3WTYA

Crystal structure of the complex comprised of ets1(g333p), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
118
structure length
118
Chain Sequence
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 17
structure length 118
sequence length 118
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtyA00
4IBZA 5AB9A 2ADYA 2J20A 3VD2A 2P52A 4LOFA 5ABAA 4KVPA 2AC0A 5KBDA 5AOKA 1EANA 2IOMA 3D07A 4IJTA 3IGKA 4IBQA 2J1XA 3US1A 5G4MA 4AGQA 4AGMA 3D09A 2ATAA 2X0WA 3D06A 5AOJA 4AGLA 5G4NA 5LGYA 2J1YA 4IBVA 3VD1A 2GEQA 3WTTA 1IO4C 3Q01A 3WTWA 4IBUA 2J6WA 4IBYA 1CMOA 3EXLA 1HJCA 2OCJA 2XWRA 3KMDA 5AOLA 4LOEA 4G83A 4GUOA 2XWCA 5BUAA 3QYMA 4G82A 4L18A 4IBSA 3Q05A 2BIMA 2FEJA 2X0VA 3VD0A 5AOMA 2RMNA 1GZHA 3D05A 1TUPA 4HJEA 2J21A 2IOOA 1E50A 4L0ZA 4L0YA 1EAOA 2BIPA 1T4WA 3QYNA 3WTSA 2WGXA 3US0A 5ECGA 2BIOA 2AHIA 2J1ZA 4MZIA 3WTUA 4LO9A 5A7BA 1CO1A 3WTXA 2J1WA 3TS8A 1TSRA 3ZMEA 2BINA 1LJMA 1HJBC 1KZYA 3KZ8A 4MZRA 4AGOA 2YBGA 1UOLA 3WTYA 2IOIA 1GZHC 4IBTA 3WTVA 4AGNA 3Q06A 1H9DA 5LAPA 3D08A 2PCXA 3WU1A 4AGPA 2MEJB 1HU8A 4QO1B 5AOIA 5G4OA 3IGLA 4XR8C 1EAQA 2BIQA 2H1LM 2X0UA 3EXJA 4A63A 2VUKA 1YCSA 4GUQA 4IBWA 3D0AA
chains in the Genus database with same CATH superfamily
1N0LB 4HKBA 1BIIA 2P80D 3QUZB 1U33A 1N12A 1B0RB 1JV5B 4Q9CA 1HXYB 1N8OE 3RPIB 2CWRA 3BSGA 3CMOL 1GGUA 1MFCH 4NQCD 4OF6A 3KBEA 4W6XB 1MIEH 1RD6A 3EDFA 4WFEE 1PFCA 5JPMB 3HMWH 3CCHB 2LR4A 3S2AA 2VLRD 2JI2A 4XPHL 3CVBA 5IT2H 1HIML 2ADFH 1J1OH 5EZIL 3O3UN 1OPGH 2R1WB 4L8DB 3O2DA 1DJSA 2CMRH 3CN3A 4NM8L 4N0CD 4ZO9A 2M2DA 2OS7A 3QQ3B 4XB7A 2XWTB 4NNXA 4XWOD 3ZDZB 2NW3B 2FO1A 5C7ZA 3P4LA 3QI9D 1FP5A 4UNVA 4OT1H 1TJMA 2OMTB 1U21A 2ZD0A 4W9HC 5HI5D 4QDGA 2BFVH 3OJDA 3OKDA 5CHNA 5F9AC 5IV2B 4WCYL 3UTTE 1J8SA 1QEXA 4P57B 4BZ1H 2A6KB 3E38A 2MQGA 5JW4Q 4JAMB 1IL1A 3DK0A 1NMBH 3EO0A 4V11A 2BOBB 1J7VR 5T3XH 5LDSA 5C6TL 1RPKA 2BW5A 4DGVL 2XWJA 3QB7C 2OPCA 5E51A 2R1XB 2DI9A 1VFMA 1E28A 5FAAA 3H7BA 5D7SL 4XWGH 4XN7A 2UXFA 4R26H 2DLHA 3ARUA 4U1GB 2JXMA 3D05A 2IPTH 2IOOA 3LH2L 4X7FC 1FGNH 3J7HA 3PABB 1JF6A 4MJIA 2WQRA 2ZX7A 2MQ3A 3I50H 3NCJH 4MTMA 4OZFH 4XTRC 3VXMA 4ZMNA 1VLXA 5F0PB 1JNNH 3WNNA 3GBNH 3QEGL 4MJJA 5IEKB 1QTSA 4WJ5B 4MZ2A 2A77H 2BY1A 1XGQB 5EORH 3HI1A 4H7VA 2E7LA 1JWSA 3FT0A 5T5NF 4B95C 4K71B 1UWYA 3O6LL 2EIMB 1G7IA 1M7IB 1CWVA 3INUL 4N5ED 5FV1L 3ZT6A 3VI4B 1QLEH 3PL6C 1QA9B 4UOQA 1DSWA 2YKKA 4RAVA 3FU5A 2R0LL 5D2LE 3BCFA 2X2YA 1E4JA 3HNVH 4I0PC 1M57B 3BEVA 3T0EB 1A4CA 1ZT4B 2WLIA 3QQDB 4I4WB 4B27A 3CN0A 1A4KA 2WBJD 3QJFB 5DR5H 3QXVA 2WM0A 3U4EB 2DQGH 3P11H 4JM2C 3KL5A 3V8CA 1YYML 4Q6IA 4XOBA 3ZE2F 4D8PB 3H9SA 3GKWH 2V0AA 2F7PA 4P4KA 4A63A 4YGVA 4NO0B 3VYOA 5KSVB 3NJJA 5IQ9B 4JRXA 1Q9LB 4LVOC 3PV6B 4ZW8A 3GI8H 5DQJA 4LLWB 2IXQB 3GPSA 4JMXA 4EN3D 3L6FA 2H32H 2L04A 1SXCA 1BOGB 3MRDA 5KSBE 1UKSA 3WN5B 2Y22A 4DKFH 2XTJB 3HE6D 2DWDB 4LLQA 1F02I 2DLTA 3RHWK 1CICB 3T4YA 4AG4H 4WTZG 1WIUA 4DKEL 2VZVA 3DBXA 2RQEA 1IKFH 2EYSB 3TBWA 3VXUD 3ULSB 3DIFB 4MNGA 1AQ8A 1MCOH 2ZWLT 3AT8A 2C4XA 4QXGH 3D09A 3FO1B 4KROD 2X4SB 4UNTA 3DX9B 3K0WA 2WSPA 3ARFD 1TNNA 5TE4H 3LD8B 2CIIA 1U8NA 4LQFH 1IAKB 1XF4B 3LKSA 3W5NA 1NAKL 1ZEAL 3L4XA 4KVNH 5JHAA 4MQXD 1XXFC 4J5VA 3P0GB 2FNWA 1M7XA 2VQ4A 1NOFA 1Q9OB 3BQUA 4MXVF 5I6OA 3KVPA 2XSKA 5I6XB 2ENYA 4H13C 4Y4HC 4ANXA 1SYSA 5T3ZD 2I9TA 3GSOA 5I0YA 2C9AA 4JEGB 4RMRA 3BWZA 2ZYHA 1RSYA 5E8DH 2MTPA 1MCEA 2WZ5A 3ETTA 4FYSA 3TF4A 1TETL 1JHLL 2G3ZA 4ZAKC 2RMNA 4U1SA 3KGSA 5FWQA 1S3KH 3SODB 4NKOB 5JHLH 3FQWA 4C58B 5F6HI 4PJHE 4G8AC 5FF6B 3VFVB 3GSNL 3O2WH 5CJQH 3FCSA 3IRCA 3EG9B 1WCQA 3OMIB 5DFVD 2EXYC 4FHBD 1MAKA 1N0XL 2BVYA 4AI7A 3LTVA 3HG5A 4QYOB 1AI1L 1M2OA 2NTSP 1BOYA 2XQYA 3CHXA 3H3PL 3CFCH 3UJIH 3KD4A 4OFQA 3ZT7A 3C9NA 4OD1L 2X4TA 2DQIL 3CFKB 4FG6D 3DETC 5TF1H 4FQQA 3SPVA 1MZZA 4PVMA 3MGTA 3FSZA 2NY1D 2FX7H 4BQBA 5SWZE 2NY3B 3FO9A 3L5WA 5CLXA 2Y72A 4Z7UF 1MCQA 1U8QB 1BD2E 3S0PA 1U8IB 2C26A 2GY7B 3C5XA 2AXGB 3KH3A 3H9HB 4QOKE 3D0AA 1ZHNA 1SF5A 4J2XA 3GBEA 5DFAA 3CFDA 4Z7NB 1I1RA 4WI0B 5I8KH 5DC9B 1VFOA 5FOJA 5IUSA 1UM4H 3QIBB 2NXZB 2ZP8A 2ZSWB 3I85A 3JVGA 4MFHA 1HZHH 1OT2A 5L7XL 1AANA 5AW3B 3SE3C 2ICWA 3HUJB 5A3IC 3QPXH 3PGFH 4P5TB 4NHUA 3W37A 5A16B 1VEOA 1RHFA 1OLZA 1NCCL 5JNYA 4EIBA 2AQSA 5C0AD 3IDMB 3BKJL 1TCRA 1Z9LA 3S98A 2P44B 2OMWB 2H41A 3HTLX 2ZPKL 1I8LA 1WH0A 4QHLA 5CF3A 3AXIA 1I9JL 2JIXA 2O6EA 4YE4L 2AV7B 1MFAH 1VGKA 2XICA 4AKPA 3HRZA 1CBVH 4PGJA 4ZD3L 2DIEA 1F90L 1FL6A 1FZKB 3BZ5A 3C12A 3F6JA 4KC3B 4MD5A 3TA3D 1KXQE 4XMPH 4YUEH 4ENEC 2Z4QA 3D3VA 4GAGH 4WO4D 3WXVL 2MPAH 2AI0H 4NZJA 1XAUA 1JWMA 3DUSB 5BXFB 2JKLA 1S2EA 3V6ZB 1ZJBA 5CR8A 2L7EA 2PPCA 1T89C 4BYHA 3VD0A 4ANVA 1FH5H 4WW1A 4X6DB 2JFCA 3SQBB 2OXHA 4OM0H 1J05B 4LSUH 3NZUA 4XX1E 2D7MA 1CD0A 3S3BB 2QGEA 2VITB 1XGUB 2GCYB 5LN4A 4HQQL 2BNQB 5DF0A 1W0VB 2XWBB 2QQLH 1P5UC 4GJTB 5D4HA 1EX0A 2BVPA 5TE7L 2CA3A 4APXB 3E9UA 1KZQA 4F7MB 5I2IA 4J39A 2EDXA 2CR0A 2R2EA 2YXFA 3HBGA 5SV4A 4GMSH 1FFTB 4M5ZL 2C8NA 1ZMYA 3MLSL 5JA9A 3B43A 3BP5A 4P59H 5CFHA 4BRVA 3KYAA 5E6IA 5IJKC 1GC1H 1IBHA 1SBSH 4AUUA 2QQNH 2YAOA 1P7KB 4JY5H 5MEOA 3EOTH 1JHTB 1QEWB 2QZQA 3FCTA 5BOPA 1RJZB 3DECA 5HYJB 3WG7B 3C5ZB 1FLRH 1O7VA 4IOFC 4LCCC 3GLDA 1VCBC 1TYJA 2EEFA 1WPCA 2VT0A 2VQTA 1TENA 1NUDA 3QHFL 3TC9A 2V6HA 4FFYH 3TURA 5CJOH 2HTKC 4RIRB 4UIMB 3CX2A 3QAZB 4TNEA 2ZXWB 4QTFA 3KS0J 4N8VG 3BGFC 3B6SA 4EI5A 1EJFA 3RDTA 2QLYA 3PWPE 2PWGA 2VH5L 1U6AL 4GP5B 2IPKA 3FL7A 1MJJB 2GBVA 4OZFG 4AL8H 3ALXA 5F7BA 4NZ8A 5C0ND 4X4KA 5IMMB 3OJ2C 2AEPL 4XZ4A 4RFEA 5ABAA 3Q8BA 5AKTA 3IMSA 4B9CA 2PXYD 2GJJA 3MLWH 1M53A 3VWJD 1RZGB 4DEWA 4GSXA 4HPHA 4CGTA 4OLUH 2D73A 5IR1A 1AS7A 4GQRA 1SY6L 3S36X 3BT0A 3IRZA 4JGUA 4ZTOL 4LSPH 4JFHE 1NGWA 1WITA 4N0YH 3QDMA 1J8RA 3MLTA 5DJ2A 4Z76A 2IV8A 3A67L 2PWDA 4XP5H 5KVDL 1S7SB 2B3IA 2F8XC 1OEZW 3STLB 4PG2C 2HG0A 3VU1A 1A4JA 1CDJA 3WS6A 4QRPA 5D2NA 4F15C 3ULVH 3BVDB 1FJ1B 1L0YA 5DO2D 3QJZA 2VJ8A 2VXUH 3IVKA 2D0HA 4FCHA 2R39A 3FQ2A 1IKOP 4U1MB 2Y6SD 4PREB 5AB1A 5T3ZH 5TDPA 4JFDE 1IQWH 3KJ6H 4DWHA 1OAQL 4RGMC 4ZFOB 4OLWL 5GS0C 1HILA 2R8SL 3RWIB 4QRUB 1F8TL 3GO1L 3MUGA 1HAUA 2OMXB 3ARRA 3FB8A 5CP3A 4FLQA 3NFSL 4PJBF 4P4RA 3E1ZA 4QAWA 2DS4A 4XPGL 5GZOA 4KAQL 5IKCA 2V7HB 3NTCL 3ILPB 1ZK5A 2WJ7A 4HS6A 5H37A 2NY2B 2Z91A 4K23H 4AE0A 1K8DB 4FMFA 5GRUL 3ME0A 2O26U 1G43A 4RNRB 2D03H 4Y4FC 4MNHA 4KPHH 4Y5XC 1HQ4A 3LEYH 1G9EA 1XGRB 1ZT7B 3MLUL 2F54D 2OL3L 1X5LA 3OB0H 1DQMH 5I1CL 4PMEA 1FO0L 2KKQA 3CDGA 4PJAE 3VRIB 4WUKH 2HRPH 1ZHLB 3IGUA 1RZ8A 2CIKB 3LYRA 3D33A 3FTGA 4PV8B 5LCVL 4BUHA 5J6HA 1ZV2A 3M45A 4RDQF 1G7LB 3U2SB 4FFTA 3HHSB 4OCLC 5CBEA 2HUEA 3POHA 4MQ7A 1DBAL 2B1AH 1IAIM 3SDXE 3KXFE 3BRDA 2DQFA 1GL4B 1HHJA 4Y8DC 3O2VL 4M93B 5D1XC 5C09B 4YQXH 1J8HA 3NJLA 2AJXL 3T8MA 3TO2B 5KYYB 3V0IA 3CDZA 1OCWL 1FNGA 4J27A 1IAOB 3VW3H 3VFRB 3DWTA 2FSEA 3AY4A 5E2UH 2EQDA 2QEJA 3LNIA 5AW1B 5BRZA 5GSRA 4ZXBA 2O5YH 3IJEA 4RSVA 4G7YH 3RP1A 1A2YB 3CLFH 1XO8A 2MHAA 4YVNA 1OHZA 3N42B 2EXWD 4A6YH 1IKNA 3UTSB 5F97E 2XFXA 3GSNA 5DRNA 5ABZA 3NABH 1KG0B 2EDLA 4OGZA 2B39A 1NH6A 3VRJB 1MCIA 4NKIL 4GSDH 4Q2ZA 4QTHB 5K59E 3SBRA 5BV7C 4X6FB 5FO8B 1BSIA 3I02B 3NIGE 3HPJB 3O4OC 4B9KC 3GGWB 3HG4A 3WMQA 2TRHA 5JDSA 2N56A 3VDAA 4PB0L 5DURB 3AABA 3LEVH 1NMAL 5B8CA 2DIJA 1T5WB 4NQDD 5G5DA 4IMLB 5T5FH 3KLHD 4OZIA 3QQ4A 3TEXA 3MO1A 4Z3IA 3ISYA 4HFWB 4PJGF 2DQDL 3NA9H 5D5MA 4KDVA 4EUPB 4HK0A 4NLHA 3C6EA 4G80B 4QEGA 1A3LL 4P07A 3SDDA 3BX7C 3EJYD 4AIOA 5HHQB 5DZJA 1GSMA 3KGUA 1TQCB 3WHXB 1A6VH 4P2CG 4ES8A 4KQ0A 3QP3A 4PJEF 1BQKA 2R4SL 5D1QD 2FQDA 3N40P 1MUJA 5I19L 1AGBA 3QIUD 1KXTA 2DTML 1UKQA 4JPKH 1HS6A 1T6WA 2X4QA 1F1AA 3UZEC 4FTVA 5F7NC 4JKLA 3QUMA 4OIBA 1TZIA 5A40E 3MLZL 5EUOB 5IMKB 4NKDB 4NIKB 2ZAHA 1JGVH 1SJMA 3EUDA 2VXSL 4X2UA 1DE4B 1WFOA 2YGOA 4WDIA 4KFZC 3T3PF 4BQ9A 2Q7YA 1XF1A 4XVUC 4F8LA 4H40A 3BRGC 1KIPA 1YVLA 3EGDB 4QRAA 2R2CA 4JY4A 4Q9BA 2B4CC 2WYHA 4R4ND 2VDRL 2DLIA 3QFGA 1SEBA 4JREC 4U7KA 5LQBL 4EKJA 5CLTA 5I0ZA 1OP3H 5D4QA 2W9LA 4K94L 2X1WL 3WFCL 1E6JH 3CFJB 2C4FU 1ZLDA 5DS2A 3PUUA 1T0PB 2WXPA 4OCXH 4HS3A 4MMZB 1DFBH 3CFBA 4QHUB 2VLLB 1R3KB 3SKUD 3W0WB 1T1XA 3O6FD 3HNSL 2Y1AA 4QUOA 4R84A 3RKDC 5B38A 4AEHL 2H6UA 4HKZB 5DHDA 5FLUA 2BHFA 1EXHA 5CLYA 5FYJU 2BVQA 1JGUL 4P5RA 3SKNA 4K7PL 4WQOA 3VWKC 2ISDA 3QPQD 5CZXC 5AZEH 2CJUL 2MOVA 4N2CA 2BS8A 1W16A 2ZWZA 4GRWE 3P2DA 4KTDH 5CGYD 3KBFA 3ZE1F 2O61B 2HKHL 1CGVA 2ZKYA 3IE9A 3MYZA 2KZBA 1VFBA 1ZLUK 2HJLB 3L2MA 1DVTA 1NBCA 1VJSA 2I5YL 2YMXL 4X9GA 1D7FA 3SOTA 1PLCA 4FQPA 1J9CT 4PJXF 4UT6H 5EA0H 1KJ2B 2VQ1A 3ZX1A 1KB5B 2GQHA 2NYYD 3CAFA 4KKBC 4ZQKA 4JCWA 4YXHL 1IUZA 1R24B 3HLKA 3ZRFC 2GTWB 5GGTL 4WVRA 3BUTA 4GG6A 4WKZB 3VI3F 1KNOA 1WAAF 2O5ZH 2V4LA 3W39A 1JWUB 4NUJA 4DKDC 2ZOUA 4HWBH 3BO8B 1CGXA 1RK0B 2NZ9C 2ORBH 1H8LA 1CE1H 1BMZA 1W8EA 3BWSA 1D5ZA 5EZOL 2RFXB 1W8NA 1YJDH 3TPUB 3UP6A 1U58B 1S7VB 5F2FA 3S8GB 1X7QA 3AJ7A 4WEMB 1SYVA 3FRPB 5CZVH 3PHAA 1I31A 1M6OA 5DEFA 3ZK0A 3LZOA 3RGVA 4EXPX 5C2UB 5MP6H 3VX1A 2BY2A 2GHWB 4J8RA 5E56A 3F01A 1XTMA 5KS9B 2JQMA 3KPRB 1CT8B 2CGRH 5K39B 4ZUUB 3ECQA 1ZTMA 1WA0X 4LSRH 3EYQD 5E1GA 3FHQA 1I8MB 4AT6B 5GRWA 3ZDZE 4TQHA 1R19A 3KPSA 3G6AA 5T1LD 3V4UL 3RL2A 2QMKA 1DANT 1ZT1A 1AE6L 4EBQL 4HIHB 4BSWA 1GJUA 3L3KA 2LOEA 2CRZA 1E4XH 2K7QA 3SYPA 1RHHB 1RPUA 3E3QC 2CBMA 4YS4A 3BH9A 3GSXA 1QPXA 3GB7B 3TT1H 2X4PA 1SY6A 4XPTH 3TJEH 2TSBA 1QRKA 1E4XI 1MWAL 4R6UA 4M03A 2ZG1A 2VXVL 4BFEA 5E8PB 2DM4A 5TDOA 4HUUA 3MZGB 2OYPA 1QFOA 2GJ6A 1JGIA 4XP4H 4RX4D 1B4JH 5IW1B 4NRXB 3FUFA 3QRLA 2FATL 1U41A 4PJ5A 2AJUL 2C3GA 2IBZX 1A7RH 4IKJA 5FYKE 4U4BA 4DQAA 2Z92B 1GW6A 1KTCA 2G0LA 3HZYA 3HI6L 4N9GA 5DEGB 3BPOC 3TWCH 4CSTA 3BGAA 1XF3A 4GNKB 1CFQB 1FL3A 4Q7DA 3NACL 3H54A 5E94B 3SDAD 4PWIA 4GRLC 3ZPDA 3QCVL 2CO1A 2VDML 3BAWA 3U9PH 1QSEA 2FEDC 5JZ7D 1RIUL 1YZZA 3CU7A 1K4DB 2CJSA 3KG5A 3L4TA 2VLKA 4PG9B 4K8RL 3NESA 1Q0XL 1VENA 4Y19B 2XBZA 2PO6A 2WZPD 3F7RA 3PP4L 2P52A 5CSGA 5FCUH 3T0EE 3VCLA 1N2RB 5CWSB 4HF5H 3RGHA 1D7CA 4OLXL 2OL3A 4YSAA 3UTPE 2HMID 3P3TA 1OSPH 1MCPL 2P7TA 2R69H 3C8HA 3OHXA 4MAYC 4UDTA 4AUJA 5ID0A 5HDBB 4OJAA 3CVHB 2H0PA 4AVKA 4FXKB 1FHGA 4FQCL 1J48A 4LARL 1WC7A 2PPFA 2PTTA 2RH0A 2Y7MA 3L5XH 4R3SB 4PJ9D 1ROCA 2VDNB 3IJYA 5LGYA 4W9JC 2MWCA 2DYPD 1T66D 2OFQA 3HMXL 4DP1X 3QUHA 1J1XL 1JOIA 4PGBB 4D94A 2NOYA 1EERB 4N0FB 2VC2L 3L5IA 1S7TB 2XTJE 3VGEA 2I7SA 4ZUWA 4KKCC 4XBEH 1G7JA 2O93L 4Y1AE 1YNTF 1ZE3H 4FQXD 2VDKB 2P9RA 4Y8AA 1JPFB 3JUZA 2OM5A 5KOMC 4A2MA 5AVVB 4MYWB 2PCPB 4JFEB 3L3OA 1AZBA 1W9XA 4XP6H 3B2XA 4NXSA 5DLLA 4UNIA 4IU3A 5E1AB 3BKCL 3SSGA 3K80A 4NDMB 4L8CB 4HIIB 4G5AA 4I89A 2FEJA 4K7PY 3JT0A 3CVIL 1YPZA 4E0RB 4Q9RH 2GK0B 1AGCB 1UB6B 1ADQA 3F7PC 4KV5F 4MJ5A 3JWDH 2OI9B 1ZVSA 2C7FA 5DJDA 2AJVH 1S7UB 2F6AA 5JXED 1RUKL 2AK1L 4FL4B 4O2EB 4OTXH 4OVVA 1BIIB 1OK0A 3QORC 1PGRB 5J1AA 3IYLW 3EAKA 1X5HA 4ODUA 4X7DC 1NLDH 1OIOA 3SE8H 2BCKA 3WEOA 5A6MA 3L3JA 4HSQA 2QHRH 5ISZD 1F11B 1G9MC 1DFXA 3H42H 4U2YA 3UC2A 4NGHL 2KL6A 1Z2KA 4L9DA 2W0FA 4LDCA 3WTVA 5J89A 5CLWA 4MB3A 2IDSA 3STZB 2VJXA 3QUXA 1QPPA 2ITFA 1R3HB 4U6VL 1T03H 3MLYH 3G9AB 4FXTA 4K15A 4BH8A 3IDUA 4NNXB 4F1SA 4G6KH 3RBSA 3BFOA 1M2VB 4JHBA 2OLDA 4FJYA 3SY0A 3G6JF 3ZYJA 4C56B 1JNHA 5CHNB 4J6IA 4HUVB 3S96A 2OP4H 4ZSOB 2DWEB 1FLTX 4WI3A 4YNYA 5SX4H 5EUKA 5I5JA 4BKLA 5CEXA 4ALAL 4LL9A 4NLAA 3EO0B 5DJYA 1DN0A 3VXRD 1GGYA 4PJIF 1AYOA 2ODHA 2XWJB 1KN4L 3FTXA 1TLMA 2IOMA 3F00A 4AYMC 5FECA 4OUOA 2JXMB 1MJUH 4H0GA 5IJCC 4XODA 1KLFB 1X5AA 1HVXA 1GIGH 1D9KB 2Q8AH 5E9DA 2Q2EB 4YEEA 2A6IA 4ZOAA 2QQKL 4Y2DB 4Z7NE 3GMOA 3SKMA 2WYIA 1IT9H 1BF2A 1DVQA 1B2YA 1PKQB 1JWSB 2HT2D 3ARGA 3NK3A 3MRIB 1TQWA 3QUYA 3CXFA 5EZJA 4NO5A 1HEHC 2KMWA 3FCUB 3A4FA 4UT7H 2EE2A 5HGDA 2NY6D 4WY7L 4L8SA 4CL7A 4DNLA 2GAZB 1SJXA 4PVBA 2Y7OA 1EEUA 4GI6A 2WLIB 4B5ZA 5FV2A 4IHOA 1FWXA 2CR6A 2HJKB 1A21A 4GRWH 2KDYA 2Z31A 4O9HH 3VQLA 1EAOA 4WI2A 3K4DA 3QZOA 1K3IA 1UWXK 4KWUA 4JZOA 4P4KB 2XHNA 3OAWA 4LLYA 4N2NA 5F8RC 1OP5K 1UURA 4AC2A 5GGTA 3R0MA 2Y3NA 3WUWA 2X9ZA 5IREA 4LLMA 1S3RA 2EIEA 3MRDB 1K8IB 3UPRA 5JPNC 3LKNB 4LLQB 5TE6H 4RAUA 1U3HB 4YDVB 2ETWA 3ML9A 4B60A 3DBXB 5DJCB 4X6DE 2CSPA 1UZ8B 3U36A 4OCSH 3REWA 3DYOA 4JO3L 3MGOA 4DVRL 5LG1A 3TV8A 2J6EH 3OKMA 1WGVA 5SWSA 1KCRH 4PJFF 2D9CA 2BNQE 2F15A 2GK2A 1F4YH 2LT9A 4HSAC 4GY4A 5HDQH 1EHLH 1L0QA 3ROOB 4TULL 2JK5A 4ZO8A 4M9OA 3GMNA 4Z95L 4O5LH 3WDIA 3ULUD 1E5CA 1HC1A 1T22B 4G8GA 5GSVA 4U0RC 1BVZA 1SXAA 4HJGB 2Q3ZA 2XG4A 5D93B 3ISWA 4Q9QL 2VRKA 3ZMRA 4IK6A 4Y16A 1MRFL 5HYJE 3ZHDA 1GSKA 5K9JH 3GSOB 3U0TB 1EUTA 3UROR 5CEZL 1SLXA 3VFGH 1RMFL 1EANA 3GHBH 3ASWA 1Q0YH 4BUQA 3SGKA 3ABZA 4EO5A 1T3FA 4JRYD 2FGWH 2OZ4H 4U1SB 4ZOBA 1I1AC 1MLCA 4NN6C 2YUWA 3WV0A 1CJYA 4F8TA 2WCSA 3B2DC 3FQWB 4U6XA 3VD1A 1J12A 5BZXA 2G3MA 3V5DA 1FGVL 3V4VB 3NQIA 4YPGB 1S78C 4Y5YC 4GBXB 3FCSB 1DR9A 4KFMA 4LL4A 4WNQA 3DI2B 4Z3GA 3P9MA 4Z3JA 3FFCE 4FZEH 5F7YC 2CH8A 3MNWA 4TS6A 3CHPA 5F1IB 3VXPA 2BSDA 1BXUA 1CL7L 4M3JA 4IRJD 4WENB 3KPOA 4HUMB 4K7FB 4KZCA 3MV8A 2OK0L 3BP6B 4J3VA 4NJAH 4IYKA 4TMPA 5DD0H 1OAXH 5C3LD 3SYQA 1F2XK 4R0LA 2LVEA 1WZ1H 5I9QC 3MGTB 2XN9A 5DK3A 1FH2A 3MNDA 3FO9B 3S37X 3SGEH 4TSBL 4N5UA 2J8OA 4QCIB 1KB3A 3IMVA 1R33A 4XMKL 4XNXL 5FX3A 5EC1A 4LF3A 2L7UA 3GYRA 2J1ZA 4X80H 4XNZC 1KIRA 2H9GA 4RH4A 1QX1A 3SE9L 3HMXA 3ECVA 3QQ9D 1UUSA 4RGOL 3MA7A 4ODHH 1UXWB 2IAMD 1JTTA 1INEH 2ZZUT 3TEYA 4M5TA 2XYCA 3WFBH 7FABH 2ICWB 2IQ9L 4IRZL 4LBAA 4M6OL 4ODWA 2QKIC 1BF8A 2V2XA 5DLML 1OZUA 3FN0L 2XT1B 2ZOKA 5AG8A 2V2TB 1INDH 3Q2CA 3QHTC 2QKSA 3HEIB 4OY9A 4YHPA 4AGPA 3U0WH 5EC2A 1NCDL 1CTNA 1RULL 2E47A 3SPIA 4NNPL 4PGDA 3RB5A 1EXUA 3Q8CA 1EAQA 5C0CE 4DFHA 4ETQB 4QHLB 1QO3A 4M6NH 5DJXA 2BWDA 1YQ2A 5A2KH 1UD3A 2JJSC 3B1UA 1VGKB 3HB3C 2EUWA 5HDOA 1E90A 3QDJD 2DQCH 3LKQA 1FL6B 2JKSA 1OTTD 4IRSD 4MD5B 1KN2L 2Z4QB 1UZ6E 1MFBH 4NWUL 4LESA 5EZPA 4PJDF 2YZ1A 1OO2A 3QEHB 5C09E 3IJ7A 2NYKA 4GAFB 1R0AH 4NSKB 4J3OG 4N90D 4WW1B 3RJQB 2YR3A 3U83A 4G6MH 2Z9TA 3QUZC 2OXHB 3GSQA 4FF9A 2BP0B 1OWRM 1CK0H 2MTAA 1IQDB 5AOJA 3H7LA 1YNLH 5E0FA 2H0JA 5EDSA 3OG6B 3WN6A 2RTTA 2ATPA 2WBKA 2QVFB 5AUMA 4MNQD 2BVPB 3UEZA 3OTTA 1QBMH 2R2EB 2VXQH 2WMPA 3D2UD 3GSRB 1FBIH 4PGCA 3EOYG 5CILL 2D3JA 3IM1A 2I85A 5AW8B 3BP5B 2EUVA 1CVRA 4P3DA 3RPKA 2NX5E 4YXLL 3UG5A 1AKJB 5CXPA 4TUOA 4X0KB 1KOAA 2PTVA 3NGBB 4U1LA 1ZLEA 1PEWA 1AR2A 2IWEA 2ARJA 5MEOB 5CGBA 3P77B 3FCTB 3RZCD 1B0GB 1MRCH 3F7KA 3FT9A 4Y5VC 1I8IA 2XJKA 5ERWA 5F3FA 2NLJA 2YAHA 4MCNA 4PCTA 5D96B 2ZNWA 4JQVA 3EDEA 5F7EH 2XPYA 2PYEA 4CSSA 3TP4A 4JPVL 3GTNA 1UC6A 1KGYE 4ONGH 2ENQA 5LNDA 2UYLA 4PJXA 3ZTDC 3L3HB 4TNVF 1TDQA 3SBWA 3B6SB 2IFFH 3GBDA 2WIMA 3GXDA 3OZ9H 4NZRH 5FYLL 2AJ3A 4L2YA 3QIWB 2E5EA 5SWQA 5IHUL 2BJMH 4RFEB 3QHZH 1ET5A 2NT0A 3MNVB 2HH0L 1VADA 3CH1A 1K2DA 4CVXA 2YPLD 2HWZL 1Z3GL 1LK3H 3GHPA 5EUOE 3FQYA 3Q9PA 4JHAH 4RRPG 1NL0H 2QSVA 1BWMA 3M46A 2HXAA 4KK6D 2QPSA 5I6KA 4Z76B 3B5TA 1YMMB 3NRPA 3FFDB 5DJ2B 5MEQB 3JV0A 3ML8A 3IU4H 3TO4A 4GMTL 2FBJH 2OR9H 1P6FA 4PRPD 3ULUH 4JZJB 3OAUH 1CR9L 1BBJA 5LJYH 1A4JB 3QJQB 1MFCL 4QT5A 5D2NB 2A9MH 2YPVH 2AJZA 3PDOB 3X11A 5KANI 3IVKB 3D18A 1D3CA 1OGPA 5MHSD 2FNBA 1NICA 4LAJH 3QO1B 4O02L 4GKZB 2K8MA 3EGSA 2Q6WA 3DTXB 5IT2L 1JS4A 1YECL 2ADFL 3OPZL 5FUZL 1TEFA 4F57L 3D25A 3GM0A 2KQMA 3MUGB 3IN2A 4X5WB 1P1VA 3GK8L 7TAAA 1U30A 3PFUA 4P4RB 3WBDA 1AOHA 2J8UF 4I9WE 3V0HA 1YY9C 4ZPTA 5IKCB 1G94A 3MRLB 1TPXC 4P2OA 2E7DA 2BFVL 1FZJA 4HK3J 4NP9A 3TF7C 4DGYL 3AM8A 4HS6B 4BZ1L 2Z91B 4FCAA 3SE6A 3ME0B 1CQKA 3ARDC 4HH9B 1ACYH 4MNHB 3MJ7A 4N2LA 4QO1A 2WQWA 4ZPVB 1FNEB 3KLAA 3KWUA 3MRPA 2CPCA 4WSGA 2J1KA 3EFDL 2R0WH 3HS0A 4GW1B 3T2NL 1RZ8B 3MTXA 3FTGB 2Y24A 4OGXL 3BKYH 5J6HB 1C1EH 4NKMA 1DJHA 2FR4B 3SGJA 3TGXA 5DZLA 4N8CH 5GRZA 5DMKA 4PYHA 1Q1JL 1NWPA 4PEEA 5F7LB 2AMGA 3NCJL 5CBEB 3VYNA 1V10A 1GH7A 1I7UA 2ICWJ 3G04B 5C2BH 5I1EL 3GBNL 1SOSA 5ITFA 4ZFGH 4NERA 2DQFB 3VH8G 1O6SA 2H8PA 3KHOA 3MRJA 5EORL 2IGLA 3I9PA 1J8HB 1IM9D 2FRGP 2JKIS 3CDZB 4M7LH 2DJUA 2CR3A 2BIPA 3LRLA 4CADB 5GSRB 1NC2B 4OBSA 3PWUB 4ZXBB 2ZCLH 1A7NL 1KFAL 1VZGA 4Z5RA 2MHAB 1DL7H 3CFTA 3KPRE 1N4XH 4L5FE 3QZMA 3HNTL 3CFEA 2XFXB 3CXHJ 2Y36L 5D7HA 2DQGL 4B9JA 2GJZB 4Q2ZB 1YHPA 1WUZA 1H3PL 3CUPA 2HLAB 3RUGF 1B0IA 3K2UH 2DMKA 4AUYA 2F68X 2APFA 3BFQG 3M8OL 4PTUA 4UYPA 5DJZA 5JDSB 5FO2A 1FCCA 2BFGA 3ZRCC 1CDHA 3U2JA 3ALWA 3L95B 4I5BB 4WI7A 1ZVYA 5HYQA 4UTCA 3MO1B 4LP5A 2OYMA 3I9GH 1KPVA 1KV3A 4JFSA 4QXGL 4U6HB 4HK0B 1DBMH 3EBAA 4AQ1B 3MV9A 5J0BA 1KT2A 1RZFL 3VXUE 2XY1A 2CXGA 4PD4K 5TE4L 1JXDA 3HVDA 2IALA 3N5AA 3AT9A 3ULVF 5ANMB 1VSCA 4WFGE 4HJJH 2APBA 4KHXH 1KXTB 4KVNL 4N0UA 2FJFB 4NO2B 4QY8A 3E6FA 5E5UB 3BJLA 2X4RA 3CZFA 1DVYA 1SVZA 2GC7C 1PKOA 1NFDA 4PRHD 5D2LF 1QRND 3QUMB 3KLSA 4POZD 3SBPA 4QRSA 5J7CC 2Q3XA 2Y7NA 3DV4A 1A3RH 1FL5B 1P9MC 4FI8A 5KSAD 2Q7YB 4MA3B 2BS9A 4XC3L 4Y19E 3UGEA 4L3ED 3WTWA 2YIHA 1KIPB 2J43A 4XAWH 3X3GH 4IRZA 2C9QA 2P4AB 2FB4L 2GIXA 4JY4B 5KTEL 3DRQB 3Q5YA 4P3WA 2FHBA 4GAJH 1JHKH 1LO5A 4RDBA 2XIBA 1J0HA 3BISA 4AIEA 1P4IL 5HDBE 3WY1A 5DFTA 3NJNA 2ZX9A 5JHLL 5IHWA 1TNMA 2PNDA 1S9VB 3HG1A 3UZQA 4HS3B 4S0TD 3RIKA 3BP4B 4P3CH 2B8OT 3CFBB 3L1GA 3VD5A 4RA0C 1T1XB 4HAGA 5F96L 3O9WB 1ZY9A 3IWVA 4FNLH 5EU4B 3X3FH 2AP2A 2OTWA 1AACA 2BVQB 4Z23A 4MMXC 1MQKH 3LQAC 4ERSH 4KRPD 1FVCA 2D4FA 2CO6A 1DJYA 4BH7B 3BVUA 3MX0A 3K72A 1ZV5A 4PQXA 3DURB 4N2IA 4ZUSA 4ADJA 1HINL 4J3WA 4KOBA 1PS3A 4PP1C 5KN5A 4Z3FA 4IGBC 5GQBA 4MKTA 5GJSL 4KQ4L 5FA3A 1NCTA 2F61A 3PL6A 5EIIG 2NT1A 4MMYA 4ZW6A 1OF2A 2YOCA 4IMKA 2VQ1B 1XCQB 4ISVB 5FCSH 3E8UH 2QSTA 3FYEB 4U6TA 4QXUL 4R5XA 3RIAK 1G6RB 4C8XA 2YBGA 3GBML 3JT2A 3QJVB 4XT1C 3R06B 1UADC 4KZEL 5JIQA 1BMGA 2WXLA 1HKLH 3DVNA 1S5IL 4E41B 4OLYH 1YN7A 4NUJB 1Y0LA 2AQ3A 3MA9L 2VUYA 4I77L 4KJWD 4NENA 1ZKAA 4JM0A 1Q72L 4W4OC 4N2OA 5I8KL 1IGMH 4QRBA 4FFZL 4Z7VA 1W72B 4P99A 1HZHL 1NGZA 1M9SA 1X7QB 3QDGA 4P2QA 4QRQA 5GISH 4Z6AT 2R27A 5DEFB 2KQNA 3U1SH 3U7WL 1W80A 5CM1A 3RGVB 1XB6A 3ETBF 4HBCH 2EDFA 4JB9L 1X4YA 4W9KC 4IOSD 4WSJA 4W81A 3O8XD 2ZKHH 1FPTH 4J8RB 4RISH 4ADGA 4OGAD 3FT3A 3MFFA 3QAZC 2ZOOA 2JLLA 3MNZA 5E4OA 5KYUA 5KVGE 4NP4H 1L6ZA 5CIPH 2MNJB 4RMUA 4NQEA 4JO4H 5DHVA 3I2CL 3IXAA 4HJUA 3CK0L 4EUPH 1YEGH 1DUYA 2WKGA 1MFNA 2B0SL 3G6DL 3NSJA 3RL2B 3S3SA 3CN4A 1ZT1B 5I16A 3SPCA 4C56E 1HEJC 2X6VA 4V2BA 2MCPL 1XH1A 3QS2A 4ZSOE 1KGWA 2BSTA 3L3KB 2GSIA 3U6RB 4P46C 2B5IB 5IQNA 1RIVH 2XXMB 1JZ2A 1ORSA 2AI0L 4RQQB 4X8JB 4IJ3C 1UXSA 1SQ2N 3FT4B 4YXKH 3QQXA 4PH8A 3X1EA 5KANG 3S88H 2AK4B 3PYCA 1CDYA 5CP7A 1E4WH 5L9DL 1SEQL 1ZA3A 1ZTXH 2EDWA 4TXVB 4B3VA 4HUUB 1EGJH 2GJ6B 2M8XA 4LSUL 3VX0A 3APDA 3VTTA 4H8WC 4M8QA 1YEFH 4HUXA 4FXGC 5AKVA 5H8DA 2MQ0A 5EFIA 2UZIH 4XXDA 3DI3B 1XGTA 3VFSA 1IC5L 4O02A 4ZAKA 4WHYH 4I3RH 5DK2A 2WVSA 3LH8A 1FL3B 4ICXA 1PKQE 1U0QA 3UERA 3HHRB 3QYNA 1OTUD 1BZ7A 3WEMA 3MRQB 1GC1L 1WWAX 4DAGH 2QQNL 4JY5L 2MPVA 2VLKB 4KJPD 3EYUH 5L4FA 2G9HB 2Y7SA 3UGXA 1HYSD 1RU9H 4KDWA 5FGBC 2FWSA 2CO3A 3NRFA 1JCKA 3UG4A 1B3IA 3Q2LA 2PO6B 4G1EA 4L9LC 4EIGB 1WYJA 4OBRA 2YQGA 2J1WA 4HIPA 1ID2A 25C8H 1ZWIB 3SGDH 4Y2OA 3L2LA 3TJHC 3VCLB 3LNEA 4FFYL 2D7PA 5T1KB 3MMEA 1ETZB 3ZTJH 4MD0B 3OHXB 4PJ8C 5E99L 1O7DE 3SGDI 5ICZA 5L2JB 1WC7B 4YDIL 4TNWF 1EPFA 2ADIA 2V33A 3ECUA 4RWYL 1CF8L 5I75C 4BA8A 3HAEG 2WAQA 3VVVA 3D0LA 3MLVH 3CSYA 5J3HC 3Q6GH 2BS71 3TNNA 1EJOL 5AAMC 1G7QA 2XX1A 2BIQA 2YWYA 5DCCA 5DZVA 5B1BB 4OKDA 1G7JB 3QXTA 4OLUL 2PPDA 3WKNA 3IS1X 2CO4A 4M1CC 5FYKU 4IBWA 3HFML 2AAVA 2JKRM 4WUUD 4N0YL 3VYPA 4IRJB 4XVSL 4MJID 1SMAA 3O41A 1U8JA 3ARPA 2WK2A 4XXCA 5HHOD 3VXMD 2VL4A 3FOMA 5BQ7A 2LLNA 4S1QH 5GGUA 4N25A 5DVLA 3L3GA 4DEUA 3HZVA 1YPZB 3P9LA 1LP9B 3HAEB 3MV7D 5IHHA 3QXAA 3C6SA 4WWOA 4HU8A 1R5VA 1TZAA 3UACA 3EJSA 1QAWA 5F88B 1BW8A 4XN4A 2BP8A 1IJNA 3VD3A 1DSYA 2XRAL 4NB7A 4M5YH 2GT9A 4AJ0A 5J1AB 4ODUB 4UM8A 4ZRGA 2GTZB 2V9UA 3AQYA 3MBEA 4YR6B 2CLVA 4CDGC 4BZYA 3H9SD 4KPHL 2R23A 4JK0D 1MCLA 2W0FB 2IG2L 5TTRA 2DQEH 3T4AA 4JRXD 1ACZA 3VFWA 1MG2C 5D70L 5DT1H 1KLUA 4KJQC 1DQML 4OZGF 3VTAA 5GS1B 3KDPB 4W9LC 1YUKB 2HYMA 4JM4H 4OVUA 4EI0A 5I17A 2UUDH 4GS7C 4ZO6A 1HSAB 2XZAH 2ESVB 3GI9L 2P8LA 4EF3A 1UM6L 3CX5J 3SY0B 5E2WH 1OGTA 1P5UA 3VUAA 3EGXA 3QWOA 1JPSL 1Y7VA 3CHSA 1TTCA 5ECGA 3S96B 5B39A 5JYLA 2AXJA 2BNUA 5EUKB 3BIKB 2VDLH 4D0BA 1OWWA 4KRLB 4HXAL 2FHFA 1TIUA 4X5QA 3I9AA 3G5ZB 5LDUA 3SCMC 5AL0A 5DJYB 1DN0B 3AADB 5EDXA 2EDBA 3LKPA 3MJ9H 4MBRA 3TIDB 4DF9A 4YQXL 5IJKA 1R47A 2H4EA 1J18A 3RVTD 5DWPA 4ZMOA 1IAIH 4R2GB 2Y7QA 3PJNA 1UOVA 5C9KA 3DXAB 3RNQB 3HI5L 5JW4M 2XVKA 2PCFB 4FQ1L 3RFZC 2O5YL 4ZMVA 3S5YA 3OAYK 4G7YL 4EZKA 3BQUD 3K81A 1IAII 3NIDF 5BO1H 3MODL 4YJZL 3L7EA 2H3NA 6FABL 4D7PA 12E8H 1EZLA 2A6IB 1JZHA 1H6FA 4YBQD 4YSEA 3SKMB 2LQRA 3NABL 2LTQB 5FGSA 3ARGB 1ITCA 1ACXA 5CSZB 3S34H 3I84A 4NO5B 4UQ2A 4LDOB 3VD4A 3FQUA 4PJAF 1NCAL 3CH8A 4N0CC 4ZUTA 3SO5A 4XWOC 1HOEA 1U3YA 3BGMB 4LVNB 5FKPA 5C97A 1CC3A 3QI9C 4GXVH 3APMA 1F1DA 1DBKH 1IGFL 5HI5C 4G9DB 4G8FB 5IM7A 4DN4L 4IJTA 1HQRB 2DPKA 4IBQA 4LP4A 4PRBA 4JO2L 3L9RB 1A7OL 2VDKH 2W60A 1ODAA 4KY1H 2F74B 4YHMH 5E5MB 5FWRA 1T4KA 2N0MA 2Z31B 2GIMA 3VXTB 1QZNA 5DMIL 3OKOA 3ZQXA 1D5IH 2W0KA 5D7IB 1GZPB 1NA8A 3V7AG 1JZ7A 4IBVA 4JZOB 2QPUA 4PG2A 1VGEL 3WNMA 1NBZA 4LLYB 4JDVA 4WHCA 1E43A 1YQVL 4FKEA 1HZLA 2WQAA 4LLMB 5L88H 5EEYA 4W93A 3UPRB 3MR9B 3CDCA 4K2UH 4M4RA 4RAUB 3IJHA 2BW4A 5DQ9A 4G6AD 1L4IA 2EO1A 1MIMH 2ZE0A 3UBGA 3U36B 3EH2A 4FFZA 2GABA 4O2CB 3REWB 3CZEA 3IK2A 1MREL 3KBHE 3MGOB 2NTFA 4LCUA 4KH2A 2ATKA 4WIQA 2BK8A 5C0RL 5JQHC 5SWSB 3QNFA 1IEHA 3CN2A 2ZSVA 1KELL 1UACH 3MRGA 4AYDC 4XNQA 4PJ7F 4N5EC 1TG8A 2JK5B 4Y5XA 3GMNB 4DHLA 1G9NH 3UAEA 1L7TL 1U8OA 4M1DH 1E6JL 4FABH 5L2KB 3K4AA 2X44D 4G8GB 4OCXL 5DS1A 2XG4B 2P5EB 4AYGA 3TM6A 3O2DH 2Z34A 4GT7A 5IQOA 4PR5A 2WBJC 3JWNG 1URIA 4YHZH 3HC0A 4XMXA 4PJCE 1PZ2A 2VO8A 2XVGA 3K8LA 2F8IA 4NUPA 4X4YA 1T3FB 3QS3A 2WO3B 3HE7D 4HEPG 1PG7H 4KTDL 1PIGA 2J55A 2JIXD 1QFUH 1TJHL 4Z7WF 4BFOA 4Q4IA 5D1XA 1BVOA 2IPUG 2ALAA 2MIZA 4U6XB 3HE6C 4PB9L 3D3VD 1WGOA 1NAML 3EKCA 3PPSA 1OD7A 4HIJB 1REIA 1HHGB 2AJSL 2G3XA 3L54A 4WHYG 4WNQB 5FFLA 4L05A 5EA0L 2HVKA 2ID5A 1FC2D 4KROC 3VXPB 3Q9QA 4CBZA 5I15H 3L17A 3LN4A 2GSMB 2DIBA 1HKFA 3FRUA 4X8CA 4X4ZA 4XH2A 2AQ1A 3ARFC 3KPOB 3S3DB 1C8QA 1AD9A 4JHVA 1U91A 3MV8B 4FG0A 2O5ZL 3RIFK 1G1KA 4K9EC 1YMME 4HWBL 2BSCA 3WOVA 1CE1L 1EZUA 3ZQWA 1EDQA 4YLBA 5KJRH 5DFWH 5J1TC 4BFBD 4MQXC 1WCBA 4H26A 4YDNA 1KXHA 3VE0B 4AYID 3VXSD 2VISA 1JZDC 3O3AA 5IVZB 1A6WL 5FK9A 1SOQA 2QADD 1E4HA 2Y06H 4Q4EA 3UTTA 2HUHA 5I1LB 1JGLH 5E6ID 3DIDA 1M6UA 3WTTA 3IDIB 1P6AB 1T7WA 4MDJA 1ICTA 1T0OA 2MFNA 2RALA 4I18C 4YHIA 4X6CB 2MCAA 2AQ2A 4WW2F 4OFYA 4ODXA 5D1ZB 1KGCD 1EMTL 2EUXA 1VAHA 4CKQA 3R4RA 4LLDA 2XA8H 4GRWF 3OJVC 5I76A 1G1CA 3GMQA 2EIDA 3MA7B 3K74B 4F8PA 3P2BA 3IDXL 4GUOA 1MRDL 3C87A 3M7OA 3V9CA 1SRDA 2BSRA 4NZFA 5DFVC 4H1LA 4ZFZA 4EI5D 3RDTD 3RWHA 2AVGA 1T5KA 3MBXH 4OJFH 2Z7ZA 4KX8A 2HN7A 2Q0ZX 5E08H 1AQDA 2R1YB 3GIVA 5EC2B 4WKXA 1S46A 4WEBH 5JQ6L 4PGDB 2YN3A 3Q3GA 4WAFA 1QFHA 2H6PB 5CCKH 4UV7H 4FLHA 4LRIA 2CE6A 4XP4L 3ZTNL 1WIOA 3RKPA 1WBYB 4YSQA 5EEUA 2KZKA 5IFAL 4FG6C 4YHYC 1MW0A 1LEGA 4KGJA 1A7RL 3LKQB 5GGQH 2A7BA 4KH9A 2FLBT 2NY1C 2W0PA 4NZUH 4PRID 2AXFA 3TJPA 3QDMD 4EZLA 5D6DC 2LLGA 4YSPA 2NY5H 3FQRA 5DS8A 3QQNA 4PRNB 1A6UH 1YYLL 3V0AC 3WJJC 1NLBH 5CD5D 1J8HE 3DNKA 1DVSA 4QRPD 4X7CC 4Q74A 3U9PL 1BQHB 2GITA 3LQZA 1SOKA 3IKKA 5D7KE 3GSQB 5C70A 1MOEA 1QZ1A 3NPSC 3DVGA 1IZJA 3L3IA 3ZDZF 1AGDA 1G1YA 3TBYA 2ATPB 3VWKA 2A5UA 1WFMA 5KSBA 4Y1SA 3ZE0E 5H4YA 5I26A 4X5XA 2WMPB 5D7LD 1IEAA 1OSPL 2J5LC 4HJ0D 5TF0A 5GZOD 3VFUB 4N6RA 4WI5A 2WQUA 2APVA 1A0QL 4P3DB 1AQHA 4L1TA 4NPKA 3C6LA 2NY7L 3TEZA 1OM3H 1EO8H 2EEBA 3OV6A 4U3SA 5JOFA 4BWWA 1I1YA 4M3KB 3WEXA 5ADOH 4PY7A 2ED7A 4DPRA 1MJ7H 5IMOA 1NIDA 2CXKA 3FXIC 4N85A 5F1NB 2PYEB 2AKRB 2D7OA 4S2SB 4M8UA 1UWEL 3TA3C 4F7PB 4Z1PA 2JMRA 2ZF8A 2IH3A 4YHOL 5E2VL 3QWRA 4LKCA 3DUUB 2WV3A 4WO4C 2PW1B 3NP4A 4KZDL 5M95B 1G4RA 2HX7A 3HS8A 2NNCA 2YUZA 3EOBA 4MHHG 3TZVA 3JVFC 2J6WA 2AJ3B 2JELH 5LAXB 4RGND 2X4NA 3P3RA 2E74C 4HSCX 4OV6F 4TUJA 1E30A 3K0YA 4G3YL 5ANME 5SWQB 3L08A 4G7VH 1VADB 3VI4F 1K2DB 1VZHA 1Z5LA 1ZCRA 3GJEA 5K9OB 5TQ2H 2BNRB 4XCEB 4U1HA 1TKWA 2UWEB 5BRZD 4HC1L 1E0OB 2PYFA 4PJHA 3HFFA 3AWFA 3P1VA 3V6FA 1R3LA 1YC8A 5KVEE 2GFBB 4Y9CA 1T0MA 3GIZH 3DMMB 3NIFF 4S1SH 5F7DB 4ELKA 1E50A 3WE1A 4CSZA 2OSLB 3VDBA 1TYRA 3AACA 3L4WA 3MRNA 5F9OH 1CXHA 1IGCL 1O6VA 1RK7A 2L8AA 2R29A 3K6OA 1B0WA 4QGTA 3EO9L 2XV2A 4DZ8B 5KBKA 5ISZE 1O7DC 5J12C 1CDUA 1OK8A 2MMXA 1CLYH 3AS2A 4D3CH 3D39D 4BKSC 2AEQL 1NCNA 5B3JE 1DBJL 4NC1E 3MRKB 3QEQA 4FNTA 4ZPTB 3CLWA 4IIQA 2AMUA 3PXJA 4L1SA 5CEYB 4UAHA 1VF5C 2BVUA 1JNLH 1FZJB 4FLOA 3IF1A 3WTYA 4DP5X 1WRFA 1JK8B 3TBSB 5IG7B 1LO4L 1JYNA 5KAQG 5C0NC 4D9LL 4QOKA 3U1PA 2EEXA 2CDEA 3SDDD 5G2NA 3MJ7B 4HWZA 4XI5D 3C09B 2PXYC 4RFNB 4QO1B 2RAMA 1J5DA 3VWJC 4Y89A 4UT9L 2X0UA 3EXJA 3LV3A 3HS0B 1JAEA 4U6YA 3VXRE 1UT2A 3SPGA 1EDHA 2EINB 2XG5A 1NCOA 2EKSA 1SJHA 2XTLA 3CMOH 3F12A 1QLRB 4NKMB 4FQIH 1T04A 3JV4B 1LWHA 4FTVD 4K3JH 5HVWA 1E3XA 3ATEA 2DZEA 5DMKB 1KTDA 3L9EA 1GIGL 1U8HA 1XHHA 2X09A 5HVHB 3SJVA 1JTOA 4E41E 3AXHA 5FO9B 1BFVH 1I7UB 4XPHH 1HIMH 1EZVY 4MAYA 2Z93B 2JCCF 3WIFA 5ITFB 3OKLB 4AKQA 3X12A 5DO2C 1XF2A 1JGEB 1O6SB 1VA9A 4M6ML 2H8PB 5C07D 2VR6A 1FYHB 4NM8H 3QDAA 1E4KC 2AEIT 2Y6SC 1E6OL 2J88H 5DYOB 3DX8B 4D0CB 5JHMA 4WV1C 3RY4A 1I53A 4YHNA 4B6ZA 4WCYH 4UT7L 1KXQA 3ZZQA 1RK1B 3C8DA 3LNGA 4ODSL 1OB1A 4P23B 4Z5RB 2X9WA 3GJFK 1EFXD 1XIWD 4ODTH 4L29B 1AQMA 5CKAA 3V5KA 3ZYOA 5C6TH 2WXGA 4NUGL 3WIHA 1NAMA 4AW7A 4DGVH 4E9YA 1WWCA 5D7SH 2EE3A 4JFQA 4GG8B 3QZBA 5LBGA 4N2EA 3LH2H 1UB5A 1DLHA 3OHMB 4IKKA 4GI8A 3O3EA 5DJZB 4L2LA 5H94A 1VRSA 3VJ6A 3QEGH 4H2AA 1A66A 1X5KA 5J13B 2AK4E 4LCIL 3DJTA 2WC7A 3FT1A 3P69A 3O6LH 1KPVB 2GJ6E 1S7XB 4G70B 5AW5B 5DEJA 2YN5A 2OZNA 3INUH 1EQWA 5J8OA 2J6EL 4LIQE 4JBSA 3QORA 2PR4L 1YG9A 2X53A 1ZDSA 1F4YL 2ZP9A 4R7XA 1B6DA 2R0LH 3BXNA 3H0TB 2KDGA 4OF0A 2IALB 2W59A 5EMYA 1QG3A 4TLTA 3ULUF 5ELIA 1TSRA 3RYMA 1ADWA 2D3LA 3PFQA 1C9SA 4MSWB 2YUVA 4M7ZC 4N0UB 1DJWA 1V3LA 3EBIA 1BIHA 3HUJF 3E6FB 2J72A 4HIXH 4O5LL 3SDYL 2GB2A 1NFDB 3IAQA 4BFJA 2VNCA 1P69B 1YYMH 4QRSB 2EXWC 1IC1A 3PWPA 1HXMA 4XE5B 3MV7B 2VLKE 1UCBL 2RJMA 3ZHNA 4EXKA 3DYPA 3WL9A 2NW2A 4I1NB 5CP3H 4NPJA 5E4AA 4E9RA 4Q97A 4ZFFA 4F91B 5K9JL 2F19H 3IS0X 2EIZB 2P3YA 2CO7A 1NIBA 5KVFE 5I0WA 2QVIA 2AQTA 4X7SL 2C3HA 3WDJA 4NIYE 2I9LB 2FX8L 3L5JA 5H37H 4DKEH 3BPNC 4GP8B 3KPSD 2OZ4L 3OKYA 5B21A 4OI8A 5IF0A 5GGSA 1BVKB 5D7JB 5DC0A 4U3XA 3UZQB 4JRYE 5GGVL 3VQ2C 3KLHC 5ID1A 4TKWA 3S6CA 3BAKA 5FR3A 4L4TB 3AQDA 1KGJA 3F62A 5HHNA 4M4PA 4JS7A 2YEQA 2KC0A 4FZEL 2E9BA 4Q6KA 1JYWA 4BEIA 3D0VA 1UENA 1N8ZA 2YJLA 3ZO9A 1C8PA 1NAKH 1ZEAH 4LHQB 4YZWA 3EJYC 3LH9A 1ZE3C 1E5ZA 3LRMA 4HZAA 4JY6A 1FVCB 5EWIL 3LJ3A 4UANA 4JFDA 5FYKL 1A1NA 5F7FA 2XQ0A 2CLRB 3K72B 3GSVA 4QRRB 5D1QC 3CZJA 3MCKB 3CBKB 5DD0L 4PJ5D 3VFMA 4ZW3A 1SLUA 3RI5F 4CW1A 3QIUC 3PG2A 2ZX6A 3TCLA 3H55A 1YYCA 3ZDXB 2OULB 1WLHA 5DI8A 4XNUL 1L3WA 1L6XA 2Z3FA 3KCPA 2AS5M 4O58L 5IQ7L 3PL6B 1ZGLM 1OF2B 1YPZE 4PBXA 2DL2A 1TETH 1LP9E 4GW4A 1IGJA 2O5XL 3JWDC 2DI8A 4PUBH 5BS0B 1BWWA 4I0PB 3S4SA 3DVNB 5IIEB 4R4BA 3FUKA 4X7EC 5AD0A 3G3LA 1NOAA 1YN7B 4Z3TA 1IBZA 2AERT 3NCFB 3GSNH 1P2CA 4JM2B 1MDTA 5CS7A 3V6OE 3NGBC 1K6QL 1U8MA 4BK5A 1ND0A 2QTVA 4LT7A 3GSWB 3WNPA 5IESL 2HB0A 1N0XH 4XC1H 2VN5A 3OGCA 4ODHL 4LVOB 4Z7VB 4A7VA 1KBVA 4MD4A 3US9A 4QHNA 1NGZB 1INEL 2XQYG 1BP3B 4JE4B 3QDGB 5DZ9A 3JTTA 4QRQB 1C12A 3QJSB 2QR0A 1U92A 5JIDA 1CS6A 2FL5A 4JPQA 3O6FC 3VG9C 4OR1A 3QSKB 3H3PH 3Q5OA 4CNIA 3SDXA 3MACL 3KXFA 4E42B 4OD1H 2DQIH 1INDL 4Y4KA 4JR9L 4AEEA 3QPQC 3FUMA 3TWYA 4NQEB 5DHVB 1TSHA 2I26N 2I32A 3FB7B 3IXAB 3II1A 4XVJL 2ESVE 4O2FA 4RZCB 4X7TA 1DUYB 5CGYC 3UL4A 3WLWD 4BV1A 5BVJB 5JIPA 2XN2A 4NI3A 1TU2A 2BSTB 1WO2A 2D7TL 2GSIB 1ZHKA 5HYSA 4JFUA 1NTDA 3UADA 1HXKA 1M7DB 1QBLH 2Q3AA 2X87A 4LOUD 1FF5A 2CDFA 4HC1A 1BPLB 4GH7B 1UXSB 3II3A 2NYYC 1R0AL 3UBXG 2DQHL 4Y4HB 3DXAE 4M1GL 1F0LA 3C60A 3ZUCA 5L7XH 1QSFD 4N90E 4HUXB 3INOA 4KK9D 1GGCL 4JN2A 5JORB 4OD3H 2P48B 4XPBL 4O02B 4ZAKB 4XBPB 1NCCH 1QUNA 3AROA 3BKJH 4FNQA 5IHZB 1B9KA 3V52L 1Z9MA 4V1DA 2ZPKH 5KYWA 4B0MM 5B3SB 1T83C 4HCRL 4HPYL 1I9JH 2A6DB 4YE4H 1ASPA 2EIJB 3NFNB 3UBXB 3EYQC 3OAZK 5DJ6B 3WY3A 1F90H 1EAPA 1IBDA 4AE1A 4G1EB 3WXVH 3TIEA 1BAFL 1JERA 5F7EL 2ZWKA 3IFNL 3QUXD 1MY7A 3IGAB 1WG3A 4OQ1A 4X4ME 1KY7A 3MMEB 4XP9L 43C9A 3FBQA 2FQGA 3LZFL 4UT9A 3HS9A 4AWJC 3KJ4C 4GO6B 4U1NA 2DWYA 5D7IE 3W11D 4MJHA 2QL1A 2IFFL 1MXGA 2BM3A 3OZ9L 3MLRH 5DMJB 5F89B 4M7KL 4IK7A 5DEZA 3S35L 3CZNA 4I88A 2YPKA 4HQQH 3B5HA 2GC4C 4G7QB 4G59C 1LO3L 5TE7H 4DETA 2KPWA 3T0WA 5T1DL 1G7QB 5FEBA 4M5ZH 1OT4A 1TZGH 2E9WA 2HX9A 4HHGA 4LAQL 2IADB 1CGWA 2QBWA 1MF2L 3EF7A 3PHOB 1SN0A 1IBGL 2ENJA 1WK0A 3TCXA 1T80A 4E5XG 2WO4A 3PDDA 2G5UA 6PAZA 1KGIA 3NCEB 2EO9A 5EU7E 1A4AA 4WFHD 5GGVY 3TPKA 1FFPA 5DUPL 5L4IA 5SWSE 3TBCA 3O41B 5E9DD 5F93C 5BUPA 1DVUA 3SDAC 4B9ZA 4F7KA 1FAIL 3NN8A 4A39A 3ZR6A 3V7AE 1F56A 1BZEA 4HDIB 5C3IA 2QSQA 3GSUB 5JZ7C 2AXWA 4UZUA 3L3GB 3HZVB 2QKIA 3QHFH 3GJFA 1MCBA 3P9LB 3KLDA 3D87B 3FOLB 4Y9EA 5L2KE 3QUYD 1R5VB 5LNEA 4G8GE 2Y69B 1OSZA 3TU6A 5J9PB 2P5EE 4JFFB 2BP8B 3LKRA 2VH5H 1U6AH 5EBMB 3BN3B 1KCUL 4K9JA 3DX7A 2R2HB 2HX8A 3PJLA 4E5XB 3F64A 5LVEA 1N19A 2HMIC 2JJSA 2AEPH 3S7GA 4AK2A 5IVXF 2GT9B 2CCLA 1R3JA 4OUUA 4F5CA 3MRHB 1KEGL 1R3IL 4KO6A 3APFA 4PJ9C 3H4FA 1IRAY 1N9PA 4AYSA 2B59A 2CLVB 1T66C 4BQ8A 5E4IA 4F37K 1AHWC 3LQAL 1SY6H 4YIQA 2UY6A 3NJIA 2MNWA 5DRWB 4HW6A 3LKOB 1N0LA 4MQTB 4APQD 5B3NA 3QUZA 5A2CA 3A67H 5HJGA 5KVDH 1B0RA 1JV5A 2QFRA 1T2JA 3BDYL 4FQXC 5EUOF 1H3GA 3RPIA 3PUCA 1FI8C 3BVWA 5I17B 4UAOC 2NXYD 1OGTB 1P5UB 4OU3A 3EGXB 5AAWC 3N1MC 1WFJA 4UNUA 1WWBX 5B39B 3F83A 1X9RA 4CC4C 1OAQH 1QNZL 5I1DB 1KXVC 1XR9A 4PWEA 4OLWH 2R8SH 4ZFGL 4L8DA 1F8TH 3GO1H 4LFHD 4KK8D 5BJTB 1XCTA 5JO5A 3LKPB 5TH2A 2GG1A 3NFSH 3QQ3A 2NW3A 4XPGH 4KAQH 1EO5A 4DN3H 4JG5A 3NTCH 2Y7QB 5EOTB 1N5YH 4Y5VA 5IV2A 1YNKL 4DPBX 1X6LA 2DQTL 4P57A 4LCCB 4IEFB 2A6KA 4UUJB 5GRUH 4ZMLA 2YRLA 1F4AA 3MV01 1GZHA 4X6CE 1FYTB 4TVSa 4Y16D 3MLUH 2VZSA 2OL3H 4QJ5B 1CXLA 1X3DA 2Y5QA 2IWGA 4ILDA 3WKPA 5I1CH 1FO0H 5FDWB 3BGFB 4CRPA 1OF0A 1JXFA 1D6VL 1UUNA 3ZJAA 3QXDA 4ECNA 4NC1C 3TXAA 3RZWA 1EXGA 5I5RA 3FQUB 2WNWA 3VXOA 4ZUTB 1DBAH 4F8NA 3FSVA 4GLRH 5FKPB 5IEKA 1RLBA 1G0YR 4WJ5A 2C3VB 1PY9A 3J07A 3BPLC 1FIGL 3PHQB 5F9JB 3O2VH 1FVEB 4PRBB 2BZDA 2IIJA 2AJXH 2V9TA 2WLNA 4GLRI 2W60B 3F6LA 1OCWH 4JG0L 1T4KB 4ANWA 2K9UA 3OKOB 4PY8J 4O4YL 2G75B 1Z0NA 3U0PB 4F15B 4JN1H 3F2LA 3E2HC 3KLLA 4H8WL 3B7YA 2Z0UA 4I4WA 2X2UA 4X0NA 1PD6A 3IEAA 4HJJL 3K6SB 1ADQH 3QJFA 3UX9B 2DY2A 4YSCA 2Q7NA 2EO7A 1U95A 2XN9D 4DT2A 1IC4L 1WISA 4NKIH 4RGMB 5DQ9B 4UF7C 4UYQA 4D8PA 4GO9A 5AFAA 4ZFOL 5KS9F 1VB9A 5KSVA 2YA1A 1FZOB 1A3RL 1QLFB 1ZHBB 3BLPX 2NTFB 4PRHE 1ZJAA 2DQUL 2EUZA 4LLWA 1VESA 3X3GL 1FFNB 1INQB 4MA8H 4PB0H 2GI7A 1CD8A 4FFWD 2HT2C 1NMAH 1VPOL 3WHE0 3WN5A 2Q86A 2DWDA 1Y6MR 2XN1A 3MRGB 1CICA 3ARDA 3QARA 3BIBX 4GP4B 4KKLD 4Y4FB 3GRWL 3PP3K 2X6AA 4Y5XB 4Y1AA 3NDYE 2DQDH 3CFIC 3ULSA 2NY6C 3TBVA 1G4MA 4QAMB 4XMWA 2YD0A 2DWSA 5DRZB 2QELA 1A14L 3RILA 2WVTA 4PR5B 1DHKA 5JIKA 3X3FL 4LOVA 3UIYA 4LRNL 3NCYS 2R4SH 1PMYA 2ICEC 1KCKA 5I19H 1PSKH 1AZNA 3X1FA 1NM9A 2V3FA 1GHFL 2PYEE 2Z8SA 2DTMH 2EDRA 1AD0B 1Q9OA 1CFBA 4OV5B 1SUJA 3RY6C 4WTZA 2VXSH 3ARZA 5D1XB 1MHHB 1N68A 2HJFB 4AJWA 4DVBA 4AK1A 4M43L 4LE8A 4Y0GA 1X9QA 2C3WA 5EF0A 2OAAA 2VMFA 2Q10A 4CVZA 2VDRH 5I74C 3HCVB 3BSHA 3PGDB 5LQBH 1CLZH 5TDNB 4CJ0A 1JYXA 2BNRE 1DQQA 2JNZA 3B9AA 3IDJA 3LN4B 6TAAA 1K5NA 4K94H 1HKLL 2R15A 5MERA 2UWEE 4Z7IA 4HCRA 2KYIA 3VFVA 2FZ3B 4BHUA 3UBHA 1IGML 4LEOB 5BV7B 3OKNA 3HNSH 4F58L 1KF9B 4NAJA 4AEHH 3ULUC 3WXWL 3O4OB 4H26B 3ILEA 5BW7C 1JGUH 1X5GA 4K7PH 3O3AB 4G9FA 4PD4J 5GISL 3FH8A 4DESA 2CJUH 4DFIA 3IB4A 2FLRT 4FYRA 4LCWD 3ZHKA 4P9ML 2ZKHL 1MW1A 3QCUH 3U4BL 1TTGA 3CFKA 1YAIA 2HKHH 2AAAA 5I6NA 1KGUA 4ODXB 2UV3A 2W1NA 3K8MA 3IFPA 2I5YH 2YMXH 1IBBA 1OW0C 1ZLUH 2C9PA 1TTUA 5I76B 1XIWB 2ADGB 2WLZA 3GMQB 5ILTL 3O3BB 3WENA 3NJFA 4A1RA 3TN0D 5T5NG 4YXHH 5CBAA 3HA0A 1JD7A 2WNKA 1U8IA 4KTYA 4UTAA 5GGTH 2AXGA 2BSRB 1ECYA 2VIRA 4ZFZB 5M94B 4B50A 3ARWA 1JZ8A 3N1FC 2IAND 1MHPH 4YXKL 2JJTC 2AGJL 3DO7A 1PZ3A 2FQEA 3L16A 1BZDA 1IBFA 3QE5A 3VRLE 1XDTT 3JWOL 3JYBA 1AQDB 3GIVB 4IRJC 5EZOH 3KE0A 4Z7QF 4H4NA 1P9MA 1XCWA 2VLME 2ZSWA 5IZ7A 4M7LT 1L9SA 5JOEA 5TK4A 1ACCA 1USQA 2VUOA 2FK9A 2UZIL 2YXWA 3SKOA 1LEGB 4H20H 1RSFA 3MQIA 4KY2A 4JREB 4X5RA 4H5SB 3IDMA 5AVZB 2E6QA 4LSSL 3JUYA 5DS8B 1BCIA 3BVTA 3TO4D 2OMWA 4M02A 4CKVX 4F2FA 2NPLX 3KEDA 4CC0A 3DSNB 2YS4A 3IDGB 4U4IA 4N6QA 5FUOL 2PTUA 3V4UH 2A99A 2I24N 2DBLL 2N59A 3LQZB 3KWTA 2WTPA 4XO9A 3L9YA 3JYCA 8CGTA 2DH2A 1P4LB 1FZKA 1RZKL 3EYUL 4EBQH 1S7WA 3DVGB 5D4IA 3R7RA 1QBBA 1Y1UA 4GKNA 1AGDB 3QQ9C 1RKRA 2ED8A 2VWEE 3TBYB 3VWKB 5KSBB 3DUSA 2IAMC 5DMGD 5KBMA 1MWAH 4LDLB 1HHHA 3ZE2B 2X6MA 4A7GA 5MEND 2EIKB 4GIOA 2VXVH 4X6DA 1MCWM 4N6RB 3J27A 3QO0B 3SQBA 4P2OD 1T5XB 3MCLH 5IK3B 1J05A 3MXWL 4KI5F 4D2NA 3RJDA 2VITA 1U8LB 3GMPA 1XGUA 2D0GA 5C0BD 1PD1A 2FATH 4N2AA 1I1YB 2BNQA 2AJUH 5DZAA 4C4KT 5JOFB 4PY7B 2CKBB 3MLVL 3K6DA 1G87A 1KJ2L 2NUTB 1KB5L 5DJAA 5IMOB 1MCJA 4UQEA 3UG3A 3HI6H 4U49A 2BC4B 2P28B 4X9IA 2WXJA 1OTTC 1FVDA 4IRSC 5IQMA 3QCVH 1BREA 3ZZSA 2VDMH 1WFUA 4LKCB 4MB5A 4Q52A 4AOFA 1RIUH 1OCCB 1JHTA 1QEWA 4R7DA 3EOBB 1KLGB 5HYJA 1MHCA 3C5ZA 4K8RH 5ENWA 2FSDA 3MC0A 1Q0XH 2VDPB 3TTYA 2UVEA 2YSTA 2VMDA 2I25N 3MXVH 4TUJB 3OLEA 3PV7A 1U42A 4HKXA 2AQRA 4OLXH 3FQNB 4N0UE 4BE6A 3GJEB 5CEZD 4NAMA 3ABLB 1MCPH 4UIMA 4WEEA 2WD0A 1NKRA 4FQCH 1TKWB 3P02A 4L5FL 4AV5A 1K5WA 5LBSL 3MV7E 2PYFB 2VSCA 1NCGA 4PJHB 1SF3A 4R5VA 5EHFA 3V6FB 3HMXH 3IGKA 2D2OA 5IMMA 4LSDA 1T1WB 4M5YL 4LMQI 4ODVL 1L6PA 2CUAA 2R7EB 5DSCA 3X1NA 1LILA 3FFCA 1BG1A 4YFLI 4DGUA 2HTLD 3UAJD 1XEDA 1WS7A 3RZCC 2MOGA 3SY6A 1VFAB 1BBDL 2AW2A 1ZLVK 4R7NB 1AC6A 1V27A 2D8KA 1LDSA 2CHDA 4XOEA 3SYAA 2E7BA 2LLLA 4ZMQA 1UASA 5E6UB 1DQDL 4JX0A 3POCA 1S7SA 4L4TE 1YEJL 3STLA 3BKCH 1TYEB 2X5PA 3G08B 4Z3EA 3QEQB 4F9LC 3CVIH 3V4PB 3IF1B 4U1MA 3BDBA 3EYOB 3RRQA 3I3DA 1HNFA 3D85B 3BPOB 4QOKB 3OQRA 5GRXG 4QRRE 3MV9D 4QRUA 1RUKH 1GY1A 3BAYA 2AK1H 4HWZB 2OMXA 3Q6FA 2X1PA 4GRLB 3ZDXE 1HNGA 3LB6D 4AC4A 1RZJL 3L4CA 4K9EL 4Z7UB 4HUNB 5E1QA 4U6YB 2A74C 2BSEA 1KV7A 2XG5B 5FGBA 3FUHA 2CNYA 3UC0L 1K8DA 5F70A 4KK6C 1T04B 5BS0E 1RIHH 4QNPE 3GRWA 4JL1A 2AZUA 2FT6A 1RZ7H 3OZLA 3QRFM 3CJJA 4NGHH 1XGRA 4B97A 3SJVB 2K6WA 1ZT7A 2FGZA 1AG6A 4MAYB 4WWKD 4S11A 3LPFA 4UM9B 1XF2B 2JKWA 3CVHL 4U6VH 5GJTL 1R5IB 2CIKA 3TFKD 5E8EB 5C0CA 2HFGL 4TL4A 3GZKA 3A22A 4Z7VE 1F4XL 1G7LA 2Y5EA 2VDNL 3HHSA 1FFQA 3EDKA 4LSQL 1AH1A 3DRTA 1J1PL 1AGFA 3HG1D 3N6YA 1JZFA 3UZVA 3GLEA 1ETB1 4ALAH 3G5WA 4OLZH 3ET9F 1IIKA 4PHXA 4LPVA 1YCSA 3CZUB 3A6BL 3VSVA 1ZVHA 3GS4A 4KY1L 1KN4H 2WKOA 1UCTA 2VL5A 1M4KA 3N91A 4JFQB 4S1RL 4U1KA 3LSOA 2AV1B 2IO5A 3MNMA 3QXUA 1Q94B 2CDGA 4FD0A 1DLHB 1A2YA 4H0HB 2E7MA 2CO2A 1A9VA 2MJWA 1H19A 2XKUA 3JWNC 3SE4A 5L88L 5C08B 2QQKH 5ACLA 1JYVA 3NZSA 1MFVA 3VJ6B 2W80C 3VRJA 3DGCR 2CHNA 4YDJB 4X6EA 5HHXL 5CCGE 3BZ4A 4QTHA 1X5IA 4Y7OC 1AO7D 1MH5A 2NX5A 2P5PA 1SVBA 1P7QB 4RZKA 4X6FA 5FO8A 1LO2L 1LQSR 2LFGA 1KMGA 1RZQA 3QORB 3QG6B 1UM5L 5DHEA 2WINA 4AMKL 1EHAA 2WBXA 5J56B 3DVIA 1FFRA 1WTGT 4IMLA 1CG9B 5J57B 2H2SD 3V10A 4N24A 4Q58C 1Z32X 3BEWA 4UOW0 3S3PA 4KDTC 4P2QD 4G80A 1QD0A 5FYJE 2XETA 5C0JA 3ZSTA 3VFPA 5KVGL 3WUWG 3DX0A 15C8H 1UWXH 3WL9B 4HOMA 4J12A 3U79A 1PTZA 2ZG3A 1OP5H 2JI1A 4BBWA 5FYLD 5A2IH 2YSSB 3R7QA 3NSCA 5JOPD 3C8KB 2E4TA 5JR1L 1F3DJ 5IMKA 1MI5A 4NKDA 5IF0B 5GGSB 2XQBL 2VR3A 1DE4A 4JO3H 4DVRH 4YO0B 4A7TA 4TF4A 4W4NA 5I1KL 4AYFA 3EGDA 5ID1B 4TOYL 1KEML 3FPYA 3RFZA 3MFGB 2P8PA 2Y2TA 3CFNA 1WD8A 1WEJL 4R4FL 2P80A 3D0VB 4TULH 1A3ZA 1T0NB 2X2IA 4OFPA 4QWWD 4WWNA 5DVKA 4MYPA 5DD5H 4IKIA 4Z95H 2VM9A 5HDRA 3P4NA 3SO3C 1MLBB 2CHXA 4OLVH 1PZDA 4MMZA 4A66A 4JG1L 3M88A 4QHUA 2VLLA 3RVUD 3VFMB 4LNRA 4CW1B 4A7QA 4X98B 4HKZA 3TYGL 4PI0A 2WOYA 4FX5A 2ZAIA 3KCPB 2IBBA 4POZC 1RMFH 5F3HA 3ZKND 2G2RA 1MCRA 1WFTA 3N55A 2JJVA 4I0CC 5IB5B 3N0PB 3L1OL 1UVQB 3QI9A 35C8L 2X70B 5KSAC 1GYVA 3CVDA 4U1IA 4R96B 1TTRA 4RDQG 5EU6D 1NC4B 4PJBB 4JFFE 2B20A 4Z0BL 5AD0B 2HJLA 1QPKA 1FGVH 1P2CB 4FJ6A 4Y2LA 4EQ2A 4DEPC 3GUTB 1U8MB 3ZKMD 1HCFX 3FH5A 2XA8L 1KJ2A 1ZAGA 4ORGB 3RB7A 1KB5A 2LFEA 1KGCE 4BKTC 5E7BA 1KB9J 1R24A 1ZANL 4QHNB 1CL7H 2HVJB 1BVLA 1C12B 4H8HA 4YWGL 2FL5B 4WKZA 4B53A 5JPNB 3K6NA 1GJWA 2IDUA 1CU4L 2OK0H 3ZHFA 1JWUA 1CL7I 3BO8A 5E08L 2FIKB 1EWHA 4GIAA 3N41B 4WEBL 4KRPC 1IM3B 2RFXA 1I3UA 5FFGA 3WELA 1U58A 1S7VA 1RP9A 1NZRA 4X7TB 4XGZB 3CU1A 4TSBH 5ESAB 3FW6A 4CVUA 5K1NA 3RA7L 1NEZG 4WLCA 5HYSB 1OM9A 3KWVA 4XNXH 1UYWL 3KPRA 3MRMA 4ZUUA 5LBSA 3TLRA 2VQUA 1I8MA 1Z66A 2NR6D 1A6UL 1NGPL 1KBPA 1XT5A 3CHRA 4UMGA 5AYQA 3SE9H 1PJWA 4U0RB 1IJ9A 1DBBL 4R5TA 3VFOA 3A3YB 4RGOH 2WBJA 1NCBL 3CQQA 2OQJB 2YO3A 2G60L 4H88L 2FIRT 4HIHA 2P5WD 1XB8A 4B9PA 4KJWC 1JZ4A 3OKEB 4RMSA 5E0QA 3GB7A 4IRZH 4M6OH 1TQTA 4JN2B 1FYTE 1KYUA 1GMIA 3DHPA 3FN0H 5DLMH 5HGHB 4QGYA 1QUNB 1KC5L 1I1AB 1AZRA 4NN6B 4XCNA 2PP8A 2N0KA 2F08A 5E8PA 1RULH 2RR3A 3RHWF 2W94A 4NNPH 3Q2VA 5I8EA 3NQKA 3LY6A 4V1DB 2H2PD 1FQ9C 3MOQA 3O8XC 4NUQA 4QHKJ 4Y5YB 5D7LE 4OGAC 3MBED 3V4VL 3NCCB 4NRXA 5MEPA 3EHBD 3VXUA 5DGRA 4ADIA 1FHNA 9CGTA 3FTYA 4N0RA 2VKXA 1EAPB 1KN2H 4N2KA 4NUMA 4Z8FH 3C5JA 4PJGB 4A68A 1O5PA 2ZXBA 3TIEB 4K5OA 4NWUH 5DEGA 2HCZX 3IPEA 4OM1H 5E94A 1PLAA 4BSJA 4KITB 2EP6A 1D2PA 1OSYA 1XMEB 3ARED 4U1NB 4MDRA 3ZLQC 3LIUA 2KZ1B 3ILDA 2C9VA 5I9QB 1RPQA 5HHMD 3IN0A 3KPPB 4NQVA 5K93A 2YPKB 1CTOA 4WNJA 4KKAD 4V33A 1N2RA 4E2OA 3T8XA 1U3JA 2DQMA 4QXTB 1ZS2A 5I0XA 4WI6A 4XN5A 5CILH 4TV3A 3BH8A 3UEQA 3CVHA 2F1EA 4FXKA 4J6RL 3Q01A 4YXLH 4XNZB 2ZYRA 2WQSA 4R3SA 1LM8V 5F8QC 4R7VA 1PFOA 4IBYA 3FUEA 1I9EA 1C5BL 4WJKB 5DRXB 2W0LA 3PIQA 4PGBA 3ABGA 3AXLA 3B7SA 4K3DL 4H8UA 1OTUC 4UOZA 1AYRA 3UYOD 2GTQA 4JDEB 1CLOL 2G4EA 1BGXL 4E9QA 1QP1A 2QKIB 3GJFB 4JPVH 4KJPC 1GKOA 1KCSL 2F5BL 2WYZA 1HYSC 1JPFA 5AAPA 2FJGB 1O7SA 3LNFA 2WLLA 1OSZB 1H3WM 4M62H 2EYRB 4GFXA 4OZIF 1F6AB 3LKRB 3LRSB 5FYLH 3WSQL 1XXDC 2NY4D 4D3CL 4P2RB 3DX7B 5DHVH 5E1AA 3MJ8A 4NDMA 1RUQL 5D5MF 4HIIA 1V8HA 2B08A 5IHUH 4FNPA 3HB3B 4E0RA 2XV3A 1R3JB 2ZUXA 2GK0A 2ZKMX 2HH0H 3NA4A 1AGCA 2QPEB 1UB6A 1S9WB 3D39E 3DX6B 4M56A 2I07A 4MKMA 5IB1A 3ZE1B 2HWZH 1Z3GH 2B59B 5D6DA 1DVFD 1DJXA 1S7UA 3PQYD 1Y18A 4FNSA 2ITDB 1UD4A 1V7NL 4O2EA 1EVTC 4YIQB 1X9UA 2BINA 2G5BA 2OV0A 2UY6B 2Y6TE 1V7ML 1HK6A 2GVYA 4Z77B 4XN9A 5DK0A 4UQCA 4GMTH 5C9JB 1F2QA 1W6WA 1RJYA 4TQEL 1CR9H 4PCYA 5IB2A 4HV8B 4FQIL 4NYLB 3MVSA 4K3JL 4N2BA 3VI3B 3FFOA 2JH2A 1F11A 4JUSA 3QUGA 4PS4L 3I6GB 5ETUB 3TOPA 1BFVL 4O02H 2E0PA 1YECH 3OPZH 2EH7H 4XPFL 5FUZH 1XR9B 2VTFA 4F57H 4CU8A 4WFFD 3Q43A 3STZA 1R3HA 2E7LC 1XCTB 3GK8H 5JO5B 3VGHA 5IOKA 2DMBA 4QRTB 5TH2B 4XMTA 2BWIA 5FM5O 1TMQA 2ROXA 3BCDA 1GXEA 1M2VA 2J88L 4GFTB 3NBNA 2ZTBA 5FYJH 4C56A 5C07E 4HUVA 4LOFA 4UINL 4Y5VB 4DGYH 1NGYA 1OGAD 4ZSOA 2DWEA 3GD1C 3IMUA 3VSQA 3HG0A 4N9OB 4PY8I 3DX3A 1QACA 1K3ZA 4PLKD 2DMHA 4X6BB 3T6QC 4PP2B 5IROD 4ODTL 3BAJA 5D7JC 3TA3A 3N1GC 1LEIB 5IHLB 3EFDH 1B4LA 2ARJQ 4Q6IC 3QR2A 2F1BA 3QNZB 3T2NH 2DLGA 3ARXA 4OGXH 2OA9A 5EO9A 3DX1A 3QXDB 5CZKA 1KLFA 1BX2B 1AQKL 3E8VA 4YC2C 1Q1JH 1IGTA 1D9KA 3K91A 5E6ZA 5K9QI 2DV6A 3P0VL 1F45A 2VE6B 4DPAX 3VXOB 3KDMA 5I1EH 4Y2DA 1IAMA 2JSFA 4I7ZC 2EECA 3IFOA 1PKQA 3IFLH 2QTEA 1L0XA 3MRIA 3UBFA 5F1SA 4GG6F 5F3BB 1BYOA 1AMYA 3CFQA 2IH8A 4G6FD 4WFED 1BG9A 2CK2A 4ONHB 4M3HA 1RJCA 1ULVA 1PU0A 2BDNL 6CGTA 1OPOA 1XMWA 1A7NH 1KFAH 3MI6A 3BUQA 4J23A 2GAZA 3RVTC 2B2XL 3M1BA 1N64L 2NY5C 3HNTH 4OIAA 4YVUA 1MCHA 2HJKA 3QISA 4HIXL 1CE6B 1U95B 2Y36H 3GWJA 2BZ7A 3BQUC 3U4KA 4TLUA 4MZ3A 3GXTA 1H3PH 3UTTD 3FULA 5FM4A 3TVMD 4YBQC 4DKTA 3RDJA 4WHDA 2EDJA 2ZT9C 4IOIA 4YMPA 4HYTB 3M8OH 2F19L 1N5AB 1TPXB 3Q1SH 3MPCA 2YAEA 5KBPA 1K8IA 3LKNA 4B7LA 5HXMA 2J71A 2Q86B 3A6OA 5IMLB 5AW4B 3ZE2E 3ARDB 1U3HA 4YDVA 5DJCA 5I6MA 3GKZA 1UZ8A 4Y1AB 1BYNA 1T2QL 1GGIL 2ERJC 2PXYA 4E9SA 3IT8D 4J3TA 4JHWL 4KO5A 3BKMH 4UCFA 3TBVB 1RUPL 3GMMB 1E9PA 5LGHL 3NZHL 3T3MF 1XQ4A 1Q38A 1RZFH 5E7FA 4G8IA 5IQLA 2W9DL 1NSNL 2FTAA 4XHJD 4YHKL 3E6HA 3ROOA 3ZIYA 4U05A 4PHZA 2PP9A 3FN3A 4ONOA 2Q1EA 3OVUB 2VRQA 2WQVA 3CZSA 3ULVD 1TZOA 2BIIA 1T22A 4HJGA 3A4DA 1Q1PA 4PSPA 7PCYA 5E2TL 4DK5A 4ZMWA 1HL9A 2FECI 1EEQA 2NY0D 5JMRA 4KMLB 4F20A 3NSFA 5KSUA 3PGCB 1I7TB 2HLEB 4P9HL 3U0TA 4DVBB 4XC3H 2GKIA 3UDWC 4AQOA 4G6AC 1TR7A 3EJRA 2FB4H 3A4AA 3QVAA 1TCMA 5KTEH 1HCVA 4WJG3 4CVZB 5E5LA 1QASA 4MXVE 4PUBL 1E27A 3U7YH 1P4IH 1CN4A 1MPAL 1DQQB 3IDJB 1K5NB 5MERB 1NGQL 2ZICA 1A65A <