3WTYA

Crystal structure of the complex comprised of ets1(g333p), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
118
structure length
118
Chain Sequence
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
total genus 17
structure length 118
sequence length 118
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtyA00
4AGNA 2X0WA 2ADYA 5BUAA 5LAPA 5G4MA 4IJTA 4LOFA 5KBDA 1TSRA 2BIQA 2RMNA 3TS8A 5AOIA 4MZRA 1EAQA 2AC0A 3VD1A 2IOIA 4IBYA 1TUPA 1E50A 4HJEA 1CMOA 2YBGA 1GZHC 4GUOA 4IBQA 3VD0A 3Q01A 3IGLA 2VUKA 3EXLA 2MEJB 1H9DA 5AOJA 3WTUA 1YCSA 1CO1A 3D08A 2BIOA 4L18A 1KZYA 2J1WA 3ZMEA 3KMDA 2H1LM 2J20A 3D09A 1LJMA 5ECGA 4L0ZA 4IBSA 2ATAA 4AGQA 3WU1A 2WGXA 4AGMA 2J6WA 2XWRA 2X0VA 3D06A 3WTTA 5G4NA 2IOOA 3US1A 4XR8C 4MZIA 5AB9A 4KVPA 1T4WA 5G4OA 2BIPA 4IBWA 2BIMA 4LOEA 2BINA 3D05A 3IGKA 4AGLA 4QO1B 1GZHA 2J1YA 5LGYA 2J1ZA 3WTWA 3QYMA 4A63A 3WTVA 3WTXA 2GEQA 2XWCA 1HU8A 2PCXA 5AOMA 2J21A 4AGPA 3D07A 3VD2A 5AOLA 3EXJA 3WTSA 3WTYA 4LO9A 4IBVA 1HJCA 1EAOA 2AHIA 5ABAA 3KZ8A 1UOLA 3D0AA 1EANA 4IBUA 5AOKA 1HJBC 3Q05A 4IBZA 2J1XA 2X0UA 4AGOA 4G82A 5A7BA 2IOMA 1IO4C 2P52A 2OCJA 3QYNA 4GUQA 3Q06A 4IBTA 4G83A 4L0YA 2FEJA 3US0A
chains in the Genus database with same CATH superfamily
1S5HA 4AGNA 3SDCB 4BK5A 4E9WA 1OGSA 4G7YH 1DVUA 2H26B 2VZSA 4HIIB 4JKPH 5DJ6B 2YRPA 5G5DA 4I0KA 5JXAL 4URTB 2ETWA 1KFGA 1DTUA 2GJ6A 5FKAA 5C0JB 3DSNB 3VFMA 5A6LA 3FSAA 3B7RL 1IM3B 1D7DA 5FO8B 3VD1A 3AT0A 3DECA 3DUUA 2VDNL 1W72H 3NCXA 2PCYA 4GO8A 1FFOA 1OSYA 4JQVA 1PZBA 2R4RH 3G7TA 1NUFA 4PB0H 5B39G 4R84A 1OPOA 3WUWB 4Z3FA 1P5VA 5EUOB 1BZ7B 4WUUA 3LQZA 1YY9D 2APFA 3SZKC 5FK9A 3M45A 4WJ5A 1OQXA 3FTZA 5JOPD 1IC7H 4CDHA 1MQKL 3MV9D 1T03H 3WJMA 4FQHA 2I7OA 5LNEA 3RQ3A 4A66A 2WCGA 5AYQA 2PNDA 1FC2D 1IAOA 2XN2A 4A7SA 5EOCL 4GAYA 5KANI 2ERJB 4EJ1C 5B1CA 3IGUA 4ODSH 4BWUA 4Y4FB 1YEIH 2FBJH 1T5XA 4XVSH 4TKWA 1JK8B 5IMMA 4FQCH 3Q3GB 3FO9B 2J8UB 3PV6A 5D2LB 5GGSY 4LKCB 1FDLL 1ZOXA 2TRHA 4TPRL 3LEVL 2Q20A 1E5AA 3L3KA 4NS0A 3W81A 3SBWA 3ZTDC 2H3XC 2PABA 3PP3K 1NOLA 2GCYA 4O02A 3B7UX 3X3FL 1FPTL 2BINA 2PYED 3EYFA 4FCHA 1NAML 2VDQL 1DQVA 4G6AC 2PWGA 3R8QA 3S2CA 5C07A 2PYEE 3FQNB 4U05A 2WWOA 5IROD 1RHHB 2EVHA 4NNYA 2AJUH 3DDFA 4DKFL 3EFDH 1XL4A 1CDGA 5D8JL 4X6BA 5FUZH 1ZK9A 4NKMA 1CTOA 1DJXA 1OAZH 3BWUC 3CC5B 1QSFD 4HUWB 1T66C 2LGNA 3QIUB 5KN5B 2UXFA 5K9OB 4ZDHB 3BISA 3G04A 2KQNA 4XVUC 1BIHA 2FX8H 4H88L 3WY4A 2Y7SA 4OGZA 3U7YH 3NGBC 1OCRB 2DQFA 4Z3HA 4M6NH 3ULUD 4J28A 5I75C 2ZWYA 1E30A 2JI3A 2DQ6A 4OLWH 2PCFB 2WLHA 1KB5L 3QK0A 3ECUA 1KT2A 5JPMA 4OCYH 1VKXA 4LHUB 3FQWA 4OZIA 2OS7A 4W9HC 3ZZSA 4OB5L 3KLLA 4AX3A 4L8CA 1WA2X 4LCWA 5JDJA 4RGMC 2HLAB 5ESQA 1RJYB 4NQVA 3GJFH 1MI5A 1N3NA 1DN2A 2IQ9L 1JHTB 3PHOA 5C2UB 5I5RA 2IOIA 5I1IH 2OULB 4X7EC 3VH8A 2DIBA 2R2HA 1OLLA 3JVGC 1F8TL 3SO3C 4NXSA 1JUFB 5C0DA 3RKDC 3MRHA 4GT0A 3UYPA 5AD0B 3WEAA 1YO4A 1E6OL 2KKQA 2L4OA 2Q3XA 4HSAC 1MW2A 2HT3C 1FSKB 2CJ3A 3BFWA 4XTRD 4F7CB 3OXSA 2X89A 1ZVHA 1OAYH 3Q8CA 4JZOB 5KSBB 1S3RA 5G5DB 1A6TB 2R56H 3ZZ1A 3B8YA 1D7FA 3HMXA 1QTYT 3EH4B 2HUHA 3ZE2F 2IGLA 2PPAA 2K45A 3MRCA 1JS4A 2BSEA 2BZ7A 2IV8A 3B2VL 4BFBD 2R0ZL 2OMTA 5C08E 4EQ3A 2TRYA 2NXYC 3QI9B 4PCTA 3PQYD 4N2OA 1HTYA 1IGTB 3MMEB 1IUZA 5EUOA 4N2DA 1JRHH 3IXTB 5FGCE 4YE4H 1HHKA 2GSGB 2YR3A 1YG9A 5F88A 1BM7A 4Z7VB 3CVIL 1NUGA 3OAYK 4FF9A 4OGAC 2UV3A 1M57B 4JCWA 3MR9B 3DX9B 1QLRB 4JFPB 2ZKMX 2P80D 4QXUL 4R83A 2BSCA 3RNKB 1EMTH 4FNUA 4U1JA 2YD3A 1ACYH 3F04A 4DK3A 5LGKA 1HU8A 5CINL 2OMVA 3HMXH 2DLFL 3IBOA 4KXCA 5BVJA 4WAFA 5DUJA 3BSZA 3Q8BA 4X99A 3PV6B 1MY7A 4MAUH 4ZMTA 3FW6A 1KFAL 4HGWB 4F8TA 1UJTA 1ZXKA 1P1VA 1KBGH 1MHPH 1P7QD 3UBXA 1ZTXE 3B2VH 2ZF9A 2J2ZA 4U1HA 5FHBH 1UJ3A 3MA9H 7FABH 3LIZA 1CGXA 1MNUH 3BVVA 3W9EA 4OVVA 1BQUA 2OL3H 2KMWA 5IJBC 3TZVA 1JRHL 1GYVA 1IGCH 2GUOB 4Y4FD 2J57A 5IMOB 4AUJA 4JZNA 3A6OA 2BNRB 4Z0BL 5DT1H 1RHHA 2Z0BA 3QAZB 2BO0A 3HG1B 4U1SA 3RUGB 5D2LE 3BIKB 2XZCH 3F7YB 2EYRA 4Y4HA 1UKSA 2Q8AH 3AWGA 5DI8A 2WINB 3ZKMC 1TG8A 2A99A 2ZTBA 4YMPA 1V10A 2EDDA 4QWWC 2QVIA 1HWWA 2QPFA 3LZFL 1HC1A 2YZ8A 3GXTA 4HUWA 4CC0A 1NQBA 4FQ2H 5JHLA 1AO7E 4MB5A 4EUPH 2HFFB 1M2VA 4P2QE 1OSEA 3WY1A 1LLAA 3LNIA 4NQDA 2B1HL 1GSKA 4YO0A 4A2FA 3SKJL 3HE6C 1E67A 3DX2A 5SX4H 3TPUA 5D2NC 4G3YH 3GD1C 1X7QA 3EF4A 4ZZKA 4H26B 3FU0A 4JHWL 2DJSA 5DO2C 3IDGA 5T33L 1WUZA 1JGIA 3RWHB 4JN1L 5AG9A 3KNBA 2P44B 3C9NB 5I76A 1XF3A 4X4KA 1CR9H 4UOQA 4P48A 5HDQL 3RE0A 2HB0A 4NQVB 5E5LA 3T0BA 3K2UL 4HWBH 4XVTL 2MCG1 3I3EA 3SYCA 5EO0B 1U4EA 1UVQB 4LLDA 2WVUA 3D69B 2EVIA 2WIMA 1DE4B 5DRZB 3WI9A 3WKML 2NW2A 2WXPA 5JR1H 2EDYA 3ESUF 5CEXA 3NFSL 1HEJC 3BZ4B 3Q8FA 2NNRA 1OAZL 1XX9C 1R34A 4XB8A 3PPEA 1BZ8A 4XMUA 4LCIL 3KJ6L 1VADA 2NXZB 3X11A 1HIML 2Y1VA 5ESAA 1QBMH 1DLFH 1OHQA 1J5DA 1GTFA 3S5LB 1UQSA 5IVXF 2H6UA 3TCLB 1J05B 1AG0A 3GBML 1A6TA 5DMIH 3ROOA 5IT2L 4NZ8A 1SNRA 4H2AA 5ID1B 1AIFB 1PFOA 2D7NA 4H8WL 2KT6A 3MYJA 2R1YB 3DX1A 4NIYE 4DWHA 3JT0A 1ZHLB 4JQXA 4X6CA 2IANB 5KYYA 4XOBA 1B0GA 1E43A 1ORSB 3SCMA 2EKSA 2FECL 1IGJB 2ZUWA 1TJXA 3B9EA 3DPDA 3O0LA 4JKPL 4XMKL 1DUYB 4C83A 4MXQC 1U8OB 1E2ZA 4LSRL 4A55A 3KG5A 4R2GD 5F88B 4OY9A 3B5TA 2VDPH 4HGKC 3VXMA 2Z93A 4TVUA 3TJHD 5IR1A 5IOKA 3BH9A 4G8FB 4JY5L 4OLUH 1HVXA 1X5XA 1U33A 3WG7B 4WF7A 5CCKH 1NOFA 4ZMWA 4WWKC 4P3DB 3SQOL 2P4AB 1EGJH 2XRAH 3ARYA 4U7SA 3JWNG 3QXDA 4IHOA 2AEPL 3CFNA 2FE0A 4PJGB 4JG1L 4RA3A 2CDGB 5B3JF 3ZE0B 3ZKSD 3QRFM 1KB5A 1PY0A 2CJUL 4PTUB 5CSGA 1MNNA 3D3VB 4GSXA 3OZ9L 4LLVB 4FQXB 3WKQA 3DV4A 3ZUNC 1AR1B 1E9PB 1EAJA 1E42A 3T71A 4WK2B 1G0XA 4JPVH 4QF1A 2WAHA 2J2ZB 1HEZB 1TOXA 4ODWB 2HH0L 3NA9L 4HBCH 1BG1A 2Y72A 4XBPB 4UUJB 4XMKH 3EDDA 4PAZA 2AKRA 1CD0A 2FGZA 5AKTA 1L5GB 3QIBA 3C08H 4LKXA 5JXAH 3O6FB 2P28B 2CD0A 2AEOA 2VDOB 3H9YA 1HH9B 4NKOA 5TQ2L 3F7VB 4RRPA 5DFVD 1L0QA 5F9OL 4YHZH 4F9LA 3QEQA 5HPMB 5KZCB 4JFHD 2DQCH 3K72A 4HIIA 4JHBA 3EGDB 2EINB 3EGXB 1H3WM 1MZZA 2XZQH 1KCVL 1U58B 5D4QA 4A7UA 1C5DB 2C3VA 2GFBB 2JB6B 3B7SA 4YC2B 2MIZA 3K6FA 1YY8B 2X0VA 2XY2A 3VFMB 1TIUA 2HAZA 4ZAKC 3SEPA 4DN4H 4G5AA 5JQ6L 3THML 5F0JB 2ZCKH 1WCBB 4NKQB 5FYLE 3ZDWA 1WGVA 4PJCB 3EHBB 1P53A 1T7YA 3IAQA 2E3VA 3NSXA 3GLEA 4L1LA 1TYJA 4XMLH 4X5XB 4BHUA 4I48B 1J8HB 3CSPA 3D85D 5KAQG 5FK9B 5I6MA 5E00B 3HRPA 4BK5C 1UATA 3D6GA 1OB1B 3ISRA 5D4IA 2EH7H 3EJUA 4BDVA 1K8IA 4HGMA 4YDIH 3QDME 4FNPA 4KXZI 4NAQA 1E4KA 2X1WL 4MASA 1X3DA 3ESPA 4N2BA 4AQZA 3QYMA 2E6PA 3FOLA 3MRFB 4H40A 1YECH 2X40A 1QBLH 1YC8A 4MA8H 1A3RL 3L7FA 5JOFB 1IFGA 1UM5L 4D7BA 4QMEA 4LPYA 4JREB 2C9VA 4E9LA 3QEHA 3S8FB 3MBWA 4MQTB 3F7KA 3UTTE 3BRFA 5CP3A 4HXAH 2ZNXA 5SX5H 2VLRD 6FABL 1SOKA 2H3NB 3D69A 3F7LA 2HPTA 1JVLA 1SJXA 3DSFL 4PJAF 3X14A 4O02B 4YNYB 2B5IC 2J1XA 1R4XA 3N43F 4S1RL 3H55A 1N5YL 1WSST 1H8LA 4LVEA 4NQQA 4G7SB 1IVTA 4D9RD 1O75A 1FYTB 2I07B 3LQAH 4JG5A 4MHHG 3V0FA 1TQCC 2XN9D 1I85A 1KJ2A 4MS8D 5IB5A 4DVBA 5EBLB 4EI0A 4RWYL 4NQUA 3X11B 4MDIA 5FW8A 1R24B 3F64A 5EU7E 3LVEA 3VXSE 1GPOL 1IC5H 1AZVA 3CC1A 1AGFA 3KPTA 1GGCL 1LK3H 1HAUA 3S5LA 2VWEE 3L3IA 1UGNA 3H2WA 2I9LA 3BVDB 1O9WA 4WU5B 2WZ6A 2XOTA 5DD3H 5F89A 3TPKA 5KW9H 3SKOB 4RWHA 2R1YA 3L4YA 3BFOA 1KEGL 1J1XL 1OHZA 3QSKB 4B9KC 4ZDHA 3WDHA 3CK0L 3FB8A 4L4VB 3CXHJ 4WHYH 2EVJA 3G6DH 5H2BB 4LAJH 7CGTA 2EKSB 3ES6A 3OKNB 1SY6H 3FULA 3L9BA 4YSEA 2VJXA 5AB0A 4ZFFA 4UANA 3MXWL 1NKGA 4KFZC 4PYGA 4PREA 5BV7C 2O61B 1YUKB 3ARGA 3PWUB 4HZLA 5CIPA 3ZSSA 2P49B 2A4CA 2AAAA 1SDAB 2EE9A 5IHHA 4QHLB 2ESVA 3BUYA 4D9QE 4QO1A 3WLWD 1BZ9B 3LMJH 4K2UH 3CX5J 1WF5A 3D3VE 3LZOA 4N3UA 2MHAA 4NQSB 4AY0A 4Z18A 4QEGA 5C0GB 5FYLL 3V5HB 2HLAA 5ESQB 1P7QA 2SEBB 3SGDH 5H94B 3RWCA 4AGQA 4B97A 2CDGA 4JM2C 1XR8B 2NOYA 4R0LA 5EN2A 4TQEL 1R0AL 4X9BA 4HOXA 4OZFH 4XC1L 2LHAA 2Y36L 4KY1H 2Z0UA 3NEOA 3W39A 3LY6A 2B59B 2XTJE 4JFQB 4TRPL 1E8WA 1T83C 3V5KA 4XCFH 3I75B 1KCBA 1VDGA 1SJHA 4Y19E 4B3EA 1S2EA 3T0EC 4BUQA 2BOCA 4OB5H 4FHJA 4HK0B 2UY6B 3OXSB 4J3XA 5DJXA 2XKNB 4R7XA 3VXRA 1W80A 3DYMA 1NUNB 1QG3A 3HZKB 2X05A 3I2CH 1S78D 2G60H 2KERA 4IIQA 2GQHA 2V5TA 2ZP9A 2IMMA 1G9NL 4MB3A 4JB9H 4KTEH 5DMKA 4Y88A 3RG1C 1UM4H 1B2WH 1WCBA 2QQNH 3C5ZD 4XXDB 5F1OB 1XD1A 3QI9A 4P9HH 4XOEA 5EDSA 1HEHC 4UQ2B 5FIEA 4G80B 3K8LA 3ARWA 5A3ID 5KSBF 4AYID 4WWKB 1JDAA 4ZTOL 2XNAB 4GRWF 2LT9A 2ED6A 1H6UA 5HYSG 3T0XA 2DBLH 1QUNA 1JGLH 2A6KA 5IBTH 1U3JA 2ARJA 3ARBB 3EDKA 4YXHH 1LMIA 1MY5A 4LHUD 3IDXH 4GSRA 2XVKA 1QSFA 3T0EA 1SDYA 1UJ3C 4FJ6A 1I9IH 3QJUB 3MBWB 3GBMH 4PB9H 2XXGA 1YN6A 4NQCB 1GGUA 1C1EH 4IW4C 5EU4A 3UAEA 4J27A 1LGVA 3EO0A 3BGMB 3LIZL 1TVHB 2XWEA 4ONGH 4GH7B 5LVEA 1TUPA 1MG2C 4XMWA 1K5NA 1SHXA 4NSKB 1HQRA 1BF8A 2YPLE 4M56A 4PJCF 4MSWB 1QSVA 1QVOA 1C5CH 4JFUA 5D4JA 4KKLC 3H4HA 4GG8B 5D5MF 3II1A 1ODAA 2OMWA 3VFWA 5HHOB 1P7KB 3HUJB 4YDNA 4N0CD 4PV8B 1S3KH 5AVYB 4XXWC 4MJID 2H1LM 4QTHA 1AGFB 1SM3H 2ZSVA 3RL1B 4HDIA 5BQ7B 3BRGC 3GO1H 1UH2A 5DJ2B 5K59E 5TK2A 4OQTL 1RVFL 1WD8A 4D94A 2IAMD 1A1NB 2MPAL 2XTJB 1PLGH 1H6EA 4MZIA 5FYJU 3BZFB 3QPKA 2DYPB 1H9VA 3L54A 4PPTA 4ANXA 3VXQA 4UZUA 5CGMA 5D96B 3NJHA 1X7QB 2VOTA 4H2CA 4EOWL 5I8KH 4IDLA 3BEVA 3B7TA 1Z9MA 3DX4A 2BMKB 3INUL 3MJ7A 1H0DA 2QPEB 3W2DH 4L3AA 3RWHA 3LH2H 1PG7H 1AC0A 5EUKB 1MELA 2UYLB 5EF0A 3BP5A 2GTWB 1BZ9A 4KJYA 2ZCHL 4L4VD 1T1YA 3FMGL 4G59C 3S3BB 4BWWA 3A5VA 1WFMA 2X4UA 3V4PA 1DL7H 2ICEA 3O4OB 3DHPA 1DBML 1T4KA 4TV3A 4ZPTA 3SYOA 3WXVL 4CVXA 5A1AA 5JHAA 4CVZB 4AVHA 3RGVA 1K8DB 1G87A 3PL6D 3BJ91 3FCTA 3IGAB 1DE4A 5DRZA 1XBRA 3EYUH 3G9AB 4BSJA 3VD9A 1L3NA 3K8KA 3MRRB 3SKNA 2W81C 2EYTB 3OF6D 4AEEA 2EE2A 1S7SA 3QORA 5KSVA 5D7EA 2JV6A 1CFMA 1WFJA 3Q6GL 4JN2A 4OUUB 5CBAA 1HWGB 3NABL 4AIZB 4LB8A 1RXLA 2VQTA 1HHIA 3C6SA 4WQOA 4X2UA 3SGKC 3IDJA 3SDAB 2CRZA 4I0PB 5C0JA 2K4AA 4XCCL 3WKPA 1AKJD 2ICES 3N9GL 3QNZB 3DX7B 5I1HL 2L8AA 4DH2A 3IJSB 4ZW7A 1YDPB 3LEYL 2Z7ZA 3T0ED 2FATH 2VRQA 3O8XD 4XXDA 1OAQL 3ASOB 2YGVA 1FFOB 2BVYA 2AAVA 1FBIL 5IMKB 4XMPL 3DOSB 3BI9X 3EOYG 1II4E 2WLLB 3L4UA 3ZKNC 3ZRFC 1CG9B 4YHMH 2WXOA 4N0YH 4CN4A 4ES9A 4DP7X 3MO1A 3BUBA 4Y16A 2JK5A 1OTTD 3BH9B 3L16A 1DBJL 4YN3A 3LRLA 2N4IA 5TJWK 5C0FB 4EI6B 3CSBA 3MUUA 4LAQH 3HKFA 4AQAB 1AGEB 3W0WE 3HFMH 4HUVA 1NCIA 1UM6L 4ZS6D 3TF7C 1H5BA 5AVZB 1J1OL 2OMNA 3SCMC 4LKCA 4R7NB 1FQ9C 4X9GA 1U8KB 3AS1A 4HC1L 2GYSA 5EUOE 4I2XB 3I02B 3GBDA 3GBEA 2DMKA 1I8LC 4OV6F 2DQJL 1XR9A 1YEHH 4IRZH 2B2XH 4AIOA 1MJ7H 1T4WA 1F4HA 1KPVB 1ACXA 4OI9A 2UZIH 1ZHNA 2JIXD 1L7TH 4JRFA 4LKXB 5E9DE 3ELQA 4X8GA 1OZTG 2WQVA 1E27B 4BZ2H 3KGSA 3QW9A 1BGXH 4UQAA 5IHUH 5E94A 3DDGA 5DHYA 4RA0C 4C8XA 1XF1A 4Q9RL 1J10A 1U2HA 2ZSVB 1LEIA 3ASNB 1FVCA 3KGRA 4HDIB 4FG2A 1HH6B 1CDJA 1N26A 1LO5B 2UZPA 2P46B 2MNUA 4URKA 3NSYA 3BC9A 1T80A 3T1WA 5F93C 1NFAA 3NCJL 3CQQA 3BKJH 5CBEA 4W70A 3G04B 2X53A 2YPKB 3JT2A 3BVUA 4HKJA 4NKIL 4X6EB 5HDOA 3NZHH 3MRKA 4JFEE 3P4LA 1T7VA 4UT6H 1AJ7H 1KNOA 5E9AA 3KEHA 2J25A 3MJGX 1AGCA 4U6XB 3U7WL 4I1RA 3FXIC 3CPLA 4QRTA 2I27N 5A7BA 1HSBB 3KR3H 4JO5A 2QJDA 3QEQD 2B4CH 4Y4FC 2NY6D 1BXUA 2XWTA 3SBPA 2WNKA 3H9HA 4BM7A 1WAAA 2YK1L 1F3DH 1EFXD 4NIKB 2VLJA 4Z7QF 3UZVB 1E9QA 3H85A 4XP5L 2ZOWA 3ECWA 3Q48A 4P99A 4XNDA 5DRXA 4ZAKA 3EJZC 1DQML 4L8BB 1EZLA 3QFJD 4BINA 2QMKA 1KGXA 4NFCA 1F02I 3OR7A 4HKBB 3ARUA 5TE4L 1N3NB 4LRIA 5FYKU 1UHVA 3VFOA 4U1NA 5A2KH 4QHKJ 4W9CC 2UVFA 1KG0A 4XGZB 3TS8A 3P4OB 1AFVL 4O2EA 4XNYL 5HVHB 3LRHA 3WN5C 4YNYA 2PETA 4JJHA 2BOBB 4PWKA 4QD2E 3GTNA 3WXVH 2E6QA 3SKNB 2ATKB 2VNCA 3L81A 3LRMA 3AY2A 3S37H 5IFAL 3ZYIA 1NKOA 1QSEB 1IEBB 3AG3B 1CBVL 3HMWH 2ZUQC 1JHLH 3U36B 5ISZB 3JWOC 2J71A 5BMFL 5BCAA 4LPCA 1E6OH 4R7VA 1BBDL 2YA0A 1QEWA 2IDUA 4ONFL 1X5ZA 4YGVB 1RIUH 5BZDA 3IXAA 4PUBL 4EXPX 4IBSA 2YD6A 4WU5A 1NGQH 3PWLA 5I73B 1CFVL 1YDPA 2J6WA 1ZPUA 4M43H 3QZBA 4J3BA 2MKWA 3QHFH 2APBA 5CMAB 3P77B 4I9XA 4ZMVA 1JP5A 2ZXBA 5HHPB 3FUFA 4YFDB 1J5OL 2PPDA 2V7HA 2ZJSL 3RFZA 4I77H 2Y69B 4BE5A 1AGDB 5TPWL 1I9EA 3B5GA 5FWQA 1A3QA 3VG9C 1DBMH 1NAKL 1MLCB 1OF0A 5DUML 4MMYA 1NAMB 1JRHI 5GISL 1TZGH 2B4CC 1MSPA 2CGYA 4ZSOA 3BAKA 5LGYA 5KVFL 5E1IA 4OZ4B 2MHAB 1RZFH 5C0GA 2OMVB 1BJ1J 2OTWB 3L9RB 3PAUA 4HOWA 3PREA 1TZIB 1A2YA 2E8ZA 3II2A 3WTXA 3OLGA 5FM4A 5E8EA 1K85A 5ID0A 2Q86B 2F7QA 2JB5H 4M7JH 3GS0A 1O5PA 3G3LA 4Y7OC 4R7NA 3SIKA 4X0KB 2OXHB 2DEXX 3G6AB 1MJUH 4TQHA 1EHAA 2YAFA 4ZUVB 3GMQA 4L9LC 4OV5A 2R29H 3JTTB 1NBVL 1QFOA 4MNQD 2VSCA 3VFNA 5TDNB 1TJHH 2BP8B 4CILA 3TL5A 4NO5A 4NQXA 1IL1A 4B7IA 3CFBB 4R6UA 4HX1B 3BCFA 3OX8A 2NNAA 3VRJA 4LCUA 1MIEL 1RUML 4LARL 5DJXB 5ICZB 4OCWL 4XVUD 5C86A 1Z2KA 1LEIB 2VYRE 2AEQL 2C9PA 2CIIA 2YD0A 4UIMB 4OIBA 5D70L 1GYCA 4JR9L 3L3HA 4PB0L 2OAAA 3VSVA 4G8GD 3EYQC 3MN8A 1G7JA 4OSUL 4QRQB 5I5IA 4WEEA 4B9YA 2YFOA 4ALAC 2RJMA 4P5SA 1E5YA 3HR5B 5D1QB 5I74B 1A7PL 2Y5QA 5ITBH 1FP5A 4RISL 5I0WA 5BS0B 4M6MH 3VCLB 1AFVH 2KZKA 1HE8A 3B3IB 3JZ7A 4DK5A 1RUAH 3PHSA 3NFSH 5DURB 1PKQA 1N70A 1Y18B 2FNBA 2FHCA 3NACL 1A9EB 1YEIL 4FLQA 4JDVB 5D2LF 4DN3H 1EEYA 1MVFA 1ZLEA 3HG1E 3RUGE 4AEHL 1QUNB 3N42F 1DQJA 1ET8A 2WPGA 5TGBA 4NBZB 3CV5A 4IS6A 2CKBH 2VLJB 1UACH 3EJQA 4LSUL 3RVWD 2DL2A 1PDKB 2EO1A 1QSFB 1GMIA 5J11B 5LLIC 2R2BA 4FZ8L 2PLTA 3KPMB 5DEZA 4PMFA 3CFKB 5JXED 1NCOA 1E4HA 3VFVB 1D6EA 3HVDA 5IW3A 2R4RL 4U1NB 3OAZK 4RZCA 5DO2D 3DURB 5FO9B 5IFJA 4F37F 3S0PA 1NCJA 1R3LB 3WNKA 4AL8L 3BXNB 3VFSA 1K5NB 3FRUA 2BVOA 4ZOEA 3US1A 2HTKD 1IAIM 4GRLC 2ATKA 4NQTA 3UXFA 4BHUI 4XXWA 1E3FA 1F4YH 2O6CA 1HHHA 1U8LB 3OKLA 4QAMB 5ABDE 3VGFA 3R0NA 3VRIB 1T2JA 3V0AC 2HRGA 2VSKB 2FD6H 3D0VB 4GAAA 1VACB 2X09A 4P5TB 1M7IB 5IW6B 3PCYA 1EK3A 1MRDH 3NOIA 2ED8A 2NY1C 4FQXC 2ODIA 2A1WL 4WK0B 3CDYA 3U7WH 3GBNL 4GT7A 1OAUL 3FSZA 4LMQI 1KACB 3QUML 5GS0D 3F3HA 4JRYB 3NJMA 4L8SA 2BHZA 1SXBA 2F1BA 4FYRA 4JY6B 1B0GB 1KWKA 1RMFH 1Q90A 2MNJB 5K1NA 1XF4B 2NY1D 5F7HA 4TNFA 4MYWB 3BUPA 1X5YA 4GSDL 2NY4B 2KI6A 1X4YA 4PGCB 3VMPA 2CO6A 1PX3A 4TNVK 1L3WA 1BVLB 3GEWB 3L4VA 3W0WD 5LBSL 3EG9A 1BFOB 1EXUA 4AW4A 1RLBA 4NWTL 1CFTA 5IR1B 1V55B 4G8FA 4TUOA 4Z7UE 1TQBB 2PTVA 3QULB 4M29A 3TBWB 4JM2F 3FQUA 3C60D 1MCRA 3T77B 1KB9J 1T1YB 4DP6X 1XFPA 4RDQG 1UZ8A 3HHRB 4KJWC 4WO4C 4FQJL 4Q9RH 4QGYA 1WDAA 2GT9B 3IFLL 4P4RA 3K71A 5C1MB 4KPHH 5SV3A 1PW3A 5JXEC 1F4WL 1EMTL 4XCNA 4P5MA 3DV4B 1J1PL 2VUYA 4MWFB 4H5SA 1JDCA 4QUOA 4X8JB 1VGEL 3LZPA 4J2QA 3U83A 1HAWA 4JFFA 4BFIB 5I1JL 4ODWA 3BKML 4JFFD 1RL1A 2NXZC 4A37A 1THCA 4DZ8B 3JTTA 1FFPB 2AC0A 4RX4A 4GXFA 4GSDH 5ANME 1E2VA 1JE6A 2IFFH 3NCFB 1S7TA 2CO1A 2VE6A 2DWXA 2G30A 3MLYH 4RGND 4OLXL 2OTPA 4PD4K 5EOQL 4XCCH 3NPSC 3PF2A 1H6FA 1T5WB 3K72B 4JN2B 5CAYB 4WHCA 5LAXB 2UX6A 5MENB 1QI4A 3RWJB 3RI5K 3WBDA 2CIIB 2O5ZH 2WXIA 3MUY1 3KPRD 5J6HA 4I0PA 3MV9B 4RFOH 1BQRA 4MJ4A 4M7KL 1G94A 5C0IB 3CFCL 2MCMA 3BGFB 4Y9BA 5FYLD 4GBXC 1ETZB 1SOQA 2Y06L 4F57H 5JHLL 2R4SH 4KKRA 1OCWL 4F2FA 1D5XA 1EJ6A 5F1NA 1IBFA 1IM9B 1WVZA 1DQDH 4PRIB 3MUZ1 4FLOA 5KBNC 4P2RA 3GHEL 3MDJA 3P2TA 1B4JH 3IJ9A 3LH9A 1MHEA 4A2DA 3WS6A 2X4PA 3ZMNA 2C4FT 1DANT 3IVKB 2BJMH 5BQDA 2C1OA 4Z9KB 5D7JA 2EIKB 1I1AD 3QWQB 3CFDB 2NX5D 1F00I 3ABMB 3C08L 3N44F 1I8LA 3C60C 1WTGT 4OKDA 3CNKA 2XWCA 3N1FC 4WRLA 2UWEB 1JG9A 3CH1B 1JZ7A 2EECA 1DFXA 1S7UA 2BW5A 2CRIA 3UPRA 3TCXA 3ULUL 1XSOA 1SJMA 2XZQL 3ARFB 4PJ9D 3HG0A 3H0TB 4PJ6A 4WI9A 1W8OA 1KDJA 4M7LH 3WD5H 4ENED 4A2EA 1CLOH 4DVBB 2A74B 2WKLA 3DJ9A 4F7PA 2IOMA 1MPAL 3HAEH 3S8GB 2A2QT 1SQMA 1QPPA 1D5ZB 1IBDA 2YD7A 4NBYB 5EU6B 1YEWA 2FHBA 1AKJA 1QP1A 2VN5A 2B3RA 1GGTA 5KVGL 3GSVA 4ETQB 2DM2A 3IFNL 3MV01 1HINH 5DUPH 5JPNB 2VIRB 2BIIA 2YSSB 2Q8BH 1K3IA 2CO2A 4ODTH 3LEVH 5BO1L 4FXTA 2JB5L 4M7JL 4DTGL 3QCVH 3HVNA 2LU4A 2X4RA 4JHZA 4U3HA 5IVXA 3ULVF 4HV8B 2FJFB 4LSPL 3NCWA 5FO7A 1NAMH 4HJEA 1XIWB 2R29L 4H8WH 1CE6B 3K3QA 2XN0A 4FD0A 1FFTB 3HPJB 1ZKAA 1LP9A 4FYSA 4KUCF 4WKZB 5IW1B 3D5OF 2HJKB 2W65B 4I4WB 4JRYD 5DD5H 5SWQB 1YLBB 3MROB 1AGBB 2KPWA 3DV6A 4TLUA 1P5UA 3EFDL 3W56A 4FL4B 4L3CB 3RTLA 3Q5OA 3EADA 1SM3L 1P7QB 1KTKE 5BJTA 2CK2A 1UH4A 2AQTA 5AVUB 3K71B 2QMJA 4XO5A 4AUYA 5TK4A 1DQTA 1DSWA 2PO6C 3L17A 4PVLA 1NEPA 3KBHE 1L6ZA 4GAGL 5SX5K 3OKMB 4FADA 4H5SB 1ADQA 3QO1B 1ZLVK 3ZTNH 4XN2A 4PV9B 3PFUA 4N68A 3KBPA 4PRIE 4HCGA 5HXMA 3LKPA 4FNLH 4MJ6B 4YHKL 1OCZB 2XQ0A 5DVMA 2APWA 3SYAA 1ZLUK 1KBPA 1OSPL 3R8BB 4ZW8A 2X10A 3VXOB 1AE6H 3SDCA 1HKLH 1N8OE 4L37B 1ZGLP 3O6KL 4N28A 2WN2A 5SX4I 4OKVB 4HH8A 5F7BA 1XBDA 4F7TA 1KULA 1A7OL 3IAPA 3X1BA 1DO5A 1PNDA 4NPYB 5MERB 4LCYB 3PWLB 3C2AH 1JGEB 4K7PH 4P2QD 2AQ2A 3VRLF 4E9YA 5TPWH 1XMEB 3IPEA 4PGDB 2J21A 5I19L 1NUDA 3PNRB 1T6WA 3WUWA 4LGRB 5EBWB 1MJ8H 3EXJA 4XH2B 3SB3A 2H1PL 1D5XB 2JWYA 3MBED 3OB8A 3ZE0F 3LPOA 4FFYA 4HG4J 4C4KT 2D0FA 2WGNB 4Y4HC 1CXEA 4C54A 3GIVA 3IE9A 1DLFL 1OARH 4KBPA 2FQEA 2IMNA 5JNYA 5GGUA 1QI5A 2A6KB 1TTGA 2P52A 3EJCA 2X4PB 2A6DA 3DIFB 4LLYB 3GMPB 3P9LB 5EIQA 3HG3A 4MKTA 5IIEA 3CVCA 4AIXA 3QWNA 1O7DE 2V8MA 3S8WA 2J8UA 2OSXA 4GMSL 5FFOA 2HKHH 2YQBA 4FA6A 1DVTA 2WBJD 1KJ2L 1S7UB 4Q56A 1JVOA 4LDEB 4WDIA 5I30H 4ZUVA 4ADIA 4N86A 4OV5B 1CB4A 4NSKA 4IIZA 1YYCA 2HX7A 3FCUB 4GG8A 4NO5B 4W9KC 1KMGA 3CFCH 4KI5F 4HS6B 2VABA 2NUPA 2C9AA 5HY9A 4HJTA 1CS6A 4UAOB 4OZGA 4HLZH 4NNYB 3WDIA 43C9A 3JWOL 5ICZA 1R17A 4QXUH 1G5GA 5AVRB 1LILA 3MV8A 2OL3B 3RILA 1W6LA 1RH8A 3BT2L 3V52L 1KN4H 3K6DA 3KMDA 1QFPA 5CGYD 3RX5A 1N67A 2ADFL 5T1LA 2X6BA 4X4XA 5T5FA 3QIUA 1MWAH 3X1NA 4JVWA 2XFXA 5DJ2A 1KTBA 3GXNA 2VGLM 4X8XA 4YR6B 3HR5A 4ICWA 5D1QA 1SUJA 1VAHA 1YYLL 4GKLA 3V4PH 3CCHB 3L1OH 5C2BL 2IWGA 4TTDC 3ZVVA 4LGSB 2QQLL 1QA9A 1Z3GL 4JKMA 4XMTA 1ETB1 3QAQA 1N59B 3AS3A 2OV0A 4OLZH 2WUCL 3B2XA 1KEGH 5DT1L 3MGOA 4HUUA 7TAAA 1VKXB 4GUPB 3N85H 2JXMA 4PGZA 3UIZA 1P5UB 2CGRL 2X9WA 4MX7A 4R5TA 2FK9A 3PWVB 2X3CA 3KBEA 5BJTB 4NZDA 3KW8A 2FIKB 1A4KA 3RX8A 2BNQE 1KN4L 3LDBB 1ZV9A 3H9ZA 4MA3B 3CFKA 5AWNH 3U0TB 4HK3J 4K71B 1A6AA 3KCWA 4OD1L 1M9SA 2Z31B 3MI6A 3OKMA 1AP2A 4U7MA 1AHWC 3PXHA 5BZWA 2ZUUA 5KVDL 2WANA 1CC3A 3ARED 3L4ZA 4B5ZA 3FRUB 3WTSA 4IBVA 4BQBA 3LKPB 3VDBA 2ZOTA 5CD3B 4PI0A 4Z7AA 3IRZA 5C0DB 1S5IH 1JPEA 4XP4H 2XZAH 4PMEA 4CKQA 1FNAA 1B90A 3OKLB 5FYJL 5E9DA 5ACMA 2OI9B 1XB8A 2OX5B 4RMRA 5DC9B 4MTMA 2Y5EA 4L37A 1JIBA 4IU2B 4HJSA 4YDVA 2YC1B 3ETTA 3IAGC 1G6VK 2MRYA 4GXVH 2XYBA 3WE1A 4CN1A 4NN5B 4N6RB 3ARBD 3KVPA 3VACA 3EDFA 3DX7A 4H8UA 4HZAA 1TTBA 2D3LA 5B22A 5BXFB 4WV1C 4QHMA 3RAJL 1U93B 3VD4A 2VW4A 1FG2A 3W0WA 1TSRA 5DUBA 3ETBF 3MZGB 5D1QD 1MW1A 5JLZA 1UWEH 2CR0A 2XN9A 3IMTA 3VU1A 4OU3A 4F9LC 4PGCA 5LBSA 2CO6B 4JUTA 4X98B 1A5FL 4ODUB 5CHNA 3F6JA 1B4RA 1QKZL 3O2DL 1SF3A 2FH6A 2NY3B 3VRLE 5FECB 5I24A 3EYUL 4IRJD 2PO6B 2JLLA 3CHSA 2P8LA 1BV8A 3LZRA 1BMGA 3RFRA 3V9EA 4F3FA 3GK8H 4W4OA 2WYHA 1T89A 1QBBA 1EZUA 2AFNA 3SKMB 3VQ1C 4L2LA 5EOCH 3AU0A 4Q0XH 5BVPH 1AE6L 1A9VA 5I8OL 3KPQB 3TH2T 4S2SA 2OJ1A 1F4AA 3I02A 1IC4H 1XGZA 1JV2A 5JIHA 4LEOA 1OAJA 1BXAA 4GSQA 1GY1A 1JWMA 3VX1A 2AEIT 2ZKHL 2CG9X 1S7TB 1YEKL 1NCWL 4A39A 3QZNA 4FI6A 4DCQB 5E1AA 4AZUA 1OD9A 3P30L 3BJLA 3RZCA 1URZA 1MFDL 2WBJC 4HWZA 1FYHB 4J1UA 4YDLB 3RURA 1TJGL 4NKDB 2KL6A 1MJ8L 3VNZA 4LL1A 1V7MH 4PH8A 2VRAA 2WYZA 1BX2B 4ZFZA 3VFTB 6PCYA 3T1FA 2WLNA 3MV9A 4KOCA 2J1YA 3SDXA 4XP6H 3WL9B 4CNIB 3DGCR 5GS1B 4NX0A 4PJEA 3WMPA 2F5BL 2WXKA 2R0KL 3GI9L 4JO1H 3VDCA 5A2FA 5CD5C 3KH3A 3OPZH 4ABWA 4XNAA 1T89C 2EO9A 4X6EA 1RZJH 4KDTA 4A6YH 3CQPA 5A16B 2WUBH 5F1NB 1HJCA 1V7NL 1S7RB 2OCCB 4PRIA 3MKGA 2ICWB 1VGKB 4NUJA 3GKZA 3DLQR 1XF2B 2G5BA 5KVEL 4F15C 3EJYD 5FB8B 5L9DL 2XV0A 4FQCL 5AZ2H 4Z76B 4ODTL 2JXMB 4XXCC 1IARB 1TJGH 1FNEA 2QV4A 2NLJA 2ZT9C 3CXFA 1AR2A 5B21A 1V7ML 4JPIA 2EDJA 4L8BA 3RYMA 3SBWC 5GGTH 2IQAB 3IDMB 2AJVL 4QRSB 2OK0L 3NK3A 4PRBA 3H7BB 3NRFA 1S7WA 1W72B 5K93A 2GJZB 1NGQL 1UVQA 1AP2B 3U30C 5TDPB 3TT1L 2AXGA 2GJPA 3QDGB 1PL3A 2J8OA 5A7EA 4PBWD 3PWPD 3ARFA 4AJYV 1ZA3B 4M48H 3NSDA 4HJJL 3UYRL 4Z3TA 1MH5B 2K3HA 5HHNB 4F7KA 1NDMA 5IBUG 2DQGH 4Z7WB 4JFDD 1M1XA 3FHEA 4OZGE 2BNQB 5DUMH 4Y1AE 3HBQA 3FCGA 3MNWA 2EUWA 5CKGA 1UQSB 3JV6B 4LCIH 3ZYOA 3LKNA 5K39A 3ROOB 2COVD 2G4GA 5DRWB 4EBQH 2CDEA 3NIGB 3KR3L 4ETQA 1KSRA 1CDHA 3T3PB 4IGBB 5C8JA 4OJFH 2X1QA 3IU4L 3GXDA 4G6ML 5D7KE 4XCEA 4UV4H 3O0RH 1E6JH 3P77A 1IBGL 1UXSB 3LV3B 4AGMA 2J8UE 3UEQA 1WISA 2PP8A 2KYIA 5JPMC 2P80A 4HV8A 4FP8L 4UB0L 3CFUA 1NC4A 4FLSA 4ZTPH 4AQ1A 1CLZL 1NCDH 4U1MB 5SWZB 1ZS8A 4CJ1A 3WN6A 4F7EA 1NIDA 4I9WE 4O2CB 5KVDH 2PO6A 1I7RA 1JERA 2QV2A 4L3CA 2VXVL 2A0LD 4AGLA 1QFWM 4PI2A 1TZIA 3X1EA 3BMWA 3V4VH 4E2OA 32C2A 3MUJA 4KXBA 3D3VD 3AT9A 1P84K 2J1ZA 1UD5A 4N22A 5E8EB 3WIHA 1OTTC 3BAEL 1ERNA 4P59H 1E9PA 3EZJB 4QRRE 5IESH 4X50A 5BV7H 1F41A 3GMQB 5IOPB 4HCRA 3VSUA 2UWEE 4GP8B 5K59F 3BDYL 4LNVA 1GKEA 2AKRB 2EXWC 4PM1A 4AYSA 5F3BB 2ZWLT 3KXFA 3P0YL 4PW3A 4UT9L 4KXDA 3K2IA 1GJIA 4UQCA 4IQHA 1EANA 1R46A 2LFEA 2NSQA 4YZFE 2F7PA 2CNYA 5FWRA 3RZCB 3G5WA 2WTOA 1Y6MR 5INCB 3AQDA 4J1UB 3MKKA 5CJ8A 2B2XL 5T5FL 5CSZB 4Y19D 5L4JA 2A9NH 4PLKD 1UEYA 5DO8A 1E4XH 5I1GH 3DO7A 1ZXQA 3OKEA 3VFUA 5C71A 1PZ2A 4W9JC 2VWEC 4MJHA 1WK0A 1JMZA 4OCLC 2UXTA 4G83A 2VDNB 2F74B 4RNRA 4QXWA 5DSCA 4HWEL 1GY2A 5F9AC 4BH8A 1ED3A 3CVIH 1W91A 2AI0H 2CDFA 2F18A 4GQ9L 4NNXA 5JUEH 3OM3B 5A16A 2CCVA 3X13B 3ZW3A 2XQYG 3VCLA 4ZOCA 2QQKL 1BYNA 3GXIA 2PTUA 3RPKA 1J87A 4NUJB 1CXKA 1DLHA 2FX9H 3LEXB 3HNTH 2VXQH 3JVFC 2M83A 3KLHC 4PJHF 2HFGH 5EPMB 4DETA 3AB0B 1SMDA 3MGTB 3FB6A 4PS7A 1KGYE 1ZRUA 1N18A 2Z92A 2AGJL 4K3EL 4N85A 3LNGA 3FOLB 3HS0B 3NCEB 5GGVH 1EHKB 3WJJC 3E9TA 4KK8D 2WO4A 1Z6JT 1MCFA 4NFBA 1OE2A 4IKJA 3T3PE 3PHQA 1M71A 4LCCA 4KKZA 2CBTA 2HA1A 1LEKA 3T9WA 4EMZA 2OA9A 2EDKA 3ZRCC 4CMHB 4KXAA 3A4FA 4P2OA 1UD2A 1ZE3H 4B60A 3QDGA 4UM8B 2E27L 2ZWZA 3PJSA 4FZ8H 1I7TB 3TH4T 3BXNA 2XWRA 3UZEA 3VFSB 2BVOB 4CSZA 1QFWL 5K5YA 5IK3A 3VGEA 1IBGH 3ZGIA 3VQLA 3GYRA 5ES4B 2IH3B 4KO7A 1LD9B 1OAQH 5T3ZH 4GAJL 1FSKC 1E4WH 5C0BD 5CEYA 1UASA 2P5WB 4F8QA 5I0DA 2N7SA 3PQYA 4MDIB 3OG4B 1IAII 4OT1H 1TQUA 4MXQD 4NC1E 5CZVL 3A0OA 3UYRH 3QHZL 4NUGL 1FORL 3UROR 2WLIB 2Y5TB 3ZQWA 1KIRB 3I85A 1WJ3A 2EH7L 1KEML 4ONHA 4TOYL 3SJVD 2FZ3B 4XMXA 2DI9A 1VERA 2XFXB 1P6FA 2CK0L 4HPOL 1TZHB 3CSYA 4I7ZC 2CKBL 2YRZA 4JY6A 2KH2B 4A63A 1IGFL 1UXSA 3LV3A 4J3TA 2RFXA 3D50A 5DJYB 4G5ZL 2C4XA 5C97A 1SMOA 3NRPA 3QXTA 3F7PC 5EG6C 3FJTA 5E5RB 1F90H 1WBYA 3DHJA 4E9SA 1AMYA 4GI8A 3TNMA 4ZFOL 1KZQA 3OPUA 3N41F 3AUVA 1NPNA 4WFFD 1U2YA 4F7EB 5E6IA 4WTQA 2ZOLB 3DX6B 4WUKH 1I7RB 1NH6A 2CHNA 4MX7B 5F9OH 3T77A 5HYIA 3CH8A 4M48L 3PWJA 4HCIA 5H94A 3RWCB 2VLMD 4LSRH 4DZBA 1A14L 1T3FA 3KS0H 5K33A 2XG5B 2XRAL 3F01A 3N40F 4JJ5B 4P5MB 4EUPB 3ZT5A 2ZQKA 4X4YB 2I69A 4LLWA 4DN4L 1WRFA 1MVYA 4JLRB 4TSAL 2W80C 4XNUH 5BZWB 3SQOH 3L5JA 4OIAA 5AVQB 2MPAH 4TM9A 2FJSA 1RZJL 3L5XL 1TPXB 1A9BA 3V6OA 1KCUL 2BSRA 2DOCA 2Z8WC 3QAZC 4A67A 1ZHBA 1TJIL 4ZO6A 3GXUB 4GP4B 1UFUA 1P1ZA 4KZCA 1F3DJ 4FFZA 4KJQD 1NM9A 3A67H 4G7QB 4WSJA 2W8CA 4KO9A 3SYQA 4G9FD 3RDTC 1TEGA 2LOEA 4PWEA 4Q4IA 3EXLA 3DMMB 3KD4A 3AACA 1Z9PA 3NCYP 2DLEA 3ZIMA 1J5OH 5DR5L 3ZL2A 2B7DT 4BH7A 3L6FA 3H56A 2HX9A 3LS4H 4QRPD 3WFHB 1A02N 1NJ9A 1MFCL 3GLAA 1TYRA 3GPSA 5DFVC 4A2GA 1RP9A 3QQ3A 2O72A 3KAAA 3ULVC 4NI3A 4LL4A 4BFGA 3LRGA 4K07A 1EJFA 3CX5K 2WGXA 4XNUL 3N1MC 3C12A 1GS7A 4HD5A 4M1GL 1EFXB 4O2FB 2K8MA 3RGBA 1YNLH 2C9QA 2W07B 5FYKL 5FLUA 4ABQA 1LP9E 1BAFL 4JRXD 3T6WA 3VFGH 5F1SA 2OMXB 2V17H 2HRHA 1OK8A 1WBZB 2GW5A 4Q9QL 1NFIB 2HFEB 3ARBA 3ZHDA 1WS7A 5KEZA 2Z9TA 3QCUH 2C1OB 1FAIH 5DFAA 1ZPLA 1P7HL 3CFDA 3VH8G 4PJHA 1DJHA 3BVNB 4H7VA 1LEKB 4QJ4B 5FHAL 4KAQL 2H6PB 4ZBJA 2XQBL 4P2OB 3JYBA 3NAAH 3AM8A 4Q9CA 3GNML 3GZQA 4JY4B 5DD6B 5IQNA 3ECVA 1BVKA 1MFVA 5KYXA 2ESVD 2NY5L 5AAPA 5DMYA 2FYYA 1NMAH 2IH3A 2J6EA 4MSWA 5AOLA 5CEZL 2JKSA 1X9QA 2Y1AA 4MNQE 4PJGF 4JFZL 2MTAA 2ZF8A 3EOBA 3MSPA 5CLZA 2WWNA 4L4JA 4EN3D 5HHQA 3EH1A 4CBZA 2QGDA 3B83A 3BPLB 2FWSA 3U25A 2EDTA 1YEGH 2MCPH 4OM0L 2J72A 4B7LA 2XY1A 5BW7A 4MYPA 1FZJB 1XO8A 3IMSA 2P3YA 2AV1B 3Q6FB 2IALA 2JKWA 4WO0A 2YSSA 3QR0A 2BH0A 1TVBA 4OCNC 4A7TA 5IB1A 3IN0A 2A9AA 1KBGL 4NM8H 4BUGA 2PR4H 1UUNA 1A1NA 4KVNH 2APTA 3BKCH 4AUUA 4P4KA 5KS9B 3ZDYF 1S7RA 2FJFA 4MJJA 1HHGA 4JL1A 3ILQC 2ZKYA 1Y0LA 4JO3H 5KSBE 3MOQA 3TNMB 4N2GA 3V0HA 5HGBB 4PRAA 4J6RL 1UG9A 4AG4L 2E0PA 1LO3H 5IROC 4LEEA 2GTWA 2FNWA 3DVFA 2XDHA 3TV3L 4W9DC 3MCKB 4X5WB 4AE0A 5LBSH 1ZT4B 4NZUH 1N64H 4N8VB 1G9HA 5HSFA 1MVUB 1HQ4A 5AOJA 4GKZB 3TBTA 4QRSA 5FOBB 3PP4H 1E5ZA 5SWSB 3PWNB 3UERA 3AC0A 3OLEA 3JWNC 1TETL 3CDCA 2R9HD 3I3DA 4Y2DA 4YUEL 4MZ3A 2FJUB 3VWKD 4HWBA 5TE7L 1LQBC 5I8CB 2AABH 4GG6F 3OMAB 1WV7T 5KANG 2W0KA 3ZX1A 1XGTA 4QHPA 2BC4A 3HHMA 4D9RE 1GMEA 4QOKB 1YNTA 4RZKA 1VGEH 3UTOA 5LXVA 1NDMB 2A1WH 1GXEA 1P6AB 2BVEA 1IJ9A 3T09A 4XAKD 1J8HE 2R9HC 4F2EA 1ZA6B 2WUCH 3N2JA 2XACC 4FZEL 5KW9L 3LSOA 1F2QA 4EQ2A 3OG6B 5JW4Q 1HHIB 3C6SB 3QUYC 4WWOA 3CHRA 4M8RA 3M8OH 2CDEB 1AZNA 2ZX6A 4YHIB 4N1CA 4BH7B 2G2RB 3L6FB 3FB7A 3WFHA 3HB3C 1NJ9B 3WXWL 2Q76B 1CGTA 4XCEB 5CCJA 3CHQA 4AI7A 4UZSA 3QIWC 1UM5H 4F5CE 1N5YH 4PS4L 1P4LB 5IV2A 4DGYH 3DOSA 5AFAA 3FBQA 5HHXH 1MRCH 1XGRB 2DWEB 2CRYA 3DTUB 4HXAL 4O58H 2CHWA 1HXYA 4B0MM 5KS9E 1NBYB 2Y23A 4JO2H 2FT8A 1ZGLM 4PBVC 3M17B 2GK0A 3NPZB 5IQ9B 4R5VA 4TUJA 1NFIA 1J9QA 2HFEA 1SBSH 1NLBH 5LG1A 4PJFA 4MHHI 2Z1KA 3ESNA 4A04A 4PJ9C 4V2CB 4PJHB 2JJUA 3ME0A 35C8H 4WWKD 5E4OA 3EAKA 1NEZB 2H45A 2FD6L 3BWZA 4N2IA 3BT2H 4XPAH 3GMLB 4IK7A 2FEJA 1FAIL 2WSKA 3KPLB 5JORA 1T22A 1DBBL 1WG3A 4WDIB 2GC7C 1CFNB 3FQRA 3O8XA 1CXFA 1KV3A 3AUWB 4PJDF 4CN6A 3TP4A 3NSCA 5JW5A 4JGMA 1UD6A 4P5TD 1FN4A 1I3GH 3F7RA 4L1HA 1KIQB 1LO0H 1NCDL 3KXFB 3BKCL 4NCC2 2WQSA 3U7YL 3QJHB 2BCMA 3W5MA 2BRQA 1U8NB 2C7UA 3GSQA 4HXBH 5M94B 2V5SA 4XNQB 4P9MH 1D5BA 3TN0D 1D9KB 43C9B 1JYNA 5MP6L 3T8XA 3BYTA 2BSSB 1BEXA 1R3HA 3L3OC 4M3HA 1RZ7H 3VWJB 3NESA 2BP0B 3AITA 5A40E 4G8GA 1AR1C 3PGFL 5SWSE 4R4BB 4N20A 5DLML 1WZ1L 2DWDB 3E6FA 3MV7A 4NOBA 3V8OA 1NCNA 1ZMYA 2IBZY 1IC1A 4P2RE 4X5QA 4XMZA 1ED3B 1JXDA 3GMNB 1RIHH 3GHBH 5ICYA 4HKJB 4YLCA 4D8PB 3O6MH 5C0RH 2HH0H 4HBCL 5F96L 5DWPA 3TYFA 3QWOA 3GM0A 1ROCA 4RAHA 2BY2A 3BT0A 4IKIA 4JFDE 1JYXA 1RVFH 1TJHL 3APMA 3C6LB 4MVBC 4CC1A 1F86A 1Y7VA 5EPMA 3IE4A 3IDIA 3QEGL 5HHVH 3WFCL 4OQTH 3UZVA 3O6LL 1H3VA 5DRNA 7PCYA 2CXKA 4KUZH 3DVGB 4PLJD 4XN9A 3HTLX 5C09B 4FOMA 3RWGB 2XWZA 1YEEL 4MLIA 3RDTD 4GKZA 1XCQB 3VYNA 4QCIB 4OZIF 4ZO7A 2YXVA 4PJ8D 3P4OA 2NY3D 3IWVA 4UM8A 2J44A 3ZTJH 3BZDA 3BFQG 4KJWD 1KGWA 1JI2A 5AOMA 5F96H 4EZKA 4EI5B 5JO5A 2AZAA 1YQVL 4UNUA 3W9DB 4G9FE 3LH8A 4IOSA 2E9GA 1M6UA 5FCSH 4ZUSA 4YQXL 2Z7WA 2AHIA 5TQ0H 1Z9NA 1BP3B 3P9MA 3GSNB 1VF5C 5HHMB 4M5TA 3ZDXB 3T3PF 2NX5A 4AENB 3QEGH 3RHWK 2N01B 2PXYB 3TEXA 3LXAA 1KCRH 4Y19B 2AJZB 1EHXA 3ERXA 1RJLA 3PGDB 4NQEB 2R7EA 1KIRA 1BLIA 1IVLA 3U46A 4KJPD 3ZPDA 3P3SA 2G2RA 2EP6A 3WEOA 1JF6A 3QDHA 4QOKD 3UAFA 5BXFA 1BBDH 1T1ZB 3AREC 4FNSA 3L13A 4IDJH 4WJKB 1U93A 1DSYA 4KY2A 4NUMA 4RFEB 4IKLA 2PYFB 4C56B 4HUMB 2V7HB 3O2WH 25C8L 5KAQF 4M9PA 3WLBA 2WBJB 1OOWA 3QDJB 4M43L 4Z5RB 1ET7A 2MSPA 2R51A 5DQJB 3U4AA 1KY6A 3L3GB 5LWYL 1J12A 1LNUB 2QHLA 2YN3A 4ZMPA 3K2UH 4HWUA 3TIEB 4UTBL 1UM4L 2QQNL 4MZRA 2YMXL 3FT4A 3PUUA 4HG4K 5FECA 1OVZA 2DYRB 3LXBA 4LBEA 4XNYH 1NCTA 2MH4A 4GLRI 5FUCE 1ACCA 2P8LB 2AJ3A 1RK1B 3HC3H 1R3KB 1AHWB 1U0QA 1U8JA 3BO8B 3ME0B 3NJGA 2R23A 4MB1A 1NEZA 5AYUL 1N8ZA 1BLNB 5EZOH 3BAJA 2XSKA 2F54E 2Z65C 3O2VL 4RSYA 2O5XL 5I6KA 3ZQ9A 1T22B 2QEJA 3CQFA 2ZAGA 4YGAB 3MUGB 1I1AA 4KNTA 5TDOA 4YXKH 4JJOA 4ZMNA 5KSAB 3WNPA 4E68A 5FW6A 4Z3IA 5K9KB 5C92A 1L9PA 2BSRB 4MA7L 5CGYC 1TQBC 4R8WL 5E6ID 3T2QA 5E0FA 1LL1A 5G4NA 3X12B 3ZKMD 3OX8B 3VI4E 4BWTA 4S1QH 4TYUA 3JWDC 4MVBD 4LOUC 3CIAA 4NKDA 4FTVD 1E5BA 5J0BA 1ZT7A 3OJVC 5AB9A 5D1ZA 4KVPA 4QTIL 1R3HB 4HVBA 3H3PL 1V3MA 3VA2C 1EPFA 4L2YA 4DFHA 4XP5H 1MJ7L 3QIUC 4O58L 1P4IL 5K9JH 2BFVL 4HP5A 2VM3A 2FR4B 1KLGB 4K94C 3E6FB 3D39E 3MV7B 3O41A 1CN4A 5T1DH 3RY6C 3LKSB 1X9UA 4F80A 3T65B 2H47C 4PY7B 5J1AA 2FB4L 2DQEH 3MXVH 4Y16C 1JNLL 2AJSL 3MRGB 3D0LA 2Y6TE 2NY2C 3Q7JA 1MXGA 5DURD 5KOVC 3S34L 2VLJE 3WKYA 1PX4A 2ZSWA 3TN0C 2J12B 2XZAL 3BP6A 4BUHA 3V4PL 2Q9OA 5FB8A 2VITB 4RAVB 1T2XA 5LN8A 1CU4L 1SDDA 1BIIA 3MODH 3TTSA 4N2NA 5AOKA 2ZXCA 5C7XH 4P2YA 4JPIB 5ELIA 4PJAE 4FAAB 3R06A 1EDYA 4RFOL 1UZ6E 2ZUTA 5LG6A 4Z7QB 1SXSA 3V7AE 4WEMB 3UJTH 4LNRB 2E9JA 3CHPA 3QFJE 2C3WA 2JCCB 2W9LA 3PIQA 5EZIH 1L7TL 4I5BA 5AKVA 1B6UA 5FO9A 4QNPE 4CKVX 1F3RB 4AM0A 2AANA 1U92A 5HYJE 5I1HH 2APVA 4NZUL 4JFTA 1KGJA 5GRVL 1HI6B 4FJYA 3QZOA 4IRSD 3BWSA 4PJEF 5FC9A 3L3OB 1PAZA 1YJDC 2K4WA 3LXCA 1JWSA 3LCYA 4OTXL 5H37H 2Q3AA 2J5LB 4EZJA 2BK8A 3PL6A 3LRSA 4J2XA 5J89A 3OB0H 2YS4A 3R18A 4KDWA 2IPUG 4E36A 4CSPA 1LWJA 3MLXL 1EERB 4PWHA 5IJDC 2BXZA 2E7BA 2Y1YA 4KC3B 4PJIE 4R90H 3MYZA 2EKJA 2OSWA 2BLFA 3TEZA 3QDGE 1YCSA 4B96A 4HKZA 1VFUA 1WS8A 1RI8A 5BRQA 3Q0HA 4DQOL 4OAWA 4RQQA 5MEPB 5E2JA 4XPHH 4RFEA 1WUNT 1J9RA 3QUMH 1KCKA 4AG4H 4PJ5E 5JMRA 2VRKA 1CFQB 4K23L 4OJFL 3T0EE 4OCYL 1HHGB 1XH3B 4YSPA 2FO1A 1NCAH 5H37A 4F5CA 4AMKL 2FQDA 2FLMA 4X42A 1ZLSL 1ZS8B 1K9TA 3QUHA 5ITFA 3AG4B 5HTSA 5L2KE 4NM4H 5AKSA 3GF8A 4Z8FL 2V3DA 5ACZA 3CSGA 5E2TH 5ERWA 5HDBB 4F2ME 1ZS2A 3C5SA 1JPSL 1V3KA 3MV7E 2F7RA 4TXVB 3TBTB 1BMZA 1L0XA 4XBGA 5SWSA 4RDQF 2DY2A 1D5MA 3NH7H 2CLVA 3ARPA 4JFFB 4FTDA 1RUPL 4UOW0 2OZ4L 5KJRL 3WTWA 2CLRA 4HWNA 2DPKA 4FLRA 5I8CA 4N26A 2GEQA 5ACLA 3GS4A 5ICXA 3BZEA 4M6ML 2XG4A 3WFDH 3PV7A 2CA3A 4AGPA 5IROA 3L4TA 2RIKA 1DQLH 1Z7JA 1INEH 4JFOA 1RU9L 1EHLH 4XCYB 3N91A 4UV4L 3U7AA 4LSTH 1QASA 3S5ZA 2LAGB 5MEND 2VMEA 3OLDA 3QIWD 4LLUA 4E41D 2XVBA 5DZPA 3LHPL 3WAKA 3QFDA 1RFDL 2DBJA 4XHQA 3HB3D 1HFUA 4KMTL 1V54B 3NIFF 3FO0L 4NZFA 2BVTA 6PAZA 2HJFB 5E8DH 2FR4A 1WAAE 3GSOB 4UTBH 3NYKA 3O41B 3HW7A 2Q76A 1ZLVH 3LD8C 1M3JA 1B9ZA 4JM2A 3G9VA 4A7QA 2C3XA 5J1AB 2FUTA 1FNSH 2KBGA 1TLMA 2P5ED 4TNEA 4QRPE 3QXAB 3S96B 1XGRA 2DWEA 4I3SH 4RBPH 1RK7A 1DFBL 1E4KC 2JELL 4S10A 2NQDA 4GXUM 4JO1L 2VC2L 3LNHA 2FX7H 3M17A 4EKXA 2OMZA 4XMVA 1KBWA 4ES8A 4ZFGH 4NT6B 4JFDA 3KCPB 4ZRGA 5GIRA 3P1VA 4AYFB 1KYUA 1HXMB 1QNZH 2E74C 4PJ8A 1H3GA 3SY0B 1GL4B 1OV8A 2CBPA 1X4ZA 4UTBA 3TWCL 3MLTA 4I18A 3PWPA 4ORGA 1QBML 1YY9C 4DW2H 1CT8A 5E8DL 1QO3A 2JCCA 3PIQB 4YBQC 4IIQC 3LB6C 4JHAH 3NFPA 3I9IA 5IEHA 4BGLA 5DQDL 3QHFL 2OQJB 3FO1A 5CEYB 5DZ9A 3FTGB 3GMRB 1RPQA 4M00A 4PJAA 2P24B 2RQEA 3OKKB 3PYCA 1KBBA 4F7PB 4CW1A 4CUCA 1UWEL 3NJLA 3STZB 5CWSB 5AZUA 2R0KH 2BRRL 3GI9H 1G1YA 4ODVH 5TE6H 4N2AA 3WD5L 4IEFB 1AKJB 5F7MC 1X5IA 4ABUA 3ABGA 4U1LA 1RUQH 4R4BA 2V3EA 4DFIA 1QUPA 2DBLL 2XBDA 4XNXL 2Y25A 4HUKB 4IRSB 1PBYA 5FA4A 1E8ZA 5KG9B 3B2UD 2NDFA 3GMNA 4M8QB 5ICYB 3GSNL 4ADJA 2YPLB 3IJYB 2B08A 1TXKA 2A4EA 2AV7A 2VXTH 2ZKHH 2L3BA 2YBRB 5H4YA 1RULL 1XIWD 1ETA1 4PIBA 2R8SL 1F1DA 4BIKA 3M86A 2D7PA 1FGNH 1CE6A 4TRPH 3FONB 2KZ1B 3HHSA 1T21B 4K7FB 3CZJA 2BVPB 1PSKH 3DO4A 3FQYA 3LXUX 2VDKL 3TF4A 5EEYA 3OVUB 3II3A 4NO0B 4NC1C 4NGHL 3FKUS 4YDMA 1FH2A 4HS8L 1BOYA 3B2DC 5GRZA 1NGPH 5I15L 4WNJA 5ERWB 4TULH 1PVHA 1AKPA 2O5ZL 3LPWA 1IT9H 1JL8A 4R7DA 4JVUA 4A7GF 2ZP0T 4X4YA 1AQMA 1KELH 1XWVA 3FFCB 5FFGA 3VWKA 4DF9A 3OLIA 4N87A 5CN1A 1U91B 2R0LL 2YOCA 3S4SB 1OTSC 4MJ6A 3ZHKA 4AXWB 1OXYA 4R90L 1CUOA 2IFGA 2VDMH 1MFEH 4XC1H 4JFED 2QGEA 2WD0A 3NQKA 4KROB 1FFNB 4XCYA 4S1DD 3UBFA 4ECNA 1X7TA 1DSFH 2FX9L 5I1JH 3KXFE 2NX5B 2PXYA 2LTQC 3QFDB 3CK0H 2HMIC 1RPKA 2QPDB 5B4MD 1QYGL 5DHEA 4AQEB 3DMMA 3VWJD 2Z91B 1BDYA 1NCAL 4FQ1H 1V3LA 4KUCD 5B1KA 1D5IH 3SPIA 4GRLD 1JGEA 1U8CA 1MWOA 2ZOKB 4M3KB 5T3XL 4P57B 4X80H 4Y1SA 3KPRE 3QG6B 5DK2B 3QXUA 4FXKB 1U95B 2VLRE 1UT9A 4NN6C 1E3ZA 1EJ8A 3MRLA 2YAOA 3B1UA 2WBJA 2AS5M 4Z5RA 4ZFOB 2F08A 2ZUQB 1WAEA 1S9XB 5GHWL 3GIVB 3QJQB 1OK0A 4M9OA 4PRNB 4ONOA 1MCWW 3GSUB 3K6OA 1KYDA 3FOMA 3QUXB 3V0VA 2HP4A 2FHFA 3BAEH 3NRQA 4G42B 3DIFA 4LLYA 4PJ7F 2VDOL 2JJSA 4LCCC 4BKLB 1Q38A 1SHSA 2AJ3B 1XF5B 1N10A 4F9PA 5EZJA 5I73C 1U8JB 3BO8A 3VXUD 3X1GA 4LZKA 4KDTC 3KJ4B 1TTAA 4I88A 2BIPA 5F7NC 3A6CH 3LN4A 4G6MH 4L48A 3PWPB 4ORGB 5H35B 3FFOA 2JKIS 3SGKA 2COQA 1KIPB 3PQYE 2OZ4A 2YEVB 3D8MA 1M42A 4H0HB 1X6NA 3SGDI 4X6DF 5KYXB 3VB8A 3WOVA 4J7RA 4KK8C 1MXDA 2XBTA 3W11D 3QIBD 2D7OA 3ASWA 9PCYA 4G8EA 2VXTL 4TS6A 4HEMA 4G2AA 4TNGA 3JBG7 3LQZB 4QTIH 2V8LA 5C08A 3T4YA 1J86A 3MOBH 5CJXC 1SEQL 2QPSA 4FQHB 4S11A 2WTPA 3CDFA 5D1ZB 5AYTA 3TU6A 1HYSD 1E8YA 2D2CC 2ALAA 2OL3A 4Q52A 1UOKA 1X5HA 3STLA 3VNYA 5JXEA 3FZUC 4ZTPL 4XP1L 3ZHNA 1UA7A 5I0ZA 3D18B 2O5XH 3OC8A 2CRMA 1LWRA 5J4MA 1WHOA 5AL0A 1BZQK 3LKSA 5F0PB 2AK4B 1KCWA 1EZVX 1BJMA 4CU8A 1MRDL 3CCHA 3HG1D 3AXLB 3D0LB 4MXVE 4OM1L 4FFVD 2HG0A 1G7LB 2DZEA 4KAQH 2WO3B 1A6VL 2J3SA 2ZUXA 3GRWH 1I7ZA 5TD4A 5AL8A 2XTSA 3EYOB 3A47A 4ZW6A 3WNMA 1OE3A 2B5IB 1G9MH 2VQ1A 4GUPA 1MCPL 1YPZF 4POUB 3LKQB 1H8OA 3VFPB 4X5WA 2EYSB 1J9SA 1UURA 2Z8RA 5J12C 4KZDL 3G5XB 2P5EA 1EJOH 3FU9A 4AYDC 2J5WA 4GBXA 4MA3A 2ROXA 2M2DA 5FOBA 2FRGP 3INUH 3OHXC 3PWNA 3U48A 2P5PA 2N56A 3MLZH 2CKNA 4QAWA 1AHKA 1RV6X 3MRPB 4Y8DC 1FH5L 2FLBT 1MQ8A 1P84J 3MVSA 1A7PH 1U92B 4PIRF 3SGJA 1F45A 3ARDA 3FRPB 3DPBA 4D0DB 5KZCD 2DQHL 4WCYL 4F15B 1FNSL 4MNQA 2AQ1A 4NNPH 2E86A 4F1SA 2B1OA 3TA3A 1GZQB 4LSQL 3BD5A 1JK9B 2JQAA 1UWGL 2X4QB 2VXSL 3RWIB 3UACA 3FDWA 4JS7A 4UQ3B 5BV7B 4JQIL 3GJFB 1MCDA 5F0MB 3IK2A 1AHMA 4GKNB 1YN7B 2WTRB 3M1BA 1P9MA 5EA0L 3DK2A 3C8KB 2VLKB 3V4VB 4MCZA 1LE9A 2EAEA 4K8RL 3N43B 3O6KH 1JHTA 3P4MB 2W91A 4OAWB 4RQQB 4AC4A 1PY4A 5C07E 5MEPA 1IV8A 1BEYL 3DJTA 4L29A 2KDYA 2DQDL 3W2DL 5JLZB 4BFEA 3MJ8B 4XE5B 4I85A 4Z7OB 2KC0A 2VLME 4MRCA 3JV4A 1IGIH 1XH1A 1S3KL 1NBYA 2E8YA 2P5EE 3ARBC 2GITB 3EYSH 3VWJC 5B39A 1OAKL 4RGOH 5HGHB 2OP4L 3MLUL 1AIZA 2B15A 5EOTB 5CM1A 2BCKB 1X5KA 3HPLB 4OCXL 4Y7MA 3K80A 2QLYA 4MMXB 2FJGB 2OSLA 3RU8L 1C5CL 1HCYA 3APFA 3DVNA 5F6HJ 4QHUA 5EIIB 4IGBC 1CLOL 3RJOA 3LN4B 5H35A 2Q8BL 1J11A 1ZE3C 4Y1AA 2WXRA 2YO3A 5FAAA 1BD2A 1NM4A 1EGJA 4N9GA 2IGFH 4MMZC 4GO9A 2EDEA 4PRDA 3U4EB 2KPNA 2OMTB 1EHLL 2V9RA 3VO0A 3WMQA 4HJGB 4Q0XL 5BVPL 4U3SA 3BKYL 4M6OL 4FTVB 3KPSB 2HN7B 4X7TA 1S7VA 3IXTA 5EU3A 3JWNH 4F8LA 4Z1PA 5G4MA 3AWEA 5AW3B 2HTLD 4DP2X 3BP7A 3I9GH 4DUXA 5EO1A 4MJIA 1VCBC 2G2PA 1I3GL 3ML9A 4KTEL 4ONGL 5BW7C 1BYOA 1K4DB 1QLRA 1UGKA 3CVHB 4JFPA 5LXGL 4JN1H 1ILSA 3D2UB 4NAJA 1MEXH 1IGMH 1N19A 1BF2A 2LW3A 3MOBL 2D03H 4N8CL 1QKZH 5CGBA 3VMNA 4F33A 2KDGA 2QGCA 1I53A 2FYVA 4ZAKD 5E56A 4NFDA 4GIPD 1ZV2A 1IKOP 1FCCA 1GAFL 4HU2A 3MCYA 2MTPA 3AXHA 3OTTA 4HSQA 1PYWA 2R15A 4YHYC 4RGNE 3HIZA 3WNIA 2NYKA 5KUMA 4DAGL 4XN1A 4RIRA 4EN2A 4Z6AT 2IAND 1C9SA 4JFFE 4OLVL 2IFFL 2NSXA 1S8DB 2FT7A 1MG3C 3F12A 3KJ4C 4DESA 2QT6A 4XN7A 3FCSB 1Z3GH 2ADGB 1KUMA 4C57C 4U1SB 3DBXB 1HXMA 3QR2A 1MHPL 3PUCA 1RZ8B 4MNGA 4C56D 2UXVA 4JDEA 1RY7B 1ROWA 1YMHB 2BVQA 1A47A 3BUDA 3D85B 4GBXB 4ISVB 1XCQA 2B4CL 4Y2DC 3F00A 4B53A 2UX7A 3SQBA 2N0MA 3H42L 3NIFE 5L6YL 4BXSV 1LXMA 2VAAB 3DRQA 4R0LC 1PS3A 3KPOA 1LMKA 1UD3A 4J3OC 3TESA 4BZ2L 5IEHB 4XO9A 3MLVH 3D4ZA 3D4CA 2XZCL 2CGZA 1AZCA 5FA3B 5HVWA 1E7VA 2IG2L 4WKXA 2I7SA 2Z35A 5DK0A 2WZ5A 3DUSB 4BSVB 3DMMD 4J3WA 4EI5D 5I66B 3BH8A 3CHXA 3JV0A 1W0VA 4LFHG 4WI6A 3K6SA 2V2XA 2CZNA 2BSED 3BKJL 4U6VH 4ZO8A 5DRWA 2GSIA 2VN4A 2R0WL 4LASH 4LQFH 4O51A 4HOMA 3IFOA 4GPVA 4IBZA 3FO2B 4X5LA 4JANB 4TVSa 2VLKA 3V4VA 4DUVA 5KG9A 3Q5TA 1R6VA 2NSMA 3DGDA 4JO3L 3H42H 1XSJA 5HJBA 3EBIA 4P04A 1G7MA 4Y16D 1WFTA 5IB2B 5K9QG 1CTNA 2VL5B 1NC2A 5G55A 6TAAA 3US0A 1PD6A 3GWJA 4GJTB 3FSOA 3KVQA 3X17A 1NC4B 4R5XA 4JFHE 5CUSH 43CAA 4P46A 5CU9A 2XC8A 1YC7A 1BZOA 2IDFA 4GRLA 4PWFA 3W82A 2QKIC 3PP4L 4K3JH 3WO3B 2H1PH 3BPNC 1RK1A 5I1IL 1AHWA 1YZZA 4DK6A 2E76C 4GFTB 2ISDA 3OAUH 2EXSA 1G5AA 1N8ZB 5ID1A 5KOMC 4ACPA 1BD2B 5JQ6H 3VXSD 3UTSE 1NSNH 4PJBE 4PRDB 5A2IH 1U8MA 4WU7A 3SDAC 4OF6A 1G7IB 1OOAA 1GJWA 2AQQA 3UG3A 3OF6A 4M7LT 1M56B 1AACA 2CALA 2GI0A 4U3SB 5EC1B 1QRNB 5T1KA 1KXVC 2IGFL 1N2RA 3R4DA 4PRPB 4P5KA 4UBDC 3OHMB 4MNHA 3BLBA 1AAJA 3QZLA 1AOZA 1G7HB 3EOTL 5F3FA 2WQAA 5D93C 1J5CA 1GSMA 3HJ0A 2OR9H 5C0BB 5ETUB 4A2HA 3DO7B 5LB1A 1YEDB 4IKKA 4DO5A 3F6LA 1K2DA 3GTVA 4N1HB 1M4KA 3T3ME 4EUPG 2FGWL 4XVJH 5IMLB 4G6JH 5DEFB 2F74A 3I84A 3FAWA 1JF1A 4RNRB 1CGYA 4L4TA 1T0MB 1OGTB 3REVB 5DK2A 2DQTL 4EN3A 2AEQH 3D3VA 1NDGA 5E51A 1NANH 5AUMA 1YSOA 1FNGB 1ZANL 5EBMB 1U3ZA 3UC0H 1MREL 2ZWKA 3EFOB 3O2DA 1MW0A 3KL3A 2NNXA 1EEZB 5E8PB 2Z31D 2JJSC 2BOLA 5IG7A 3T0AA 3FU7B 3QIBB 5EMYA 2YFNA 4OSUH 4JK0D 1ODUA 3GSUA 5GS0C 1DHKA 3S5YA 3O6FA 1KTDA 4ELKB 3SOBL 4KH2A 1N5AA 4XOAA 1FZOB 2PW2A 5HPMA 3KDPB 3A67L 5EZJB 2Y0SA 3V4LA 3D85A 3BP4B 2J4WL 3O6LH 5I0XA 1CIUA 1KIPA 4LNRA 4QTFA 4XHJD 2DEYX 2VLLB 1S9VA 1JCVA 3ALWA 2LVCA 3NZ8B 2F9BT 4PJIA 3MLPA 5C0AD 3P30H 4AM0B 1QLEL 4YPGA 2ZYSA 2HWZH 3OR6A 4OJCA 2V7NA 3UDWA 3UH8A 4R96B 5KYWA 2V4LA 3HZMA 2PTTA 5HGDA 1XT5A 1NCUA 1KN2H 3D25A 4OD2A 4Y5VB 4E5XG 1G4MA 2CUAA 2LABA 3PQYB 1T20A 3QUMA 1H8NA 1N0LB 1Q72H 4G7VL 4LU5H 5EB9A 4I77L 4KKNA 1WFNA 3V6FA 4BRJA 3NSJA 4U0QB 1W0WA 2WZPA 4K8RC 4YBHA 5I1DB 2B0SH 2EIBA 3K6SB 3T0DA 3GIZH 4TSBH 3FUDA 2Z6FA 5HI3C 2HT4D 3HS9A 3ZLQC 5AZEL 3L7FB 3D18A 1HNFA 3VXRD 3FO2A 4H1LH 4N2CA 4ONHB 3TTYA 1LEGB 2FZ3A 2VSMB 3I74A 1KGCE 2WP3T 4HKZB 3S3SA 3AAZB 4NUGH 1A3LH 1PX8A 4Z77A 2RFXB 3NIGF 2C3GA 4ZJ9A 1CLYH 1Q1PA 4GAFB 2WLYA 5I6XB 1TNNA 1W8NA 3L48A 3QDMA 2A9ML 1PY9A 1PIGA 4M4RB 3X14B 3V9CA 1JZEA 3CLEH 5AW2B 3RZCD 1AQDB 2K7QA 3OKOB 5IQ7L 1DBBH 3G5VA 3LPPA 3PRZA 2X9YA 4BQCA 5KSAD 1KTCA 3I9PA 5E6IB 3WLWC 4ZQTA 4PTTA 3HE6A 5DK3A 1TQCB 2WN3A 4KRPD 4XPBH 2EEBA 3EOTH 1PZUB 4P07A 3QIWA 1VB9A 3QDAA 3T2NH 4HEPA 4E41A 5KTEH 2YJQA 3A6BL 3SHSA 4U2ZA 2ERJC 3AMKA 3I2CL 5CFHA 5D1ZI 4XBGB 1JGDA 4LLWB 4HU8A 1OSZA 1H5BC 3NFNB 3QEQE 2PYEB 4N0UB 4BZ1A 3O3AB 4TTGA 1AD0A 3GQFA 1P4BH 2FSEB 2L0DA 3DTXB 2YMTA 4LMQE 2H9GB 4XNZB 4PP2A 1T2QL 2OCFD 3ARGB 4HZLB 3WFEH 2AQSA 4FABL 4PJ9A 5I82A 2YIHA 5DZVA 3G6JB 5AALA 3QJVB 1P1ZB 3ET9F 5T8IA 1Q9LB 3SBRA 2QFRA 1F3JB 1X5LA 4XCFL 1WA0X 2GKIA 3CVBA 4MB4A 5CZXC 5DS8A 5LCVL 2X87A 2XPGA 3RNQB 3V5HA 1YN7A 2HJFA 5GGRY 2F8OA 5DEFA 1HT6A 1OF2B 3U4BL 1S9KC 1ZLSH 4FNQA 1UB6B 4P23B 4MCZB 3CVDA 4N9OB 1LE9B 1U8IA 2J56A 2NTFB 4JM2B 5DZAA 4HZ1A 3U1SL 2WK2A 2DLTA 2FGWH 4HIEA 4XVJL 1FNGA 3MRQA 3CVHL 4NP4H 4F27A 4L3EE 3TA3C 3VW3H 1DQQB 4RMBA 3BPLC 2W07A 1FL5A 3E9UA 1DN0B 1ML0A 4H20H 4JRXB 4XNMB 1FE8H 3V5KB 3MXVL 4IMLA 2WNWA 4JM0A 4HULB 1TNMA 4PJDB 4NI6A 2NQCA 1BFTA 1T0NA 3IMRA 2QQKH 2DLFH 5L2JB 1JPGA 3QJZA 4XZ4A 1CLCA 4HK0A 3DVNB 3TC9A 3WFBH 2EEXA 3OKYA 3V79C 1KB9K 1TQWA 3SDCC 4PJ8B 4FX5A 2X89D 3RA7H 1X7SA 3MA7A 1TSHA 2C26A 2HZHA 4Y1AB 1SLWA 1U30A 4U6VL 3CLFL 2AGJH 4GRWB 4K3EH 5D55A 2N7AA 15C8H 3E2HC 2GUYA 3RWEB 5C7XL 3X1FA 2X7LB 4HLZG 3A23A 4JY4A 5DD6A 3GBNH 4Y5YC 1PNCA 4DEPB 5I28A 5INDA 5DJ0B 4PS4H 3VXPA 3BSHA 5FOJA 1A3RH 3MV8E 5D93B 5IJVB 3KPSA 5IBUB 1XB6A 3RDJA 2YJLA 2EH8L 1RMFL 1KYOK 3HRZC 3HN3A 5C7ZA 3EOBB 1T20B 2ZX7A 2XQYK 4JKLA 5CWSA 1A1OA 3RB5A 3DETD 2N1TE 4IYKA 4JHUA 3HE7B 2CJTA 1UH3A 3WFBL 4LVOC 3EJRA 3B9KC 2FECI 3M6DA 3KPSE 1QI3A 2DQEL 1IEAA 9CGTA 3IMUA 1JK8A 1ASOA 2BNRE 4HETA 4WENB 3TFBA 2GIMA 3FO9A 1EO5A 4AEIL 2D31B 5FA4B 3EBGA 3OWRA 1OO2A 5F9WB 5F9DC 4M8QA 3CSFA 1FAKT 1F1AA 1WZLA 3I6GA 4UT9H 4HMCA 1DDTA 1O6SA 1CXLA 1RZKL 3FFDB 4J3OF 3B37A 1HQRB 4U3XA 1F8TH 2NXYB 3O4LD 5C0EB 4PJBA 1QBLL 4MA8L 3PY9A 4AH2B 4L1SA 2K6ZA 4Z7OE 4EDXA 3NDZE 5CLTA 4YX2H 4Q8BA 3KHOA 3EGSA 1L9RA 1R5WA 2V2TA 1GOFA 2MOQA 4U6YB 3QIWB 4LOVA 4A2MA 1KB5H 4E41B 4AL8H 1A7OH 4ISVA 3TBBA 4KMLB 4QJ3B 3TIDB 5ICUA 5BQ7A 3SQBB 3NDYE 1U8QB 3L8QA 2FB4H 3ARSA 1JGDB 2NY6B 1CK0L 3DRQB 5KTEL 3HOGA 2LV4A 4UYQA 4XMLL 5FDYA 2BFVH 3B3BA 2EEAA 5CNHA 3QUXC 3TBCA 3UC2A 3QUGA 4MD5A 1AD0B 2XCMC 1EVUA 1XGTB 3APDA 5L0QB 4G8IB 5D4HA 2OTUB 3JWDH 1BZEA 4NZJA 1SJEB 5GQBA 3NGBB 2CQVA 1WD9A 4AEHH 2ZZUT 2IWKA 3O3BA 3L3DA 5FM5M 5SWZE 2A9DA 5FKPB 2GBVA 4QYOB 4TL5A 1JWUA 1KT2B 1ZV5A 2A9MH 4Y0GA 4F7MA 3RTQA 4AQEA 1HKLL 3MNVB 1FGNL 3IFOB 4JKKA 1OSPH 1AXIB 3S88L 1Y1DA 3B9DA 3QG6A 1T4KB 4ZPTB 1VFAB 1U95A 1JZ3A 4XVSL 4F91B 5HYSA 2CMRH 3VJ6B 4EIZC 1IZJA 4TMPA 5IV2B 3MRQB 5ILTL 4DGVH 1NCCL 4ZFOA 5E6IC 4YLBA 4TPRH 5D1ZC 3BWAA 2IJ0C 1HXYB 5KYNA 1DN0A 2AF2A 2NW3B 3MRHB 1YQVH 3CBKB 4BCXA 3QQ9D 3QUXA 4BBWA 1PTZA 2LVEA 5IB3A 4ZQKA 1T0NB 4E0RB 1PCSA 1TENA 2BERA 2GJ6D 3E8VA 1DUZA 1TKWB 3N0AA 2VISA 3RPIA 3RY6A 4BKLA 3GZOA 4N90D 4OUUA 4UILL 2HXAA 2H0PA 5KSBA 4OF5A 4ATWA 2J43A 2IOOA 5BPPA 3AQYA 3CUPA 4OCSH 4OD3L 4OFDA 4PBXA 3UAJD 4TSBL 1M9WA 3MJ9H 2L7JA 3S3CB 5EN3A 1KCSL 1MIML 3N42B 4ZFGL 4CGTA 3WFDL 3DHUA 5JORB 1E4XI 2C5DC 2RBLA 4BD4A 3LNFA 1E5CA 4LLAA 3RIKA 5CCHE 5JOPE 5I8KL 4M5ZL 3U6XS 3RY5A 1KXHA 1FN4B 4DQAA 3PXLA 4JW3A 5JDSB 1A3ZA 4G8EB 5EC1A 4CA4A 1NMBL 4MJ5A 4UQDA 4HCRH 3LHPH 5DVNA 3UTQB 4XX5A 4FXGC 2R1XA 4U4IA 1YVLA 3PDOA 3EBHA 2NY0B 4UMSA 1Q0EA 4KGLA 5HJ3A 3F58H 5FR3A 3OHXB 4OIIL 2BSSA 1A7RL 2BP0A 5B7MA 1F6FB 1IKNC 5IMLA 1BOGB 4GI9A 5DD5L 2ZIDA 4M7LL 4GW5A 3VDAA 2H0FA 3MJ9L 2IH9A 1T0MA 2CPUA 4EN3B 5J3HD 5I1LA 1NDGB 3ARTA 3L5XH 3ILPB 2IBBA 1F6LL 3D51A 4PJ7A 3QS2A 1I8IB 5B8CC 2PW1B