3WTYA

Crystal structure of the complex comprised of ets1(g333p), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
118
structure length
118
Chain Sequence
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 17
structure length 118
sequence length 118
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtyA00
3D07A 3D09A 3Q06A 2X0VA 1LJMA 2AHIA 5AOLA 2J6WA 1HU8A 2J1XA 5A7BA 3VD2A 1T4WA 4IBZA 2ADYA 3US0A 2P52A 3KMDA 1CO1A 3Q05A 3IGKA 2J21A 3WTYA 5AOMA 5LGYA 5AOIA 4GUOA 3US1A 2IOIA 4KVPA 3WTTA 3KZ8A 4LOFA 2PCXA 4IBUA 2WGXA 2AC0A 2GEQA 4IJTA 5ABAA 2X0WA 3ZMEA 2BINA 4HJEA 4L0YA 2J1WA 1KZYA 3Q01A 5BUAA 1TSRA 5LAPA 3EXLA 4MZRA 5AOJA 2XWRA 2J1YA 2BIQA 2J20A 3WTWA 2ATAA 3WTUA 2OCJA 2YBGA 4L18A 3WTSA 3QYMA 1HJCA 2X0UA 3IGLA 2BIMA 2J1ZA 4QO1B 2FEJA 4AGOA 1H9DA 2XWCA 4IBTA 4IBVA 4AGPA 3EXJA 4G83A 5AB9A 3D0AA 3TS8A 3WTVA 5G4OA 2IOOA 4LOEA 2H1LM 1EANA 4AGNA 4L0ZA 1EAOA 3VD0A 4A63A 4AGLA 4G82A 1GZHC 4MZIA 1UOLA 4IBYA 4IBSA 2VUKA 2RMNA 3D06A 4AGQA 2BIPA 1E50A 4IBWA 4GUQA 5G4NA 1EAQA 3VD1A 1IO4C 3WU1A 4IBQA 3QYNA 3WTXA 4AGMA 2MEJB 5AOKA 1TUPA 4XR8C 5G4MA 1CMOA 5ECGA 2BIOA 3D08A 1HJBC 1GZHA 2IOMA 4LO9A 5KBDA 1YCSA 3D05A
chains in the Genus database with same CATH superfamily
5E23A 1PL3A 4E9TA 4OCWH 4PJ8A 3ARZA 5IHUH 2V17H 3CFKB 1DQLL 3DROB 4UIKH 1MNNA 2OSLA 2D2OA 2Y2TA 4L29B 3TO4C 4QRUB 2F15A 3RUGF 4QHKI 3HZYA 1MCJA 1QFUH 4GLRI 2OMVA 4QWWC 3MRPB 2SEBA 3MRNB 4NBXB 4N0CD 4EZLA 2W91A 1QWUA 2CR3A 1MWAL 1MFAH 3B9AA 3B37A 3RP1A 4ZFOL 3IGFA 3O6MH 5JPNB 2IGLA 1TU2B 2KDGA 3L08A 3PQYD 3TASA 3S37H 4YHZL 4NQEE 5TE7L 3MLRL 1Y0LB 2CIIA 4RAVB 5AAPA 5EEWA 2YAPA 4XPAH 4JQXC 3DRQA 3LXUX 5DD0L 4WI3A 1OY3B 1CGYA 1HXMA 1A7NH 4FG0A 3BUBA 4H0GA 4H1LH 1MHEB 3QIBA 4JMXA 4RDBA 3GSOA 4FE9A 1LO2H 1WHPA 2C34A 3K72A 5EN2B 2AZAA 4V1DD 1L9OA 4C4KT 3DDFA 3IB4A 1SYSB 4CC0A 2X4OA 5E8NA 5J56B 5GISL 3QDAA 4JVPA 1LQBC 2WJ5A 2QV4A 3RA7L 3PV6A 1CFTA 1MCFA 2OSYA 1FFOA 2HKFL 3OHXB 3QEHA 4GBXA 2B5IC 2GJ6A 1FCGA 2KLTA 5CJ8A 5F7LB 3SD2A 3X17A 3ZQXA 4DP6X 1X5HA 3REVB 5IFHL 5DURD 3J27A 2H1LM 4Z95L 3BZ4B 5FYLL 3VD0A 1M1XA 5EFIA 2VQTA 4RX4D 5HI5D 3SOBL 2G5BB 5HHPA 1OVZA 2X9XA 4NKDA 4MSWA 2VCOA 3MX0B 3PWPA 4WI8A 1G94A 3S2AA 3RFZA 4N20A 3PWVA 4RAHA 4FHKA 3SCMA 1AQ8A 4B9KC 4N90D 4GUQA 4HH8A 3BESR 3FUIA 2BNQA 3UADA 1NM9A 3TBVB 2VLKE 1BXVA 4OJFH 3WNMA 4ES8A 1INQA 1OLLA 4HUXA 5KS9A 4NO3B 1DJHA 3VI3B 1IJ9A 5AKTA 3WDIA 4WCYL 3AUVA 1N67A 4V2BA 4R8WH 4XO4A 4LCUB 4Q6YA 3MMEB 4MJJA 2OZ4A 2C9RA 4KXDA 1T20A 2Z4QA 5DFWH 2H3KA 3GPEA 1JZ8A 4QYAA 3RZCA 5HYEA 5DHVA 3HLKA 4OZ4B 2PETA 2R29A 2JB6A 1GA2A 4ZFZB 2Z7WA 3QH3A 4KROB 4MXQD 1YQVL 3BN9C 4EIZC 2Y1VA 3MRDA 2Q76B 5D7IB 1FGVH 1IV8A 1SJEA 3CZFB 2YS4A 4GH7B 5JOFB 2CO7A 1HQRB 3CFBB 1JYVA 1OAQH 1PW3A 2ZOKB 3KCWA 4I3SL 1CE1H 3N0PB 4PJ7A 4PLKD 2YAOA 3JTSA 3OV6A 4E5XA 5BOZG 5I15H 4PMFA 1A6UL 1BEXA 1D6EB 3HG3A 4OD3L 4YHML 3GRWA 2PWEA 3EJUA 4ZFGL 1V05A 4AEIL 2FUTA 1FL6A 3G5VA 4QHNA 1MW0A 1S7RB 1SY6A 4A6YA 1FL5A 1LO4H 4YBLC 1BCIA 1CLZH 3OJDB 1EH9A 4NLHA 2BERA 3L48A 4GAYA 5JHLL 2BSRA 5FYJE 2MKWA 3TO4A 4OZFG 1D2OA 1HEJC 3TF7C 1F5WA 4HSCX 4JREB 4K3EL 2VE6B 2ED9A 3C75A 3ZE1F 4XT1C 5DLMH 3O11A 3CZNA 3JWDL 1JYWA 3V4VA 4H26B 5C0EA 3MNMA 4WUUA 3AG4B 2NXZD 4HIXL 1WIUA 4U4IA 4NQDA 4XGZA 1H6FA 3UXFA 4ABQA 5IB3B 5A3IC 4WWKC 1DQMH 3I3BA 1RHHB 3TV3L 3ZVVA 3PABA 4PTTB 4XXDB 4JQXA 3O3UN 1TQSA 4CMHB 4IHOA 3B5GA 1DFBL 4O2CB 2D31B 1IGFL 2YHGA 1URZA 4FNQA 4HSAC 5AENA 4X5XA 5E5UB 1A8JH 3SDAB 3TNMB 1LNUA 3FFCD 2MCPH 4JG5A 4M03A 5TD4A 2PYED 4OF0A 3RVXD 1P69B 3QJVB 4QMEA 3UJJL 1I3UA 1P84K 2YUVA 4GAGL 3WFDL 2BVPB 3TJPA 5KUKA 3ENEA 3H1ZA 1FVCA 5GGTH 1D5IH 3SYOA 1T66D 2VR6A 1RV6X 5FKAB 4WI4A 2IAND 3Q13A 1JDCA 1F1DA 1PQZB 5I1DA 4K5LA 4WI0B 2FT7A 2X9YA 4LLMA 4RWYL 4NN5C 3H2WA 3DV6B 4QXGL 4H25B 2VTFA 2CCVA 4NQUA 3PGFL 3ZIYA 1YEEH 5H35B 1IGIH 3VWJC 2VRAA 4TUKL 5I1AA 4IKKA 3M7FB 4J6IA 3B2UC 4P2RA 2PO6D 3KVQA 1N70A 5AW8B 3P2BA 5DHXB 4GSRA 3D2UD 5GGQH 4PJFE 1MFCH 5JNYB 4N8VB 1BBJA 1G1YA 4Z0XA 3ULUE 2DH2A 1Q0XL 2IDSA 4GXUN 2X4NB 3DNKA 3BKYL 3ARVA 3L16A 3OKMB 4H0HB 2P7TA 4LVNB 5J3HC 1WEJH 1CXIA 3MPCA 1I7TA 5FUOH 3A47A 1JRHL 3S8GB 3PREA 4ENEC 3DSNA 3DX1A 4YHPA 2Q3XA 4N8PA 3S4SB 3J2PA 5KZCB 1W16A 3X1NA 2EE9A 1YHPA 4WO0A 2O72A 3KLAA 1GGBL 1U3YA 2VMEA 5A2BA 2CM6A 4PRIE 1XVSA 2AABH 5CLYA 3CV5A 5CS7A 4U1KA 2ZUSA 3OQ3B 5CLXA 2W0FB 1MF2L 2NQDA 3KXFA 5AVQB 3NOIA 5AB2A 1R9FA 1HHIA 4ODHL 5EV7A 2Z35A 5FA4A 2DTMH 2E7DA 1Q9WB 3NZSA 4EZKA 2ORBL 2G5RA 3BWSA 4KKBD 5C0IB 4EBQH 2AJUH 2CA4A 4OLZL 1A7RL 2FSDA 3MV9B 5E6SB 1WISA 4L18A 4BWTA 3SGJC 1XIWD 5C0CB 1MDAA 4ICXA 2EVJA 4YR6B 1MEXL 1ZLEA 3HBZA 2DWSA 3DO4A 5EBLA 5HHME 2NTFB 5HYJD 1FP5A 4K23H 4QRQA 2E7LC 2J88H 5BMFH 1PKQE 1MCWW 1H8SA 2Z64C 3U6RA 1H15A 4N0CC 5BO1H 5F7KC 5M7QA 3VXME 2OQJA 2XWTB 5D7JD 2JK5B 4Q6IC 1O7DC 3MRQA 2RR3A 1PJWA 4E0RB 4YX2H 5CCKL 4FYSA 4YBQD 3MRBB 5IB1A 4WW1B 5AW0B 3MO1B 4W9JC 5DLLA 2KZBA 4KHTL 2EEFA 1JZHA 5ANME 5I9QB 2YJLA 3GLEA 2YPLE 4WWKA 1KGUA 1HFUA 4Y4HD 5ACMA 1L0QA 1A6AA 1A1NB 2X88A 4F57L 4OF5A 1WQVT 4X7SH 1A7PL 1WFJA 2BS8A 3CFJA 4EDWL 2OCCB 2OP4L 3RWDA 1V27A 1R5IA 1TDQA 2FIKA 4Y9CA 5E4EB 1I1AB 4ONOA 4Y9GA 3V6FB 4HIIA 5E08L 1F4YH 3KG5A 3U25A 4K7PH 1TQVA 4OQ1A 3FT0A 3LS5L 1U33A 1DO5A 1T7WA 3BYTA 2BIOA 4MXVF 4QHUB 5E2JA 4P2QE 4DQOH 2BVOB 1N0XL 1OB0A 3I6GB 4JHUA 4RQQA 1ZRUA 3G5WA 1RZPA 3DJRA 3P40A 4X9IA 4YVNA 5CJOH 5E94A 1DCLA 4L8BA 1F13A 1KCSL 2F54E 1NGXB 1PD0A 4LSPH 1J05A 4U1HA 4J3OF 1U2YA 1PG7H 2NT0A 4W9GC 3ZYOA 3VW3H 5HI5C 4Z7QF 2G60L 5EEUA 5TE6H 5IFAL 1DJXA 2VQUA 1TZ8A 2XVKA 5DVKA 4F3FB 1BYNA 3BH8A 5SX4H 3O0LA 4PGDB 3VWJA 1IJNA 4LSRH 3U9UB 3B2MA 4CN4A 4XNZB 3Q2VA 4HS8L 4IRZA 2GABA 1CGXA 1VADB 1U8MA 4YAQA 2YRZA 5CIPH 5IKCB 5FIEA 4JM0A 3SBPA 5KBLA 1OSZB 4HJSA 4DK5A 4LCCC 1BEYL 2JH2A 2CO6A 2J1WA 1QFHA 3HN5A 1JE6A 2QZQA 4UTBL 3FT4B 4L4TE 2P5WD 3FW6A 1Z1WA 4M4RA 4NC1E 3WFZA 3BCFA 5FLUA 3QXTA 4MXQC 3GMRA 2Y5QA 3ZZ1A 4E41B 2H0FA 3BVDB 5CD5D 4YHKL 5GJSH 4GKZB 5KYNA 2R69A 3QUML 3L3GA 4O5LL 4F2MA 4PLKC 3KPNB 1GZPB 2GG1A 4ZFFA 1EHNA 3WSQH 1XGTA 4F58L 1WD8A 2IH3B 3BH9A 4H2AA 1A4AA 1II4E 5L4IA 2K7PA 2APXA 2VDPH 4HWEL 1N64H 3MJ7B 5CGTA 1E5YA 2VLLA 1J5OH 1LO5B 3VYOA 4LKCB 1W8NA 1DL7L 2OX5A 5KJ7E 3NCJH 2Y06L 4GRLB 1AR1C 1ZE3C 1VACB 5ITBL 4HMEA 4GEJA 5F9OH 3T6QC 3FQXA 4MCZA 4MZ2A 5IM7A 1A6VL 1C08B 1FZOA 2DD8L 3DGCR 5ICXB 1NBZA 1BIHA 2GUOA 2OW6A 2ZKHH 3FUHA 4Y2OB 43C9A 3FXIC 3JV4B 4F2FA 3N42B 1NOAA 4FFZH 5D70H 4EN3B 5EWIL 2VZUA 4JRYD 3C5JA 4HVBA 2NXZC 3EOTH 3DGGA 1ONQB 3EADA 4Q6IA 1WFNA 2MEJB 5KSBB 5L6YH 3PQYA 3S48A 1PEZA 1U8PB 1VZIA 2DLIA 2X09A 3P0GB 1GCYA 1BFSA 1RIUH 1XEUA 3D08A 4V33A 1XAUA 4F2EA 2GK2A 1HJBC 3IETA 2UZPA 4LO9A 4LDLB 1DBAL 3LQAC 4X9YA 4XZ4A 5T5NG 5I0WA 1SJHB 4WHTA 5AD0B 3MRRB 1QX1A 5JIHA 4F7TA 2EH8L 4HGWA 3MLXL 4M02A 5CKGA 3RVXC 1G9EA 4JB9H 2N59A 3PL6D 4Z6AT 1KULA 1IBDA 3X3GH 5FFOA 2J1XA 1PSKH 4TVSa 2Q2LA 3HC3L 1JPGB 4LDOB 1AS8A 3BH4A 4WJ5A 4RIRA 4M5ZL 4PJHF 1T66C 4TLSA 1EEQA 3D34A 3ZBMA 4PJEA 2EIMB 3PGDB 1KUMA 3G6AB 4Z7OF 5ITBH 1A02N 3DGDA 4NSKA 3U0TA 4MQXD 3WFCH 5I24A 4S2SA 4JFHE 3HBGA 5B8CC 4JQIL 3LNHA 3MV7E 2G30A 3HS0B 1CG9A 5G5DA 4RX4A 4O2EB 1KXVA 1P7KB 2JCCE 1M7UA 3FO2A 4NKQB 5F7HA 1JL8A 2PO6C 3P2DA 1QBML 4N0YH 2AQPA 2CKBL 2WPGA 2J6EH 2AEPL 3D18B 2VDOL 1KBWA 3K0WA 4HUNB 3CVCA 5B3NA 3MRMA 5EBWB 2L7QA 3OXSA 2DKSA 3I9IA 1R3HA 2BSTA 4DUWA 4FADA 1C8QA 1NC2A 4UZUA 3TOPA 1CBVL 3FO9A 1A47A 2WXPA 2VMJA 2XTJD 1JGDA 1S6NA 3EGDA 3MACL 5HGBB 4KKZA 1BMZA 1G7MB 4G43B 1HAUA 3D3VD 2DYSB 3UBXA 4UNUA 2K6ZA 4AUYA 4LCCA 4LK4A 1RUML 1U42A 1LMIA 1IAIH 2NY0B 2W38A 3QWOB 4LSVL 4QRTA 5L4MA 5J11B 2AEIT 3PAVA 4PLJD 5FA3A 5IOPA 3O2VH 5L4JA 5FWQA 1XZ0B 4TYUA 5EU7E 3OKNA 4NEHB 4NQEB 5FS5A 4DQAA 2E76C 4TSCL 5C0FB 2BHFA 1TENA 1DLHB 4P23A 4RZCA 1G5GA 4ISVB 2FJFA 4KKBC 4PRAA 1JXFA 1W0WB 2BP5M 1J8HE 2UXTA 5DMIH 5MHSD 1A4CA 5FO8A 2FEEI 4OFYA 5GHWH 4G6JL 1DQDL 4MTMA 1BPLB 3TCLB 5FB8B 3C5SB 2BDNL 5FPIA 2HUHA 2LOEA 1XIWC 4FXTA 4HISA 2YXWA 4A2GA 1QFWL 1WUZA 2EECA 1W2KT 2NQ3A 1NIDA 3IN0A 4RA0C 4HJGB 4LNVA 3TPUA 4XP5H 3TX4A 3SEPA 3FFOA 2OXHB 4G1EB 1DUYB 2HKHL 2ZSWA 3F58H 3LKRB 3VXQA 4BINA 4RISL 3C08L 1S9VB 3APMA 3LTVA 3BMVA 3LZOA 3NJHA 4LAQH 3VRIB 1EUTA 1HI6B 4P3WA 4BGDA 4QRFA 1BZDA 2IFFH 3BCDA 4YBQC 2XX0A 3F00A 1PFCA 4B9IA 1L0YA 3FOLB 5JORA 4ALAC 2J5LC 5EPMA 1I8IA 2N01B 1I8AA 2YD0A 35C8H 1SQ2N 2FYYA 5AZ2H 1ZPUA 1TSHA 1ICTA 3O6FB 1P7BA 3PLYA 4Y4HC 5T1KB 1MCLA 5GXBB 3CLEH 2IPTH 3MCYA 4M4PA 4UQDA 3HR5A 2Z34A 3SIKA 4FJZA 4PPTA 2NY1D 3HG0A 4K8RH 5TH2A 2VLKB 4EOWH 4LEBA 4OCYL 5HYIA 2AAVA 3PPEA 5JHAA 4Y4FB 3DX4A 4ERSH 3FFCA 2GVYA 4GMTH 2PYEA 4N0UE 3WBDA 2PPDA 3MGTB 1CD9B 5IJVB 1N8OE 2Y2YA 4IIQB 3WO4B 3CSYA 3SY0B 4K0OA 5CP3A 1QW9A 1FYTE 1BG9A 5GRVK 3DJZA 2VABB 1RJYA 2B14A 2E3VA 2IANA 2RQEA 3V0GA 1KB9J 3HHMA 2PWGA 5CU9A 3QDGD 2YSTA 3GIVA 2OMXB 1Q94B 1T1WA 1NA8A 2BVTA 5B8CA 4P5SA 2UV3A 4Y9FA 2J55A 1UB5A 3OD3A 3QHFL 3CHQA 3GMOA 2QVMA 4OQTH 4S0SD 2PO6A 2ZKYA 2EUWA 5ERWB 3D2UA 2XXCB 2UZXB 3LVEA 3D50A 3C09B 1W72B 1G7IA 1LM8V 4G6KH 4HK0A 4HS3A 4IMKC 5C9JA 5I16B 2DBLH 4N6QA 4NUMA 3NABH 1FFQA 3ZZSA 1HK6A 3LDBB 1ET5A 2PF6A 3BWAA 5A2AA 1F4XH 2XVLA 3G6DH 4U3CA 3T1FB 5H4ZA 2V37A 4PJXE 5AYQA 4AC2A 1MW3A 4R0LC 5IUSA 2H6PB 4KY1H 5BJTA 4V1DE 3S36L 3IJ8A 2D7TH 2OK0H 2A9MH 1PX3A 2R1WA 3OG4B 5CD5C 3EAKA 5SWZE 1U2HA 1ORSA 3KWUA 5EF0A 3G9VA 1U8KB 3DOHA 5DO8A 4NENB 1PLGH 4G72B 4GT0A 4HWBL 5G4MA 3CQFA 3V95A 5HDBF 4C58B 1BQHG 1QVOA 2M83A 2CRZA 2JF1A 3B9KB 4QXTB 4ZOBA 4Z7NF 3WE1A 4TPRL 1R4XA 1HS6A 3MLYL 1Y6MR 3U9PL 2C4XA 4KDWA 3BFOA 3H8NA 3I9GH 2A6IB 4DKTA 2PCYA 2AXWA 2ZG1A 3P4MB 2VB5A 3STLA 5T3XD 3HG2A 5AVTB 1XIWA 3UC0L 1OARL 4XOCA 3QC5X 2F53D 2O5YL 5HYJA 4S10A 2UY7B 2KH2B 2YUXA 2JNZA 3KDMA 2HKAA 5BRZD 1TG8A 1X5AA 3NRFA 5AOIA 2CUAA 4GKOA 2OSLB 1DN2A 1K72A 4R3SB 4UILH 4FMFA 4HZ1A 1FWXA 2FX7H 4L23A 2G3ZA 1SMAA 2HN7A 3ETTA 2OMVB 2X28A 2CBOA 2J12B 4NKIL 2MWCA 1AZRA 2YGNA 4TRPL 3Q48A 4YHNB 4PJFB 3UROR 4Y4HA 4JZOB 4P8QA 1NDGA 1QATA 2DWXA 4PW3A 3VFNB 1XSOA 3PL6C 2CIIB 4PVLA 2EYTB 2ZOWA 2ZSVA 1GGTA 3H9SD 4LHUG 2VM3A 2R2EA 4PLOB 4EDXA 4F15B 4U6HB 4F93B 5FDWA 1HXMB 3QIBB 3RILA 3V9FA 1E4XI 4HUWB 3SYQA 1UT1A 4KI5F 3ZL4H 3FTZA 1ZTMA 4MDIA 3D33A 4GPVA 4QTIH 1G7PB 4PRIB 1G9NH 4MQXC 5E8NB 2JJSC 2F5BH 5B39G 3OMNB 3IDNA 1QFWM 3BFWA 2CUMA 1T7VA 4M8RA 3CX2A 1AO7E 2WCGA 3QEHB 3WKML 4ZK8A 1E9QB 2E86A 4H8UA 4M5YH 4X42A 2K70A 4LSQL 2XOTA 1BBDH 3B2PA 3DX6A 4JFQB 5D96B 5IJDC 3FRPB 4XN1A 1NANH 1M1XB 4HAGA 5EFIB 1T2QH 5AQ0A 3P3YA 2EILB 3MRGB 2OI9C 2PW1A 2XTJC 4NKDB 5E6ID 2XTLA 2B2XH 5DMKB 3IN2A 1E3XA 4NIYE 2P8LA 5E2VH 4GQZA 3PWVB 3QZMA 1FVEA 5HHMB 4K71C 3K7UA 1CFNA 2OJ1A 5CINL 3TYFB 1NFDA 1PKQB 4JHBA 1THCA 3VXMB 4IU2B 4BQCA 2P5WA 2AK4D 1SOXA 5ANHA 4B9JA 4PLJC 3CLFL 2DQCH 5KS9B 4R0LA 1QNIA 1U95B 2ZONA 4NGHL 3UO8B 4NWTH 3VFRA 2QSCH 3U1SL 3WGVB 3JWOL 5AW2B 1UJTA 1A25A 4JDVA 2VDNL 3OPZH 4NHUA 3HW7A 5ANMB 1SUJA 3RZCB 2NPLX 3GUTB 2PYFA 3NQKA 1AMXA 2YPLB 1U8QA 4Z7WA 3B34A 5JW4Q 1W0YT 1KBVA 4GMSL 1AY1H 1LGVA 4LARH 2ZCLH 5C0GB 2FQDA 2NUTA 1T4KB 1IM9B 1V7NL 4F8PA 4G9FD 1SJEB 1M7XA 2JI3A 2VXUH 2BSDA 2DLEA 2N1KA 2CO7B 4G6FB 4ZUUA 2OA9A 4Q8BA 4X4YB 2WXKA 3L95A 4MD5B 1ZLWK 2KDYA 4QT5B 4P2QB 2N3JA 5AWNL 5EOQH 3UTQA 1LO0H 5LNEA 2JB5H 2PXYB 5FM8A 1ZLSL 2H3NA 4WSGA 3SYPA 3IMTA 4GIPD 3BE1L 2OMUA 4OVUA 4MZRA 5AOJA 3R18A 2F54B 2BVEA 4R96A 5AKSA 2I32A 4JRYA 3H55A 4GAYB 1AQMA 2B4CL 3TO4B 1YPZA 4JFYB 5JDSA 4UINL 1AKJD 5DFAA 2R39A 2XC8A 1KGCD 4HWUA 2YK1H 5IF0A 1KWKA 3V4VB 4XXCC 5BPPA 4JKNA 4L3ED 2F9BT 4UM9B 5DVOA 5J1TC 1MJUH 1KIPA 3DVIA 3MNVA 4RNRA 1RUAH 2GTZA 4TQIA 4ZPVA 3RY5A 1Q9OB 4S1RL 2AJ3A 4FLSA 3MGOA 3LMJH 4BH8A 1OAZH 3PL6A 2YD5A 1A7OL 4A55A 3LHAA 4A04A 2FO4A 1CQKA 4IHOB 5T3ZL 4NRYA 3VACA 5JIPA 4L4TB 4N2NA 3AS0A 3LNDA 4ZMPA 1EK3A 3O0RL 3GB7A 2YGOA 4KMTL 4PR5A 4X5XB 4LLAA 2BHUA 2R0ZH 1Z5LA 3FBQA 2P48B 1E30A 1FAIL 1F4HA 1UM6H 1PD1A 5E1QA 3BZEB 1U3HD 3UTOA 1RZ7L 3QEUB 2JJSA 4YN3A 3DMMD 1GOFA 1IAOA 1JZIA 4AKPA 5CD3A 4Z76B 3MHZA 1OGSA 3OB0H 2FATL 3DV4B 2ZX7A 1WWAX 2GC4C 3U1PA 4LVOC 3V7AG 5I1DB 2X70A 1NIEA 2OL3L 2WVVA 3Q1SL 1QTSA 3AWEA 4Q89A 5TDNA 2APBA 3LSOA 3NSJA 3DXAE 4DAGH 4IOIB 1CWVA 1ZLUK 1XEDA 2XQBL 3ISRA 5EU3A 1G7HB 5BZZA 4JM2F 2IBZY 3KW8A 3U7YH 4JFWA 4WKZB 4DZBB 3FTSA 4Z0BL 3ARBC 4MD4A 4L9LC 5DZPA 3TLRA 1UOKA 3D9AH 4MJ4A 3D3VA 5GGTA 2ALAA 5J13C 1S9WB 1WF5A 1XGZA 1XCXA 3D0VA 3BHBB 3T8VA 1DN0A 4OGXH 2TAAA 4KMLB 2DPKA 2WIIB 2GYSA 4DKEH 2AQNA 3F5WB 4Q0XL 4X6EB 2CK2A 2A99A 2H8PA 3L5HA 5E5MA 3ROOA 1DVSA 5LWYL 3CC5A 1UXWA 1RIVL 4JM4H 4FOMA 4ELMA 5DC0A 2LTQB 1GTFA 4LHJB 1NAKL 2ENSA 2X38A 5B3JF 4L5FH 2JJUA 4JCLA 2HAZA 3FC8A 4ABVA 1DLFH 2BNUB 5LHDA 4AMKH 3ERXA 4NZUL 1NEZA 7CGTA 1XH2A 3TC9A 3H7BA 1ORQB 2Z35B 3L81A 4JE0A 2WBJD 4NQCD 2AJXH 4B6ZA 2ZXDA 2BXZA 4FHJA 4JFEE 1F0LA 3PHOB 1E43A 4JPKL 5HI3C 1RY7B 4BFKA 3EHBB 2OYPA 4YE4L 4IK6A 2F08A 1PZ5A 5AZEL 1Z32X 3DHPA 5E1GA 3OVUB 1EJOL 5LB1A 3MV7B 3BWUC 2VDQL 3L17A 5D72L 3O2DL 3O45A 2JCCB 5KVEH 4XNYH 1T04A 4AZ8A 5IGXL 5JOPD 1DBMH 1LEKA 4JVWA 2NNAB 2VDMH 4YHYC 2P5WE 2OR9L 2BLFA 1SFDA 1DZBA 1XGUA 4AH2A 4GSDH 4A7TA 2H26A 1JYXA 3EGSB 3UG5A 3ES6B 4XXCA 4OCRL 3UIYA 1JVKA 1RSYA 2AXFB 4O58H 2A9NL 5IT2L 3Q2WA 3ZN6A 1A9VA 3VMOA 3LJ3A 1RZJL 1WWBX 1JK9A 3HMWL 1LP9F 4PIBA 3L6FA 2O4EA 4WWKB 5TQ0H 4JGMA 5DJYB 4NQSA 2UWEA 2Z9TA 3P1VA 1YEJL 3M46A 4G6ML 3O4OB 2EADA 1W9XA 4EIUA 3GO1L 4WRLA 1SHXA 2GT9B 5C0ND 3ILDA 1R5IB 3DURA 4RMSA 2VJ0A 1K8IB 2YN5A 3DPBA 1K85A 1AD0A 1KJ2L 3VFSA 1KYFA 4YH6A 4ELKA 2WQ8A 3Q5TA 2WTPA 2IPUG 3IK2A 3NPSC 4F33B 3SPHA 2G9HB 5E99H 1XF1A 2CXKA 4LCIH 2VITB 2FIRT 2YKLH 3TT3L 5E94B 1B9ZA 1RP8A 1J8HB 3QIWA 4L8BB 4ZO7A 2WXNA 3NJVA 1J05B 5J1SC 5AOMA 1CYGA 3L3OB 3SGEH 4BJLA 2GIYA 4QDGA 4TULH 2CH8A 3W5NA 1HEHC 4GKLA 4YXKH 1CFBA 4RFEA 5GGSY 1PDKB 1GS6X 4IU3A 4ZUWA 3G5YB 5L9DL 3VAEA 4FFVD 4XTRD 2AEOA 3ARBA 4L9LA 2IWEA 4E5XG 1N4XL 1VKXB 2WO3B 4Z1PA 1I7RA 5E4AA 1NWOA 3SGDH 1UWGH 5FYKE 1GXEA 5ECJE 3VD5A 1KBGL 4IOSD 2BW5A 4PJBE 1QYGL 2DQFA 1WS8A 1E67A 1M9WA 1ZS8B 2BP3A 2CO6B 2W9DL 2Y07H 5C2BH 2FJSA 4GG6A 2Z93B 2AJSL 3CNKA 5JOEA 3R4DA 2HFEA 4G7RB 1DO6A 1JPFA 1TQTA 3M17A 3BT2H 2YUZA 2QSTA 4DN4L 2E47A 5HJ3B 4EVNA 5I1LA 3MOBH 1EEZB 3CD4A 3T6WA 1WO2A 3H4HA 5B22A 4DGVH 2SODB 5CIPA 4ZNEE 5A6LA 1YMMD 5D7EA 3LEXB 4AXWB 4MXWL 1OAJA 1SEBA 3RPBA 2D3JA 3ARYA 4ZFFB 4U1JB 3ZDYE 5C92A 4N0UB 2G3MA 3BH9B 4LQ1A 1MAMH 1RURL 1NAMB 1SLUA 1Z3RA 3BJLA 1AGCB 4H44C 1KIRA 2EDWA 4NUGL 3A6OA 2Q86A 4UDUA 5J6GA 3FH5A 5C0AD 4B41A 1CYXA 4I4WB 1FYTB 2JKTM 1L3WA 4JDTL 5BQ7A 3QQXA 2OX5B 4E9YA 4HIEA 2FBJH 2L3BA 4C57C 4G8IA 1MLCB 4JPIA 5KVFE 5HD8C 1IKNC 2YWYA 2J8HA 2YWZA 3D3VE 4O02H 4H8HA 1D2PA 1BFOA 1FZOB 1TZIA 1OAYH 3CFDA 4PJAA 3HRPA 2VT0A 4Z23A 2JJVA 1NMBL 3LH8A 3F7QA 3CK0H 2VLJA 2QMKA 4KJPD 1QWHA 1QNZH 3ISWA 1EZVX 2PP9A 4Q6IB 4WFHD 3DDGA 3GSXA 5IQOA 4F7MB 5KSUA 1UJ3C 3EOBA 5MERA 1CTMA 3C87A 4NUQA 4XBGA 5IVXE 2F5AH 1RKRA 3VI3F 3H9SA 5SX5K 4HG4K 3IETB 3S5YA 5EC1B 3VGBA 3HJ0A 3FO1A 3RVUD 1J0HA 2Y6SD 1VFAA 4PJXB 4P5RA 2P52A 1IL1A 4QLWA 4FFZA 3WGUB 4V1DB 2VQ1B 1LEIA 2FSEA 3F7RA 1U3HC 4FZEH 3SBWC 1JWUB 5SWZB 3BDBA 3EBIA 3NCXA 3DMMC 3U30C 3UBHA 3DETD 1WJ3A 3UYPA 2NRDA 2A9CA 1BD2D 2BXYA 4EUPH 3OKDB 1TZHA 4XNMB 1F00I 4OM0H 4HZAA 1CPUA 3HZMA 5GRUH 2H2SD 1K3ZA 5DURB 3S3DB 2PWFA 1H8OA 2P24A 4IKIA 3TBCA 2I9TB 4MJIA 3TTYA 2JIXB 3KCPA 3Q1EA 3UZVB 5DJCA 2CO1A 1DJSA 3LNFA 2DH3A 4KMQA 2X4QA 3OLGA 2DIEA 2HLEB 3C2AL 3K8KA 2WZ0A 3FO2B 4Q4EA 3GMNB 3V0WL 2FH8A 1YEFH 5HY9A 2ZKXA 4DN3H 5HJDA 3AS1A 3WHXA 5BV7H 3GC3A 4AIZB 4XZUA 1KGJA 3OAUH 4GINA 4HWZA 1PG7W 4L3CA 5LGJB 3VQ1C 3Q8EA 1EFXD 1WZKA 3JZYA 2DB8A 2HRPH 1KTRL 2AK4A 3U48A 1B2WH 1JGDB 1PYWA 3MODH 3FS9A 1FBIH 4JVUA 3TVMD 4ODWA 4UQEA 2FD6L 2FLRT 2P8MA 4NYLB 1T1XB 1FHGA 2NSXA 4L0ZA 3UZQB 4F1ZA 1ZT1A 4LSUH 4G7YL 1PPIA 4E2OA 4UMGA 4CSTA 4BFFA 2J6EA 1CE6B 1H3GA 1GZQA 4FI7A 1NCWH 4FMKA 2WQSA 2XPGB 4N22A 3ULVE 1SGKA 5IOPB 3U4BH 3V5DB 4CADA 1CZ8H 3T4YB 3DX0A 1EHLL 3MNZA 3QDGE 4DVBB 4U0RB 3CFCH 4G9FA 5HHNA 1K4DA 1MFEH 2WBJC 5FAAA 4S0HA 5AOKA 1D9KD 3C5XA 1L9SA 4G70B 2FJFB 1YY9D 2WNGA 1CU4L 1NIAA 3IU3A 1A0QL 4LVHB 4FAAB 5DZJA 3INUL 5ETUB 2CPUA 4UMSA 4GAJL 4V11A 1OGAD 5TDOB 2H0JA 5FHAH 3PAUA 1WAPA 3ZYZA 3DO7A 3U7AA 2VC2B 3QAQA 2BOCA 1YCSA 1KV7A 1PMYA 1VCBC 2WXGA 3G5XA 5KVGL 3ARGB 3OMAB 5C0RH 3BSZH 3QWRD 1AO7B 4MA8L 4ZTPH 3WFHB 3MBEA 1ID2A 3GLDA 2AVFA 3HUJA 3RKDC 2X4SB 1MLBB 3QJFA 1AKJA 4Z8FH 1YNKL 4LL9A 3VXSD 3OKEA 3EJQA 3QORD 1UKSA 4JPVH 1QSZA 1JAEA 1JGUL 2YUWA 2QKIB 2PABA 2Y5TA 3ESOA 5E6YA 3L4UA 5EPMB 4PS4L 1ZY9A 4FTVD 4W9KC 4M7KL 2FVNA 2FYYB 5AOZA 4ZAKD 3ABZA 3STZA 3T6VA 5CHNB 4AJ0A 3ZZLA 3L7EA 2D73A 1CD0A 2EDLA 1H0DB 1LDPH 4KFMA 2A6JB 1OTTD 2E46A 3ALPA 1NPNA 3EDFA 1NC4A 5C0NC 1ZIBA 4G7VL 3AT9A 4F7EB 5D4IA 4HEME 1UXMA 2D9CA 3BC9A 2Y5EA 5T3XE 2E8YA 3IKCA 4G1MA 1I1FB 3SZKC 1U3HA 3SBWA 4CVXB 3LZFL 3AGWA 1BXAA 4TNFA 1KEMH 2BHZA 3DMMA 5I1CH 4BZ1L 3LQZA 1JGEB 3OR6A 2F53E 1FNEA 2WXQA 3WTSA 4Y4KD 4MQ7A 4F7PA 3L9RA 2X9WA 3LPWA 5F6HI 4PCSA 1YC8A 3HMXH 4L8CB 2Y1YA 3IGUA 2H45A 1IM3A 4TSAH 5BRZE 1FIGL 1TJIL 1CDCA 4BSWA 4BKSC 1OPGL 2HRHA 1RIHH 1A9EA 1IQDA 1OSPH 4OD1L 4B27A 1KYAA 4G8GE 4CJ1A 1BQKA 4YXHL 4XPTH 5B8CB 3SDCD 5C3IA 3KYAA 4FYTA 3GQFA 2R9HD 3SBRA 2OTWA 3PJSB 3MXWH 4YHIB 4BRVA 3UPRB 4XTRC 3RGBA 1XCTB 3K6SA 2WXHA 3D2UB 1G9NC 1I85A 1XQ4A 4IOFD 5B1KA 3I50L 4JG0L 5I1GL 1J8SA 6FABL 4F37K 3RTLA 4U7SA 1ZA3A 1ZVNA 5G4NA 3VXOA 4DP2X 2V2TA 1AP2A 2WUBH 4M7LL 1UWEH 4H8PA 4HD5A 4WI5A 1IC5L 1XHHA 1S3KH 3EDDA 4JANB 4V2CB 5DJ8B 3IFPB 3JV5A 1C5CH 3H9ZA 3ML8A 3WNNA 4GO9A 3SKJL 2XQYA 5DD6A 3N1PC 3ATBA 4PGCB 3VXRE 1WDAA 2XN9E 5DJAA 5DHYB 4GQQA 3V0IA 3EYOA 5K33A 1TMQA 4JFTA 1K8DA 1FA4A 2YSSB 3VXUD 5DZOA 3HFML 3HNVL 2HCZX 3V4LA 5F96H 2V7NB 4JAMB 4RDQF 4M6MH 1YYCA 1EO5A 4X4ZA 2H41A 3OAYK 5CM1A 4G59C 4N28A 2A4ZA 2VISB 3SPVB 3ZO0A 4KITB 1VIWA 4QCIB 5EUOF 4NQCA 3FONB 4BSJA 1KJ3H 3OGCA 5F7NC 2R2CA 1U8LB 5AVUB 2QBWA 4O4YL 5EOCL 2WHVA 3VSUA 2VXQL 3GMMB 4TSBL 1J86A 1UKQA 3STLB 2XZQL 3V5HA 1E9PB 5TPWL 5DUPH 3SN6N 2AEWA 1WBYA 3BYYA 3QULB 4NNPH 1P6FA 1T89C 4FEIA 3FH8A 2GEQA 3ZIMA 3NVQA 4AYGA 3CMOL 1PEWA 2VMFA 5EOTA 5JQIB 4MAUL 5D7JB 5J9PA 3FZUD 1VFMA 2AK4E 4H8WC 1YNLL 3DXAB 2HJLB 4NQVA 3GTVA 1P4BH 4G5ZL 3D4CA 5SV4A 3VTMA 4DP7X 2UYLA 2Q7NA 4J2QA 3KPSE 2X05A 1UB6A 5C3TA 2J20A 3OM3B 1FSKC 4K4KA 1ADQL 4A2LA 1P4IH 1SVZA 2ZJSH 3O3DA 3QXVA 3RVUC 3WIHL 2Y6SC 2H32B 3LYRA 3DX3A 5AYTA 3NACH 4B97A 4DKFL 3PIQB 3MBWB 1W91A 5K93A 1I1YB 5CJ5A 1RHFA 3E6FB 5LKNA 1YN6B 1I4FB 1M05B 1MOEA 2ZSVB 3JTTA 4POUB 3DETC 2R2EB 4EDXB 5MEQB 2VO8A 3D39D 1V3JA 3VGHA 5DK3A 2DM7A 4FQ1L 3ZYIA 5ID1B 3IF1A 3T8MA 2IPKB 3H85A 4GXVH 4PJCE 3NSFA 3V0JA 1J12A 3B1TA 5DQJB 3TT1L 1U8HA 4HBQA 2H6UA 1BPVA 2IC2A 2H2SC 4YUEH 1GJWA 1FYHB 2RACA 2CDEB 3AXLA 3Q3GA 4NO2A 3P30H 3RWFA 3RE0A 3V4PB 3L54A 2A73A 4I87A 1AE6L 5L8LB 2YGVA 1HSAA 4FFYL 4WTQA 4NQQA 5ALBH 2VR7A 4PWHA 5F44A 2P5ED 4K3HA 5CR8A 4UIMA 4KTEH 2WNXA 1KGCE 3VE0A 1RZKH 4JFFA 3GT6A 1FC1A 4JFEB 2AXJA 4L3EE 1TJGL 3JXAA 4X83A 5D93B 2NXYB 1K3IA 3SE6A 2WW8A 2V6HA 3LPGA 2VKWA 4FABH 5MEOA 3N42F 1A4JA 3TVMC 4N8UA 1FG2B 4Q14A 4WENB 4AQ8C 4CN1A 1T1YA 3KS0J 2L4OA 3Q5OA 2XKNB 4IOSA 5KSBF 3Q06A 2BS9A 1CFNB 4P3CL 1GSMA 2QMJA 4Q58C 3KLHC 3L4XA 5F9JA 4R4BB 2YQ2A 1L9TA 2QQLH 1NCAH 5ITFB 4Z9KB 1TVBA 4WNSA 2P5WB 3I3DA 3DYPA 4ZUSA 1LWRA 1ZANH 4OGYH 4N2CA 4Z7VE 3KMDA 1TJHL 4XN9A 5EIIB 3WNPA 2VZOA 3B3IA 1OF0A 3MRLB 2NY2D 1X9UA 3UEQA 1VESA 2QPFA 4FXGC 3UTTD 1AXSB 3RWIA 5JYLA 1UTDA 5F7MC 1X5KA 3HTLX 1K6QH 4I48A 1D9KC 2PYFB 3ARED 1YY9C 2XNAA 1NCBH 2WQVA 1MUJB 1AQDB 2R0KH 4FCHA 4QTHA 1MCOL 1XB3A 1XCWA 3WEXB 5C0AA 1PZ3A 5KYWA 3SE3C 4YK4C 4ZUUB 5ALCL 4WNJA 3V4UH 5I6XB 1B0RB 1NPJA 3I02A 2WXJA 4QNPF 5D1ZD 1NLDH 2PLTA 5CP7A 5GS0H 2BP0B 4NIKB 1F4WL 3ECQA 3L5XH 1NIBA 2N7SA 3DHJA 3QORC 4QPEA 4P59L 2E7HA 1ZXQA 2HFFA 3L3KA 1BIIB 4A38A 5FXCH 2BIIA 4GW5A 4WGKA 2W9EH 3DIFB 2LLGA 4IEFA 4JEGB 4ZAKC 1DBKL 4QHKJ 5T1JA 1XH0A 2DMKA 5F89A 1EX0A 1QFOA 1AIFA 3B8YA 3VFTB 2OR7A 1OTTC 4AQ1C 4Y5XB 4LEEA 3BKML 2AJVH 2L0DA 1KIPB 3L1GA 3MNVB 1B3IA 4RNRB 1QLFB 4ZPVB 1KBKA 5KAQG 3A0OA 3WD5H 2X6BA 3D06A 3MJGX 1NBYB 1XGYL 3AQDA 3QXDB 1V5JA 3TN0B 4BH8B 4IBWA 4U6VL 2BNRD 4FDWA 5C8JB 5DJDA 4PJBB 4FYQA 5KANG 5E2TL 3FB8A 2JTDA 4XOAA 4LKXA 1XTLA 2HZHA 3GIZH 4GAFB 4NZRL 5DTFA 3GWJA 2DI8A 4Y4KC 4PJIF 1BD2A 1A14L 5C09E 2JELL 2QADD 3OKKB 3ZTEA 1N0LB 1TIUA 1NKRA 4KBPA 4GUCA 1P6AB 2BH0A 5K9QG 2Z6FA 3N40P 4S11A 3WL9B 4LSSL 2KT6A 3NN8B 4X80H 5BVJA 4RMUA 3SDCC 5LBVA 4RFOL 5EEVA 5FOBA 3HPJA 4XBMA 1IARB 1S9XB 1FH5H 2Q10A 2N7AA 4N2IA 2EDRA 3W9EA 3TCXA 2ROXA 3ZDYB 3KPOA 2CJUH 3NSYA 5JOPE 1HOEA 4O9HL 2WVVB 2CU9A 5TDNB 4KUZH 4PMEA 4IOFC 3LSOB 4JY4B 4XBEL 3L5IA 3VMNA 1IC1A 2ADIB 3UJIH 2Y6TE 4ODUB 4AENB 4AX3A 1AZBA 5A2CA 1NCIA 4KJQD 1MHCA 1ZLVK 4RGND 3PE9A 1EFXA 2ODIA 3IRZA 4UF7C 3V0HA 4Y7MA 1IKOP 3KLLA 1HILB 1V55B 3ZRSA 2ADGB 2IF7A 3BIBX 2IQ9L 3TVMA 4DCQB 3N2JA 1HC1A 1JI2A 3D3VB 4AQ8A 3VDBA 1XO8A 4K71B 3GHBL 1YYLH 1DBJL 2BSSB 4PRPE 2YEZA 4PV9B 3QFJA 4EZJA 1GGCL 1O9VA 1KEGL 3N9GH 5CCHE 4OB5L 4YLBA 4XCYA 4IYKA 4MNHA 1ZT4B 4QHMB 5K9JH 1KYUA 1UADC 5IVXB 2W60A 3K2KA 4FXGA 2XFXB 4JKPH 2DS4A 4N5EC 2AZUA 3N40F 4XC1L 3B7SA 1D9KA 5ELIA 1CL7H 1I8UA 2D4DA 1EIBA 4FERA 2V7HA 3GTNA 1R34A 2DWYA 3H6JA 1MHHA 4FTDA 1NEZB 5DVNA 1OGAA 2GTWA 3SE3A 4BUQA 4ZD3H 3TWCH 5BRQA 5F8RC 1E5CA 1ZEAH 1SXAA 1MREH 4D8PA 3QWRA 3U2SB 4A66A 4DP1X 5BCAA 3LRSA 5CMAB 3IBOA 1ED3A 1EO8H 4PB0H 4TXVB 3BOVA 5E2WH 2APSA 3FZUC 4YDKL 3I9AA 5TDPA 2VZTA 4KDTC 1L7TH 4XVJL 5I18H 2V9UA 3VG0H 3N04A 3QORA 4NO0B 4UYPA 1JXJA 2UVFA 5E2UL 1U6AH 3AB0C 3UMNA 4YSPA 5DUBA 1JPTL 1ESOA 3O45B 4B50A 3IEAA 3D8MA 3JQOB 4JY6A 4AZ8B 1REIA 1LEKB 4ZAKA 5B1JA 1NGPL 1OB1B 1MG3C 2OMWB 4KAQL 4M1GL 2D7MA 1S8DA 2H26B 5H94A 1DQLH 2AEQL 3KPPB 2YO3A 4AQ1A 2XA8L 3WKPA 2NY1B 4H1LG 2NCMA 3BLKA 2EEAA 3UTSD 4C4BA 2EVFA 1YMME 2LQRA 3BT0A 4WWID 4FP8L 2DIJA 5KBDA 3AY4C 4KO5A 2DQEL 3BSGA 2UX6A 2XHNA 3L3IB 5KW9L 1MWAH 5EBMA 1JPSL 3S0PA 1HHKB 1PIFA 1ROCA 2HLFD 3KPQB 4GQRA 5D1XE 4HK3N 2G2NA 1QBBA 3MUHL 4Y4KA 1KLGA 4YL4A 4AY0A 2N4IA 4JGNA 4YDLC 1OEZW 4YHZH 3S96A 2E4TA 5TE7H 4AT6B 3MLRH 3BUYA 5FECA 1IBZA 1GAFL 4XMWA 1CDGA 3QDGB 2V8MA 3VFSB 2K8QA 2IH1B 3IT8D 3NJNA 4N25A 5DD0H 3T0BA 3BZ5A 4PCTA 2EEDA 4W9ZA 1CI5A 2BCMA 3VX0A 3SPIA 1H3PL 1OCZB 3AU1A 3MV01 3SDCA 5SWSD 4HYTB 5GRJL 5EZJB 2YA1A 3IRPX 4H0IA 4J12A 5J1AB 4UQ2B 4RETB 4OCMC 3CFUA 1BFTA 4JRLA 4APXA 4UNVA 1MVUA 4I2XA 3S6CA 2GW5A 4OAWA 5GISH 4WFHE 2QQNL 4LGRB 5DD3L 5AW3B 3RA7H 3L3HA 2DL9A 3RGVD 5BS0D 5CZXD 3P3RA 2HKFH 2A5UA 2H0EA 1OP4A 4RFEB 2NY6D 4OLYL 2D0GA 2I5YL 5I8EA 5IFHH 2G0KA 4Z95H 3TEWA 2Z8VC 3KYMA 3PUUA 4LLUB 5FYLH 2YRLA 5LAXB 4YSQA 5J13B 3K8LA 3SOBH 4DKDC 3CXDL 1JWSA 3IJ9A 5F7DA 3VXUA 1KGIA 1RP9A 3X12A 5A2KH 3ULUF 2E6JA 1S7VA 3ME0B 3U36A 4MGXA 3O3BB 1T0OA 1UT9A 2HVKA 3HRZC 5HDWA 3AREC 3VFMB 1H3VA 4KU1A 4YSUA 3M17B 2XWBA 1W72L 4UM8A 4KOCA 3INOA 2Z1PA 5I6KA 3IJYB 3HI1A 3P54A 5FO7B 3WIAA 2MPAL 1KBBA 2VAAA 4IM8A 3MRHB 3BZDA 4JO4L 5FYJL 5EU4A 4DO6A 4I1NB 4WCYH 2JKNA 2KKQA 3Q2LA 5FO9A 2L7UA 4JG1L 5B4MC 5IWLC 1SEBB 4XMVA 1AGFB 1I9RL 3PPSA 3RNQA 5D1ZC 3NRQA 4GO8A 3KYNB 3DTUB 1AD9B 2ZP8A 4ONGL 4WFFD 5EU6A 4UDUB 1QRND 2F53B 1I9IL 2DYPD 3ESVF 4PSRA 4DPAX 1N3NB 5I75C 2MH4A 4QHLA 4WTWA 2FGWL 1YQVH 1FN4B 3V0VB 1AI1L 1EZUA 1MXGA 4I0PC 5AB1A 4A68A 3JWNE 2D8KA 4JL1A 2BWQA 5BRZB 4WEUD 1HYSD 4TLKA 3S35X 4KDTA 2WKGA 5D9SA 2Y1AA 4I3SH 1NM4A 4G8GB 4FRWA 4HDIA 1CFSB 5FLVA 4TUOB 4U1GC 1ETZB 1A6UH 1BFOB 4OD3H 1QWNA 4YHMH 4MB3A 4ZFGH 4TTDD 4AEIH 3MRCA 5SV3A 4KH2A 1IT9L 2Y3AA 3MI6A 3MRIA 3CUPB 3UG4A 1Y6NR 5D71L 4QR7A 2ADYA 1RULL 2QT6A 3S5LA 5JHLH 2ZXWB 1GC1L 1CGSL 2YXVA 5KS9F 2WLJA 2FL5B 2ITDB 4K3EH 4P3DB 2R4RL 5FUCC 5GS0D 3QZWB 3W9DB 5I8CB 4JRXE 3D39A 4O02A 5AYUL 1XD1A 3JWDH 3FO1B 3HE7D 5DHEA 2XN9B 1VFAB 3TIEA 3VXRB 5E8DL 2QADC 3QA3A 4U6XA 5AG9A 2IWFA 3RDTA 5L88L 4JN1L 4PP1D 3SKOA 2QV2A 4HIXH 2HLAA 2VMCA 4OCSL 3GK8L 4NPJA 3T77B 2F74B 3GBDA 5L2KA 4JLRB 4KQ4L 3ZT6A 2E8ZA 4X98B 3HPLA 5JPMC 5CJBA 4ECNA 1QUPA 2E56A 5FX3A 1IBGL 3TV3H 1T0MB 2AFNA 4YIQB 3PGCB 3ULUL 4RSYA 1D7BA 2J1YA 5D2LE 3TEYA 1OZTG 1DFBH 1T7YA 5D5MA 4ZQKB 5L2JB 1JHKL 1CUOA 3HZMB 4PJ7F 1IGFH 3H6AA 4RMVA 2VAJA 2ZCZA 3F84A 3ILEA 4LRIA 1YDPA 2YPVL 4FA8A 3VXSE 4L3AA 3UJJH 4KJQC 4NZTL 3MOAL 4RGNC 3ISYA 4ODBD 3QNZB 4GAGH 2X4QB 3WFDH 5E6IB 1BGXL 4FTVE 3FO0L 1OD9A 4FA7B 1ZA6B 2ZXGA 3I6KB 5HY9B 2CSPA 1CICD 3KWWB 4FQQA 1OT2A 2UX7A 4QGTA 5FGSA 4XRCB 4EUPA 4Z7IA 4I9WD 3KJ6L 5D1QD 4A7QA 3VGEA 3BMWA 2NW2A 4L3CB 3DUHA 4YDNA 5TF0A 4WO4B 3DI2B 2H6OA 2G75B 4RWYH 4XN2A 3EO1A 3HC0B 2AK4B 3NFSL 1NUGA 1PYWB 4QXGH 5F7UA 1BSIA 4ODWB 5L8KB 3PGFH 4HV8A 5AALA 4TUKH 2GSGA 2A83B 3UTTA 3KPSB 1MIEL 1JNHB 3FT2B 3IS0X 2HVJB 5D55A 4BCZA 3HRZA 1TJXA 1JSYA 3AREA 2HG5B 2EC9U 3SE9L 1Q0XH 3QZNA 5LQBL 1BDYA 3BKYH 2IV9A 4BUGA 1A65A 5C7XL 2R0LL 1VEMA 3GXNA 2CGZA 4WHYH 1JRHH 4LOUD 5CXPA 2ZAGA 1YEIL 3RZWA 4K3GA 3LRMA 3DVGA 1AZZC 2GITB 1GGBH 3D05A 5D1ZA 5D6CA 4PJCB 3DO3A 2XWXA 4CU8A 1YC7A 5FKPB 3W38A 3GI9L 2EDYA 1BFVL 1XGRB 1MF2H 3IDXL 4I0PA 1DVFD 4PWJA 2J44A 4Z78A 4ODHH 4F8TA 2AVGA 2BIHA 1IB5A 4P5MA 4KO7A 4AL8L 4CVZB 2FEEL 4OUUB 2ORBH 1MJJB 1O6VA 3CXFA 4KO9A 2VIRB 3WNIA 5DJ0B 1TZOA 1AKJB 3BW9B 4AUJA 3HZKA 3NA9L 4OLZH 1A7RH 3PXLA 3WMPA 4NNYA 2LW3A 2RA1A 5TF1L 4L3EB 4NRZB 5DS8B 3UTPD 4WK4B 5E00B 1ZVSA 5CGMA 3FOMA 1MEXH 2JKJA 1DVTA 1WP6A 4QXVA 1DP0A 4ZFQA 4S1SL 1F90L 4HUUA 1UJ3B 2NQCA 3LH9A 4F8LA 2W0KA 5IHZA 5JHMA 5F0PB 1KC5L 1OQXA 2BNRA 3BSZA 4NO5A 3L7EB 4FQJL 5JW4M 3LRHA 1QPKA 4LIQE 4PRDA 3K71A 3DBXA 2EE2A 4ZOEA 3T1WA 4X6FA 5EO0B 1MCBA 2YBGA 2Z7YA 4OCXL 5CCKH 3ZQ9A 2YD4A 2QPEB 3NIFF 3X13A 1G7JA 2BZDA 3LXBA 3MLUL 4K7FA 3MLSH 4MJ5B 4LESA 4Z7VB 3U6XS 4KHTH 3QQ3A 3RG1C 4OZGA 4U49A 3QI9D 1U3HB 3WUWB 3V4VL 1S7WB 1ODAA 3QGVA 1BAFL 3ILPA 1HINL 5HGDB 1A1MA 3U30B 1K5NA 4XX1E 1X6LA 1OK0A 2GJRA 4F7PB 5IP4A 1ZHKA 2ARJA 4UNIA 4F7CA 4F57H 2C4FT 3QZPA 2X4RA 1A7PH 3BP5A 3WS6A 4EDWH 2CJ3A 1BVOA 2F7QA 3LRLA 4GKSB 1TTAA 1JK8B 5E08H 4HETA 1MRCL 3LS5H 3PHQA 5CZXC 3RGVC 3CX5K 4R7VA 4PJDA 3V9CA 2ENQA 4HC1L 5IREA 1N0XH 1BLNA 2NY6C 4O2FB 1HESA 1LEGB 3KJ4C 3RVWD 1YNTA 4GG8B 2EINB 2V4LA 5FCUL 1OT4A 2NYYD 4WI7A 5DWPA 2QPDB 4D0DA 4MMZC 1KCSH 1T21B 2ZP9A 3LKNA 3T2NL 3EFFA 3HMXA 2FT6A 2ZYIA 3QEQA 4N2GA 2QTVA 3UYOD 3ZRCC 2G60H 2NY5C 2V2TB 1SQMA 5IFAH 1AP2B 4XBPA 5B7MA 3MA9L 4HCGA 2AMUA 3GBLA 3REWB 2XG4B 3D39E 1I82A 1QBLL 3GS7A 5DJAB 3B7RL 3GJEB 1HHJA 4D9QD 5ILTL 1LJMA 2UXVA 2Z31D 4HS8H 3TZVD 4ZMTA 2EE6A 4D9LL 2CBQA 3T0ED 2VLRE 1Z6JT 1BEYH 3NK4A 1MJ7L 3NUKA 4PWFA 3TBSA 1FLRL 3S9DB 2WOBA 5DFVD 1ACXA 3O2WL 4UTBH 5F7FA 5D5ME 8FABA 2P5EE 3QNFA 2WBJB 1TQCC 2O61A 1TQBB 3O4LD 4U1SA 3BGAA 3V8OA 1G9ML 4KXZH 5FYLD 4Y0GA 5C09B 4HU2A 4KJYA 5I66B 4MX7A 1Q38A 3P73B 4ZW5A 4YHKH 5HDRA 1UM5L 3QIUD 4RGOL 2ZE0A 5AEAA 1HYSC 1NINA 2DQIL 2YZ8A 3I84A 2NNRA 3QUMH 4O5LH 1AGEB 5D4HA 2EUXA 1WBXA 1WBYB 4F58H 4HFWA 3GRBA 4KRMB 4XP9L 2ADJA 4TTDC 1QZ1A 3E1ZA 3QNXA 5EMYA 4QJ3B 5A1AA 1FZMA 2ESVE 2XN2A 4ZMOA 1J1XL 4ABWA 3IJEB 2M2DA 3LV3A 4GS7C 5C07D 1DL7H 4JKLA 3CIQA 3DRTA 2OMTB 3M7OA 3NJIA 5IVNA 1RLWA 2Y06H 1JZ2A 3HZVB 3WXVL 3IDMB 1NSNL 1WPCA 5J12C 1QSVA 1SHMA 1UB6B 4R6UA 1R3LA 3UTTE 4G6AD 4F8QA 3UTZA 3BUDA 2FDBP 4UQ9A 4ZRGA 2NT1A 3QT2A 4I8DA 5GS0C 1A6VH 2DD8H 4MNQD 4P2OA 4Y1AD 3GGWA 2Q6WA 3HE7C 1YEKL 1ZT7A 2QVIA 3TA3D 4WFEE 3VQ2C 5EWIH 4BQ6A 4W4OC 3VU2A 2K0RA 4PRPB 1RZIA 4HP5A 4PP1C 3SO5A 3TU6A 1P7QD 4L37A 1YEGL 1XR8B 4GKNA 1HDMA 3D85D 1JZDC 4L4VA 5F1NA 2X3CA 1LLAA 1R6VA 5E7FA 5F70A 4DJMA 3FB6A 3IF1B 2WUCL 1DBAH 3IDYC 1IAKA 2C3XA 4AYFA 5SWSA 4R2GB 2EH8H 3AXLB 3MLXH 5IQ9A 2HRGA 2JKXA 4DF9A 3ABMB 1U93A 1FRGL 5LN8A 2Q20A 3GXDA 4PVBA 1F6AB 3HC3H 3CH1B 1E4XL 4ZMZA 4XMUA 5BS0A 4M5ZH 1CICC 1GGUA 4B60A 4QAMB 2E27L 3RL1B 4CILA 2HYMA 5D1QC 1GL4B 4PJ5D 5A6IA 3OKOA 1G43A 5KJRL 1N5YL 3W39B 1I7UB 3AM8C 4MCYA 4MMZA 1J18A 4JQIH 2ATPB 2F7IA 1GJUA 2BSCA 5HDBE 1T1YB 3BQVA 1HAWA 3QR2A 5BXFA 2AK1L 5D6DA 1QBMH 3GBML 3KGTA 4Y5VB 2CKBH 1VGKB 4RCAA 1PLCA 2AEPH 2VDOH 3FQTA 1WVZA 2VZVA 5LGYA 3KWXA 4JKKA 1S7XB 1Q0YL 2XWDA 2Y7OA 5ENWB 4P9HL 1AXTL 1LK3L 2BM3A 4FQIL 1CBVH 3PDOB 3MACH 3VM7A 1CDBA 4PJXF 4NAJA 4KPHL 2OFQA 3FQNB 4LOUC 3JBG7 2F7RA 1YMMB 1HE8A 1VFBB 4BCXA 1PZUB 3AG1B 1QD0A 3BLPX 1WIOA 2GSIB 2GY5A 2YEVB 4IRZL 1N7ML 2DJMA 4LNRA 4PG9A 5DGQA 1DHKA 1RUMH 4PBWD 3KH3A 1NEUA 3QO1A 3WTWA 4LSVH 3O9WD 4Y2DD 5D1XB 1J5IA 1OGTA 1VZGA 3DVNA 2J73A 3FCTA 3W5MA 2VDLB 1DVFC 1ZGLB 1FVDA 3A4FA 1A1OB 4RGNE 1N59B 3UOAB 3WIFA 4TSCH 5KG9B 1U8JB 5T1LA 3RU8L 3VFPA 3WJMA 1KPUA 3GMLA 4BV1A 4HBCL 3Q6GL 4FLQA 3V6ZB 5IUCA 1QUNB 1EUUA 2JI1A 4X6BB 2ZICA 2BWDA 2D3LA 4G6JH 1EFQA 1DQDH 1TQUA 1MZYA 1R24A 1WG3A 1KNOB 2BDNH 3NJJA 4KXCA 4IJ3C 3KPMA 5FCSH 5MEND 1WZ1L 1QFWH 1FDLL 4YSCA 1NCGA 1NAML 3GZKA 3H3KA 4L8DA 1KXTB 5IB2A 5MEPB 3NFPB 4QJ4B 3EZJB 3F12A 3BP4B 4URTB 4BFRA 5F89B 2WLLA 1AIFB 2WTRB 2E9BA 2HKHH 3TH3T 4RISH 3C08H 3MXVL 1D5BB 4Z7UE 1AZVA 3K0YA 5LXGL 3HE7A 1ZK9A 4MAYB 2EDQA 3RPIB 4G8EB 3BN3B 4NKOB 4U1NB 1QO3B 3DX9A 5TE4L 4W4OA 3PCYA 3ZO9A 4DUVA 1RSFA 4NP9A 3FQUA 3FTUA 1CLVA 2FO8A 3KW7A 3QI9C 3Q6FA 3QNYB 1NWPA 5DJDB 1BZ7B 3FB8B 3GSNB 4WHCA 2BC4A 3DC0A 3VFOA 1FIEA 1JUFA 2ATKA 4MQTB 2NSQA 1ZLWH 1HWWA 5BZWB 1EERB 3TYGL 3SD5A 3NEEA 4PBVC 2ZX5A 5AW4B 2DLFL 4M62L 4OCYH 2Q8AL 4A7SA 5DJZB 1DBBL 5JMRA 1TPXB 4NBZB 3FU8A 1N8ZA 4QRPD 3RHWF 3VGAB 4PRBA 5LLIC 5HVHB 4P99A 1P5UB 3GSWA 3HN8A 3RVWC 2EIZB 2F8XC 2NYYC 3FU7A 3UJTL 3FYEB 5FDYA 4YS4A 5D1QA 4Q2ZB 4Z3TA 2NLJB 4DP9X 3A4DA 5E7BA 3ZPDA 5DJ6A 3ZQWA 2EH7L 1EFXB 2WGXA 4OZHA 3AM8A 3KEDA 3UTSE 3VG9C 4DHLA 5F88A 3BO8A 3RVTD 4WW2C 1NBVL 2Z1KA 3QHFH 1EDHA 3R8QA 3CZKA 3MJ8A 1JZJA 2K9FB 2Z31C 4NNXA 3TZVC 3MGAA 1FJ1B 5E70A 2IDQA 5F1KC 1E8WA 2XIDA 3T0EC 1ZSHA 1CC3A 1JF1A 4GRWE 4AIEA 4C56E 5A6MA 4NCC1 4FLHA 5DFVC 4X5WB 2AJZB 3RBSA 1E4JA 1DDTA 1CYWA 3AAZA 3DTDA 5I71C 2QVFB 1YN7A 4NZFA 4JRXB 3FYIB 1A4KA 5GGSB 3ZYJA 3S36H 1ODUA 4XP4L 5DHMC 3E0GA 3L1EA 3QIUC 4KQ3L 1MHHB 4MMXC 3BD3A 2XYCA 1XMEB 3B8SA 4HWBH 4GUPB 3S5ZA 4ZDHA 2B1HL 3MYZA 1SF5A 1ZLUH 5LGHL 1C7TA 3F85A 4YSDA 1PS3A 3AG2B 1E27A 1CIUA 5D1ZI 4MJ6A 1KTLA 2IVFC 4TPRH 32C2A 1BJ1H 5D2LB 2OTUA 1HHGB 3MLYH 3U9PH 2BP8B 3BPLB 3F8UB 4NT6B 4OD2B 2ICWA 3G04B 5DWUL 4AEHL 1JFHA 1T5XB 4PRNA 1KTDA 3VXSB 1MAKA 3MRFA 4Y7OC 3GI8L 4HIQA 4MA7L 4LQFL 1HH9A 3UC0H 1OARH 4G6AC 3RWGB 4CMMA 5IFJA 3SDDD 2O5YH 4FTVB 2WZ5A 4DESA 2CO2A 4LFHG 1NUDA 4P5KB 1UCBL 3TA3C 2CDGA 2VC2L 1AHMA 2L04A 5J6SA 3ARFB 3QQ4B 2F1AA 2V9TA 4D3CL 1K2DB 4MDRA 5IMMB 1XF5A 2P49B 4AYBA 3A4AA 5D4JA 2CHWA 4PVMA 1URLA 1P5VA 5ES4B 3V5KA 5I76A 1SYVB 4GXFA 4KZCA 5FF6A 4ZTOL 4X9HA 4YDVA 4AJVA 3QI9A 1WLHA 2DEWX 5F3HA 5B1BB 3X14A 2ICEC 4NKIH 4U2YA 43CAA 3IPBA 4WFFE 4TRPH 3WY1A 2DOCA 1QRNE 1T7XA 3MUGB 4XAWL 4RWHA 4YNYB 5AAWA 5GGUA 4NP4L 1T0NB 3WNLA 1X7SA 2E7MA 3BUYB 3KPTA 1EZVY 2IH9A 2ZWYA 1C5BL 2CRIA 1HXYA 3RJOA 3MFGB 4U3XA 3SDCB 1NOLA 3JWDC 5GSVB 3GKWL 1JF6A 1QSED 5DC4B 3OR7A 1U92B 1MWAA 1I8KA 2BFVL 4M8VA 4P04A 1NCDL 5D7KE 4OAWB 1UH2A 1CFQA 3CHPA 4X4XA 4ZUVB 3BVNB 2APVA 5LVEA 1MI5E 3WKMH 3E2HC 4YSSA 4LSQH 4M7ZC 2A9DA 2ILLA 4IW4C 5I1EL 5FUZL 2EDEA 4WW2A 1X4YA 4LLYA 5ESQA 1NJ9A 1A6ZA 3KYMB 2Y7LA 3FN9A 1GIGL 5FM5O 3P0VL 2WWNA 1JWSB 1Q9KA 3TZVA 3ECUA 3BPNB 3FAXA 3VH8B 2M8XA 3DPDA 2QKSA 1SBBA 3T0EA 4HUVB 3U36B 3B6SA 4TM9A 5CINH 4KNTA 2H47C 4N8CL 4KK6D 4UM8B 3RDJA 4L2YA 4YJZL 5L0QC 1UATA 1TTFA 4EXKA 1KBPA 3O9WC 4JO5A 4Y2DC 3S35L 3CLFH 3O4LA 2GBTA 4P4RB 2ZAHA 2JQMA 3ABGA 4NGHH 1DE4A 1PLBA 2EKSB 4JJ5A 3U1SH 4ZMWA 3JWOH 2YD1A 3D4GA 2CPCA 3QIUA 2VDNH 4MMXA 4YGVB 1VDGA 3GRGA 4W9EC 2O6CA 3OF6D 2V3FA 4I9WE 4FI8A 3EO9L 3G08B 2CJTA 3VFUB 1X7QB 3N0AA 5E56A 1FL3A 1V7NH 3T0DA 3MV8D 4OZHE 1TCMA 2X0VA 5IEKB 2X1WL 5IBTL 1E2WA 5C07A 4F24A 5D9SB 3ZTJH 1G0XA 4XNDA 3QQ9D 4XCEB 4NQTA 3U2IA 4WV1B 3ZU8A 5AWNH 1CLCA 2GAZB 4HH9A 5GGRB 1ZLSH 1JHTA 5TTRA 5L7XL 4MNQA 3NSCA 4ZO9A 1QPXA 3BE1H 4Y1AA 2C3GA 3IWUA 2W0LA 3IYLW 1NFDF 3TA3A 5CO1A 2IADA 2P80D 2B4CH 1NFAA 3QSKB 3ULSA 1VERA 3EYVA 1P7QA 2AQ1A 2QFRA 4UINH 4POYA 3NCWA 3D85A 5HGAA 1QA9B 1KIQB 5K1NA 3D39B 4O02B 4OKVB 1RUKL 2WXLA 4UUJA 2ICEA 2VSCA 3LN5A 2BS71 1C12B 3SYAA 1PY0A 4Z7WF 5I30L 2X7LB 4AKOA 4S1RH 4J2XA 2YARA 3OHMB 4OR1A 4ODXB 4YDLB 4I3RL 4XPGL 3K4ZA 3HPLB 5K39A 5JHLA 2XUWA 1A7OH 2VLRB 2LFEA 3MNWB 1I9JL 5HHQA 5IMOA 2EEXA 3P2TA 2ITCA 2K6YA 1I75A 3BVUA 3LNEA 5T3ZH 4U7KA 5D5MB 2P5EB 3CZLA 1R3JB 2D7OA 2XZCL 2P26A 3GM8A 3JSSA 3O0RH 4QOKD 3C2SA 4KMTH 5A43C 2AV7A 3LZNA 4PJ5A 3WJJC 2R0WL 2UZYA 2HJFA 2WAQA 1FAIH 4UQ3A 1JNLL 2AQQA 2AV1A 3MUZ1 1RZ7H 1OM3L 3KR3L 4F8NA 4G3YL 1Q1PA 5I2IB 2NZ9D 2HT2D 4JFOA 4MMYA 3RVTC 2FATH 4JZNA 4FQQB 4PV8A 1MWOA 4UDTA 1YPZF 2CR0A 2VUKA 3HC4L 2OL3H 3Q1SH 1TXKA 3V4PL 1HL4A 5SX5H 2ESVB 4P2AA 1EAQA 4RRPM 3UC2A 1E4WL 5C0JB 3C60C 4GOSA 2XQBH 3S88L 1BQLL 1LDSA 5DRNA 1B4TA 3GSRA 4HV8B 5AL8A 5TFSL 1WUNT 4OJDH 4ZMNA 1SMDA 4Z0BH 2FH6A 1D5ZB 3UTTB 2NY2B 2CD0A 5IEHA 4LLDA 1PZ2A 2BSEA 3AREB 3BDXA 2HFGL 1U8CB 3CN2A 1HHHB 2JSFA 4ESKA 4XVTL 5IESL 1I7ZA 4H88L 2FO1A 2X3AA 3T65A 2QELA 3O9WA 5CLZA 3QISA 3FN0L 4PQXA 1YG9A 4Q0XH 2P8PA 5DXWA 5JTWA 1U4EA 4X8CA 5KYXB 5LWYH 2LU7A 1OALA 2IQAA 1RIVH 1KPVB 1UEMA 3FUFA 3L9EA 5D1ZB 5IK3A 1NAKH 5E9NA 2F18A 4PJ8D 3ZDYF 3P77A 5CF3A 5EO9B 2EDKA 4NZUH 5CSZA 1NMCC 2B08A 4Z78B 3CDZA 5MENA 3H7LA 5DU7A 4ZW6A 4P5MB 4PWKA 5BNXD 1LL1A 4KI1A 4PY8J 2Y7QA 3SDDC 1EXUA 2QHRL 3OAZK 4IMLB 5LBGA 4KDVA 3APCA 3U7WL 1KIUA 3HLAB 1Z9MA 1AFVL 2CK0L 2WQAA 1AJ7L 4IS6B 4U1GB 5J0BA 1BJMA 1Q9LA 4JPKH 4U1MB 5HDLA 4D9QE 4YE4H 4HK3J 1A7BA 2OMYA 3LKPB 3FOMB 5AZEH 2ZKMX 2DQGL 5I74C 5IVZB 1EJOH 1GGYA 1WRFA 5D7SL 5DCCA 2OMNA 2VDQH 3MR9B 4MJHA 1A2YB 5D72H 3O2DH 4Q9QL 4QHPA 4LT7A 2XT1B 4YLQT 5HDBB 1DQQA 3DHMA 5IGXH 1HKFA 2JQZA 3VM5A 1QEWB 1NGQL 4TTGA 1BVLB 4R83A 2W9LA 4PRDB 2OR9H 1FPTL 4H4NA 3QUHA 4XN5A 4DP4X 3KM2A 4EAEA 5I0YA 5CWSB 1SN5A 4J1UA 2Z8RA 4I5BB 3T0WA 1R46A 2C3WA 2J1KA 3HAEB 1G7JB 4OCRH 3D0AA 3DTXB 1NGWB 1KLUA 3H3BC 5CR1A 2A9NH 3QQ3B 5IT2H 4Y19E 4PBDA 5DVLA 1RZJH 3HMWH 3V0FA 3K91A 5A2LH 1SN0A 2L8AA 4QRPA 2FWUA 5DRXA 4AV4A 1MW2A 2BMKB 4XB7A 5JPMB 4GW1A 1SFHA 1UOLA 1YEJH 4F7CB 4G6MH 1N18A 1UYWL 2FHCA 2HB0A 2WC7A 5FYKL 3GO1H 4R26L 4XO3A 2ISDA 4NJAL 1S9YB 5C07E 2WB1A 3VD4A 4GJTB 2W07A 3WJJA 4UB0L 5DF0A 3FB7A 4NUJA 1KJ2H 3KM1A 4RGNB 3SKMB 1T5WB 3L9YA 3RWCB 1O0VA 3U46A 4ZSOE 2WLHA 5F7EL 1E5ZA 4JFPB 4MNQE 4OCLC 4HKJB 3SCMD 3TT3H 1IE5A 2EC9T 1HL5A 3LCYA 1UXLA 2WBWB 3LKNB 4M1CD 15C8L 3KNBB 3EFFB 3L3JA 3P9MA 5AVYB 2VM4A 2X1OA 3IMBA 3LN4A 2JWYA 4XCFL 5DK2A 5DUML 2EDOA 4A1RA 5AG8A 3VGGA 4YQXL 3C60A 5JQHC 1G4RA 3VCLA 1M3IA 2EIDA 3JT0A 5L9DH 3PHAA 4KK6C 1QLEB 3BISA 4KKCD 1YJDL 2JV6A 4L8SA 2LAAA 1ZMYA 4HFUL 1N4XH 3CVBA 4DVRL 4Z7UB 5KVFL 3SE8L 1KBGH 3B56A 3KZ8A 1QYGH 1SDYA 2J3SA 4TNEA 2W9DH 3ULVF 1XH3A 2DZEA 4AW7A 2AJSH 2IXQB 1D5MB 1NL0L 1T6VN 2CIKB 2P44B 2YN3A 3S5LG 3IFNL 3IXTB 2MIZA 3T4AC 5D7LD 2GBAA 1KCKA 4DN4H 3W2DL 2Q8BL 3WLBB 3ASOB 4I18B 4Q56A 4MX7B 4HXBL 4TV3A 4WU5B 3OLDA 3NEXA 5CEZE 4L1LA 4HKZA 3F7YB 3Q8FA 1RZGB 3KDPB 4TVPD 2YD3A 2X9ZA 4B5EA 3HN3A 4MXWH 3QQ9C 5E1IA 3WY4A 2CGRL 4OUOA 1BQHA 2V5RA 1E4KC 1RI8A 1RURH 3JYBA 4Q9BA 4NUGH 5IQNA 2DI9A 3FU0A 2GCYB 1FZMB 3SDDA 4LDEB 4I77L 4JDTH 4E9VA 3LV3B 1CLYL 3KH4A 4WUUD 5LBSL 1E28B 1FFNA 2AXHA 1B0GA 2C9SA 4GQ9L 1ZKAA 3UTSB 1VHPA 3AITA 3QUMA 3W3BA 1AGDA 4QO1A 3GS4A 3IE4A 2NW3B 3GGWB 4UAOC 2JI2A 4ANUA 1NMBH 4YDIL 1XD0A 3CVIL 2OV0A 4IDLA 3VSTA 4N3TA 3VI4A 4F91B 4N2EA 4NB7A 5EULV 4EUPG 5I6NA 3DARA 5D4QA 3ZE0E 3IDJB 4JJOA 4F80A 4L37B 5GSRA 2ZUWA 5GS1B 2ERJC 4HZLB 4GRWB 5EC2A 2OYMA 4C56B 2E9IA 4K9EC 3B2VL 2EYSA 4OV5B 3LPOA 4ES9A 4BKLB 5I17A 2IDCA 2JXMB 4YOKA 3O3EB 1JV2A 3EYUL 4TQEL 5IJCC 4AYFB 5KYYB 1ZHBB 3GZPA 5ESVA 1QSEA 4FG4A 3FQWA 2D0HA 2NDGA 3Q9PA 5F6HJ 1C8PA 5KBKA 4CGUB 2Z3FA 4Y89A 1IGCL 4LLQB 2EDTA 3ZKXB 3O6LL 3M07A 3PFQA 3LXCA 5GS2H 5MENE 4K73A 1MIML 3EBHA 2NZ9C 2HT2C 3SZ6A 1KYOJ 3RGVB 1XB6A 5AOLA 3FT9A 4AUUA 4TUJA 3H53A 2KERA 2NX5E 2Q7YA 1MQ8A 3UH8A 3ULVL 2NY6B 1I9EA 3II2A 4C47A 5INDB 3UPCA 1MPAL 3H42L 3BWUF 3VXTA 1IAMA 4PJAF 3M1BA 3LKSA 3FT3B 3MYJB 5HDOA 3EJRA 2A3TA 1SUHA 4WLCA 5DA0B 3GZOA 3C2AH 4G80B 4OZIE 5ADOL 3VQLA 4HIJB 5IG7A 2XKUA 3V0WH 1EEYB 5BXFB 5C7ZA 5EUOE 1ILUA 5T3ZD 2CHNA 4IJTA 4DO5A 4OJCA 3BP7B 1XGPA 1CXHA 3FPXA 1T6BX 1E8ZA 3QWNA 4LL4A 1KG0A 4YZFF 5K1VA 4FF9A 3CFEA 2PCFA 2Y69B 4KX7A 2D4FA 2BVYA 2RH0A 3BVXA 1I8MA 3BPCA 1H3UA 5I73C 4TOYL 3VRJA 1YQ2A 4NRXB 3WY3A 2FD6H 4RAUB 1DSFL 4JQIA 4TL4A 1JGVL 1GW6A 4HIHA 5IW1A 3KXFD 5FW8A 3KLSA 4JY5L 2Y24A 3L4CA 3II1A 5IQ7L 2YOAA 4ETQA 4FQCL 4G7YH 3BP6A 3FQYA 2CKBA 1YUKB 3RB7A 1HN1A 3QO1B 3QFGA 1QRNB 3ZMNA 2VUYA 2DYPB 3OF6A 3T4AA 4FNLL 1HNYA 4M61A 1MY5A 3DVNB 4R7XA 2IAMA 4AWJC 4OW6A 1EHLH 1WC7B 4NPYA 4XMPL 2F8OA 3MV8A 4KZEL 2EDJA 4M93C 3VFPB 3WJMB 3RIAF 3OSVA 3KVPA 7FABL 1HOCA 2GK0B 1IGTA 2JLLA 4JG9A 1CU4H 3QPXL 1CURA 2R1YB 1E4KA 1A0QH 1Y6KR 4CNIA 3N1FC 2MNWA 3INUH 5EIIG 5KSVA 3CSGA 5IB4B 3IGAA 4GAJH 5T3XL 3HG4A 1AGBB 3ARDB 4JDEA 2DEYX 1H3XA 3D69A 5KVGH 1WSST 2P80A 4FYRA 1JWMA 1U4FA 5ABDE 5DRZA 4R90L 2QSQA 3QCVL 4K07A 1R3KA 4MA8H 4WNQA 2WINA 1RERA 4J8RB 4DW2L 1MI5B 4NI6A 3WO3B 5TGBB 5DEGA 1U36A 1IILE 1EAPB 2BVUA 4PJ9B 4QF1B 1YNKH 1G6VK 3HE7B 1J9TA 4BFIA 4MD0B 5K9OB 1JGUH 3AXHA 1TKWB 1S7QB 4JUTA 3BFQG 1J0JA 4Q9RL 4IRSB 4M8QB 4L1TA 1DUZB 2LFGA 4BA8A 5JZ7D 3KLDA 4PS4H 1J5HA 4N9GA 3WN5A 4OZFB 3BUIA 4NXSA 4M7KH 1ITBB 2TRYA 1HSBB 1NDTA 1DZ0A 4EI5D 3VFOB 1AQHA 3CN0A 3VSVA 2FWSA 2ZUQB 4N3UA 5C71A 2V3EA 3QJTB 2WN2A 3IDGA 2HVBA 4PJHA 2R4SL 4URKA 4G7VH 1UKTA 1ZSDA 5EG6C 5FM4A 1VLXA 2F19L 1IGYA 4XCCL 1AR2A 4B0MB 3VWKD 2QQQA 1UA3A 3LZFH 3UAJD 1E4HA 3RFZC 2ROYA 3GSWB 4BZ1H 3Q5YA 4HJIA 3Q2CA 3SCMC 4PD4K 1CICB 4D0BA 3E38A 4M1CC 3EDKA 1FIGH 1TJIH 2EDHA 5FEBA 3HUJF 4D2NA 1OPGH 1KFAL 5JXAL 4OD1H 5ID0A 4OZHB 1X9RA 4YXHH 3E8VA 2X42A 3QG6A 3BO8B 3QRBA 3T8XB 2DMBA 4FQHA 3SDXE 1FNGA 3LIUA 3C5ZB 4KKCC 3JV6B 5AW6B 3VI4E 1XF4B 3MUUA 1FV1B 4BQBA 2EIKB 3I50H 1YUHA 2GJZB 4JG0H 3X3GL 4FNUA 5I1GH 1I1RA 1TETL 6FABH 3KLQA 1SRDA 5CILL 3ABKB 3MJ9L 4M7LT 4ZW7A 2A6KB 4M7LH 4QUOA 1IC5H 1ZHLB 4XE0A 3SKJH 5IR1B 3VFWB 1J87A 2E9JA 4Z7VF 1YN7B 1AG6A 1W0VA 1QSEE 1A4KB 4KNUA 1MCRA 2BCKA 3CZGA 5GRXG 3LKQA 4P07A 1NGZA 3RL2B 3MLVL 1W6WA 3HFMH 3HNVH 1A3RL 4AEFA 1E50A 3LNIA 3K8MA 1UWYA 1MNUL 1Q0EA 3MSPA 4ORGB 4NZJA 1WCBB 4I3GA 4ZI8A 4H20L 4HX1A 3DUUA 5CBAB 1ES0B 1R3IL 5TQ2L 1DVFB 2KC0A 3GZQA 1EGJL 1MFBL 1KTLB 2ZKWA 4I85A 32C2B 1BVNT 1GKOA 2VDKB 1U8NA 4FLOA 4O4YH 1Z9LA 5EOCH 3TIDA 4U6TA 5E8EA 3VRLF 4TSBH 1XF3B 4R97C 3FTWA 2XZQH 2VJ8A 3JWOC 4FQ2L 5TPWH 4NHCL 1F1GA 4IJ3B 5FK9A 1HH9B 5EDXA 3CVHB 4HWBA 1KTCA 3EFDL 5IFJB 2ZXAA 3Q0HA 5DUJA 4PJIE 2BVQB 1Z0MA 2HJKA 4HOWA 2ZIDA 3CMOH 4LCWE 3PWJA 1HL8A 5JR1L 3W56A 4MAUH 3CQQA 3US0A 4FI6A 2YLKA 1S5HB 1YNLH 1XF5B 5T1MB 5EZLB 2XPYA 2DQ6A 1UH4A 4G5ZH 3FRUB 1P5VB 4LLVA 5EUKB 4DSYA 4YPGA 2WWMD 3MROB 1ADQH 2DMCA 2NZ1A 3QI9B 4EKXA 4J3VA 2XU9A 2GJJA 1KXHA 1IKFL 4G42B 3WIHH 4DETA 2HT4D 2W65B 5DYOA 2MHAA 4DKFH 1CXLA 3RBGA 4L0YA 1D6VL 5SWQA 1M7IB 4GLRH 5DQDL 4LBEA 2XG5A 3UACA 2OXGB 5E8OA 3MV8E 4ZXBB 3U0WL 3R06A 1RK0B 1BVKB 2R1XA 3QQDA 3UCQA 4QXWA 1E7UA 2BOBB 1NH6A 2QR0A 1CLOL 2DQUL 1A4BA 1P84J 4FQ1H 3S2CA 4WEBL 5DJXB 4DFIA 4Z5RB 4FQLL 3L3DB 4F92B 1LE9A 2ZF8A 2X1QA 3TT1H 2ICWJ 2X5PA 4MBRA 1I8KB 2IJ0C 1J11A 4UV4L 4FNSA 5HYFA 4OGZA 1ZXKA 3TEXA 5ICYB 4GB9A 1NC2D 1R1CA 1AE6H 2ZG2A 4FFYH 1OWRM 3QXWA 3TBBA 3F7PC 2AQSA 2YGPA 2M26A 5JHDD 2B20A 4WDIB 1SF3A 1KN2L 1FORL 2Z91B 2O93L 1L3NA 3GSQB 25C8L 4YEFA 2IGFL 3QUXA 1TJGH 5F1IB 4CRPA 3MCLL 3AZUA 2GFBA 4E36A 5HVGB 5CEXA 3DLQR 4H5SB 5IHLB 1MRDL 2Z31B 5GS2D 2I25N 3RIFF 4BKTC 3QO0A 3QAZB 1EBAA 2K1MA 4PGBB 2MOGA 1LD9B 1DQKA 4LVEA 2GHZA 4P3CH 2R23A 4BH7B 1F56A 3IVKA 5T33L 1UOVA 3H3PL 4R7DB 4P23D 4X4ME 2VUOA 1DCEA 2LAGB 3NYKA 4XMLL 2E75C 4QOKE 2VQ4A 5HGHA 3QUZB 3FB5A 5D7LA 4OFYD 1DEEA 2NMSA 1TJHH 4K94C 1KT2B 5DJ2B 1S3RA 5FGCE 1N10A 4JCWA 3K1KC 1U2CA 2VXTL 4Y19B 2LVEA 4NN6C 4O51B 3RWJB 1R5WA 4BZ2L 4Y16D 3FCBA 3L9BA 1I31A 2X6UA 1ZWIB 1AR1D 2ZCKL 3IAPA 1PIGA 5IMLB 1MCOH 2A74C 1INDL 4ORZC 1J5CA 1SDDB 3U2JA 2DKMA 1SXSA 2DMHA 1ZGLP 1Z3GL 2A1WL 4GW4A 5C07B 1KPRB 2IG2L 5ALCH 1N19A 3FU5A 2R7EB 2IMNA 4Z3EA 3OKLB 5EO1A 2PPCA 4WFGD 1ECZA 1OP5K 2Z0UA 1KZQA 3KYKL 2KBGA 4N2MA 3V7AE 1KB5B 4ZSOB 3S8WA 1M6OB 3EJYC 3NIGF 1F4WH 4MNQB 1JTTA 1FAKT 2YAEA 1J9QA 5ABAA 2PKDA 4P59H 5EF3A 1BW8A 3GMQA 1ZAGA 2IADB 2K3HA 4PW9A 2DLTA 4YFLF 3SJVD 1TOXA 5A2IH 5JZ7C 4KFZC 2YRPA 3ULSB 4KZ0A 4A2MA 3FJTA 2FBRA 1UHVA 4P57A 1P1ZA 1DBKH 3BVTA 3VNYA 1RJZB 3D85B 4M5SA 4YHOL 4UT6L 4EI5C 3VXNB 5ICUA 4HS6A 3SKNA 2FQEA 1KJVA 1J9RA 2FJGA 2FNBA 2XA3A 2CLZA 3ETBF 1U8OB 1EWHA 4L2LA 3W0WD <