1AZVA

Familial als mutant g37r cuznsod (human)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKRLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER/ZINC SUPEROXIDE DISMUTASE
publication title Subunit asymmetry in the three-dimensional structure of a human CuZnSOD mutant found in familial amyotrophic lateral sclerosis.
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 39
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1azvA00
1COBA 1HL5A 1E9QB 3ECWA 2JLPA 3MNDA 4A7GA 2AF2A 3L9YA 1U3NA 2JCWA 2C9UA 1E9OB 1DO5A 2WZ0A 2WYTA 1YSOA 3HW7A 4BD4A 4BCZA 4A7QA 2V0AA 1PZSA 2LU5A 3KBFA 1B4LA 1IBDA 2AEOA 2WZ5A 1OZUA 2Z7UA 1BZOA 1E9PA 2XJKA 3HFFA 1Q0EA 2AQQA 2WWOA 3GTTA 4OJAA 1SXZA 4A7VA 1Z9NA 1JK9A 1F18A 1SRDA 1SXAA 1SXSA 5KBLA 1IBHA 3SODB 2ZKYA 1N18A 2Q2LA 3RE0A 3KM2A 1XSOA 1JCVA 1SDAB 2K4WA 3CE1A 1CB4A 1RK7A 2SODB 1S4IA 1BA9A 1OEZW 1DSWA 3GZOA 3S0PA 2AQSA 4N3TA 2NNXA 1SXCA 1Z9PA 2AQNA 1CBJA 1F1GA 3F7LA 1AZVA 1TO4A 3CQQA 5CU9A 2C9VA 1XTLA 2WYZA 2XJLA 1SDYA 2ZOWA 4MCNA 1EQWA 3H2PA 3GZPA 1MFMA 3GQFA 1SOSA 1UXMA 3PU7A 2ZKXA 3KBEA 4MCMA 3QQDA 2AQPA 2E46A 2WKOA 2GBUA 1B4TA 3GZQA 1JK9B 3K91A 1TO5A 2Z7YA 3LTVA 1IBFA 1P1VA 1OAJA 3HOGA 2E47A 3L9EA 4B3EA 3F7KA 2WKOF 2WWNA 1YAZA 2GBVA 1UXLA 3KH3A 3H2QA 1IBBA 2VR8A 3KM1A 1E9QA 1OZTG 1PU0A 1XTMA 2VR6A 4A7UA 3ECVA 2ZKWA 4A7SA 2AQTA 1E9PB 2AQRA 2VR7A 2WZ6A 3T5WA 4A7TA 1FUNA 1ESOA 1PTZA 1SXNA 2GBTA 1EJ8A 1E9OA 1F1DA 1SXBA 1KMGA 4N3UA 1OALA 3GTVA 3QQDB 1QUPA 3KH4A 1IB5A 1HL4A 4A7GF 2R27A 2Z7ZA 3MKGA 4FF9A 5KBKA 3CQPA 1YAIA 4L05A 4U4IA 1SPDA 2APSA 4OH2A 5KBMA 4BCYA 1F1AA 1L3NA 2Z7WA 2C9SA 1N19A 3ECUA
chains in the Genus database with same CATH superfamily
3HKZA 2YKLH 2PN5A 4MJ2A 2GT9B 4HS6A 2ZAIA 2OV0A 4Y5XC 4L3EB 4Z7VF 1DVZA 1Q9OA 4GW1B 5JPNB 2H0EA 3G5YA 4YHLL 5CAYB 3ZTEA 1VKXB 4AZ8A 1IC5L 4DAGL 5FFOA 2VLKA 2WP3O 3K72B 3FCSA 5T1LD 1ET5A 5DMYA 1FNEA 3QPQC 1REIA 4UOJA 3Q8AA 1E4XH 3VFNA 3NMEA 4DESA 1S78D 3U0PA 4XB3A 2NW3A 2X42A 4FTVA 2BC4B 2IBZY 4PJDF 2CDGA 1YMMD 4XN5A 1R3JA 5E2UH 1DLHA 4PV9B 1XZWA 2WOYA 3GMNA 1UQSA 1EVUA 3K2KA 4B60A 2ZG2A 4QXWA 1U6AL 4ICXA 3OAYH 5F0LB 2BVUA 4BH8B 1ET7A 4XGZB 3HN3A 5D1XC 3TPUA 1EPFA 3QNZB 1I7RB 3VE0A 5FGCB 2KERA 5HGBB 2D31A 5HY9B 4KFMA 5F6HJ 4M1GH 5CBEA 3VH8B 4JO4H 4J23A 4XH2A 1OT1A 1JFQH 3LXAA 4NFBA 1PG7H 2V2WB 3FTGA 1R5VA 2GHWB 1QWUA 2HRHA 3P1VA 2EECA 3ATDA 3GKZA 5IW6B 1EK3A 2QPUA 2L7UA 4HIJA 4JREC 5IB2A 3O8XD 3FU3A 3WTVA 1LK3H 4X7SH 5EWIH 4Q56A 1RUAL 1UWFA 3VFVA 2DWDA 2WGXA 3ARDD 3OGCB 3R8QA 3X3FL 4N9OB 3QB7C 4HVBA 3TURA 4BK4A 1E7VA 2Y6SD 2WBKA 3GSWA 2ZYSA 3T65B 2H1PH 1MCPH 3OX8A 4OZFG 3T4YB 3ZW3A 4J5VA 4RGND 5C8JA 5I9QB 2J6EL 2M2DA 2UZXB 4K23L 4JCLA 1WT5A 1OP3K 4ECNA 1OAKH 3VXRA 2BSCA 2BX5A 2EYTA 3N55A 1QR1A 3QFJA 1PJ9A 2B9BA 4UM8A 1CK0H 2WNGA 1UG9A 4DK5A 2Q7YA 4FE9A 4PJEB 5FGRA 1D5BB 2DW5A 5I5IA 1EAPA 1W8OA 5AZUA 5I1AA 3CQPA 3S48A 2WBJD 3LVEA 2VKXA 4BZ1A 4AL8L 4FMVA 1WLHA 3UTPE 4AYBA 4I77H 4OZGE 4BZ1H 1QTYT 3P3YA 5E1IA 2VISB 3U2SB 1XDTT 5KYXB 4FQLL 3R0MA 5BRZB 3NJXA 1SF3A 4RGOH 2BP3A 2JWYA 1AIFA 4V1DD 4ATTA 4B27A 5AOIA 3PWUA 2OMWB 2QBWA 3DXAB 5AVXB 3I9IA 1MJ8H 1XZ0B 3LEYL 1BBJB 3DO3A 3NSYA 4IK6A 1JD9A 3HW7A 1S7SA 4KY2A 1U4FA 1BYNA 2DEXX 1OM3H 4A7QA 4PV8A 5D5ME 2ZUSA 3ECBB 2FO8A 4RBPH 1UM5H 1TJGL 1YYML 3BZ5A 3GS0A 5FHBH 1ZHNB 3DKHA 3GSQB 4ELME 1KGXA 1UHVA 4W9LC 1J1XH 2FB4L 2ICWI 4OVUA 4DKFL 4I0PC 1HE7A 2NYYC 4IYKA 1VDGA 2E7HA 2GAZB 4LPUA 4FFTA 2IV8A 1GOHA 4FNTA 1E6JH 3P69A 3GRWL 4KV5E 3SQBA 3UAJA 2WLHA 1IBGH 3N85H 2VLMD 2WWMD 4FYSA 2IANE 3OXRA 1I1RA 4P9ML 3BAIA 1CD1A 3KJ4B 5E00A 5EU6B 1SN0A 3W39B 5KYWB 4LHUD 4F1SA 2XN1A 3C09C 3KWWA 3QZBA 2YPLE 1Z9PA 3SSGA 4Z7OF 4HV8B 3UX9B 3F85A 3ATFA 2X1PA 5CFAA 1NA8A 3BT2H 5I0DA 3S5LG 3QC5X 4X42A 1JGIA 3DETC 3FN9A 4WSKA 3G6JB 5H4YA 4JY5L 4MCZA 1FAIL 2MJWA 4HA1A 3QIWC 4MZ2A 3NZ8B 1N9PA 1IUZA 1YG9A 2A9AA 2XQBH 3DC0A 4ZS6D 4LEOA 2P42B 1RK0B 4GP4B 1NGWB 2J88H 4QRAA 1OP5K 1HXKA 5ESAA 1NFIB 2BFVH 1HXYB 2XZCL 3T0AA 3IU3B 1XGYL 3EJYD 4K07A 2IDSA 4OFKA 5F3FA 1CICC 1NBYA 3GIZL 2UZPA 3DDGA 2GABA 4DIXA 3OKLA 1L6ZA 3A47A 3UC2A 1DUYA 2DMGA 4BIKA 3VTTA 1QWHA 2C3XA 4HHAA 1NCOA 4E5XG 5I6KA 3HZKA 5JW5A 2A2QT 2F7OA 2ZP9A 4XNYH 4R8WH 3JUZA 4WW1A 3KLHC 1YECL 1NCBL 1S7WA 2FE0A 3BDXA 5DFVC 4NPKA 4PPTA 1MRCH 2XQYG 2PWGA 4I2XA 3WNLA 4JQVA 1NCDH 3CLEH 2FX9L 3QH3A 4PJ8D 4UT9L 5D2LE 2KPWA 4AQEB 1KPRB 4X2UA 3F7QA 1BZ7B 2ZX8A 4QEGA 3H9SE 3GI8L 1VZIA 4EEEA 1CF8L 3GRBA 5T1LA 4AIEA 5DRNA 2X2HA 4NHUA 2AFNA 5EBGA 4O58H 5KJRL 1E28B 3RIKA 1DVXA 4UILH 4P8QA 1QD0A 1Q9LB 1PQZB 1TQTA 3P73A 3FFCB 4N8VB 1IEHA 2Y5TA 2B9AA 1JF1A 3Q06A 3UTQA 3DUSB 3L1FA 3LH2H 4DKDC 3OKOA 1SJVA 4HJIA 4NNPL 1YMMA 1F2XK 4Y4HC 1RAMA 3NIGB 2CIIA 1IM3B 4BKLA 3I2CH 1YSOA 1OD9A 2GUOA 3ASOB 4YZFF 4DK6A 4LSQH 2VABA 3U30C 1H9VA 2OMVB 5C0DB 1RZJH 4D8OA 4XVTH 2Z4QB 1X5ZA 5FV1L 4XN9A 3ARGD 4MGXA 2ADJA 5F8QC 1OPGH 4XVUD 1CE6A 3EDFA 4OZIF 2XG4B 3JZYA 2ORBL 3LKOA 3N43F 4JY6B 1IEBB 5A40E 3HAEB 1OSPH 4JPWH 1ZXQA 5HYSB 2XVKA 1JTPA 4OJAA 3C9NB 5AVZB 3OXSB 4GG6B 4F37K 5E9DE 3BUPA 4LSUH 1WG3A 3TPKA 2COVD 1U58A 2G0LA 3SBWA 1SDAB 5BS0B 4PJ7B 3WNKA 3O8XA 1ZRUA 2VZ1A 4CDHA 1JV2A 1MZYA 4BFNA 1E4XI 5DHYB 5E5MA 4FHKA 1IC1A 2H1XA 2PO6B 4N0FB 3ARDA 2ZYHA 3LZPA 1CDBA 5ETUB 4ONFH 4U6YA 1KXHA 4YEEA 2E56A 2VJ8A 3D2UB 3CFIC 3VFSA 4PREB 3UYRL 4FZ8H 4FXGB 2XIBA 5F9JA 3WDIA 2YN3A 1HNYA 4YX2L 4HS3B 5E03A 1MHHB 1VSCA 4MBOA 5DTFB 2K45A 3JWOC 3EOYG 4LOFA 1JWSA 4MNQE 1UXSB 4HFUL 2H26A 5I6NA 3U46A 1YYLL 3V7MA 1FVEB 1HOCB 3ARSA 2JMRA 2R0KL 1NAMB 3WGVB 3O6FB 1DVSA 2YARA 1QPKA 1P4BL 4HLZH 2WBJA 4Q58C 4IHBA 4FG6C 4KKCD 1KGWA 1ETA1 2X3CA 3JWNH 5DRWA 3VU2A 1DJZA 3WD5H 4GSDL 2IC2A 3MNZA 1G1KA 5IBLC 1T21B 5EZIL 1TMQA 1D2OA 4XPFL 4L4TD 2WYIA 2AK1L 4V1DA 2AITA 1GCYA 1HSAA 2YAOA 4HJUA 1AD9B 4R26H 1MFAL 3WIIH 4HUUB 1QSFE 1A7QL 3IFOB 4DP0X 1QBBA 1T04A 1L0XA 1DDTA 4ZUWA 4KKAC 4GUQA 4NQDD 2WXIA 3O4LB 35C8H 4PUBL 4Q14A 4A7GA 4Z76B 3RWGB 1FAKT 3STLB 3FBQA 2ZCHH 5KTEL 5IHZA 3MRMA 5IK3B 5GGSB 2F0CA 5MENA 3HRPA 4N0UA 4G9DA 3VTMA 3L5HA 3L5XH 3PGFH 3Q5TA 1I1AC 4W9DC 3LHPL 1AKPA 1BFOB 2QDVA 1NCJA 3FOMA 4HAKA 5EN2B 2AC0A 3L3OB 3PP4H 4JW3A 4LHUA 3AACA 4XXCA 4XVSH 4LRIC 4ZK8A 3T8XA 2ILLA 1CFBA 1NANI 5KN5A 2VT0A 5L8JB 1KTDB 4UQ3B 5FYJL 4XPGL 1PZ5A 1HDMB 3VXSD 1HNGA 2P48B 2VDOH 4YSOA 4E9SA 2UWEB 4LLYB 5CJQL 5CP3A 3FB7A 4XB8A 2R0WH 3VUAA 4NQSA 3TIDA 4I88A 1LEIB 4GKZA 5CP3H 5IJDC 4S1SH 3LD8B 4QO1A 1JMZA 3L9RA 3PABB 3RPIB 5JUEL 4F8OA 1QFWH 1J8HE 5DEZA 1TYRA 4ONGL 5DMKA 2I7OA 3ROLA 3QFDB 2BSBA 3V9FA 1YMHB 1NDGA 4EZJA 2A38A 4EQ3A 2V5YA 4EZMA 1NBVL 5IKCA 4HSCX 1MW3A 15C8L 2WINA 2CRYA 3C6SB 4DKAA 2ADFH 1ZEAH 2QQNH 1UXMA 3KYKH 3MJ7A 1KXVC 3E80A 2AXFA 5ENWA 4Z3HA 1KT2A 2I9LA 3VSUA 1P1VA 2WLIA 1IGIL 1V3MA 2C7UA 3KDMB 5B39G 3KDPB 4MNHA 1XGPB 2UV3A 4I5BB 3WXVH 3CK0L 3KPQB 3KE0A 2GB2A 4PJ8A 5DI8A 4YLCA 1SJXA 2XRAL 3ALWA 4U3HA 1DANU 4GAGH 5EMYA 2EZ0D 3PL6B 1TSRA 3CMOL 1T0PB 3U7AA 4YBQC 1A2YB 1P4LB 3C12A 3C5SA 3KGRA 1SUHA 1FUNA 1W0VA 2KDGA 1QUNA 1EHNA 7FABL 1BFSA 1JPFA 3LKPB 5EN3A 2BS9A 3WMQA 1R3HA 3P30H 3CN3A 3U82B 4R3SB 2EXTA 5EUOA 2IAAC 1NIAA 5BO0D 1TSHA 1OB0A 3GLDA 4LU5H 3TASA 2KYIA 4LCCB 5D55A 4AMKH 4A04A 3NCXA 3MXWL 3ZL4H 4WCYH 3QCTH 1ID2A 1HOEA 3FO2A 2FD6H 2W9LA 3ARGA 3D0LA 1GC1H 1RUPL 2CO6A 2VDML 3VW3L 1KYOK 2HJKB 4FCHA 3T8VA 5FYKL 2AJUH 2YFNA 4JVUA 5C6TH 2FWSA 5DJDB 1F3JB 4NPYA 5D72L 3O41A 4E9WA 1XF3B 2XACC 1SLVA 1KB3A 5C6WH 5TJWK 4OCMC 4YK4C 2XG5B 2OSWA 4ADIA 1Q0YL 3AQDA 5HGDA 4FQ1H 4FQXB 2QVMA 4QT5A 4UQIM 4QHLA 1KGCD 1S3KH 4FNLL 2EXYC 5DA0B 3RVVD 2IQ9L 4AGQA 1CDGA 3VFOB 4J3OC 2DLEA 3KWVA 4ZUTA 5SWZE 4E42B 2ZOLA 2O61B 1FL5A 4KGLA 4DP1X 1ONQB 1T22A 2G4GA 1JJUA 1JK9A 4BDVA 3QI9D 4M3JA 3OHMB 4FXKB 3C5XA 1NCCL 2CPCA 5E8EA 5GSVA 4IM8A 3ZKXB 3FTVA 1EXGA 5CD5D 1UTDA 2MRYA 2R2EA 5DD3H 4Z7QF 5DUPL 1TZIB 2DWYA 4U7SA 2SODB 5A3IC 2BPBA 5L2KE 3BIBX 2R9HC 2J8UE 5LAXB 4ZG1A 5AVRB 3LKNA 1FN4B 3MC0A 1PZAA 3Q5OA 1FJ1A 4HWEL 1WAAE 3NTCL 1H3PH 1L0QA 1ZT1A 4A2DA 2WYZA 1BFVH 4HOWA 2XXFA 1SOSA 4Y4KD 2EH7H 2DKUA 2Q86A 4QRPD 1MCRA 4OZGB 1A6TB 1DHKA 2Z7YA 3I3EA 1X9LA 2R0ZL 1J48A 3F7VA 2YUVA 4GP8B 4AEFA 1OANA 2X9ZA 3V5DA 4L4TA 4XZUB 5C0BE 5AZ2L 2IPUG 3L3HA 5I75C 4UQAA 2VDRH 4FQCL 3OMIB 3NGBC 3BUDA 2XV0A 3BESR 3QDME 4D0BA 2BP8B 4LAQH 4ELMB 3FUFA 3LN4B 1I8UA 2DMBA 4NQDA 2P8LA 2CIKA 3KH4A 1N64H 2VLLB 2F74A 1EXUB 1JGDB 4A7GF 4K71C 5GIRA 1KEML 5B8CC 1YQVH 4GO9A 5EUKA 2Z8SA 3MBXL 1TQCC 4M62L 5J1TC 2DLFL 3FB6A 2IANB 4KMTL 1IAIH 3VRJA 4FRWA 3S37X 1F4YL 1OIOA 3BT0A 3NFSL 4HBQA 3WOVA 1SYVA 4BRVA 1EVTC 2YPLB 3DX9B 1AZUA 3K1DA 3KLAB 2IH1B 1I9RH 2N59A 3IF1A 4HDIA 3VNZA 3VXME 1LO5B 4JRYD 4KQ0A 1A5FL 5JXAL 3V6BR 2ENJA 1Z5YD 1CLVA 3MBED 3PPSA 4NUPA 5FIEA 3VXSA 5IZ7A 2G75B 3WFEL 1CLYL 4FTDA 3CJJA 2RFXB 4MWFA 5ESQB 3QJFB 2Y5QA 5EO0A 3FUHA 4JFSA 4YXLL 4H5SA 2VIRB 4LSSL 1AGFB 1MAMH 32C2B 4RETB 4U1SA 5LGJA 1WHPA 1FFQA 4ZQKA 2ITDA 3QEGL 1UZGA 2AQQA 2G3MA 3HRZA 3SDXF 2L8AA 3EUUA 2C4FT 2WO4A 3GXIA 4RRPA 4N8PA 1MCBA 4WWNA 5CILL 2FNBA 3QEUB 1AMYA 4QXTA 1UM4H 2CUIA 2JJSC 4TVPH 5AW9B 5CIPB 2NNFA 2BLFA 4LP4A 3RNKA 3HE7B 4CVZB 1M2OA 2AEWA 3F6LA 2F8IA 3MRKA 4ZMYA 3WNPA 1X5YA 4UM9D 2JELL 2DY2A 5BV7B 1SEBB 1A6UH 2XSKA 3EO9L 5EO9A 1ZGLM 2Y6TE 2ENSA 1PX4A 4OU3A 2NLJB 2QADD 1NMAH 2Z1KA 5D2LB 2B2XH 1KLFA 2ZUXA 2AVFA 4XODA 3L2MA 1EAJA 4Z7WF 3H9SB 2ZKXA 4D7PA 2YAFA 1KFAL 1KJ3L 1LDPH 1LEGA 2OMXB 4NKQB 3JT0A 4J3OF 4XBEL 1T1XB 2ENQA 3FQRA 4WUUE 3SPJA 4F8LA 1TETH 5LKNA 4NENA 3PHOB 4Z7AA 2IMMA 1HHKB 1QFWI 1JDAA 3FQ2A 3QHFL 2R29A 2CSPA 4AV0A 2ZPKH 4OD2A 2A6IA 4YAQA 2R29H 5IWLA 3GPEA 4JANB 3ZPDA 4PTUA 2MCMA 3BGAA 4Q2ZB 1VFBB 2P46B 3FF8A 4XX1G 1E9PB 1F45A 2BSTB 2JXMA 3INOA 3JTTA 3MGOB 4JJHA 4N2HA 4MNGE 1RUQH 5F9DC 3TJPA 1MJJB 2NY4C 4L29B 1UVQB 4MA1B 1CBVL 1NGPH 5D1ZC 2AV7A 1GKEA 4QIRA 1Y7VA 5JDSA 5MI0B 2VXUL 2XKNA 2B5IC 4ATWA 3DGGB 3NK4A 5L6YH 3OAWA 4TUOB 1NBCA 3QNXB 5E9DB 5AW5B 3T1FB 2NSMA 1RJLA 4PJIE 1W2KT 1RVFL 2N4IA 3DK2A 3QS2A 3D39D 3B1TA 2FVNA 4M93C 1C08A 1I1YA 2XHNA 3EGDB 1JHKH 3CFDA 1NCIA 3ABGA 5T3XE 2DH3A 1JCKA 4GW5A 4PSRA 1JGVH 5B7MA 4KVNL 1HN1A 4OKVA 5DJXB 5DD0L 1MW2A 2DQJH 4XN8A 3SGEH 1KIQA 1MCSA 2N1TE 3QI9A 4HG4J 4JX0A 2BWIA 1CFMA 4D8PA 1PCXA 1M05A 4NDMA 3L45A 1V55B 2E9GA 4DEPB 2H32B 3ZGHA 4GS7B 5T1DL 4WI7A 4HUKB 3MV9E 3L1GA 4N8CL 4IRZL 4LNRA 2KUTA 4NNXB 5DJYA 4MNQB 3L54A 3O3BA 1ND0A 1NMBH 2NPLX 5DJZB 4PJ5D 3T09A 1R5WB 3TF7C 4L5FH 1S5HB 3OWEA 1WFJA 1XT5A 3V0AC 4P2OD 1JNHB 2K7PA 2GEEA 3HUJE 4KRLB 3QPXL 3RWEB 4TUJA 2I07A 1XSOA 2BIIA 4G6JH 3T9WA 1KJ2A 3X14B 1OGTB 1UJTA 3K5RA 4Y4KA 3B6SB 1KJ2H 3Q6FB 1DJXA 1MSPA 2A74B 4QRPA 3VWJC 4N5EC 5EOCJ 1ZIBA 3QWOB 2VMEA 5AB1A 1OM9A 1VGEH 1RERA 3OMNB 2H3KA 4PW9A 4TNEA 2VLRD 2RHEA 2E6QA 2ZSVB 2K9FB 3QQ9D 4G2AA 4K5OA 4RFNC 2X4RA 5DGQA 4YHZH 2XFGB 2KQNA 1VACB 4NBYB 4S0TD 3F5WA 4GYBA 5JR1H 4GUOA 2UY7B 4YFDB 4OIAA 3U0WL 3PG2A 4X4ZA 5J1SC 1BZDA 1XH3A 4HIHB 2RBLA 1QSFB 4RZKA 4UB0L 5EZJA 1QLEL 3KPOB 4JN1L 4YNYA 4XP9H 1H5BB 5KSAA 1IVLA 5T1KD 2HFFA 5GS0D 1AD0B 1PX8A 4J6RH 4Y9BA 3RWFA 5G5DB 3O2DL 4MDJB 1TKWA 3WN5A 4PR5A 4BQBA 4HPYL 1PY9A 1U3HB 1DFXA 4XBPB 4DETA 4XPBL 5MHSD 1TZHA 3HNSH 5L88H 3G5VA 3B8SA 3LNDA 1O9ZA 2XBZA 2P26A 5ITFB 1J9CT 2NY5C 1RY7B 3CFJB 4P4RA 5EU7C 1M53A 1YEKL 3EXLA 1IGYB 3VI3A 1OP9A 1EHXA 1QX1A 2EIJB 3CNKA 1G7JB 4X7TB 1M1SA 4HMCA 2YC1B 2BCMA 4YFLF 1A7BA 5E6SB 2X4UA 1T4WA 4W9IC 5IV2B 1D5MA 3EO0A 3IM1A 3N0PB 5F9WC 5AW6B 5E2VH 5JOPD 5SWSD 3V0FA 4A2GA 2ADIB 4KPHH 3BZ4A 4LPVA 4OFQA 2E4FA 2DQCH 3DV6A 4R4FH 1S9YA 1OCCB 4X9YA 2AQ3A 1BJ1H 4AG4L 4JRYA 1TPXB 1W80A 3H42H 2XWTA 4YSDA 3MBEA 1JPST 2IIJA 3M1OA 4QOKD 5AYUH 2D03L 4MB4A 3L6FA 3RWDB 3WE6A 1ZXKA 4HJTA 4KTDL 1OSZA 2R51A 4AUYA 3WUWB 1EMTL 3WN6A 4FFYA 1J8HB 3IS0X 2B3RA 4I18B 4NGHH 2FAUA 1ZT4A 3M88A 4MAUH 5DHDA 4X4XA 1XF2A 4G82A 1U36A 4KY1H 4OFIA 3U36A 2WKLA 3WAJA 3O81A 5J3HC 4NSKB 5FW8A 3ZR5A 3EDDA 3AROA 1CD9B 1GKOA 3BIKB 5FKPA 3QO0B 5FS5A 2BRRL 3B9KD 2DKMA 5FYJE 1J11A 1I8IA 1JZ6A 4ZTPL 1GSKA 1J8KA 4FERA 4F2MA 2ZCKL 5DYOB 4HALA 4AYFA 5GRXG 5FR3A 3HVDA 2FR4B 1QI5A 3HE6D 3PV7A 3QJZA 1IL1A 4NZUL 4N85A 4E36A 1A7RH 2V5RA 4ZMPA 5I76A 2DLHA 4AVIA 3FO0L 3VI4F 3WFCL 4K7PY 5IQMA 3LX9A 4MS8D 3HNVH 2VYRE 2VR4A 4G43B 2XNAA 3CUPB 5J11C 4NQVA 4TLUA 3QUYC 3RZWA 1KC5L 4FQHB 2X9YA 4I9WE 4DJMA 3QJVB 5KSBA 3BH9A 2YOAA 3MX0A 4OVVA 4D9QE 4X6DF 5J1AA 1WEJH 3UH8A 3K5SA 1MCDA 1G6RL 3WIFA 1F1GA 3NVQA 5IGXH 3VD4A 4K23H 5HI5D 1VFAA 4D0CB 2VWEC 3DSNA 4CMHB 2AZAA 1RZKC 3E6HA 1A3RL 2XX0A 3EO1A 3NJKA 1FYTD 2YKKA 4NBXB 3SPVB 5ID1A 2Q8AH 5C08E 1EH9A 4LMQE 1HX0A 4JCMA 4G8IB 4ZD3L 5HHQA 1SMAA 5H35A 3B7TA 3HN8A 4MX7A 4CVWA 3KWUA 1X4ZA 3OV6A 4GT0A 3ZTJG 1JVLA 1S7VA 1MRDL 4ZYKA 1JK8A 5KG9B 3KNBA 2P24B 2G3NA 2YGVA 1JWUA 2WN2A 4QYOB 2VSMB 4HLZG 3DVNA 5TGBA 3DX1A 1E6OH 4BK5C 4FQLH 1E4WH 4IKIA 1BQRA 5C0FA 2J73A 1GZPB 1CGSH 4WJG3 3C5ZC 4BE5A 5D7JC 2ED7A 3D39A 3I6GA 3QUMA 4P59L 1KOAA 4G8AC 3QUMH 2CKBL 1EUTA 3LEYH 4HUXB 2XV6B 4NJ9H 3ZE0E 3OPZL 3PGDA 4P3CH 1XIWB 4LEXH 1DVFD 1BVLA 1DJHA 5SWZB 4K9EC 3P02A 1IU1A 2WJ7A 3QIBD 1AS8A 5FO8B 3TBBA 4YQXL 2EIDA 2J8OA 1DQQB 1P5UB 2BIHA 3D85B 2WLLA 4ODHL 12E8H 4L3ED 1IGTA 3CN0A 3GJFK 3K6SA 1OGPA 1A6WH 1IGCH 2XIIA 4MB3A 4R5VA 5FYKE 1ZLUK 4P5MA 2DPKA 3H54A 4OGXL 2CRMA 2CGZA 5L2KB 5DRZA 3ZL2A 2DTSA 3TL5A 2J8UB 1IGJA 2V2XB 1DSFL 1QSZA 1FNGA 2G5BA 3GO1H 5FX3A 4Y4FB 4F9LC 4IBLT 4QRBA 1P2CA 4PJ5A 3KL3A 4HWNA 3VD1A 4O02L 5INCB 5DZVA 1J5HA 3G08A 5IBTH 1ZHBA 4P2OA 1U95B 2E27L 1IAOB 4FQJH 4UIMB 3S4SB 3ZHNA 1FZMA 4AGMA 5KAQG 2Z3FA 1JRHL 5DF0A 8FABA 1XGTB 4UZUA 4KRNA 1WAEA 2IXQB 5J89A 4LHUG 5F7DB 5B1CA 2R0LH 4DGYL 2CLRA 1Q0EA 3CCHB 4AQOA 1N0LA 4PRNB 1G7LB 1CXKA 2VLRA 1UT9A 4R90H 3TVMD 3Q2NA 4F3FA 5C0BB 1Z0MA 2X4OA 4LSTL 3DROA 5CM1A 1R5IB 1WICA 4PAZA 3IFLL 2E86A 4NYLB 3E1F1 2LHAA 4LK4A 3ZX1A 5ICYB 5CJXA 2FBRA 2BCKB 3NOIA 3QDMB 3BPLB 5T1KA 1GTFA 1HKLH 5GS0H 4FA8A 4KXDA 3ZDXE 5SWQB 4CA4A 3MJ9L 2EKSB 5ISZE 1HESA 1YECH 4AENB 1K9TA 2HXAA 3ZOAA 2BK8A 2R1XA 4RA3A 1I9JH 1OO2A 4TSCL 3QQDA 3KWTA 5C09B 4X5RA 1ED3A 1Z3GL 3K80A 2IAMB 3QCVL 4RDQF 4M3KB 5CN3A 4AYID 3TT1H 1EEZB 5DMJB 4IIQA 5SWSA 3GSUB 4X99B 4MJ5A 2O5XH 4A55A 3QRFM 3FCGA 5DMGC 3VXMB 4WFHD 4XMTA 5JOFA 1MI5E 3RFZB 3RZCB 4OLXL 4C58B 4QOKA 1LD9A 2HT2C 3BLPX 4DTGH 1QABA 4JO3L 4F80A 1R3KA 4W9KC 5LLIC 3JXAA 3KG5A 2E7LA 1FPTH 3ILPA 3E0GA 2VN6A 3GZKA 3S3SA 5BW7A 3T0BA 4ZMXA 3I6LE 1JGEA 4IHOB 4YWGH 1ZVSA 1SJHA 4X8JA 4PJCE 2V5SA 3VCLB 3B9KA 3J27A 1WE5A 2WWOA 4HZLB 3DPBB 3VAEA 3EZ8A 2NZ9C 1ZIAA 3O9WA 4N90E 4XTRC 4OM1L 5LXGL 1E3ZA 1G94A 4XB7A 1JZ4A 2NW2B 5AW1B 2HKHH 3NEXA 4GRWH 5E4AA 5EU4B 4E9YA 3HE6A 4B9GA 3T6ZA 4NAQA 3AS2A 4P5TC 1AY1H 3FB8B 1U8NA 1NUNB 5F70A 1JWMA 3GJFH 4EAEA 1T66C 1TFHA 1KIUA 1ZLUH 4Q9RH 2WN3A 1S9WB 2AEOA 2MH4A 3WEAA 1LVEA 1VFMA 5I1LB 4ZFZA 2IEPA 4WU7B 4WUUB 3KPRE 1FO0L 4DKEL 3DDFA 3QUXD 3U25A 1H9DA 1NFDE 3UZQB 3VXNA 3EYSL 2V3EA 3P11L 1DN0B 4OCYH 3UPCA 2EDOA 5A7EA 3KPLB 3QO1A 1C5BL 2WQSA 3PYCA 2FIKB 4JFEE 2XYBA 4H0IA 3R1GL 3QUHA 2QR0B 1EEYA 1FYTA 1YN7B 4P2CG 3BH4A 2B1AL 1PVHA 4C83A 2NY6C 2DZEA 3IMBA 4LF3B 5IVNA 3P54A 5DEGB 1UOWA 3O3DA 3ULUD 2JKXA 3FFOA 4MNGB 1JXKA 1RMFH 1Q72H 1JP5A 2BVOA 2JTYA 4DGVH 3CLFH 1KJVA 4AEEA 2F5AH 2VW6A 4ZTEA 4EI5B 3D1MC 2BVQA 5K9QI 3S3DB 1KCBA 2LU4A 3BPOB 5L4JA 3QZNA 3N40P 5DSCB 1B0WA 4Y5VA 3U9UB 4PJIB 4IKJA 3P0YH 3RIAK 2AK1H 1U4EA 1EHAA 1ADQA 4JPKH 3CZLA 1ADQH 3WY2A 1SJEB 4IBWA 4LASH 5HD8C 1GW0A 2NXYD 1DVFA 5CEZD 3SCMD 4PRAB 2B0SL 4E0RA 3SDDB 4JFPA 3QIBA 4LBEB 3KM1A 2HFGL 2IWFA 4B97A 1UC6A 4X5WA 3ETTA 1BSIA 4L3EA 4PB0L 1RH8A 2V3DA 4X6CF 5JPNA 2H0PA 3OHXC 3F62A 4KK6D 4FZEH 1A3QA 3IFNL 5CO1A 1XCTB 4FHBD 4UT6L 4M7LL 4W9FC 3ZHLA 2PW1A 2FSDA 4XR8C 3QPKA 1SHWA 4DVRH 5F1IB 3X13A 3D34A 4X9IA 1KPVB 4FFVC 2DTML 3CSPA 4ZAKB 5GGRY 1NH6A 1Z6JT 3MMEB 2O5YL 2BC4A 3HUJB 3IETB 3ZDYF 2BIPA 3HLAB 3W11C 4K3HA 4HGMA 3TBYB 1G7IB 4PV9A 2HFEA 1NJ9A 1IM3D 1OF2A 3U0TB 5FGBC 3ZE2E 3RDJA 4HOZA 1PNDA 5I8KH 3EOBB 4BH8A 5I5JA 2YAHA 4TV3A 2G2NA 3VWKC 1G9MC 4JZOB 4AEHH 2XBTA 3QNZA 3L3JB 1I7RA 2BJML 3MODL 2NY2D 5IHWA 2ZZUT 4OSUL 3TVMA 3UO1H 3VD5A 1A6VH 3H85A 2O4EA 3MACH 4FYTA 1GPOL 4PJXE 4TULL 3AY4A 5J7CC 1MFBH 4DW2H 2X4PB 2WZ5A 1TQBB 4OKDA 1UOKA 4XCNB 1N68A 3FKUS 2PWEA 4FQ2H 4LPCA 4YOKA 3RVWD 3WLWC 5T1JA 1I9EA 1TQUA 5CHNA 1J8RA 1LILA 3F01A 3JTBA 4RRPG 1KYDA 5GS1C 4OY9A 5HDWA 5DD6B 4XP5H 2HH0H 1SXAA 5I1KL 4WSGA 1IBHA 5IMMB 2ZKYA 4UINH 3BUTA 2CAKA 4YDIH 2DN7A 3GXUB 4J8RB 2BHZA 3F8UB 3QIUD 1EDYA 1QLFA 3T65A 4OF3A 2GTQA 5DEFB 4NWUH 4YE4L 3TT3L 4ZFGH 4EN2A 1ZANL 1L9NA 1EAOA 4RFOL 1AMXA 4JFZL 3QORC 2L7QA 1B88A 1N5YL 3B7RL 4MDIA 1RSFA 1M42A 5KYUB 1PZ3A 4JDEA 2FO4B 4KHTH 4UMSA 4WQOA 2R4SH 1GJWA 4KUCF 4ZW8A 2WXHA 5I16A 1UZ6E 2Z8VC 3O6FD 4JFFE 4PJEA 3CVIH 4OD3L 3E9TA 5EO1B 2CLZA 1CFNB 5JOEA 3QR2A 1FVCB 5DO2C 4N6QA 4S0SD 3EYOA 2ICWJ 1YAZA 2MWCA 3PFUA 1E4KC 2CDFB 1IT9L 4DZ8B 4U6VL 4M7ZC 2FHFA 1DQLL 3MRCB 3OLEA 2J12B 3E1ZA 3SY0B 2OJZL 2NSXA 5IMLB 2X1OA 4G1EB 1XZ0A 1ET8A 3EYVB 5CINL 3IRPX 4YPGB 2VZTA 1J0IA 3AXLB 3QARA 2OXGB 2FCBA 1UASA 1PG7X 1AI1H 1ZHNA 1F4WH 1MEXH 3IGAA 3GSQA 4MMZB 4ZO6A 3EBGA 2YK1L 4KNUA 4GUPA 5I1JH 2K3HA 1TLKA 2WUCL 5HYJA 3KVDD 2JI3A 5J4MA 3IJYA 2GAZA 3MA9L 2AJXH 2WQRA 5DWPA 4AQ8C 2OMUB 1KB9K 2KT6A 3QUXA 2H6OA 2C9UA 2DBLL 3GMQA 3W39A 1QMUA 5KYWA 1RK1B 1SDDA 1FL6B 4AY0A 3VXUE 5ACZB 3UZEC 1C5DA 3CHXA 5C08B 4KI5C 5KVFH 1WZ1L 1V7NL 3RVUD 4JY4A 2WLMA 3HC4H 1NEUA 5DUJA 4AMWA 3ULUH 3CFKB 3K6OA 1XB3A 2IOOA 2Z92A 4WHTA 3U7YH 3M7OA 4Y16D 1JXDA 3O11A 1I1FB 1ZV9A 5KANI 3HHMA 4N8UA 5HTSA 5J57B 5ICZB 1NFIA 2AV1B 1HXYA 3DJZA 5IJKA 1O6SA 3EJSA 4NFDA 5GHWL 3QCUH 1BA9A 2YD1A 4YBLB 5D2NE 3RPBA 5FYLD 3H9YA 3ZE0B 5EPMB 2Y2WA 1HYSC 1BQSA 4NQCD 4TLSA 4QNPE 1N3NB 1QRNB 5DRXA 3SCMA 4PG2A 5CEZH 4XXDA 2HG0A 4L0YA 2HVKA 1XF5A 2CJ3A 5HVFB 5I1EL 2NXZB 2VDMB 2VDKL 4L9LB 1OB1A 4NN5C 1BZ7A 4Z7VE 3G3LA 3C87A 3PL6D 1MVUB 1LQSR 1CL7L 3MZGB 4M62H 3K6FA 2DEWX 3O2VH 4AT6A 1AIZA 1E28A 4JG1H 1LEKB 4HBCL 3BE1H 3B5TA 2CA4A 2LTQB 3BKCL 2A6KA 3UC0L 4JS7A 3ZZ1A 4O2EB 3DUSA 3C60D 5D71H 2DQGL 1T4KA 5JXED 1DVQA 1MF2L 1A7NL 1IM3A 5DFWH 4GMSH 2ZG1A 3RWJA 1RIHH 4GW4A 3WFEH 2OMVA 2YS4A 5F44A 5GISH 5EZLB 4KKPA 2Z4QA 3TEYA 2DLGA 4K8RH 5TH2B 2F58H 4HLJA 4NRZB 3BUYB 3NYKA 4OLYL 2XG4A 5DZPA 3OKKB 4WEBL 3TNMA 1UZ8B 2WSPA 3WFHA 5JW3L 3BLBA 3B83A 3HAEA 5HYSA 5CXPA 3DRTB 4BSWB 4CAGA 1JZIA 2R4RL 5CP7B 2HLEB 4I87A 4FYQA 4RGMC 3GRGA 4GBXD 1HINL 4FQXD 1AO7E 3ZDXB 2P43B 4PJ7A 1BD2D 1USZA 2ROXA 1NEZA 2VM4A 3J07A 4AW4A 3TGXA 2YWZA 5J9PB 3ESVF 2EINB 1RZQA 4FKEA 1N0XH 4J3XA 4A2EA 3ZIMA 4CBPA 5ETUA 4RQQB 1PY4A 4KZEL 5K9QG 3FSVA 3QIUA 1J8SA 4FXGA 1FH5L 2QVIA 1BFTA 4OZ4A 3OZ9H 2ZCLL 3LPGA 4KFZC 4X50A 3TBWB 2R83A 2ZIDA 2I32A 3DHPA 4PJHA 3TTYA 4WKZB 2JB5H 1KJ3H 1MHHA 3PWLA 5DTFA 1L4IA 1MI5B 3NJFA 2CHNA 4ZOEA 4KNTA 1U8PA 2DICA 5J6GA 1JUFB 1A3LL 4NKIL 3DOHA 3O6FA 1HL9A 4KK8C 3CIAA 4PJFA 3VMPA 3V4UL 4UDUB 4Z95H 3U4AA 4IBZA 3UTPD 2HT4C 1HSBA 1KCVL 2APBA 3PXLA 2GTZB 1F6LL 4PW3A 2F54E 2CPUA 1VCBC 4YHPA 2AEQH 3P9WB 1W0WA 1JNLL 1SM3H 4HC1A 4ZMNA 1B3JA 2B3IA 1FDLL 2Q3ZA 2MCAA 3B7YA 5C2BL 2FZ3A 1T21A 2RD0A 2EDLA 3BHBB 1MJ7H 3EHBB 1HAUA 3G04A 3MRDB 1YY9D 4X7CC 3QXUA 5D7HA 5CSBA 2JJVA 2PO6C 1AD9A 2CQVA 4YE0A 4HUUA 1G0YR 3PNWB 1MHPH 3CBKB 1SHSA 3L81A 1A4CA 3GMLA 2BDNL 5DR5H 2VR8A 1MIML 1P0SE 2VDNL 3BUBA 3FH7A 5HDQH 2R56L 2RQEA 4M5ZL 1MCOL 1X5HA 3BP4A 3O6ML 5EOTB 3RWHA 1I8KB 3TCLB 1IJNA 2APTA 2Y36L 3P9MA 4KJWD 1PTZA 5E70A 4G6MH 4XMXA 1A4JA 4DP5X 3KPRB 3CVHA 1BX2A 3BVTA 3S8FB 1NFDB 3CVHH 2C5DC 5FDYA 2OMTA 3QXAB 2K7QA 2Y07L 1UWGL 4JHZA 1BFOA 4CUCA 5KSVA 2DB8A 4JG0L 1JNNH 1OE2A 5EN2A 2FJGA 4JFEB 4YSAA 5EEWA 4N8CH 1F3DJ 2W94A 1XEUA 3FQNA 4RAVB 1AGCB 1MFEL 1AYOA 3ARBD 3FU6A 4MD0B 1EGJL 2AJYL 1KTDA 3M07A 2XVBA 3AQYA 4M6OL 5JZ7D 1KF9B 1ETZB 4KVCH 4LRNH 1QQDB 1N8OE 2XETA 4DZBA 3L9YA 1T89C 1K72A 3DJSA 3SYPA 3FUJA 3G6JF 4PU2A 3CZGA 5GRZA 4Q9QL 1V8HA 2CO2A 4L8DB 1ZVNA 4QXGH 3CN2A 4Y16A 1NMCB 2PXYB 3GBDA 5F88B 4BCZA 5DD5H 3QRBA 3D06A 1YMHA 1JD7A 2OJEB 5HHPB 4M02A 3MNMA 5C3TA 3WFBL 4I89A 5EHFA 2WPGA 1UWEL 1JERA 3C6SA 1FV1B 3IKCB 2C26A 5I74C 4JHWH 3D69B 3UBXA 2PR4L 3B5HA 1IC4H 2APXA 1SJMA 5HJBA 5MEQB 3AREC 5FYLH 4Y1AD 4A7VA 4NQCA 3AWGA 1E5ZA 4B9KC 1KELH 1I85C 5T5NF 2RQ8A 5GRYA 3RDTB 1SRDA 2J43A 2V7NB 3CU1A 2FECL 3VM7A 5A2CA 1M57B 4P2RE 4HQQL 4MJ6B 1A66A 1QHQA 3L5IA 3MJ6A 3KPQA 1Q90A 1XR9A 1PEWA 4G8EB 5F7FA 3GB7B 4L8SA 2OZNA 1UOVA 3ATEA 4LB8A 3BKJH 4HUMB 1UD5A 2AQNA 3PAVA 2L0DA 1ZJBA 4O4YH 4OV6F 1HH9B 1KBPA 3PL6A 5KWYC 2XWDA 1YEKH 3ARDC 1A2YA 1P4LA 5CCKH 1DL7H 5EB9A 4XXWC 2P4AB 2YAMA 4PS4L 2XXCB 3QNYB 3OKMB 1OAUL 3PF2A 1BMGA 4B0MM 4F8PA 1B90A 1YNLH 4TSAL 5EF3A 1T0NA 2WTRA 2NY0C 3C60A 5CSGA 1M1XA 3LD8C 4NUGH 3GGWA 3OKNA 4JKWA 1JGUL 4KK9C 5DHVH 3GZQA 4R3SA 3F04A 4NZRL 3ZT6A 5JXEA 3ZE2B 1SZNA 1ANUA 1KBBA 3PWPE 4WGKA 3NIGF 5B7EA 4B7LA 5AUMB 4LCCA 3WJMB 3RY4A 1T1WA 3OM3B 5C0CD 5J6HA 3FCTA 5F1SA 3KS0H 4U05A 3C6LD 3CPLB 3BPCB 4YZFE 1YQ2A 1U8JB 4KTDH 3I6SA 1XFPA 1XR8A 2WV3A 1U8HB 2AK4D 4TLKA 1ZLVH 5LAPA 2LV4A 2YWYA 4PJXB 4OAWB 4P9HH 4W6YB 1GTNA 4X5QA 3ZYZA 4GKSB 1SHXA 3JWNC 1CZ8H 1NGZB 2V3FA 4JM4L 1X9RA 5EULV 4MQXD 2IG2H 1F3JA 3MOAH 3HBQA 1XF3A 2GJZA 4IOIB 4GG6F 2XG5A 3S98A 4HPOL 3TA3D 4GBXA 3RY5A 2BRRH 1YA5A 2YQ3A 3VX1A 1ZV2A 4FQXA 2ZP8A 4WY7L 1BD2A 43C9B 1RULL 4XNUL 4APQC 2H6UA 4LQFL 5E99L 5ADOL 1NSNL 1JV5B 2ZCKH 3IT8D 1F02I 4L37B 2O61A 2CNYA 1KIPA 1TEYA 3LKQA 3T0ED 4F57L 2PTUA 5B21A 1M71B 4UOQA 1S7QB 3L1OL 5FUOH 2VH5L 3RWCB 4XNMA 1BQ5A 5KANG 4Z0BL 4G11A 3VFUB 1FFOB 2OYKA 3OR6A 3P4NB 1QLEB 3B37A 1Q9WB 1CJYA 1ASQA 5IVZB 5BVPH 2QDWA 4AEIL 3IS1X 2L04A 2IALA 4CADB 1FN4A 5JORB 4O9HH 3E8VA 1CXLA 2FRGP 2BZDA 2XT1B 2DRUA 4AWJC 3CV5A 3N1PC 2NR6D 3WKML 4HXBH 2V2TB 1PG7W 4JFFB 2VO5A 4M1DH 3VVVA 4XMLH 4XXCC 1O6TA 1KN4H 3SE8H 1A3RH 4M48H 5E94B 3RG1C 4P5RA 4F7EA 4ZDHA 5I30L 1UCBL 4UAOB 5AAMA 3EYUL 3GXPA 2WXMA 1CE1H 1AC6A 1H0DB 2P8MB 4EZKA 3EOAB 3WS6A 2FEEL 1EJOL 4DN3H 4C56D 1CXFA 1BXUA 5TQ0H 2PCFA 1SEQH 3A21A 4XMPL 2Q5BA 3IJHB 1FLRH 5KVGL 1SXCA 4B5ZA 5H4ZA 3K2IA 4IBQA 1QSFD 3IJSB 5D5MA 1I7ZA 5E4EB 4ZQTA 4K7PH 1SLXA 3ULVL 5T1MA 2VRKA 3EJYC 2ZWNA 2CBPA 2E59A 2YGPA 1YNTB 4FXKC 1XB8A 2BP8A 5LBSL 4F7MA 4ELMA 3ATBA 3ZKXC 4JRWA 5IHHA 4X9HA 1HWGB 4K3EL 1PGRB 1EXHA 4S1DC 2VLLA 1IILE 3S37L 1JPTL 5DS8B 2YPVA 1NOAA 3VD0A 4QPEA 2YPVH 3SE3A 2A9MH 5JPMC 4XAWL 3BI9X 3ZKNC 1R24B 5HHNB 5HYJD 1TNNA 2MKLC 4UV4H 1J1PH 3H3PL 3APDA 5CJOH 1XF4B 4YLBA 3N9GL 2OFQA 3NBNA 3KLAA 1KB5L 3FO9B 3MUUA 2GKIA 3VXUB 4PVLA 4Y2OB 1ETB1 1LO5A 3ARBA 4JNXA 4NC1C 2VZOA 1G43A 4KOBA 5BJTA 1WS8A 2CBTA 2G75A 2EXWC 3AFLA 3B4NA 4YUEL 2PP8A 2VAJA 1MCKA 4DPRA 4KXZH 4AYSA 2UWEF 3CDCA 3DVGA 2VIRA 1J8HD 4OLWH 4AQ1C 32C2A 3DRQB 4A2MA 2GYSA 1DQDL 1G6RB 4TXVB 4OV5B 3OAUL 2EH8H 2JSFA 1M7IB 3DI3B 5D2NB 3QEUA 5A2LH 4B5EA 4HJGB 3DWTA 4M7JL 5CIPA 2WXJA 4F7CB 1F6FB 1KBVA 2DDQH 3LY6A 5CIPH 1G4MA 5E0FA 2E0PA 3AG4B 4Y1AA 4GG8B 4ZFFB 4G42A 1IEAB 3LIUA 3UJTL 3H7BB 2BERA 3WBDA 4OZHF 3VH8G 1SBSH 5PCYA 3ULAB 4GFXA 2ESVE 1T7ZA 4U1JB 3LIZL 3QEQE 3QUKB 5D2LA 5DUMH 4D3CL 5DLMH 3HFFA 3H9SA 4QGTA 1R17A 4CILA 2CUMA 2OMXA 2F53D 3UYOD 5D70L 1QLRA 2V9QA 5BUPA 4RMBA 3PHOA 2E9WA 1YCSA 2Q2LA 4FHJA 1JHLL 1HHKA 4BSVA 5IIEB 3WAKA 2W0FB 2YRZA 3VD3A 1QPPA 3VYNA 4KRMB 1A1MA 1UB6A 1MRFL 4M5YL 3TNNA 5C0CA 2DMCA 3BD5A 4Q2ZA 5I1DB 1K85A 3MGOA 2BSTA 2NQCA 3C6LA 3QP3A 4KJPD 3ZQ9A 5JNYA 1SDYA 1MJJA 4L29A 3BAEL 5ABDE 4KAQL 3II1A 3RUGB 2AK4A 3WXWH 2OZ4L 2AQPA 4YR6A 3N1FC 3HE7C 1DQJB 5KBDA 5ICXA 3DSFL 2QGCA 4HZ1A 5TFSL 1JIBA 4O02B 3GHBL 1OY3B 3HMXL 4KQ4L 3T1FA 3LEVH 3ZMNA 4EE2A 1BWWA 3QG6B 5BV7C 3TFKD 3TA3A 2YMTA 1AO7B 4XOAA 3VFRA 3PV6B 4O2CA 1PYWB 4FQPA 4Y9FA 3QQ4A 1MLCB 4OM1H 4KKQA 5SWZD 5I6XB 4LLUA 2V17L 1ZHLA 1DQKA 1EJ6A 2G5RA 2X6CA 3CSGA 4HISA 3T0EA 3FAXA 1LO2L 5DJXA 5EU3B 1ZT7B 1DJIA 5C0JB 3KMDA 1QFWM 5C7XH 5I8OH 1F4XL 1BBDL 3QDAA 3ZTCC 3SDYH 1MFDH 1PBYA 1BECA 3ZRFC 1HEZB 2OR7A 1GSMA 3KVPA 3E3QC 3FUDA 1ACCA 4YHYC 2L4OA 2H32A 2PTTB 5A2AA 5L2KD 4KHXL 3MLSL 4UUJA 5MEOA 4NNXA 3ARUA 4MNQA 3Q0HA 2CO1A 2JLLA 1R5WA 2GK2A 1MFNA 3OLDA 3RBGA 1S5HA 1D5RA 2EAEA 2NR6A 4G6KL 4JO1H 4WFED 1JNHA 5C0NC 1DJWA 2AF2A 2I60L 1GIGH 2QZ5A 3QRLA 1SMOA 5ECJE 5MI0C 3NACL 3Q6FA 3D25A 3ZZQA 3JV6B 2A74A 3MRIB 4MA7L 2F54B 5CCGE 4IBSA 3HS0B 1NDMA 2ZXGA 1WSST 4OZGF 2RA1A 4LARL 1FORL 5TDNB 4W1TA 2HKAA 1KNOA 1T5WB 2YRPA 3MUJA 4H0LC 4HIXH 4OCSH 4C56A 3SBRA 4LCWD 3A67L 1VACA 4I9XA 4BQ6A 1PZBA 3HHSB 3WL9B 1QSFA 1JZFA 3HRZC 4JQXA 2AXHA 4QCIB 4AM0B 4D94A 1H5BA 3NSJA 4RA0C 3H2WA 2HYMA 1AD0A 1OGSA 1HCZA 4HULB 1VPOL 2W0KA 4MDJA 4P57B 3H9ZA 4Q0XH 3LS5L 5JMOC 2C9RA 4Q97A 3TJEL 4LOVA 1MWAA 3CDGB 4HOMA 3TX4A 1MWAH 3HC3H 3FN0L 2PPCA 1NINA 2DIBA 2HTKC 2UZYA 1R3LB 4U3SA 1KTLA 1G7JA 2IAMD 3A6BH 3AQXA 4X7TA 3F3HA 4OLZL 2Y72A 4KV5F 1R3IH 4PRBB 2AI0L 2H3XC 4WWKB 1KN2L 1WTGT 4MJ4A 3VFWB 1JPGB 5DC4B 4YGAB 4ZUSB 4F20A 2L7EA 4OGZA 3V4PL 2ADIA 4M7LH 4HPHA 1Q1JL 2DD8L 3AS0A 3IYLW 3WO3B 1B4TA 2YPKB 4Y5XB 1UM6H 3U9PL 4KDVA 4MB5A 5B3SB 5TDPB 5KVMC 4NUJB 2XA8L 4WFGE 3RZCD 3QXTA 3S8GB 1FE8H 3SHSA 1OAJA 1DP0A 2ZJSL 3H0TB 5AD0B 5IT2L 3S3CB 4N8VG 3KHQA 2R7EB 3WUWA 3LDBC 5E8OB 3QJHB 1J8HA 2Y9RT 1FO0B 3ZE1B 4HWZB 2H8PA 1NWOA 4W93A 5HHXH 3FULA 3FQTA 2EEDA 4Z78B 5I8CB 3ZVVA 4NZTH 1RJYB 2Y1ZA 4MHHI 3SDXE 4EKJA 3QXDB 2IWEA 2Q2EB 3BIKA 4XC3H 4Z18A 3QG7L 4ONHA 2XN0A 3QO0A 1EANA 1UYWH 3O2WH 1E5CA 2HVJB 4FJYA 4ELKB 4UU9A 4K9EL 2O93L 3ARWA 3QYNA 4GQ9L 4QRUB 1V27A 3NCMA 1YEEL 3MRNB 4TRPL 1HHGB 1U8CB 2BINA 2EDNA 4G71B 4JG9A 3HAEG 3MCYA 5HYSG 4PP1C 4FEIA 4P2RB 1WWCA 3EYFB 1RHFA 2G2RA 2JV6A 3I02B 3IPEA 1AP2A 2NUTA 4GKLA 1A65A 5TK4A 2XWJB 4MXQD 1T0MB 3DIFB 3OAZH 1KTCA 4NP4L 3WIHA 4Y9CA 1WZAA 3CUPA 4LSRL 3WIHH 2IV9A 3U4KA 5GQBA 2O5ZL 3QDHA 1TPXC 1CFTA 2F53A 2YGQA 4Z7WE 5I18H 1M6OB 4KWUA 3GXMA 3QI9C 4YDMA 2D9QB 1ZANH 2CJUH 1W0YT 1QNZH 1A47A 1LNUB 3ZHDA 5CD5C 4XN1A 4J3WA 4DOHE 4H40A 5F7YC 3J7HA 1QW9A 4OCRL 4X80L 2K8QA 3SPVA 3S3PA 1UH3A 4PGDA 1QOKA 4XP6H 1NDTA 4WV1A 5EIQA 1F2QA 1JVOA 2RCSH 4G8IA 3V5KA 4JFQA 3CFCL 3SJVE 2CHDA 3AG3B 1PZCA 1MQKL 3NPZB 3QZWA 3AY2A 4BKSC 1GYVA 1GMIA 2F68X 1IAIM 2QVKA 4QYOA 4BFFA 1U8KB 1BQHA 4PJ9C 3SDAC 4N20A 3GTNA 5AKRA 1DBJL 2QSCH 2F1BA 5E2WL 1Y6NR 5F6IC 5GRUH 3TV3H 2J1XA 1GS8A 2UZIL 5JW4Q 4ODXB 3AG2B 4ZZFA 1HK6A 3CLWA 1XIWA 5T3XD 2KLTA 1INEH 3IDIA 5SWZA 3NFNB 1RHHA 3T2NH 5LNDA 2RACA 3HI5L 5FO8A 2XPZA 1MOEA 1RUML 1KGUA 4MD4A 2EYSB 3WKNA 2HFTA 3GUTA 3UCQA 1RFDH 3WN5C 3OQRA 2A3TA 4JFVA 1VADB 5F6HI 2G2PA 5L2KA 5DMIL 3MV9D 5FC9A 2J8UA 4RRPM 1D6VL 2V2XA 4OUUA 1HT6A 5GZND 1IRAY 4OLVH 2DQMA 4I0PB 3U79A 4AGOA 3DV4B 4WK2B 4HEPG 4KJQD 4HF5H 5INCA 4JM0A 1O7DC 4AH2B 5GGRB 2JE8A 2CE6A 3S4SA 2HUHA 5AL8A 3LZRA 1IQWH 1XGTA 3ML8A 2WZAA 2J4WH 1K3ZA 2IXQA 3FU7B 1RIVH 5IUCA 3LN5B 4HD5A 5DUBB 2EDTA 3PDDA 3MBEC 1TF4A 1J88A 3C09B 1TYEB 5D7IE 4PRNA 1G7LA 4MFHA 2C9SA 4XNXL 4LCWA 2JTDA 2JKIS 1YEGL 4AXWA 1DJSA 1R5IA 1CXIA 2BSRA 2X4QB 2I5YL 2VDPH 4RVBA 3OJVC 4HCIA 1DO5A 4NYLA 4TM9A 4PWHA 5DXWA 4H88H 4ESKA 2R8SL 3FU9A 4I3GA 3QSKB 2ID5A 4KTEH 4XP4L 2V0AA 2ZG3A 2B39A 3VG0L 2J1YA 4G80B 2VXVH 1BAGA 2A6JA 3CFQA 2EKSA 4MJID 2DH2A 5EC2A 4ODVL 2WGNB 1FRGH 2BOCB 1P4IH 2CGRL 3AW5A 4HJSA 3AU1A 4YHMH 1MFCL 1AVAA 4CVUA 5I1EH 3ESOA 2WW8A 4U31A 3SOBL 4GMTH 2FSEB 2A1WL 4IIZA 2IAMA 3ZKMC 1EJFA 4WI0B 2QADC 3A4DA 4FFWD 1MCEA 1EEZA 4HMDA 2Q9OA 3B3IB 1VFUA 4TNVK 4DPBX 4X99A 1ULVA 2YJLA 4FJ6A 4N68A 4AJVA 3FT3B 1C16B 4WO0A 2QHRL 1E8YA 1N59B 2VR3A 4IW4C 4Q4EA 5E2TH 3IVKA 2CLVA 5C0AE 3RZCA 3IJEA 5E6YA 1UA6H 4S1QH 3TONA 4NWTH 1TU2B 3O3UN 3OB0K 5DDHB 2HLAA 1Z9SA 4HD9A 4JFYB 3EBAA 2YEZB 3GRWA 2ZKHH 4IJTA 1TQSA 3VFTB 5I73B 3BMWA 1H3TA 2WLNA 3T2PA 2ITCA 4PRID 2LU3A 4Y4HB 4IHOA 4ZX4A 3GI9H 2E7DA 1WIOA 4ANXA 4LKCB 3ULSA 1WHOA 1DBAL 5C0IA 3BUQA 3L9EA 1C12B 4NO0B 4DN4H 3PDOB 4QLRA 2Z31B 1Z5LB 4FFZL 4K3DL 3U30B 4A38A 3IFPB 3REVB 2QV2A 1EHLL 4KMLB 4WVRA 1IZKA 4HZLA 3DPBA 2ENYA 2OBGA 2Y3NA 3BEWB 4M1CD 2Z65C 4JJOA 2GJ6E 1EEUA 4W70A 3UACA 2CUHA 2EE3A 4HH9A 3CX5J 3CXHK 1KXQA 3TO2B 5AB9A 3QEQB 1DSYA 4KRPB 3LRGA 4QRRE 3FB8A 1LMKA 1HXMB 1PKQE 1MJUH 4U1HA 4KXAA 3MPCA 1MW1A 4MMXB 2H9GA 4HWBL 3SBPA 3SGKC 5I1LA 3RFZC 2EO7A 4WU7A 4D9QD 2G9KA 4QTIL 1ZA3A 4PCKA 3TZVD 1KTRL 3HC0B 4UV7H 3RGVB 3WEXB 5C07D 3KPLA 5IB3A 4JK0D 2FIKA 2EDXA 3L3KB 5D7SL 3CVCA 2V37A 2QR0A 1QA9B 1X5FA 5TE7L 2QLVB 1I53A 2VDKB 2XTJD 3B56A 3FSZA 4LF3A 4RFEB 5DEGA 2YA2A 3BW9A 3D4GA 1ICTA 1AR2A 4MYWB 5FUZH 4A66A 3LZLA 5GRJL 5CUSH 5F7EH 4OCWH 1DBKH 1IQDA 1NIFA 4P3DB 4R4BB 4U1KB 1W72L 2I85A 1YUHB 4HUVB 4X98A 1ZGLP 3O4OC 3VGEA 1ZLEA 2FK9A 4KU1A 2IPTL 1MCNA 1ZJAA 3H9HA 1K6QL 2GBAA 4PJIA 4JE4B 4PY7A 1D5XA 5DLLA 3NIDF 5HPMB 2VQ4A 3FFDB 4OQ1A 3FHEA 1WC7B 1ZSDA 4NKOB 3TYGH 2D0FA 2JJWA 3RE0A 5K69A 4PQXA 1BZ8A 3L3GB 1B0IA 5EEZA 3UYPA 1SN2A 3HS8A 1TJIH 1XVSA 4YIQB 1EBAA 1AXIB 2F18A 3BVDB 4H8UA 5GS0C 3FOLB 4KXCA 1FNSH 4JJ5B 1GOFA 2P47B 2D7MA 4CC1A 2OXHB 3O6MH 5F7AA 3T2QA 1T03L 1G9HA 2Y36H 5K9KB 4XCEB 3HCVB 3NABH 2NY7H 1XCTA 4QY8A 3GQFA 4BELD 2AABL 4MHHG 3MV9A 5GZNA 3SGJC 4Y9GA 4MD5B 3P4OB 5KW9L 4YDKL 5EF2A 4PD4K 3S36X 1HYRC 5FO7B 3LTVA 1E5AA 1KPVA 1DLFL 2ADGB 2IDCA 3BXNA 5I1GH 1WAAF 1M3JA 3C8DA 5EU7E 4EI5C 3GLAA 1KCRH 3HLKA 2BIMA 3OB0H 5ID0B 1FA4A 5IMOB 3II3A 1ZPLA 3U0TA 1I1AB 2ZSWB 3ARFC 3E7JA 4Y19E 2AJYH 2N56A 3EH3B 2JFCA 1MPAH 2NCMA 3EOBA 1JYNA 1RZ8B 3FONB 4JZOA 5LQBL 2ZUQB 1B9ZA 2KKQA 4MBRA 5CWSB 1ESOA 5DC9B 4KK5D 3MUGB 4E41D 4QHUA 1FGNH 1NQBA 1HIML 5T5FH 5DJCB 3WTYA 2IH3A 1HHIB 3ARRA 2WQXA 3EYQC 1N6QL 3SDDC 3LMJH 4XCNA 2K78A 3ABZA 4LLWB 5CZVL 4Z7NE 4HK0B 4OR1A 4BH7A 3QA3A 2OJ1A 3BKMH 3PFQA 5CGYD 2GIYA 4RISH 3TA4D 3HPJB 3NJNA 5ISZD 3HHRB 2B4CH 4MJIA 3I9GL 4JKPH 5DD6A 5GS3A 5BZWA 5IG7A 4JL2A 5I0ZA 4GPVA 3QBTB 3RU8H 1D5ZB 1TVHB 1UWYA 4KMQA 3S9DB 5I19L 1DZBA 3BP7A 1MY5A 4ZSOE 4OT1H 4AC2A 5AVVB 3GT6A 5H37G 2HX9A 2HPOA 1L7IH 1M2VB 2IOIA 1E4XL 1NKRA 1YPZF 1U8IB 2WXRA 2C9PA 4YMPA 1UKSA 4MXVE 1KDIA 4NT6A 5GJSH 2VDNB 3ZU8A 4KX9A 2HZHA 3BIAX 1BM3H 4DUWA 5E2UL 5IBUB 2YGNA 3RA7H 2DQFB 4P23C 1F4AA 5AG9A 3IBOA 2CMRH 4JFDB 2A9NH 2C4XA 1E3FA 3SDCC 3BN9D 4WJ5A 2ZQKA 4JMNA 3SODB 4JKLA 2NTFA 2ZUYA 2Y0SA 3KM2A 5EO1A 2SEBB 1NM9A 5ANMA 5C0GA 2OYPA 1E27A 2NYKA 4LLQB 3D8MA 4PRIA 2CDFA 1X7SA 1YEFH 2VWEE 1BLNB 3SDXB 3CFBB 4M1GL 2C1OA 3EHBD 4JO4L 1I8LA 2A7BA 1OXYA 1FFTB 1JFQL 3FU8A 4HUCA 4XWGH 2C9VA 1PG7L 1YEDA 3G9VA 4G6FD 5IMLA 4G1EA 1DYZA 3MA7B 4N90D 5DJ0B 2OMZB 4YPGA 1ZGLB 1KY7A 2F08A 3KBEA 2ZF8A 4Y5VC 3AXLA 2JKNA 4GT7A 4HS8H 2OXGA 2VW7A 3L95B 2I27N 4X7EC 4CSSA 1LK3L 2WXOA 4X7SL 2CHXA 1RUKH 4H20H 2CUAA 1BIIA 5E99H 5EWIL 4BGDA 5HP5A 3MRLA 3QDJD 5CBAA 4KKLC 3D50A 4YK4B 1RP9A 4MAYC 4Z7WB 2H1PL 1MCPL 3KPRD 3RJQB 3GLZA 1TG8A 4ELDA 2WQWA 5KS9E 3K1KC 4RMUA 1RZFH 3TZVA 1LM8V 1RI8A 5IEKA 5C07A 5AAWC 1OAKL 1DDHA 2YQGA 3ZZLA 4DOHB 4JFED 4YXKH 1RK1A 3IDGA 5GGUB 3M1BB 1FL6A 3D05A 2AERT 5GSRA 1CK0L 3HI1A 5ACZA 2R27A 2IGTA 1IFGA 1IBYA 1LE9A 3FQXB 3SJVB 4XWOD 2VLJE 1AHWC 4PCYA 4DO5A 2HX8A 4I77L 1KJMA 4BZ1L 3DX8B 1X6LA 1XCWA 4UOW1 1UJ3C 2OSLA 3PRZA 5ICZA 4RGOL 3TM6A 1A02N 2AJVH 3KPSE 3CHQA 3D3VB 1G7MA 3NFPA 3OLIA 4MMZC 4N2FA 1MJ8L 5E7BA 3GXDA 3TVMC 1JGLH 3C8KA 2COQA 4Z7IA 1N5AA 1OM3L 3AY4C 5EPMA 3BAYA 1H15B 3WENA 4IMKC 1UM5L 4W9ZA 2Z7UA 4UTBA 5FHBL 2R1YA 4YSRA 4UTBH 4OW6A 5EZPA 3ZJAA 3AVEA 2JCCF 1J1XL 5CF3A 3LEXA 3BCFA 5AWNH 5I75B 4NI3A 5DQJA 4YHOL 3UPRB 2CBMA 4J3TA 2WC7A 2XTSA 3RVXC 2E7BA 3HJEA 4CN4A 3SE6A 1E6JL 2E9BA 2IQAB 1KGJA 2CZNA 4X6CE 1MVUA 2YUZA 3VO0A 1IBGL 3N85L 4XE5B 1VLXA 3X17A 1G4RA 1KACB 4Z3FA 3S3BB 5AFAA 1TZGH 4K71B 4MLSA 3X11A 2XWZA 2QKIC 5DK2B 2BH0A 4G7RB 5EOCH 3K6DA 3FZUD 4KZ0A 2W1NA 4M4RB 4NNYA 3K8LA 3HUJF 4ENEC 3BT2L 2DYRB 1A1OB 4Q6KA 3P40A 3QZLA 2N01B 2WNKA 1CPUA 1U3YA 4B53A 3VACA 5DQ9B 2JNZA 4GI6A 5D7IB 3MV11 2XQBL 3LB6D 3RY6A 4E41A 1X7QB 4OFDA 3OLGA 1UZ8A 2BFVL 4HJ1A 2GUYA 4TTDD 4UBDD 1U8MB 3WUWG 3T6XA 3MLVH 3PPEA 3BAJA 1RQ5A 3F12B 3N44B 1LMIA 5L2JB 3HA0A 2AAVA 2NXZC 4U1LA 3ZKQD 3KYNB 5G4OA 3OTTA 4L9LC 4XNYL 5ISZA 4XZ4A 2WIIB 1MRCL 2DQ6A 2H47C 2NT0A 4J1UB 2GW5A 3MROA 5J9PA 4R96A 3UTZB 3V4LA 3CLEL 2G9HB 1D7CA 4H26A 1MVFA 5L9DH 5DJ2A 1N7MH 1Q9KA 3NSCA 2M8XA 4M5TA 3EH1A 3FXIC 5CEYB 4PY8J 2Z91B 4O58L 5EBWB 5F7BA 2KC0A 2ARJB 4IRSD 4K5NA 3V6FB 4UILL 4ZFOB 3RL1B 2WXNA 3LH2L 1RIUH 4PS3A 5C0AB 1T2QH 3FQ4A 3MGTA 1XAKA 4KO6A 5E1AA 4NO3A 4ABQA 1ASPA 2DQUH 2RJMA 3I2CL 3D2TA 5LNGA 2XZQH 2VAAB 3CSBA 3R19A 4EIBA 4LESA 1R34A 2BSSB 4M5YH 4H0HB 1F4HA 1F6AB 3B8YA 4L8CB 1RZJL 1P6WA 1FZOB 4LLDA 5EEVA 2XN9E 4NC0B 2ZT9C 2VB5A 1VESA 1OPGL 3BAEH 3SE4C 4CJ1A 2FUQA 1MWOA 3TYFA 1FFPB 1OSPL 3BHBA 1P9MC 4JPWL 4MRCA 3MLXL 4PJCA 4WJKB 2ZYIA 3CGTA 4YHKH 4JCWA 1KBKA 5GGQH 5I71C 3O6LH 1JPEA 2QZQA 2NNRA 3DSFH 1ZS8B 4LSUL 1TFPA 2NY4B 4W68A 4ZMOA 2GFBA 4O5LH 2GJ6B 1E42A 1KWKA 2D3JA 3DOIA 2V4LA 3FAWA 1PF3A 3MLZH 5T8IA 4Q6IA 4ZPTB 3JQOB 3CZNA 3N40F 3AZUA 1BQHG 5A6LA 5ADPH 2B5IB 3N0AA 1PKOA 2XQYK 2EO9A 4QRRB 5CD3A 2Y7QA 3S8WA 3S34H 1PKQB 1U30A 3SKJH 5TE4L 4ZMZA 3QDJA 4WI2A 1HFUA 3GDCA 4NCC2 4ONFL 5EOTA 4OZFH 3FCBA 5DVKA 4I3SL 3FU0A 2A6DB 5CEXA 2BVEA 3KPRA 3FT1A 1NFDA 2X4SB 2GC7C 1JYWA 3QXAA 3LQAH 1T3FA 4B41A 2PYEE 1DZ0A 3GIVB 1IBFA 5DFTA 1A8ZA 4QHKJ 1G87A 3PP3H 1UT2A 1OTUD 3EAKA 4JFEA 3OR7A 4HAGA 1ORSA 1XBRA 3APFA 4F9PA 1OTTC 3FRUB 4RAVA 4MD0A 3T77A 5ACMA 1KLUB 1M7UA 5K93A 2ED6A 4Y2NA 4X6FB 3U48A 1ETZA 4RIRA 1N70A 1QQDA 3VA6A 3BZEB 4QTFA 3O0RH 5JIDA 1MVYA 2Y06H 2YBRA 1WYJA 3NACH 4L8DA 3WD5L 1XHHA 4G8GE 2W81C 5F88A 3S4SG 3EJZC 1AJ7H 3MUHL 3FSAA 1A4KB 1E90A 1TENA 4JO8A 4W9EC 4AGPA 5HHPA 4DGIH 1JI1A 2VUKA 3QQ3B 4F7PA 3B9EA 4K8RC 2FNWA 1JHTA 2I24N 3KGTA 1FV1A 3VWJB 2F15A 1PD0A 2ZX6A 2WSKA 1USQA 3JV5A 4R26L 1B4JH 1E7UA 3WIIL 1JZ5A 4LLMA 5MEQA 1IKNA 1V3LA 3HR6A 2OMYB 4IKLA 1N19A 3ZE0F 3Q5YA 3VB8A 3MNDA 3FT2B 1U21A 5IVOA 5J0BA 5I1IH 1JYVA 4RFNB 4YSQA 35C8L 3RVWC 1HILB 1TCMA 3PHQB 4MJ6A 5I0VA 2K1MA 2ZCHL 4LGSB 1Z32X 4G5AA 4N26A 3RIAF 4EN3C 3RI5K 2WQUA 4PJBA 5E6IB 3ME0A 4WU5A 3GSOB 3LRHA 3L5XL 4KJYB 3PGFL 4LMQI 3TJHD 3T0WA 3NESA 3ESPA 1B3IA 4XAKE 2C1PB 5L4IA 3EJRA 3VQ1C 3PP4L 3FL7A 5IESH 1QNIA 4XVSL 2EE9A 1RSYA 2V9RA 4L1HA 3I6KA 2ZUVA 4JM2C 3GTTA 4Z7UE 5IW1B 3S2AA 4EIGB 1E4JA 2VCOA 2O72A 5EOQH 3SKNB 2Z93A 1XGRB 5GS2H 4Y19B 1B0GA 3SKMB 2VDOL 4J28A 5AUMA 1G7QB 1DEEA 1A9EB 4RSYA 1CLOH 2R0WL 3AC0A 3D09A 1KG0B 3CPLA 4S1SL 1KCKA 5F96H 2J3SA 3G6DH 4XHJD 1JZ3A 3EW3B 1CF1A 1U8JA 1QFWL 4S10A 5DC0A 3DO7A 4Y8DC 1SVCP 2QTEA 1CBJA 1G84A 3PQYE 4ZO8A 4OAWA 1AZVA 2GTWB 2H0FA 1NGZA 1ZLWK 2ADFL 4Z7NB 1FI8C 1ZEAL 4F7TB 2QQNL 4BKTC 3KYKL 3DX4A 3O6KH 5IHUH 4CRPA 4NO5A 3RVTD 4Q89A 3BSZA 3IDMB 4U1NB 3BSZH 3ES6B 4P2QE 1BVKB 2C9XA 3J8F7 3KCPA 1CWVA 3NP4A 3QUZD 4NKDB 3WXVL 1IM9B 3BH8B 3P77B 4ZSOB 1S7QA 4A7UA 3PIQA 3RWCA 2QQLL 4GAGL 1N8ZB 3RLSA 2G4EA 3KR3H 4W4OA 4MSWB 3VFUA 4EPSA 1FFOA 3P4NA 1WRFA 1OW0C 3GM8A 4IRSA 4OJDH 4PJGF 3ARQA 5FOBA 1T5XA 3SKOA 4CKQA 1HL4A 1P7KA 2W0LA 3P30L 3SEPA 3LH9A 5J11B 5TDOB 1KYAA 1NM4A 1FGVH 3QUYB 4K4KA 4XBGA 3VFGH 3FUIA 4LU5L 1I4FB 3HN5A 4AMKL 1VENA 4BCYA 5E94A 4WCYL 3ZL4L 3QCTL 4KZDL 5E8PB 3N91A 3I9AA 3D18A 2F54D 3M86A 3MRFB 3TN0D 1HCFX 2P44B 5DHEA 4ORGB 1GC1L 5DA4A 1CLCA 4GIPD 3CFCH 3IXAB 3V4PB 1IE5A 3EF4A 1O7VA 2VGLM 2AJUL 1MQKH 5C6TL 3HTLX 4KI5E 3IJHA 5DJ8A 2P5EE 2ICEA 2R2BA 4JUSA 4Z5RA 1PFOA 4GRMA 3IJSA 4MCYB 2EDYA 2VC2H 1T83A 3BZFB 4FQ1L 5CJBA 1BF5A 4PRHB 1S3KL 4YHIB 4ABWA 1P7QD 1YNTA 2XV3A 3QEHB 2XWCA 2NMSA 2DI9A 4FGMA 3FPYA 2NY3C 2BXYA 4LHQB 5IM7B 4E5XB 2OCFD 5D7JB 3NIFF 1YNKH 3DBSA 2W07B 4GQZA 4M00A 1RUMH 2BWQA 5F3HB 5C9KA 4MS6A 1R24A 2WMPA 5KS9B 2W60B 5E0QA 1OV8A 5DD3L 4WI4A 3TBTB 1I8MA 1NCTA 3FS9A 4L8SC 5CGMA 2XVLA 4XMUA 5F8RC 3AAZA 2FJHB 5C86A 4HCRA 1CFQB 2MPAH 3FO9A 2H3NB 4G83A 1H3PL 4UAOC 4HCRH 5EU6E 3M17B 3MAWA 1BFVL 3WUZA 3RJOA 5CCJA 2VITB 4YSTA 1CQYA 4OI7A 4N22A 4XCFH 2VDLH 2VLJB 2EH7L 2IOMA 3L2LA 1GGYA 1NL0L 1FHGA 3LV3A 1NUDA 4JM2F 2QQKH 4POUB 3G6JE 3CDZA 1X5XA 3DRQA 4GSUA 3FQWB 4I48B 3L7FB 1QTPA 1IAMA 1VCAA 4HOXA 4XCCH 4XO5A 2D3NA 3PDGA 4WO4B 1M7IA 3CXFA 5C9JB 5D2NA 3OBAA 5CMAB 4P9HC 4HJGA 1YEGH 1HQRA 1ZWIA 3MV7E 2AQTA 2X1QA 1C5CH 2WZ6A 4Y2DB 2VDRL 5D1XD 2BWDA 2NT1A 4A7TA 1FVDB 1OL0A 2PCPB 4GG8A 2DF3A 4ZFFA 1IEAA 2EDMA 3DJRA 4FMFA 4X9BA 5IB4A 5CLWA 4LAQL 1K5NA 3LSOB 4R7NA 1CYWA 4WSJA 1N64L 1MHCA 4U1JA 5SX4H 1JOIA 3QUKA 1YQVL 5F7NC 4Z7VA 1L3WA 1G7HB 4X6CB 2FLMA 1MDTA 2ZONA 1GYWA 3WI9A 3EFFB 4HIIA 3ABLB 1IAIL 1L7TH 3VDBA 5AVTB 5FUCC 2EVFA 5ALBH 4I1RA 3U4EB 3WGUB 1INDH 1I9RL 2G3ZA 4QHNB 5IJVB 2TRHA 4OGAC 1A9BB 2AS5M 3NQKA 4Y8AA 4PJDA 2YA1A 2QHRH 4TUKH 3PWPD 3FFCE 4HFWA 3QJRB 5JLZB 3ZE2F 4DUVA 5F1NB 1D5IH 3EG9B 4JE0A 4YS4A 5BOZG 4BFOA 1MAML 2J57A 2RIKA 1GY1A 5I28A 4RNRB 4CC0A 1MY7A 3HB3C 4PH8A 1F0LA 4X7FC 4EBQH 3FUKA 2W65A 2EDWA 3TWYA 2UUDK 1TLMA 1BAFH 4RMSA 4UNUA 4ADJA 1ZE3H 3X1EA 3W9EB 1DQJA 4KITB 4PJXF 3JWDH 4GEJA 4P5SA 5IFHH 5M94B 2VDQH 2IPUK 3POCA 5FB8B 4GRLC 1UM4L 4FX5A 4TVPL 5HBBA 3QG6A 1DBAH 1X5GA 1HHJB 4N86A 4LP5A 4MDRA 1TIUA 2CO7B 1MKFA 3F7RA 3V0HA 1H19A 1HAWA 2Z35A 3ET9F 2DIJA 2VJ0A 3MOQA 2YAEA 3PV6A 3BX7C 1YY9C 3QAQA 3DTDA 3WDJA 1CDUA 1IKFH 5FWRA 1A6UL 1MLCA 3HMWH 5BS0E 4ZW3A 1NMAL 1SUJA 3QUZA 4FI6A 2B2XL 1S7XA 2X53A 5JQ6H 1AGEB 3GS4A 3GZPA 5C0JA 5DVNA 2NZIA 1FHNA 1U3ZA 3NZHH 4YZWA 4GSRA 1AFVH 3OG6B 2EO1A 1HEZA 1LDPL 4TQ8A 5DT1H 2BOBA 4JL1A 2FHCA 2N0KA 5I0WA 4WWOA 1GXEA 1TETL 1R4XA 4FL4C 4PRPD 3KEHA 3VXPA 4UQ2B 5F21B 2Y2YA 5HYFA 4I0PD 2NYYD 2X4TB 2YD8A 4JPSA 3QAZB 3RILA 2ICWA 5H2BA 1KBWA 2ZPKL 2JIXB 1KTBA 2R29L 4XPHH 4XC1H 5ICUA 1ILUA 2XPYA 4LDEB 4FQIH 3QULB 1UZ6F 2FBJH 4IBVA 4N2IA 3D6GA 1ZTXE 1A0QH 1FP5A 1OGAE 3MN8A 1RUQL 4FKKA 2VN7A 2XN9B 2F54A 5CSZA 1YJDH 4ILDA 3TN0A 1NGPL 2OMBA 1UD3A 4YBHA 3JV0A 4YN3A 1IB5A 2HMIC 5GRJH 3OAYK 2MQGA 5T33H 1E5UI 2Q10A 5AYTA 3F64A 3PCYA 5AOZA 5AB2A 4FF9A 5L6YL 4N24A 3L4XA 1MDAA 1YEHL 4ABUA 1RXLA 3MDJA 4LCIH 1T7WA 1K6QH 3QIWD 1YMME 4QCIA 2OS7A 3I50H 3VQMA 2AQ2A 2BS8A 4NP9A 1AS6A 4HT1H 3DYMA 1P7QA 1PAMA 4P57A 3BPNC 3LQZB 4YDVB 1DQTA 2IWKA 1JGVL 1MH5B 3EBIA 3QQNA 5KUMA 1CICD 1WIUA 2GSGA 4L1TA 4BCXA 2DQJL 3ARXA 4AQZA 1FZKB 1F13A 3KLKA 4IGBD 1WVZA 3IDXH 4JRXB 2EADA 2QLYA 3A4FA 4Z77A 1OT2A 3JVFC 3VA2C 3BGMA 3KLHD 2EQDA 3DVFA 5HHME 5DFVD 2PYEB 4OIIH 4ZUSA 1TZ8A 3OPUA 1UD6A 4LVEA 1TJHH 5EFIB 1NMBL 3Q2VA 2B7DT 1AG6A 4Y5XA 2WO2B 1E43A 5TDPA 4YLQT 3HS0C 3OHXB 2A5UA 3CSTA 3KXFE 2HKFH 4G6JL 2D4FA 2NTSP 3MNVA 1PFCA 1A1NA 2DQIH 5AD0A 1BHGA 1KJ2L 1J7VR 2UXFA 4ZOBA 3QJHA 3RTQB 2UUDH 1VGEL 2X70B 4HWZA 3MV8D 5EORH 2HPTA 4WDIB 3KVQA 3KCWA 4Y4HD 5LQBH 3US0A 1TZAA 2ARWA 5I8CA 2EP6A 2CJSA 4DT2A 5CLYA 3VXOB 2W0PA 2PYFB 4JZJB 5MP6H 3QXDA 3TO4B 5JR1L 4LVHC 1P7BA 1VF5C 5D1XA 3D5OF 2HVJA 1GAFH 2RH0A 2NUPA 1I7TA 2VE6B 4XP9L 3IDJA 4J6RL 4TSBH 3NDZE 3QE5A 1HHGA 1A7PH 1Q94B 1U8CA 3MR9B 3PJSB 4M6NH 4QNPF 4XMKH 3F7KA 3KAAA 3INUH 3Q7JA 3MCKB 3L7EB 2BVPB 2ESVD 3JWNE 4OZHE 3GSNA 1BQLH 1W72B 3QEQD 4KDTC 3X12B 3HNSL 5L88L 2IADB 4RBPK 3BP5B 1JN6B 3GSNH 3O45B 1GYCA 1LWRA 2XWJA 4KH9A 2GEQA 4XMZA 4NXKA 5I0XA 5I19H 4OCLC 4V1DE 5GS1B 3UAFA 1IX2A 3B2MA 2OYLA 5E2VL 3G5ZB 4KPHL 5HHOE 4Z7UB 3KYAA 5FHAH 1MLBB 3MSPA 2DQCL 3ILQC 4R4FL 1WA1X 5E51A 1TJXA 4HKJB 4I4WB 4XNZC 4GH7B 3CSYA 1DUZB 3H42L 2CHWA 3PWPA 3RX9A 3ZMEA 4N25A 5BRPA 5AYUL 5F3BB 1DFBH 5KVEL 1QBMH 1EZUA 1Q4NX 3QORB 3T4AB 4MA3A 4ZXBB 2OR9H 3L5JA 2NR6C 2J25A 4QRQB 3DBXA 4LVNC 4FFYL 3DIDA 4NGHL 1CIDA 3PQYB 4N0UE 4MAUL 1WZLA 3W3BA 1NIDA 2FX7H 3L17A 3RUGF 4KY1L 4OZIA 2XIDA 1W91A 4ZMLA 5SX4I 1EZVX 3E6FB 2R23B 5FXCH 1NUGA 1WQVT 2EEAA 5LGKA 2B59A 4HCFA 4ODXA 3W5NA 5TPWH 4M7ZB 3SD5A 5IBLD 4P2QB 3NFNA 3P3UA 3WEBA 2QHLA 1A7RL 5LUMA 4KC3B 5JQHC 5K9OB 1N18A 4R97B 4N2CA 4BJLA 3HNVL 2CR0A 3G6AA 1UH4A 4AITA 2L7JA 5SX5K 4JAMA 5FO9A 1ES0B 3N06B 3AUVA 1KYOJ 1TTCA 4KKAD 1WEJL 4W81A 4PRPA 3TV8A 5BOPA 5IGXL 3LQMA 4UQDA 4I0PA 3DX2A 4OJFH 2Q7NA 2MOQA 1JL8A 4TNGA 3PU7A 1JF5A 2YSSB 2HTLD 2UYLB 4JDZB 4Y88A 3ZYOA 5KYYA 4TKWA 3B5GA 1JI2A 5D7KD 1NWPA 4N0YH 2P8PA 4LPYA 5EZOH 5FO2A 2Q8AL 1I1AD 2CG9X 3KYMB 1Q9OB 2TSAA 3FU7A 3G5YB 3ECQA 1XMWA 3GBMH 1JRHI 3VYOA 2GHZA 2NX5E 4AZ8B 2VLKB 1WBYB 2VJXA 3HG1D 2R1WA 1FNEB 2W88A 4KROC 3EDEA 4JB9H 2YQ2A 4PSPA 4NC1E 3VFNB 3SBQA 1E6OL 3U0PB 2YD2A 4JGJA 2P5EB 1E4WL 2YLHA 1NANH 1QI3A 2NW3B 4FTVB 3W81A 1CGSL 3SY6A 4FABH 3BRGC 1R3JB 3QIWA 4P48A 1DLHB 1CG9B 2UX7A 1SOKA 3BQUC 3QUML 4U6HB 2YN5A 4NJ9L 1K3IA 3EOTH 3DURA 4P3CL 4ZPVA 1R46A 2Y3AA 4KNSA 4LEXL 2E75C 3LH8A 3GMRA 3TPUB 3SYCA 4D0DA 2JJTC 3VE0B 3RJDA 1CICA 2BOCA 1IO4C 5KVDH 4U4IA 4AJYV 12E8L 4Z9KB 4IGBA 7PAZA 2P45B 1A6WL 1IGCL 5CNHA 3UTTE 1HZHH 5CBEB 4D9RD 4YSUA 4YHOH 2FQEA 1MCCA 4XH2B 4WI0A 4FADA 5T3ZE 2VRAA 3B9AA 3MRRB 3PXJA 2LLLA 2X9XA 3D0VB 3F7YB 4JPIB 4PG9B 5MEND 1Z7JA 4H1LB 1KCWA 1SYSA 3FTGB 1R5VB 2W5PA 3B3IA 4XNQA 4CNIA 5F97E 3GO1L 5HJGA 4WNQB 3STZB 2BMKB 1C16A 1N59A 2FH8A 4NN5B 4TS6A 5IB2B 4WFG