WIAA 3CFDB 4FNLL 4FTVB 4YQXH 1MUJA 2A7BA 4TVPE 4QRRA 2RAMA 4Y2DA 2IF7A 5C07E 3P3YA 1S3RA 1KT2A 4APQA 5CP3A 4WHYH 2VN7A 2J6WA 3EFOB 3EO9L 4E41B 2NPLX 5C0FB 2J1WA 1AOHA 2E6QA 2Z7WA 3GUTB 4PJAB 4PR5B 2WQXA 5F7KC 1G1KA 1JZHA 4YR6A 4DQOH 2YPVH 1DDTA 4JBSA 4PREB 4RGMC 1PCSA 3PL6A 4LPWA 4W4OC 4L29A 4N1HB 4Z3GA 4RZKA 1UM6H 3BKYL 2YD5A 4DTGH 4D9RD 5DF0A 1JHLL 3EO0A 3T09A 4O2EB 3ZTJG 3HRZC 4PD4J 3ARGB 1JGEB 3L2NA 1A4JA 4J6RH 2GT9A 1R5WB 3T2QA 1YNKL 3EG9B 5BNXD 4ENEC 1UCTA 2X6AA 1MCBA 4QOKB 1IEAB 4ALAL 1FNEB 3KJ4C 2XDHA 1AZBA 1ZY9A 3ABKB 4DETA 4Y9GA 5AVVB 4JK0D 1GTNA 1BYPA 5L2KA 4AQAA 3GMNB 3QP3A 3VWJC 2B4CL 3MO1B 4NGHL 4F7PA 2VDLL 3QUZC 3F65A 1Z3GL 2J8UB 1YEKH 4K23H 3R8BB 5FM8A 4B9CA 2UYLA 5AOZA 1HKLH 4LHQB 1EEQA 2PR4L 2EIKB 3PNWA 1LD9A 5AENA 1NANI 3CFKB 4WW2B 4Q7DA 2QQNL 1CD1B 4QHNA 5SWZE 4XPBH 2H26B 5BOZG 1V7ML 2FX8H 4NSKA 2G2RB 5D72L 4A2MA 3T1WA 4BWWA 3QC6X 1DQMH 2E9GA 4P2QA 1KB3A 1Y6NR 4KV5E 2XYBA 1ML0A 4LASL 2JKSA 4NHUA 2HLEB 3FQUA 1ANUA 1PMYA 2G0KA 5BZDA 4IOSA 4QYOB 2B16A 1AQDA 3MUGA 5D2LA 1I4FB 4R6UA 1E3XA 5DVLA 2RHEA 1ORSA 5D1XC 3RWIA 1P5UC 2QPDB 4LHJB 1RIUL 1SVCP 3BWUF 4X7FC 1FZMA 1MLCB 2QHRH 4BA0A 1QO3A 3KPPB 2LLLA 3BDXA 1M2VA 1X44A 2NT1A 1NM4A 1OCCB 4JG0L 2YKLL 4F9LC 3HAEG 2H1XA 3Q8CA 5AAPA 3W9EB 2VAJA 5KW9H 1FNAA 1I9RH 5IJBC 1WE5A 3BMWA 4S10A 2XZZA 2Y36H 2OSLA 2X4QB 4TNGA 2EDNA 1KEGH 4V1DD 1NCTA 4LDCA 5ESVA 5JMRA 4DEPB 3DPBA 3L4VA 2VMEA 4X9HA 4XO3A 3QNZA 3L3KB 4KJWC 3SGEH 3GKZA 3N0PB 3ASWA 4IU2A 4WWKD 3UMNA 3D0LB 3LMJH 3T0ED 3K6SA 4PRDB 5TDOA 3S35H 3L2LA 3AXHA 3RVXD 1XT5A 1ZLUK 2AQTA 3JWNH 2AXGB 4GKZA 2FCBA 2WM0A 3EH4B 4K7FA 4ONHA 3WUWA 1JXGA 4FN0A 5HYJD 4QKXB 1D5MA 4H88L 3A23A 4BE6A 3MRMB 1B3IA 1ZWIB 3NRQA 2CRIA 2F74A 5AVSB 1P7QD 2AK4E 1R3LA 3O2VL 1BZDA 2VN3A 1YMMB 1DSFL 3A6BH 5AOIA 4WI9A 3S37H 1D5XB 2AQSA 5KVDE 1FNGB 5EU4B 3VXMA 2V5MA 3EYQC 5F1IA 4JFFE 3VYNA 2AXFA 2B7DT 3QJSB 3US1A 3N1QC 2J7LA 1JN6A 1KG0A 3B8YA 2QVMA 1KCUL 4XN7A 1OTTD 4X6CE 4XVJH 1M7XA 3T04D 1VRSA 4WQOA 4LLYA 3D69A 1KJ2B 1C08A 3QFJD 3I2CH 1JHKL 3WOVA 4FA7B 3BGMA 2YWYA 5D71H 5E2JA 3K74B 1ZT1A 4LVOB 3L7FB 4ZMOA 2ENYA 4WW2C 5C97A 4HAKA 3ULSB 1Z66A 4Z6AT 1AGCB 4KVCH 1G9NH 2J44A 1DFBH 4X80H 1GPOL 2HRLA 3L3HB 1Q9LA 4XTRC 4XN9A 4NWUH 5ACLA 3FTUA 3DDGA 1N59B 2HG5A 5EU5B 2Y7SA 1QBML 1KCVL 3LPGA 4XX1E 4UQ9A 1A7PL 2ODHA 4X4YA 4OGXH 1GZHA 1HH6A 1U3HA 4RDBA 3TO2B 3Q43A 4LSUL 2X09A 1S7VB 3DGGB 3VCLA 5IY5B 3KPSD 3HC2A 2AW2A 4LCUB 4FDWA 6FABH 1KGWA 5H35A 4BSWB 4UYQA 2GC4C 4FJ6A 5D70L 1AS7A 5LAPA 5C0CB 3V0GA 5HVFB 3FDWA 1RJZA 5BQ7A 4IK7A 3L9EA 4L3EB 3MNWA 4Y2LA 2Y2TA 3MXVL 4Z0BH 3ZE0F 4RFEA 1USQA 1KUMA 4Z8FL 1Z9SA 1AFVH 2VO5A 2CR3A 3ZSSA 5C2BH 3QBTB 5E2TH 3KPNB 4JO1L 4GW5A 4RA0C 1TCRA 2OZ4L 4G3YH 1AO7B 5E9NA 4U0RB 2H32H 3ILEA 3QSKB 4DEPC 2NY7H 1M53A 3QPKA 4FXGA 4Q9RL 4AQEB 5BMFH 3P73B 4GNKB 3AS0A 2E9BA 3D3VB 1ZAGA 4PJEF 2ADFL 4TNVK 4FHBD 1N67A 2AKRA 3EOAB 3AQZA 4AIZB 1UXLA 1H9DA 3W82A 3ZTNH 4Q9CA 1QQDA 2WGXA 4NO2A 4P3DB 4RMSA 3MLSL 3MOQA 4ODSH 5FGBA 4PYGA 3MLWH 5DU7A 3WTWA 1ZS2A 2XI9A 4IBSA 1GW0A 5DUJA 1CFSA 1XGUA 1Z32X 2VZVA 4JHBA 2L7JA 4GJTB 5E8PB 2UZIH 1RZ7L 3PP3K 4LLDB 5AZ2H 4OLWH 2DEYX 4XVTH 1X5MA 1Z3RA 2C26A 2IEPA 5HVWA 5AKSA 1RJCA 4L3CB 4W9ZA 3A21A 2W80C 4XCFL 3ECVA 3WXVH 4TSAL 1AXTH 3MUUA 5AW9B 3QPQD 1TTUA 1H9VA 3UTTD 3HOGA 1SHWA 5E8DH 3T4AA 5EOTA 8FABB 3FCSA 5FYKD 3VI3B 2O26U 3CZSA 3H3KA 2O61B 3E38A 2BVQA 1DL7H 2ZCHH 5CHNB 1F2QA 4LVOC 3CQPA 3IN0A 3NCCB 4XCNB 4U1IA 4Z7OE 3WTYA 4AYBA 4M7JL 1KYUA 1WT5A 4OQTL 4BQ8A 3KD4A 2WWOA 4C55A 2CCVA 4A2DA 2I24N 3CDZA 3W5NA 1VENA 1VPOL 3TZVD 1HSBB 4IRSD 1LK2A 3JV0A 3B5TA 2Y7MA 3VE0A 1FH5H 5FO8A 3KCWA 4LF3A 4XCYB 5IF0A 2VXVL 3DX8A 4JY4B 3DOSB 3FS9A 4CC4C 5DTFB 3QYMA 4NB7A 3U4EA 4CW1A 4PVNA 1GGUA 3DXAE 3DJSA 3P9LB 3O3BB 1QLRB 3GPSA 1WJ3A 4M5TA 4OZHF 4GKSB 3DECA 5G2NA 1G94A 3SQOL 1A3RH 4EKJA 1XF2A 4LT7A 4FFVD 4WY7H 1RULH 4GQQA 5HI5C 2YXFA 2VDOB 4EBQL 1U91A 2FWOA 2R69L 4KQ4H 5EF1A 5CD5C 3DTXA 2E9JA 4OCSH 5C0AB 4P5MB 1LE5B 4XMUA 5HHOD 1FHNA 1EMTH 4U0RC 1ACYL 4P4KB 4LP4A 4QTIH 2Z34A 2XG4B 3H9ZA 3W3BA 1R5IA 5GHWL 3SBWA 3W56A 1O7SA 4AI7A 25C8H 4KH2A 5F2FA 5IB3B 2NCEA 1CTOA 4WI0B 4AGNA 3VXSB 1NGZB 1JJUA 2Z3FA 2FNBA 4MCZA 2WANA 3PDDA 3EHBD 3NCBB 4FQJH 1PAMA 4C59B 4M7LL 3I9IA 1IBHA 2P80A 2UZYA 1W0WA 1ZTXL 4PJDF 5JPMA 5DC2A 2YXWA 1QZNA 2NW3A 1R0AL 4I1RA 3D4ZA 4APQD 4WO0A 1QFWL 1E5UI 4X8GA 1F4YH 3NEEA 1GYUA 2VLRB 1X5XA 2LAAA 2ESVA 2CJUH 1RZ8B 3BI9X 4WIQA 4Z7AA 1Y07A 4A7SA 4KJPD 3NEOA 3S88H 5F1NA 1VFBB 4PB0H 2NY6B 3PL6D 5FDYA 2WXHA 1OGAE 3LQMA 3FH8A 4JANA 3MXWL 4HJTA 4F7EB 4P8QA 1IC7L 4A6YH 1RIHH 1ZJAA 3BH9B 1TITA 3QNFA 4Z7VB 2PCPA 5JXAL 1KTLA 1CF1A 3ET9F 4ZMPA 5JMOC 2W9EL 5J56B 4ODXB 3P40A 3U2IA 3X13A 2J5LB 3SE4A 4YWGL 2VUKA 2CHXA 4E42A 1OPOA 3KL0A 3GSXA 1T1XB 3BEWB 4ZUSB 3V9FA 2A4ZA 4F2MB 3PP4H 3MV8A 4XP4L 5L2KD 1MIML 5J1AB 3U4AA 1CD0A 4XNXL 2ZOOA 1U2CA 2HFEA 4I88A 4N0FB 4PRPA 4YSDA 4X6DB 3BGAA 1T3FA 3EXLA 2XSKA 3WJJC 4U05A 3X1GA 1UQSA 3SDCA 1TJMA 2XIBA 4HKZB 2I7SA 1RZKL 1IGML 3EJSA 3FRUA 1OSZB 1J0KA 3P77B 2UWEA 4D0BB 3ARXA 3JVGC 5EWIL 4JRYB 2YAQA 4RMRA 4KI1A 1JWUB 2B2XH 2A2QT 5ERWA 2A99A 4H20L 2OMTB 3H42L 5CEZE 4GUQA 3MCG1 3BH4A 4IOFD 2KZKA 4LSVL 1DO6A 1K9TA 4P2QD 1ITCA 3BO8A 2CO6A 1L6XA 4LRIC 4N5ED 4P4KC 1YY9C 2X53A 4IOSD 5HHMD 3S2CA 2FT6A 2H2PC 1KBGH 4M6AA 2NR6A 5FA3A 3TVMB 4HV8A 2NMSA 5I1HH 2FEJA 1R24B 1YEGH 1M7DA 1BVKB 3VTAA 2UX6A 1MFVA 5AD0A 3N85H 3MA9L 5GZOA 2I9TB 2X9YA 4BH8B 3G04A 3SODB 2GJ6E 2F58L 3A24A 5DJCB 4YHKL 3CFUA 2Q86B 2J5WA 2DW5A 3E2HB 2AV1A 3IMSA 1XB6A 3ASNB 5IB2B 4BWTA 3V9EA 3DRTA 5F3BA 3LEXB 2I27N 5TE6H 1EGJL 1BFSA 1P4BH 3O9WA 2R29L 4EI6A 1O9WA 3E8VA 4XHJD 1U2HA 4HIEB 4CVWA 3GM0A 4U1NB 1AD9A 1UZ6E 2W0LA 3JV4B 1SMDA 5HGHA 5KSVB 2A83B 3S35X 3EYFA 4OSUL 3UBXB 1AJ7L 2WV3A 4NRXA 1IFHH 1BECA 1FFOA 4WUUB 4NENA 4KKBD 2ZOKB 5AW1B 4G8FA 4NI3A 1QYGL 5E6ID 4O51B 1QX1A 3AM8C 5MEQB 3WTXA 1IEHA 1DUYB 1EEZA 3OZ9H 4XBEH 1MFNA 2IBBA 4OM1H 1EZVX 4PJIA 3NJKA 5C0GA 4Z7IA 2AXJA 2WSDA 4X7SL 2QADB 2NY4B 3ZJAA 4A2HA 2EDFA 3RNKB 4L1TA 5BVPH 3C60D 2I5YH 1V54B 1W9XA 4LDEB 2YGOA 4U1JB 3PWLA 3BIAX 4PIRF 2HX7A 2HYMA 2J5LC 2LW3A 4PJBA 3D33A 4HJ0C 3VXMD 3H3BC 1OVZA 2R59A 5HYQB 2R4SL 1EDHA 2D7MA 1CE1H 2ITFA 3H7BB 2D7TH 4GAFB 4QHLA 3J7HA 4M1DH 4M8UA 5HPOA 5I15H 3LHAA 2OI9B 5GGTA 2YQ2A 2Z91B 3KLHD 3WFCL 5K39B 5L7XL 4EUPG 4AM0B 2CUHA 3HMWH 3T77A 3CHRA 4RESB 2OXGA 1SBSH 4XWOC 2HMID 1LMIA 3L9RB 2APXA 1TNMA 3FFDB 4XGZB 1UA6L 1NINA 2AMUA 5IHUL 4JFQA 4TUKH 4JO5A 4XP1L 1QLEH 4MHHI 4RRPM 2J4WL 2R29A 4MAZA 2HJLA 3TVMC 1U3HD 1QUNB 4NQVB 3GZKA 4L4VA 1I3RA 4MBRA 4NNPL 5E4IA 5B7MA 5G5DA 2ZXGA 2A9NH 1FV1B 4KBPA 4TOYH 5I30H 5IBTL 2FJHB 3S0PA 2AJSH 1TZGH 2HVJB 1T1WA 4RFOL 1F90H 4WFEE 3E2HC 5BS0B 2F08A 3SOTA 2IG2H 4FKHA 4FHJA 3MRJA 2Z4QB 4PJ5B 5AUMA 3BW9A 3HNSH 1MY7A 3NDZE 4PN6A 3MCYA 3V95A 5BO1L 2WVVA 3VI4F 4C56E 5L8LB 1LNUA 4NQUA 3OJDB 1N5AB 2WB1A 2WQ8A 2DKUA 5BQDA 4KC3B 3CZFB 1XGPA 5L2JB 5CZVH 1KIRA 2A74A 1J8RA 3CC1A 4WFGE 4TLSA 5AYQA 1NWOA 3QORB 3QUHA 3U82B 2VWEE 1PFOA 4D7PA 4EVNB 3ME0A 5KVFE 3GTTA 2ALAA 2ZE0A 2UZPA 1XH0A 1ZHKA 3MBXL 4Z7WA 2BHYA 2Q2LA 4D3CH 2CHDA 1SGKA 4CBZA 2XWCA 4E9RA 2HVKA 5JHLA 3KH4A 4WWNA 5F6HI 2QADC 2NY4C 2QQLL 4G8AC 1EXUA 4KTYA 5G4OA 2EVJA 5F6HJ 1OP5K 4NBYB 2AV7B 4YDKH 1J1PL 1A2YA 4JR9L 2GJJA 4XVUD 3W1ZA 1FH2A 1GH7A 1IC0A 3QG6B 2XVLA 2WXJA 5KSAB 2OMXB 4AQ8A 3QUXB 1BIHA 3OAZH 2XICA 3ULVH 5HYSB 3ETBJ 1HILA 1CLVA 3BKML 1C8PA 3O6MH 3TURA 5LAXB 4PJXB 4X7TA 4DAGL 2VITA 5MERB 3PUCA 3VXQB 2IWKA 2NNAA 1R3HB 1ZA6A 2SEBA 3IKCB 3QWRA 4NQTA 4TNWF 4AYGA 4JO8A 1YEDB 3Q2WA 2VR5A 4UT9A 2BY2A 2J6EA 1MEXH 2OI9C 1A6TA 4K2UH 4ZFZB 4X0KA 3SCMA 3ARBB 3MI6A 1RUML 2AJZB 3HG1B 4LOEA 5C09B 4HFUH 4N2OA 3WTUA 1WS8A 3ULUC 4L2YA 3TYFA 2IADB 5KSUA 2KERA 4N0YL 2PYEA 2ICWA 5CFAA 2IVFC 5CKAA 1JNHA 3RVUD 2X4TB 3BAEL 5SWSD 1J7VR 1O0VA 4ZMQA 3GJFH 1ACCA 4EXKA 5KSBE 3UO1L 4UDUA 5ICZA 3VWKA 2UXTA 3HMXL 3B2PA 2FYYA 3D18A 2A9MH 4MRCA 4M62L 2DAVA 2Q1EA 4X98A 3T1FB 3ECBB 4OFPA 1RLBA 4JVPA 5GJTH 3S36X 3OKOB 4Z7NE 3MNVA 4UTAH 1YEHH 3DVFA 3LJ3A 4Y5YB 4OAWB 4L18A 2ADJB 5E2VL 1GYWA 4CU7A 3QRFM 1DJIA 4PG9B 4XAKE 3LPWA 4JO2H 2ZTBA 3OKLB 2JKTM 1T2JA 5IJVB 1NFIA 1KIQB 2RQEA 3HI5L 1U95B 5DS1A 5DQJA 2HUHA 4OLUL 1HXMA 2BNRE 1HJCA 5KVMC 2EUWA 3GBEA 4NCC1 4ICXA 4U6YB 5T5NF 1CK0L 1E42A 4WDIA 5FB8B 4B97A 4G6FD 1CLCA 1S9WB 2BIQA 1S5HB 1BJ1H 1BGXH 4FJZA 1E6OL 2W65B 4PG2A 3IMBA 5KEZA 4YHLH 1NGXB 3QORC 1T20B 2GJPA 3VGBA 3ZYZA 1N64L 4N2HA 2X89A 3H6JA 2Y25A 4ZD3L 3QEHA 3EBAA 4FS0A 4XMLL 1BVNP 1D5ZB 3MRDA 4X5XA 1Q94A 4BYHA 2H6OA 3MRKB 2Y6SD 1G7LA 1ESOA 5JW3L 2E6JA 1F1AA 3UO8B 5E1AB 1MCOL 2YSTA 2HWZL 1PQZB 1P5VA 5I6XB 3FPYA 1IAOA 1BFOA 4BGDA 1F11A 2P80D 4ERSH 3K2KA 2MQGA 1AHWA 4XO9A 3THML 2MQ3A 5KSAC 3SDDA 2NY5H 2Q2EB 3QUXC 4Y1TA 3HS9A 3KYMA 1BD2E 4GSDL 4OGAC 1NC4A 4P48A 3VFVA 3VA2C 5F3HA 2WLLA 4UDTB 2IIJA 2EXTA 3VMOA 3PLYA 1MCPH 4UTBL 3BP6B 2Q8BH 3GSVB 5AB2A 1CZ8H 4Y1AB 3ARBC 3BZEB 1RUQL 5B38G 3L9YA 1SFDA 2EYSB 3RX8A 2VDKH 3CHPA 4TPRL 2R8SL 1VKXB 1KB9J 1P6FA 4MCNA 2H8PA 1J5DA 5T33L 3VFWA 3QQ9D 3GZOA 1M6OB 3PG2A 4H1LB 2H4EA 3GMOB 4YNYA 3RPIA 3HG0A 3N40F 5GGRY 4X4MA 3QHFL 3LS5L 4X9GA 1QACA 4JS7A 3RNQB 1CE6B 1MH5A 5DJYB 1Z9LA 2EABA 1OM3H 5A40E 3NZHH 3VSTA 3MV8D 1OARH 3UTZB 2L0DA 4PRPD 4XPTL 1OAXH 3ZO0A 1NGWA 4MB1A 4HD5A 2DTMH 1F6FB 3SDCD 1QRNE 4B9FA 1IAMA 4D9LH 4LKCB 3FU6A 1RU9L 4FERA 3MV9E 1I8KA 2NT0A 2PCXA 4DO5A 4V1DB 1BQHB 3GMRB 2KUTA 5ETUA 2JKXA 4HIHA 1XCTB 2EINB 4WWKB 1A6PA 4P3CL 1JGUL 2ITDB 5JA9A 1QSFB 2CBMA 5L4FA 2FBRA 1MPAL 5D1ZA 1Z0MA 2DY2A 2W95A 4LCCB 4ZFFA 1RZIB 5MENA 4FZEH 2EECA 1E4XL 3UP6A 3N50A 3B7SA 4PY8I 5HYJB 5CCKH 1CLZH 1DBKL 3RDTD 4PY8J 2WLIA 4GRLB 2NR6D 4FD0A 5KG9B 1KBBA 1E8ZA 4BXVA 1HN1A 3FT4A 3QEGH 1P7QB 3RY5A 4Z3IA 3MLYL 3ZL4L 1NM9A 5HHVH 3I85A 1F4WH 4YN3A 4IIZA 5GZOD 4OI7A 2GI0A 1FO0B 3OKKB 1PU0A 5IW1A 1S4IA 3CVHH 2FT8A 1YNTB 4KZEL 2NNXA 3DSNA 1UA7A 5DJ6B 1EDQA 5T1LB 5I6XC 4DNLA 3O9WD 5D5MA 4JDEA 4FI8A 5ESAB 4NIKB 2HZHA 4JFOA 2DL2A 5FYLL 4RRPG 4ZSOE 1FDLL 4BXSV 4KWUA 4K0OA 2B20A 3BFQG 4HH9A 4HQQL 1BZ7B 5EPMB 5I1LB 7FABH 4IEFA 3V5DB 5ICXA 3U6XA 4CMMB 4MAYB 3ZTDC 3HFML 5TH2B 1K4DA 5LXVA 4CAGA 5MEOB 1CDJA 5H8DA 1KLFA 2ZP9A 3H85A 1ED3A 5I8CA 2IPKA 4OM0L 1E65A 1PDKB 3BDBA 1KPRA 4HKBA 4NNYB 5I1IH 3BT2L 3QXUA 5B3JF 4WWPA 2NRDA 1INDH 3DOHA 5E56A 2H3KA 4NXSA 1WWBX 4Z7UF 5IHLB 2VDRL 5TQ2L 3KPLB 3BRGC 2V4LA 4N2DA 4A67A 3IDIA 4GY4A 3RX5A 3OMAB 5EFIA 4G7YH 3RIAK 1ZLDA 1AC6A 3VFGH 4GG6F 1MG2C 2IFFL 2EE2A 3E7JA 4N26A 2WAQA 4GYBA 5C86A 3SOBL 4K9EC 3QQ4A 2WYZA 3HEIB 2EDBA 4JFUA 4ZO6A 1YCSA 2VC2B 3EBIA 2Y5TB 2KH2B 2Z1KA 2FB4H 2GIMA 4NQXA 3MVSA 4ORGA 4C4KT 5L8KB 5AVTB 4MA1B 5ITBL 1MW0A 4WHDA 4YFDB 5F1KC 4XBMA 1J12A 3WNLA 2K8QA 2ZXBA 2MQCA 4PJGB 1EZSA 3G7TA 4OZ4B 2WP3O 4N0UA 4ODWB 4WWKC 4FXTA 4F5CA 2W0FB 3MREB 3WO4B 4XODA 4NZDA 3RVXC 4LCCC 4XC1L 3DGCR 5B8CC 2XJKA 3LZNA 3KGTA 2WZAA 1G0YR 2R0LH 3GS0A 4JFDA 2XPZA 4GRLC 1FZJA 2GAZA 4FLQA 2CK2A 3FJTA 1RUKH 4HJ1A 2KS0A 3DSFL 4L4VD 4P46D 1TU2B 4PJ7E 4S1QL 4TSCL 1MDTA 2P47B 3CE1A 1H8SA 1LEKB 3GXNA 1AP2B 1D5IL 4E2OA 1AGDA 3FTVA 1TDQA 1NBQA 2HRPH 1D2OA 3F85A 4Z3FA 1MWAA 3NH7H 2B3IA 5B7FA 2XN9A 3KEDA 4MA8H 4PJ9B 1OTTC 3NIFB 2C5DC 4JNXA 3K7UA 4YVUA 3VFOB 4XNYH 4JVWA 3WAKA 3BEVB 4PMFA 3NSFA 3ABGA 1EBAA 1KN2H 4XZ4A 1MCRA 1KOAA 2LFGA 4ICWA 3ZYOA 4NQDD 3LPPA 1EA9C 4DESA 2XFGB 4NN7C 3BXNB 1VAHA 3UTQA 2C34A 4XZUA 1SQ2N 1JPFB 2X2YA 4MAYC 4B9PA 3OV6A 3LKRB 4PJCF 2CIKB 4LE8A 4PLKD 4QJ4B 4WFFE 1D5BB 2Y5QA 2WKGA 3SYQA 1PLBA 2IPTH 3F7YB 4JKLA 4MQSB 2ATPA 4MXWH 4G9FD 4Q9BA 4TRPL 2H5UA 1YYML 4PGEA 3GSOB 3S5ZA 4M3KB 1FL5B 4QHUB 4ZYKB 5MHSD 2CUMA 2DWDA 2HAZA 4NHCH 3PHOA 3RVVD 3KGUA 4JDVB 2G5BB 3B4NA 2F68X 3TEWA 3IU4H 3TH2T 4Y9BA 2F18A 4AGPA 2NX5A 1FF5A 5BRZA 1ZEAH 3TP4A 5AW3B 5I76B 4I8DA 3QWRD 1A7OL 5E1IA 4JHZA 5G4NA 4FYTA 4AH2B 5IGXL 4LPCA 1GS7A 1TJHL 4F37K 1U6AL 3EOBA 3LSOA 3TIEA 3VXUD 3C9NB 1Z0NA 3SCMD 1K72A 3BSZA 1O75A 1YMHB 3CVDA 3D08A 1WFTA 5D7EA 4CILA 3N1MC 3T2NL 3HLAA 3TH4T 3PWVA 4MA1C 2WCGA 2FIRT 3D50A 1DANU 5HHOB 1NCIA 1JD9A 4PV8A 3BKCL 2DWYA 3PABB 1PLGH 1XR9A 4NJ9L 2Z93B 3KJ6L 2JKLA 4QRPD 5KS9F 1P7KB 3NIDE 3FONA 2EDXA 3OHXB 4LEOB 4UOQA 4BJLA 2X4PA 1YEIL 4AMXA 1EWHA 2K6WA 2QELA 4P57A 5CCJA 1HOEA 1KGJA 3AG4B 3COOA 4FI7A 4PWEA 1KJ2H 5H94A 3VWKD 1MAML 3WO4C 1GJIA 4E9VA 1TNNA 1QR4A 1FRGH 3KR3H 1NBYA 5CGYD 1KGUA 3DJ9A 2VH5H 4GRMB 3GXFA 1UM5L 1I8IA 4HS3B 5IQ9B 4MX7A 4PCTA 3V0WH 2BO0A 1U8QA 3S98A 4XPAL 2MKLC 5B1JC 4F7TA 4QRRB 4UMSA 2O30A 1J18A 1GGIH 3QNYB 2WZ6A 2OK0L 4TQPA 1KT2B 1T2QL 2YPKA 4APQB 1R3IL 3HHSA 2ZD0A 3IBEA 1UJTA 3ATDA 3FSOA 2G0LA 4PJ9C 3VI3F 1X5AA 4BKLA 4N2KA 3KYKL 4EZMA 1WICA 4YR6B 2YGPA 3QPQC 3HBGA 4YSEA 1S9YA 3AFLA 3L3JA 3PL6B 4L29B 4LL1A 4POZD 3SGDH 1CBVL 4P06A 3X3GH 3ASOB 3EO0B 4YO0B 1Z7JA 4GRWF 1NGQH 4HYTB 1A4JB 1NSNL 1DUZA 3TS8A 2X89D 2GT9B 1X7SA 3FCBA 1E43A 3OLDA 2WQSA 4R90H 4NUQA 1DEEA 3H9SE 5KYYA 4J3OF 2CGRH 1E4WL 2O6EA 2H1PL 5L2KB 5CWSA 4JEGB 4AQAB 2VDPL 1Z2KA 4I13B 1BF8A 3CV5A 4F7PB 2E5EA 1YAZA 2JQZA 2OA9A 1QI4A 4OUUA 2J72A 1M3JA 5FCUL 3U7AA 1TZOA 2UYLB 1J0IA 2XQ0A 5KYXA 1FG9C 3WHE1 3SPJA 1NC4D 5LDUA 3BVXA 4HIJA 3PNWB 1LD9B 4PRBA 2A1WH 1XDTT 2YRPA 5T3ZH 3U79A 1ILSA 5JW5A 4YHNA 5B38A 3D39A 5JQ6H 1TJXA 3CQFA 4IDJL 4TS6A 4AYFA 3UAJA 1DN0A 4N9OB 1I3GL 1MAKA 1SYSB 4KROD 4MMXB 4MXVF 4OF3A 2CUIA 2YD1A 4P2QB 4BSVA 4GW1A 1RUPL 3KPRA 2GSIA 3RJOA 5A6LA 2D7QA 3FQUB 3BJ91 2FQGA 2YAEA 4OLEA 4UINL 3S3JA 1UACL 2APTA 1AQDB 3MUGB 4CSPA 2OYKA 3LVEA 1ORSB 4AYDC 2BIPA 1BOGA 3RWIB 3OHXC 4OV5A 1QPKA 1FZMB 3TLRA 1B0WA 5EH1A 3U6RA 1JNLL 4AYMC 1QO3B 2OKMA 2WP3T 1WV7T 3VM7A 2VM3A 3WXWH 2AEOA 1UXMA 2DQTL 4ZQKA 5EA0H 2EYTB 2WXQA 4G8GE 5GISL 3V5KA 3GEFA 1L7IL 3DX2A 2OMYA 5AZEH 3CHSA 3JYBA 4YQXL 2OSLB 2ZUYA 4JN2A 4X5PA 3WLWD 5DHXB 5ESVB 4APQC 1PJ9A 2PWGA 3DPBB 3HNVH 3QNZB 3M46A 4ABUA 1T66D 4IU2B 2KPWA 3P2DA 3EYOA 4KK8C 2DQCH 4Y19A 3CFJA 4DQOL 3PFUA 2YPVL 3QJZA 4Z7VF 3RA7H 5E6IB 4K7FB 4G6MH 4GKZB 4ONHB 3GIVA 2H6UA 3PL6C 3WUWB 4YH6A 1OSYA 3U9PH 2VRAA 4CU6A 1CDIA 1UM6L 2VDLB 1D5MB 4DTGL 1QOKA 1AZNA 2EH7H 5MP6L 3HG5A 4DK6A 3M6DA 5CJXA 3T0AA 2F74B 2L7QA 2V5TA 4J6RL 1R3LB 1U8PA 5E2UH 5B1AB 3L3GA 2VDOH 4QXTA 1VA9A 3ATFA 3FO1A 1KXQA 3VXMB 1DJZA 1ZDQA 2W5PA 2VMFA 2H0EA 4JCLA 1JN6B 2WCSA 3DMMD 1N12A 1KG0B 3CFCH 3EBGA 2E0PA 5F7AA 4BDVA 35C8H 5GRYA 1OGSA 2VDNB 2ZIDA 1J8HA 1M1SA 1YECH 3HHMA 4RRPA 4AK2A 5FWQA 4LLYB 3D69B 1C08B 1YEKL 4K23L 1DVSA 2JI2A 3BGMB 1HKLL 4NZJA 3OKEA 4RNRA 3VYOA 1ZT1B 2B59A 3ISYA 3FL7A 3TJHD 5A2BA 3ZRSA 3I3BA 1NA8A 4OLYH 4CC0A 5JOEA 9CGTA 4NPJA 4KUCD 4JRLA 5EC2B 5EUOF 3K91A 4XPBL 1S7QA 4FQXA 3RUGB 1DQVA 1XD1A 2FX8L 3LXUX 3QDGD 1CT8B 3WEOA 3F8UB 1Q9LB 3KH3A 3M1OA 4IOFC 2EUXA 5IOKA 3GT6A 1FFTB 4BKTC 1DQML 2HG5B 4HT1H 5LGHH 2D7OA 3HVDA 3DDFA 4X4YB 4KRMB 2DTSA 4R84A 2P5WA 3FC8A 4L4JA 1HH6B 1Q9KA 4DP0X 2XBZA 3N43B 2IBZX 1U3HB 4WNSA 4K3DH 1NIBA 2IO5A 2Y7OA 3NJLA 2A9CA 4XX5A 3VCLB 1JPSH 3A0OA 3QHZH 3OSVA 1SDYA 2QHRL 3ZE0E 5E99H 5EO1A 5EU7E 1FAIH 5H35B 1NOAA 4MJ4A 1KLUA 1YEJH 1TT6A 3EIFA 1OALA 4A2FA 4IBLT 1XMEB 1NAMH 1P2CA 1RJZB 4U6HA 4ZW8A 4ZQTA 5BQ7B 3MNWB 3UL4A 1JHTA 4M8QA 4RFEB 2ZP8A 5KW9L 4PV9A 1I9RL 1T7WA 1Z9SB 3ZQXA 1KY6A 4KH9A 2Y36L 4OJCA 4GW5B 4JL2A 1TCRB 4PP1C 1KEGL 4UM8A 3LB6C 4M6OH 4PJEE 3WV0A 4HCRH 2AQRA 4NKOA 2JJTA 3KVPA 1FP5A 1G1OA 2EADA 3LMJL 4ZMZA 5IP4A 3S35L 4NLAA 2XKNA 3A4EA 5DJ8A 2AKRB 4KKBC 5CLYA 5F1SA 4NQEE 4ZRGA 2QV4A 3H2QA 1O9VA 3FUHA 4JFDD 2XWEA 1UB5A 5CEYB 2ENJA 3P2TA 2VJ8A 3F12A 2Z92A 5I23A 2OYMA 4FX5A 4P49A 5FC9A 3ABLB 5FYLD 2Z35A 1PZBA 3LRHA 1PEWA 3REVB 1XGUB 3MA7A 1EERB 3D9AL 3IFLH 3A6BL 3S37L 1T80A 3IGAA 1N10A 1C8QA 1I1AA 2P5PA 1PKQA 3UZEA 4ZUUA 3RTQA 2VM9A 3QXAA 3ELQA 1CVRA 3BWZA 4KI5D 3K1KC 2VLJE 2WPGA 3GBNH 1VB9A 3FU7A 4A1RA 3POCA 1JXKA 1NMCB 4XVJL 5JHDD 2BWIA 3T4AB 5L6YH 4L23A 5EOTB 3CFTA 3FCSB 2BIHA 3I2CL 5HPMA 3V2AR 5B7EA 3KLHC 2BVQB 2EKJA 4RAUA 4BKSC 1E2ZA 4G6JH 1CJYA 5D71L 4AJWA 4TLKA 1XH3A 4U1IB 1FFNA 5KVEE 3VXPA 3FQXA 4UI2A 3DV4A 2HMIC 1CYXA 3I6KB 3C8HA 2X70A 4KVCL 1OCOB 5IQOA 2DQHH 1G9NL 1DFBL 4X80L 3CDZB 3ZKSD 3ECWA 4NWUL 1FFRA 3B43A 1SEBA 3BAXA 4DKAA 5I28A 1LK2B 5KAQG 4OGXL 5ABDE 3VE0B 3LYRA 1E27A 2BW4A 4ZNCD 5FO8B 1RHHA 3SDXF 2R0ZH 5IF0B 1U3HC 3ZO9A 3DX8B 4OZHE 1GOGA 1K5NA 4I9WE 1UEMA 4OZFG 2JKRM 1U8KA 3IK2A 3U4EB 2GI7A 3A67H 6FABL 2AQQA 4XX1G 2NX5D 5BRZD 3MRNA 3LN5B 5C0EA 1W0YT 4CNIB 1A9EA 1A7RH 3HC3H 1NGPH 1DN2A 4I5BA 3AITA 1XF2B 2SODB 5AOMA 3CPLA 4Z0BL 2EUZA 4GB9A 2W94A 4X6FA 3F7LA 3BVTA 2V9TA 4GO8A 1AFVL 1U91B 4XOCA 2FWOB 4PHXA 3N42F 2BNQE 5C2BL 5E2TL 3DTXB 5FYKU 4DJMA 5JQHC 3A22A 4G3YL 3Q7JA 4OF0A 4G6FB 4Q6IA 1LP9A 3PV7A 1R5IB 2NY7L 4FXGC 4Z76A 5BMFL 3O4OB 5ECGA 1SFHA 2FEEI 3FQWA 4NKIH 4LU5H 1JZ4A 1FGNH 4M7ZB 1EHNA 5DUPH 3ZHKA 5FW8A 3MKKA 3ULUH 3ZTNL 4ABVA 1HX0A 4DQAA 2EVIA 3BN3B 3P0YH 4PJDE 2W9DH 4MCZB 1SYVA 4ODSL 5FGBC 3MLWL 4BRJA 4ZTOH 5CZXC 4PMEA 2UZYB 1W0WB 5JPMB 5HD8D 2NW3B 4Y8AA 2UZIL 4K3EL 4YSAA 5AZ2L 4OLWL 3BQUA 2P52A 1TG8A 1RUAH 4XVTL 2X88A 1IFRA 1XTLA 1XZ0A 1QBAA 2ESVB 1IM3D 2ZUQC 4R9HA 1LO2H 5KOVC 3SDAD 5F1NB 3WXVL 1AXTL 5FKPA 1OHZA 1NMCC 2HN7B 3JBG7 4I3GA 3T4AC 5HHPA 5EEVA 1LO5A 4JANB 1NUFA 2P8LA 1DL7L 4HUWA 2ZCHL 3I6LE 5FIEA 3UGUA 2XWTA 2V3DA 2YSSA 2PCPB 1JG9A 1ORQB 4GSRA 2ZUTA 1KTLB 1ID2A 1TSHA 1ZVSA 4P59L 1WT5C 3RVUC 3IFOA 4W9KC 4LOVA 2MNWA 5E6UB 3X13B 3P1VA 4QRTA 4YPGA 4E5XG 5BCAA 1IMHC 3IVKB 5KYUA 4MDJA 3GSXB 3O6FA 3MJ8B 2BHUA 2DF3A 2ILLA 3DOIA 3ESMA 4KDWA 4WEUD 5F9JA 4IBTA 4N4YB 4B7IA 3MV8B 1JCVA 4ZFQA 3CU1A 2HFEB 4PRPB 1FH5L 3X12A 2DQUH 5FDWA 2BSRA 4G7SB 1UQSB 3SDCB 1LJMA 4P04A 3FRUB 1L9TA 1WAPA 3O11A 4ODTH 3ZDYB 2UWEB 2J3SA 4MTMA 2WK2A 1A3RL 4ZK8A 5HDBE 4RGNE 2O4EA 3D39D 4WY7L 3UROR 1RULL 1KC5L 2ATAA 3WKPA 4QF1A 3A5VA 4LCWD 4KQ4L 2CLZA 1U8IA 4OCSL 2C4FU 1F6AA 2CO4A 3BO8B 3KPRD 2CO6B 1KYAA 3GEWB 4LSRH 1EMTL 3PIQA 5DWPA 4ZOCA 1FG2A 3GHBH 2X9WA 3IS1X 4QTIL 5FA3B 4WCYL 4LZKA 3B83A 1LE9A 3SBWC 2HT4D 4HV8B 1PL3A 5K69A 2ENSA 4OFVA 3MRGA 1M7DB 25C8L 3KLAA 5CN2A 4M7ZC 1WZMA 2Q20A 3EDFA 3G5ZA 3G04B 3W2DH 3HAEB 1H3WM 3VNZA 1LEIA 2IFGA 3L4UA 1TQUA 1TIUA 2Y6SC 2AV1B 1T1ZB 1YA5A 5F3BB 3DRTB 5HJBA 3OG4B 1CFVH 1MCNA 2X3CA 4FQJL 1W91A 5I0WA 2C3XA 3O9WB 4P2RA 4KKZA 3VRIA 3E9UA 3L3IA 5JPMC 4UCFA 2IGFH 4N8CH 3Q8FA 2YPLA 1AD9B 3FBQA 1F4YL 5C07A 5HGHB 2MNUA 2M2DA 4XO5A 2CJUL 4OW6A 2X1XR 1Y7VA 1E6JL 4Y19D 4DKTA 2XZAH 3I6GA 4V2CB 4JZJA 3S88L 4NRXB 3CHXA 1TFPA 1E67A 1FFOB 2NSMA 4KGJA 4PB0L 3TN0A 4NENB 1THAA 3KDMA 4JUTA 3FSZA 1A25A 1EEZB 1JPGA 2ZUSA 3IPBA 3RX9A 1NQBA 2HVBA 5TE4H 4PJIB 5C0GB 4KXCA 1PJWA 1KENL 1G7HA 2N1KA 4A6YL 3S3BB 1FPTH 3RL1A 2DIAA 3QQ9C 2CJSA 3GXTA 1GGYA 1D7DA 3CZGA 3PWLB 5CMAA 3W38A 5JXED 5IHWA 3SE4C 3ZT6A 2EACA 4QI3A 2WHVA 4PJBB 3OR7A 4DK3A 5IIEA 3NCYP 4N2CA 3W0WE 4O5LH 3IDNA 3S3DB 3PP4L 3QRBA 4QHLB 4CVXA 4GP8B 1DTUA 1J8HD 3MRIA 4DERA 4JO3H 4QJ5B 1E40A 2F15A 2VW6A 3WE6A 3SDCC 3ULVE 4R5TA 2PW1A 3KS0H 4FEMA 3B2XA 4WTXA 4CGUB 3ARSA 4AQZA 2OXGB 5BOJA 1ZK5A 2B2XL 1D9KA 3AU1A 1NC2D 2CR0A 3LKNA 3RVWC 4H0HB 2IH9A 4D9QD 1D2PA 1VDGA 5DHVA 5SWZA 1IKNA 4JFQB 1N19A 2B3RA 2R15A 2P5WD 3O6KH 1ZLVK 1KBGL 3QZBA 2NR6C 2HJLB 3FHAA 5LKNA 4NZFA 3GBMH 5LWYH 5I1HL 5DSCB 4L4VB 1I3RB 5I6KA 4IKNA 1YNTF 5G5DB 4AQ1B 1YEGL 5IW6A 4PRAA 1PZUB 3WFBL 4LVHB 5GZOC 1T1WB 4M02A 2OPCA 3OLIA 5IROA 2ED8A 3ECQA 4FTDA 3DUUA 2E7LA 4X9BA 2EXWC 1RK1A 3EH2A 3PWJA 1LM8V 3MRJB 3BW9B 3K6IA 2YAPA 4H1LH 5TE6L 1I9EA 3VJ6A 1FA4A 1P4BL 2LR4A 3O9WC 2BM3A 4ACPA 2N0KA 2WVVB 3G5WA 5DD0H 1LNUB 1J1OH 2WOYA 4Y16A 3L45A 1R33A 4K9EH 1KIRB 2A74B 4N25A 3GSNA 2F54E 4QRFA 5BXFA 1Z1WA 3V6BR 1PLAA 1QSZA 3I9GH 4BZYA 1XSOA 1IFHL 1JXFA 1ZHKB 5I19H 4XBEL 2W0PA 2HVKB 4OM1L 4MKTA 1DQLH 1EXUB 4U2ZA 5BVPL 4LQ1A 3HR5B 2I5YL 4UZGA 5DJAB 1OTUC 1NCGA 1A2YB 2BC4A 1B0RA 2PP8A 4YPJA 3E6HA 2FTAA 1OLLA 12E8H 1DQQB 2AK4A 1SXCA 3SYCA 1DBBH 3L6FA 4H13C 5LG6A 1HILB 1R17A 3RTQD 4F57H 3ALXA 2JJVA 4X7TB 2VITB 1CE1L 1C5DA 2NNAB 4P0DA 2D7TL 1ZA6B 2SEBB 4JFFA 1WITA 3L5HA 4M1DL 4OFYD 5I15L 4ODHH 3SPIA 1A6TB 4X0KB 3SCMB 3K8KA 1MRCH 5EEXA 2CRZA 4X6CA 1U8JA 3TYFB 1IQWH 3HMWL 2E56A 5KSUB 1FO0H 1OAQH 4GMTH 1Q0XH 1SBSL 3BGFB 1YZZA 1JNHB 2XNAA 4HBCH 5AW7B 2EDOA 3K2UH 3OVUB 1TF4A 1KXTB 3ALWA 4DO6A 1O6TA 3QIWD 4KDVA 3O2DH 1RL1A 4IW4C 4UDUB 4DEWA 5ICZB 1MDAA 1B4JH 1M4KA 3VWKB 3RZCD 4B0MM 4N2LA 3UCRA 4TUKL 5E8EB 1QLEL 2FYYB 3D18B 4OZFA 5E08H 2ZP0T 1GIGH 4YEEA 1CQYA 4X98B 4U6XB 4URTB 2A9NL 3MNVB 3ESVF 3Q9PA 4TOYL 3T6QC 1H5BA 4L3AA 4LVHC 3RY4A 4PBVC 2AJSL 1TZGL 2AAAA 2P7TA 1T04A 2QGBA 3LKSA 5E5MB 1FVDA 3KLLA 2K7PA 2ZUWA 3HPLB 1NFIB 3ZX1A 2IG2L 2WXKA 3WNOA 3HNSL 5DQJB 3PGCA 1HXMB 4XNAA 1QA9A 2V7HA 4HX1A 3DJZA 2WNKA 5F7BA 5DHMC 1BPLB 3KL3A 3LKOA 4HAGA 4WDIB 2Y5EA 3QEQE 4EQ3A 5CZVL 2A74C 1JD7A 3K6OA 4KRNA 2VC2H 1IILE 2Z0BA 4KK5D 5BZWA 3QEHB 4LCYA 1KSRA 4PLKC 1Y18A 5DR5H 3SYPA 3MRDB 3OKYA 1C5BH 4X5XB 1Q94B 5E7FA 4D3CL 1G7LB 3AADB 4J3BA 2E4TA 5HP5A 3S9DB 1P5VB 3U4KA 4YDKL 1QEWB 2C9QA 1IAOB 1BFOB 1BLIA 1F11B 3OC8A 3NMEA 2PPAA 1AHWB 3RVVC 4AQ8C 1BLNA 4OFDA 3RWFB 5DK0A 1AHMA 2YA0A 4P5TA 3ULVL 3KYMB 2C9SA 1NC4B 3V0VA 3O6ML 3VFVB 1X9UA 3B5HA 4MB3A 5LXGH 3WSQH 1PGRB 3MPCA 5F3HB 2WLLB 5D1XE 2WUBH 5B39G 2OTWA 5D7KE 4ZAKA 1MEXL 1M71A 1KTKE 4K2UL 5EIVA 4L8BA 3SCMC 2CM6A 4KROB 1PNCA 2YAHA 2N01B 2VSCA 3OAUH 4HFUL 5BOPA 2YD7A 2XWDA 2LU7A 1JGVH 4R3SA 4R4BA 3DX9A 1KJVA 3VFWB 4E5XA 5C3TA 3BGFC 5F72S 4YNYB 3LNDA 3T8XA 3RPIB 5AB0A 4Y4HA 4YMPA 5DZ9A 5GRWA 4OCXH 1MH5B 3O6FD 3ZQ9A 1OKEA 3VWKC 5FYKH 3CXDH 2H6PA 4OZIF 2ARWA 2DOCA 3B34A 5DVKA 4E41E 5IB1A 2A9ML 3N1PC 3RGVA 5LGJA 1SOKA 5DUMH 1IAIH 3NCEB 3LXBA 1NGWB 5FM5O 2CLRA 2GCYA 5GJTL 3RKPA 1FJ1A 2W88A 4UTAL 3MV7D 1YEHL 2WBWB 1I8KB 4MA7H 5AVYB 4KXDA 1FVEA 1GJUA 3UPRA 4JO2L 3QQNA 3GC3A 3OKDB 1IO4C 5ETUB 3DXAA 4HIHB 4RISH 4OI8A 1UJ3A 4PJHB 1K8IB 4QO1A 3VFTA 2WLMA 4DFIA 3NFSL 3KNBA 3M7FB 4ZFFB 5MENB 5F88A 2BSSA 1XF1A 4POZC 1BGXL 1QW8A 2WLIB 1JV2A 3B2UD 3HG3A 4PG2C 3QCUH 4YHLL 4L8DA 3RILA 3FT4B 5TQ0H 4GUPA 2FO8A 1JUFB 1NUGA 3GLEA 3P3TA 3OL2A 3UAEA 3TIDA 3II2A 3AXLA 2ZNXA 3GB7A 5ID1A 3QXWA 5IW1B 4QRAA 3DSNB 3ZUNC 1JPST 2BFGA 3P02A 2WO4A 4KMTH 1PZSA 1BXXA 2FE0A 4P2RD 3B7RL 5CJOH 4ERSL 4JDEB 3QDMA 1KGXA 1AHWC 3DETD 5GGSY 3GSUB 3SDDC 4JFOB 2NY5L 2W81C 4GKNA 2YEZA 4ABQA 5ICYA 2QQKL 4HH9B 2OQJA 2YGQA 5GQBA 2JH2A 4IEFB 4IU3B 4BE5A 5ICXB 2MEJB 3EFDH 1I9IH 2ZKXA 1K4DB 1MCPL 3TN0D 5JORA 2VZTA 1T6BX 3CVBA 2Q8BL 5B3JE 3PCYA 1CZ8L 3QDGB 1KLFB 3VRJA 2QZ5A 1ED3B 4KROC 2IPKB 3P11H 5CXPA 4Z7UE 2VDKL 1JF5A 1KPRB 1G5AA 2ENPA 3MX0A 4HKBB 1MRDH 5CP3H 1OGAA 1ILUA 1CFNA 1IE4A 1JZ3A 3BAWA 3UTSE 5I5IA 2VRQA 1TEGA 3IDIB 5EFIB 5HHXH 4L1SA 3GINA 1JFHA 1OM3L 1I1CA 5F71A 3H0TB 3NZHL 4HZAA 3D2UA 3U48A 1OARL 4QXUH 5FM4A 2YK1H 2F8IA 3WY4A 3R8QA 1OAXL 4QPEA 4EUPB 2IBZY 2DTML 2KI6A 3DYMA 4OLZH 2OMUA 1V3JA 2MCAA 2UUDH 1AD0A 1TXKA 4H5SA 4NQXB 3N44F 4ORGB 5ISZE 4D9LL 1T6VN 2AABH 2MSPA 1JGLH 1F5WA 1TSRA 4OBSA 1JZIA 3WLWC 3NCMA 1H3GA 4GFXA 3ZKQD 1D9KD 4N0UB 1OCZB 1M7IA 1YMME 2QKIA 3ZHLA 1NKRA 5D1ZC 2DQJH 4FZEL 5DRWA 5L4JA 1ITBB 2ZF9A 1CLZL 4JFDB 4BFFA 1N3NA 2WWKO 3GS7A 5CCKL 3MMEA 1FZJB 2GAZB 4GAGH 4FQCH 4Z78A 1GZQA 1U0QA 4CN1A 2RTTA 5BJTA 3QEGL 1MVUA 1U8LA 1NTDA 3RKDD 1RQ5A 5DZNA 4ABWA 2NZ1A 5HHVL 1F4WL 2YN3A 2CO1A 2Y7NA 4JQIA 2KYIA 3WNKA 1AGDB 5IROD 1EBPA 4LIQH 3VQ2C 2F0CA 3CLEH 4E9SA 3CVHL 3KM1A 1QRKA 1EHXA 2G2NA 2LLGA 2XN9B 3L9BA 2GJ6A 4M6MH 1VHPA 4JPVL 2F9BT 4XC3H 1B9KA 2V17H 2DWEA 1P1VA 4NO0D 2FUQA 4PGBB 5JIMA 4L0ZA 5B21A 4K7PH 5CU5A 1HDMA 4PJCE 3RUGF 5EBGA 5HXMA 2PYFA 3LS4H 1NCWH 2VDRB 2UY7A 4UAHA 7FABL 4H2AA 3TJHC 3UTQB 4XZUB 2HX8A 3N40P 3WCYA 5DEFA 4LO9A 4I85A 1EAQA 4L1LA 5FM5M 3S8WA 3BKYH 4ZUVA 3JUZA 5GSVA 5FHBH 3N43F 1GY2A 4H8WC 5LLIC 4YSSA 2ATPB 5AW2B 2Q3ZA 4EMZA 5I1IL 4PGEB 4WNQA 4UOJA 5D7JA 2DJ4A 4F7KA 2BIMA 5EOQH 1INDL 3OM3B 4TL5A 2BSCA 1KZYA 3T8VA 1LO3H 1IAKA 1W8EA 2DWDB 3PHOB 4H8VA 1AO7E 4G7YL 3VFGL 5ACMA 1SXNA 2NX5B 1CXFA 3FQTA 5BRZB 2EE3A 5I0XA 1EDYA 3DURA 2X4NA 5J6GA 4U0QB 1Z3GH 4M3HA 4NDMB 2J8OA 5F89A 2DYSB 2ZXEB 3TPUA 3EOBB 3D3VE 3LSOB 2FB4L 4JKMA 4TNWK 3TIEB 4LARH 1NFKA 1T83A 4ZFOL 1P7BA 3L4ZA 4HIPA 4I2XB 2CHZA 3HLAB 3PWVB 5F7MC 3NJXA 3K5SA 3KW7A 4LMQE 4B9KC 4PV8B 1V7MH 1XR9B 1WF5A 4U1HA 4J7RA 1FNFA 3HE6A 3UACA 1BWMA 2VDNH 3FONB 1TEYA 3P69A 4NKMB 2X4PB 4ZOAA 4P57B 4LASH 5TF0A 3BIKB 2ZICA 3H3PH 3UADA 1NBYB 4ADJA 4MJIE 1XVSA 2R0LL 1I8IB 1MQKH 2VUYA 4W9FC 1CGSH 4MX7B 1RUKL 3G9VA 2R56H 4HDIA 1KMGA 1H15A 1OEZW 1U8QB 1UFGA 4AGMA 4W9EC 1YAIA 4F7TB 5ADOH 3VI3E 5DD3H 5DLMH 2IOOA 2NYKA 4M1CC 1CXIA 1DANT 1I7UA 4FFYA 2YPKB 1T5WB 1NCCH 3WJMA 1DO5A 1XWVA 1ZK9A 2XQBH 3HHSB 4YC2B 3VVWA 3NH7L 4QRBA 4RMUA 4WU5A 5CNHA 1UURA 4MA8L 3QS2A 2W8CA 4KI5C 5DFVC 5HBBA 4FKEA 3O0RH 4KFZC 1QKZH 1PLCA 1WWCA 1GGBH 1ZE3C 1ZVYA 4XNYL 1S9YB 3L3JB 1GYVA 4OY9A 2OSXA 1CDGA 3K6NA 1RI8A 3DO3A 4Y4KA 5HY9A 5IKCA 4WK0B 1DUZB 4IGBA 2YUVA 5JIQA 3NVQA 1IARB 1HYRC 1ACZA 2ZCZA 4N0CD 1IGIH 5EDXA 1DEEB 4XVOA 1CIUA 5KYYB 4PRHE 2QL1A 1WFMA 2IPTL 3VO0A 2E27H 3APMA 3VH8G 4MXWL 3REWA 1J5HA 4LNVA 5CWSB 1MCFA 1BBDH 3ARVA 3FB5A 1G5GA 3QC5X 4I4WA 5DJXA 1TVHA 4ZOBA 3UJIH 1T4KB 2AAVA 4NHCL 4OUUB 1KACB 1YQVH 5C0AE 5J13B 5KYXB 2FEDD 3IU4L 1KCUH 4LKXA 2HPOA 1R4XA 2IALA 4HIJB 1ZEAL 4PRBB 4MXVE 1X9QA 3FUMA 4YHNB 6TAAA 5B38B 1IAII 3D39B 1JZJA 1WRFA 2YUWA 4OUOA 3S5LG 5JTWA 1JDCA 3TL5A 4AYFB 4OF8A 1DN0B 3ZK0A 5TPWH 4JJ5A 2NXYB 2KQNA 1UT1A 4K73A 2P26A 4GW1B 4TL4A 4BSVB 3KPRB 2P45B 4KOBA 2GSIB 1HH9A 1ZMYA 4G11A 5JQIB 3WL9A 1YRKA 1PLGL 2WZ0A 1HT6A 3B6SA 3E9TA 1GPOH 2F8VA 4J12A 3VRLF 5IESH 3CN2A 5E00B 1JPEA 2Z31A 1BOGB 3T3MB 4OV5B 2PTTB 1FIGH 3OXRB 3U6RB 5IJCC 3IE4A 1KJ2L 4AQOA 2YEVB 4HA1A 4MBOA 1AXSA 1FRGL 3KR3L 3W57A 1RMFH 1J1XH 4UV4H 1R5VA 1IBGH 2VLRE 4X5WB 4ZQKB 5J3HC 2VH5L 1P84K 5BUGA 3V5KB 1NICA 3ABZA 3BPCB 5B4MD 3FW6A 3V0WL 2XKUA 2OMYB 2YN5A 1V27A 4LLMA 4GI6A 3CBJB 1GGIL 3EZ8A 5HD8C 2WWMD 1Q38A 4H8QA 1XCWA 4JN2B 4X9YA 4ZMWA 1WWAX 4Z7VE 4YC2C 4F8NA 2XBTA 4XI5D 5FOJA 1F0LA 1MN4A 3EYOB 4Y19B 4S1SH 4K9JA 2F1EA 5KBLA 2VW7A 4IBZA 3CFJB 1AZZC 2E7DA 2K1MA 4G42A 1J05A 4HLZH 2DEXX 4BD4A 3GIVB 5E5RB 1QSVA 4DP7X 4F2ME 2O5YH 4CBPA 2APVA 4KXAA 3ZSTA 2NSXA 3X3GL 4X6DE 1NGQL 1F58H 2AJ3A 2WINA 2YD3A 3UGXA 4U49A 3MRRA 1U8PB 2VR7A 3L3GB 4YEFA 3FUIA 4QXTB 4H25A 4R90L 4LBAA 2ZCKL 3FO1B 4FKKA 3MLSH 2CGRL 2GB2A 1XGRA 1WISA 4R2GD 1KN4H 4HOXA 1CDYA 2VL4A 3C6SA 4BDVB 4RDQG 3NK3A 5HVHB 3IJYA 4NZUH 1J8HB 4NT6A 1OB1A 4WJG3 2XA3A 3QDMD 3D52A 2E4FA 2PW2A 5D7LE 4JHAH 2ZSVA 3U1QA 2O5XH 5J13C 1CO1A 3EADA 2EDWA 5EUOE 3TEYA 3OKEB 4G1EA 4RNRB 3LIUA 1OCRB 2B59B 5FGSA 5I17A 1SJMA 2A1WL 3FQRA 5T3ZL 3ATEA 3FKUS 1EFQA 5FUOH 3MROA 2IAMA 1USZA 5JQ6L 1S7QB 4FQXB 4Y2OB 4HD9A 2EVHA 3FUKA 3UAJC 1YC7A 4BK5A 2NXYC 2J71A 3MGAA 1XZWA 4OLXH 1O9ZA 2I07A 2P5WB 4D94A 1Q9KB 3BDYH 3NJHA 4JPQA 5DMKA 5T3XE 3ZE1F 3RFRA 3QE5A 4TSBH 2IV8A 5IR1A 1KGCD 4OJDH 4DN3L 5EO1B 2MCMA 3ZTJH 5DO2D 2CAKA 3IJHA 1KLUB 5KJ7E 4FEIA 4ADGA 2VIRA 2NNFA 3LZPA 3WXWL 5CR8A 1P2CB 3PJSA 5IZ7A 1DQIA 4U6HB 5EA0L 1JHTB 2GIYA 4M8QB 4WUUE 3WMQA 2CM5A 3IMRA 3Q6FA 4PV9B 1YPZF 5AZEL 4HXBH 4ZDHA 3TOPA 1NFDF 1AZUA 2C7FA 2WWNA 3G9AB 1VFAB 2XU9A 4MLSA 4N20A 4WKXA 3PFQA 4UM8B 1UD4A 4XMTA 1QRNA 4U3XA 5HGAA 1QNIA 3HNVL 1NIFA 4NUJB 2JKIS 3MV9A 4XXWA 3JXAA 1MIEH 1FWXA 2DQCL 1JL8A 1O5PA 5DK2A 1CTNA 1GKEA 4EAEA 2XKNB 2YIHA 2OCFD 5DJ8B 3SE6A 3RA7L 5CEZD 1JOIA 4G6ML 3U9PL 1UB5B 1DQDH 1XB3A 2X0UA 3F12B 2EH7L 1X4YA 5CJXC 4B5ZA 2Z35B 3NG5A 5IFJA 5F9OH 5E2UL 2VDOL 3MA7B 3E8UH 3FHQA 1BQLH 3ULUE 3IGAB 2H1LM 2OJEA 5FW7A 1PKQB 1IEBB 2FO1A 4ZUUB 5LB1A 3RTQB 1HOCA 3QXAB 2W59A 1MJJA 3K46A 3CFCL 3H6AA 1RP8A 4FAAB 35C8L 3B1UA 5HVHC 3FU7B 3Q2CA 1YECL 3NT0A 2VLMD 5J8OA 5LNEA 1FYTE 5GS1A 5HPMB 1F8TH 4WFHD 3BH8A 2A38A 4CUCA 1HWWA 1SXSA 1U93A 1WA1X 3HAEH 4RAUB 5I6PA 5IOPB 1HEJC 2XA8H 4BCXA 3G3LA 2BVOA 1CD8A 1U3YA 1XH3B 3BOVA 3TFBA 1FFNB 4ZSOA 3EJZC 4OLYL 3VXPB 2VKWA 3FQXB 4A55A 3DV4B 1CB4A 2X70B 3EGDA 4FQXC 1AS8A 1FSKB 2YS4A 3SDXE 3UEQA 1VESA 1HCZA 4MYWB 5JDSA 5JHBA 2XWBA 4HT1L 4G71B 1SEBB 2CBOA 2R2BA 2BP0A 5LGHL 1NZRA 5BS0E 2YBRA 5D7JD 4ENED 4M4RA 1E27B 1RHHB 2BVPA 3BVNB 3R7QA 4K3DL 4N3TA 1K5NB 5HDQH 3LD8B 3WHXA 1SXAA 1U8KB 3TBSB 3QHZL 4ELMF 3CTTA 4LBEB 5DMIH 1U33A 3GMQA 1FAIL 2BCKA