1AZVA

Familial als mutant g37r cuznsod (human)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKRLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER/ZINC SUPEROXIDE DISMUTASE
publication title Subunit asymmetry in the three-dimensional structure of a human CuZnSOD mutant found in familial amyotrophic lateral sclerosis.
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 39
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1azvA00
4BCYA 1F1GA 2Z7UA 3ECVA 2AQTA 2LU5A 3H2QA 1PU0A 1CB4A 1OEZW 3CE1A 1OZTG 4A7GA 4N3UA 3GZOA 1F1AA 3L9EA 4A7VA 2Z7YA 2R27A 4A7GF 1SXCA 1YSOA 1JK9A 2C9SA 3KH3A 3QQDA 3KBFA 2AF2A 1IBBA 3GTVA 5CU9A 1JK9B 1QUPA 1TO5A 2Z7ZA 3QQDB 1HL4A 2Z7WA 1TO4A 4B3EA 1DO5A 1ESOA 1PZSA 1DSWA 1PTZA 2K4WA 2WZ6A 1XSOA 1UXMA 1SRDA 2VR7A 1BA9A 2E47A 1XTLA 3GTTA 4A7TA 1RK7A 2GBUA 1SDYA 2ZKXA 1Z9NA 3CQPA 4A7SA 2Q2LA 3MKGA 2AQQA 2WZ0A 5KBMA 2ZKWA 2ZOWA 3L9YA 1COBA 1UXLA 1SXNA 1N18A 4BCZA 1F1DA 1SXZA 2AQPA 2JCWA 1SOSA 2C9VA 2WYZA 3HW7A 2GBTA 1AZVA 1IBFA 1OZUA 3SODB 2VR6A 1SXSA 1B4TA 1CBJA 1E9QA 2XJLA 4A7QA 1MFMA 2SODB 1E9OA 1JCVA 1XTMA 2GBVA 1F18A 3KH4A 3GZQA 4U4IA 2JLPA 2AEOA 1YAIA 2WWOA 4OJAA 1E9QB 2C9UA 2XJKA 3K91A 2NNXA 1IBHA 2WZ5A 4N3TA 3T5WA 3S0PA 2AQSA 1E9PA 1FUNA 3GQFA 1SDAB 1SPDA 1U3NA 2WWNA 3KM2A 3KBEA 4MCMA 1YAZA 3RE0A 3ECUA 4OH2A 1HL5A 3F7LA 1Q0EA 1E9PB 3F7KA 1EQWA 1L3NA 1N19A 1P1VA 3KM1A 4BD4A 3GZPA 2AQRA 2V0AA 1B4LA 3CQQA 3H2PA 4FF9A 5KBLA 1SXBA 4MCNA 2VR8A 4L05A 4A7UA 1OALA 3LTVA 5KBKA 1SXAA 2E46A 1Z9PA 1BZOA 2AQNA 3HFFA 2APSA 1IBDA 2WYTA 3HOGA 1E9OB 1OAJA 2WKOA 1EJ8A 1S4IA 2ZKYA 3MNDA 1KMGA 2WKOF 3PU7A 1IB5A 3ECWA
chains in the Genus database with same CATH superfamily
1WDAA 4HJGB 1JE6A 4Z95H 4GRWE 3J8F7 3V8OA 4ODHH 5LBSH 5DHVH 2IANB 4MVBD 1SJEA 5EDSA 4PPTA 3IDIA 2XX0A 3EDEA 4N5ED 5EBWA 2ZWLT 5I28A 1KDJA 5F9JA 1WICA 5CEYA 4NQCE 1D5MB 5BV7C 2XIIA 3KNBB 3O81A 4PP2B 3SPVA 1BAGA 3ZKXB 1S7VA 3BQUA 5CMAA 4ZMZA 5FECA 1IARB 1KACB 5FW6A 5T5FL 4XMVA 1FV1A 4M61B 4Y2OA 3RAJH 3WTVA 5GS0C 3RPKA 5D4QA 3K72A 1XH1A 1HWHB 1F0LA 3VFVA 1MW1A 1PZDA 4XRCA 4DZBA 4UMSA 3UCRA 5CUSH 1NAKH 5BW7A 3NJGA 1TZIA 2EJ1A 5D1ZB 1SDYA 2VLJD 4OAWB 1PYWB 1TZHB 2WO3B 1G7MA 4E0RA 1USQA 2EE6A 2JKWA 1V7NL 2K1MA 2R0KH 3DTXA 3IMTA 4GS7B 2QL1A 4LOFA 4XPHL 3WELA 4XMPL 5D1QA 3V55A 2CKBH 2VJ0A 1SOQA 2LABA 1JGLL 4YZFE 5CN3A 3AG4B 4YXHH 2FBJL 2N56A 2E7CA 5GXBB 1WCBA 4KXAA 3MRNB 1A7RL 4OUOA 5D7LB 2OK0L 2XWCA 3MREB 3WDHA 4F9PA 1YEFL 1K8DA 1KIUA 3LKPB 5DUJA 2XXMB 1EO8H 3EYVA 4G6KH 4ZO8A 5DFTA 1DCLA 5TDNA 2UXVA 2X28A 5BO1H 1JYNA 4BH7A 4W9KC 2AXJA 1AANA 4YHMH 3FCUB 2G9HA 4QJ4B 3CDZB 1KTDB 3ZT6A 1SQMA 3SQBB 1A6AB 1IAIL 5CJOH 5JW4M 1SYSA 1RULH 1MRFL 4Q9CA 1FO0H 2WWNA 3QEUA 3O45A 4LQFH 3HZKA 4XN7A 3EOBB 1T66D 1EQWA 4CJ1A 2HTLC 2Z1PA 3CD4A 3ZDXE 3NESA 4F7PB 3A4DA 3D1MC 2RFXA 4NO5A 1F3JA 4RFNB 2Y2TA 3PJSA 1FAIH 3CLFH 5C0CB 1H9VA 3QDJE 1AZUA 1P0SE 4H0HB 1BVKA 3GUTB 3APMA 4K7FA 4L4TD 3DX7A 3O3BB 5IK3A 1YPZA 3E6HB 4F2MA 3OLGA 3UERA 2BNRB 5IBTH 4G5AA 4LCCA 4YXLH 3KLKA 1S7SA 4MJ6B 1UT2A 4JO3H 4NSKB 1FBIL 2ZXQA 4NKIL 2H47C 4HJSA 3GMOA 2ZCHL 1A4BA 1AGDA 1MEXL 3A4EA 2EIZB 2BWQA 1A22B 2NDFA 2DQCH 5TE7H 3HA0A 5F1NB 3BVUA 1AP2A 1JGEB 4KI1A 5JXAH 4KROC 2JKSA 3SGKC 1KGCD 5IT2H 2JF1A 4LO9A 4R84A 3ESOA 4ELDA 1T20A 5HDQH 3N9GH 5HD8C 5CBAA 1A64A 4KUCD 1VADB 3B9KD 1MFDL 4J3WA 2VL5A 2XZZA 4LASL 2IGLA 1H3GA 4BUQA 2WGXA 1W15A 15C8H 4X7EC 3QQ9D 2FHFA 4HHAB 5ICXA 5JHDE 3V4LA 3MFFA 1YLBB 2FT8A 1IC4L 2NY6B 3QPQD 5CCJA 2ED6A 3QQ3A 4R0LB 1QFPA 5EIIB 1C1EH 1IU1A 2P8MA 5ITBH 4FQLL 4JY5H 2Q2EB 4NKMA 1XV8A 4AH2B 1W9XA 3K6SB 5JW5B 1WF5A 2BFVL 3FQUA 4MZ2A 3E9TA 5LKNA 2EVFA 5D2LE 1C5BH 1A4AA 4ORZC 3DJSA 1U3HD 4Y5YB 5GRXG 4FJ6A 4E9RA 1QFUH 3OM3B 3CK0L 3QUYA 5C0AD 5IROC 1YEDA 2OL3B 2JIXA 1I3RA 2XN2A 1R3LB 4OLZH 4U1JA 2DM3A 3O2VL 1GKEA 1M71A 1O9VA 1RPQA 4M1DH 5DEJA 2AJSH 5EC2B 5F0MB 4L0YA 5DDHB 1T83A 1HDMB 4OF5A 1EV2E 5EU6D 2ZXCA 2C9PA 3NSFA 1XXFC 1BREA 4KO9A 4ENZA 3NBNA 2ICWB 1L7TL 2QR0A 4TNWF 2APFA 2FECI 5I74C 1WK0A 3VYPA 2UZXA 1UZ6E 5AB2A 1QI5A 3QZMA 1J0HA 2ZOLA 3FQ1A 4P2QD 5F6IC 1C8PA 1RZQA 1RK1A 1O5DT 3VWKC 3L48A 3ARQA 3RZCA 3K0YA 4PS4H 1GJUA 3ETBJ 5E2UL 2QQQA 1GZHA 3OHMB 1YQ2A 4KKCC 4MQXD 2HTKD 2MTPA 1U2HA 5MI0B 1ROWA 2VXVL 2XQYK 4OZ4A 3NTCL 5C0JA 3PHQB 2CUIA 3IVKB 1UEYA 3C08H 1X5JA 3VUAA 3FQRA 2G4EA 4WK4B 1MAMH 2DQJL 2ATAA 3N44B 4JKKA 3E6FA 1MG3C 4Z3HA 2X41A 2GKIA 3QARA 1IAOB 3FSAA 1AJ7L 1F4YL 2YRZA 1QW8A 2D0FA 1Q4NX 5FFLA 3MNWA 1XL6A 2QMKA 1CU4L 2C4XA 3T04D 1TQTA 4ODUB 2X4UA 2L3BA 2A77L 1BQLH 3FT1A 4PY7B 4M9OA 1M7UA 4F2FA 4PLKD 5AW1B 2P80D 4OF7A 3VXRA 1A7OL 3BEWB 3G5VB 4LVNC 4FAAB 2XYBA 2ZP0T 3NUKA 4BWTA 5AVSB 5I8EA 1A9EB 4KX9A 2HJFA 5FCSH 4ZFGL 2UV3A 1CD1A 3QNZB 5H37G 4IBQA 5E8OB 3WFBH 4HWEH 1T5WB 3AB0B 4Z3FA 4FEIA 4KJYB 4W1TA 1EHXA 1GIGL 3OXRB 1WZAA 1DYZA 3JVGC 1CGVA 1UT1A 1X5HA 3VFUB 1MJUL 1UJTA 1KTLA 1G7IA 2HJLA 3QFGA 4WO0A 5F7EL 1U3HC 3B5TA 3SY0B 2K4WA 3GYRA 4PG9B 3KL0A 3TWCL 3EYQD 5AUMB 3PXHA 3H7BA 3HRPA 5DHEA 3MJ9A 1JZ8A 5FO9A 3DYMA 1T89C 1L0QA 4EZKA 5BJTA 2ZKXA 4FADA 4CC4C 1U8PA 4OKVA 4N1HB 3ZDXB 4DF9A 1KGWA 4NUGH 5MEOA 2PYFA 4F58H 3F5WB 3FB7B 5E1IA 2XFXA 2PCFA 1ZHLB 1DLHB 4GMTL 4XNYH 4MCZA 4YHIA 1KIRB 2VDLH 3NYKA 3IRCA 4JQIL 5IJVB 4EEEA 4DTGL 1DVFD 3AZUA 4U1NA 1XSJA 1E6JL 1G5GA 2YHGA 3ASOB 3CV5A 1DVQA 4LLDA 1P7KA 2A74A 2QSCH 4XMLH 3EJPA 2TRHA 3SY6A 4I3SH 4XTRC 4WHDA 2IPTL 2VM4A 1TQUA 4AT6B 4HIPA 5G5DB 4HX1A 2Z31B 1GYWA 1KPUB 1OHZA 5K9JH 2VDPB 1IQDB 3VD7A 1EJFA 4N90E 4XHJD 4ZUSA 5CCHE 3I50H 3WU1A 4Z0BL 3VI3E 4S0HA 5D93B 5EEVA 4H1LH 2XG4A 3E7JA 1T0OA 1T0NB 3AG3B 4ISVB 3GMLB 3BFOA 5E4IA 4DP8X 1N8ZB 4HUXB 4XP6L 2EKJA 4LLVA 4MCYA 2QVTA 5FYKH 4JZNB 2R0ZL 2BXZA 4ALAH 3KBHE 3UG3A 4AVJA 5JHDB 3QDAA 1MWAH 3FH8A 3EF7A 1LQBC 3HFML 5EZPA 4H8HA 2QVMA 3EYSL 2NMSA 1NCWL 3HG1D 3U1SH 2JQMA 4CVWA 4LARL 3HS0A 2VDOB 3I3DA 4P2OB 3VA2C 2NY3B 4IHOA 4QXTA 1OB1A 1XDTT 2VW7A 3NJHA 4HD9A 4XC1H 3U30C 1BYOA 1AD9A 2W60A 1I1YB 5H8DA 4IBLT 5FK9B 2MCMA 1MCRA 4L9LB 3D85B 3JZYA 2DWYA 4MQ7B 4Y1TA 2ZOOA 4QHKJ 4PYHA 5B3JF 4MMZB 3DPBA 3AGWA 2DW5A 1RFDH 1KCRH 2L7QA 2YD3A 5EZOH 3TVMA 3KPRA 4LHQB 4NRYA 3L4XA 1L5GB 4N1CA 1AOZA 1P6FA 3QUMH 3UBGA 1ET8A 3NABH 1NCBH 4DFHA 3B7UX 1AGBA 3H0TB 5D72L 1AMYA 4GSXA 2VITB 3FCTB 2FEEI 4X0KA 4PJDF 5D5ME 3HCVB 1DO6A 3CX5J 3RRQA 3VXOB 2E9JA 3MLYH 4HJ1A 5HHOD 4G9DB 3L13A 2ZKWA 2ZOWA 4P2AA 4LNVA 2UZYB 3D2UD 4TTGA 2ENJA 1XIWA 3ULVH 3DXAA 3HRZA 3SKUD 4OD2B 1DBJH 1HWWA 1MW0A 1YEGL 2PWHA 4QOKD 4F93B 3RLSA 1CE6A 2BOLA 2D8KA 5GQBA 4ZK8A 1HEZA 1XT5A 4M7LL 5HGBA 5KTEL 3O6MH 5F0JB 1L6PA 3O9WB 4PREA 3TH3T 3O0LA 4RVBA 4WI9A 4Y4HA 3RGVC 3NEOA 4LKXB 4LKCB 3JTSA 5I73C 1E27A 1VZGA 5I2IA 1T21B 1A4JB 4HCRA 3ZXAC 4EUPA 3BKML 3VXMB 3SKOB 3GLEA 2EC8A 3THML 3VSUA 3TNMA 3MROA 1X4ZA 1H3PH 5CS7A 5IV2A 1PSKH 1EHLL 4NO3B 4U1GC 3OJDA 2OMTA 1NPJA 3MJGX 2YAOA 4ZYKA 4DEUA 4RCAA 1E40A 5AVQB 4PQXA 2C9XA 5BZWA 5D7JA 2Z92A 2JI1A 2YIHA 4ZFFB 5EV7A 5DJ8B 1IGIL 4HIEA 3QCVH 1KBGL 5FO7B 3FOMA 7FABH 1PD1A 1WBXB 1F4XL 5DCCA 5IB2A 2ZXDA 4PJIE 5IW6B 3JZ7A 4ICXA 4PJXE 1YO4A 1KENH 2P8PB 2PPDA 3FQWA 5J13C 4UT9L 4B53A 3NAAH 4Y1AE 3GMPA 3LRLA 3OPZL 4DO6A 5JHMA 4NGHH 2OTPA 3EAKA 3RILA 3T2NL 3T2PA 3MYZA 5BQDA 1OCZB 2NY7H 2N1TE 4JZOB 1IBGL 2K8MA 3N85H 3QDMD 3LSOB 4UQ3B 2BY3A 2ZX7A 4Y0GA 4YXHL 1IGML 2G5RA 2P45B 4XH2A 1AS6A 4UQEA 4XVSH 3W9DA 1TR7A 2K45A 2BP5M 2ZSWB 3WS3B 3VMOA 2KLRA 2OMBA 1WYJA 1F3DH 2UWEF 3MA9L 3O3DA 4E9XA 3N41B 3OKDA 2V5RA 4N9GB 1U42A 3HC0B 4ZNCD 1FG2A 1TSHA 4CNIB 5DMGD 4I0CC 5DJXA 1ZLSL 3LKRA 1VFAA 4YDJB 4KTEL 5DRNB 4XBPB 3TBSB 3VGGA 3EO9H 4IIZA 5TPWL 4JFWA 2IJ0C 4KZCA 5EU7C 2J12B 3BI9X 4E41E 3QIWA 3LCYA 3TZVB 3DO7B 3MDJA 1MHCB 3HZMB 4PJ8A 2VR7A 3GHEL 1FZOB 3KGUA 1P9MC 3GIZH 3A67L 5IIEA 3N1PC 4I77L 4NNYA 3M8OL 3OXSA 4TNVF 3DROB 4IRZH 2AXGA 1XCXA 2G60L 4FMVA 4PGEB 4XGZB 2G30A 1KPVB 1JYVA 2GC4C 3F84A 3TTYA 2W91A 2YK1L 5AYQA 3ZTNH 1CXLA 2R1XA 3V2AR 1MI5D 2E8ZA 4DWHA 2O1AA 2WTPA 2VN4A 2WYIA 4PHXA 3PDDA 2VC2B 2BSBA 2HVKB 4KRPB 3E9UA 5D96C 5TE6L 2CJUL 4F9LA 3WXWH 1F18A 4JPVL 1I3UA 3BVTA 3L45A 3Q6FB 4UQAA 4ZMAT 4Q6YA 4BA0A 3FSOA 4HHWA 3GPEA 1JPFA 1KELH 4X0NA 3UZEA 4BK5C 3REWA 3T6WA 3PWPB 4QEGA 3FTXA 1E4WH 3AAZB 1ZA6B 1ZGLB 2YWZA 1A21A 3PHSA 1T7YA 3G08B 1IFHH 4AG4H 4PCTA 1RIHL 3RPBA 2VDNB 3N91A 1RXLA 1QRNB 4N2GA 3JWDC 4PJ7F 5C0GA 2RA1A 2VO5A 2R9HD 3UC0H 4AEIH 1BIHA 4NIKB 3ULAB 2PCYA 4OBRA 3F12B 1R24A 2FUQA 5KUKA 5DRWA 3P2BA 1N68A 4FEMA 3OKKB 2NUPA 3NEXA 2OYLA 2WXGA 2HFEA 5JTWA 4JE0A 4OJEH 2LVEA 3LRSA 4QUOA 1DQDH 2R69A 4XMXA 3OG6B 1S5HA 1HCYA 5DFVC 2GTZB 2HUEA 4AMKL 1YNLL 2NW2A 1R34A 4L1HA 3PAYA 1K4CB 3DNKA 2FD6H 4G9FD 3LEXB 3VGAC 1A2YB 4OCXL 5JQ6H 4XZUB 5D5MB 1Z66A 4LT7A 1R3HB 4ACTA 1JZ3A 1IKNC 4YPJA 2O26U 3ARRA 5FAAA 1J48A 3VRIA 1TFPA 2W9EL 3AFLA 2Z9TA 5GZND 5KYWB 4MXQC 3ULUF 3GGWB 1NGZB 4ZOBA 2CPUA 2F7QA 1O9ZA 1RVFL 4N2KA 1U8OA 1X7SA 4K07A 2P5PA 3TBVB 1H3UA 2A6DA 5EZIH 4YC2B 1WA1X 1TETL 2XXFA 1BQRA 3ZL4H 4DUWA 1D6VL 2Y06L 3SDDA 3QH3A 2CIIB 3IU3A 3SKJH 4WDIB 1S7WA 3U48A 5LXGH 3WSQL 4ZX3A 2VSDA 4H8PA 3U0TA 2YC1A 1YEIL 5CN2A 2Q6WA 2NY2C 3C60D 2ZAGA 1QUPA 4N68A 3T1FB 5ICYA 1E8ZA 3NJJA 4KKLC 3LY6A 5JIDA 5LLIC 3KPQB 2OSLB 5CFAA 1BVZA 3QJOA 5I66B 3Q8BA 4FTVA 2W9LA 5D6DC 2WLLA 4P3DA 3QDGA 4ZTOL 3SOBH 3JYCA 5LBVA 3UABA 2A2QT 4XPTL 4HEPG 1YY8B 1NCTA 1ZOXA 4YEEA 1I7UB 1DBBH 3FTGA 5F9OL 4YE0A 2WO2B 5B38B 1OGAA 5I17B 1JGIA 1MREH 4TPRL 4HJJL 2H1XA 4WW2A 4BRJA 3QR1A 3AWGA 3ZE2F 1QBBA 1QSEA 2YOAA 4HOXA 3QS2A 1S9YA 4TQHA 4MB5A 2HG0A 1YDPA 2EDJA 5DJZB 3QUZD 1CL7H 4PJXB 1YEHH 5GJSH 4GIPD 2IDUA 1G7QB 3MUHL 4S1DD 3LZOA 5IWLC 5L6YH 5JQHC 4WSJA 2ZONA 4GEIA 5DI8A 3C5ZB 4C47A 4GUPB 2P4AB 3D0AA 1SVBA 2GCYB 3RI5F 1X9RA 3FFDA 3C6LA 3HZYA 4AGQA 3EJYD 2XWDA 2PO6D 2KQNA 5JOPE 2K4AA 5EDXA 1I7TB 1OGPA 1J9RA 4OD1H 4S2SB 1QSFA 2HAZA 2R2HA 1ZLDA 2OS7A 4AL8C 4IMLB 2IH9A 1JZIA 3BHBA 2GSGA 3GZPA 4Z7UA 4CJ0A 4F20A 1WGVA 2I7OA 3GSRA 1ADQH 2HH0H 2HFGH 3RWFB 4YSEA 1E6OL 3QGVA 3ARED 3S4SA 3S88H 1UQSA 3IU4L 2PXYC 1AD0A 4HZAA 2GY5A 4JO1H 3ZUNC 2I60L 5C0EB 1KJ2L 2UXGA 5T3XL 2H32H 3X11A 2D0GA 1FYHB 4Z7IA 1QSZA 4LCYB 4TQPA 4AWJC 3ZVVA 3L5WB 4K2UH 4Y16B 1DE4A 3IK2A 4AC2A 1SJVA 1WAAE 5D7SL 2FJSA 3ZZ1A 1FFOA 3DBSA 4PU2A 3RY6C 4BKLB 4YE4H 1HYSC 3VQMA 2VDQH 2R2BB 3BO8A 4N8CL 1T04A 5IUSA 2APBA 2J8HA 5F1IB 3H9SD 2HKFH 1WFNA 4WUUD 1E4XI 4DVBB 3HZVA 4WGKA 1WS8A 5ILTH 4X4MA 3S37H 3SDXA 4WWKC 4BQ8A 2WN3A 1YY9C 3E8UL 3M7FB 4OLEA 4NJAL 3Q9QA 4PYGA 3VI4E 1P84J 1IJNA 5KSAA 4HLZG 5ITFA 2Z93A 3KPPB 3QI9C 3EYFA 1I82A 1IGCH 3A6OA 2P26A 2J5LC 4XAKD 1XWVA 1JD7A 4PI0A 4I18C 3AUWB 4N2FA 4JW3A 5HHXL 5I23A 3O2DA 1U8QA 1ZSDB 4S1SL 2CM6A 5DD1H 5HXMA 1P1ZA 1YC8A 4PV8A 4OFIA 3LEYL 4P5TC 2QTVA 5HI4C 3HBPA 1SXNA 4G7YL 5I1KH 1TKWB 4ZMLA 3KWWA 4XMTA 4HPYL 2A0LD 4XPBH 5IHZA 4OTXH 1CK0H 2VLJE 3H85A 4UDTA 4G70B 3MKKA 4KDTC 4ZT1A 4PRHA 2E4TA 1OM3L 3I6KA 5KVDH 1RU9H 1A7NL 1NH6A 5E08L 4OVUA 3V0AC 1YQVH 5HY9B 3QORD 1T6BX 3OAUL 4NLHA 1A6PA 3ROLB 4DP4X 4MNQE 2EXTA 2WIIA 4FULA 3O6FB 3PL6D 3H4HA 1NLBH 5JPMB 4IU2A 2EXYD 2F74B 1U3YA 4AMWA 1CPUA 5FGSA 4MHHI 4R90L 1N12A 3MRMA 4R3SB 2ORBL 3GSOA 4R7NA 2IFGA 3TF7C 3FRPA 5HI5D 4JFTA 2OM5A 3TPKA 3W81A 3T08A 2WLJA 5JA9A 3HNVL 3RTQD 1C5CL 1KB3A 1G1OA 5F3BA 1T3FB 1MCFA 3F6IA 4ZXBA 2B3IA 4UDUA 4DGWC 3OJMB 2VLKA 3U36B 2BFGA 4PJFA 4P23A 4RFEA 3TN0A 3UDWC 4Y19A 3V4PA 3CFKB 4LGRB 4WI5A 4NZJA 3MRFA 1CBVH 3T0EA 3VYNA 4I9WD 1SUJA 2BS71 1ACZA 3D6GA 4UTCA 4DJMA 4CC0A 2WQRA 4JPWH 1ASPA 1BXVA 3IFNH 1TFHA 4YBQC 2V8LA 3B3IB 2AJVL 1ZTXE 5IEKA 5ESAA 2Z7UA 3ABLB 4J3OH 4L4TE 1AGCA 3IE4A 4MXVF 1B9KA 5EBLA 1GS8A 1QNIA 3GHBL 2AZAA 2BNUA 3QA3B 5MENA 2DQ6A 4HK3J 5DLLA 1S7UB 4TNFA 4AQ1A 4Z95L 1UWEL 4ODHL 1DJHA 2FH8A 4W93A 5CZVH 4Y4FB 2CCLA 2AK4A 4G8EA 3AADB 4WY7L 5AOMA 4E9WA 1GZPA 5A43C 1TEGA 3EYOA 4QHLA 1EAJA 4JHVA 2WQXA 2BSED 4LSSH 2B77A 3D39B 1IM3D 1KGCE 3FFCA 5DJCA 5LXVA 4U1MB 1HWGB 2YEZB 3ZHNA 2W92A 2BWDA 3BUQA 4K8RH 4LL4A 4J23A 5ID0B 1YA5A 1K9TA 1QNZL 3O11A 3RAJL 4UYQA 4PRNA 3UADA 3V0VB 5M7QA 4UV4H 1XF2A 3MBEA 2GJPA 1J12A 4JY6B 3EO1A 3N55A 5ADOL 1A3RH 3QUKB 4CRPA 1YYMH 4U0RC 5B7MA 3OB0K 4EN2A 4HLJA 1NAKL 3SDAB 2FBRA 1XF4B 1W0WB 4FQIH 3RWDB 2P43B 5E6YA 4G42B 4QHUA 5EWIH 5C09D 4NC2B 4W9HC 3PL6C 4CMMB 1FGNH 2QQKL 3MODL 4KVPA 4PD4J 3ULVD 5C0AE 4EMZA 3EJTA 3QUXA 1RUAH 2R2EA 3O0RH 4X80H 4OLXL 2GSIB 2ALWA 1QWNA 1E9QB 3ATFA 4LOUD 1A3LL 2ROYA 2ZF8A 3M6DA 2X6BA 2EDWA 4BZYA 2R29A 4JDVB 3Q2NA 1I8KA 1LGVA 1OAXH 3RTQC 3T5WA 3V4VA 4PGBA 3OVUB 5EU6E 2YGNA 1V3KA 4TMPA 2EVHA 1EO8L 2OMWA 4G6KL 3ILEA 4WFHD 3P0YL 1JZ7A 1U3NA 3U9WA 3L1EA 1YVLA 4K71B 4JFPB 4YHML 1SBSL 2ZUQB 1UOKA 4P2QE 1V27A 5F71A 3DMMA 4N2EA 3CH1A 1OTTC 3FRUB 4NZRH 1I7ZA 1U93B 2D03H 1IQWH 4X5LA 1P5UC 2BJML 2FX8L 3D2TA 1ZV9A 3CFIC 5FKAA 3ROOA 1NPNA 4BDVB 4RZKA 3NZ8A 1J0YA 3FTYA 1Q0YH 4P2CG 1FAIL 3O4OB 4MA1C 3TX4A 1ZS8B 2D7NA 3ALXA 3K8KA 3FO0L 4IOFD 1X7TA 3GDCA 4J3BA 1B3JA 2F8XC 2UY6B 5D1XD 1H3VA 5L8JB 3ARWA 2NX5D 5EC1B 2R0LH 5BZXA 1HCZA 5F7UA 3EJJX 2YLKA 5L0QB 2NQ3A 2GITB 1PJ9A 4Q9QH 4JO3L 3QNXA 2EYSA 2VLJB 2IPUG 4JFFA 2F0CA 4LEXH 3I02A 2MSPA 4AM0Q 3IF1A 4EI5C 2IWGA 5T1MB 3WKNA 3ARFA 1WUNT 3V6OA 4B9YA 2P44B 2B59B 3MBXH 2JFCA 2K7QA 5I75B 2O5ZL 1IZKA 1G0XA 5IB4B 1EZVY 5HDQL 4FNRA 3BAXA 3EDFA 4IBTA 4BYHA 4GAGL 4R26L 4BA8A 2WP3T 2ZE0A 15C8L 3MRDB 3KPSA 3TYGH 4AI7A 2WOBA 3EXLA 5ADPL 3TNNA 3MSPA 5BUPA 2CUHA 2B20A 4BZ1A 1C1EL 2QQNL 4EOWL 3P3UA 4ZMQA 1E50A 4JY5L 3ZDWA 2F8IA 4ZDHA 2J20A 2WZPA 1J8SA 5JOFA 4OF6A 1NCIA 2B1AH 5IJCC 3D4CA 3W2DL 2PWEA 1QFUL 1UKSA 2XVLA 3FCGA 3BT0A 3PP3K 4XBGA 2A9MH 1KBPA 4X6FB 4L3ED 4ELMF 3BGFC 1FA4A 4AY0A 1J8HA 3DETD 1GH7A 2AJSL 3QFDA 5JLZB 4P2RA 4L4TB 1T4WA 4MGXA 4QJ3B 2JELH 3A23A 2DBLL 5FKPB 4ZUWB 3C9NB 4GBXD 5KSBE 4JL2A 3A4AA 2RIKA 2FHCA 4L8SA 4WW2F 4N8PA 3VFWA 1G7PA 1X5ZA 3S5ZA 1VPOH 1DVTA 3HKZA 1EUTA 5K39B 2JWYA 1PLCA 3MU3A 4KK9D 1VKXA 1OTUC 2X2IA 3NJNA 3FB6B 4G8IA 4R97B 5A40E 4HCRH 1Z9OA 3EGDA 3K81A 4PS4L 4ODSL 1BZOA 2CJ3A 5DK2B 4MD4A 1IGFL 4P99A 4PJEE 3MZTA 4DK3A 1OE3A 1QG3A 3GI8H 2WD0A 3B9KB 2QGDA 3QIUD 1F45A 1D5XB 1KTKE 1JXDA 1TJMA 2MQ3A 1XQ4A 1PY9A 2DLIA 3UYPB 3F6JA 4FFWD 3SYCA 1I85C 1FIGH 3NJKA 1MAML 2PF6A 4U3CA 4RFOH 3BZEA 5DJ2B 1OARH 1IV8A 4QYOA 3HG1E 1TJIH 4RRPM 4MAYD 2X70A 4D8PB 1R4XA 5IVXF 5KUMA 4YNYB 2JKLA 2XI9A 2PWDA 1BQLL 3NIFE 4XPGH 3OAYK 2X05A 3STBA 1VB9A 1PBYA 1T22A 3DX8A 4P5KA 5ANME 5C0AB 4CVZA 4Q74A 1MNUH 4L3FA 2EDFA 2EIEA 1AACA 4HZLB 4HGKC 4YHNB 1N67A 1NC2D 4UNTA 4HF5H 4BINA 3WFBL 5EU6B 4HWEL 4ONFH 2D0HA 1AR1D 3PGFH 2ZUYA 3IN2A 4LSTH 3OBAA 2IH3B 5F8QC 3BD4A 1JI1A 4APQA 1L9TA 2DEXX 3TCLA 1GRWA 4N2IA 4UINH 3T0WA 3UTPD 1KEGH 5E6ZA 2DQUH 4P2QB 3W9EB 2F1AA 43C9B 4E42B 1B3IA 1CFQB 4NAMA 2ICES 5C9KA 4OB5H 1BZQK 5E9DB 5E6IA 3KJ4C 2HVJA 4U05A 1OANA 4NUGL 3KCWA 2JB6B 3DETC 2ZKHH 3BVXA 3SDXF 3RVUC 3TO2A 3V0FA 1HQ4A 2P7TB 4UILL 5HHOE 4AGLA 5A2KH 4OZIE 1Z6JT 3ZMEA 1KCVL 3BQUD 1UXSB 5C07D 3COOA 5ANHA 1XGPA 4DW2L 2VDLL 4EZMA 4M48L 2A1WH 1A7BA 2H3NA 4QOKE 1MFVA 1HH9B 4DP5X 2AXHA 43CAB 4BFNA 3IDYC 2CCVA 3V5DA 1VRSA 4XMLL 5TDPA 5J1AB 4I3SL 2IANA 3LB6D 2B9AA 2P5ED 4I13B 2ITEA 4FZ8L 5K9JL 1NUGA 4P9HC 3TF4A 4JLRB 1F11B 1DLFL 3LXAA 4KXZH 5IQ9B 4B9CA 2FEEL 2J21A 2QTEA 1D5MA 1L0YA 3KNBA 1PZ2A 3TBWB 2WVVB 4K9EL 3S8WA 2OCJA 2XKNB 1BXAA 4IGBC 5I6NA 1UACH 4JRXA 3ZKMC 3DSFH 4OZFB 4IYKA 1CGTA 5GISH 4J3SA 5I26A 4B9PA 3SPIA 1NGPH 3KLAA 4DGVH 3KVPA 4ALAL 4KKRA 4R7VA 1FNSH 2V33A 1MWAL 4OI8A 3H54A 3ZKSD 3OMZA 5EBGA 1V3LA 3B43A 5D1ZA 1O0VA 4RSYA 4OAWA 3U1SL 1MJ8H 1TMCB 1TZHA 2CPCA 2LU5A 2Y7LA 4Y2DC 1DQJA 2LW3A 1CB4A 2NYZA 3CFQA 3V5HB 5ESVB 1CYGA 4Q4EA 5GGUB 2P24B 2A3TA 4FQPA 2CHXA 4C57C 3IRZA 4NQDD 5EEWA 2CRYA 1SXCA 3MJ7B 2OJEB 2J6EA 4N0FA 5TTRA 3QDME 4KNUA 3OGCB 4UM8B 4HIIA 3IE9A 2ILLA 1M2VA 5D7LA 3UAJA 3HIZA 3MREA 1QTSA 1UB5B 4Z78A 2NZ9D 4PJCF 1LVEA 4KO6A 4NJ9L 1DVFB 5D2NC 2YAPA 5DC9B 5KSBB 2ATPB 3DX6B 3K6DA 1UJ3C 1AIZA 1A6TB 1TVDA 2A9DA 1RFDL 1KCRL 4XXCC 5EZOL 4PB0H 3BE1H 2OMYA 4CUCA 3B2PA 1LNUB 4LLWB 2ZG2A 5BRZE 3QUML 2OXHA 1HOCA 2FK9A 3NABL 1NCBL 1DSFH 4OT1H 3R4DA 3G5XB 3HE6A 1RZIA 1SJMA 4O02H 1HZKA 3L7FB 1HIMH 4U2ZA 1N26A 2O5XH 3CZLA 1JK8A 5H2BA 3D3VA 5DUMH 4DKFH 3O2WH 1CFMA 4PJEB 5DK3A 5AW9B 4PW4A 2JJTC 3MLYL 1OP3K 1Q9OA 1IAMA 2E27H 4QRPE 5C0CA 3DTUB 4F8LA 3BN9D 3V9EA 2D4FA 5I6PA 3ULVL 1Q9LA 1XXDC 2EIMB 2VXSH 1T5XB 2WXFA 3HUJE 4JAMA 2BNRA 3M1BB 1MI5E 5IM7B 3GLDA 3LB6C 4MJ6A 1NCCH 3TJEH 2W0FB 4U0QB 2EE2A 2OW7A 3HG1B 3O6ML 3RBGA 2J1WA 3PWNA 3SBRA 5I6XB 2NY0D 2E4FA 2EIZA 2YARA 3HNTH 3EOAB 1P7HL 3CQFA 3NIFB 1Q0XL 4M3JA 1BQHG 5J13B 5J56B 3LQAH 3L6FA 4XNMA 1FH2A 5I76A 3QUYD 1JF1A 4I4WB 5B1JC 2CBMA 2WQSA 2JIXD 5HTSA 1XZWA 3L3JB 2QBWA 3SOTA 3O4LA 4FLHA 1VADA 4LLQA 1U8HA 5JMOC 5JHLL 3EJZD 3KLHC 5B7FA 3V0HA 1WWCA 1G9MC 1PL3A 4ONGH 3GBLA 2WTRA 5MERB 7FABL 4P57B 3Q6GL 3RB5A 3MMEA 4ZQKB 5KANI 4LLYA 4OI9A 1MAJA 5JW5A 1GSKA 2E9IA 3QEQA 3FU9A 4J3XA 5GZOC 3NAAL 3W39B 5DJYA 1IBYA 1S7XB 4NGHL 4NPYB 4RGOL 1HOEA 2EADA 2R2CA 2DQIH 4L3CA 4ODXA 5CD3B 5TH2A 4XE5B 3GZOA 4HUMB 3NFPB 5DS2A 2V4LA 2FBOJ 2UUDH 3ZT5A 5DFAA 1G87A 2OL3A 1NBYA 1JPST 2MHAB 1XGQB 3QR0A 1U8LA 4RMWA 5HHOB 1DFBH 3L3KB 5JXED 3D2UB 3MUZ1 1E2WA 2C9RA 3AW5A 4J3OD 5FM5M 3JVFC 4N9OB 1YHPA 1XB8A 2F1EA 1TO5A 2HXAA 2P9RA 3ISWA 4XB7A 3T3ME 3OLDA 3F7QA 2F19H 4QOKB 5DD6B 4NC0B 1ZHBB 3IKCA 2FEJA 5C0DA 3I6GB 1GGTA 1PZSA 2HKHL 3BWUF 5HVWA 1FVEB 2DYRB 4QRSA 4AK1A 3UXFA 1WBZA 2HT3D 3AU1A 3GIVA 1IX2A 2X42A 4G7QB 3EO9L 5FA3B 1W91A 5F72S 5K5YA 4LCWA 2E7MA 2F6AA 3DGGA 2QPSA 3FQ2A 4WGWB 4ZW3A 2Q2LA 2N1KA 4MJIA 3PAZA 1FZJA 4A6YH 1O5PA 4NQCA 1Z5LA 2TRYA 2H2SD 4K8RD 4DPBX 3GIZL 4KUZH 1OPGH 3HE7C 1IFRA 4ENED 1C16A 1TQVA 2AQPA 2YD1A 1FQ9C 2BW4A 4IRZL 3N1QC 4LAQL 5KYNA 4ZS6C 3BPOB 4FG6C 3HAEH 5E51A 4I9XA 1FFPA 4X6CE 3BT2L 3ZTNL 2QDVA 3PV7A 2IALB 4XCYA 3WFDH 1Y0LB 2FYYA 2K6ZA 3Q2WA 4RDBA 3RZWA 5KBNC 3RX5A 2VLLB 3NP3A 4KXBA 2C9UA 1QA9B 5FUOH 1T0MA 4W9FC 2RQ8A 4G6AC 3FBKA 3G7TA 3WXWL 4WJ5A 2I9TA 4Z3JA 1UVQB 2HT4C 1D5ZB 3OGOE 1NCAL 3GDBA 3QDMB 1T2QH 1P1VA 5AWNH 1E4WL 2XVBA 2D7PA 4PTTB 3H2PA 1QASA 3S3BB 3TONA 1A9EA 4G1EA 1IFHL 3VNZA 4O2CB 5E8OA 5DRZB 1T5WA 3UC0L 3PDOB 4AEIL 4YGAB 2ZG1A 5DVKA 4HZ1A 5A2BA 2MCPH 3D25B 3IJSB 2NNAB 4J6RH 4JFOB 3NDZE 3MV01 2VUKA 1OVZA 3K3QA 3MRCB 1DQDL 3SY0A 2J1KA 5F21B 3PU7A 1KF9B 3RWIA 4D9LL 1L7IL 1IEBB 3V0IA 5AUMA 3BSGA 3LQZB 2V6HA 3KJ6H 4KK8C 4DP9X 5I9QC 3EG9B 4C55A 5JQ6L 4LAJH 1P4UA 2WNGA 4UWQB 4JZJC 3VWJA 4GRMB 1OAYL 1TUPA 5DS8B 2IAMA 3ME0B 1U8KA 2WBJC 4JN1H 1HCVA 2XFGB 3N2JA 3QDJA 4HK3N 3ZRSA 1IMHC 3MV7D 4EIGB 2UVEA 2VGLM 3NFSH 3FTSA 1AQDB 3BZ4B 5EZIL 5GS1B 4KX8A 4X4XB 2WVTA 1MI5B 1XGUB 2H0PA 1LP9E 1HINH 3SKJL 3ARGC 5LXGL 2GJRA 2F54D 1OTSD 1BOYA 4H4NA 3H9SE 4WKXA 1TNNA 4F8OA 4WHYH 1TF4A 4HQQH 1SDDB 3NQIA 1M6OA 3BUIA 3GSWA 3WO4B 2QHLA 4LCUB 2EEXA 5DEFA 1AI1H 2H8PB 3ASNB 2YEQA 1HC1A 1BQHB 2QLYA 3RNKA 3SOBL 4EBQL 2QVFB 4AK2A 3UO8B 1T0NA 2JK5A 3ZYZA 4GKZB 3GMLA 3L81A 2I24N 1AHWA 2VXUH 3RFZA 1N8ZA 1AZCA 3MNZB 4XAKE 4HUXA 4X9YA 5E95B 2EO9A 1A7QH 4DQAA 4WV1C 4EJ1C 3SYPA 3T2OA 5I0DA 5JHDA 3UPAA 2Y7OA 2J56A 1CI3M 1YEEH 3TVMD 3ZTJH 3SSGA 2VLRE 2VQ4A 2BIQA 4BSWB 1KG0B 5C9JB 1P4BH 1X4YA 1EFXA 2G75B 2M83A 5IW1A 1FO0B 1F90L 5FUCE 3UJJH 1G6RH 4DO4A 2XZQL 5LB1A 1FNAA 4MLSA 2EQDA 2V9TA 5GJSL 3RFRA 1HVXA 4PV9A 4A2DA 5D2LA 4G9FB 2GFBB 4NZTH 3RVWC 5L6YL 4P2OA 1TLKA 1E4XL 5D7KE 3HG3A 1S9WA 2B0SH 1KB5H 3ABZA 4AV5A 2ZX6A 5B21A 2OMXB 3L3DB 4QY8B 4YR6A 5FK9A 4GNKB 3W3BA 3CFBB 3LD8C 4PLJC 5FDYA 3GRWH 1X3DA 2W38A 3ZDYF 2P8LA 1XIWD 4OD1L 3DXAD 3EJCA 2XWBB 1I75A 3T3MB 3L3OC 2W65B 3LIZA 2FNWA 5DQJB 4F1SA 1S9XA 2IWKA 1J5OH 2R29H 1KXHA 1L5GA 3D33A 4AZ8B 3HPLB 3H4FA 1MN4A 3KXFA 2HH0L 3C60B 3HMWH 3QWRA 4X9IA 3UO1H 3H0TA 4LSPL 3C8KB 4DSYA 4AGNA 4H1LG 3FO9A 3RL1B 3FCTA 4GG8B 1PAMA 3H9ZA 4P46A 2BY1A 3VXSA 3HCVA 3DURA 3ZQWA 4I9WE 4KAQH 2FB4H 2ZOUA 4RWYH 4ETQA 2P52A 1RJYA 2G2NA 2UZYA 4GXVH 4WEMB 5FYKE 5H4ZA 2A4CA 4QCIA 4YMPA 5ID1B 4Q4IA 5D7JD 4DAGH 4OIAA 4KTGA 3MV9A 4FXKC 3O6KL 2RCSL 2X40A 2WXMA 1YRKA 2VDQL 4MNGE 2KPWA 3KHOA 3QUZB 5IMKA 5CBEA 1TZOA 5GSRB 1ICTA 4GIAA 5DD0H 1F3DJ 2XZAL 1H6FA 4LKCA 2HKFL 5I82A 1A4JA 1ESOA 2FAUA 3DX9A 4RMBA 3SKOA 2GJJA 3QJUB 5CLXA 1V7ML 3F7VA 2PR4H 4NO3A 5F3FA 1RJLA 5JZ7C 3JTTB 2NTFB 3S48A 1KFGA 2PO6B 1S3KH 4HS8L 2D73A 2HLAB 5DZLA 3MRKB 1IGCL 3CFCH 3GSNA 2V8MA 5I1GH 1BEYH 3A24A 3GJFH 5H37A 5DD1L 4BV1A 4KMTH 4I1RA 2HUHA 2FGWH 3VAEA 3WMQA 1MQKL 3W38A 2CLRB 3W1ZA 5IW6A 1UM6H 2X88A 3AREB 4XPBL 7PCYA 1KTBA 4U4IA 4OTXL 4IIQB 1CK0L 2D2OA 3QJFB 4BZ1H 5C97A 4H26B 3C12A 4PH8A 3QIWD 1FZKA 2YXFA 3EUDA 1MCNA 2FQFA 4X4YB 3SBWA 5KVDL 5BQ7A 4IBZA 2VWEE 4UQ3A 1AZRA 1U91B 3LSOA 1EXGA 2YD4A 1YQVL 4LF3B 4HSAC 4ZX4A 1I1FB 1TVHA 4QMEA 3ULVE 3MRLB 4X7CC 2IV9A 1UASA 1BF5A 1EZSA 3NK4A 4Y9FA 5I5JA 1JDCA 1JWMB 4ZG1A 1ORQB 2JVUA 3SZKC 5JYMA 2I25N 1LP9B 4CNIA 3RY4A 4JKLA 4WFHE 1SEQL 4LHUA 3WHE0 2PW2A 3F64A 3IT8D 4ELKA 3H9SB 2APSA 4F7EA 5JIKA 4WUUB 5AYUH 1SY6A 4FZEH 5KOVC 3L4YA 4HIXH 4HUKB 3TZVA 2C8NA 5TJWK 1MHCA 3VXQB 4A2GA 1FZOA 1HHGA 1CBVL 3VI3A 4RISL 4WJKB 1R46A 3HMXH 1TOXA 5E1AB 1F6LL 3WLWC 3ULUL 2I9LB 2XRAH 5DD3H 2CBQA 2EP6A 1RP8A 5HJBA 1II4E 4MMYB 5DK0A 3FDWA 5KN5B 4K55A 4JPWL 4A7GA 2N01B 4XGZA 4PGEA 5IQMA 3UZQB 2WLHA 2AEWA 2Z7YA 5DJ6B 2B14A 3VG9B 3DHPA 3VX0A 5J1SC 2W07B 1QI3A 4M62H 5HGAA 2B15A 5D1XE 1YECL 4CADB 3C5SB 5L9DL 5IEHA 2NX5E 2IG2L 5EO9A 3PV6B 2KYIA 2L7UA 4HKZB 3GBMH 4N1EA 4XCEA 1KBWA 5EEYA 1KXVA 3ZY7A 2WKLA 5CZVL 5IVZB 3UG5A 4TLSA 1BZ9B 2A4EA 4FQ2L 1RMFH 2OW6A 2TSAA 4DN4H 5F7FA 1MCOH 1DJSA 1ZA6A 1JHTA 3QORB 1EEZB 2VDLB 3ENEA 4N24A 1OKEA 1J1XL 3IJHB 3ARBA 1O6VA 3GSXA 3WIFA 5TQ0L 1UOWA 4LZKA 3CPUA 1N0XL 3F12A 3DYPA 3B9EA 4RA0C 4Z7WA 3V7AG 1JZEA 3SDDD 4UV4L 3BXNA 3RTQB 3V7AE 2H1LM 2LFGA 2GTZA 2BIMA 3QJHA 1NZRA 5DZNA 2DEYX 4BZ2A 3AROA 1K4CA 1QBMH 3MOAH 1A9VA 3TESA 3GSVB 3FT2A 3ARDC 3LEXA 3BIKB 3PGCA 4FQIL 1DN0B 5EUKB 4TVUA 5EWIL 1LWHA 4H1LB 2ADJA 3X14A 1KIQB 5TQ2H 1KNOA 1ZS2A 2QKIB 3QDGD 1I7RB 1KBVA 1SN5A 3TS8A 2BRRH 3D18A 1W72A 2DTSA 3MJ9L 3ZSSA 4PRIE 1FGNL 5DLMH 5A2LH 5KEZA 4Q58C 3F00A 4L3EE 1IO4C 1HESA 3WUZA 1RUAL 4X80L 2ZWNA 5DZPA 4YSUA 2K8QA 1MWAB 4JUSA 5ICZB 4OZGA 2GC7C 3EKCA 4UAOC 3PJNA 3U82B 1YNTB 4M7ZC 2XWJB 2YBRB 4MA1B 5KBLA 3HC2A 1YZZA 4MNGB 3P3TA 3RVTD 3RPIA 2FLMA 1YN7B 3BPCB 4NX0A 5K59E 3V6ZB 1AIFB 1JPSH 3UACA 1EDQA 3KPQA 2OSLA 3N44F 4GUQA 5FA4A 5F6HJ 1D7CA 1H0DA 3NCFB 1JNHA 1D7BA 1H5BA 4NZRL 5CZXC 5DUBB 3A5VA 1IQWL 2BINA 5ESQB 1IM3B 3GI9H 1NJ9A 1GCYA 4JRWA 1I7UA 4PVMA 1DP0A 4YZFF 3BAIA 1Q0YL 1GYVA 2KZ1B 4PEEA 2NY4D 2QKSA 4HIJB 3CDGA 3X1EA 3QUMB 5AW3B 4M7JH 5KSUB 3UJTL 5IMLB 4L8CB 3D5OF 1A6ZB 1BECA 2FLRT 5DD5H 4PJIA 4KK6C 2KDGA 4XXWC 1NIBA 4PJXA 1RZGA 3H3PL 3OX8A 5EULV 3UPRA 2ZOTA 1T03H 1NM4A 1G7QA 4Y1AA 5F3HB 1FC1A 3DUSB 3U6XA 4J5VA 3C5ZA 4K5OA 1Z9SA 4W4OC 5C09B 3Q2VA 4N0UA 1XSKA 2HYMA 2Y07L 4LEBA 1C7TA 2Y6SD 5LG6A 4KI5C 1F58H 3QXAB 3G04A 4M4PA 4MD5B 1DO5A 1IT9H 3MBXL 3NJFA 2VSCA 4K3DL 1CFBA 1I7TA 4HAGA 3ZDXF 4B5EA 4D0BA 2J6EH 5CCKH 3FT4A 1A1OB 3D48R 2VERA 1N6QH 5J9PB 1PFOA 3NGBB 1XEDA 3TIEB 1DQKA 3MRHA 3O8XC 5IMOA 1E5YA 4XN5A 1CF8H 4PJBB 3MRJB 3REVB 2EDRA 4IMLA 3ESVF 3BKCH 4IJ3C 4JM2C 4IK6A 3TYGL 4F8QA 5GIRB 4D9RD 2C9AA 3KCPB 4ZW7A 1KN4H 3RWFA 2O61A 1V05A 3H9YA 4PWHA 4WI6A 5D2NE 5EF0A 1B0GB 4YHYC 1FZMB 3UCQA 1OP5K 2NR6C 3UTPE 4E41A 2WCGA 4J28A 3T6QC 1OV8A 2WJ5A 3F8UB 2ZD0A 2WY3B 3KYOA 4JANB 4PY8J 2Z4QB 3SO5A 5FDWB 5C0EA 1F5WA 4JRFA 2FH6A 5E4AA 4XI5D 2D9CA 1BX2A 1NEZA 2RGSA 2Z35A 4YQXL 1WFMA 1G9NL 1CXIA 2A9ML 2DLEA 3VFSB 1DUZB 2OSWA 2AQSA 4JM0A 4F7TB 2YRPA 3JV6A 5CHNA 5C07E 3OQ3B 2CLZB 3BSZA 4Q8BA 4Y89A 3KM2A 1U8CA 3ASWA 5D1XB 2B4CL 4HKXB 3EHBC 5DURD 4JRYA 2JELL 2NX5B 4MA8H 2R2BA 4L4VE 4MDIB 1RURH 2MJWA 2WINB 2FT7A 3VM7A 2VL4A 4TUOB 2XQ0A 1SVZA 5D1ZI 1C08B 1NKRA 1RP9A 2JXMA 4PRHD 2ICEB 1L9QA 2P5EE 3QZLA 1ES0A 3MUGA 4X98A 2PPAA 5D2LF 4HCRL 3BFQG 5HYQB 5B1KA 4KQ4H 3KPPA 4IJTA 4Y5VC 4DOHE 1IKFH 3GI8L 3WTYA 1A1MB 4M7KH 2GHWB 5JW4N 1ZSDA 5GGRA 4FS0A 4F7KA 2I07B 4FE9A 5DC2A 3PIQA 4UQ2A 1FIGL 1MPAH 4W4NA 5DVPA 4FQXD 4Q7DA 4RFOL 2Y6SC 4ZXBD 2NY1D 1BFOA 3W0WD 2LHAA 2DF3A 2AXFA 4OU3A 1ND0B 2XVKA 1U30A 1UZ6F 2OCFD 4P23D 4Y4KA 4LQ1A 3TN0D 1TTRA 1T7VA 5IFHH 3LDBB 5ACZB 3BH4A 3NCYS 1AC0A 3T0ED 1GXEA 2BNQD 4NQDE 4XPGL 5HY9A 4ZUTA 2AANA 4MHHG 3ROLA 5A3ID 1WFUA 1I4FA 2Q8BH 3UZVA 5E9NA 3CVDA 2VDKH 5CGYD 3ABMB 4L1LA 5DJ0B 4HF5L 4RMQA 5EEZA 3WV0A 3IFOA 3LEVH 4ONFL 3P2DA 4GBXB 2QADD 5E4EC 2WIMA 1XEUA 1IAKB 4W70A 4DP6X 3OHXB 1D9KC 1KGYE 2EDNA 1BBDH 3U7WH 2N0MA 4MBOA 2F5AH 4BFIB 5K9OB 5MP6H 1EMTH 4Q2ZB 4QRUB 4F1ZA 5C3LD 4PCYA 3GSQB 5JQIB 4UINL 4AYMC 5GS3A 3B2VL 2AK4D 1JNNL 1CLVA 2WW8A 4NNXB 1VGKA 3X17A 5JPNB 4M1GH 3TEYA 4P3CL 5B7EA 2VLME 4AITA 1IIKA 3T4AC 1NGWB 2W9DH 4MQSB 1R9FA 2NT0A 4OB5L 2GK0B 1VA9A 4DN3L 3KH4A 4JFHD 2A6JB 3FFCD 5F7MC 1ML0A 1G7JA 2ZKHL 1R75A 5EU5A 3QIUB 3LKQA 3B3IA 1XGTA 4X9HA 3NPSC 2BVYA 2AJUH 1GGUA 2A1WL 5FOBA 4DEWA 2O72A 1TU2B 5HDWA 1WFTA 2OQJB 1WAEA 5FC9A 5GGVH 2DICA 3NSJA 1OO2A 2F15A 3A21A 3WD5H 1CVRA 2CK2A 2ITFA 4MAYB 4KKAC 5KVDE 3STZA 3LN5A 2J8UE 1MW2A 3ESNA 1RJZB 5KVGH 2X4SB 1AGFB 2X4OA 1TQCB 2YXVA 5CD5D 4S1RL 1VFMA 2YEZA 4DEPC 3QUXD 1WLHA 5ALCL 5ID0A 2CZNA 4HXAL 2EZ0C 1NC2B 3MCKB 1UACL 4R7XA 2DV6A 3TH4T 4AVKA 5GISL 5IREA 5JHAA 1AR1B 3DHJA 5HJGA 5I30H 1G43A 2IPKB 3F3HA 4FQXC 5DWPA 1NGPL 3WN6A 1OEZW 4JY6A 1IILE 4XNZB 5IGXH 3DECA 1T6VN 2ICWI 3N41F 2CR6A 4Z18A 4P0DA 1UENA 2LLLA 3SDAA 4ZOEA 3X1BA 2QQLH 4WFED 1W0WA 3BWSA 1MJ8L 4PRPD 2X3CA 3IDIB 3FHEA 1INEH 4OCWL 3AJ7A 1H8LA 5EBWB 1WS7A 1L9PA 2JLLA 3FUJA 5F9JB 4CMMA 1J5IA 4J3OG 1NUDA 3TT3H 2CKNA 5E00A 5LDUA 4A38A 1S7VB 3RWJA 1WAAA 3BQUB 5C07B 4R96A 5IHBA 2GW5A 3WNPA 5FCUH 1FV1B 3VSQA 1A6VL 3H42L 1WJ3A 2ENQA 2XA3A 3BDXA 3MLSH 3RG1C 3CVCA 3K72B 4GW5B 4M5YH 5AZ2H 1IGTA 5IVOA 4A2HA 5I8KH 4AC4A 3LZQA 4A7SA 3FAWA 3VFVB 3QS3A 2CU9A 4XRCB 4DZBB 4XCFL 3E3QE 2Y0SA 4MRBA 1L9MA 2C4FU 4PS8A 4JFFD 4E0RB 3UAEA 3DTXB 1DSFL 2PPEA 2P5EB 3US1A 2BY0A 4HGWA 1ED3A 2BHUA 2PTTA 3FRUA 3S9DB 1U93A 3NCXA 1AE6L 4O02L 3ARFD 4FABH 3VI4A 4NUPA 5DUML 4BUGA 4DKFL 3O2WL 4NP9A 4N6QA 1WCBB 1JMZA 4N28A 5JW3H 5LCVA 1U4EA 2AW2A 2JLPA 4LDCA 2NSXA 2DM2A 3R8QA 1IC5L 3P4NA 3GXIA 4KVNH 5TE4H 3AM8C 3K91A 4FDWA 1KIUB 3MLPA 1ZAGA 1ETA1 3EYVB 2VXSL 1BGXL 1RUQH 2CRZA 5EC1A 4BH7B 3UFIA 4K9JA 2X1WL 1H3TA 2G9HB 1NCCL 1QUNA 2PWFA 2E8YA 1URLA 4O9HL 2XX1A 4YPGB 2X4QA 4TVPH 1BPLB 2AQRA 1TIUA 3OR6A 4M9PA 1SYSB 3VFPB 1SFHA 4S0TD 1WZMA 3QEUB 2WZPD 2JTDA 3O45B 3HNTL 3HZKB 4NZUL 5CEZD 3KLLA 4Z7OE 3X3FH 2Y5TB 5DF0A 1LO3H 3LQAL 4XVUD 1KB9J 3CBJB 2RFXB 4MNQA 1J18A 1F3JB 5D5MF 3PJSB 2DIJA 2WKOA 4H5SA 4I89A 1J8HD 5IROA 5DMKA 1BVKB 2VDQB 1Q90A 4K7FB 4P2RD 1WITA 4AUYA 5C71A 5IK3B 3GNMH 4XPAH 1YPZB 3MRDA 4F2MB 3E0GA 3QPKA 1LTXA 3SYQA 4LCCB 3T0VA 2FO8A 1S7SB 4D94A 3A6BH 5HP5A 5JUEH 3ZGHA 4N3UA 3UTOA 3GMOB 2MIZA 1BZ8A 1ZE3C 3ZT7A 1G7LA 2KLTA 2LE9A 1KV7A 3NJXA 4POYA 2A4ZA 1HS6A 5JIMA 5CGBA 3M88A 2DQIL 1RZJH 4AIOA 1H3WM 1PDKA 4P9MH 3SGDH 4UOW1 3HR5A 3QFJE 3VWKA 2F7PA 2PNDA 1UWYA 4TNWK 1KLGB 1HL4A 1DFBL 1W80A 2NW3A 4W68A 3MV7E 2VL5B 5JLZA 2Q87A 1MQ8A 1T1XA 4WK0B 3OAZK 4F80A 3ZO9A 3I85A 2BO0A 4Y8AA 4V2CB 5G4MA 1OAQL 4IKKA 4TSCH 3DIVA 3MFFB 2F19L 2GJZA 3QQ3B 4X42A 3G6DH 2P8MB 2ED8A 2F54E 3SGJC 4NKMB 5LG1A 4ADIA 1BZ7A 2NY0B 3N50A 2DMCA 1PZBA 1WT5A 2IC2A 4PJXF 5L88H 2XBDA 3LPWA 5AVZB 1I8LA 1NWOA 3ECQA 3QZPA 4EDWH 3QUYB 5DK2A 2X1PA 3FF8A 2JIXB 5L2KD 2GIYA 3BZFB 4U1JB 4IOSD 1JCVA 2VISB 1M71B 4RGND 3GXMA 4X8CA 2WMPA 4FQJH 3WS6C 2C3XA 5E8DH 5MEPB 2JNZA 5AKVA 5DEGB 3ZYOA 3GSNH 4LPUA 1QFWM 4N2AA 4NHCH 3HC4L 2QR0B 5H37H 4NBXB 4POZC 3WFDL 4M5ZH 2UZXB 1E8YA 5ETUA 1RI8A 4XNUL 3JVGA 4X7TA 2DAVA 4GLRI 5F70A 1INDH 5FUOL 5A7BA 5I1LB 3BKJH 4KMLB 2OR7A 5KW9H 1B4LA 1CG9A 1U3HA 2NY5C 4NZFA 3IWVA 3WUWG 1Q72H 4GEJA 5E6ID 4RIRB 1L6XA 1DJXA 3EDDA 5IQOA 4HPOH 4LU5H 2J8OA 3TOPA 1IC7L 4PJ9C 1T89A 1T2QL 4XNDA 4CC4A 3BLBA 5AWNL 4XVJH 2QT6A 1CURA 4JO8A 2BP3A 4OZ4B 5C0JB 3FTUA 2V9UA 1EJ8A 3DXAE 4JREB 5EU6A 5K93A 4I1PA 2WXHA 1HZHH 4U1IA 3D4YA 3FQRB 4ODTL 1D7DA 3TV3L 3IMVA 3VSVA 3E6FB 3HVNA 3C2AH 2MCPL 3VFRA 1IL1A 4WWNA 3IEAA 3GJEA 4YIQA 2KQMA 4JCLA 4G8FB 3MNWB 2ZICA 1JCKA 1IGYB 1P2CA 2IV8A 2X4UB 3BP4A 1PEWA 4HYTB 3KJ6L 4FP8H 1R5WA 1JK9A 3F2LA 5J6GA 1JGUL 2FRGP 3QPXH 1BZDA 2JB6A 3TEUA 3D0LA 1S5IL 1CZ8L 5E70A 4LEEA 1S7RB 3QULA 5I8EB 2XTJD 1I9IL 4GI9A 1T7ZA 2HJFB 3H56A 5F89B 4F8NA 1CD1B 1XF3B 4JRXD 5LQBH 4G5ZH 3ARXA 4HC1H 3NFSL 4LE8A 1OB0A 1YYLH 2V37A 1ZVYA 1OP9A 1HH9A 3KVDD 3NSCA 43CAA 5BOPA 1QWHA 4N86A 4X4ZA 1NCHA 1G7IB 3RKDD 1LO4H 4RETB 3H7BB 4QAWA 1QX1A 3NOIA 3S3PA 4B9KC 5FO9B 1JJUA 1RZKH 4FMFA 5BJTB 4OY9A 4JLRA 3WEMA 4OKVB 2P80A 5JORA 1PZ3A 2C9VA 2CG9X 5I8CA 3FUNA 2V2WA 2XFXB 2PCFB 3HKFA 4JDEB 2C1OA 4KPHL 4MCZB 3UAJD 2ZIDA 2VXUL 3VDBA 3KGRA 2ID5A 4OGYH 4Q52A 5A16A 4PJ5A 5I1AA 4YJZL 3IMBA 1CICC 1GYUA 4U1NB 1CO1A 5D6CA 3TASA 3K1KC 1BLNA 2HLEB 3K6OA 1MRDL 4W6YB 1YEEL 4LLDB 4NO0D 2JQZA 2A74B 2NXYD 1P4BL 2PABA 4HISA 2FJUB 3RIKA 2WXOA 3UJJL 3V6FB 5FF6B 4A66A 5HDRA 3V5HA 4IEFA 4OIIL 2IQ9L 3HE6D 4FLRA 3MRGB 4N0RA 4N0CD 3SE4A 2EDLA 5ISZD 2JJVA 2B0SL 3ZL1A 3D3VD 3MJ7A 2IDSA 1UD4A 2OJEA 1QFWH 2VJXA 2XYCA 4ZUSB 2FL5A 1BYNA 1GGYA 4WTQA 1RLBA 2B16A 3FUFA 5KBKA 2BC4A 4HXBL 2QDWA 3JYBA 3MV7B 3KYNA 5C0FA 1W72H 3GRWL 1UB5A 4LLVB 4MCYB 2ZYRA 1N2RA 1ID5I 5KSBA 2ATPA 4UM9A 3CHRA 3B2XA 4AQAB 6PCYA 4FNPA 3TFKC 1J5OL 1BF2A 2R29L 4IDJH 4X7DC 1LNUA 1KLUA 2F54B 2DQFB 3V4VL 4JK0D 2XACC 3CXDH 3Q2LA 3K2MC 4Y8DC 3HMWL 1KZYA 1NFDE 3UO1L 4F5CE 3HS0B 3ALWA 4ABWA 2YKLH 4N2BA 3S36L 4JFEE 3RGVA 4IHOB 4QXTB 1OB1B 2GB2A 3C09B 3CH8A 3CIQA 4O4YH 2J55A 1N5YH 5FB8B 1EAPA 3R4RA 2Q3XA 1KXTA 4PJEA 2N7AA 2EKSA 2X3BA 4M6NH 3FKUS 1HNGA 4KAQL 3O3AA 2FB4L 2WTOA 4N5UA 4PW9A 4DKDC 4RWYL 4N0YH 1IBBA 2CR0A 1GHFH 1MOEA 2I32A 2VMDA 2YD6A 1SM3H 3NZHH 1RY7B 3TVMB 5IM7A 3KPRB 2YR3A 4NRYB 2WXLA 4I0PD 4XCNA 3HG1A 5IBUG 4NENB 3QIBC 3V52H 4TULL 3NH7H 1AGBB 3HG0A 2YAMA 3QEQD 1CR9H 2VB5A 3UH8A 5IBLD 3EOAA 4XMKL 3VRJA 4X0KB 1DVXA 1QKZH 2OAAA 5L4JA 2B2XH 3GC3A 2H2PD 5ANMA 2PR4L 4RRPG 3WUWB 5EIVA 1I8UA 4HS3A 4LIQH 5FEBA 3L3JA 1BQ5A 1B90A 1CGSH 4KI5E 5F2FA 1XIWB 3NCWA 3EDKA 3ILPB 3DXAB 3HRZB 4KY2A 4PCSA 3CFCL 4GRLC 4X5XA 4P4KD 2EDEA 1BEYL 5I1DB 1H8OA 3ZTDC 4KMTL 1HEZB 3EBHA 5HGBB 1S2EA 4TLUA 3HHSB 4UZUA 5INCB 4ZQKA 4PREB 1NCDH 2JMRA 3T6ZA 2BHFA 2Y2YA 1UM6L 1TTGA 2WNXA 1E27B 3DO3A 3FHQA 4JKPH 4LCWD 3VW3L 4NPYA 4BZ1L 2D3JA 2OYPA 4LRIC 4EI6A 4ECNA 1D5IH 2VM9A 3U4BH 3TNMB 4MJID 3CFDA 4PV1C 5IV2B 3F7LA 3NFPA 4KVCL 4LP4A 5G2NA 4NQCD 4CBPA 3QDGE 4JO2H 4BQ6A 2QFRA 3PP4H 4OZIA 5HHOA 1NANH 1XGQA 4OFVA 4N2DA 4PJAE 3T3PB 5CEZL 2OMTB 4OW6A 2PTVA 3D2UA 4ZYKB 1P9MA 1VLXA 4NRXA 1P7QD 4KDVA 3HJEA 1SXAA 4R4FH 5BZWB 4ATTA 3J2PA 5D7JB 2Z92B 1MHEA 1MFNA 3OJ2C 2JSFA 1UFGA 4JDZA 3IAGC 5DD6A 1NEUA 3FOMB 3BSZH 4Y5XC 2LAGB 3N42B 2QHRH 1DBKH 1AO7A 4L0PB 3TBYA 4DK5A 1WHPA 4NERA 4TNVK 1E4JA 2E6PA 5EO0A 4F7CB 1U0QA 2R15A 3JUYA 4GH7B 4YDLC 5AYUL 4TF4A 4HIXL 3CE1A 1BJ1H 1KGUA 3U4KA 5EOQH 5BW7C 4ADGA 3TCTA 1NQBA 3W9DB 5DD3L 4BK5A 3DARA 4JS7A 5DR5L 1B0RA 1EO7A 4UT6A 5C92A 4QHNA 2YSSA 4V11A 3O3DB 2WNWA 4PUBL 1QATA 1YG9A 5F88A 5F7AA 2X12A 3OKDB 5D1QC 1VENA 3ZHKA 1FG2B 3MV8A 5BVPH 3MRRA 5E2WL 1MFCH 1X9UA 1OK0A 1CCZA 4O51B 1MHPH 5EPMB 3LKRB 3WFZA 1VFAB 3FQTA 2J6WA 4KKNA 3H6AA 1QA9A 4QXGH 1EANA 3QIWB 4R2GD 4QHKI 3SDYH 1KJ3L 1Z9MA 3WEBA 5L7XH 2MOGA 1RMFL 3VWJD 4DN4L 2W95A 4HWBH 1DEEB 4NNYB 1MCOL 5IOPA 1MCWW 2IAMD 3UMTA 1TQWA 3OXSB 3MPCA 1IKNA 1F1DA 2AXGB 3QDJD 6FABL 2WCPA 2P3YA 2WYZA 4XC3H 1VEOA 2GBTA 4CVXA 3PDOA 3EGXA 2YN3A 2CUAA 4V2BA 2R1XB 3B7TA 5IJDC 3SE3C 5LBSA 2WLIA 5IHHA 5DHVA 3EBAA 5BRZA 1FL6A 3CSFA 3IJSA 4D9RE 4V1DA 2XNAA 1THAA 2CE6A 2DWEA 3LZNA 4PG2C 1NFDB 3WNIA 1IEBA 4JBSA 4LNRA 1QBML 3LQZA 4J3VA 1MCPL 4YDIH 5ECGA 3QO0A 1NAMH 2JV6A 3BDYH 3FF7A 1R5IB 2WCSA 5C08D 1JPFB 2JCCE 4GRMA 5I0ZA 3REWB 5TQ2L 3BPNC 1HHIA 3HAEG 3MI6A 4NQXA 5DS8A 4EZLA 3Q06A 1QBLH 1WZ1L 5D6DA 3RDTC 4QRPA 5D8JH 3QUGA 5EU3A 1DL7H 5DLML 1IIIA 3WY4A 4BQBA 5T33L 5D70L 1TLMA 2CLVB 2A9NH 4K3HA 2X1XR 4GPVA 3H3BC 1JHLL 3LTVA 1IKOP 3HUJA 1AQDA 4U6VL 4X4XA 1R24B 4IDLA 1LO5A 4KUCF 5BV7H 2NUPB 5KVFL 4TVPD 1EFXD 2X9WA 3LRSB 5IHUL 3AY4C 2B08A 4ABUA 3SIKA 2NW2B 3K4AA 2CKBA 4S10A 3UGUA 4KKZA 3GXUB 2IBBA 1JPSL 2AJXH 3ZIMA 1M42A 1H15A 5IJKC 2XQBH 2VMJA 1F1GA 3EJRA 2KMWA 1DQVA 1QEWA 4PSPA 2IOIA 4M4RA 4UIKH 4ZPVB 4AGOA 5IF0A 3VRIB 4TQEH 4LSDA 3GI9L 4GKZA 4HU8A 4KZEH 5I71B 3ZTEA 1U8OB 2RTTA 4OQTH 2YMXH 3G5YB 4UTBH 5EN3A 1JRHH 1OK8A 5HDLA 3OAWA 4Z7VE 3SDDB 1OCWH 1GGCH 2IFFH 1AKJD 4LXFA 2MQGA 3VTMA 4JGMA 3RI5K 3WDJA 2G75A 4BSWA 5DD5L 4JPQA 1FO0A 3OLEA 4NAQA 3UTSD 2YC1B 3HG4A 3P40A 3KXFD 3DJRA 2V2TA 4O02B 1TO4A 5J4MA 4Z8FL 2WZ6A 3W0WE 3SEPA 4RQQA 1MY5A 3HN8A 4NN6C 3DOHA 3QB7C 4P46D 4X5WA 2MPAH 2ROXA 4NQTA 3VXSD 2WLLB 4P3DB 3QDGB 2FO1A 2IWFA 2ERJB 3T0EE 2OMXA 2V5MA 2BNQE 4QY8A 1DZBA 4PJAB 4CSPA 2YGPA 3CG8A 5GZNA 1WC7A 3CFBA 1KWKA 1WCQA 4KHXH 2WWMC 1MF2H 4P2YA 2OTWA 1JZFA 3EH4B 3R0NA 4NYLA 2J6EL 2ENYA 3ULUC 4KZDH 4EKXA 2W65A 4ZMOA 4AUUA 1S8DA 4CILA 3RZCC 1CF8L 3MV9D 4XXDA 3P2TA 4W9IC 4WHYG 1S9YB 1BXUA 1LHZA 3N40F 3RWCB 3BKCL 4PJGA 5CIPH 5DZVA 1YDPB 1E7UA 3BWZA 3NIGE 3TURA 5HHNA 3RY6A 4NB7A 3GZQA 3B7YA 4GP8B 1B4JL 5IW3A 3HC3L 3IYLW 3LVTA 1WWBX 3PWVB 3RL1A 5DI8B 5HYJA 5GGTA 2AK4E 5TFSH 5T3ZL 5C0NC 2XG5A 3E2HB 3FFDB 3QZWG 4LVHB 3HZYB 3BJLA 4QDGA 1INQB 4WWKA 4FQ1L 2NSMA 3KBEA 4JFHE 3ZTJG 1LWJA 4KJPD 2C7UA 4WKZA 4ZNEE 3L1OL 3S96A 2F2HA 2NY4B 4X6CA 2R2HB 3GTNA 3QI9A 2OR9H 3VMPA 1KTRL 3BHBB 4TOYH 5AW8B 2GSGB 4JHWL 4Z7UB 4FTDA 3D9AH 1ZGLP 2CHWA 3GSRB 1RURL 3LMJL 3MZGB 4YX2H 1GA2A 3KAAA 4P5TA 3P0GB 3TJHC 3S4SB 3PGDA 3QXWA 5SWQA 1KSRA 2X5PA 1AD0B 2X4PA 1BVOA 3DOSA 3TA3D 5CF3A 4KDTA 5AW0B 3JTTA 4XVTH 2NTFA 3X11B 5T1DH 2VR9A 2VKWA 1NPUA 1NMCB 2UY7B 1ZTMA 1PZ5B 3B2DC 1DE4B 1JTPA 2VIRB 4LPVA 4FNLH 1IKFL 4L1SA 4PWFA 1A14H 3WG7B 1YSOA 3HHRB 3FQXB 3HG2A 4IKNA 1FFOB 2XWZA 3KS0H 3QEHA 3W11C 5C0IB 1KC5H 3W5NA 5BZDB 1SHSA 2Y24A 3N43B 4U1LA 1DQIA 1RV6X 2J88H 5B1BB 3CBKB 4LHUD 3BO8B 3LPGA 4FYTA 4HMDA 1T04B 2CLRA 1RZJC 2JJSC 4L29B 1MLCA 1MPAL 2CAKA 4LPXA 3SPGA 1BW8A 5KSBF 3OKLA 1R6VA 3UAAA 3CN0A 3HZVB 4H26A 2EO7A 4WFEE 1A65A 3VTTA 4PRPE 4FJZA 4QR7A 2WLYA 2JCCB 2KHAA 4Y1SA 4FL4C 3BPLB 4PP1D 2DL2A 4PAZA 5ITFB 2Z93B 2LT9A 2L7JA 3MRLA 5C0BD 5CEXA 1JDDA 1K8IA 3Q5TA 2VAJA 1UH4A 1D2PA 2VT0A 4PJEF 4EQ2A 5HHPA 2OL3L 1NTDA 2VDKL 1U8QB 4H40A 4Z7QE 3VFOB 1LP9A 1P1ZB 1NDTA 2Y7NA 1ZTXH 1RUKL 2R4RH 3LEVL 5DURB 4OGXH 1VHPA 5HVHB 1BBDL 3KWWB 1A7PH 3L17A 3U7WL 1BVNP 2QSTA 5IHZB 2MRYA 2FX9H 3S3DB 1LWRA 2QVIA 4UDTB 4U6TA 2OMNA 4PRHB 4DGYL 1OQXA 1I9JL 1VERA 1GKOA 1NCNA 1MFEL 3I6KB 4M1GL 5D71H 1I9EA 1E42A 2J7LA 1JUFA 2W9DL 4J27A 3IFLL 4XO3A 1FSKC 4UCFA 1UZGA 3HLAB 2OMZB 3NIFF 4FA8A 2HLFD 2WIIB 5KN5A 2DKMA 2O5NA 1E65A 3ARBD 5FYKU 1WFJA 1GC1L 4G6MH 5ELIA 3UZQA 3K0WA 3GSOB 4BD4A 1SF5A 3FRPB 4YVNA 2OXGA 2VLRA 1U8IB 4XNXH 4CADA 3ILQC 2DWTA 1N6VA 4OGAD 1DJIA 1P5VA 4FD0A 4R7DA 1EJ6A 5F3BB 2H1PH 4FQXB 4HKZA 4ZXBB 2H3XC 1CTNA 2NY1B 3C6SA 5C6TH 3P9MA 2OZNA 3ATBA 3MV11 3W0WB 3WD5L 3HB3D 1AQMA 4KGLA 4PJFB 4P23B 4RFEB 3TN0B 3DHMA 4X8XA 3T0EB 2YGOA 4NO2B 5GRUL 1H19A 2X4RA 1GZQB 4LGPB 3DOIA 5KVGL 2IDQA 4MDJA 1EEZA 3RU8L 3ZJAA 3U9PH 5C7XL 4XP5H 4LDLB 3PL6A 2FIKA 3IJHA 4EN3C 3H2QA 3S2CA 3F7PC 4DESA 5CKAA 4NDMB 1E43A 1J8HE 4M8UA 4OZIF 4OCSL 1F8TH 3MGOA 2HRPH 1G9NC 5ESAB 1A6WH 4P2RE 1BAFH 1AGCB 4RMVA 1X5IA 2QADB 1LO2H 4M8RA 4YK4B 5EBLB 4AYBA 1L6ZA 3NIGB 2BNUB 3RTQA 4D7BA 5TF1H 5MENB 1JZHA 1MNNA 3GBNH 4AQ1B 4WO4C 1ZANL 3FH7A 4PCKA 4P5MA 2EDBA 5IMMA 5KWYC 4EF3A 4G8EB 2AK4B 3GSVA 5FHBH 3UBFA 2KT6A 3BIKA 1DN0A 2HJKA 4PP1C 5HI3D 3QJVB 1CJYA 1QMUA 5SX4H 1INEL 1KIQA 3EYOB 4QHLB 3VXUE 1RZ7H 1EA9C 3J07A 2CDEA 3AS1A 1UXMA 2AEPH 3QZWB 1W2KT 5DT1L 3FFCB 4F27A 4UV7H 5IESL 1HHHA 2BWIA 4HG4K 4Y4HC 1P5UA 4NM8H 1QTYT 1TDQA 1N70A 1O9WA 4G11A 2Q76A 1OWWA 3LNIA 5ICZA 1U92B 3VXTA 5GHWH 5FCUL 1MCIA 2HWZH 1BZEA 3O11B 4DFIA 4O2EA 5F1KC 4PRNB 3MLSL 3C87A 1F2XK 3DTDA 1XD1A 1G6RB 1RZKC 4M5YL 4MNGA 2BSTA 1XF2B 4C58B 3AQZA 3EO1B 3MRBA 2FSEA 3M07A 1HSAB 1PGRB 1YN7A 3U79A 1O6SA 1OAUH 1URZA 2CO4A 3AITA 4Y1AD 3JBG7 1WE5A 3WKQA 4IRJC 4QHUB 4QKXB 1X6LA 5DUBA 1XZ0A 4KJQD 5BXFA 3SN6N 1B9ZA 2WHVA 1V55B 3NVQA 3VMNA 2AERT 2AV1A 3QUXB 1HL8A 2Y1YA 4MSWA 5AVTB 2J3SA 1FI8C 5L2KE 4RGNE 4J8QA 4KVNL 5TE4L 4HIJA 1I8KB 5LGJA 3H6JA 1MDTA 3V4VB 1JWSA 4PGBB 5IMLA 1HHJA 2WUBH 2OMWB 1RUQL 3P73A 1VGEL 2ZXAA 4OLWH 5DQ9A 4BQ9A 1QPPA 4A68A 1NBQA 2XN9A 1ODUA 3OF6A 4TVPL 4PRPB 1SZNA 5SX4I 3CH1B 3E1F1 4AV0A 1I7ZB 1FGVH 1R1CA 2ZYHA 2MCAA 5FKAB 2VDOL 1KCUL 4S11A 1E8XA 2IF7A 5I8OH 1MRCH 4AW4A 4X6BB 2HFTA 3N5AA 3TIEA 1MLBA 2XV6B 2XY1A 3B2UD 3OWEA 4NN7B 4Z7QB 4JCWA 3QDHA 4WI2A 2ZNWA 3GNML 3NP4A 4GXFA 4PJ8C 4XPAL 4Q0XH 4A37A 4YSAA 4JRYD 3Q44A 3OQRA 3KCPA 1DZ0A 3LIZL 1CDYA 1B0GA 3X13A 1FZMA 2P5WE 2PPFA 3QNXB 1QQDB 5JUEL 3LPFA 4JFFB 2H6UA 1UURA 1A3ZA 4N2LA 4OCYL 4Z3IA 2FJHA 1ACYH 3I02B 1T7WA 3VH8G 5AENA 3WCYA 5B8CC 2J73A 1J8RA 3FC8A 4JFQA 5EO1B 3ARFB 2ZUUA 4QRBA 4GQ9L 5L0QC 4P49A 3NIDE 5I1CL 2EIBA 5JW4R 1UCBH 4P9ML 1RK0A 3VFSA 3GJFB 1CN4A 1GS7A 4F7TA 3OZ9H 1QFOA 4WK2B 4GUOA 2CLZA 3CQPA 4GP4B 4JRXE 5GRJL 3DVGA 3SGEH 4KH9A 4PVBA 3CFTA 3TNNB 4TSCL 4L5FH 5AVVB 4MDIA 4ZFZA 3EGSA 5ABAA 3SQRA 2DJ4A 3G6DL 2D7TH 3DA0A 1PY4A 3MLVH 1PFCA 2JI3A 3FUKA 5F96H 3NFNB 3U0WH 1C08A 4ZDHB 5TGBB 1GY1A 4CA4A 5JOFB 2AI0H 4Y4KD 3EBIA 2BHZA 1JERA 5L88L 2PCXA 4YSQA 2PUQT 3SDCC 4J8RB 2DWDA 3TEWA 1TCMA 4XBGB 4XN4A 5HYQA 3PXLA 2Z4TA 4HJ0D 3LV3A 4NQSA 3HBZA 1KZQA 1LQSR 4G80A 4AVHA 1A1MA 1J8HB 3F65A 5DSCA 3ZKNC 5J06A 3OR7A 4XNAA 4P2RB 3C75A 4YDVB 3N3EA 1S78C 2XICA 3FYEB 4H8WC 5E8DL 5FYLH 1Z5HA 2ZX5A 3RA7H 5KYXB 2I07A 3GSNL 4N6RA 4JVPA 3T3MF 2AABH 3HR6A 1G7PB 1D5RA 3AWFA 1KCWA 2GI7A 4LMQE 4N8VA 5EG6C 5I1IH 2Y1AA 3K7UA 2P28B 3QYNA 3NDYE 3U6XS 1TTFA 4X8JB 1ZEAL 4NQQA 3BKJL 3VB9A 5AB0A 2J1XA 5G55A 1KIPA 5ISZE 1Q72L 1HKLH 3NPZB 3EGDB 4EQ3A 4PRIA 1F6AA 1J7VR 4HPOL 4L3EA 4LU5L 4MD4B 4NP4L 5CILH 1ASOA 4BUHA 4ANUA 4UNVA 1K4DB 2DH2A 4YBLC 4DIXA 3PQYE 4HEME 4XVJL 5JW4Q 3SGEI 3GS4A 5FS5A 5DJ0A 1SJHB 4PJDE 4GKNA 3LNFA 1AXIB 2FHBA 1HZHL 5F1OB 2A6KA 2DYSB 1J0KA 2APVA 3RP1A 4FCAA 3C2AL 4Q2ZA 3T0BA 4QYOB 1Q9KB 2O6CA 3GSQA 5FYJH 2AKRA 4Z7NE 2X70B 4WW2C 4ZOAA 2QV2A 3G9VA 4JHAL 5JPNA 2AHIA 2X1QA 5LGHH 1NGWA 2GK0A 1NDGA 1SY6L 4CVZB 4MRCA 4UOJA 4LB8A 5L2KB 4XX1G 4RGNB 3U0PA 4HMEA 4C83B 4H8QA 4YUEH 2WM0A 4XX1E 3SQOH 4B41A 2DQMA 4G5ZL 3C6LC 4IGBA 1FE8L 2AQQA 1E2VA 3QAZC 4XP9L 4ZUUA 4UNUA 1O7DE 4IRSC 3TCLB 5DMIH 3JWDH 3JV5A 2OP4H 4NWTH 2AAVA 2X87A 1RJCA 5ACMA 5KS9A 1LO4L 3WENA 3QEQE 2AAAA 5DHDA 3WJJC 3L2LA 1RJZA 4Y2DA 5E6IB 1NGQH 2JKNA 2ZCKH 3BMWA 3ZDYB 4ANKA 4CW1A 2X4SA 5I6MA 2HVJB 4JHBA 2CMRH 3QG6A 4BEIA 1RD6A 1QO3B 2HTLD 5AOLA 3BW9A 1OWRM 1XGPB 3BYYA 4OGYL 2GUYA 2YEVB 4NZ8A 4DPAX 1RHHB 3B7RL 3IS1X 3BGAA 5HJDA 3BVNA 4GAYA 3WMPA 5D2NA 4NM4H 3V5DB 5J11C 5TDPB 2OJZH 1M4KA 1LP9F 3GMNA 3LPPA 4GW4B 2UWEE 2HFFA 1B2WH 3ZBMA 2CM5A 3MJ8B 4GP5B 4LCWE 4X99A 3R8BB 1IE4A 4BZ2L 4MJIE 2AS5M 2CALA 1BFSA 3INOA 4H0LC 2IBZX 1BCIA 1K6QH 4KROD 2XTJB 3E1ZA 2XZCL 3FU0A 5C07A 5BO0D 4J39A 3MQIA 4JRXB 12E8L 2B7DT 5CJQL 5JYLA 1W72L 2JJTA 4OBSA 5HD8D 3ZDZE 3PPSA 4GW5A 3KLAB 3QJSB 4Z7AA 3NRFA 4L4VA 4F2EA 1U21A 4OD3H 3FN0H 3WNKA 5KSAC 2K78A 1V8HA 4R8WH 4IDJL 3LHPH 5IFJB 4AJVA 4ZQTA 2V7HA 2CCWA 2WAQA 5AAMC 4HU2A 3CXDL 1UWXK 3VSTA 1DQJB 1CS6A 1SYVB 2P5EA 2K0RA 5KVGE 4A2EA 5GGSA 4ZAKC 4GYBA 2YKLL 4RMTA 4FQHB 3NA9H 4O4YL 1RUMH 1D2OA 1CLOH 4XP1L 1N5YL 1TPXB 3NEEA 3SCMC 2CIKB 1T2JA 4N0FB 4GUCA 4MNQD 2ESVE 2VTFA 4HIIB 4OGZA 5EA0H 1M2VB 4UQCA 3CVIL 4N0YL 3QNFA 5E03A 1NWPA 3FZUC 5IROD 1PTZA 4NCC2 5B1JA 4Z78B 3L95A 1GHFL 1E30A 2R8SL 4P05A 2CD0A 3INUH 5CM1A 1ADQA 1OOAA 2W5PA 1SM3L 5E6RB 3NZHL 1TQBB 3QO1A 2OMYB 4JPKH 2NXYB 3OWRA 5DWUL 5IKCA 4LSUL 3HI5L 2OXHB 4W6WB 4YPGA 1HOCB 3L9YA 1EH9A 3VFPA 3V52L 4AL8H 2LVCA 2AVFA 4IBVA 4N85A 2CH8A 1CR9L 3HE6B 3K6NA 2H32A 1RZIB 2VMEA 5F7DA 1EWHA 4NQDA 3UTTD 5ISZB 1QKZL 2Y5TA 1JK8B 2B2XL 5H2BB 5GZOA 2AEIT 2J1ZA 3D3VB 4WQOA 1M9WA 1UFUA 3OZKA 2PP9A 3VWKD 3VQLA 5L8KB 4JMXA 1Q9OB 4M8QA 2EH7H 4OF3A 2XHNA 3VFGH 4KKCD 4OJAA 3VX1A 2XA8H 1Q9LB 4I3RH 4JAMB 3ET9F 2X53A 4JDTH 1NIEA 5LNEA 3FB8A 1W8EA 3PWNB 1YNTF 3DYOA 1NCDL 4XMZA 3N40P 4Z7NB 3K8LA 5C7ZA 3ATAA 3P77B 4KU1A 4A55A 1EK3A 1LDPH 3IBOA 3FPYA 4B9JA 2V3FA 1D5IL 4BFGA 3L6FB 5C08E 1I53A 2KUTA 3I9AA 4XNMB 5GGTH 3HHMA 2LTQB 5I76B 5E8NA 1JF1B 4YFLI 4JVUA 4LSRH 2W0KA 1KLGA 4N25A 5AL8A 3O4LB 1I1RA 3TYFA 4LLQB 1KYOJ 1U8HB 1AS8A 2WQVA 5A7EA 4HUUB 4QRAA 4OCRL 2Y22A 2WP3O 2GTWA 4Q56A 3BP7B 4L2YA 2WTRB 4L37A 3HG5A 4QXWA 3TH2T 5LWYH 4YHKH 3RJDA 3BSZL 4TVPE 4I0PB 4MASA 1DQQA 5DU7A 3MMEB 5J12C 3SD2A 4F33A 1ZA3B 2V17H 4JO4H 4LLYB 3I3EA 4HIHA 2QHRL 1NGX