1AZVA

Familial als mutant g37r cuznsod (human)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
b'ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKRLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER/ZINC SUPEROXIDE DISMUTASE
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Subunit asymmetry in the three-dimensional structure of a human CuZnSOD mutant found in familial amyotrophic lateral sclerosis.
pubmed rcsb
total genus 39
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1azvA00
3HFFA 2C9UA 2AQTA 1IBBA 1B4TA 2R27A 2WKOF 2ZOWA 1OZUA 1KMGA 4MCNA 1OAJA 4OJAA 1HL5A 3MNDA 1YAZA 3H2QA 4B3EA 2VR7A 3F7KA 1E9PA 3KH3A 3KM1A 1XTMA 2Z7ZA 4U4IA 3ECVA 1TO5A 1SXBA 3LTVA 4A7TA 2K4WA 1L3NA 2VR8A 3KBFA 4A7QA 2Q2LA 2APSA 2V0AA 3GZQA 2WKOA 2AQNA 4BCZA 1E9OA 1PZSA 3CE1A 3RE0A 2WZ6A 2ZKYA 1OZTG 3KBEA 1U3NA 1SRDA 3KH4A 3GQFA 2Z7WA 4BD4A 1UXLA 1IBHA 1JCVA 1AZVA 2E47A 1DO5A 1Q0EA 4MCMA 1UXMA 2SODB 2JLPA 2GBTA 2AQSA 2WYTA 4N3UA 5KBKA 3QQDB 1Z9NA 3CQPA 1EQWA 1XSOA 1E9QB 2LU5A 4BCYA 2JCWA 3T5WA 1FUNA 1HL4A 2E46A 2ZKXA 2C9SA 3GZPA 3CQQA 2ZKWA 1Z9PA 4FF9A 4N3TA 1COBA 2AQRA 1IBFA 1IB5A 1SXNA 3F7LA 2XJKA 4A7VA 2C9VA 1XTLA 2Z7YA 1B4LA 1QUPA 1JK9A 1EJ8A 1SXAA 2WYZA 2WWOA 1F1GA 3S0PA 2NNXA 3HOGA 1SOSA 1YAIA 1SDAB 1MFMA 3H2PA 1F18A 3L9YA 1PTZA 2Z7UA 1SXCA 1BA9A 2WZ5A 5CU9A 2GBVA 1BZOA 1SXZA 1YSOA 1RK7A 1N19A 1SXSA 1E9OB 1SPDA 4A7GF 2AQQA 4A7SA 4L05A 1OALA 3ECWA 1CBJA 3K91A 3GTTA 1JK9B 1E9PB 1PU0A 1CB4A 2AEOA 2AQPA 2WWNA 2XJLA 1F1AA 1SDYA 4A7UA 4OH2A 2VR6A 5KBLA 3ECUA 1OEZW 1S4IA 4A7GA 3GTVA 1DSWA 1E9QA 5KBMA 3MKGA 3GZOA 3QQDA 2GBUA 1F1DA 1TO4A 1IBDA 3HW7A 2WZ0A 3KM2A 1N18A 3L9EA 3PU7A 2AF2A 3SODB 1ESOA 1P1VA
chains in the Genus database with same CATH superfamily
3CVDA 4C56B 2E9WA 3NJJA 1MWAL 1L7IL 3TWYA 2DQIH 4ZW3A 2YK1L 2WO2B 3BDYL 3D0LB 3QPKA 1S7VA 1MJ7L 3L81A 5J3HD 2NX5A 3H4HA 5ERWB 2K6WA 1JZDC 3HIZA 1JL8A 2J6EA 4OCRH 5I1KH 2WXOA 1OAZH 2ZX7A 3B43A 2X2IA 4OF5A 3GPEA 2Y1YA 4DUWA 2WVSA 3HNVH 4F7MA 3FFDA 1IFHL 3UH8A 3QG7H 2VABB 2CGRL 1RERA 4FI6A 1G87A 4KRMB 4UB0H 4OB5L 3HLAA 4FTVE 3G5XB 3LH9A 4BH7B 3VJ6B 4M00A 4QXWA 3X1NA 4XAWL 3O0RL 2JJSA 3WFDH 1BAFL 1QO3B 1TVHA 2X42A 2JJVA 5I0DA 3VXUA 2RA1A 3ZDYE 2OS7A 1GIGH 4NPJA 3CSPA 4LDEB 1LMKA 1XAKA 3KPSD 4H8WC 4XPBH 3FHEA 1P4BL 4BFOA 1JZ6A 1C5BH 1ZAGA 3KLAB 4FNPA 4QRPD 3AACA 2BM3A 4GMTL 2NLJB 4LVHC 4G9FD 4FQ2L 3QCVL 4N0YL 4ONHA 3LB6C 2ATAA 2R9HC 2NX5B 3Q3GB 4ZAKA 2VDQL 4A7VA 3M88A 2EXWD 4MCYB 1SYVA 4L3CA 3MRDA 3D9AL 1NFDF 4R96B 1U92A 2NCMA 2ZWKA 2KC0A 2Q3XA 1I1YB 1E6OL 2DY2A 4IRSD 2Y5TB 4F9PA 1BZ7A 1L5GA 3NACH 1D3CA 3VI3B 1T3FB 3HFMH 2XLLA 4I9WD 5C0BE 3FQNB 2HSIA 2FWOA 3HE7A 1WAAF 4YDZA 2UZYA 3I6KA 3QJHB 5AL8A 1BAFH 4FCHA 4NLHA 2QV4A 3BW9B 4NQCB 4PJIB 2CRZA 3IGLA 3AY2A 4N0CC 2C4XA 3C6SB 4WTWA 2WD0A 1R3IH 2XHNA 4PJHB 1C5CL 4AY0A 4XP6L 2QLVB 5E95B 1UASA 2Y7MA 2EIEA 3HE6C 4FHBD 3RWGA 4AMWA 5L0QB 1FBIL 1FPTH 4W9KC 4P99A 3AFLA 4DCQA 5I0XA 3DXAE 3MUUA 5EC1B 3TXAA 2O61B 2Q7NA 5CBAA 3IYLW 3T0EA 1OVZA 1G7QA 4DO4A 2F7RA 3MRJA 2CM6A 4M61B 5GGVL 4E41A 2B0SH 1JVLA 1CD1B 1QI3A 1A3RL 3I3BA 2AMUA 3UC2A 4ZW8A 2HKAA 2EXSA 4BSWB 4N0RA 2CMRL 5HY9B 2VL5B 1WRFA 1MFDH 3MRNB 4JFOA 3F04A 3IAGC 4HKJB 1E9PA 5B8CC 1DQMH 1QACA 1MQ8A 4P46D 1V10A 3GDBA 3ZTDC 1MZZA 4KV5F 4YHML 3LN9A 4M02A 3K4DA 4ZO8A 1IEAA 5BO0D 1BQHB 4ZXBB 1OSZA 5JHLA 1EHLL 2Y6SC 3N42F 5AW7B 4A2MA 1P4IL 5AZ2L 3EYUH 4MD4B 1PKQE 1WFIA 4RESB 3O0LA 5I76B 2BOCA 4IRZA 1XF5A 2G3NA 1D7BA 1Q0EA 3N41B 4YHMH 4F93B 2Q7YB 3QAQA 2BIMA 2ZWYA 5GJTL 4CW1B 5C2BL 3NP3A 1J05A 4NPYB 5JZ7C 3C08L 2NX5D 5ISZD 2ZQKA 4KROB 4R7DA 1JWSB 1A8JH 1CURA 1PZ5A 3W38A 7CGTA 4GKZB 1BWWA 1Y18A 5AD0A 2NZ9D 3KXFD 3JZYA 1BSIA 1NCDH 2APTA 5EBWA 1JFQL 4JRLA 2W92A 2XFXA 3NT0A 3R1GH 4J5VA 3KGSA 4KKQA 3CVBA 3QXWA 4RSYA 3MLRH 4LB8A 3LD8C 3VE0B 4NOFA 1ZJBA 1G7JB 2FX7L 5EIIB 4KHTH 2O61A 6CGTA 1FG9C 3M17B 2M2DA 2MOVA 4IYKA 4ZOAA 3GHEH 2IPUG 2Z91B 4QHMA 3VGGA 3E3QE 2IALB 1IC7L 1GPOH 1M7IB 4UQ2B 5AB0A 3X12A 2ZUQC 1JHLL 3QPQC 1N19A 4L1HA 5C0AD 3EXLA 1XVSA 4HWNA 3T3MF 1EO5A 4G9FA 1EAPB 3SQBA 5BRZB 5H4ZA 4AC4A 1R5IA 4PLKD 1S7RB 4GO9A 1DBMH 3MLWL 3VFTA 1UB5A 2ZUWA 4O02A 4L1SA 1XF3B 5IVXF 4HPYL 4HHWA 1B6DA 3FCBA 1ACYL 3HAEG 3V4PL 1I1AC 3VI3A 1BZ7B 1EXGA 3F12B 3GHBH 3GZOA 1X5XA 1FFPB 1JTOA 3QI9C 4UINH 1FFQA 4XC3H 4KPHL 5JXAL 4RGNB 3UOAB 5C0DA 1MREH 3GBNL 1O5DT 3MCLH 3VD2A 3VTAA 4X98A 3RBGA 1IBBA 1MCIA 1X9LA 3NDYE 4PJFF 3RPBA 5TH2B 3T0XA 1IGIH 5D1XE 4TUJB 1IX2A 5BS0E 5AAWA 4R3SA 3J2PA 5FO8B 2G3ZA 4EJ1C 1FNSL 4UQ3A 1C1EL 1GC1L 3QORD 1X5ZA 2HT4D 1AHMA 4BJLA 3MMEB 5B3NA 1AIFA 2HRLA 4JX0A 1EVUA 2HUHA 3GRGA 2OSWA 3MBEB 3UCRA 3KVPA 3QQXA 3EJQA 2NY0D 5A6LA 5FUZH 1OGPA 2CALA 2FECI 2GCYB 1XGQA 4JQXA 3IMSA 3OKDA 4DKFL 5CZVH 3FB7A 4EQ3A 3QUMH 1AFVL 1ZSDA 2B2XH 3G3LA 4FTVA 3QEUB 4KU1A 3ZKQD 3IGKA 3WY3A 5G5DA 4ABUA 1NPUA 4LMQE 2HA1A 3BN9C 4EZLA 4QDGA 5AZEL 4EZMA 3CFJA 3GHPA 3B83A 4OIIH 5BZXA 5KYWB 1K3ZA 2ZKXA 1K4CA 4JB9L 4RZCA 2OMUA 1YDPB 2ZKWA 5JA8B 4PJDE 3UJIH 4PGBA 1EO8L 3MOAH 1JZ8A 1N10A 1W80A 5IBTH 1KCBA 4EN3C 4G6JH 1QUPA 4QMEA 4C8XA 1IE5A 2B16A 3G6DL 4Z3TA 3LXBA 4HIIA 1AGCB 5DF0A 3OKLA 2BP5M 2P80A 3MODH 4U1NB 5E51A 5D7JD 2FHFA 4YX2L 1F4XH 3AWEA 4NM8L 1HK6A 4H8PA 5D1QC 1L9QA 2UVFA 2YZ1A 1CDCA 4GRLB 1KCSH 2ICWJ 2BSTA 5D1QA 3T1WA 1U21A 1B0GB 1N8ZB 4EDXA 1HL8A 4H0LC 2AC0A 1RZGB 4GXVH 2OXHA 4U05A 4Z3IA 2ZCHH 4GSRA 2OTWB 1FG2A 4PJBF 2PCXA 1GGBL 1QHOA 4MZRA 1NBYB 2AV1A 3OLIA 1GRWA 2Y5EA 3CZLA 5IQOA 5T5FA 3RU8L 3HHRB 2H3NA 3RVVD 1CK0H 2OSLB 2A74C 3DVIA 1OPGH 5L4IA 5C07B 5KAQG 4QOKD 5FV2A 3Q1SL 3CHXA 2Y25A 5E1AA 5EBLB 1MCOL 1QWNA 3FU3A 3DUUA 1J0IA 2X5PA 4AYID 3MOQA 4PIRF 5FKPA 1Q9WA 3D6GA 5IJKA 2XDHA 2VXTL 4N90D 3S2CA 5AKRA 1FVDA 3D06A 4JFYA 3UGUA 1LO5B 3C6LD 1FL5A 1HXMA 2PWFA 2YPKB 4OD1H 1D9KA 2UWEF 2VUYA 2OZ4A 3T1FB 1PKOA 3RWHA 1O9VA 3KCPB 1N0XL 2G30A 1E4KC 1RIHL 2RIKA 5BRZD 2WW8A 4YAQA 4PJDB 5BPPA 2DKUA 3ETBJ 3P0VH 3QT2A 2YAOA 4P2QA 2NUTA 5SWSB 5AVVB 4S1RH 3DX6A 2V33A 4NQEE 4H8WH 2DM7A 4YNYA 1GKEA 1UZ6E 3GBLA 4PJ8D 1EX0A 1ID2A 5EOTB 4BKTC 4F33B 4PCSA 5EUOB 2XKSA 2VERN 2XPGB 4QYOB 2WV3A 3NIDB 3VM7A 1D5MA 5KJRH 4ORZC 1IBHA 2V2XB 3SBWA 3B9VA 3KLHC 2IQ9H 1T0MB 4R2GB 2EYTA 5ID0B 4U3SA 3B7RL 1H3WM 4J27A 2ZYRA 4Y4KA 2KLTA 3I50L 2EAEA 3SGKA 3ZDYB 1CO1A 1NCAL 2EKSA 2OJEB 3DO7B 2CXKA 2Z8SA 3AAZA 2AHIA 5IK3B 5LUMA 2C8NA 4LLUB 5CSZB 3WL9A 1ZEAL 2OV0A 4XO3A 3WD5H 5SWQB 4KOBA 4M1GH 1QWHA 5IROD 1JPSL 3O11A 1AC6A 4JJ5B 4NDMB 1FVCA 4FNLH 2YAQA 3C5ZC 4I89A 2FYYB 3BQUB 4ZW5A 1YEFH 4IRSB 3GD1C 1RHFA 3OJ2C 3MNWB 3BN3B 4XMWA 3WI9A 3S97C 4LSTL 3GMOB 1IKFH 2DD8L 4FZEL 4XN1A 4D9LL 3U7YH 3G6JA 2DQJH 3S5LG 3V2AR 1A4KB 3C9NB 3CG8A 2NSMA 2YEZA 4HCGA 3BP5B 3GXNA 1RK7A 3CN0A 4Y19D 5LO7A 3HC2A 1SXSA 4FFWC 5F3FA 5CXPA 2IDSA 4ZI8A 2AMGA 4GIPD 4KI5F 3G5ZA 4OQTH 1KN2L 1YMHB 2ADGA 2VZTA 4HVBA 3BZ4A 5KVGE 4JR9H 3OQ3B 1JV2A 4LNRB 1J18A 1HIMH 1JFHA 3UPCA 5E5MA 1F00I 3MVSA 5BUGA 2JIXD 1YMMA 1N70A 4GLRI 3S9DB 4GSDH 1PSKH 2BX5A 2HRPH 4IRJD 2VLKA 3CX5J 1FNHA 4HH9A 4KKAD 3GXDA 4ELME 5C92A 1BYNA 4TNGA 2O6PA 3O2VH 5DMIH 4U6YA 5BO1H 4OM0L 4DHLA 3BCFA 3S8WA 4I18A 3DVNB 1U4EA 4QOKB 1HE8A 1TR7A 4B9IA 2XPYA 1RURL 3L3JB 3CH8A 5F88B 1A0QL 4HGWA 3HI1A 3V0JA 4YE4H 5F8QC 4TSCH 2JCCE 3QUYD 4EBQL 3CDGA 3BAYA 4MNHA 5FKAB 2NXZB 2VISA 4GQPH 3PL6D 5DHYB 1SY6L 2EACA 2BIPA 2FSEA 3CC1A 4WQOA 4EUPA 5ANMA 3FT9A 4A38A 3U36A 5IW3A 3L17A 3MYZA 4ODWB 2HXAA 2IAMC 1HCYA 3U0PA 5IROA 3CE1A 15C8L 2GJ6A 4A2HA 2HG5B 3N40P 5C07A 3VRLE 3KBEA 1T22A 1MJ8H 4M3HA 5B4MD 3G5VA 1Z9OA 2ZKMX 4YGVA 4UNIA 2H0JA 4NO5B 3SDXF 1CVRA 5J6HB 1P7QB 5CD5D 2D73A 4NO2B 3T6WA 3WE6B 2AV1B 4X5PA 4PS7A 4X2UA 1ZSHA 3QDMA 4XVTH 5BO1L 1Q9LB 5F7AA 5HHXH 4XMKH 3CUPA 3S88H 4Q0XH 3OG6B 4OZFA 2KQNA 5I8KH 1H8LA 4QRAA 4EOWH 4EDXB 5EIIG 5L8JB 5ES4B 1QFPA 3QIUD 3ZT7A 2XZZA 3UTTD 1GY2A 5AKTA 2DKSA 1Z9PA 4R5VA 5AWNH 4LPYA 3BIBX 2CK2A 2HFGH 2NY2C 1FIGH 4XMVA 4N26A 5DC9B 4ELMB 4NYLA 2OK0L 3CZFA 4X8XA 3EUUA 2XQBL 3IDGA 1WHPA 2BSSB 5IIEA 2ZCZA 1WS7A 4PJ7A 1F4YL 1W15A 3EADA 5KBNC 5LG6A 1JN6B 2J6EL 3Q2VA 5E4IA 2VQTA 4ZQTA 5LCVA 2X41A 4NUJA 1EGJL 2DQTL 5ADOL 3ISYA 2XWBB 3CVHA 1AR1D 1JAEA 3QNYA 4MS8D 3ARBB 1FNAA 4DTGL 2V7HA 2F15A 2YXMA 5HGAA 5GIRA 2XQ0A 1DSFH 1MHCB 1EJOL 3QO1B 2OMBA 1BF8A 1FO0L 1RZKH 2CCLA 3SGJA 1XWVA 4TQIA 3WFHA 1K2DB 1ZVHA 1XSIA 4F2MB 5JORA 1QRNB 4F7EA 1I85C 1IQWH 1GJWA 2XWRA 5DQDL 5IF0B 5EU6B 3VGHA 4D2NA 4YQXL 3OF6A 2FIRT 4BXVA 2D4FA 4EDWH 5F72S 4FG4A 3S96A 2OAAA 2JB6A 2WO3B 1EJOH 1IAIL 1XBDA 2DDQL 1WAEA 4MRBA 3AT8A 4Z7NB 3LOWA 5F3HA 2EYTB 1E2VA 4KI1A 1ZT4A 1XSKA 1D7CA 5DJDA 1CFTA 2GY7B 2YLKA 4UB0L 1ROWA 4FXGA 4P23D 5LQBH 1EGJH 2COVD 2R0LH 4GT7A 4GMSH 4MLIA 5I1DA 2FO4B 3QVAA 1X9QA 3O3BB 3RL1A 2L8AA 4PRAA 3V6ZB 1HI6B 3BWAA 4GIAA 2WP3T 3QUHA 4HIHB 3UBXI 3TT3H 43C9B 4Y2DA 4GW5A 5FHBH 3P0GB 3PJNA 2ZAHA 4G6KH 4YHLL 2EYRB 5I71C 5B1AB 3QIUA 1TTCA 1PQZB 3TNNA 4Z7UB 1O6SB 2XZCL 1BEYL 3D12B 3GRBA 4O00A 1P6AB 2F53A 3ZPDA 3N1QC 4JHZA 4ZPVA 3D2UD 4CNIA 1YNTF 3I9IA 4OY9A 1UT9A 2CCWA 4LEBA 3II2A 2W65B 4N6QA 5CJ5A 4N3UA 1E65A 4FNSA 2HRGA 2W81C 1QRKA 4LF3B 3PAUA 4U6VH 4FABH 4NJAH 3RPKA 1W72B 3QJRB 4MA7L 3P77A 3HG2A 3L8QA 1ZHBA 4BK8A 3UBXB 1T83A 2D3VA 4GMTH 3OGCB 1N7ML 4LSRH 2CDEB 5LGYA 1B0IA 1TJIL 5LCVH 3OZLA 1H8SA 5DA4A 3LIZL 1KYUA 5TE4H 5JW4R 2OBGA 2EIZA 3ASWA 4J7RA 2IH9A 4ENED 5EF0A 5J8OA 2GK0B 2B1OA 2IQAA 3DROB 4AQ1A 1Q90A 2QSTA 5JPMC 3L5JA 4JDEA 5DD1L 2H8PA 1TNNA 4QHLA 2X6BA 2QTEA 4GKZA 5DO8A 2CO6A 2I9LB 3B2XA 3MBED 5BS0B 1JYNA 4NGHL 1KCVL 3GSVA 3NYKA 4LAQH 1FCGA 2IPKB 1U3YA 5EZOH 4GKOA 3COOA 1E4JA 3KWTA 2EEAA 4H7VA 3LRSB 3V0IA 4OZ4A 5EC2A 1B2WH 2Q7YA 3OKNB 1NPJA 4N28A 2XCMC 5C08B 4U1IA 3K0YA 2CD0A 2WQVA 1YNLH 4MXWL 4AYFA 3GMLA 3MXWL 1MG2C 4Y8DC 1KXVC 2ATPB 3T8XA 2X10A 4F2FA 2GIMA 1SMOA 4NHUB 4AL8H 1FFRA 3EFFA 4BCXA 1OY3B 5E9DE 1YQ2A 4DERA 3DX7B 3LZFH 4UMGA 5CJQH 2BNQB 5SX4H 4EI5B 4H26A 5EDSA 3TF7C 2PETA 3LIZA 2VDPB 4KJYA 1YUKB 1A3ZA 2LTQC 2XSKA 3QS3A 3UIZA 5I1JH 4BGDA 5CO1A 4KJPD 3AT0A 5JO5A 1XZ0B 3V52L 1TZ8A 2X7LA 3VFWA 4JPVH 4NT6A 5GSRA 1X4XA 4F8PA 3BUDA 5CEXB 3DJTA 1A2YA 2AKRB 5HVGB 5EU5A 4YXHL 4F7TA 3LMJH 3NZ8B 2ICCA 5F7WC 1AD0B 3KYKL 1M57B 3LKRA 3R06B 3S5YA 2QQLL 5I30H 4HUNB 4KKZA 4WGVB 3BWUF 5F9AC 2DLEA 4U7MA 4UT6A 1UCTA 4JO3H 4ZZKA 3MXVH 1EHAA 1JPST 4YVNA 1JF6A 4K3DL 3F12A 3MOBH 3MLUL 1LK3L 3HKFA 1QHQA 1HHKB 4RRPG 2F7PA 3VB9A 3KG5A 1OCWH 4H5SA 3LQAC 1K3IA 4J4PC 1YNKL 3BAKA 5D1ZC 1QW9A 1Z5LB 4TULH 1P4LA 5ETUB 5EU4A 5IKCA 3E6FA 4WZ9A 1IGTA 3M6DA 5BRZA 3FHAA 3QFJA 1NGYB 4J4PA 2XTLA 2ZSVA 5ID1A 1P0SE 4CRPA 5BZWB 5HDRA 5TTRA 5TGBA 1YUHA 4K3DH 1ANUA 5F6IC 4P4RB 3TBSB 3H9YA 2DMBA 4G1MB 2BH0A 4UQ2A 4Y2DB 5CN3A 3JT2A 2NUPA 4HIHA 4E9LA 2DWEB 4HIEA 5KVEE 5HHNA 4LSDA 3WDHA 5DS1A 2A73B 2BVEA 1PG7W 5I30L 3RWDA 3TZVD 4AYDC 4B0MM 2AXFA 2JKTM 3K5SA 2J8UB 4ZQKA 4C54A 4YSEA 1H9DA 4OF6A 4KDVA 2JH2A 3MUJA 4XPBL 1JD9A 3RFRA 4G59C 3ARFB 1EAQA 4L4TB 5IMMB 3K71A 4P5TC 1CB4A 2XXMB 3BN9D 3GJFH 5T1LB 1KBKA 4ONFH 3TFKC 2Z4TA 4OZ4B 1SJVA 4GI6A 1PL3A 4R7DB 5IESL 3WHE1 1WD8A 4U2ZA 1D5XB 1OAKL 5KUMA 1N18A 4UV4L 5B39A 2EIJB 4OBSA 3T0DA 4HJJL 4NHUA 4NZJA 3QNFA 1KCUH 1FGNL 2XIDA 1YEDB 4Z7VA 4FQCH 2DLTA 3MV8E 5ACLA 4ZBJA 4XXCA 4BQ9A 1WFTA 3SPGA 4PQXA 5DZAA 1SM3H 5CCKL 4XO5A 1UWFA 2FX9L 1T89C 5D7JC 1KPRA 2IDQA 4QJ3B 2Y69B 3LPPA 3ZY7A 4JAMB 4WHYH 2PTTA 1PX3A 3OJVC 2F5BH 3HI5L 1D5ZB 3REVB 2R2BA 4BIKA 4QLWA 5EZLA 4HJEA 3GSVB 1F8TL 1S9YB 1UWXH 1KTKE 3U1SL 2CJTA 1PYWB 2AK4D 4JFOB 4IOSA 3MJ9H 4J3OF 4JB9H 3GWJA 2AQ2A 1NGWA 4JCWA 5KOMC 1IGCL 3PWPD 5JHMA 4PHXA 1EBAA 2DQCH 5KZCB 3TCTA 3RVVC 5FO9B 5IBTL 3ZYIA 2H1PL 1CN4A 1QSEE 3P9LA 2ZF9A 5GGSY 4MAZA 1LLAA 2A3TA 4JNXA 1S5IL 4C56E 4KMLB 3UTQB 3TGXA 2AJVH 4ZAKC 3EH5B 4JY6B 3CUPB 4B96A 1JV5A 2YPVH 2BNRB 3SDYH 1BZ8A 2NTFA 4KRPD 4WWOA 1L9SA 4EVNA 3DVFA 4LVEA 4R7VA 2K3HA 3M1BB 3JWOL 1JHKL 4U1HA 5D4HA 5D5MF 2EEBA 3D4YA 4OGXH 2WLYA 3BSZA 4K5OA 8CGTA 3H54A 5IMLA 1EPFA 3MSPA 4MBRA 5CGYD 4BE6A 5B22A 3D2UA 3RDJA 2ORBH 4LSSL 4NQCA 4YDKH 4MA1B 1QYGH 4ZJ9A 2H0PA 5H35A 2FO4A 3LZNA 1HAUA 4GP4B 3FYIB 1FV1B 2HH0H 4JDZA 4AQOA 3NJIA 4EAEA 2IMMA 2O30A 2B59B 5I8EB 2V8LA 4MNHB 5HPOA 3DX0A 2YN5A 5IOKA 4F8OA 3CFMA 3K4AA 3SBPA 5IQMA 1IAKB 1FE8H 1Z3GL 3BPOB 3VFMB 3S98A 1DQVA 4ADIA 1WSST 4RRPM 2AVFA 3IS0X 4JFQB 1JYVA 4I18B 1RZFL 1BZDA 1UATA 1ETJA 1C8PA 3HBPA 2XYCA 2DW5A 2UY7B 4LOUC 4LCUB 2H6OA 2WTRA 2VDRB 5D7IA 3DWTA 5IGXH 3FTVA 1E8XA 3MPCA 3WYRA 4CC4A 1KDIA 3BVUA 5DJYB 2FEEL 4M93B 3U0WH 3B5HA 4F58H 1MHCA 4AGQA 4U6HB 2FHBA 3ZRCC 2UYLB 1ESOA 2OSYA 4NHCL 1I75A 3UYPB 1ZLVH 4RISL 3PWUB 2NR6C 1R75A 4RRPA 1YEGL 1DJYA 1WCBB 2ED9A 5F9WB 1BW8A 3F6JA 1RZJL 3UTZB 4MA3B 5EO1B 4POYA 5EU6A 3SE4A 4PYGA 4UCFA 3CZSA 4W9EC 4A2DA 1CGSL 1QRNA 1MCBA 1SJEB 5HDBF 3IWVA 4Y2OB 3PRZA 3VXSE 4YH6A 3HZVA 4MZ3A 5DK3A 2ERJC 1ZLSL 2IPTH 1L0QA 4X0KA 2KZKA 3GLEA 3PGCB 4PWFA 1RZJC 5GIRB 4ZMYA 4G71B 4M6MH 4P5TA 1WGOA 2WLLB 5JYMA 3SDAC 4ZTOH 5E4EB 1NC4B 2XV3A 5D7IF 3N9GH 4YSAA 1ZGLB 3V8OA 1CFQB 1OCOB 1XH3B 2EEFA 3IPBA 3S37X 3UC0H 2OR9L 2WXRA 4D0CB 4X4YA 4LSPH 4DP6X 1JCVA 4RFOH 2O6CA 1A7OH 3ASOB 3IMWA 4ZTPL 1LK2B 3BD5A 12E8L 4FP8L 4QR7A 1A9EB 1T7XA 2PWDA 3FH8A 3I50H 3ARWA 3T04D 3HG1D 1A3LL 4MNQB 4UOJA 3GSXA 3AREC 1E67A 3IDYB 4FZEH 1GOGA 3TTYA 4D9LH 4Z7QB 4A37A 4IGBA 4J3TA 1KELH 1EZVX 4N8VG 3VRLF 3KEDA 3IDJA 3Q13A 4P46A 3JV4B 3WXVH 1DJHA 2P4AB 1HHGA 3RIFF 2UY7A 4JCMA 1CFSB 1XCTA 3PJLA 1I3RB 3FU7B 4X6DB 2VERA 4BFJA 3ULVH 4TUOA 1Z5HA 1G84A 5IVXE 4LLWB 2DIJA 3QDMB 2J8UF 1OO2A 4PI0A 3H9HB 3UTTE 3SDXB 3IMVA 5A2AA 4B9FA 1SDAB 2HLFC 1EEUA 2EIMB 5AOMA 4TOYH 4MBOA 2XY1A 5CZKA 1P1ZA 3IF1A 5FW8A 4UIKH 4GG6F 3T71A 4LLAA 1YEKL 4Z18A 1NPNA 3QDJE 3Q7JA 1Z0NA 3T0VA 5JHDE 4HCIA 3KDMA 1I3RA 3KDMB 2QPUA 4Q74A 4XP1L 4O2CB 1NBVH 4HP5A 2VLKB 1Z0MA 3D2UB 3UX9B 1LO4H 2AEOA 2FBRA 4E9RA 2QL1A 3JSSA 4IU2A 4GUQA 1USQA 1FZMB 1UWEL 2PMZA 2A9BA 4Y5YA 5J1TC 5J13B 1DCLA 4IMKA 4HPOL 5ICXA 4I77H 4QRSA 3Q6GH 3SDDD 4TLUA 4PTUA 1YMHA 4EVNB 3D05A 4PS4H 4Y4HD 3TA3B 5AW3B 3WJJC 2W59A 4TNVF 2E27H 1NC2D 4YC2C 3V0WH 3VXMD 1RURH 3HHMA 4GUPB 4YSSA 4HSCX 1LTXA 5I24A 3BVVA 3ULAB 4X5XA 4R26L 1A6AB 5DO2D 4FYQA 1IZKA 1I8IB 2J55A 2GI0A 3E6HA 4TVUA 1UD2A 4DGVL 2BWIA 5FO7B 1I9JH 3VXOA 2BCKB 4EKJA 4PLNC 2R1WA 3GDCA 3NJNA 3Q2CA 3POCA 2BHZA 1W91A 2IANA 3GI9L 1OP4A 2P47B 1DVQA 1REIA 1A1OA 3X1GA 5IBUG 4M48L 4QRPA 2ZCLL 5AKVA 5TF1H 4LCYB 1TFHA 3ARDC 2YPLD 1QA9A 1U3ZA 1A4KA 3OB8A 3UZVA 5MI0B 3U2JA 2Z7WA 1UJ3B 1BFOA 2ITCA 3LNFA 2CKBB 1VCAA 2OTUB 1TLMA 3OXRB 4QRRE 2QFPA 4EN3A 4Y9GA 1C12B 5G5DB 4P59L 4KVNL 5FW6A 2MNWA 3VQMA 4PRDB 4N1HB 3QEUA 1FVCB 4HD5A 1ETA1 2W0FB 2JCCF 1INDH 3EJSA 4KDWA 4CDGC 4DF9A 1OE2A 1T66D 4HU8A 4J3UA 5E2UL 2YA1A 1WAAA 2G2RB 4NENA 4WUUD 3CZKA 1OSPH 3GMRA 2WO4A 1G0YR 2PP8A 3KBHE 4MAYA 4X6EB 1U36A 5I5JA 1KTLB 3QFDB 1A4JA 4U6HA 5I1CL 3NCMA 4BEIA 1S7UA 1TMQA 1YNTB 4JO5A 5TF1L 2Q7AA 3SGKC 5MEND 2UUDK 2WLNA 3H7LA 3BFWA 5L9DL 2F08A 4BWWA 1MCKA 1MRDL 3BWSA 3GS7A 3IBOA 5EV7A 4S0SD 5J12C 1LQSR 2I32A 5D7LB 3STLB 3OPUA 1SEBA 1WCQA 3CWGA 1QLEB 5K33A 1I9IL 5E6SB 4PGCA 5CJOH 4BFGA 3BZEA 1FGVL 3BJ91 5DSCA 4PRHD 3TTSA 2ZWLT 3X17A 2VQUA 2RHEA 3EJZD 5CFHA 1FFPA 2F1BA 4D8OA 4L0PB 3QXDB 5BV7L 3QDJD 2XX0A 1YQVL 1MHHB 2IIJA 1D9KB 3JZ7A 3SE9H 4F9PC 1F11B 1HQRB 1JV5B 4PJGA 3TT3L 3FMGL 1SVZA 3BSGA 25C8L 3AWFA 43CAA 4Y0GA 3JWNG 3UTQA 1HN1A 2FHCA 2AERT 4RAVB 1OSPL 4RNRB 4KZEL 4M62H 2BSTB 1VPOH 1IM9D 3KPRA 2PP7A 1SJHB 4DGIH 1TUPA 3CCHB 4A04A 2PXYD 1HCZA 4OLUL 4WDIA 2OMXA 4N8VA 2WXMA 1UURA 2X0WA 2FUQA 2AABH 1V7ML 3II1A 3TWCL 4P5RA 5IG7B 3WN6A 1PDKA 1B9ZA 3KPOA 1JZHA 4YO0A 4X5RA 5EBGA 3UBFA 3R19A 3FRPG 3OWEA 4U4IA 1ZLWH 1QVOB 3I9GL 2KUTA 3U0TA 2WSKA 5HGGS 5HGHA 3LKNB 4KJWD 2PTTB 1ZCRA 4WI0A 1KGCD 2QHRL 4CSZA 1I9IH 2WKLA 2DJSA 1PPIA 3EOTH 4JO4L 4UT6L 1FH5H 3UMNA 3AABA 4BCZA 2PO6C 2EH7L 1PSKL 4I1RA 4ODTH 3PXHA 3L3OA 4EKXA 1S7QA 4KTDL 2BIIA 4HX1B 5CIPB 1J5OH 4PRIE 2IAMB 2E47A 4TQPA 3FOMB 2GK2A 4Z5RB 1HJBC 4XNUH 4IBUA 3FMGH 1QSEB 3IETB 3RNKB 5HXMA 4HUVA 2QQKL 3P73A 4YBLC 4Y1AB 2JWYA 1CD8A 1U8MA 1R34A 1JD7A 1L6ZA 2W9DL 4FQPA 2IDCA 2JQAA 3EFDL 5HVFB 1Z9NA 4YHPA 4JVWA 1OHQA 4Y16C 3TU6A 1D2PA 4NO3B 3SKMA 3V6OE 4AEHL 3I75B 5DJ0B 4EUPG 1TEYA 3NUKA 4HZAA 1FVEB 4E41D 4L4TA 3W56A 3K71B 1JDDA 1UVQA 5I0ZA 2C3HA 2J12B 3Q43A 1GXEA 4S1SH 5FPIA 5E9DA 3D9AH 1JRHH 5JHAA 5MHSE 2QHRH 2D7OA 1XMEB 3A47A 3L2LA 3NRQA 4R3SB 4WW1A 3KW7A 4W9HC 3VFOB 3A6BL 2X1PA 3LDBB 3FQUB 2BVTA 2VJXA 5D5ME 4HKJA 3VD0A 3OXSA 3FONB 4HXAL 4LBEA 4W9DC 3NSYA 1CJYA 4G1MA 1ZHLB 5AL0A 5C6WH 4JDEB 4PBVC 4DN4H 3DARA 5A3ID 2ZSVB 2D7TH 2DQEL 2VLMD 3QFJE 3T0EB 4GYBA 3UYRH 1VJSA 4P2RE 5F1IB 2Y6TE 3INUH 4NOBA 4PPTA 4LNVA 4LIQL 2FWLB 2XV0A 1EH9A 2X4NB 1D6EB 4HYTB 5CLZA 3FSZA 3OTTA 3E1ZA 2C9RA 5EOQH 3DOHA 1QEXA 3DO3A 4X98B 5E7FA 4GP5B 3T3ME 1W72A 2JTYA 3PHOA 3X14B 4LF3A 2FQGA 2O5ZH 5JIHA 3MLSL 5KYUA 3A22A 5FCUL 4KNSA 4X7FC 4OFYA 3TL5A 2X4NA 1JGLL 3JWDC 4LBAA 5E9AA 3CSTA 2APFA 3NN8B 4U1LB 1TYJA 3ZUCA 1RK1B 4WFGE 4F15B 3CZGA 3PHAA 1T1YB 3TCXA 3QNZB 2XVBA 1G7JA 1MFBL 3MNZA 1EXUA 3OWRA 4DO6A 3ARDA 3B2MA 5CUSL 1XDTT 3MA7B 4HMCA 4Z7AA 1QLFB 1SYVB 5JQ6H 3RFZC 2VM9A 5HHVL 2AQ1A 4BK4A 4PRAB 4OZGE 4NQDB 1XGRB 2W07A 4JZJC 2HT4C 3NZ8A 3LKQA 4K7PX 2J5LC 5GJTH 3HN3A 4N0UE 5D71H 2AEQL 4WO4A 1FN4B 4ZMOA 3H9SA 4XNZC 1R19A 3RDTC 2GJZA 3Q9PA 2DPKA 2QQNH 4TLSA 4FNQA 5MP6L 2EUZA 1BD2B 2Y1ZA 3L7FB 3LN5A 3TIEB 5ACZB 3V4UL 2AJSL 4R0LA 2AXGB 5IR1B 1PY0A 5C0GA 2VABA 3ILDA 4LCCA 3U6RA 3JV6A 4WKZA 3T8VA 4N86A 3CGTA 2ICEC 2TSAA 1MCNA 1ZLVK 1KYOJ 5E9DB 2PYEE 1X6NA 1MFMA 4FMVA 4JQIL 2WIMA 5L88H 4LCWA 2YAHA 2BNQE 1N6UA 2G60L 1Z3RA 5FCSH 5ESVA 3V79C 3FN0L 1VB9A 2CGZA 4MJHA 5DD0H 5EC2B 5L2KB 5C0EB 2IXQA 3P2TA 4R4ND 3NDZE 2V8MA 3TA4D 4AE0A 2WN2A 4Q9RH 3E3QC 1BBDL 4PVBA 1LP9B 4RBPH 4IIQC 1PDKB 2YFOA 2R69H 5C08E 3EOYG 5DJXA 4GSQA 4PJCA 2O5YH 3FH7A 4FDWA 1KJ2A 1TF4A 3KYMA 2BCKA 2DMHA 1R46A 1H8NA 4NC1E 1TJIH 1AOHA 5LCVL 3TFKD 3GM0A 1F1DA 4J3OC 4PJ9A 2W65A 3S2AA 1Q38A 2GB2A 1R5WA 2FJFB 4DGWC 1J88A 3CDCA 3NEEA 4XNXL 1K5NA 3DTXB 2OMTA 2XWXA 1RZFH 3FQXB 4UBDD 1CLOL 1ITCA 1FGNH 1W16A 2FH8A 3HE7B 5GGTA 2XNAB 2PCPA 3LS4H 5I82A 1JG9A 2ZOWA 3S34L 1MXDA 2ZUTA 1O6SA 4B3EA 3SKOA 1R33A 1DBJH 1KWGA 3TVMC 1YJDC 5DRNB 2HKFH 3MLYH 5DSCB 5FEBA 2QR0B 2A74A 3R4DA 3QNXB 5DUML 2D4DA 4GW5B 1D6VH 1Z9SB 3DK0A 3BH8A 4DP8X 2N4IA 4RMUA 2ZG1A 3SCMB 3BP7A 3ROOB 2UZYB 2VC2B 3I6KB 5IMKB 4PJGB 5KSVB 1DBJL 2IH8A 3K72A 1JI1A 3QSKB 3QS2A 3VFVB 5JHLH 3MLVH 2YRZA 1UT2A 4XPAL 3O3DA 5PCYA 3ZE1E 4X6EA 4A2EA 4JDVB 1I1YA 4P2AA 2X70A 5E99L 2QVTA 3K6FA 3U1PA 1QNIA 1CF8H 1EEZB 2VC2L 1MJJB 1T5XB 3WTUA 1ZJAA 1BHGA 4U6YB 3S35H 4HIPA 1FUNA 4FQXC 4KRPC 4PRPE 5D7LA 4A55A 5JOPD 3CQQA 3OHMB 1F3DJ 5T8IA 4LLVB 1AE6H 1IL1A 2FBJL 5DJDB 4TUKL 1BQHG 1MFVA 4PY8I 2AP2A 3MJ7B 4S1RL 1IGJA 1SXAA 1JV2B 1XCWA 4LNRA 2XG4B 4X6FA 1KIRA 4MAYB 1GVIA 4IU3B 4ELKB 4ZS7H 3VI4E 5LGJB 5CP7A 1LK2A 1CFNB 1MPAL 3BPLB 3NFSH 4IBZA 1K8IB 1OTUD 4ZFZA 3BGFC 1TTGA 1RP8A 4HA1A 1H6EA 3BKCL 1NIEA 4HIJB 3ILPB 3O6FA 5D7SH 2NXYC 3PY9A 5HHQA 1ZGLA 4UILL 1IT9H 2CH8A 1QZ1A 4ZUVA 3EXJA 3LNIA 4PG2C 2NW3A 5IHHA 2IADB 3DUHA 1L9NA 2P46B 4V2BA 3WTTA 5E24E 3DSNB 1HSAB 1F1AA 1N2RB 1S7VB 2EP6A 2XIBA 4XC1L 1HYSD 1BFOB 2ITCB 3TCLB 3CFKA 4BKSC 4NFBA 2CO3A 1GHFH 1T6WA 2D2CC 3F00A 5D2LE 5FLUA 2DYPB 2B8OT 3SODB 1NFDE 4NUGL 2UV3A 3JWNH 1UM6L 4FYSA 4TSBH 3QUYB 5ABDE 1C9SA 3EO0B 5BS0D 2CUHA 4YGVB 2IPUK 2I9TB 1UCBH 4WFFD 2E76C 4LE8A 3BEWA 2HCZX 2IC2A 2OR9H 4EI0A 2G3MA 5E0QA 4XP4H 5AKSA 4EN2A 3D3VB 4YHOH 5CEYB 4L8SA 2BRQA 1IEBA 2VT0A 1U3HA 3FQRB 1MW0A 4N0FA 4HH8A 1G0DA 4G7YL 4JVUA 4GW1B 1ZDSA 4XHJD 3QAZB 1A6TA 1AY1L 3CXDH 1NCBL 2H26B 4LDOB 4LOUD 2PN5A 2HN7A 3CBRA 1SRDA 1CIUA 5CZVL 1TFPA 2DAVA 3HG1B 1RFDH 2PR4H 1IAKA 3N43F 1DBAH 3PWVB 4K8RC 4OVVA 1J8HD 5IB3A 4HJ0D 3WJJA 3HC4H 3QJFA 4Z7QF 4LLYB 4LPXA 2Y7OA 3EDEA 3H8NA 2CHDA 2KI6A 4APQC 2BSCA 4N0FB 2R1XB 4AV4A 3L5IA 4L3FA 4GP8B 1Q72L 8FABB 4MB5A 1MIML 4LHQB 5DJAB 4DEWA 1XGPB 3MLTA 3GMPB 2C9SA 2QSVA 5DVLA 5DC4B 5HYSG 2R0ZL 1U8JA 5GGQL 4YBLB 5F2FA 3ZE2B 2V7NB 3BIAX 4XGZA 5I6XC 1FFTB 2ZSWA 4XX5A 1A6VL 5KW9L 1N4XH 2NTFB 3L95A 2GUOB 4MAUH 3LKOA 1UOKA 2UXVA 5HJDA 4GG6B 3DLQR 3KGTA 4FL4C 2EE6A 3DJSA 4P9HL 3GZKA 1NGZA 5DRZA 1QFUL 4JFVA 5I0WA 3NJLA 3B9EA 4HUKB 3LS5H 5GRVK 1I8LA 2BDNH 2CIIA 1YRKA 1B4RA 3RVXD 1A64A 2CE6A 1JWMA 2WZ5A 5TQ2L 1T4KB 1JPGB 3EYOB 3G08B 5L8LB 1L9PA 2XBTA 3PGCA 3K2UH 3MV8A 4J3OH 3BZ4B 4L05A 4ZW7A 5BJTB 2FYYA 4RX4D 2E3VA 1SNRA 3QIBA 3HC3L 3ZGIA 1DQDL 1EDQA 2ZJSL 3QHZL 4MMXB 1U8PA 3IJ8A 3ARGC 5AW8B 5JW4N 3FW6A 5C0JB 4YIQA 3FO1B 1R3LB 3MV7A 1T7VA 2R0ZH 4MCZA 3TPUA 3CFKB 3AAZB 3IU4L 3L6FA 2GSMB 1A6ZA 4ONGL 4OLVL 2P7TB 4ELKA 4FQHB 1NICA 3WEBA 3CFJB 4CKVX 1T66C 4PW4A 4XZ4A 3QRBA 1G6RH 4GLRH 2WKGA 4K3EH 4YL4A 5KTEL 1KXHA 1OTTD 3JV0A 4EQ2A 4TVPL 2XN0A 1QBML 1TSHA 3DHJA 4JGJA 1MFNA 2W9EH 3BGAA 1HSBB 5B39B 4Y2OA 1KMGA 3O6FB 2UY6A 3WCYA 2X4UA 5K9OA 1PAZA 4A2GA 3FB7B 4AE1A 2R2EA 4HDIA 2Y06L 1JZFA 5CSZA 1P9MA 3N85L 5ENWA 4DTGH 1EEZA 3DC0A 5T1KA 5CZXD 5E08H 4HPHA 4WW2A 2V2WA 3RJOA 1CTMA 3AM8C 1OK8A 4P23C 2H4EA 1DN0A 3DJRA 1RZKL 4OF7A 4QHNA 4DGIL 1T20B 1N8OE 2CGRH 1ULVA 3UBHA 1F4YH 2YPLA 3OMNB 1L0YA 2P5EE 4ALAL 1UACH 4ABVA 3FT1A 3CFNA 2NR6A 2AABL 4P2OA 4Z7WA 5KANI 3SDAB 1EAOA 5KVDE 3ZYJA 2VYRE 5IV2B 1AZUA 4YDIH 5HHXL 2BSRB 3MGOA 4R9HA 3P0YH 4A6YB 5A6IA 5C0DB 5DUPL 3THML 3UPRB 4JFDA 3WO4B 5CEZL 3ZKMD 1NGYA 3HUJA 3HNTL 5DD5L 2D7MA 5EPMB 1COBA 2JI2A 2V17H 2HFGL 4ZD3L 1NCOA 1ERNA 5T33L 4JFZL 1GYAA 2OTWA 4XNZB 4JHWL 4C58B 5FHAH 3ROOA 3WIHA 2B15A 1W9XA 1AXSA 2WYZA 3P9LB 1I8KB 5D1QE 2XVGA 1S5HA 4AL8C 2AK1L 1MCFA 3HNTH 5DD5H 4WY7L 2AZUA 2EYSB 2ADYA 1JJUA 5J3HC 4DGYH 3TN0C 4JO2L 3VH8G 1S9YA 2BVQB 3SGDI 3DSFL 3CXHJ 3AG4B 3MBXL 3KLDA 3NK4A 2FATH 2HMID 1DSFL 2NNFA 3SE3A 5CP3H 5L6YL 4G3YL 1PCXA 3TN0B 3TONA 4S1DC 1WFNA 1U8HB 3GC3A 4IIZA 4AJ0A 2HJLA 4XP9H 1CICC 4P4KC 3WIIL 1E8WA 4B9GA 1DANT 2ZUVA 5HPMA 4XCNB 2DEWX 5EIQA 3WFBL 5GS1C 2WQSA 1XZ0A 3M1CA 1SHMA 3CFCH 1FZKB 4FQLH 5K1VA 1FIEA 2Q8AL 1XEDA 3TJEL 1XXFC 3NPZB 4BUQA 3QDGE 3BEVA 3KM2A 3NQIA 4PV8A 5KWYC 3EOBA 4Y4FC 2VDRH 1A0QH 4X5WA 2Y36L 5BVJA 3GJEB 1DEEA 3L1GA 2AQTA 1VPOL 4G80A 5FF6B 3PP4H 1FAKT 1QLRB 1IC5L 3OKDB 1IFRA 2HVBA 4HU2A 1YA5A 2VN3A 5TD4A 4UV7L 4AMXA 1YECH 1WAAE 4N1CA 3BP4B 5FDWB 3WENA 4Y5VB 3SYAA 1NOFA 4YDVA 1MH5A 5KYYA 3QWQB 1IM3D 2BP3A 1R3IL 1VACA 4R4FL 3EO9L 5HHOD 5C7ZA 4QTFA 1VEPA 5D1XD 1CBVL 2ZKYA 3ZDZE 4QKXB 2F0CA 4B53A 5FUOH 3EHBC 2NY3C 1ZVNA 3OL2A 3IMRA 3BCDA 1RUMH 2JK5A 2WXQA 4HFUL 3QCUL 2YD0A 1U8LB 4PRBA 1HH6B 2UZXA 3QULB 4KRLB 1F6FB 1I3UA 1ZPLA 4PU2A 4L8CB 5GJSL 3AADB 4TNWK 4XMTA 4JO1H 5IKCB 5AZUA 4FFZA 3IT8D 5F9DC 4GRWE 2Y2TA 2WQRA 3KEHA 4LP5A 1J8SA 4GI8A 3V5DA 4AYSA 5GRYA 4OJYA 5F96H 5FFGA 3NJXA 4FKKA 3GRWL 1U2YA 3AWGA 1MRCL 2XJKA 4NX0A 2ZG3A 1HXYB 2ZPKL 5EA0H 2HT3C 5IW6B 4MD0A 2JXMA 5G2NA 3I6SA 3OSVA 5AZ2H 3QQ4B 4M8UA 4RGOH 2N1KA 3LEYH 3NFPA 4HK3N 1MFCL 3D85A 4YEEA 3O2DA 3BRDA 3KNBA 1F4WL 1VCBC 2ZXAA 1SXCA 1F56A 3JVGA 1TPXB 1FJ1A 1KY7A 2AJSH 5C0CE 3DGGB 4BFFA 3FUKA 5IVOA 5C2BH 4HKXA 2DJ4A 4JPKH 1NUGA 1J1OL 3OQRA 3WEOA 4H0IA 3RWFB 1E42A 1UD4A 1PIFA 2V5SA 2WINA 3NFPB 3PGFL 2XFXB 3QULA 4FXKA 4J8RB 5F3BB 3QG7L 4JPWH 5KG9A 2K8MA 1JERA 1C7TA 2JXMB 2A1WL 5BOPA 1MEXH 2BOBA 2EDJA 4UUJB 1AZCA 1QFOA 4BK5C 4ISVA 3TZVC 5D70H 2VDKB 2DQUH 1CE1L 4KQ3L 4IOIA 4WSGA 1MRCH 3T2NL 1UB6A 2FE0A 4DW2L 1CFTB 2B5IC 3CMOL 4I3RH 3SDCC 5KS9A 4KVCL 3VWKA 1BAGA 2R56L 5JW5A 2NNAB 3FBQA 1XF5B 1OPOA 1MQKL 2CNZA 2X40A 1J9CT 2MCPH 4OCLC 4XN4A 1QO3A 1FVEA 1TVHB 1INEL 1R3KB 2VR4A 4L2LA 5C08A 3NZSA 1AVAA 1NIAA 3NJHA 1U8CA 3K6SB 3FUFA 5F1NB 1QTSA 2K6YA 4LRIC 2VH5H 4O5LL 1CXEA 1JVOA 1WUZA 3V4LA 3BPOC 3ULUF 3P11H 1B0WA 2IPKA 3D3VD 3W82A 2K0RA 2BXZA 2ZX8A 1RUPL 2YMXH 3LV3A 1NBZA 4CGUB 4AV0A 1KGCE 3UABA 3KJ6H 3MV01 4ZXBD 1R3KA 2F8XC 2E8ZA 3OZ9L 5ERWA 4BD4A 1NFIA 2EO1A 3FT2A 1JS4A 4HJIA 3P2BA 2I26N 5IQ7H 2XN1A 4IMLB 5F7EL 4P49A 1JN6A 1RUPH 4KK6D 2VRQA 4F80A 4PJ5A 3D50A 2GSIB 3ULVC 1U8MB 2HX8A 3N5AA 3ELAT 3KPNB 4NKOB 1I9RL 1XF2A 1S6NA 3JV5A 1VLXA 5AZEH 5IVZA 4PV8B 3RWCA 3SJVE 3BEVB 3GZPA 1N67A 3KW8A 4NFDA 4DH2A 4DFIA 3ULVD 3WDIA 4LSRL 1OE1A 4FFTA 4HX1A 5CIPA 3FAWA 4QUOA 4HS3B 2Q10A 1MDAA 3KPQA 3MX0A 2Y3NA 1B4LA 1MJUL 3AB0C 2W80C 3N91A 4JO4H 1NTDA 4M61A 5I1IL 1KBWA 2OTPA 4M4RB 1G9EA 3S0PA 4XCFH 4Q97A 3HOGA 4UTBH 3GKWH 4U1JB 3WGVB 4JCLA 4PR5A 1UZ8B 3HUJF 3H9ZA 3OB0K 4I8DA 4AITA 4DKEL 5LKNA 5I74B 3WE6A 2SEBB 3KPOB 1OGTA 4YO0B 1AFVH 1S7WB 3VSTA 1PQZA 3B37A 4Y9EA 5CR8A 5T5FL 3TNNB 2D31B 5I1AA 3UPRA 3WKPA 1ZK9A 5JXED 2A0LD 3B3IA 4MCYA 4K73A 1HXYA 4FULA 5DVKA 4CUCA 1E3ZA 2X4SA 1VGEL 3IDXL 1SEBB 5DC2A 5FOBA 4Q9RL 1LE9A 3NIDE 4PJHE 2GFBA 1ZE3C 2D9QB 2ED6A 4PRHB 4WHCA 3UTPE 1N5AB 1LEIB 3KLAA 3MV9D 4E9YA 1U8QA 3FUMA 4MJJA 2D0FA 4GAJH 2EDNA 1YNTA 2VDKL 5GRJH 1IGCH 1KIUB 4W68A 3NAAL 1NH6A 1MLCB 4J3OD 1U92B 5F88A 1M1SA 3MO1B 2G2RA 4KQ0A 3RY4A 2LFGA 4HXAH 3RB7A 2O5XH 1QLEL 2QSQA 2VZ1A 3LKPB 3QUZD 3SCMD 3FCSA 4F24A 3AXLB 1G9MC 2VR7A 3KH3A 2I7SA 4JPVL 4ODHL 5L7XL 5C0RL 3ECVA 2ADJA 4X99B 4ZODA 2DWXA 1GGBH 4WAFA 1DVFB 1CF8L 3SKUD 4MJ4A 3O6LH 2R4RH 3INUL 3M8OH 4WFED 4OCMC 1RK0B 3FFCE 3WE1A 1CGVA 2GTWA 3RE0A 3EBAA 3GMRB 1KEMH 3NJFA 3NFNA 4UIMB 4HUMB 2OR8A 5C8JA 1C5DB 2BC4A 3HS0C 3C09B 2ZIDA 4YIQB 3VFUB 1TETL 3A6CL 5KSAD 5BVJB 4JGNA 3HC0B 5KSBB 2X88A 4M8QA 5HJ3A 2R15A 3SDAD 1S5IH 4GXVL 4GXUN 5I73C 2ALWA 4H1LH 1INQB 4I4WB 4NM4H 4XH2A 3MNWA 4OD1L 4MLSA 1MPAH 1CWVA 2F54B 4KK8D 1JZEA 1NCCL 4HPYH 3D69B 4GS7C 1JIBA 4Y7MA 4IK7A 1GMEA 3L6FB 4NUQA 2AJYL 5SWZA 3ARFD 4L1DA 1T2QH 4Q56A 5K59E 4FQIL 5DJ8B 1U8HA 3BSHA 4KNQA 4O02H 1G0XA 4LCYA 1RCYA 3KHQA 3P02A 4H8WL 1IVLA 4R90L 3KLHD 2HFEA 3IDGB 1I4FB 3CZFB 2BWQA 1E43A 4MSWB 5DEJA 1KSRA 2B4CH 3IVKB 3HMXL 2B1AH 2XRAL 5I23A 3FSOA 3B5GA 1FZMA 4APQA 3L9RA 1PFCA 5AVRB 3VXOB 1VIWA 2GBVA 1S9WA 2ICEB 2WUCL 4WWKC 1OARH 4O02L 4WK0B 4HOMA 1AR1B 2VDML 4V2CB 5K69A 1R1CA 1KLUB 5EOTA 5MERB 4K8RD 1PZ2A 4OGAD 1THCA 4IKIA 4WHTB 2BNUB 3P30L 5DHYA 1S7XA 1A1MA 2LLNA 4D0BB 4OTXL 3TO4C 1JZIA 3UEQA 4DEPB 3FFCB 5DEGA 1BLNA 2XVKA 5F7KC 2VR6A 4K5MA 4LSVL 2EDTA 4Y5YB 5DXWA 1QG3A 2CLZB 3MKGA 3NCJH 4G7VH 1T22B 3MRQB 3C5ZB 4NQVA 1OD7A 1ADQH 2H26A 1AGDB 4RFOL 3MLTB 4X83A 1RUKH 1OOWA 2BVPA 4LPWA 4PJEE 3ZTNL 4M1DH 4PRPB 1DVSA 4K3JH 2DLHA 1KLUA 2R2HB 4WENB 3CN4A 1QBBA 4M6OL 5DD6A 5BUAA 3A3YB 1NEUA 3MTRA 4UM8B 4RETB 4L9LC 3CDYA 3EDKA 3PQYB 1SGKA 5DJZA 3S3DB 2PF6A 2EUWA 4BH8B 5KVDH 5LBSA 2ZXEB 3I6GB 2Q2LA 3O2WL 4WU5A 2W95A 1CMOA 3PNRB 4YHYB 2NYZA 2BNUA 3O3AA 1NIFA 5E70A 4MDJA 1IKFL 2DD8H 4PMFA 2WLKA 3LZRA 5ICUA 3VGDA 1KTRL 4P46B 4JRYD 5E6IC 4GRLA 4J39A 1KB9J 5IROC 2BERA 1FNSH 3IDIB 3AREB 5D55A 3VUAA 1YEHH 5E5MB 1UXMA 1YEKH 4URTB 5TFSL 2Q5BA 3ARUA 2HLFD 1NGPL 4U1NA 5FXCH 5IBLC 1RUKL 4L1LA 3ZTNH 4K23H 1A9EA 2BS9A 2P5ED 4XMLH 4DUVA 5T3ZD 3EHBB 4QWWC 1OAUH 1NWOA 2DBLH 2LTQB 4HBQA 2X1XR 3TIDA 2ADFL 1DLHA 4IKNA 2NSXA 3VXUD 2FNBA 4L9DA 1XH3A 3BFOA 4HLEA 3OKEB 1I1RA 2GTWB 1QFWM 1R47A 4BQ8A 4H88L 4LMQI 2IADA 3POHA 4OT1H 1HILB 4HF5L 5BRQA 4J3XA 3HG3A 4OIIL 4QXTB 4FFZL 2V2XA 3NCFB 4XPHL 5IB1A 4U3XA 1W0YT 1E40A 3BDXA 4AGOA 4LLVA 1E4WH 5KSBA 4JJ5A 4NDMA 4YVUA 3SPCA 4R26H 1N3NB 4HHAB 1BZOA 2P5WB 4NPKA 2ZUSA 1KJ3H 3QIUC 1I7TB 3BP6B 3P0VL 2WXNA 1JXGA 2O5NA 1DSYA 1X4YA 4JQXC 3CHSA 4GG8B 2BIQA 1BFVH 1LGVA 2KYIA 2XG4A 1YVLA 3FB6B 4PWEA 2OXGA 1THAA 3CX2A 3ETBF 4RVBA 4WSKA 4S1QH 1OP3H 2OYKA 1DVFA 5CN2A 4DP1X 3PV6B 5FM4A 3VFSA 3RWIA 4X9BA 2ADJB 1D5MB 4KKRA 5E2VL 3PYCA 5HGBB 5DQDH 2FWUA 3LKSB 5DS8A 4NN5B 5JIQA 4NN6C 2YGVA 3MGTA 3DXAD 4P5MB 5PAZA 4WTQA 1T5XA 3ZQWA 4DPBX 1D7DA 3DX6B 3VU1A 3C5ZA 2O6EA 3V7AE 1RZJH 5FS5A 5LXGH 1JZ3A 2DZEA 2GYSA 4NQED 4JFED 3UZEC 4N4YB 2NSQA 5I15H 1BLNB 3RX9A 2YSTA 3RWHB 3GM8A 2XQYK 4CBZA 2J71A 1IIKA 4LASL 3V5KA 5CN1A 1MAJA 4MJID 4PR5B 1A21A 3GI9H 4LQ1A 2ZYHA 5SWSE 4AQ1C 4M6ML 5DT1H 3L4WA 3TX4A 5CJOL 3ZTJG 3V5HA 4LSTH 3Q8CA 4PJ9B 1TTBA 5G4MA 3LQAH 1E27B 1LP9F 4PP1C 3SBWC 4E0RB 4G6FD 3ECQA 2GJ6D 4M8VA 2C5DC 4MWFB 1CLCA 4ZPTB 5FYJH 3WMSA 5FUCE 4TKWA 4N2GA 5T33H 1J87A 5EWIH 4R7NB 5HYEA 3MYJB 5HHOE 2X4PB 2BSEA 4J2XA 4PJGF 1MHEB 1QW8A 2K3TA 1KN2H 2R23B 2B14A 3M17A 2CGYA 2GSIA 3A67L 2VW4A 5GS0L 1CFVH 5EF3A 4UDUA 4N5UA 3C2SA 3L1OH 4I2XB 5ISZE 4BZ2L 2XV6B 5FYJU 4HCRH 4FQ2H 1KTDB 1V7MH 2R83A 2GJRA 1K6QL 2JQZA 5HI4C 2DM2A 3FCTA 1SXNA 3GMNB 1TQTA 2JI1A 4YN3A 1UM4L 3MRBB 2C9VA 3KXFE 4PJCB 1B4JL 3HI6H 3KR3L 3P3RA 4G3YH 5C9JB 4ZSOA 3HPLB 4Y19E 4Y16D 1NGXB 5EO9B 3LRMA 5GS3A 4OCNC 5HSFA 1ZSDB 3V4VH 2R2BB 3UTSA 6PCYA 3BPCA 3QXAB 4PJ5B 2ARJQ 1T04B 2IOIA 1YEJL 3B8YA 1I9EA 3DURB 5L2KA 3CLEL 3OC8A 3ZSSA 4QTHB 3MRCB 4O4YL 5T3ZH 5LGJA 5C70A 4R97C 3RIAF 3MACL 3QCTH 2J88L 1BIIA 1M71B 3TC9A 5MEQB 4OCXH 1Y1UA 1QFWH 2A9MH 3QDGA 1X4ZA 4I0CC 1A6WL 2Z35B 3DK2A 2VN6A 2VRAA 3TNMB 5B38A 4YHZH 3WFCH 2VAJA 3T2QA 5LAXA 4LVNB 4FTVB 3HE6D 5FYLH 1FH5L 4HKZA 3AXLA 4PGDA 3ZRFC 1M53A 1XGRA 2W07B 4NWUH 4UMSA 4JPIA 4NQQA 4N20A 4HIEB 1ET7A 3GIVB 4ISVB 1NDGA 2CRIA 2ZTBA 1MJJA 2IEPA 5KW9H 1OAZL 3L9EA 1MLCA 3TV3H 3B9DA 4JR9L 5I8KL 4LIQE 3HTLX 3V0AC 2QQKH 3RWFA 2J8UA 4ZQKB 2BIOA 4NAJA 5DHXB 5F93C 1KPVA 1Q94B 2NW2A 3GBEA 2NY3D 1XCQB 1U2HA 3BAXA 1RSYA 4KTEL 1CTOA 4Z95L 2FO8A 4G1EA 5D2LA 1N7MH 2PYFB 1RZ7H 1CE6B 4LAJH 4JFEB 2N7SA 4NC1C 1WA0X 3KNBB 3VH8A 4JM2D 4PW9A 4U4BA 4PGEA 5I1EH 3TV3L 4KKBC 3DPBA 1L3NA 4B9ZA 1EHLH 1A22B 4RMSA 2EVFA 1A7PH 4ETQA 2WBJB 4XB8A 3SPJA 2PCFB 4JFEE 2G9HB 4XZUA 5CCGE 2VGLM 1BXVA 4GSXA 2V5TA 5BZWA 2JJWA 2I60H 4LZKA 3PWJB 4GXUM 1JNNL 1OGTB 1YHPA 4FMKA 3PS6A 2Z3FA 1GS6X 3KHOA 3LCYA 1K8DB 1MFDL 1BG9A 5IQ9A 3W57A 3LZPA 1CDJA 3VVVA 3TEYA 4Y4FD 1O9WA 4QTIH 5IEKA 5DJCB 4BDVB 4KQ4H 4AENB 3ML9A 3JTTA 2GT9A 1B6UA 3FUEA 1AG6A 3D0VB 2VDPL 1EQWA 2XWTA 1XSOA 5C09D 2WBJA 5JIPA 5I6OA 3LEVL 4JO1L 4R8WL 2UX7A 3RAJH 4PEEA 2JK5B 4XVJH 1ZIAA 3GSUA 3BHBB 3LQMA 2CHXA 4PSRA 3K0WA 3ETTA 1M6OB 2EE3A 4HWBL 4UDTB 1NUDA 1J05B 4XOCA 5H8DA 1EDHA 2X6CA 2PUQT 4WO0A 1AQKH 2AVGA 2ICWI 5F7NC 5ESVB 4Z7VE 4NT6B 4K55A 5GSRB 3CSFA 3O41B 3QIBD 3QEQE 3L5WA 4MD5B 4AM0Q 2EDMA 3W11D 5J6SA 3VQLA 3CFUA 2JJSC 3F01A 5ICYB 1BREA 3O2DH 4H26B 3OHXC 4DPRA 2X28A 4PRIB 2ZOLA 4G80B 4K5LA 3RJQB 3MLRL 3SIKA 1VZIA 4LARL 4B9KC 3QEHB 5EO9A 5DZOA 5KEZA 3SQOL 5FIEA 3S35X 2IWKA 5LDUA 1A3RH 3LMJL 1UGKA 3BYYA 3SDCA 3SE6A 2CSPA 4HEMA 4CAGA 3BZFA 2GW5A 5FC9A 1MY5A 2DI9A 1SZNA 1R0AL 2R1YB 2UVEA 5LNEA 4AYFB 1C8QA 2WAHA 1NANI 3HCVB 3APCA 3QPXL 3S4SG 4JVPA 2XZQL 1AH1A 3MRCA 2V37A 5DVOA 2AEWA 5I9QB 1PG7H 2GJPA 1ZY9A 3GJEA 1ODAA 4IOIB 3UADA 4M29A 2B9AA 1KACB 3P73B 3WNJA 2IBZY 3HPLA 3MYJA 1BZ9B 3G6JF 3DX1A 1NC4D 4IIQA 1URLA 4PJHA 5HHPB 3BKJL 5MP6H 4KKNA 2OMXB 4N8VB 1FZKA 1WBYA 1FHNA 4P2OC 5IQ7L 5IEHB 3O2DL 1I3GL 5IB2A 4V1DA 3IJEA 1IKOP 3ZGHA 4GI9A 1TZGL 1N12A 4LLMA 2C1OA 1VKXA 1AAJA 3RA7H 4HEPA 5DVMA 3T3PE 5DUBB 3LKNA 1OGAE 1ACZA 5DK0A 1LQBC 1U30A 4C57C 2G75A 4I13B 4AW4A 4YK4C 1NCDL 3P9MA 1DUYB 3CFEA 3L13A 1U58A 3IPFA 5TE6L 3QQ4A 3GMMA 4F8TA 4WRLA 1CDHA 2Y36H 4WDIB 1O7SA 2QSCH 4KHTL 1Q0YL 4X9YA 1E27A 4C55A 1CDGA 1DDTA 4RGMC 1M1XB 4MB1A 5HYFA 3DHPA 4PJFA 4PJHF 4RAVA 1CE6A 1OAYL 3X1BA 4BQBA 43CAB 3V5DB 5ESQA 2FZ3A 3KPSE 3SE8L 3U79A 4M56A 4E9WA 5F7UA 5BZDB 4W9GC 4ABWA 4G9FE 3QC6X 1AQMA 3QUZC 3HUJB 4X4KA 3GRWA 1PLBA 4HIXL 4Z7UF 4L8CA 4XBGB 5EN2A 2XN9E 3AQYA 4OLZH 1T0PB 2X4OA 1U8LA 4PRBB 5IQLA 1CBVH 1JNJA 4JFDE 5E2TL 3BZDA 3S96B 1XR9A 3NZHH 2CJUL 2JCCA 2TAAA 1A4CA 3SE8H 3VI3E 5AVWB 1ZHKB 4WI9A 4MJ6A 3LNDA 1BVLB 1KT2A 4ZUUA 2D03L 3D52A 4HAFA 2MHAA 5KJ4A 3ZJAA 3SDAA 4OD3L 4FXGB 4F2EA 3QQ9D 2FTAA 3GEWB 4H20H 4PRDA 3DDFA 3BAEL 2AQQA 4LLQA 5CWSB 3MKKA 1OM9A 3S5ZA 1YN6A 3T65A 1MREL 1A4JB 3P4NA 5FA4A 5D8JL 3O8XC 4YL9A 3FB6A 2WPGA 2V7HB 3EZ8A 2BHYA 4O2EB 4Z77A 4I48B 4XCCH 3ZDXE 2YEVB 5F7DA 3ZQ9A 5IBUB 1CK0L 5JR1H 1WVZA 3MJ9L 2IH1A 4NENB 1E4XH 4BH7A 2XWDA 4JANB 5EFIB 3WKQA 4KK8C 4IDJH 2BNRD 5IF0A 1GJIA 4LEXL 4YHPB 5EA0L 1A02N 1J1PL 2Z6FA 4L0YA 4HHAA 4PJ7B 4A63A 4JO3L 2QZ5A 5FGSA 3WSQH 3ARFC 5D8JH 2X87A 3DIVA 4I0PA 1MI5B 2QHLA 5D2NE 1PD1A 3OBAA 1RXLA 2IBGA 2YD6A 5I6NA 1LWRA 3KPPA 1DCEA 3EYUL 3SE3C 1OAXL 4MCNA 2BINA 1WBXA 2FIKB 4QO1A 1UM5H 4A6YH 5FO7A 3S37L 1QSFE 3W0WE 2D7NA 1FDLH 3AS1A 2X4QB 3LRHA 4L3EA 4TULL 2BIHA 5CGYC 4YMPA 5JXEC 1NCHA 1T6BX 4TRPL 1U8OB 2IVFC 4JQIA 4NUJB 1UZ6F 4OAWB 4UINL 5J9PA 1PF3A 5E4OA 2NY2B 2JNZA 4WI0B 1T4WA 2PKDA 4JPWL 4WWKD 4C56A 1IBZA 3ZVVA 1Q1JL 2VUOA 1AI1L 4WU5B 3W5MA 4ES8A 4BH8A 5AYUH 2IV9A 1JPTL 5GS0C 2V7NA 1BVNP 1PZUB 3HG5A 2GQHA 5IJCC 2IQ9L 3GGWB 4U0QB 4F20A 4BV1A 1KCLA 1QD0A 2ZYIA 5IQNA 1XV8A 3HG1E 5JDJA 4ZYKB 5DRZB 5JW3L 2WNXA 1KENL 1WEJH 1OTUC 1MFEH 4WUUB 4XNBA 3FZUD 3WNLA 1WYJA 2DL2A 4WJ5B 3TURA 4XBMA 1SN2A 3QRGL 2DMGA 1AGDA 1CD9B 4JUTA 4NQVB 1MHHA 1EFXA 1FRGL 4NBYB 3AB0B 2NXZC 5JW4Q 3TBBA 1FA4A 4YDJA 5IGXL 2VQ4A 4FD0A 4KZDH 3TH3T 2ZCKL 4YBQC 2F58L 2AI0L 3GSOB 3SO5A 3FK3A 5H4YA 2JJUA 4PGCB 4ZTEA 5E2JA 4DFHA 4OFVA 1FLTX 1KLFA 3A24A 3C6LC 4DIXA 3H2WA 8FABA 3ZDZB 1MHPL 3UG5A 3MRLA 5GGUB 4ZK8A 3CSBA 3CLFH 4FXKC 2K78A 3UG3A 1A3QA 3LZLA 1KEGH 1NDMA 3ARQA 1ML0A 1ZEAH 4WHYG 3MCKA 4Q6YA 3T4AA 2FQDA 3VFSB 5D7HA 3NCJL 3TO4A 4P06A 1T20A 4Z3GA 4WNQA 3DOSA 3QG6A 4O58H 5E6ID 1EAJA 2JKIS 2XT1B 2BP8B 1BEXA 4CBPA 5HTSA 4YHIB 1J12A 3W2DL 1YEWA 4G8IB 4J2QA 1MFEL 1A9VA 1ORSB 1GZQA 4Y1AE 5A1AA 1MI5D 3WS6A 2IWEA 4WW2C 5DJ8A 3H55A 4RA3A 3SJVA 2UX6A 1WZLA 3BPNB 2OJ1A 2HZHA 3OAUH 3D3VA 3G6JB 4KO7A 3TCLA 4LSVH 4HEPG 3TOPA 1U6AL 1ZA3B 2EDDA 3GK8H 1CUOA 5HI3D 3KJ4B 2YOCA 3D08A 1S9KC 3FO9B 3AJ7A 3B8SA 2MQGA 2W0KA 4NCDA 2E7BA 4IGBB 5F7FA 4ZTPH 3BPNC 3U30C 3QQNA 4I4WA 1SJMA 5E0FA 3DRTB 3UAEA 3U1QA 3CMGA 4NKDA 3IJHA 4B97A 2WLZA 1OZUA 3BKYH 1HINH 3RI5K 3ZT5A 3VYNA 3FQ1A 4D8PA 3BUQA 5GGTH 4P48A 3HEIB 5T3XL 3GO1L 3K2MC 1A7RL 4UAOB 1GW6A 1XGYL 1KYAA 2KDGA 1ZD6A 2BZ7A 1E5UI 1WFUA 4ANVA 6PAZA 1MOEA 1QSZA 1DQTA 1UOLA 4N1EA 1QSED 3ZHLA 1G9NC 2WBKA 4ZUVB 5IZ7A 5HJBA 3D51A 4MAUL 3RUGE 1SBSH 4W9CC 5DJYA 1IO4C 2QKSA 3MRHB 5CKAA 1JWMB 3GSNB 3TEZA 4FFWD 3T6ZA 4WU7A 3TEXA 1NCJA 1TXKA 1G6VK 3LKPA 1DO5A 3KGUA 3F05A 1P84J 2VMJA 4DQOL 5C71A 2BJMH 3W39A 5I66B 3NAAH 3EO1B 1K8IA 2Q0ZX 4XMKL 3HZKB 2GUOA 5D1ZI 3C09C 5C09B 5JHDB 4FX5A 4DAGL 5SWSA 4LXFA 5DHVA 5CU5A 2XIIA 1JDCA 2GJ6E 1VSCA 3GIZH 3OR7B 4H40A 4PJAA 4QRSB 1KIRB 4WCYH 3N44B 3PQYA 3QUXA 4WEEA 1LE5B 5TPWH 3PFUA 2GTQA 1S8DA 4E5XA 2X4RA 4PJXA 5L7XH 2B59A 1KJ3L 1SOKA 4MHHG 1IB5A 5DJAA 1N68A 2E74C 2E7DA 2PXYB 2W91A 2R2HA 2Z7YA 1FC1A 4JM2A 2EEDA 4XOEA 4ZMPA 4PRPA 4XB7A 3CSGA 3MR9A 4TTDD 5EEVA 1XGYH 1KB5H 1PY4A 3LYRA 5EBLA 1PZAA 4GBXA 3S7GA 5JMOC 2Q3AA 3PPSA 5F6HI 2EDOA 2VNCA 4FJ6A 4JY4B 2CLZA 3UAJD 4DPAX 1WICA 4H2AA 3E2HB 3WTXA 4BFKA 3SO3C 4TVPD 2C7FA 4AUJA 2IJ0C 4AJWA 1JP5A 1U8IA 4NKIL 4KK5C 4NNPL 3EKCA 3TT1H 4KNUA 3UXFA 1KV7A 2WVVA 1A1MB 1QPPA 4D0BA 3K74B 1NGQL 4JFYB 2OMTB 2YQ3A 3MNVA 4XWGL 5E1QA 2P8PB 1KG0A 3EJCA 4M4RA 1B0GA 1L6PA 1RUAH 1R5VB 3ECWA 3O9WA 1M2OA 3S36H 5KJ7E 1DBBH 3X13A 4DOHE 2D3NA 4FFYL 1A1NB 1AXTH 1DQQB 3ESUF 1FE8L 3L9RB 4A7GA 5T3ZL 5TDPA 5HYQA 2P8MA 1DEDA 3RGVD 3MV9B 3NA9L 4NKQB 5IVZB 5SX5H 3APDA 5AVSB 1L7TL 2XN2A 5AW9B 4F9LA 4K94H 4QNPE 4L2YA 1G7IA 1MI5E 1OQXA 2P44B 3FQXA 1QBLL 2EC9T 4R2GD 4TYUA 3QQ3B 4JKMA 4IMLA 5EORL 2JJTC 1U8OA 1A8ZA 5E5LA 4IK6A 4AOFA 2LLGA 1RPQA 3MNDA 5SWZB 1YN7B 1NKGA 2UUDH 4RAUA 3L7EA 2RCSH 1NGWB 2R1YA 1OK0A 3WIHL 2GITB 4D3CL 5J12B 1GTFA 1S3RA 2X2YA 3DMMB 1FL3B 1M42A 3I6LD 1TJXA 4HLZH 4X0KB 1IAIH 4AJYV 2IFFH 4BINA 2PPFA 4RFNB 4FLQA 1WUNT 3UAJA 5INDA 3DBSA 5KYXA 4KI5E 3T08A 1D5XA 5EIVA 1WBZB 4FFVC 4HIJA 2OMYA 3LQAL 5EUOE 1LO0H 4A68A 4WI2A 4FGMA 1K6QH 1TQVA 4MA3A 5EO1A 3VXSD 1WCBA 1T1WA 4HS8L 3J07A 1A9BA 2VN7A 3NFNB 4JFFA 4UIMA 5ICZB 5BRPA 3L5WB 3ARFA 4IU3A 4MD5A 4I48A 5IMMA 4W6WB 4X6FB 5IHBA 5K9KA 5F0JB 4G6KL 1FN4A 1W6LA 5D1ZA 5MI0C 3S3SA 3EJZC 4HMDA 1YEJH 4O9HH 1SDDB 1IL1B 1PJWA 2G4EA 3ARGA 3Q6FB 3X11A 4AVIA 4OB5H 5F97E 2DQTH 5ADOH 1JNNH 3O4LE 3J8F7 4FNUA 2WWMC 3ULUE 3BOVA 3ZZ1A 2N56A 3KAAA 3GSUB 2QADD 3TIEA 1FFNA 1V7NL 2VDNL 3IXAA 5KUKA 4IBVA 4TNEA 25C8H 3WV0A 2OX5B 2YARA 1EUUA 1AGFA 4KUZL 1F5WA 4G8FA 4TLTA 4XT1C 5DMGD 2BHUA 5KG9B 3BSZH 4Q0XL 4BRJA 3EIFA 2NNAA 4NQDD 4NXKA 3H3BC 3ULVF 5BVPH 1ZV2A 2P24A 4U6VL 2VRKA 2LGNA 1C7SA 1UB6B 4OF0A 5KSVA 1XB8A 1DL7H 4NRYB 4IRSC 5ESQB 4FZ8L 4UQEA 1T5WB 3IDMB 5L8KB 4UV7H 2VIRB 4YXKH 2Y1AA 5FOBB 1BWMA 4KJWC 1RI8A 3FB5B 1S7TA 3LXUX 1U93B 2WYHA 1A6WH 3A6OA 4MB3A 1GOFA 2DJUA 3NCWA 4LSUL 5HYSB 3MBWB 3DPBB 1EXUB 3EH2A 3SKOB 2BY0A 1MCPH 3QFJB 4FXGC 1ZV5A 2VXSH 3R06A 5FM8A 4EIBA 4PLJD 3TYGL 3QR1A 5DC0A 2W60B 1OEZW 1GAFH 4PBWD 3TJEH 1R3JB 3KZ8A 5AYQA 3O8XB 4HK3J 1Q94A 2AF2A 5J57B 1P7QD 4XPTH 3DMMD 4RGOL 3RJDA 4ZUWB 4NN5C 1UC6A 5F9OH 4BUHA 2ZKHL 5EBWB 1GCFA 2X2JA 1MCRA 1GA2A 1SN5A 1XIWD 1IIIA 1FPTL 5I1GH 1NBCA 4LSQH 5DJXB 5F9JB 2NY0B 3N85H 4U0RC 2XXCB 3TBYB 1XMWA 1X9RA 4BSJA 5G55A 1SHSA 3C75A 2W88A 2X4TB 3ZHDA 4HUWB 3H53A 3KPNA 1H3VA 3AROA 3FQ2A 5EO0B 2J8HA 4QY8B 5I5RA 5LGKA 1BOGB 2HKHH 5GZNC 3O6KL 4JQVC 1KTJA 1WFMA 4UQDA 1N6QL 4Q4EA 1MH5B 3DIDA 2QMKA 4EXPX 5MEQA 4HWUA 3AS3A 3KH4A 5IFJA 3U6XS 3TLRA 3W3BA 4QRUA 1JMZA 4AVHA 2RR3A 4MDIA 5DFVD 3WAKA 1JZGA 4GOSA 2FDBP 4XVOA 5FA3A 2WYTA 2Y0SA 4FQJH 3EYVA 2HTKD 1NKRA 5B39G 5KBKA 3EYVB 2BY1A 5DFVC 3PP3H 3IFNL 2R29A 3ESVF 4WI8A 1WH0A 5ICYA 3VFGH 4JHAH 2A6JB 4JM2C 2B77A 1QHPA 4OCSH 4JL1A 1UVQB 2ESVA 3SBQA 2EVGA 3ZDXF 4FL4B 2I07B 4U31A 5I8CA 1EO7A 4WO4C 4EI5D 3QAZC 5EZOL 5A2CA 3BO8A 3VVWA 4P59H 5T5NG 5FK9A 4LRNH 3GXMA 4P57A 3GINA 3MXVL 5AW4B 4U6XA 1CI3M 2EO7A 2FH6A 4LHUA 4MNGA 3SZKC 4DCQB 3AUVA 5DLMH 2E7LC 5KANG 5HHNB 4KJPC 5TF0A 2F7IA 1QSEA 3RX8A 4U1SA 2G2NA 2OJZH 4UUJA 2VMCA 2HFFA 3MRIB 5CS7A 2KDYA 2D2OA 3I9GH 1F3DH 5CGMA 5HD8C 2QT6A 1I8MB 1YUHB 3ZE0E 3KPRB 4FXKB 3PGFH 1KJVA 3CSYA 5ID1B 2Y7SA 4CMHB 3T6VA 2OR7A 4M6NL 3HHSA 3QPQD 3RDTB 3C8DA 2H32A 2RJMA 4CNIB 2AJ3A 3D09A 3G04B 3TN0A 4BELD 1SLVA 1HJCA 2B5IB 2Q8AH 3SPIA 1DDHB 4ZFOA 5BUPA 3ZMNA 2O6DA 3K8LA 5IG7A 1HQ4A 5KYUB 3L4YA 2QPEB 1F6AB 3C60D 3P77B 1MJUH 3PAYA 4IRJA 3X14A 4AQEA 4XAKE 3FQWA 1U93A 1NMAL 1CT8B 3J27A 3I2CH 2E7HA 2VM4A 1B4TA 3MRGA 4B27A 2QQNL 1WAPA 3M7OA 4PGEB 3VH8B 1TVBA 1AXSB 3NH7H 1EHNA 3QJTB 4Q9QH 3MCYA 4OZFH 1B0RA 3FQNA 2WBJC 4O5LH 1RJCA 4AQ8A 1E6JH 4ZUSA 4GAFB 3RWIB 1TSRA 5E6IA 3A5VA 2P24B 3PWPE 5HDQH 3SD2A 3NCYP 4Z7UA 1BBDH 1VFMA 1Q0YH 3D07A 1M7XA 1DJGA 1R9FA 4RMWA 5L4JA 1W8EA 2UZXB 4TNFA 3UTSD 3X3FL 3IXAB 5KYNA 1TJHH 4PFEA 1P53A 4ONHB 5K1JA 4GW4A 2VAAB 4FEIA 1LYQA 4EI5A 1H3UA 2AK4B 1IFGA 3RUGB 3WN5A 1AKPA 3IFOA 4WW1B 1BMWA 3KVDD 4OZGA 1SDDA 3Q6FA 4KFZC 1WFJA 2XBZA 3Q8BA 5CGBA 4QHKI 5T1LD 2L7JA 3WHE0 4JK0D 5EU6D 4TM9A 3DX4A 4V11A 2OW7A 1ZGLP 3GMLB 1EDYA 2G5BA 2YZ8A 4Y5VA 2CRYA 4L37A 3EYSH 5KSAC 1TCMA 5T1KB 1YZZA 1SEQL 4QYAA 3VX0A 2DQGL 1DUZB 3HLAB 4AQZA 2ROXA 1QA9B 2VDQH 2WUBL 1I8AA 1RLWA 3CV5A 2N59A 3HN5A 4ATTA 3O6LL 3RNKA 1NGXA 2KQMA 3DVGB 3MLSH 5HVWA 1BQUA 4BUGA 3SDYL 1GY1A 2QFRA 5EDXA 5C9JA 4E41E 3BT2L 4NC2B 2E9JA 5FYKD 5B3JF 3AQDA 2PNDA 1CT8A 1AYOA 3IN2A 2GK0A 4W4NA 4G6JL 5C0CB 3TPUB 2XA3A 2AJZA 4BQ6A 2VDNB 2QGBA 3IJSA 3MN8A 2RACA 3VXTA 1XO8A 4JRXE 1LO3H 2Z93B 2FBOJ 4M5YH 1T03L 5D93C 5MEOA 4OFPA 1AQHA 1KJMA 2QJDA 1JNLL 1OB0A 4P05A 3GTTA 3OGCA 5KVEH 3G6AB 2NY6B 1JI2A 2AJ3B 1MCWM 2VXQH 1G5GA 3IGFA 4MMYB 4C83A 1F13A 4KUCD 4X8JA 4UI2A 3RDTA 3PF2A 3MUHL 2FX9H 4XPAH 3UROR 4IDJL 4E0RA 3S3PA 1F2XK 5C0NC 1LO3L 2EECA 4YBQD 4RNRA 4BZ1L 3QUKA 4KX7A 4UT7H 2E9IA 3U36B 1E3FA 3S6CA 4WUKH 2V5MA 4AZ8A 1CZ8H 1Y07A 1OAJA 3QDME 1IGMH 2A9NH 2DWYA 5D4JA 1M7DB 2PPAA 4K2UH 1OAXH 2NY1B 5HDBE 1YAZA 1RUQL 4KHXL 5DA0B 4WF7A 1MCOH 2BSED 3HI1B 3QIUB 2CKBH 1HYSC 1JGUL 3GLZA 3VRJA 3ZZSA 4DUXA 1BG1A 3L3KB 3JTSB 4N8UA 1NL0L 4YHKL 4PY7B 1PX8A 4BFNA 4JQIH 1ITBB 3EJPA 5I6KA 3S4SA 3SKNA 3IK2A 3FN3A 4JFHE 4OFKA 4Z7WB 4P2RB 5HGDA 4ZFOL 3D5OF 3VMNA 5EBMB 1G4MA 1MELA 1S7UB 2X4RB 4QJ4B 2GEEA 2ZT9C 1AC0A 3EUDA 4N2MA 2QVMA 4CVWA 3CPLB 1I1CA 1T21A 1IGYB 3UJTH 4FFYA 3I3EA 5JUEL 4MKMA 5B8CA 3M07A 4GW1A 4PIBA 5AVTB 1URZA 3ARPA 2HP4A 3FRPB 4K7PH 2WIIA 3NBNA 1U3HB 4NRZA 2AJUL 5IT2H 1T2QL 1MXGA 2VXUL 4AI7A 3TBVB 1WISA 3MGAA 1HSBA 1AGBA 1N2RA 2BJML 2EDLA 2FX7H 4MRCA 3DO4A 2YUXA 1ZT7A 2EC9U 4YS4A 5IUCA 3QRFM 2NW3B 2AJVL 2ZWNA 3RA7L 2AXJA 3ETSA 3HG4A 4TSBL 1FORL 1NL0H 1CTNA 2OQJA 2KZWA 1YYLH 2XACC 2FJGB 4YHKH 3RKPA 3T4AC 5FB8A 5IHUH 3QR2A 1TIUA 4K7PL 4M5TA 3FTGB 4GINA 3C2AH 5C0JA 2DYPA 4FG6D 4U7KA 3VFUA 2WN3A 1K9TA 1JDAA 3CHOA 2ED7A 4PD4J 4HQQH 5DJ2A 1I8LC 1NIDA 4A7SA 3FO2B 3LHAA 5JW4M 2F2HA 2OCCB 2OQJB 4R83A 4ELMA 3KLKA 1NC4A 4FG0A 3TM6A 3CDZB 4KROC 4U3SB 3K1DA 1HYRC 4QXGH 1T0MA 4KNTA 1HOCB 2W94A 1SDYA 4W6XB 3O81A 1ONQB 4LCWE 4KROD 4GKSA 2CLRA 2X89A 5GQBA 5KBMA 1CS6A 3FCSB 4HIXH 5EEYA 2AAVA 3O6ML 4PP2A 1DJZA 1N0LB 1S7TB 1IBDA 4N24A 5I5IA 4JZNB 3WMPA 2LW3A 4EUPH 2OJEA 5DMKA 2DLFL 2JQMA 4DJMA 4XP1H 4YAQB 5TQ2H 4BSVB 4QHUA