3WTYA

Crystal structure of the complex comprised of ets1(g333p), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
118
structure length
118
Chain Sequence
b'GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Runt-related transcription factor 1
molecule tags Transcription/dna
source organism Mus musculus
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
total genus 17
structure length 118
sequence length 118
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtyA00
5G4NA 3WTYA 4KVPA 5AOMA 3KMDA 4GUQA 4IBUA 2ADYA 1KZYA 2IOMA 2X0UA 2FEJA 2X0VA 5AOLA 2J20A 5AOKA 4XR8C 4G83A 5LGYA 1TUPA 3D07A 4LOFA 5G4MA 1E50A 2WGXA 3VD1A 2J1WA 1T4WA 4L0ZA 1HU8A 5A7BA 5AOIA 5ABAA 3WTWA 5AOJA 4GUOA 5ECGA 1UOLA 1TSRA 3EXJA 2VUKA 5LAPA 2BIQA 1HJBC 2RMNA 3WTUA 3WTVA 2GEQA 3VD2A 1HJCA 4MZIA 3EXLA 5G4OA 3Q06A 4IBYA 4IBSA 3D0AA 2XWRA 1CO1A 3Q05A 2ATAA 2OCJA 3IGLA 4HJEA 1YCSA 4AGLA 3QYMA 4QO1B 3ZMEA 2X0WA 3D05A 5BUAA 3WTXA 4IBQA 3KZ8A 5AB9A 1CMOA 1EAQA 3WTSA 3US0A 4IBZA 4AGMA 1H9DA 4IBTA 3QYNA 2J1XA 3IGKA 4IBVA 4IJTA 4LOEA 2BIPA 1GZHA 3D08A 2BINA 3WTTA 3VD0A 2J21A 2XWCA 4G82A 3WU1A 3D06A 1EANA 3Q01A 1LJMA 5KBDA 3D09A 1GZHC 4L18A 3TS8A 2IOOA 2AC0A 4AGNA 2J6WA 4AGQA 4A63A 2H1LM 4L0YA 4LO9A 2PCXA 2BIOA 2P52A 4IBWA 2IOIA 2J1YA 2YBGA 2J1ZA 4MZRA 2AHIA 1IO4C 2MEJB 3US1A 2BIMA 4AGOA 1EAOA 4AGPA
chains in the Genus database with same CATH superfamily
3U30C 3FU5A 1FZKA 3BEVB 5L8KB 4J3WA 5KBNC 2BJML 4BZ2A 2DYPB 25C8H 1OO2A 3GNML 3K8KA 2H0EA 3Q1EA 4GRMA 1KZYA 4LL4A 3LNIA 2IDSA 4OM1H 4JNXA 4TUOB 3EJJX 1XAKA 2DBLH 1ZA6B 2XDHA 2PLTA 1WHOA 2CH8A 3HOGA 3X12A 1B90A 4G5ZL 1NLBH 4O02B 2PPFA 3EFDL 2NNFA 4LLYB 4NWTL 5GZOA 1CG9A 4H8HA 5EFIB 3L9RB 3TTYA 4YHIA 1TYJA 4PJ6A 3VVWA 3WEAA 4RMUA 4J28A 4XZUA 5L88H 1A4KA 1MCPH 1CDBA 3L2MA 2YC1B 5B3JF 1QASA 1A8JH 3VYNA 1ZS8B 2Z35A 3L48A 3I50H 3IMSA 4RAUB 1OD9A 2LQRA 4TVPE 5AWNH 3KPPA 4KRMB 3OD3A 2VDMH 4C56A 4E68A 4ZOBA 3HVDA 4KKLD 4JJHA 4CU6A 1HJCA 3IFPB 4AWJC 5LGHH 4GKZB 3B5TA 2YUWA 1A14L 2UV3A 3RX8A 1YDPA 1UOWA 4PV1C 4DUXA 2B4CH 1AYOA 3ASOB 4JRXB 4L1TA 3KPSE 4HEPG 3WLBA 1U91A 4L37A 4XCYB 2YQ2A 1XF2B 3MNVB 3OG4B 4I8DA 3T0EC 4FTVE 2NMSA 3DYMA 4L9LB 4DEPB 2B39A 3J8F7 1WAAA 3NEEA 2DD8L 1W80A 4HWEL 4MJ4A 2G4EA 3K0WA 3WD5H 4ZG1A 2CUHA 2E7BA 4JRYD 4YBQC 1ITBB 1W0VB 4N0UB 1WITA 2AAVA 5DUBA 5EU5A 3UMNA 3SZKC 5I5MA 4DVBB 5DD6A 4PJ9C 5T1KA 1NSNL 1MIML 1TKWB 2P5WE 3DV6A 3LB6C 4O02L 3QNZA 5IV2B 4K7PX 5GGQL 2ZP9A 4YDJB 5HBBA 1QSED 1E5BA 3OR7A 5HYSG 1NIDA 1N0LB 1E42A 5FC9A 2F5BH 2Y07L 5K69A 1MVYA 3QDGE 3U1PA 5I8CB 2EVIA 1NCWH 3B1TA 4K3HA 2IGFH 1H3WM 1PGRB 2QVFB 3CZEA 4N0YH 1T3FB 8FABA 3ARFD 1R17A 3BPNB 3MNWA 5SWSD 5F1NA 2OZNA 4OGYL 3CVCA 2OMVB 3BD4A 3EH5B 4U7KA 1QPKA 3BZ5A 2NW2B 5HDQH 1RUKH 4I88A 5DFVC 3IEAA 2L7EA 3LN4A 1FPTH 1XGYL 4OR1A 1LNUB 5AVXB 1HIMH 4ZX4A 4ACTA 2OMUA 3AY4A 1MPAL 3KM1A 2Q7YA 3B4NA 4GMTL 4G6ML 1OGTB 5E2VL 3TA3A 4HKZB 1P4UA 4XO8A 3MBWA 4XXCA 1HL9A 2HSIA 4U1LB 3WXVL 1K2DA 5DMGC 3ABKB 1NLBL 3LDBB 3PHQB 1E4WL 2QTEA 4N2OA 4OLVL 4U1IA 1IAIM 4BSVA 1DFXA 4FQLH 3MFGB 3HS0C 5EO1A 4CADA 1MH5B 1BM3L 1JZ8A 3LKSB 4HQQH 4OW6A 5E5UB 1CK0L 4LDCA 4ONOA 5DRWA 4G43B 2FNBA 5PAZA 5CBAA 4QF1A 4BKLB 1RJZB 2WZ5A 3JTTB 3BUQA 4KV5F 3FRUB 2R1WA 4CA4A 1R3HA 3G5ZB 3P3YA 4QHLA 3RX5A 2F74B 5K5YA 3C12A 2N01B 3PL6A 3WTUA 3OB0H 3ML8A 3OZ9L 3O4LA 4MNQE 3E8UL 2ZF8A 3IMRA 3EYQC 1NC4D 2NX5D 3JWNH 3P0GB 4H8WL 3IJEA 5IP4A 3EF4A 4X5WA 5F3FA 3LKSA 2OYKA 1WQVT 2Z4QA 5LBSH 5IHUL 2XJKA 1CGSL 2FWOA 1OAZH 4KMQA 5LXGL 2BNQE 1JK8A 3QJQB 5HI5C 3TJHC 4HLZG 5JQ6H 3BUIA 4GIAA 1NDGB 4HCGA 1I75A 1BVKB 4G5ZH 4FLHA 2YGPA 4PD4J 4UCFA 2XVGA 3BD5A 1A0QL 1FWXA 3HN8A 2XWXA 1T83A 1S3KL 3LMJH 3WO4C 5EF0A 5DD5L 5C0GB 1J10A 12E8H 4PJ8C 1I8AA 2KUTA 4PLOB 3U4EA 1VGKA 4RLDA 4OCWH 2ADIB 2Q7NA 5DS1A 4PBVC 1F1DA 1K5NB 3QP3A 1V3JA 1P69B 2L7UA 2VLKA 5CXPA 1JPEA 2C7FA 4W4NA 4Y4KC 5D1QB 1RUQL 3QULB 4Z95L 5I0YA 1XF4B 1JZ5A 2BVQB 4KKCD 2PCPB 3I84A 1QVOB 4RGMB 3MLRH 2W94A 2YGOA 4PB0H 5E7BA 4FL4B 2Z31C 1T6VN 3RZWA 3LPGA 3E2HB 1CE6B 3DXAD 1KBKA 2DEWX 1X44A 4RRPG 3L3IB 4PR5A 2CO7B 2EIKB 4ZFGL 4OLWL 1JV5A 1I3UA 4UTAA 5F7BA 1RZ7H 2Y5TA 3P02A 4LLVB 4OQTA 4P2QA 4UV7L 5IV2A 2HA1A 3RG1C 3HJEA 4M7JH 3VD5A 1F4AA 3NTCL 4Z7QE 1MEXH 5L7XL 5IG7A 4JDVA 3A6BL 4GW4A 4KJYA 4OGZA 2QVMA 4YPGB 1Z9MA 2DLEA 4YEFA 1TO5A 4HLZH 1ZT7A 2EACA 4FI6A 2AJ3A 5CGYC 4BCYA 3CFCH 3ERXA 3U6RB 5HHPA 2WCPA 4B0MM 5CD3B 4Y16B 1DQJA 4QKTA 4TUJA 1ZA3A 3CZFB 3PXLA 4XPBH 4JS7A 1QWNA 2YFOA 2HKFL 1BQ5A 1NM9A 5IIEA 1KENL 2YN3A 1YY9C 3H6JA 4HUWA 1J0YA 3OPUA 5E4IA 5FYLD 1WG3A 3CZJA 1DCEA 1PZ3A 1TENA 2ARJQ 1NFDB 1MHCB 5JIQA 2AZAA 4OIBA 3WEMA 1GC1H 5HHNA 1WFIA 1J1OH 3ZIMA 2K1MA 4U49A 2V2TB 1S3KH 4ZFFB 3FNKA 3BWSA 3K6IA 1HOEA 5DO2C 2DIEA 2NNAB 4RMVA 3NH7L 4OGYH 2F61A 5J12C 1SJVA 4N1EA 3INUL 4GLRI 4F7MA 2H26B 1KJ2H 5EOTA 3Q05A 2VXTL 3GXNA 1DLHA 2GJ6A 3KPRB 3RBSA 2WD0A 3C8DA 4BXSV 1G9HA 3CPLB 2BDNH 4LEOB 1OK0A 1BPVA 1S7WA 1CG9B 4HJGA 2BIHA 3CVBA 4DAGL 1KXHA 1Q1JL 5HYFA 3U9PL 3L16A 4NO2A 4PCTA 4TUKL 5C0AA 3WJMA 2MFNA 2ZWYA 4ZPVA 2NNCA 1N7ML 2CR6A 2NY1B 2A2QT 3BGFC 1JGLH 3AABA 5H35B 7TAAA 1VFUA 4H13C 2XWCA 4J3XA 3PWPD 3IDIA 2V2XB 2BOBA 2YA0A 3N1GC 5FYLE 1SZNA 4QTHB 1HDMB 3ARWA 2Z7ZA 3H53A 5FYKH 2DH2A 3GS0A 2DJUA 3HIZA 2F5AH 3ULUH 1L9OA 3T4YA 1KGIA 4JDTL 2APWA 4UUJB 1IM9A 1KCRH 4OSUH 5E6SB 1VCBC 3FXIC 4YXHH 3LRSA 2MTPA 1HILB 3LNEA 2I9LA 1VCAA 3GO1L 4KGJA 5C2BL 2XZZA 2VKWA 1XF1A 4M8QB 2ZIDA 2JLPA 4MMZB 3WAKA 3O2DH 1T80A 3ZZQA 2QFRA 1R9FA 2I5YL 1OXYA 1LEIA 1XH1A 2CO3A 2X89D 1BAFH 4DN4H 1Q9KB 5E00A 1NDMA 2CLRB 1EGJH 2X4SB 4AJYV 4BBWA 3EADA 1NGWB 4NM8H 4V2BA 5C0IA 5JPMC 2DICA 4J2XA 3Q13A 3CWGA 3M1BA 3CU7A 4LHUA 1GXEA 2UUDH 3O0LA 5BCAA 3BT2H 2GAZB 3X13B 2QHRH 4OTXL 1H3VA 1MFVA 5IMLB 1AI1H 4M6NL 2B9BA 3VI4F 2P8MB 3QIWD 5GGVL 3QJFA 2DQTH 4NQVA 4DERA 1A7BA 1MFDH 3KJ4B 3QDJB 3PV7A 2F54A 4D7PA 2HJKB 4QHKJ 5DJ2A 3BT0A 2CRIA 4PW3A 4L3ED 4PWFA 2Y69B 1BWMA 1INDL 4HIJA 1ZLDA 1PG7H 1GR7A 4DIXA 4FMVA 3KYNA 3GXUB 5E4AA 1IGJB 2W0FB 3O6LL 1TVBB 2UY7B 4ZZKA 1JNHB 2KQMA 2UWEB 3CXDH 1PCSA 3IRPX 5C97A 3HI6L 4S1RL 5J11B 1DQQB 4G6JH 4NQEB 4K55A 4LCCB 2VUKA 3QH3B 3IDUA 3R4DA 5E7FA 1BG1A 4URKA 2CUMA 1MFAL 3OSKA 5EDSA 3TCLA 4P2RD 1W72L 1KGUA 5LGJB 4Z3HA 3RGBA 2JI1A 4D9LH 5K9JL 1X3DA 5G4OA 1OPGH 3VI3F 4JRXD 4FYQA 2JTYA 5I1HL 2YD9A 3ARDA 4LPYA 1FFOA 4HZLA 3ZRCC 2QVTA 1BQLH 4KBPA 5JHLH 4ODUB 3RWIA 3KYKH 2YN5A 3VXRD 4G3YL 4AYSA 4CMHC 1P1ZB 3DETC 5E70A 3OPZH 3CZFA 4G6AC 4G72B 5ISZA 3VU2A 3ZZ1A 1JYVA 2NQDA 3VXTB 4HOXA 2NUPB 3CV5A 1MRDH 3EOAA 3K71A 1MJJA 3QZMA 1KULA 1UENA 1FH5H 4LASH 4HWBL 5A2LH 5LDSA 5TFSL 2OMNA 4HETA 4M6NH 2AK4B 1ZRUA 2F0CA 3TL5A 2OL3L 4ZXBA 2Y9RT 4MDJB 1Y0LB 1KFAL 3HMXH 4LBEA 4UM9A 1HWHB 4L0YA 1NTDA 3T3PB 1W15A 5HY9B 3O8XD 3MRBB 1WEJL 2OJEA 4NXKA 3RHWF 5CLYA 1PX4A 1GOGA 1FZKB 1QLEL 3F85A 3P3SA 4M7LH 4PD4K 4PJEA 4HJJL 1VAHA 1R24A 2WLKA 2X1XR 3KR3H 2BY3A 4WV1A 5BO1L 4C56E 3JV4B 3NCYP 5EN3A 2BY2A 3WOVA 1MNUH 1Z5HA 4YHNA 3V6ZB 2WSDA 4WSGA 2CXGA 4FQ2H 1HWGB 4P04A 3WFHB 4JDTH 4GUQA 4FN0A 1E4KC 2ZOKB 3A23A 5DURD 3OKEA 5K39A 2QGDA 4OAWA 4OJEH 3ETSA 3EG9A 1CE1L 3MC0A 2OK0H 3RPIB 4RX4A 1KIUB 4HU2A 1S7QA 5E8NA 3B56A 3ML9A 5D1XA 4RFNB 1OB1A 4LKCB 4YSPA 2DWDA 1Z32X 3MA7A 5BRZA 5DRXA 5T1LA 4G83A 4J3OF 4U2YA 4JPWH 1GTNA 1OLZA 1SBSL 5DFAA 1S8DA 4QF1B 4BKLA 2LV4A 1SEQH 4JFDB 1AMYA 3UTQB 2ZCHH 3L13A 3ULAB 3GGWA 3L4VA 4POYA 4AK2A 4WJG3 3O6FC 4LFHG 4LSQL 5KWYC 3CUPB 1J0ZA 3GSRB 1WSST 1YNLL 1IC0A 4GS7C 1J9QA 3BIKB 3MLXH 3FCBA 4GUOA 4BZYA 1PY0A 4HFWA 4F8NA 5TF1L 1UOLA 5GGUA 2ATKB 1DFBH 2H6OA 2PYED 5CLWA 3VRJB 1UXSB 1ILUA 3VD3A 2Z92A 4AE1A 1WBXB 1A8ZA 3VD2A 3DJ9A 1U8JA 2IG2H 3FFCE 3F04A 2NY0B 3GMLA 4MZIA 4NHCH 5C07D 1NFIA 5DHEA 1NKGA 3ARVA 3KCPB 4LEXH 5JW3L 1KSRA 3NAAL 2MPAH 2DAVA 4MMZA 3T2QA 1S78D 3MRKA 4YGVB 4G5AA 2XACC 5CEZD 5TE4H 2PYFB 1BXAA 4KTEH 5JORA 3JVGA 2B2XL 2IXQB 3D4GA 4LAQH 1G4MA 1YZZA 1G9MH 2FBRA 4FOMA 4DPBX 2FWUA 2EDLA 2VDKB 4BHUI 3IAGC 1J8KA 3INOA 3ZN6A 4HKJA 1B4JL 5FW8A 4KY1H 4NHUB 4PQXA 4O2EA 3FRPA 3IDNB 2YD3A 3VX1A 3FYIB 5DR5L 4FJZA 3MLUH 4HP5A 4LU5L 4JFYA 3HG0A 4D3CL 3D08A 2EC9T 2XG5A 5IHZB 4LDOB 3X14B 1XSKA 3AXHA 1CXFA 4YHZL 4Z7QB 3ARGA 2VQUA 3F01A 4HKXA 2LHAA 4KOBA 2LAAA 1DHKA 3QEHB 1KY6A 1S7TA 3QFJA 4XC3L 4MA3B 5KSUB 4ZPVB 4XGZA 1U6AL 4K71C 3QIBB 4R3SA 4NX0A 4UDTB 5I74C 1RMFH 1DCLA 1F18A 5FB8B 1P2CB 3MV7D 1MRCH 4WIQA 3R1GH 5FDYA 4POUB 4RGNC 2NY5C 4KROC 3M1BB 4HDIA 3I9IA 4DOHE 1DDHA 3KNBB 1U8CB 4JANA 4MCNA 4NPKA 5GZND 4A37A 4DUVA 43CAB 5DC2A 2YXFA 4C83A 2ZAGA 1EWHA 2WXLA 1BOYA 2F8VA 3FUEA 4PPTA 2JQZA 1EEUA 4AZUA 4A2DA 4DW2L 1MRFH 4KKBD 2OBGA 1Z0NA 3QS3A 3SPIA 3TP4A 3OHXB 3MLVL 4X8CA 2GI0A 4PLJC 3QCVL 3V6FA 4QAWA 4TULH 5GRJH 5I2IB 1I85A 5FYJU 4XP1L 2AV1A 3ZTNH 3A47A 2BSTA 1WFJA 1KB5L 2GJPA 4Y5YC 1PDKA 3CNKA 3CHPA 1Z5LB 1DBAH 3RRQA 3QYCA 4J3UA 2IQ9L 2E0PA 4XPAH 4HF5L 5CNHA 3SDXA 5IMMB 1HDMA 4LHQB 3JWNE 5ETUB 3MXVH 4K23H 4M3HA 4XCNA 2WY3B 1IBBA 1MSPA 2XA8L 2Z91A 3UOAB 4KK9C 2Q8BH 3F7QA 3N91A 3ZKQD 1R3JB 5DWUH 3SE9L 5I0DA 1OT2A 4IDLA 4ZW5A 4DJMA 1TZGH 1XL4A 2R29L 4PGDB 2V5SA 2NY7L 1FNSH 3M1CA 4AYEC 3KEHA 1E7VA 3NCWA 1SXBA 1RI8A 3NRPA 3TT3L 3JYBA 4KXZH 1C5CH 4JRXA 3U79A 3DX3A 1JZHA 5HHQB 2R4SH 5CCKL 3FT4B 4XPTL 3W0WE 3GBLA 2J88L 1NC2A 1Q72L 2QADD 5IM7A 5B22A 1GIGH 3TO4B 2XBTA 2VAAB 4K3EL 4YSUA 4JQXA 4N2KA 4ELME 1DSYA 2H6PB 2WKOF 1O6TA 4WTXA 2EICA 3I2CH 4ECNA 1U30A 3MVSA 1UATA 1GZPB 3OXRB 1IMHC 5DTFB 2ADIA 3O81A 2X4PA 3CPUA 1JWSB 3ARYA 5AALA 4RZKA 2MWCA 1SRDA 1XR9B 4Y1TA 3HZVB 2R8SL 2G0KA 4HSAC 3TWCH 2B4CC 3ILPA 5KBDA 2DTSA 5H2BA 3QRFM 1ZLWH 1C5BH 3AC0A 1I31A 5IB5B 3HRPA 3WO3B 3OKMB 1L5GA 1UQSA 2G9HB 4WI9A 5KSVB 2Q3ZA 1UTDA 1N8ZA 4LSQH 3JV6B 2R4RH 5KSAA 3W5NA 1SDDA 3KDPB 2WLHA 1SN2A 4TXVB 5AAWA 2VLRE 2VXTH 3G5YB 4FEIA 3GLZA 1I9EA 5JXAL 2YO3A 3W9EB 3HPJB 2H41A 1OM9A 1RK0A 3C87A 3WCYA 2RB8A 3ARZA 4HUUA 4DKEH 5IW6B 3TEUA 4GAGL 1SJHA 2Z8VC 4ZAKC 1PF3A 4TV3A 2D7TH 2IPUK 4IMKC 5KUKA 3GJFB 1OP3K 4F9LC 1D5IL 4DPRA 5C8JA 4XNXL 4JCMA 3IS1X 1LO0L 2JE8A 5HGHA 4N3TA 5IKCB 1NIFA 2R2CA 1MI5D 1C5DA 5AW6B 2DLGA 3PY9A 5FUCE 1PX3A 2WVTA 5KVFE 1ETZB 4IU2B 3RTLA 4V11A 2ICCA 3HB3B 5DDHB 4XVUC 1H3XA 4Y9FA 4AL8C 3B9VA 3TBTB 5AQ0A 2WOBA 1QRKA 2CJUL 2X7LA 3DKHA 1UXSA 2P9RA 4K3DL 3DSFL 4EIUA 2C3WA 4R8WH 3FOLA 3ZL4H 4ZBJA 1PNDA 2LU5A 4U4BA 3L5XL 4LCWD 2DTML 4TNVF 2YMXH 3CZLA 1JWMA 4OLWH 1A3QA 3E38A 3D25A 4F7TA 4X4ME 4LCCC 4RSVA 2B5IC 1SUHA 5HDWA 4NWTH 3VXUB 4FMFA 2IH1B 4GMSH 4LEXL 2Z8SA 5CEYB 3UPCA 3VFVB 1P7QD 1FGNH 4NENB 2OMUB 3VXRB 5EF3A 3EHBD 1BA9A 3LYRA 4FQJH 5E2JA 1WLHA 1SOKA 1DO6A 4TKWA 4X6BA 4XN8A 5D96C 3VFSA 5F9JB 1WFTA 1I7UA 4AVKA 3QUHA 1QLFB 4Q4EA 1VJSA 1F4WH 2DWDB 4Q9RH 4BUGA 3A67H 3OAUH 3MROB 4FCHA 2NX5B 4H44C 4QKXB 3I50L 2EEXA 5IOKA 2J6EL 2WVSA 3M8OL 4G6FD 4PJXA 4B9PA 2AV7B 4FKKA 1JF1A 1CLZL 2BOCA 3KHOA 4O4YL 2X12A 4JO2L 2E74C 5IWLC 4ELKB 3BZFB 3DGDA 1HL4A 4NKIL 2VN7A 3WHXA 4MZ2A 1G4RA 4NOBA 3OR7B 2IWEA 3DHUA 5FO9B 1SDAB 2ADFL 3MRFB 1JL8A 1NFDE 3MV7B 5TGBB 3RDTC 4H8WC 4JFFE 4PW9A 4EN3D 4GFTB 1DDTA 2IQ9H 4QT5B 4XPAL 5B39G 1IU1A 3Q01A 2Y3NA 1CDIA 4KKLC 5F7LB 2DD8H 3R1GL 4JFED 4A39A 3TS8A 1ZANL 1ZMYA 5HY9A 1CBJA 5DMJB 4UINH 4TVPD 4QRRD 2F58L 1LILA 1NICA 3E3QC 4PVNA 4U6VL 1CDGA 9PCYA 3OBAA 2AQSA 1OTUC 2P52A 2VZTA 2ZG1A 2ZPKH 1H6UA 3EH3B 3H56A 1TEYA 4NO0D 3FTXA 5D7LB 5FHAH 4ZOCA 3GSWB 3A6OA 3FU8A 3DOIA 3GRWA 3HC3H 3SDYH 3VWKB 1GKEA 2XN9B 3L5WA 2YFNA 1CDCA 2NY2D 5GRUL 4H20L 1AGBA 3QWRA 1CGWA 5HHXL 2XX0A 4PJ7E 3N44B 1FYTB 2YKLL 1BECA 5AW8B 2PR4H 3QXAB 4L5FE 1U8NA 2PTTB 3U7WL 4K73A 4QOKE 1JYWA 4FXKC 4XZ4A 3FT3B 5H8DA 4NQCB 1F4WL 5HI4C 2E5EA 4PJ8A 2VXSH 4WUUB 2ZOOA 3SY0A 3QIUC 4KDVA 1TZHB 5E2WL 2Q20A 2J4WH 2EDYA 2EYSB 2EIEA 2ITCA 3LZNA 4L8BB 4JKPL 2OMXA 4YQXL 1A6ZB 1YYLH 5C0BD 3DIFB 1EXGA 1D5ZA 2G5RA 4RNRB 3VUAA 1I7UB 3CH8A 1P53A 1M7IB 3TO4D 1HQ4B 4BQ9A 2E27H 2APSA 1D6EA 2YGQA 2X1PA 3L3HA 3KYNB 2ISDA 2J88H 4MXVF 4G7YH 5HPMA 5HDQL 5IROC 3PLYA 1MHEA 2GIMA 3D33A 4RBPH 4XMVA 5ES4B 4I9XA 3EXLA 2AJYL 4QXUH 3JT0A 5HI4D 3PL6D 4Y16C 5IUSA 2NCEA 4F8QA 4OZHA 4J8RB 1OARL 1S46A 1G7IB 3DVFA 1RAMA 2BRRH 5IMLA 5EOCH 5JXEA 4GQZA 3QO1A 5INDB 3S3PA 3HG4A 4GRWE 1KPRA 2VNCA 1RVFH 5SX4H 1NUGA 1OAYH 3GFUA 4XCCH 3MODL 3Q43A 2AQQA 3C9NB 4IMLA 1TVHA 1T1ZB 2ICWI 5K9QG 5KSBE 4RFOL 1YPZF 4LGSB 4L48A 1DQQA 4FGMA 5DSCA 2ALAA 3GDCA 3WJJC 5CMAB 2GKIA 2JJUA 1YAZA 2PNDA 3GBMH 2YS4A 4ZQTA 1PEWA 4X5RA 5LJYH 4X6CE 2OK0L 1N5AB 1HILA 3IDXH 6CGTA 4JR9L 1E4HA 5KOVC 4OLEA 2BP0A 3V7MA 1KJ2A 1UD6A 1F0LA 1MQ8A 4PRDA 5C3LD 3IS0X 5INDA 4CMHB 2VUYA 4AYDC 3B9EA 4HIIB 4I5BA 1EJOH 3SQBB 3KJ6L 3T8VA 4FADA 3MJ6A 1QRNA 3PP4L 2GITB 2WBWB 1EAJA 4N8CL 4YSOA 5DHVA 3MRDA 4FQJL 3RAJL 2NXZD 1WGVA 3U0WL 4XNZB 1NH6A 3AXLB 3MRNB 4NN6C 1J12A 4PHXA 1TJMA 4OY9A 1PQZB 2Z31D 4JM4H 1ZHNB 2HPOA 3NCMA 1RSYA 1AQKL 2XKNB 3GXMA 1HT6A 2AQNA 2OL3H 1IKNA 1ZXKA 4JFUA 2VQ1B 1OTSC 4LCYB 1NCTA 4P2RE 5K9KB 2G3NA 4P9HH 3K3QA 1VEOA 3V4UL 4OBSA 2WINA 4JPWL 3NAAH 1RUPL 2EYSA 4JJOA 4ELMA 2DF3A 1GCYA 4HIEA 4E9QA 1WDAA 3VW3H 4EDXA 3IWUA 3EYFB 4KRPB 1ONQA 2OMYA 3VXRE 1NEPA 3SQOH 1E5UI 1OAYL 1XD1A 2D3VA 3E9TA 4KJPC 3LV3A 4CMMB 3VFPA 3DOSA 1D6EB 32C2B 1ZSDA 2GY5A 4Z76A 2E86A 1ZANH 2ADGB 1QQDB 1E6JH 2MQ3A 1HEZA 1PKQE 4OFYA 2H4EA 4HH9B 3FT4A 3LZFH 1I1YB 1PU0A 1PSKH 5LAPA 4OFQA 4QOKD 1IAOA 5F1IA 2A4ZA 4YBLB 2CLZA 1KIUA 1QRNE 1AQHA 2GW5A 4B5EA 4LPVA 4HJGB 4X8XA 4BDVB 2OULB 4I0PB 3I74A 4GW4B 3FU3A 2P46B 5FW7A 4F33B 3MO1B 5HD8C 5KVFL 5EEWA 5EIIA 4BFJA 4ZQKB 5BVJA 1YMME 2DDQL 4ZMPA 4YSSA 1V7MH 3OB8A 1IX2A 1J88A 4NUPA 2MIZA 5CLZA 1PYWA 2VJ8A 2P80D 2WZ6A 3LKQA 4N2MA 3IJYB 2V4LA 1CT8A 4LEEA 3B7RL 3H9YA 2ZKWA 4WTZA 4LLQB 1CXKA 1EHXA 4G9FD 2F19H 5F9OL 5E24E 3WLWC 4FXTA 3K46A 3LD8B 5EPMA 1N5YH 3ALXA 4JY5L 5I6OA 5I5IA 2Z93A 3CXHK 1ZVHA 1CWVA 1AGDB 4KROD 3RJOA 3UTTB 1J9SA 4IU3B 5AUMA 2E8YA 1CGTA 2EDTA 3K2MC 5JO5B 1LO4H 5FPIA 2ZWZA 5E9DE 5JDSB 2AV7A 3BMWA 1M7DA 2WXKA 2EYRA 2EZ0C 3H2WA 4N8CH 3ARUA 3SQOL 5HYSA 4AV4A 3PWJB 1HHIA 3PWNA 5I30L 4TLTA 2AQ1A 3D39D 2WW8A 1HSBA 3OMNB 3OKOB 4NQCD 2Q86B 2XWDA 1OB0A 2VTFA 3OL2A 3O9WC 1J0HA 4RAVA 1BQSA 1MVUA 3MRCB 3QJHB 1YPZE 2Y7LA 3ZDYB 5FCUL 2HUHA 3TXAA 3MUJA 5J6SA 3RL1A 4DQAA 1O7SA 2AERT 2D03H 3GQFA 5LGJA 4KK6D 4NM4H 5KW9H 4ALAL 3X1GA 1N2RA 4ANKA 2NSXA 2X7LB 4BH8A 1TUPA 3P1VA 2MKLC 5I17A 3IPFA 2OZ4H 3MRRB 1OCWH 3K1KC 3L2NA 1C16B 1T7XA 2HWZH 2P47B 5C7XH 2JKLA 1S7SA 1FL5A 4AYGA 1U8QA 1LHZA 3WUZA 1ES0A 1WC7A 1YNTB 4Z7VB 3U4BH 1JF6A 3D51A 4DP9X 3BPNC 1C08A 4BWTA 3H9HA 3O2DL 1PG7L 3ARDD 1WUNT 4NZRH 3ZYZA 5DJXB 3K2UL 3IXAB 3AS0A 3HFMH 4WZ9A 1ZLSH 4F2EA 3FU7A 3PP3K 5CZVL 2HPTA 2V3FA 5D2LF 1I8KA 2R69H 1IQWL 4G71B 5TQ0L 1G7LB 1BDYA 2QHRL 4OTXH 3QDGA 4M8RA 2YQ3A 4WI8A 1ZLWK 1XSOA 3SO3B 5BRZE 5CJXC 2ICES 1A4JB 3W39A 1E28B 4K2UL 4PJ7B 3TEYA 5D6CA 3ARQA 3S7GA 1AO7E 2JK5B 3T0EA 3C60D 3QG6A 2RHEA 4PRBA 2HLFC 2Z93B 1TETH 3GUTB 4GIOA 3TFBA 3K72A 2JB5H 1CXIA 3QZLA 1HH9B 5GS2H 4GLRH 4HXAH 1DEEA 2IDCA 1GRWA 4DP5X 4Z7OF 4M93B 3AAZB 2KLTA 2HH0L 4FABH 5CBAB 1YO4A 2P45B 4AKQA 3U7YH 3JWDC 3CBKB 4LLUA 1O7DE 3QNYA 3VWJA 3HRZC 4AQ1B 4DGVL 1BVOA 1Q0EA 5IVXE 1F8TH 2VZSA 4W9ZA 4UQCA 2NTFB 5ISZD 3F3HA 2D9QB 2XT1B 3LN5A 1RH8A 4KRNA 3EIFA 2UZYB 2VW6A 4HIXH 2JKSA 4DT2A 1X5JA 4TTDC 4LLMB 3MKKA 4FAAB 3VWJC 3BVNA 2J8UA 4R7VA 1AP2A 3MREA 4MJ6B 1EVTC 4P5TD 5C6TH 2NY6C 3O11A 4GKNB 3T8MA 3P77B 1OOAA 2VDPB 1OD7A 1JVKA 4QNPF 4RVBA 4XX1G 2EVJA 2EDQA 1DP0A 2J2ZB 3BW9B 4NPJA 1UWXH 5FHBH 2KKQA 5JMRA 4QRPD 1IM9D 1ORQA 3D4ZA 4PY8I 3K8MA 2NW2A 4MJ6A 5E1HB 2E9JA 3KYKL 3SDAA 1DVFA 3TIEA 5ACZA 5DK0B 4ATWA 3UIZA 4YVUA 3U48A 1KWKA 1EH9A 4LIQE 4P2AA 1Q0YH 1TQCC 3M17B 1TCRA 2GSIB 2IWKA 4UMGA 4WO4B 5LQBH 3ZTDC 3VXSD 3ULUE 3NP4A 3SDAC 3ES6A 2AANA 2IGLA 4RIRB 1R46A 3HS0B 4JO2H 5DD0L 1PDKB 5EWIH 1N59B 3K6NA 1SOSA 1KN2H 1IFHL 3VXQA 1EZSA 1GYAA 2WINB 2QELA 1BPLB 3LKQB 2NY2C 4TSCL 5CJ5A 5FXCH 4Y4KB 4IGBB 3VXPB 3HMXA 4OZFH 2AKRA 3QR0A 4WAFA 5DWPA 1JYNA 2IWGA 1PY9A 3STLB 3NP3A 1PZUB 2I60H 1M7XA 1RULH 2YPVL 1SYSA 2F53D 3IU4H 1ODUA 1UZ8A 1U3YA 1H5BB 3QR2A 3ZTEA 2WBJB 4JKNA 4J3SA 4AKPA 3AXLA 3MRNA 3LEVH 3GI8L 3NCXA 4UV4H 4YVNA 3TV3H 2P5ED 1Q0XL 4RGOH 3T0VA 5AVUB 3D12B 4PJ5E 3ESUF 3M6DA 1KXQE 1QUNA 2YARA 4WO4D 3S6CA 1NIEA 3C2AH 3QZBA 4W4OA 3AG1B 3KZ8A 4QTIL 4H1LG 1OZUA 1M1XB 2CCLA 3KPMB 1JDCA 4ISVA 5GGSB 1LK3H 1E9OA 3RDTD 2OI9B 2I07A 4BA0A 2PUQT 3LRGA 3GIVB 5FO8A 2Z35B 5J57B 1FNLA 3MOAL 4G6KH 2P8MA 2GC7C 4PWGA 4P5KA 4IEFB 5JIDA 3MLPA 1OM3L 4MCZA 4DZ8B 1GZQB 3RIFK 3GSUA 1HCVA 4QYOB 3WUWB 4CW1B 3S3SA 1HZHH 4LP4A 3VFNB 2R2BA 2YAMA 1B9ZA 4JHZA 4Q74A 3QC6X 2VR9A 1WD9A 4PI0A 1ZVYA 3JTSB 4PJHA 4F7PA 2XTJC 4Z5RB 2XA8H 3EJYC 1Q9WA 4X9GA 3WJLA 4IRJD 1U95B 3EGXA 3W0WA 4KY2A 5I8KL 4S1DD 1KCWA 5TE6L 3RVWC 4K4KA 2Y2WA 4U33A 3LEXB 3Q2NA 2ZCLL 4AIZB 2EDBA 5F1SA 3FL7A 3VYPA 5EN2B 1DQLH 3ULVE 2I27N 1KB3A 1FFPA 3P9MA 4QAMB 3ABZA 1BAWA 2VLKD 5LAXA 2APBA 2YWZA 4LSDA 2WN3A 4HMDA 3G04B 5CCGE 1CXEA 3GJFH 3FFCA 4LPCA 1GIGL 4KTGA 5I1LB 1C7TA 1JPGB 5FFLA 5D7JB 3S35X 1MG3C 4LVOB 3RQ3A 2WO2B 4RH4A 2FL5B 1M2OA 3OAZK 2ZXWB 3NFSH 4F7CB 3QVAA 2WQAA 4Z7VA 3MRIB 1D5BB 4QGYA 1I8IB 4C4KT 4EQ2A 4J4PC 4JJ5A 5ID0B 1BV8A 1AS7A 2FB4H 5EBWA 5I23A 3MA7B 1J1OL 4LNRB 1VPOL 5BRZB 5EU3A 5J4MA 2VR7A 3QIBC 3LVTA 4DEUA 2HAZA 2X38A 1SXNA 4X7FC 3KLAB 5JYLA 2GSGB 1QAWA 4OZ4B 5A7BA 3U7YL 5HYJD 5IB1B 5C09E 4P3DA 5C2UB 5IFAL 1Q72H 2ZXEB 4PG2A 3T08A 1XXFC 3AS3A 1YY9D 3BQUD 8PAZA 4DN3L 5DVOA 1LYQA 1XGPB 1P6FA 4MMZC 2NT1A 1VFAA 2DYPD 4NAQA 5IFHL 1ZIAA 2DWSA 3GHPA 3Q2CA 2QGCA 3GO1H 4IRSC 1NEZB 3D85D 4WNQA 3QORA 5T1DL 3SGDI 1YEHH 4UI2A 3QJHA 1Z3GL 3C08L 5D1XB 1MWAA 2AK1L 5E6RB 3H3PL 3IFOA 3U4AA 2B14A 3QYMA 3MRBA 3POCA 3TBSB 5DC0A 5DZPA 5F2FA 4HK3N 3F58L 3VFGL 2L7QA 4P4RB 5HI3D 2YLHA 3IKCA 1RZ8B 2APFA 3BO8B 3ARBC 4MA1C 1A6TA 3IGKA 5DJ6A 5BZWB 3V7AE 2CDGA 1E4XL 3GPEA 2R2BB 4XMXA 2DQHH 1T7ZA 4OFVA 3MLTA 4POZC 1B2WL 1PPIA 3OZLA 1CR9L 3GC3A 1N8OE 3QHZL 1T1XB 5H94B 3ISWA 1I1CA 5I76A 3EJYD 1OT1A 5KEZA 2QSTA 4OZGB 4BQ6A 4GRLD 4PS7A 4ESKA 1W6WA 4X4ZA 1SN5A 3QNZB 3EDJA 4WWNA 2PKDA 4Z3EA 1MLCB 5ICYA 4JY4A 4Y1AD 4Y2LA 1G9NH 5GGRA 2X4RB 2FB4L 3E6HB 3H42H 2AJZA 5MEQB 1JS4A 4Z7VE 3KYMA 1UKQA 5IOPB 3M7FB 3QNXA 3BN9C 4URTB 1FNGA 2QSCL 2BP8A 5BV7B 1AXTH 3HNSH 4X4XB 1AI1L 2YSSA 2EJ1A 1E6JL 5ABZA 1DVZA 2N4IA 2Q9OA 4G59C 2P5PA 4WEBL 3DRQB 2UZIH 2BW4A 3CBRA 1I7TA 3NJGA 3NJLA 2IANA 2C9UA 1IFGA 1XR8A 4QR7A 2J5WA 3SE8H 5AFAA 5AKTA 1A1NA 4D0DB 1FFOB 4HZLB 3FOLB 4HLJA 1A14H 5CUSH 1DR9A 3QEQD 3OPZL 3PDOB 4HGWA 3KWTA 2IGTA 3KPLA 5FYJL 3W81A 1FO0H 1S9VB 4PRHB 4ANVA 4Z3FA 1V3LA 2CGYA 2HYMA 3MYJA 1J5OL 3GZPA 2IIJA 3SE4C 4ZMOA 4Z77B 1S7RB 1TQSA 4R2GC 4L8SB 2JXMB 1QLRA 3T4AB 3U6XA 2WXHA 1WWBX 2CJSA 4ELDA 4GXUN 4P2OC 5L2KD 5C8JB 5DJZA 4JKMA 1CFTA 3FCGA 1T2QH 4UF7C 3MLRL 3W9DB 5J1SC 4Q9QL 2JCWA 5DYOB 3BKJH 4KXDA 2GTZA 3VW3L 4KKRA 4JO1H 4XB7A 1ZEAH 3QO1B 1F2QA 1AZUA 3C60B 3WHE1 3ZTJH 2OW6A 2XKNA 3NGBB 4APXB 3MV8E 4ELMF 3MRMB 2HCZX 4BELD 3VFUB 5D7IF 4Z78A 3LRSB 3ZQ9A 4BZ2H 3MRDB 3ZHLA 1MY5A 2PO6A 4DZ8A 5I16A 3KLHC 3GBEA 2V0AA 3MYZA 3TVMA 5TFSH 1NUDA 4K7PY 4RMWA 3NZHH 5EOQH 2XWBA 3HZYA 1AQDB 3KLDA 4UWQB 3VYOA 1KXTB 1F2XK 1JGUL 1YY8B 3ULUC 3O4LE 3PIQB 4MNQA 1FC1A 1MCHA 2XFXB 1VENA 5FEBA 2E4TA 5FV1L 2UXVA 1D5ZB 2ZUQB 1UZ6E 2ITDA 2IG2L 1BZ9A 3H6AA 4IKKA 4NHCL 1WYJA 3FC8A 2Y5QA 4NCC2 1JPSH 3FFDA 4DCQB 4MB3A 5T3XH 1UEYA 4TM9A 4HKZA 1A3LH 3DI2B 4OCMC 1PX8A 1G7QA 3FN0H 4UU9A 3FTSA 5T5NG 1F6FB 1R6VA 2K4WA 4XI5D 3V0AC 4Q9CA 2E75C 5FECA 3S88L 1JAEA 2KDYA 5CMAA 4BK4A 1BZ9B 3Q2LA 2VZOA 3HZMB 2A6KA 2KMWA 4W9JC 3ZKNC 3UZEA 3CPLA 1DN0B 3FBKA 1WZ1H 1YMMB 2H3NA 2WNXA 1T66C 2V33A 1SFHA 4DKFL 5EZLA 2CK2A 4FZEH 5KTEH 2FT6A 4N0RA 2CJTA 2G3ZA 5EUKB 3C6LB 1HI6B 2FLRT 5H35A 2EDNA 5HHQA 3HBZA 1IZKA 4UAOC 3W9EA 3QZNA 2C3XA 3GBNH 3GJFK 4N2GA 4WKXA 5BMFL 2EDJA 2V2TA 3MCLL 1JZIA 1B3IA 4M9PA 4F5CE 1ML0A 4LHUG 4PUBL 4HAKA 3DMMA 3EBAA 5C0CB 4M62H 2Y06H 3FCSA 2CLVA 4LIQH 1PZDA 1B4LA 3ECBA 2UX7A 2B5IB 3DBSA 3RJQB 4BFIB 3VRIA 2J8UE 3JT2A 2X4TB 4ZXBC 1T21B 3UPRA 3H3BC 4PP2A 5IB2B 4MCMA 4WO4C 5TF1H 5D1XC 3ZDYE 1A4BA 1Q4NX 3U4KA 4MAZA 4QMEA 3VB9A 5HHNB 3NPSB 4K2UH 4PJ5D 3D85B 4F8TA 2JB6B 4K7FB 3R7QA 3PNWB 5ABAA 5KZCB 3OWEA 3WEOA 3QQDB 1VGEH 3VE0A 1AGCA 4NP9A 1FHNA 3OAZH 3R19A 3VD7A 4ENEC 4NQQA 1IGFL 1DN2A 3NMEA 2XYBA 1HTYA 2FSEA 2O5XH 3FQUA 3DPBA 5FHAL 4NXSA 4PS8A 5KJ4A 1T1YA 3TNNA 4A04A 3IMVA 4I2XA 2P5EA 2DJ4A 2K9FB 2X88A 1NCAH 2UY6B 4FD0A 4Z3IA 5I5RA 4Y8DC 1AD0B 2B1HH 4MVBD 3Q9PA 3CIQA 3UFIA 1A6AB 4UZGA 5AB9A 2R9HC 1SEBB 2BS9A 3HG1B 5E8DH 3QEUA 5IOPA 1D2PA 4W93A 5ITBL 5K9OB 3ESPA 3RWGA 4MD0B 2WTRB 1HN1A 5D5ME 1UUSA 5F44A 2APXA 2M26A 1R3IL 3OLDA 2FD6H 4L8CA 2VJ0A 3VSUA 3H3KA 2O72A 3MJGX 3MJ9L 1RIUH 1YUHA 4TUOA 5SWQA 5CD5D 1QYGL 3ILQD 1LWJA 3S3CB 5A2CA 3WU1A 3OTTA 4XI5C 4M62L 1HESA 5IFJB 1AG0A 2BVQA 3WIAA 4DEPC 5IGXH 3HFFA 1DBBH 3BH8B 5FLVA 3GRWH 2HT4C 3B9KA 4Z18A 5LLIC 2VDOL 5I24A 5F9WC 1PZBA 2ESVE 1X9QA 1OHQA 3D9AH 1OWRM 5C0GA 1I8LC 4N9GA 3INUH 5BVJB 4U1JA 4B60A 4R4FL 2CRZA 1CYXA 4R5VA 1JCKA 4C59B 4PJ7A 3SPJA 1U8MB 2H2SD 2E3VA 2Y22A 4WHYG 1GTFA 5E8PB 2DLFH 3IMTA 4WU7A 1WZAA 3UGXA 2KI6A 1YN7A 4P5TA 1GMEA 4OD3H 4XPGH 4X5LA 3QWOA 4XO5A 4X99B 1RK0B 1WA2X 5I6KA 2YRPA 1AKPA 1GGIL 2VN5A 3J2PA 3L7EA 3WNIA 4ODWA 4E9WA 1LP9B 2J5LC 1NMAH 5D7JC 2HVBA 2A4EA 2XTLA 3PJLA 3D69A 2W9EH 4H1LA 4W9LC 3DA0A 3R0MA 5JQHC 2A6KB 4K8RH 2OTWA 1WC7B 2G9HA 1L5GB 4W9CC 1KIRA 4U1SB 3MUHL 3DX6A 4TMPA 4P9HL 5I0WA 4UQBA 2NZIA 2BDNL 2IALA 2NXZC 3MGTB 2NPLX 4TNWF 4XBGA 1I7RA 4NQEE 2NZ9C 3HBPA 4NNYB 3B2UD 5F9WB 4ICXA 5DDHA 3VQ2C 4FNLL 3WNMA 1ZEAL 1FL6B 1RSFA 4KVNL 1QO3A 2B1OA 3WHE0 3T1WA 3DVGA 3IKKA 3D52A 3U0WH 2FYYA 2YD5A 4IIQC 4BCZA 5BZXA 5DI8A 1QLEB 2PO6B 1NGQL 1HHKB 1RIVH 3EH4B 4GRLC 1E27A 2XX1A 4NC0B 3CSYA 3DPBB 1MWOA 3LZFL 1HK6A 1KZQA 1OIOA 2CDFA 3L6FA 4X7TA 3AU1A 1JRHH 2WYIA 3WIFA 1N64H 2P3YA 2WBXA 3MV9B 5FA3B 4J5VA 3MDJA 3FOMA 1IIKA 3KL0A 4HIQA 4GG6B 4XNAA 2Q7YB 3BP7B 4YHLH 1AANA 3GI9L 2J1XA 3KG5A 3S3DB 1Y6NR 3VI3A 1HL8A 4HCRA 1ID5I 3FJTA 3ARBB 2YLKA 1UH3A 2BIPA 5JNYB 4BKSC 3TEZA 2WNKA 2EC8A 3QUKA 4NQED 3L3OB 1N8ZB 5KN5A 1RP9A 2V17L 3OKNB 4MNGA 4F57L 2DQGH 3CC1A 3VXTA 1OGAB 1GOHA 5LXGH 2NCMA 1IGMH 3CZKA 2CUAA 2AI0H 4AGNA 3PWUB 4Z7WA 3W2DL 1TQWA 1KTCA 3ETBF 2OR8A 4K3DH 5MI0C 3RKDC 2R2HA 4WK4B 3WY2A 4B96A 1P5VB 5IHWA 4OJAA 5GZNC 4LSUH 4ZO7A 1XWVA 3EGSB 4FE9A 3SDXE 2J1YA 4MA8H 3NGBC 2C1PA 4R7XA 4HMCA 3FTGA 4P23B 1L7TL 2EO9A 3LY6A 4IOFD 4L9DA 3T3MF 1SNRA 1CVSC 2WTOA 1R24B 2GT9A 5CN1A 4F93B 1K8DB 3GMOB 3QFDB 2LTQC 4YE4L 5KVDL 5ID1B 4WFFE 1ZDSA 1RJLA 2X2YA 1L4IA 2NNRA 1MELA 2NQ3A 1B4RA 3EYFA 4IGBC 1NCJA 2HMIC 1EO8H 4FLSA 5IBUB 1ACZA 2GT9B 3I9PA 2XV3A 4KU1A 5DLLA 1OPGL 4JRYE 4NPYA 5KVMC 4MJIB 1MCWW 1B3JA 4ILDA 4KK9D 1HYRC 4F91B 4YAQA 2ZP8A 1QQDA 5C0CA 2ESVA 2VDMB 1HHHB 4M00A 2AF2A 4HAFA 4RDBA 1YG9A 1DBJH 4ZTOL 2H1PH 5AOIA 5CZKA 4IDJH 1WZLA 3U2SB 5C6PB 4MQ7B 1TSRA 5LAXB 2BSRB 3BXNA 2ICWB 2BWDA 3SEPA 5I8OH 4FQIH 4GG8B 1DEEB 4OLXH 5JZ7C 1KEML 4QRSB 1XIWC 3G3LA 4L5FL 4A6YL 2K3HA 3FUDA 4LCYA 1KIQA 2MMXA 4FQXB 1T22B 5FCUH 3T0EB 5I0ZA 5I1JH 2ILLA 2OCCB 5B38B 5DA0B 2W5PA 5CINL 3KCPA 4YX2H 3PAUA 1YYLL 4G7VL 4NGHL 2CRYA 2ZXGA 4WI5A 1X5XA 4AJVA 1G7MB 4X7TB 3IXTA 4GO8A 4OD2A 1JFQL 2Z7YA 2Q6WA 3X11A 5I19L 2E7LA 1B2WH 4A6YA 1QNZL 1PIGA 2P5WD 3IJ9A 1C1EL 1L6ZA 4LU5H 2EECA 1TMCB 4PRDB 4FJYA 1U8IA 4WDIB 2CHXA 3WDHA 5L2JA 4IRSB 5KSBF 5EUOB 4XP6H 4G9FE 4MJ2A 4IOSA 4FFYA 1GZHC 3T9WA 5IVNA 2XUWA 4P2RB 4BFNA 4JFDA 1ECYA 2BW5A 2P49B 2WOYA 2IPKA 5EWIL 3WEXB 1QATA 5E08H 2A0LD 1I7RB 3L1FA 5DHMC 2A9MH 1NLDL 1XGRA 1UD5A 4ZXBD 3EFDH 3Q5YA 4HJIA 3HFML 2AJSH 3GJEA 4WHTA 4YK4C 1T20A 2DJMA 2XQYA 1XH3B 4NJ9H 1DBAL 3QPQC 4Y19A 4YDVA 3VFTA 5SX5K 3CVHB 2OR9L 3N85H 1TTCA 2A6JA 4B41A 1W8NA 2Y2TA 1F58H 1WA0X 2VR8A 4NERA 3LQAL 3MLUL 3MX0A 4OF6A 4H0HB 1LP9A 3W56A 5CSBA 4JG1L 1ZHBB 2AJZB 1YNLH 1VRSA 2K6WA 5DK3A 4XXDA 1MRFL 1TZGL 2Y4SA 5C7XL 3T5WA 2XN0A 1XMEB 1OCOB 3NFPA 4JGMA 4C4KO 1N12A 3LXBA 3SY0B 4K8RL 4NS0A 3H2QA 1JHKH 4F24A 4GYBA 3Q8AA 5DZAA 4I87A 1GCFA 2R0WH 1T1XA 5DMGD 3QXTA 3P11L 4YHML 1GYWA 1XCQA 1MFMA 1ES0B 1I9RH 1OKEA 2YMOA 4R0LC 4I1NB 1AZCA 4J3OH 4JPIA 1RULL 1AKJA 2J1WA 4N0YL 1MN4A 5I1IH 4F9PA 4YSDA 5IG7B 5CAYB 3TOPA 4CVUA 4HBQA 3BMVA 5AB2A 3CN4A 4Y1SA 3L3KA 3E1ZA 1PIFA 2VMDA 3IFLH 4OCYH 5D70L 1XIWD 3ULSB 3D2UA 4GO6B 2E59A 3DMMD 1XGUB 2CM5A 4I2XB 2GABA 4JCLA 1WTLA 4MA1B 3S35H 1M71B 2ZOTA 3BP6B 1M6OB 4U1NB 5FLUA 3TT3H 4I9WD 3FOMB 2P48B 1E5CA 5TE6H 5D71H 2B1AH 5E03A 1O9ZA 4UILL 5BUGA 3OQRA 5I5JA 1NLDH 3EYQD 4PJBF 4AVHA 1O9VA 4Z8FL 1YECL 2GY7B 1ZOXA 3DVNB 3ZT5A 3MJ9A 3PUUA 5EMYA 2WVVA 2NXYC 4Y9BA 3BE1L 2DPKA 5F0LB 4JEGB 5KVDH 1V7NL 2GUOB 2HLFD 5F9AC 3UTSA 1E2VA 1Z1WA 3MJ7A 4U6YA 4N28A 5LQBL 4XBEH 2F1BA 4TNEA 1QI4A 3HCVB 3QEGH 4HEME 1KYOJ 4HH8A 2H32H 4OLXL 1MCSA 3V0FA 4WTZG 4DP1X 2IH3A 2X89A 2XZCL 2NLJB 3MMEA 6FABH 1JJUA 2X42A 3C6SA 4ELKA 2OQJA 4JFHE 1BOGB 4N2BA 4CAGA 4Z7NF 4Q6YA 4PG2C 3SGEH 2QSQA 4JDVB 1H9VA 4WEUD 3MROA 1D5IH 2AITA 4V1DD 2J25A 4GEIA 4OZHE 3EO0A 4B5ZA 4TQHA 3QORC 5AZ2L 3UC0H 4MSWA 1OAJA 3VFPB 2B20A 4F1SA 1TPXB 4LASL 4IRJC 1A64A 2NR6C 1DBML 2J44A 3QWOB 1JBJA 3KS0H 5EZIH 4L29B 3IXAA 1KJVB 3C6LD 4O2FB 1UM6H 2AEQH 1XF3A 3MLZH 3STZB 2X1OA 3ZSTA 1RURH 2FECL 1IGYA 3ARDB 2QEJA 4M6AA 5FDWB 3FRUA 3TO4C 4PB9H 3WUWG 2Y6SD 5FUZL 5G2NA 2Y36H 4LCVA 2ADJA 3GSXA 4KDTC 2Q8AH 3BYYA 4ONHA 3RP1A 1G7QB 2R59A 4JFWA 4UU9B 2BVTA 1JZJA 2JJWA 2R8SH 4PV9A 4TQEH 2HFEA 2XV2A 3RU8H 1JXDA 1N4XH 3D07A 2VXQA 2LU3A 2WKOA 1U2HA 4OF8A 3S34L 4KQ4L 3C8KB 4MLSA 3S5YA 4QXTB 2ZNXA 1E4XH 2Z1KA 4BQCA 3T4YB 1KBGL 3P0YH 2O5ZH 2WN2A 1JWUB 2C3VA 4KXAA 2XWBB 5ITBH 2B7DT 2J7LA 1F86A 4NQCE 4S1SH 1V8HA 4JY5H 4Z7AA 5ISZE 1NJ9A 3KE0A 1RIHL 3IAPA 4JO5A 4Q7DA 5I1DB 2C9PA 3TA3B 1E30A 2QV2A 5HGGS 4WFFD 4ENZA 1MZZA 2Q86A 2AQ3A 5IW1A 1SEBA 2F53E 4FQLL 5C0BB 2XWTA 2WYHA 4GEJA 4MQXC 5D5MF 4NJAL 4KKQA 5IEHB 4P2CG 2WBJA 4CN1A 5E2TH 2WIIB 4YL9A 3F12A 3T3ME 3U2JA 1RUMH 1X4XA 1EBPA 2EXYD 3LPOA 5AVRB 5C0BA 4N0UE 1H8NA 3FU7B 3PJSA 3HPJA 1H5BC 3MRMA 2KL6A 2OPCA 2RCSH 1KELL 3APMA 4HWBH 5DVLA 4ODTH 5EPMB 2X6MA 2O5XL 3UYPB 3MI6A 4OM0H 4WWKA 2ZD0A 3S37H 1HQRB 4PWJA 5DD1H 1MHEB 4FNLH 3K2IA 5C09D 5KVGL 1CUOA 5FGBC 4K9EL 5EU5B 2XG5B 1ND0B 35C8L 3RWJA 5IHZA 5B4MC 4KY1L 2OX5A 5D9SB 4U4IA 2NNXA 6TAAA 3C6SB 3MLXL 1CI3M 4PJFE 5GS3A 4K9EC 1MXGA 1UCTA 4PS3A 3VI3E 3F05A 2DIAA 5GSRB 3K5SA 4XCYA 1XIWB 1D7CA 2KDGA 5DJYB 3WI9A 4HBCH 1CFQB 3LH2H 3KPLB 3NN8B 5ESQA 3FN3A 5GHWH 4A2LA 3CFQA 4AW7A 3KPTA 4KWUA 4AM0B 4HJ0D 3ENEA 3OXSB 4AKOA 1RPUA 2EE6A 2XWJB 4Y4KA 4GKZA 2ZTBA 4NO5A 4O4YH 1JGEA 1EAOA 3CFBB 5D93C 3O6KH 4N20A 5F6HI 4JQIL 3QUYB 3MAWA 1UA6H 4JKPH 4YQXH 3TJEH 3KLSA 5EUKA 1QZNA 2B0SH 3K91A 4JUSA 4V33A 5T5FH 2W81C 1AIFA 4BH7A 4IKIA 1QD0A 3UDWA 1A22B 1K72A 5L4IA 4AQ1A 3RHWK 2GHZA 4MDIA 4A1RA 3RB5A 5D1ZD 4C54A 1ZCRA 1QFUL 2EUVA 3L3KB 1UG9A 3GKZA 2P8LB 4JL1A 1DVFB 3QIUB 3TIEB 3U7WH 3CCHA 4P06A 2FT8A 4LSUL 4AQ8C 3I6LE 3NFNA 4LP5A 4NN6B 5C07B 4GAYB 4FRWA 4LKCA 5JW4R 1BLNB 3IF1B 5M94B 2H8PA 1AXIB 2W07A 5J11C 3F7YA 4XCNB 1TZHA 3P77A 4JFXB 4E9YA 4K94H 5LWYH 3NCJH 3BUPA 3PIQA 4MNQB 5HYJE 2GTWA 4QRAA 4ANXA 5TH2B 3BVNB 5DJDB 4JZOA 3WN5A 4NP4L 4X4YA 1J9CT 4A2EA 4LVHB 1BMWA 1JGLL 3IU3B 4R90L 1EUTA 1DE4A 3K81A 2NTFA 1EDYA 1MEXL 1KTKE 4KUCD 5L7XH 3L54A 5FB8A 4KZDH 1FFRA 2VLJB 1ZD6A 3FO2B 1A6TB 1E40A 4M8VA 1ZIBA 5C0CD 1L7IL 1ZDQA 3GZKA 4S1SL 4XCEB 1P7HL 2AEPH 2EADA 3BP5B 2JIXB 1PW3A 4JCWA 1HH9A 3BDYH 1EX0A 3MFFB 4R4BB 4CSTA 1U8PA 3IMWA 5ANHA 1FRGH 4S0TD 1TIUA 2V9TA 3ISRA 1KIRB 2PW1B 1MFCH 2UUDK 2G2RB 3PP4H 4N2EA 3I9GH 3EFFA 4MASA 4MB4A 4YUEH 3FQWB 4HKJB 3DWTA 4QI3A 3P4NB 1QTPA 1KYDA 4F27A 2H9GA 3RILA 1G5AA 2MCG1 4EI5D 1JPGA 5EO1B 3VSQA 5A6IA 2DM7A 2LU4A 4JR9H 2VLJD 3KPRE 2GSGA 2VITA 4GG6F 1FFPB 5FA3A 1FL3B 2BSEA 1CLCA 1INDH 5TJWK 4AL8L 4N2NA 2BY0A 3HAEA 2KPWA 5FGRA 1USQA 1QPPA 1T66D 3CSYB 3RI5F 4BFGA 2WP3T 3ZQXA 1XEDA 2O6DA 2VB5A 3ZYOA 4ADIA 5KYXA 1MFBL 2MNWA 4G6JL 1MG2C 4X50A 2F15A 3BT2L 3TNMA 1HC1A 4X4XA 4O58L 5I1GL 4M9OA 4NQEA 4QLRA 4WKZA 1I4FB 1RUML 5CU5A 3VQMA 4PRPD 1J9RA 3T2NH 1KG0B 1IGCH 1I1AA 3UTTA 2FQFA 4V2CB 1BVLA 1YLBB 1A4CA 1UXWA 1IGJA 3HHMA 5BOJA 5F6HJ 3C5ZD 1CC3A 3GKWL 4OI8A 1OE1A 3CDCA 2DW5A 2XETA 2OSLA 3TZVC 5FR3A 4MXQC 4GKSB 3L7FB 3U9PH 4ZNEA 5B3SB 1FNSL 4G7VH 4NGHH 3CXFA 2OXHB 1IARB 1WWAX 4LIQL 2I07B 2X6VA 3FT3A 3QDJA 2BMKB 4GSQA 4X42A 3O6FB 3TBTA 4P23D 4G3YH 3AU0A 4HAGA 2BXZA 1H15A 2XPYA 43C9B 2JQMA 4YS4A 5DZNA 1TCMA 5KSVA 1DE4B 1F3RB 1INEH 1YPZB 1XH0A 2XRAH 4L3CB 2EXTA 3FH8A 3IRZA 3ILPB 4M6OL 4HJ1A 3JTBA 1BZ8A 2HJLA 3NZHL 4J6RL 3WKMH 5IHHA 4PV8A 2PO6C 2ZOWA 5F1IB 2KPNA 4R2GB 1VFBA 2ZYIA 2MCAA 4WFHE 4WNJA 3MRHB 2EKJA 5DMKB 3BSHA 4LE8A 3TF7C 3NEOA 3SYQA 3TJEL 4PYGA 4HV8A 2EDEA 4X6CA 3GK8H 5CILH 4LSVH 2JB6A 4K7FA 2GFBA 3AY4C 4XT1C 1QHQA 2DQFA 4H40A 4PSRA 5IM7B 1G6RH 4WWPA 1IUZA 1UD3A 4MQ7A 2A83A 3V5KA 5IESH 3AMLA 4S1QL 4D9LL 1FYTD 3OAYH 2AJVH 2QMJA 5C08B 1QSFD 5K93A 4W6WB 4X4MA 3N44F 3II1A 1YMHB 3TYFB 5F7WC 4D8PB 4UAOB 3EF7A 2YWYA 4B53A 5JW4Q 2QVIA 2AEPL 4CSSA 4AGQA 3MRIA 5A1AA 4I1RA 1CFVL 5F1OB 4IIQA 4WUUD 2B1AL 3T0ED 1OQOA 1KOAA 4TVPH 1A6AA 4YDLC 3HPLA 3BWUF 4IRJB 5C09B 3SCMB 1YC7A 4P46D 4BGLA 3PWVB 2AQTA 3L3OC 2F54E 3IRCA 3E6FA 4DN3H 2HFFA 3DGCR 1RUQH 4MAUL 3G04A 5J0BA 1ED3B 5ID1A 4UNIA 2ADGA 1K6QH 1LO0H 1TZ8A 2YEVB 4GSUA 3UO1L 3ARSA 2JMRA 3RWCA 2AV1B 2VH5L 1LL1A 2IH1A 2ZAIA 4YN3A 4K0OA 1XZWA 5DLML 1CLZH 1WIUA 4PJAA 1BEYL 1IC7H 5C0RH 5BW7C 5KSBA 2OJZL 3ZOAA 1KBPA 4KFZC 1W72B 4CVZA 4LVNC 2ZX7A 4CN6A 4LCWB 4AXWB 5E9DD 1UD2A 4IKJA 1E5ZA 1SF3A 3QI9B 1NL0L 3IN2A 4NB7A 1E90A 2XNAB 2V3EA 3B7YA 2OV0A 3KLQA 1E4XI 3NTCH 2VISA 5D1ZA 1K85A 3I3DA 2KZ1B 3HHSA 2DWXA 3MUUA 2R1XA 5DC9B 1R4XA 3BKYH 1X5AA 4XNUL 5AL8A 5J13B 3LXUX 5CGTA 4H8WH 4JRXE 1U3HA 1KTRL 2VLJE 1WHPA 2WV3A 4NUGL 1LEIB 5LDUA 3H7BB 1GHFH 5FO8B 2WCGA 3U0TA 3V6OA 3AACA 5F88B 4ZO9A 2JJSC 1CXLA 2CDEB 5E1GA 1C7SA 5FGCB 2W1NA 3BQUC 2I9LB 2KS0A 3X2QB 1IIIA 2ZSVA 4P48A 3VGHA 3H0TA 3CDFA 1F13A 2V3DA 5E9NA 2IDTA 3UJIH 4U1GB 3EO1A 4WK2B 1MRCL 3BISA 3EUDA 4OLYL 3SBQA 3VFRB 4LOUC 1DTUA 5CGBA 1D9KC 2JK5A 4ZNCD 1YN6B 4UIKH 4X7DC 2I9TB 1NPJA 1BF2A 2WLIA 5TQ2L 1EEYB 3DXAE 5MEPA 2JTDA 4JFVA 3N5AA 4RGNB 5TDOB 3RVTD 3WTSA 1DBKH 2YK1L 4JFOB 2HTKD 1ZK9A 3TNMB 5JIPA 4ZS7L 4P3CL 4G8GE 5AL0A 1BJ8A 4L8SA 1K3IA 1RZJL 4NBZB 5IJBC 4JFZL 1MCJA 4PU2A 1KXVC 5H2BB 3CBJB 1ZGLA 4G9FB 2LR4A 4R7NA 2VDML 2QGEA 3BLPX 3VXUA 3VDAA 3GM0A 4IMLB 4NC1E 1A7RL 1KB9K 4EUPA 5I73B 4WUUA 1PS3A 5L6YH 4PWKA 5I66A 5ILTL 2X4PB 5HP5A 1UH2A 2LGNA 4Y2OB 4DKDC 2RTTA 1PZ2A 2J1KA 1NCBH 1CICD 3V0JA 2BCMA 2DI7A 4DETA 1D9KD 5D1QD 2VDLH 4AE0A 2X87A 1OP5K 5JPNB 2FQEA 3HE6D 3NQIA 2BERA 5CZVH 3SD5A 4DQOH 1FYTA 1JPFB 4YWGL 4DZBB 3H4FA 4XH2A 2R2EA 2Z3FA 4IS6B 1SHSA 1T0NB 4OD1H 4U1GC 3SDCB 4NFDA 1AOHA 5J6GB 3TTSA 1N9PA 2NY5H 4LEOA 4NUGH 1H8SA 3HR5B 3ZHNA 1FORH 2JIXA 1IE5A 4LKXA 1TTRA 1VZGA 4Y88A 3IWVA 4FNQA 3QA3B 4JDZA 4K7PL 4NLHA 1T1WA 1XF5B 2NX5E 2GQHA 4KOCA 5ALCH 1OGPA 5FFOA 1KNOB 1MWAL 4PJDA 4U1HA 2IOMA 5B39B 3QXVA 1KPUB 3PQYA 3S8WA 1QZ1A 4JM2F 2Z91B 4G43A 4KROB 1F3DH 1FDLH 4LLDB 1BJ1H 3KPSD 4YC2B 5G5DB 5EIVA 5LGYA 2V7NA 3QQDA 3VE0B 2XC8A 1J48A 4X83A 4X9FA 3ZT6A 4HWEH 1F8TL 4BFRA 4JO4H 3B83A 2NY7H 3EZ8A 3K6FA 5F96L 4PB9L 4QRRE 3RFZC 4G6MH 1T21A 5LBGA 5MENE 3MZTA 3SO5A 5HVHC 4R2GD 2OSWA 1FVCB 5DD1L 4KITB 3BSZA 1OGTA 1JZFA 1NFKA 5AW0B 5L2KA 3GMNB 4OLVH 3UTPE 2JI2A 5ERWA 3OKEB 3KDMB 4W9EC 5DEFB 5HYQA 1YJDC 2P26A 1WVZA 1DJWA 1CO1A 3T6VA 2RD0A 2YPLB 3N40F 5ISZB 3ELQA 4JO3H 1KBVA 1MOEA 4LSVL 3UAJC 1Y6KR 1J0IA 4DGVH 5L88L 3SE9H 1GGYA 4U6TA 1L0QA 5EEUA 5GGRB 2BNRD 2DQGL 4U3HA 1R1CA 3P0VH 1HKLL 5B1JA 4D9QD 3ZE1F 5JPMA 3OGOE 2MKWA 4ZQKA 4ZMLA 3ZLQC 3WFBL 4XWOC 1FO0B 4NNXA 2WANA 4DP0X 3NFSL 3R06B 4Y2OA 5DS8B 2XN2A 4GNKB 5HGDB 3UJJL 1MIEH 1T4KB 4J12A 4MB5A 3EDKA 3C5ZB 4F2MA 1A9EA 3OZ9H 4X98A 5DC4B 2CNZA 4IIZA 5GRJL 4KK8C 3MBXL 1CFVH 4KRPD 5TDNA 5TTRA 3LRHA 1V7ML 5LGKA 3O3EB 3WXVH 1W0VA 4N0UA 3CH1A 5T3ZH 4IOIB 4FZ8L 4ODSH 4KKAD 3GXTA 3QQ9C 1MJJB 5CF3A 4YE4H 1AHWC 2FJSA 5HJBA 3LZLA 1A1OB 5HGAB 2XIIA 3NCFB 2EEDA 2FEDD 1ND0A 3O6ML 1Q0XH 4NCC1 2DS4A 4RGOL 1XF2A 1NMCB 5HDOA 2WXGA 4FEMA 1G87A 1MFAH 3RPBA 1WTGT 1EJFA 2GIXA 5JXED 5H37A 4PJIB 3WMSA 4IRZH 1ODAA 3UYPA 4Z7UE 1U8JB 3GMLB 1RQ5A 3MOBH 4CVXB 2YPKB 4PJCE 4QYAA 5KYNA 2OFQA 3GXFA 3QPXH 4FP8H 4HIIA 4JAMA 3VJ6A 3FONA 3PJSB 1W0YT 2XKSA 1SVCP 1HSBB 3IJ8A 3SCMD 2MHAA 4NZUL 3ARDC 1ZV5A 5EB9A 3GSOB 2Y2YA 3P4MA 1HXYA 2Q5BA 4F3FB 1NDTA 1AKJD 2RJMA 3DTUB 3DGGA 3GSNB 1MJUH 3S5ZA 3VG0L 3REWB 4ZMAT 1BBDH 1MQKL 1ORSA 2DL9A 4KZCA 5EORH 5MERB 2JJTA 1CFNB 4NDMB 1UFUA 5CEZH 3CLFH 1IEHA 4OCXH 5GGTH 5HGHB 5IKCA 2RIKA 3PS6A 5MEPB 1D7BA 5C08D 5FKPB 1P5UB 1NFAA 1F97A 3HTLX 5E8NB 5I1AA 5FKAB 4KMTL 2VUOA 4GH7B 3WTWA 5F7MC 5IROA 2Y07H 3UZQB 2IAMB 4LLQA 3OMZA 3X14A 4LT7A 3TCXA 1W8EA 2DMKA 2X3AA 3KWVA 5HHOD 1WD8A 4JRWA 4AIEA 2CMRH 1DO5A 3AB0B 4L4TD 4AJ0A 3P3UA 2ZSWA 1MCCA 4AT6A 3L4CA 4I18C 1IGCL 3D5OF 4WSKA 3EJSA 2K7QA 1G9EA 4AIZA 5HPMB 3SGEI 1PD1A 4MMXB 5HDLA 3BCFA 3W0WB 4WWID 1FBIH 4TQPA 2VMCA 3UYRH 4AG4H 4W70A 4NO0A 5T1KB 4E2OA 3IF1A 1WK0A 3B3IB 1DLHB 4N2IA 5ITFA 4RISL 2FX8H 4C47A 2N1TE 2HVKA 5GGUB 2OP4H 1HE8A 4JN1H 4LCWE 4M7LL 1FFNB 4JE4B 3SYOA 1R3LA 1BFVH 1GC1C 3SDXB 5CD5C 5IMMA 1N6QL 2ZOLA 4LDLB 1MHCA 2BSTB 1CLOH 2IFGA 3VXSE 4U6HA 4A2MA 3PDOA 2EIBA 4PRIB 5DUPH 5IVZB 1MHHA 1J9TA 2SODB 3PQYE 1IEAB 3LKNA 5SWSE 4XN4A 3WELA 2OJ1A 1DQJB 1XGZA 1JGEB 1ZV9A 3ILEA 3FSOA 4LQ1A 4WWKD 3RURA 1HH6B 1ZLSL 2A9DA 4NQXB 3EOTH 3MV01 2WPGA 5CEXA 4S2SA 4D0BA 4JKLA 1WE5A 2BIMA 4EN3C 2C3HA 3SDXF 1JGIA 1O7VA 4HUVB 3FO9B 4H7VA 1UZ6F 3PHOA 1HXMA 4X9HA 3FH5A 5IEKB 3RL2B 5KN5B 2WXOA 4B50A 2G3MA 3I85A 3F7RA 1AE6L 2MQGA 4FI8A 2B77A 4R3SB 4QJ5B 5GS2D 3BPOB 4V1DA 4QRRB 3QCTH 4NC1C 4YE0A 4OCXL 3T8XB 3LKNB 3DURB 4NKMA 3QEGL 5E1QA 2V9UA 1J8RA 5EA0H 1P5VA 2N3JA 2RCSL 4JL2A 3P4OB 4HUWB 4GG6A 3GSWA 1OSZB 4ZJ9A 3SBPA 2VLRA 3U83A 1G7JA 4KVNH 3REVB 3ABGA 4IJ3B 4TVSa 1FUNA 5KYUA 1UXWB 5C0NC 4Q89A 3VXUE 3Q8FA 5JUEL 5ENWB 2H7WA 4JRYA 5D2NC 2AJ3B 4Y8AA 1H6FA 3QIBD 4HUMB 5GRUH 4PJGE 2I26N 2VMEA 4JB9H 4L4TA 1RZGA 1X5KA 4GQQA 5IJDC 1YC8A 2Y6SC 3K6DA 4NRYB 2IV8A 4AUYA 2NX5A 3B2DC 3UERA 4AYBA 4OQTL 1XFPA 5TDPA 3T0BA 2X2HA 1QR4A 2F18A 4ZT1A 3ARTA 1KPRB 1P1ZA 3FUIA 4GRMB 4X7SH 5E6UB 2WXMA 5PCYA 4WHDA 3VGDA 4D3CH 1KTLB 1RIHH 1M1SA 1BYOA 2WQVA 2J8UB 2X2UA 3P0VL 3V4UH 2R9HD 1D5XA 1DUYB 2WNWA 4LMQE 3JWDH 2OMZB 3BPLB 1BQHG 2GBAA 4IK7A 4MQXD 4TSBH 5DZVA 3VFMA 3GB7A 3NK3A 2GCYB 1P4BL 4G80B 5KYWA 3B2PA 3V6OE 1SLXA 1DQKA 1JOIA 2WHVA 5MEOB 2IBZX 2EVHA 3M07A 1ZKAA 4EMZA 3R0NA 3MLWH 3MX0B 4QTHA 4Y89A 2AJVL 2G3XA 1ULVA 3DYOA 4N1CA 4RFOH 3ILDA 5EU7C 3U6XS 1KEMH 4NZDA 1RZKH 2W95A 2FZ3B 4KHTH 1ID2A 2UY7A 3GTVA 3SKJH 3FCTA 4L18A 1AE6H 1ZVSB 1N2RB 1N68A 1C5DB 3PPEA 2BRRL 3WN5C 4BSWB 3H2PA 3F6JA 5EU4A 4Y1AB 3O3BB 3VDBA 2FLBT 1T4KA 2HT3D 1SN0A 4F2MB 1BAFL 1ORSB 4DN4L 5MERA 4XWGH 1MIMH 2DWEA 4R4ND 3TF4A 1VKXA 1PZSA 1AY1H 1E6OL 3D0LB 4PN6A 3KPRA 1NCNA 1RLBA 5DVKA 1A6WL 1M05A 4NAJA 2PTVA 1F41A 3FQ1A 3NIFE 3GSOA 4FFWC 1JK9B 3ABMB 5A3IC 2CO1A 4L4JA 4NUMA 2Q0ZX 2XVKA 3ARFA 4WTQA 4ZUUA 2NZ1A 3AQDA 1HHIB 3TPUA 4A7GA 2BNQD 1M2VA 4ODXA 2XN9A 2GTWB 2X6AA 3H7LA 3RY6C 5E8PA 1TZOA 1RU9L 4FHBD 3LIZL 4M02A 3OKMA 1OK8A 4Y1AA 1AJ7H 5E5RB 4ALAC 2HN7B 4DK3A 5A40E 5D1QC 5C07A 3MOAH 1QP1A 4GQRA 1UFGA 4I0PC 1ANUA 1CDUA 2AKRB 2BZDA 3P73A 3QCUL 4JFSA 4OM0L 3TEXA 4BA8A 5C0ND 1TDQA 3JTTA 3EG9B 4HCRL 4UB0L 4XMLL 1KLFB 4I85A 4L4VA 3HAEH 4NP4H 2NW3B 4FHJA 4H88H 1U3HD 1E9QA 2AABH 1MHPH 3DURA 2VO5A 4XCEA 4YZWA 3X1NA 1UCBH 3JWNG 4KUZL 3OB0K 5K1JA 5M95B 3LZOA 4BZ2L 2JKXA 3MRFA 4IQHA 2B9AA 5TGBA 3RVVC 2DJSA 2CO7A 2VR3A 3IDJA 3KCWA 1MY7A 4LB8A 2YAEA 5IVXB 3MTXA 3SJVD 1OSPL 4KNTA 5E2UH 1FAKT 3LKOB 5FYJD 4PLKD 2BVEA 4UYQA 4XN2A 3FPYA 4HHAB 4OF0A 4LLWA 5DFWH 2VL4A 3FUJA 2D31A 4NNPH 3LS5L 4GRWB 1VZIA 3Q7JA 3TCLB 3DRTA 5LUMA 3D3VA 3UBFA 3FU9A 1FVDA 4F7EB 3K74B 2E9WA 1B6UA 1M7DB 1NAML 2DQEH 2VN3A 3DBXA 4G7SB 4YHPB 3W57A 4DKAA 2GK2A 2DDQH 4Q9RL 2V6HA 5DVPA 4X6DA 5FGCE 2G2NA 3M46A 4I1PA 2WC7A 3F7YB 1X5GA 1OE3A 4P5RA 4TRPH 3WYRA 3VH8G 2GBTA 2VJXA 5J1TC 1L3WA 1LQBC 4GW5A 5IBLC 3ECBB 2BK8A 4BFEA 3D48R 3MCKB 3GT6A 5DS2A 3M45A 4L1SA 4UQIM 3ZJAA 3VG9B 3ZUCA 1TTBA 4JZJB 3GTNA 2DIJA 5LBVA 3DX0A 4MJ5A 4R26H 3AGWA 4CC4C 4PJ9A 3MRJA 5ALBL 1Q9OB 5DD3L 3TIDA 3T09A 5DD5H 1F4XH 1TZAA 3LKPB 4LRIC 4OIIL 5AEAA 4HUVA 1FGVL 3GM8A 4GFXA 1PQZA 4XO4A 1YHPA 4MA7L 1FZMB 4JFOA 3BRFA 1I7ZB 4OBRA 3DSNA 4LSRH 2IBBA 3MJ8B 1JZ6A 1SF5A 4EIBA 5D8JH 3OLIA 1I1FB 5C9KA 3LZQA 4AC4A 2X6BA 4QXGH 2WKLA 5IW1B 4MAYC 1IC5H 1EHLH 5ESQB 1EEZB 4WW2B 4HPHA 5G4NA 1W9XA 2R1WB 4XP4L 1KCKA 4PAZA 4WY7L 2UYLA 2R7EA 3HNVH 4ADJA 5DT1H 3DSFH 4BFKA 4EVNA 3T4AC 5F8RC 5DJXA 2DLFL 4JHAH 4XGZB 3PWPE 2FQGA 5DRWB 3PAYA 4XVTL 2X5PA 2OX5B 3DX8A 3FB7A 2W9DL 1PL3A 32C2A 3PAVA 5K33A 3ARGB 2P43B 4HKXB 4YXKH 3NACH 1KN4H 2Q76B 3QRBA 2BP5M 2HG5A 5A2KH 2BJMH 4HIEB 4JMNA 2E6QA 5F96H 1ADQA 2EAEA 2GJZA 4TL5A 4JFFA 5KG9B 3LRLA 5F7DB 5F7UA 1JRHL 1E67A 1G7PA 2VSMB 4GSXA 5EEZA 1NDMB 2Q3AA 3WV0A 3HJ0A 4ZUTB 3THMH 3A6CL 4J3BA 4CDGC 3CVHH 3UBXG 2EH8H 4KJQC 1UWXK 3CFIC 1F1AA 1TTAA 5JZ7D 4LRNH 3O3DA 1XL6A 5FDWA 3QEHA 3TYGH 3ULVD 2GJ6B 1SXZA 1FDLL 1SOXA 1LWHA 2QZQA 1DZ0A 1IM3A 3NCEB 4O2FA 4ZZFA 1MCFA 3HC3L 3SGKC 2BVUA 2V9QA 3UTTD 1UM4H 1NJ9B 4XPFH 2XY2A 4FFYH 4PRPA 3B5GA 3LRMA 2DQEL 4WQOA 2LLGA 2O5YL 3FRPB 3ARFB 4AMWA 2L4OA 1N26A 3HC4H 5K59E 3SGKA 4TTDD 4R0LA 3Q2WA 2BHFA 3FCUB 5DQ9A 4JPQA 1A6ZA 2QVKA 4P2QE 3BD3A 5AOZA 3G5VB 1DJSA 5LG1A 3RZCD 1JNNL 1N5AA 3HNTH 4WNSA 3VGAB 2J21A 1A1NB 2WMPA 4NO2B 2Z7UA 2XZAH 3DX9A 2CE6A 4CL7A 2E7MA 5D93B 3UCRA 4BK5C 2VT0A 1LEGA 3BAWA 2ZNWA 4XX5A 1XAUA 5EU6B 4XP1H 1G9NL 1ZLVH 1ZHLA 2A0LC 4PV9B 3BAIA 2DRUA 5FWRA 1DQDH 1XGTA 2PO6D 3NIDB 4YIQB 1PZCA 1P6AB 5E56A 5FGSA 5HHXH 2C4FU 5FM4A 3PDDA 3RUGF 4EUPG 5HSFA 5I18H 1HAWA 2KT6A 3DRTB 4PR5B 3FONB 4DO5A 1NSNH 4Y7OC 5HTSA 4APQB 3UTQA 2ROYA 3NCBB 2YPLA 1MIEL 1KV3A 2QFPA 5CIPB 3TESA 3HS9A 1MLCA 5ICYB 3VFMB 4OCLC 3COOA 3EGSA 2D7PA 4LRNL 3ZZLA 2BHZA 3VB8A 3OKOA 5AZEH 4OGAC 2GJ6D 1FIEA 3OX8B 1JUFB 3SPCA 3FTUA 4F57H 4KQ3H 2QPSA 4HVBA 4N2LA 1BSIA 1EJ6A 2WZ0A 5C0EA 5D7IA 3LOWA 1UT2A 3TCTA 3B43A 2X0VA 4B7IA 2A7BA 5CJBA 3AJ7A 5J1AA 4ES9A 5EC2B 2ITCB 4KDTA 4KRLB 2XTSA 3T3PE 3UABA 1P2CA 1P4IL 1A6PA 2OSYA 4NCDA 5J9PA 4G11A 4L4VE 1UM5H 1IKOP 1ZA6A 2H6UA 1TZIA 5IK3B 2HN7A 3L81A 1GGTA 3B37A 2LLLA 2AQPA 3WS6C 3S88H 4PJHE 2XA3A 2LU7A 1NGXA 4GAJH 1OE2A 3AQXA 2GG1A 1CE6A 3PABB 4G9DB 2W8CA 3S4SB 3MA9H 1BXXA 4Y4HD 1AXSB 4UT9L 4NSKB 1GY1A 1DQLL 5DGRA 1OM3H 3V0HA 5GJTL 5A43C 3KEDA 3TV3L 5K9KA 4JQIA 1KB5A 3H4HA 1AZZC 1Q0YL 4KZEL 3ZR5A 3CFEB 2WLLA 2FJGA 3QDJD 4LSPH 3G9AB 4MXVE 4NOFA 2A4CA 2P8PB 5L2KB 3ARED 4TQ8A 4DVRH 1XBDA 1XGUA 2DMGA 5K1VA 4IBQA 3ZL4L 1Q38A 4GINA 3D6GA 4YSQA 3S96A 2EXWD 4A7VA 3U9WA 4FFWD 5BQ7B 1J8HD 1VLXA 1I3VA 2COVD 3VCLA 2KQNA 1NOFA 1MUJB 1ZWIA 2CGZA 3CFUA 1NL0H 1H15B 2AK4E 4X6FB 2I60L 5C0DA 43C9A 1HOCB 4JB9L 3BKMH 2HJKA 1BQKA 3IJSB 2YK1H 5D7LE 2Z0BA 2WQ8A 3QWNA 4FHKA 3FFCB 3RA7H 2FQDA 4MWFA 4OCRH 2VDRH 3PL6C 4M5TA 3V5HB 3DO3A 1OAQL 1FH5L 2PF6A 5F3HB 2WLIB 5EHFA 2NR6D 2IF7A 2PN5A 2YUXA 3C08H 5JOFB 2CJUH 3RVTC 4BZ1L 2WB7A 1ZHBA 5E4OA 3BP5A 3O4OB 5AVQB 2V5TA 1UGKA 4I3RH 5MP6H 4CDHA 4F7KA 2A1WH 4X80L 4ODHL 2DYPA 2KERA 2QKIC 3US1A 1QABA 3CFJB 1RJZA 5GPRA 4LPUA 1QW8A 4AGOA 1XH3A 4YDVB 1V5JA 3TN0C 4ATTA 1E5AA 2PP7A 3MCYA 3H85A 1ZLEA 4KVPA 3VX0A 4YLBA 2EIZB 4HS8H 4Y4FA 3NA9L 4O2CA 4H26B 3AG2B 1RZKL 2CPUA 3PWLB 2CU9A 4NEHB 1BZQK 1OT4A 5AVZB 4APXA 5E00B 3FO0H 5INCA 3HB3C 2J20A 1A7PL 3ATBA 4X8JA 3SE4A 4LBEB 3QBTB 3V8CA 3PNRB 5EO0A 1U3HB 4M6ML 2RQEA 4Y2DB 3FB6B 4LCIH 3BFOA 4O5LH 4ZO8A 4IU2A 4CU7A 5D7HA 3S8FB 2Q6WB 3ARBD 3IXTB 1AS6A 1QBLH 1RZJC 4OD2B 5D1ZB 3ZE1B 5HDBF 4XB8A 2NUPA 3EOAB 1LE9A 2H3XC 5HYEA 2A99A 4NIYE 4P57A 5BO1H 3B1UA 1ETJA 4J1UB 5MENA 4B9GA 4H0IA 1MRDL 2VSKB 3GJFA 4UIMB 5B38A 3WLBB 5DQ9B 2EE3A 2SEBA 3GHBL 4JG5A 2PETA 1RHHB 4XN1A 2WQSA 4ZFOL 4HPOH 1HNGA 3D0VA 5FYKE 3BVTA 2AAAA 4YDKH 5D7JD 4NQUA 1M1XA 3ALPA 5KSBB 1A2YA 1OAQH 5I71B 3VVVA 5DUML 5H4YA 5EF1A 4XWGL 2IV9A 3P9LA 1XCTB 1FV1A 2QADC 2ZUWA 3FZUC 3EHBB 3G5YA 4LSSH 4M43L 4WGVB 4DK5A 3L5JA 1TU2B 3O9WA 5FYJH 1CFQA 3NN8A 1Z5YD 3O2DA 4FERA 1JXJA 3E80A 5H37H 3QYNA 1QNIA 4H88L 4RFEA 1DSWA 4HWZB 2IANE 3NT0A 4IJTA 4CILA 5GS1B 4M3KB 4ZFOB 1LE9B 1M7IA 4H2AA 1V3MA 1IBGL 2H3KA 4MAYD 4P4KB 4P99A 3FT2A 1WISA 4WU5B 3SDAB 4JX0A 2LE9A 5JNYA 1UACH 5AVSB 5I18L 2J8UF 3LIZH 5D6DA 3GMPB 2LT9A 4AC2A 3MNZA 1OANA 1UB5B 4GUPB 3WIHH 1QSEA 1HQRA 3P2BA 2E9GA 2V9RA 4HUNB 4WO4A 2V8MA 3AREA 2KZWA 2HX8A 1VPOH 4IBWA 1BJ1J 1E3XA 4MMXA 4EE2A 2FIKA 3OKLB 3ZKND 5D7KD 2HZHA 5LBSA 2EXSA 5CSGA 3JSSA 5AW3B 1E4KA 1AR1D 2BOCB 1INEL 1USZA 4KKBC 3TVMD 2YXMA 3B7TA 3DHJA