1AZVA

Familial als mutant g37r cuznsod (human)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKRLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords COPPER/ZINC SUPEROXIDE DISMUTASE
publication title Subunit asymmetry in the three-dimensional structure of a human CuZnSOD mutant found in familial amyotrophic lateral sclerosis.
pubmed rcsb
source organism Homo sapiens
total genus 39
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1azvA00
3QQDA 1E9PB 1EQWA 1IBDA 3CQPA 1OAJA 2ZKYA 1SXAA 2AEOA 1Q0EA 3ECUA 1ESOA 1RK7A 4FF9A 2WYZA 3HW7A 2XJKA 2XJLA 1OALA 2WYTA 2Z7YA 2WKOF 1B4TA 2LU5A 3KH4A 2AF2A 2C9UA 3K91A 1SDAB 2C9VA 1E9QB 1P1VA 3CQQA 2VR7A 4A7GF 3MKGA 2NNXA 4A7SA 4N3TA 4BCZA 1PU0A 1SRDA 3S0PA 3KBEA 1S4IA 1COBA 1BA9A 4N3UA 1IBHA 1TO5A 2WZ0A 4OH2A 2WKOA 3KM1A 1UXMA 1E9OB 2Z7WA 1F18A 1E9PA 2AQSA 3H2PA 4A7GA 2WZ6A 3KBFA 1B4LA 3PU7A 3F7KA 1E9OA 2AQQA 1SXBA 3GTVA 3LTVA 2WZ5A 3GZQA 2K4WA 4A7UA 1OEZW 2Z7ZA 1SXNA 3GZOA 3GQFA 1DO5A 2SODB 2Z7UA 1N19A 3ECWA 1DSWA 3T5WA 1E9QA 4MCMA 1Z9PA 2AQNA 3GTTA 1SXCA 3RE0A 5KBLA 1OZTG 1XTMA 1F1DA 2VR8A 1SXZA 2ZKXA 2ZKWA 2R27A 1SOSA 3L9EA 2GBTA 3ECVA 1MFMA 1QUPA 1CBJA 2GBUA 2WWOA 4BD4A 1HL4A 1JCVA 1YAIA 2AQRA 1U3NA 4OJAA 1UXLA 2GBVA 4A7QA 1SPDA 1FUNA 3GZPA 4A7VA 1JK9B 1SXSA 2ZOWA 2C9SA 1PTZA 1F1AA 1XSOA 1OZUA 1IB5A 3L9YA 4A7TA 1PZSA 3F7LA 2VR6A 1JK9A 5CU9A 5KBKA 1F1GA 2JLPA 2V0AA 4MCNA 3HOGA 4B3EA 1CB4A 3CE1A 1TO4A 1SDYA 3KH3A 1EJ8A 1L3NA 1KMGA 2E47A 1HL5A 1IBBA 2Q2LA 3MNDA 3KM2A 2JCWA 1BZOA 3SODB 2APSA 2AQPA 2WWNA 1XTLA 1YAZA 2E46A 3HFFA 4U4IA 1IBFA 1Z9NA 4BCYA 1YSOA 1N18A 3QQDB 2AQTA 1AZVA 5KBMA 3H2QA 4L05A
chains in the Genus database with same CATH superfamily
1LEGB 2P8LA 2OJZH 2RMNA 1ZT1B 5CP7B 1HSBB 3QXVA 1BXXA 3KDMB 3LV3A 3FCTB 1M9SA 3EJYD 2BM3A 3KPSE 4F8QA 1P5VA 4BE5A 2DRUA 4ABQA 4IBWA 2ICWB 3APMA 1G1CA 3BWAB 4KHXH 4LLMB 3NPZB 5C0AD 1HK6A 3BVDB 4QIRA 4QXVA 2JE8A 3H53A 3CVDA 3MKKA 3QXTA 1YC7A 2W0LA 1F5WA 4H8WC 3UO1H 4YZWA 5C07D 5CILL 4AVHA 2XXCB 5I9QB 3NIDF 5BZXA 4ADGA 4P2AA 1MCFA 4DCQB 2F5BL 1JCKA 4P3DA 4QHMA 4LLQA 1CLOH 2J1ZA 3L1OL 1AE6H 4LKCA 5FOBA 2BS8A 2NXYB 3S2CA 3DUSA 1Y18A 5GQBA 5TE4L 3FCGA 4KI5D 5IT2H 3BPLB 1IT9L 3ZDXE 2YUVA 2GSGB 3D3VB 4B9GA 3KWWA 1EZUA 4JFTA 1NFKA 4ZDHA 5DQJA 5FYJD 5CJ5A 4TKWA 4R4FL 1AFVH 1UEYA 3FUHA 3T04D 1P5UA 4MAUL 3GF8A 3UXFA 5E08H 4G6KL 1DANT 4KY1H 3L5XH 4HUVA 1MQKH 4YDZA 1IL1A 4MD0A 1B4RA 1CLZH 3TZVC 3NFPB 4IIQC 3WN6A 2XETA 2ZKWA 3F65A 3AJ7A 1SOXA 4OZFA 4TTDC 4EN2A 4FG6C 3RI5F 4B9KC 2W88A 2W65B 5DD5L 3IF1A 3AS0A 3KPSB 1WWAX 4YLQT 4ABVA 2QLVB 1K8DB 3HMXA 3KPRB 4O58L 7TAAA 1N6QL 3ZKMC 3EFOB 3QHZL 3MXWL 4XP9L 4XO9A 3ZL4H 3F85A 2VDML 4JM4L 1S3RA 3LZFL 3F84A 3HMWL 3P4OA 1DEEB 5E8EA 1G7JA 1PZSA 4AM0B 5KBKA 3UZEC 5IQOA 4PVBA 4LLVA 2WOBA 4PWHA 4AJYV 1QLEB 2H41A 2DEWX 3O3BB 2V4LA 1JN6B 4JO3H 3H3PH 1RZJH 3FONA 3IE9A 4OF8A 4YNYA 5B1JA 4ZW8A 3WEOA 3MRKB 5IQ9A 3NIFF 2NCMA 3U83A 5ITBL 4NOBA 3GJFB 4GMTH 2LE9A 4KV5F 3ZDXB 2K7PA 1NJ9B 1PZ2A 5JUEL 4MS8C 5AVWB 3HZKA 1GS6X 4Q6IA 3PWLB 3F7YB 3KPNA 4WTQA 1Z66A 4ISVB 3QHFH 3ARGB 1CFSB 2KL6A 2V2WA 3AU1A 2XN9E 3TCLA 4A6YL 2ORBL 1QW9A 5IJVA 1PD6A 5KS9F 3CMOH 4B27A 3IJSA 3QXDA 4NKIH 2XA3A 4E0RA 4PR5B 5HDBE 3EDEA 3SDXA 3U7WL 3VW3L 4ZW3A 1QTPA 2X87A 5LXGH 3CXDH 3RWJA 2M8XA 1JYNA 3SY0B 4LT7A 3MLWH 3GFUA 3P4MA 2XWDA 1PL3A 1B6DA 4HV8A 4J8QA 5A2LH 1Y7VA 3J2PA 4OZ4A 3X12A 3SPHA 3VXOA 1JL8A 1EAPA 1O7DE 1U93A 3QRGH 1INQA 4G71B 4JDVB 3WTXA 1I8UA 1J0IA 5KYWB 4L18A 5C6TL 4U1IA 3TA3C 2WZPA 3SKMB 4A7GA 5IVXA 4GUCA 3VVVA 3PU7A 5ID1A 4FG2A 2PR4L 4W93A 5AB0A 3VX1A 4H13C 5I26A 3RHWK 2IAMD 2PETA 1BQHG 5EOCH 1RSYA 2UVFA 2DQGL 4YLBA 2DMCA 5A2JH 4AWJC 1MFEL 1VRSA 3BISA 2UX7A 4YXKL 2P24A 2GT9B 4NAMA 3MROA 4XOAA 4C47A 2XVGA 3CVIH 3UPCA 3ARDD 4WCYL 1CK0L 3RFZC 4J6IA 1J11A 2OXHA 1PMYA 2WSPA 2XN9B 4NT6B 2Z31A 4IRSD 4AYSA 4N9GB 4QYOB 4JGMA 1IVLA 5I1LA 1FF5A 1U95B 1ZE3C 1G9NC 4PFEA 5HDBB 4DUXA 4PHXA 3DETD 4XGZA 1G1KA 4PN6A 3BVNA 4LMQE 4X98A 2QPDB 4L23A 2WGXA 3OVUB 4Y2OB 1BQKA 5GZOC 2CKBB 4JMNA 3VRLE 1G87A 4TYUA 1AR1D 3S37X 1S5HB 1TIUA 2VRQA 4HU2A 4M48H 2M26A 3W5MA 1KJMB 3HHRB 3S5LA 2VITA 4RMTA 2WP3T 3QEUA 4B50A 5I9QC 3TC9A 5JZ7C 2FEEL 1NCHA 1MOEA 4MGXA 1JVLA 3HBQA 3SE6A 2HN7A 2NTSP 1NIFA 1HHKB 2IPKB 3IMWA 4JZNA 4HCRH 4OKVB 1B0IA 1AGEA 4KMTL 5MI0B 2NXYC 3TLRA 1IQDA 4UNIA 1PIGA 4C4UA 4OCWH 2BXYA 2QVKA 2MTAA 3DTUB 3BPLC 4GP4B 4R0LA 5TF1L 5DJ8A 4HP5A 2E7LA 1M2VA 2FZ3A 3LIZL 5TH2B 1Q0XL 1SOKA 3MUJA 5KVEE 1D6EA 2OL3L 5ISZE 2IXQA 3G5WA 1NCJA 4PS3A 3UJTL 3VFGH 3B7YA 4NHCH 3EYVA 5ESQB 2DMHA 3K4AA 3KWWB 1NCBL 3C5JA 2P5WE 5AOJA 1KB5B 3LS4H 4AZUA 3PWNB 4LPVA 2ADYA 3K91A 3EHBD 4GRLB 4X80H 3S5LG 1PKQA 2PPFA 3TTYA 1L9MA 4QRUA 3V5KB 3SO3B 1DJHA 2G30A 5JW4R 3A6CH 3BKJL 4AYGA 4N8CL 2YXWA 3HN3A 1L9TA 4X9YA 4ONFH 4E42A 3MLSL 4N3UA 3HE7A 3UBGA 1S9KC 1M05B 1ES0A 3L3KB 3DIFB 3MLTA 1MCCA 4OD1L 3TWYA 4DGVH 1BF8A 1UYWL 2ZP8A 3LRLA 5DFTA 4OB5H 4OGAC 3IGLA 1XL6A 4ABUA 1TEGA 3WE6A 4F5CA 2CLZA 4KNQA 2R56L 4PP1C 5JTWA 5E8EB 1O75A 3T8VA 4JFOA 3KD4A 4Z3HA 1ZLVK 4Z7VF 4QEGA 1FNGB 2DZEA 1BXUA 3NJLA 5LHDA 4I5BA 3TZVD 3WL9B 4HK0A 4KVNH 2FUTA 3FONB 3O9WA 2FJFB 5HDQH 4TTDD 5BRZE 2GW5A 3WUZA 3ZHDA 1B0GB 1ADWA 2DJSA 1Q9WA 2ZSWA 1WRFA 3ILPB 3C09C 5ISZB 4U7SA 1QUPA 5GRJL 3ZKMD 5F3BB 5FC9A 2MIZA 3MJ7A 3EF7A 4WK2B 2X09A 1NBYB 3ARGC 4LEOA 2P5WB 3H3BC 5AOIA 1KELL 4MXVF 4Z7QE 5T1KA 4WLCA 1Q38A 3WG7B 5HVFB 5CJ8A 2R1XA 1T2JA 4NN5B 3WNMA 3G5XA 5C0IB 4MJ6A 1TXKA 1L3NA 4UMGA 4E0RB 3OLDA 4M5ZH 5DMGC 1H3PH 2VUYA 5C0NC 1CXKA 1F90L 2HAZA 1N8ZA 2A1WL 2XNAB 1R3LA 2DQHL 4PWJA 2WVSA 2N0MA 2APSA 1LQBC 2XFXA 3MTXA 4H26B 1XTLA 3UO8B 3COOA 3L17A 4PRBA 4MS8D 3X12B 3VFVB 1BLIA 1INQB 1M2OA 4PY8J 2VDQB 3NK4A 3FT0A 4M4RB 2J1YA 4U1IB 5LNGA 3KW8A 5T3ZH 4U1GC 5B3SB 4ZO8A 5KVDE 3HC3L 1RIUH 4PEEA 1VFOA 2EDFA 4BYHA 4OSUL 5B1KA 3GI9L 2NNAA 4J28A 4K3JH 4RGMB 4RRPG 2A6IB 2CBMA 1DR9A 1GC1C 5C70A 4PJAF 4Y5VA 4G1EA 5BRZB 3CVHH 1KB9J 3LSOB 2ZXGA 3TBWA 4NKOA 3ZDXF 4UBDC 1VACA 1SJEB 3OM3B 1T21B 1JVKA 3DJZA 5KN5B 2X4PA 1YUHA 3MLRH 2WBJB 4PRPE 5EZJB 4M1DL 3T0XA 1I7ZB 5EO0B 2R1WB 1YYLH 2FJHB 4S0HA 4W9IC 5KSAB 5D7JA 4UB0L 4Z7QB 3L54A 3V6OE 2EECA 5F7MC 1GHFL 3TA3D 3NZUA 4PAZA 4KXZH 4TNWK 4YE4H 2FIKA 3NSCA 4PJ9A 3DV4B 1NFDA 2CA3A 3HBZA 3BKCL 1D9KB 1N7ML 1AY1H 3ABGA 1PKQE 4IBSA 3X1GA 1WAEA 4BWTA 4WJ5B 1F4XL 2WSKA 5EN3A 4CVXB 1DE4A 1DZBA 1M56B 1TU2B 1WFTA 3BVNB 3VXNB 4DP9X 1KZQA 4BGDA 3ULUH 1CD0A 4H0GA 1AMYA 1ILSA 1O7DC 3P30L 5IJKC 2AZAA 5FA3B 1SUHA 5F72S 3Q8FA 4Y2DB 2WXPA 2XTJC 3SPIA 2WXFA 2VXTL 3SQRA 5IIEB 2BSTB 2AXWA 3FW6A 4NLAA 4Q0XH 4XWGH 4FFVC 3MJ9L 2JIXA 1HAUA 3S8GB 3K2IA 4Z8FL 2DYSB 1E4XI 4N20A 1ERNA 4QGTA 3ZSSA 4F5CE 3QEUB 2HUEA 1Q9LA 2JJUA 4HETA 4QRQB 5CXPA 1CGSH 3JUYA 4OIFA 3TEWA 2Q5BA 4GQPH 1DBKH 1X9LA 4GAJH 4YIQB 3EADA 1HTYA 4CN6A 2OYMA 5E2UL 4FE9A 4IU3B 1AQKL 3B9EA 3FUJA 4IBYA 4U6YA 3BWUF 3S37L 5GZOD 4I1PA 4XH2B 2VDNH 1HILB 2FZ3B 4PRPB 5IQLA 4OY9A 3HFMH 5C0FA 2G60H 4FEMA 3MRQA 1D6EB 4EJ1C 2J56A 3DSNA 1RK0B 2ZKMX 1P5UC 2B20A 4L4VE 1BREA 1XV8A 2R1YB 4GRLC 1PZCA 5H94A 4F7KA 4I85A 3SO3C 3W9DB 2W81C 4X6FB 5DEFB 2XG4B 3B5HA 7CGTA 5JZ7D 1P4IL 3AMKA 3X11B 4LHQB 5CZKA 3GXDA 4AH2A 1J48A 1PKQB 1KFAL 2J55A 3L4YA 5D93B 3IJEB 1E27B 2NXYD 3HFFA 1EK3A 1F3RB 5DZAA 4R7DB 4K7PX 4B9IA 5I1CH 3FU0A 3MLTB 3D3VD 4MJ5A 2YMXH 3D05A 1GZHA 2EO1A 2A3TA 1BJMA 4MMZA 5HHNA 4UM9B 4WY7L 4KO7A 4GSQA 2OMTA 2IGFL 1QYGH 1J7VR 3R1GH 2EVGA 5TE6L 2FAUA 1KOAA 4TXVB 1S8DB 3EFFB 4LKXB 4QCIA 1FNSL 2J8UE 4HUXB 4HK3N 1LE9B 2Y25A 3SQBB 2CCLA 1A66A 3P0YL 5IQ7L 5EDSA 1SLXA 3N44B 1EMTL 1XCQA 1Z32X 2BRRL 3QIWA 3KPSD 1M4KA 5AW9B 4D8PB 1FZMB 5KG9A 3KPRD 1E4WL 2YJQA 7FABH 2WNKA 5AAMA 1MUJB 4H8WL 2LVCA 2N59A 4OGAD 3DGDA 3KYOA 4L4VB 3NEXA 3WO4B 5EA0H 4LEOB 3L8QA 1OQXA 5IB3A 2L7EA 4PP1D 3B1UA 4NN5C 5KYNA 1AC6A 1DTUA 3UIZA 3GRWH 2JNZA 1U8OA 1XSIA 5AOKA 4V2BA 4CA4A 3KXFA 3BVWA 2Y06H 1JG9A 3G5XB 3GXNA 1Q72H 4LPXA 4MNHB 4XP9H 4Q9RH 3VRLF 5IMLA 4FNPA 4ESKA 4PV9A 4N2OA 1Q9OB 1I85C 2Y23A 1EAOA 1WS8A 3UTSE 4OFKA 3B9KA 1J1XH 2RTTA 3KCWA 4F37K 3AGWA 2CK2A 3ECVA 4FZ8L 2FCBA 1JV2B 1E0OB 2IPUK 4BA8A 1MDAA 4XBPA 3H6AA 3LNEA 4YHLH 4ZQTA 3FB8A 1IMHC 2AQRA 3PP4H 4YXHH 2J8UB 2A4CA 3O2WH 3TM6A 3MRNA 5EBLB 4RGMC 5HI3C 2CJSA 3FU7B 4Z95L 1QASA 3MOBH 1U8PA 4J4PA 1TJMA 5DLMH 2MFNA 2QEJA 1DCLA 2OK0L 2X70A 2VR6A 1WAAE 4HX1A 2LAGB 3NTCH 5DMGD 2XWCA 4NKOB 3WY2A 3OMZA 1VACB 2WBJC 5C0ND 4E9QA 3GO1L 3AS1A 1WICA 3V6FA 2Q2LA 1YUHB 4NS0A 5KSAC 4P5SA 5E8PA 5I0VA 3PGCB 5I17B 5GRVL 1C16B 1S7SB 4Z9KB 2HKFH 1CZ8H 3GGWB 3DIVA 5D7JB 3LRSA 1D9KC 4W9JC 3QZMA 5KOMC 5C7ZA 1KCVL 3DK0A 2X6BA 1E3FA 2YXVA 3FQRA 3GDBA 4K9EC 2JJTC 3ELQA 4HU8A 4ZOEA 5AZUA 3SDXF 4N0FB 4XB8A 4ETQA 2QDVA 2AJYL 4AGMA 1PEWA 4OF6A 4EIBA 1LGVA 4URTB 3ARXA 3HI5L 5C9JA 1DE4B 3T0DA 3GSXB 5H8DA 4UBDD 1SMOA 1JGIA 3VJ6A 3QI9D 3QR1A 1KXVA 2YRZA 2YZ8A 4Y2DC 5FWRA 1CDIA 5HHVH 1GYWA 1G1YA 4PGDB 3UTSB 1UADC 1N2RA 1YEIL 1HOEA 2I7SA 3BQUA 4PBVC 1GIGL 1ET8A 3ZJAA 5KVGE 4PJFA 2GY7B 2XN9D 1YO4A 4DAGH 4ANUA 2HPOA 4HKXB 3Q3GB 3OHXB 4A7GF 1T1ZB 2XKUA 5K9QG 2W80C 2ICEA 3BWSA 3HZMA 3N55A 4ZTPH 3F01A 4L2YA 1LO3H 3J27A 1R3JA 1MCSA 1KBGL 4R0LC 2WKOA 2X4OA 1GW0A 4G6AC 2GQHA 5A1AA 4PPTA 4Z7QF 3V6OC 1WS7A 2XA8L 4FXLA 4A2GA 2V3FA 4JY4B 2F19H 4OFYD 4G42A 3RTQA 4WU5B 1HXMB 5D93C 2FX9H 2I5YH 3QZWG 5D6DC 3E1F1 4R26L 4YBHA 1UWXH 3RAJH 1CF8H 1UFUA 4XCNB 3QEQA 1N6VA 5EOTA 4NQCA 4HCRA 3A67L 3LQAL 5ICXB 4B97A 5BO0D 4OBSA 3DPDA 4HUUB 1A02N 3ZMRA 2GAZB 2ZUXA 3BPOC 3C2AL 1AACA 1LP9E 2GVYA 3T6VA 4OZGE 5IVOA 5F3HB 2XRAL 2FLBT 2FT6A 2H3NB 2DWDA 3NCXA 1KJ3L 5DHVB 3U2JA 4JR9H 2V2TB 5E99H 1TQCB 1E6OH 5HHNB 5C0CA 4LBAA 3NN8B 1G9NL 4GRLD 1FLRL 3D39A 3G9VA 3FT3A 3MODL 4HS8L 5KEZA 4CRPA 3ABKB 3HVDA 1W6WA 3W2DH 5JQHC 2WYHA 3DDFA 1QFWH 1JHTB 4OJCA 4O51B 1HEHC 4HFUL 4K7PL 3O9WC 3PGDA 3VXTB 3V7AG 4NZTL 4PJ5B 3E8UH 1XCQB 4F8OA 4OFIA 2PTVA 4HUMB 3ZLQC 5FKPB 4JGNA 4GH7B 4I0PB 4NUGL 4WUKL 4DVBA 3GHEL 3ZIYA 1QFUL 2QV4A 3L7FB 3WO4C 4BCYA 5HHOE 3JXAA 1F6AA 2NT1A 4D7BA 4E9SA 1A5FL 4X6BA 3IDXL 1QPXA 1TPXC 4HDIA 1NANH 4XPFL 3JTSB 1L9OA 5BO1L 3VMNA 3H85A 1BJ1J 1WF5A 4BZ2H 1XX9C 2QPEB 2WXLA 3MV8D 2E7MA 3QJSB 3ZYOA 1QFHA 3LB6C 5FFGA 4CADA 2NQDA 4FQCH 2JI2A 1U8MB 5LAXB 1R33A 5J12B 1U4FA 3AG4B 1O7SA 3FDWA 5HHPA 1LP9B 3DXAA 5ISZD 3NRFA 1BD2A 2EVJA 4OZGB 5C0EB 4JRWA 2FGWL 3D6GA 2SEBA 3E3QE 2P5WD 4G6ML 1NC4B 1DQQA 3GEFA 2D9QB 5I1DB 4N87A 4N2DA 3SO5A 1XD1A 3S98A 4OAWA 3WIFB 4ZODA 1XB3A 5I6MA 4AENA 3U30B 1MSPA 4XBPB 3FUEA 3OMAB 2WXNA 3FB8B 2VC2B 3CLWA 3N44F 4W4OC 3B8YA 5C0JA 2KYIA 3MRNB 1MFBL 2PP7A 4KTEL 1QBML 2AQQA 2FO8A 5GGVY 4NNYB 4E9YA 1EXGA 2BY2A 3ROOA 3SPJA 3UJJH 4IOFC 4HJUA 4FFYL 4FMKA 4KAQL 3EG9B 4Q74A 3WAKA 2OMVB 3LHPL 3AM8C 4NUPA 1A6WL 1N5AA 1U3ZA 1WBYB 1XF1A 3M1CA 1MJ7L 4AC4A 3MFGB 3WMSA 5HHOB 4QXGL 4MZRA 4JQXA 4OLWH 2YPVH 1E8WA 3V6FB 5D7KE 2GEQA 5D7JC 5E8PB 2A5UA 2FLMA 5KOVC 3ZW3A 3ULVE 1CYXA 1E28A 3IT8D 4DP0X 4WHTA 3RIKA 1GOFA 3QDGE 4PTTA 5DRXB 4UIKH 4LO9A 5F9JA 3WNNA 1X9QA 5HI3D 5BRZD 1MCKA 1N4XL 3EZJB 5EUOB 4IM8A 4LCUA 3BAEH 5AQ0A 3HRZB 5DZ9A 1RUPL 3QEQE 3EH1A 3MCYA 2D31B 3EYQC 3VGEA 4DNLA 3HTLX 3CXHK 2YD7A 2WBJD 2W9LA 2Z35A 4DN4L 2VXUH 1B0WA 5JW4Q 3P3UA 5KSAD 1KUMA 4Z3FA 2VDKB 1MDTA 4LVNB 3OHXC 4TQEL 2J8UF 2ZUSA 1UCBL 4O2CB 1J0JA 5AUMA 2EUWA 2TAAA 1U8IA 5EH1A 3RIAK 3SODB 1D9KD 1T4KA 4G11A 4Q9CA 1PLCA 3S97C 2FR4B 2OTWA 1YAZA 1RUAH 3PWJB 3L4WA 1A1NA 1EDYA 1SUJA 2WXIA 1RURL 1D6VL 4F7PB 4RBPK 4TV3A 4Y2NA 1JAEA 1JMXA 1D5ZA 4AQAB 2ZXBA 2BSRA 3MRJA 4P3CL 4PJ8D 5D7IE 3EJPA 3PV6A 3W38A 3BUQA 1MCQA 4Y2DD 3H8NA 1CL7L 2DBLH 2FL5A 3ASWA 2L7UA 1V55B 4FF9A 1QOKA 2HKHL 1ZY9A 4FQXB 4NZFA 4EDWH 4PV8B 3H9SA 1KDIA 1T5WB 4RCAA 1TZAA 1IC4L 1DDTA 3QDGB 1NFDF 4IKIA 4KX7A 1FPTL 2KZ1B 2NZ1A 3HBGA 1EHLH 3HB3B 3KJ6L 2GKIA 3RTQB 4D0CA 3MA9H 3K6NA 3CQQA 1I7RB 1RZGB 2CGYA 3K5SA 1YEJL 3FUKA 5B7MA 1RULL 3OWRA 4NZDA 3QEQB 1EUUA 1DSFL 2AJXL 3MNWA 4G6AD 3WKNA 1IC7L 1N26A 4XNQA 4PRPD 1Q8MA 4AM0Q 1GZHC 5KSBA 1JERA 3LPOA 2X38A 3DXAE 4C56A 3VD4A 5E2WH 3P3RA 1TQCC 3RKPA 1FZJA 2IO5A 3FAXA 1P69B 2LV4A 3AACA 3K71A 2Y24A 2OJEA 3KVDD 3CX2A 4ODVL 1E5UI 1ZGLB 4LRIC 1JUFA 4GSDH 1SF3A 4HULB 1JPST 3PHOA 3S2AA 4AI7A 1GY1A 3DPBA 1N59B 3DUUB 3DRQB 1NBCA 3NFNA 3SGDI 3OG4B 3IU3B 4NQSB 5L4MA 1LWJA 2ZUUA 1G7HA 2CKBL 4UT7H 4LCYA 1ZDQA 4C55A 4JPVH 1VFAB 3KYKL 1OCWH 5HJ3A 5K9JL 3PGDB 4I0PC 5D7IB 4DZ8A 2DJ4A 2BVPB 1J1PH 3D5OF 3MV7E 2YKLH 5HYJA 5I16A 4X99A 1EEZA 3ZT5A 1ZEAH 2X0WA 4NUMA 4UM9D 1VKXA 1UUSA 3P4LA 3RVWC 2HLEB 1WV7T 5DEJA 4MA7H 4JO5A 3GXTA 4H0IA 4JKMA 5TPWH 3BN9C 4JDZB 4MNGA 3HAEA 4P48A 1H3WM 4L4TE 3VFMA 4MHHG 1PW3A 1GYAA 4JO1H 3AZUA 3AWFA 1HVXA 4NXSA 5J12C 5MEPA 2PW1A 3ZVVA 5CWSB 3VUAA 1OT1A 1QPKA 4IBZA 2A9NH 3TV3L 3EYSH 3OKDA 4RMQA 4Y4KA 4RLDA 3QZNA 1YA5A 3MQIA 1BZEA 5EF2A 1KB5L 2X44D 3DXAB 4ADJA 2ZCKH 2QHLA 3W56A 1V3MA 3GPEA 1EEYB 2GITB 3S4SA 5CJBA 4L4VD 3V9CA 5D2LA 3OJDA 3K2MC 4WNJA 3K0YA 2J5WA 1P7KB 4QHKI 2XBTA 1BQ5A 1DN2A 1L9QA 2ITCB 4R83A 4DO4A 4K5NA 2E9WA 2XUWA 5ADOH 3L9BA 4JQVC 5EU5B 3SPCA 4TSAH 4AENB 4WWKA 3L6FB 4Y9BA 2GC4C 4UT9A 4J4PC 3GRWA 1C1EH 1B6UA 1NGXA 2VL5A 5BW7A 1MH5B 4PG9B 4LCCB 3LB6D 3GSNH 1HESA 5E23A 3QNZA 2MKLC 5I82A 3ZE1E 3MV7B 1RK7A 1R5WA 1VEMA 4JVWA 2EDKA 5CGYC 4AL8L 5F1KC 1TZGH 1HH9B 3MGOB 1RHHA 1RFDL 5D71L 3NBNA 3I50H 1BZ9A 2J21A 4M7LT 3WFHB 3RILA 1MCBA 2AXGB 4TNVK 1EXUB 2H0FA 2WP3O 3KWXA 3TJHC 4DPRA 3CDGA 3RWGB 2HVKA 1SRDA 4WFEE 1IM9A 5H2BA 2ADIB 4L4TB 3ALXA 1JYWA 1GJIA 2OAAA 1IBGH 3H9SE 1S9WB 3R4RA 5ELIA 4NEHB 4A04A 4Z7UE 3KR3L 1HSAB 3AW5A 3FQYA 2D03L 3HRZC 3SHSA 1OAUL 4HIXL 3UOAB 1CTMA 1LP9F 2QKSA 5GGVH 3DHMA 1XF2A 4OZGF 4O02H 4N86A 3REWA 4Z3GA 1A4JB 2VL4A 4OI7A 2FHCA 1E3ZA 2FB4L 2WUBL 4NZRH 2Z7ZA 5E9DD 1DYZA 4LVNC 4ZOBA 1SEQL 4NM4H 1IAMA 4JZOB 4FQQB 1T20B 4HT1L 4MASA 4X9GA 4CGTA 3GBNH 3QPQD 3BFOA 3SOTA 2XZZA 4R84A 4JQIL 1L7TL 1J18A 1NKRA 1R3KA 1U8IB 2ICEC 2X9XA 1T5XB 4J6RL 1QBLL 3VGDA 4ZYKB 3ULSA 3KEHA 3TO4A 2NY4D 2FH6A 3EJCA 4PRNB 3ZE1B 4OZIB 1CD1A 5IHBA 5EZOL 4ZPTA 3UTSD 4G8GA 3N04A 4HXAH 3ULVC 3FU8A 4FQXC 2J3SA 3NACL 2DEYX 5HGHA 1JK9A 1C12A 6CGTA 4NQUA 1KCRH 3TOPA 3L5IA 4P05A 3RTQC 4OF5A 1NCNA 3H9SB 1S7VB 3VD2A 1IIIA 4F9PC 1U3HA 4MNGE 4Z7UB 2HFFA 2IFFL 1ADQA 1G43A 2LFGA 3BKYH 2DB8A 4XP6H 4XHJC 4ZFOB 4FDWA 1XMEB 4WSGA 2FNWA 5E00A 1FRGL 1USZA 4BQ9A 1IC5L 2AMGA 4U1NA 2DICA 1KIPA 4UILH 4XNQB 1XCTA 2VZUA 4JY6A 2C4FT 5EU7E 5TFSH 3VG9B 4XB7A 4D8OA 3EXJA 4RVBA 1I1FA 4LASH 2YUXA 5CF3A 4PJFF 2I9TA 1IM3A 1FE8H 4ZUUA 5HYSA 3A4DA 4HHAB 2OSXA 4K9EL 2I32A 1JV5B 1RUML 4WI6A 3TPKA 4LLYA 3UYPA 2CO2A 3L08A 3IRZA 3MCLL 3QO0A 4CJ0A 1R0AH 3OX8B 4JG0H 1AOHA 2VLJA 3DPBB 3GK8L 3WJJA 4P04A 4AUYA 3VGAB 1A7NH 2WKOF 3EGXB 3DX8A 4OFQA 4YK4B 5F44A 1Z1WA 3AQDA 5HI5C 2ZNXA 1JDCA 3C8KB 3QULB 1WH0A 2VDOB 2D0FA 3NAAL 4G8AC 4R5TA 2HFTA 4X0NA 2Y6SC 4AQEA 3K74B 4F7CA 3WFCL 3RJDA 5JW4N 1N64H 4YH6A 3ULVF 1BA9A 4P9MH 4PRDB 1WISA 4XNMA 2JI1A 3AUVA 2WXKA 3LPWA 4KUCF 1H19A 2HLAA 3KM1A 4GAGL 1J9QA 2NNRA 4G8FB 3T0BA 3UBFA 4AGPA 5HYSG 2ARJB 4F1SA 2PXYB 4Z0XA 3V52L 2X4RB 4MNGB 3HAEB 2X4UA 4Y16B 1YNKL 5CU5A 5DR5H 1H8LA 2CLVA 2UY6B 5I66B 3K1KC 4C83B 4PJ5D 3WHXA 1CDUA 4I0PD 1PD1A 4U0RB 3QJZA 1UD6A 3PIQA 3DVGA 1R3IH 1JMZA 1A4KB 3D07A 4W9DC 2VR4A 1UJ3B 3ECBA 4LSVL 5IHZA 3RVWD 2GBTA 1SYVA 4GP5B 1HDMB 2QTVA 3UBXB 2K7QA 4NWUL 1HHIA 4BKTC 15C8L 3MTRA 3CBKB 4DN3L 1U3NA 5EBMA 1AKPA 3QZBA 5FYKE 1U92B 3KPPA 3IDGA 2JQAA 1UOWA 4LQ1A 4BZ2A 5DJ6B 4N22A 3Q2CA 2ZOLB 1NCUA 2J6WA 3L3DA 4JFXA 3CHOA 3NRPA 3QNZB 1SF5A 3M1BA 4Z76A 3CC5A 3LZOA 4G8GE 4JQXC 1NC4D 2JCCA 2YHGA 4JFYA 4R8WH 1BZ9B 4ZX5A 3AFLA 1A3RL 3BESR 4JGJA 4FQJL 4KDTC 5DS2A 2O5XL 2WIIA 3D18A 3T1FA 4DO6A 3MC0A 2NY2B 3CDGB 3SD5A 1N9PA 5HTSA 1VESA 1IM9B 1SLWA 5DRNA 2XV6B 2FQEA 3U1QA 5E0FA 4CDGC 5JR1H 1TTAA 1ZHKA 2N0KA 1XF4A 5ICZA 3M6DA 3QZLA 2Y7MA 4JANA 3SKNA 4C4BA 1XF2B 2Z0UA 1UM4L 3VDAA 1NAKH 4F3FB 1XF3A 2R23B 5CGYD 3REWB 5ALBL 1B2WH 5HHOD 3O2VH 4U0QB 2RFXA 5B38G 1KENL 4UIMA 3RZCA 1HYRC 3U0PA 5EU3A 3TJHD 5JW5A 5F21B 1IQWH 3BH8B 5IMKA 2IQAB 4IKLA 1BOGB 2AV1B 4K23L 2Q2EB 4LIQL 4N2GA 4X5XA 4XC3H 2ICWI 1R3HA 1ZLEA 3I9IA 2BVQB 3CCHB 1UZGA 2Z3FA 4CVWA 3A4AA 3FT1A 2XWZA 2XXGA 4WDIA 2YIHA 1Q94A 4ODSL 4JHAH 1A8ZA 1TSHA 1AIFA 2AXFA 3UYOD 4CMMA 1HH6B 1E9OB 5F88A 3M45A 1ZHNB 3LCYA 2B08A 4G8GB 3BD3A 2TSAA 4OM0H 2GIMA 2E56A 1UT2A 2NY5C 3CZJA 3FSVA 5HHME 4E9VA 3OF6A 2HX8A 4RQQB 2J1KA 4WI4A 5FGBC 1ZLUK 1UOLA 4XVOA 5ENWA 5HGHB 2ZXQA 4WI7A 1I31A 3TO2B 1FZOB 3JWNG 1K5WA 5DK2A 1E3XA 1E9QA 2JKXA 3EGSB 3NFSL 4FQ2L 2E76C 4YGVA 2EAEA 3T4AB 1KY7A 1W72B 3Q6FA 4PJ7A 4UT6A 3BUIA 4N8VB 4MX7B 5HY9A 1CFQB 2D0HA 3IDYB 2BMKA 2NW3A 4E9TA 1H6FA 1UWEL 4HUNB 3BE1H 3LN4B 3VG9C 4AMKL 3CH1A 1KACB 1MELA 4KKBC 5J7CC 4BFJA 4JPKH 2ATPA 1JHLH 4YSQA 3BRFA 5D7KD 3EBAA 4DVRL 2AK1H 1TYRA 4QRAA 3UTPE 5E6UB 1BJ1H 4FQXD 4LSQL 3Q2NA 5SV3A 3CFKA 2NNCA 1IM3B 1S46A 1Z3GL 3QDGD 3FSAA 4FN0A 1K9TA 1JNJA 3WS3B 1WFUA 2FWOB 3HB3D 2DEXX 1U91B 4U31A 1BQUA 2FSEA 3VGAC 3E80A 3QO0B 4YK4C 4A66A 3VQMA 2FX7L 4XHJD 3WXWL 4B5EA 3JYCA 4XX1E 4CBZA 1TKWA 4S11A 2F53A 4JL2A 3DX8B 5E6YA 5E24E 4BCXA 1ZPUA 3L4UA 4JFZL 3FH8A 3GLEA 4JKLA 3ZO0A 5FO8B 2K78A 4NCC1 2WWNA 3TBYB 5A7EA 3KEDA 3CFNA 5HHMB 4F7CB 3QRLA 3QYCA 2XICA 1LMIA 3R7RA 1MF2L 1HEJC 3P4NA 1EBPA 3TPUA 1N18A 1E4KA 1KTJA 3PG2A 4W6WB 1HCYA 2HLAB 4LPYA 2Z8SA 3LEYL 2AEWA 1WZ1L 1YPZE 4OCRL 3OQRA 4M61B 3SBPA 4DUWA 1SXAA 2ADGB 5J1AA 5B1BB 2IBZY 2X4UB 3BP5B 3DX2A 2CLVB 5IOKA 2WXHA 4LU5H 4U0RC 2VQ1A 1BP3B 2J20A 1M7XA 5EU7C 1OCCB 5DFVC 5HI5D 5KAQF 4PCSA 1JWSA 3THML 1FVDB 1YDPB 2WINA 2Z8WC 3IDMB 5KSBF 4WZ9A 1S7RB 3G6AB 4HWZA 1LDPL 2FHFA 3S5YA 1UJ3C 3PIQB 2WO2B 1R24B 1MRFL 1CF1A 2YMTA 3HNTL 2G5BA 3IDIA 1RHFA 3RY4A 5GISL 4ZUTA 5I1KH 1ZXQA 3EDDA 4HGWA 2EDBA 3BLKA 5LG6A 2Z4QA 4HIQA 1UQSA 4RZCA 4WWKC 2VKXA 4XMLL 1FL5B 4JM0A 1F18A 4DGIH 2AI0L 1PG7W 3MBEB 3WD5L 2OXGA 1QRKA 4NQXA 1X5KA 3D0VA 3U36B 4X4YA 3IJYA 4MJHA 5IFAH 2DQFA 1QRNA 3WKML 4N5EC 3AUWB 1KTRL 1YECH 4JFXB 4B53A 1FG2B 5G5DB 3V6BR 1WFIA 4JFHE 5AB1A 2DQIL 2FHBA 2ZE0A 3X1FA 3NJHA 2EEAA 2WLNA 1KPRB 4JPQA 2NY2C 2K70A 5FYLE 4PD4K 4MQ7B 3Q06A 1YPZB 2BSBA 1IZKA 1P7QB 5C7XL 1ND0A 2VR9A 1KCUL 4XMKH 1PBYA 1ODUA 5TQ0L 2Z8VC 3ZTEA 1KWGA 3C08L 1KDJA 5DQ9B 3L3IA 1NWPA 1SBSL 3MV7D 3OLIA 3RWHB 1KLFB 1SLUA 1BIHA 3O2DL 2D2CC 2JMRA 3GSNA 3IYLW 5E6IA 1KYFA 3SKNB 4PI0A 4X9BA 1T7VA 5D2LF 3H7LA 2RFXB 4M6OH 4FABL 2MNUA 3NZ8A 5DEGB 2CR6A 1U8KA 1T03L 2ARWA 4L4TD 3FO0H 3ZHNA 3QORB 5E70A 3WBDA 4AMWA 3S3BB 4TVUA 1U2YA 4U05A 3B4NA 3VRJB 1MWOA 5I24A 4MTMA 2OSLA 4NO2A 1S9XA 4LCWA 4B9FA 3L16A 4WDIB 4XT1C 3D08A 4MDJB 3LIUA 2X9WA 1FAIL 3BPCB 1FN4A 4R7XA 3VA6A 2WV3A 3NDZE 4HS3A 4YSAA 25C8H 2VC2L 5I5IA 4HSQA 2QVIA 1X7SA 4FCAA 4NN7B 3DECA 4I77H 1KGCE 4M5YL 1WEJL 1OIOA 3MRFA 1CGYA 1TF4A 1FC2D 1F6LL 1K5NA 2O5YH 4MBRA 3S3JA 2DM7A 5EC1A 4ZX4A 5BVPL 3T4AC 4XPAL 2OCCB 1GVIA 4KQ4L 4HISA 3SYAA 3GKWL 3SBWA 1E9QB 4WTZA 3IDYC 3PJSA 4HS6B 2BNRE 3LS5H 1WHOA 3MJ8A 1IKFH 1MFCH 3PGFL 3U1SH 4YGVB 2VAAA 3OXRB 3PHAA 4QHUB 2WLLB 4YAQA 3AS3A 2V5SA 1BAFH 5A6LA 3L1FA 2B0SH 1JTPA 3CH1B 1KC5H 4GKZB 3ASNB 4LMQI 1U8JB 1OGAA 1WBXB 1XSJA 4TL5A 2O61B 3JWDH 1A3LH 4WFED 2VRAA 2F1AA 2RACA 3MA7A 4Y1AE 5C0RH 3IEAA 3A5VA 1MCOH 3L4VA 4MMXB 2WZ5A 5DDHB 4C4KT 4A7UA 3WJJC 3X3GH 3KPOA 1P6AB 1ZSDA 2NZ9D 4P2QE 1ITBB 4PW4A 2VZVA 3F12B 4ODXA 4MRCA 2AC0A 1VJSA 3BGMA 4U1GB 1NC2A 1JWMA 4IS6B 2DQJL 5E95B 1TQUA 3HG3A 1QRNE 3F7RA 3CAFA 2BIIA 5CLZA 5LBGA 2HT3C 3IRCA 4HOXA 1XL4A 1PYWA 4V1DE 4K5OA 1SN0A 1J8SA 1RJLB 2CXKA 2HRHA 4N2HA 2R29H 5EG6C 1GR7A 1DANU 3B7UX 4UQ3A 2OMWB 4XO5A 1KIUA 1MCJA 4ZZFA 1NBVH 2BP5M 5H37H 3DROB 3FO1A 2IADB 1RXLA 1Z6JT 3HE6A 4Y19A 1LHZA 3NH7L 3V4PH 1HEZA 1L5GA 5ILTH 1T22B 2B5IB 1DBML 4NJAH 2VERN 2WVVB 2BNRB 3VXQA 1KJ2H 3APFA 4CGUB 3QYNA 1A4BA 3ZL2A 5JPNA 2AEQH 2DY2A 3EOTH 2VSKB 3BP6A 3GNMH 4PW9A 1JPSL 1B9KA 2R0KH 1CJYA 3CK0L 4YHKL 2B59A 2KC0A 3L4TA 5JQ6H 1ZSHA 5EEYA 1FV1A 3N85H 1JK8B 3LZQA 4GRWE 7PAZA 4FNLL 4QXTA 3FO2B 2VLKA 4Y1AB 2QQLH 2NSXA 3LKOA 2XG5B 2PXYD 4ZMAT 3HG5A 5M95B 2B8OT 4HLZH 4Y16D 4HGWB 3MBEC 4XN9A 3O3DB 4L8DB 4P2QB 2YEZB 4YN3A 3U6XA 5F1IA 4Y4FB 3Q6GH 2JKWA 4TF4A 2EDHA 4X4YB 5JA8B 1DJSA 4JN2B 4HBQA 4PRIE 1CI3M 2P8PB 4EIUA 2DQFB 1QRNB 2F2HA 3MLYH 5F70A 4JCLA 4MJIA 3ZMNA 1DUYA 1NCDL 1DVZA 3E6HA 4BJLA 1Y0LA 1RPUA 1IGJA 1T0MA 4QHLB 4V1DB 4YEEA 3PQYE 3SOBH 2AJSL 2C7UA 3DOHA 2VW6A 1KN4L 3WKPA 2VLRB 2NNXA 5AKTA 5GS0H 1I9JL 1T1YB 3RIFK 4KO9A 1PDKB 4G3YL 3DYPA 3KL0A 2JB6A 3IFNH 1RUQL 4X42A 4WI8A 1TZOA 4IBUA 3QNFA 4KDVA 4PBWD 1ND0B 5GRYA 1G6RH 3WFDH 3EOBA 1IAIM 5E2JA 1BQHB 4NYLB 1CGXA 2AQSA 2X3CA 1F0LA 2UWEA 4DPBX 5LGHL 4N5ED 4ZUSA 1XGRB 3HS0A 3U6RA 1E5CA 2A9DA 3QO1A 2RA1A 4OQ1A 4ALAL 4GRWB 4AMXA 4AE1A 2B14A 3G6JA 4YX2L 3RZCC 2CHDA 2F7QA 2Z64C 1I8LC 4U1SA 5LCVL 2H32H 2ZUWA 1OGAE 1RERA 1S7QB 3TYGL 4S10A 4KI1A 4RBPH 5T1LA 2G3ZA 1XEUA 4PG2A 4NWTL 3M8OH 4QF1B 1YJDL 1XT5A 5IVZA 4DQOL 3FB7A 3TIEA 1A9EA 3KHQA 5K1JA 5I1HL 4KHTH 2VDRL 3CIAA 3LKSA 4PRIB 4YDIH 3CFCL 4F57L 1OAXH 4RA0C 4M5SA 3QPKA 2Q76B 1ZOXA 3IE4A 5EZIL 1N3NB 3F7VB 1BFVH 3V4VH 2XWJA 2G9KA 8FABA 1FN4B 2JCCF 1UXLA 5IW6A 3PQYB 1KT2A 4NQEA 3PXHA 1J87A 1DVQA 2NDGA 2WQXA 3BJ91 3L3JA 5AW3B 1KIRB 5AWNH 1PX4A 2YEQA 4ZS7H 3X13A 1HHHB 3P77A 1MW1A 3EOYG 3MRFB 3C5XA 1SHMA 3ETTA 5FYKD 4HWUA 1RSFA 3FTSA 5I8CB 4LBEA 4JJ5A 3WTYA 1A64A 4N0YL 3M7OA 4ZQKB 4MLIA 4Y19E 1BX2B 1MREH 4BFEA 4TLSA 4HIEB 5AW0B 3UG5A 5DJAA 5BZZA 4X0KA 3H3KA 1YMHB 3BAKA 2G9HB 1QKZL 3V5DA 3LXAA 1MRDH 2ZX7A 2I07B 1DCEA 1OGAB 5E8DH 2XZCH 4MMXC 4Q7DA 4DW2L 1KBPA 5GRVK 5E2TH 2MOGA 2R0WH 4ZTEA 4L8CA 1QWUA 3QUYB 4H4NA 1GSKA 1FWXA 1T7WA 1PZ5A 2HCZX 3N41B 1ZLSL 1MXDA 2PTUA 1ZSDB 1IAOB 1T0NA 1IC1A 4IRJA 1DFBL 1OAZL 4MCYB 4QKTA 2VQTA 4B9JA 4HBCH 1V54B 3EFDH 1UH4A 1X7TA 1R4XA 3Q7JA 3ZHLA 4ZMVA 1XB6A 1FGNH 3QUMH 2APFA 2VB5A 4YFEA 4MJIE 5T5FH 5DVPA 3O6ML 5D72L 2DQDL 1FVEA 4MWFB 4ZAKB 5GS1A 1XGYL 3QJFB 2V9QA 1NOLA 4LFHD 1FZKA 1IIKA 1YY9C 4Y19B 3L7EA 3QS2A 4HC1L 2P28B 3NYKA 4PJ7F 3TNNA 1D2PA 3O6KH 4MRBA 4XPBL 4CSSA 3K4DA 4XXDA 2E9IA 1MHPH 3WTVA 3QFJE 2J88H 1QTSA 2Y0SA 4OLVH 2C1PA 5MERB 4RNRB 1ZDSA 5HHMD 2AANA 4Z23A 1FNHA 2Q86A 5G2NA 2WWMD 2EYTA 4P57B 1KCKA 4FLOA 1XAUA 2EH8H 1I7UA 1MVFA 2HT3D 4DKEH 1RIHL 3G6JE 3BUYA 4ZFOL 1KTDA 5IB4B 3CFUA 3IGAB 4I48A 4AGQA 2FWLB 4LQFH 3LX9A 4FQHA 1WUNT 2KLRA 3T6ZA 4FC3E 3TURA 4QHKJ 3OKOA 1DVFB 4Y4FC 3PABA 3IMBA 1EO8H 1A0QH 2XBZA 3X17A 3RY6A 4ODTH 3GSRA 4A7VA 1A6AA 1MNNA 4NO3A 5DSCA 2TSBA 4LSPH 4AVKA 1PLBA 1N5YH 1PIFA 2WCSA 1QSFA 5GIRB 3UTPD 1FFQA 2BWQA 2V5YA 5CBAA 2UY7B 3O6FB 4MJIB 1V7MH 3WIHL 4DGYL 1DUYB 1IEAB 3AB0B 3W0WE 3E1ZA 5HPMB 4S1DC 4DKFH 1CBVL 4JO2H 5GGRB 2ZPKL 1E4XH 2CRYA 4K71B 3G6DL 1AQMA 3INUH 1THCA 1RJYB 1LK3H 3HI1A 4QD2E 4XP4L 3ZUNC 5IV2A 3MBED 2X2UA 1YYML 3MACH 2YC1A 3D7PA 1GYUA 1KYAA 2ZONA 3CZUB 4MYPA 3QCVH 5K9KB 3QFJB 3VWJB 2CJUL 2Y22A 2MHAB 3L95A 4ZMZA 2AABL 3LY6A 2BERA 1J1OH 4R9HA 5C86A 3MO1A 4HCGA 4UU9A 2DWEA 3L5JA 3NJNA 1SNRA 1XH2A 3I9GL 2WLIA 1KPVA 3G6JB 3SQOL 3L3GB 3MR9B 1JNLL 1TZHB 2B1OA 4PJEE 1U8HA 2XYCA 1GZQA 2HYMA 2VABA 4N28A 1MCPL 2X4SB 4POUB 4BSVB 4DT2A 1P7QD 3T3MF 4OGXL 1WZAA 5H4ZA 2H1PH 4LLWA 3ES6B 1OCRB 1DQMH 4J3SA 3F62A 2Z92A 3BW9A 4EI5B 2D3LA 4PCYA 4JPWH 4RGOL 4TQPA 4HH8A 4XMUA 1U2HA 1WIOA 4R4BB 4WKZB 3R0MA 1MJ8L 2ZX5A 3VQLA 3MLZL 2L0DA 3VSQA 1UA7A 5AYQA 2CJ3A 1XF5B 4IDLA 3HEIB 3WFBL 2OFQA 3RDTB 1GXEA 1E2ZA 2XZQL 4O4YL 4MSWA 3W0WB 3F7KA 5HHXL 4JKKA 3TTSA 43CAB 3QORD 4KZEL 2K4WA 3IVKB 2ZCLL 4AT6A 5CN1A 2YAEA 2J25A 2WTRB 5KYUA 3RHWF 3NVQA 4HUKB 1T0OA 3QT2A 2PYFA 4M7JL 4JK0D 1UKTA 3N1GC 5C3IA 4ZMQA 4KO6A 1OHQA 4JJ5B 5CLXA 2PCPA 3MLVH 3I6KA 3KVPA 3CHXA 3KPMB 1FIGL 4MJ4A 4P46B 1YEFH 1SDDA 3NJGA 1JOIA 3UAAA 4JFHD 4BQBA 2Y1AA 5AD0A 2R8SL 5H35A 4Y0GA 2JKTM 4PHZA 1DQJA 5FYLD 1P4UA 4MQTB 1HL4A 4JPIA 4TULH 3J8F7 2VTFA 3LXCA 3GUTB 5KJRH 4PJEB 3N1PC 3IAQA 2XWTB 3T2OA 3QUYC 4RISL 3RNKA 2VOTA 3H9ZA 3HPJA 1NGWB 2GUYA 1GY2A 3QQ4A 4HFWB 3GJFK 1HT6A 35C8H 2YR3A 3C2SA 2H9GA 1UD4A 4H1LH 2DQEH 4CSTA 1X7QA 1UM6L 2RB8A 1I1YB 1MCRA 2K3TA 4M1GL 3ATBA 3UTTE 2EYSA 2D7PA 2ARJQ 2Q7NA 3VXRA 4JB9H 5TDPA 4RZKA 2Y3AA 3GMOA 3VXUE 2J7LA 2CDGA 1TITA 1UFGA 5I8KL 5IROA 4UQ9A 3MJWA 3VI4A 3F8UB 3LEXA 2CBTA 2ZF9A 4N2NA 1KIQA 5TE7L 3OB8A 2F5BH 3QJUB 4NQDE 3L1OH 4M56A 1LYQA 5L6YL 4PMFA 4LNVA 2L3BA 3QJOA 1M3JA 4GW1B 1SHXA 4F7EA 1HWHB 2HJFA 2RHEA 1BW8A 4UV7L 3U46B 3B7SA 3MRBA 5DD1L 3MRIA 1HXYA 2EDXA 2WSDA 4XXDB 1SFDA 1WD8A 3R7QA 3STZB 3QUGA 3Q8BA 3BPNB 4R4FH 4XMVA 1LO5B 3CD4A 4EZLA 5ACZB 1N0XH 1KGCD 5EEUA 4HD5A 5CD3B 1NWOA 1DLHA 2JJSA 3V9FA 2DD8H 1KLGB 2R29A 1W72L 2OQJB 4KUZL 1DVFC 4LSSH 4PB0H 1JWUB 4DK6A 1M42A 5H37A 4L8SA 2BNRD 2RCSH 4FQHB 1LEKA 4ZI8A 4FQIH 3ETSA 3V4PA 3MRMA 1J5OL 3CSYB 1AXIB 4O58H 5DUBA 1N6QH 4Z3EA 1KJ2A 3S7GA 4Y5YA 3AG1B 3QHZH 3TFKD 1S9YA 3II3A 3MXWH 4NO3B 1T6WA 2YBRA 3O6FC 1HE7A 2ZOTA 4HXBL 1BVKB 4JM4H 3T6WA 3UTTB 2K45A 3HMWH 3AB0C 2A7BA 3VXUB 5F7AA 5JIPA 4Y1AD 1HL8A 3KPLA 2P5EE 3ARED 4ODUB 4DK5A 4K71C 5ERWB 1QR1B 1KJVB 1PSKL 3VDCA 5C71A 2P26A 3LRHA 3UPAA 4NQDB 1XTMA 4OCXL 4P2QD 4UQCA 5LNEA 2VH5L 3V10A 2MCAA 2IOOA 3F00A 3EYUL 1ZTXE 3KYNA 3BI9X 4EN3A 5ITBH 4Y4FD 3VWJC 5KSVA 1AGFA 4U1LA 3ZUCA 5INDB 4JLRA 1QA9A 1UA6L 1INDL 3CBJB 2HTKC 4ELMA 4XAKD 4AYFA 5JUEH 4LARH 3FU5A 3BSZL 4NOFA 5EOQL 3FK3A 3IKCA 3QNYB 3FQ1A 4V1DD 3MO1B 3ZE0E 4RWHA 1TJXA 1Z5LB 4NP9A 5HYIA 2E7HA 2WKGA 3GSVB 4DTGL 2VLRD 4GMSH 1NLBL 2YA1A 4MMYA 4ZUVA 2GK0B 4PG2C 3DSFH 1A7PH 4M3JA 3TN0A 2PNDA 3ZXAC 3EJZC 2FQGA 3U4BL 2MCPL 3U7WH 1RZKH 4JM2D 2ENPA 4EI5C 2R7EA 1G7QA 5HGAA 4QI3A 3CLEL 4K8RH 2ICWJ 3G04B 1G6RA 4HLZG 1GH7A 8CGTA 5CJOL 5INCA 1EGJH 2EIZA 3AMLA 4G43A 3RDTC 3WEAA 3VFSA 1ZLUH 2GJJA 2X7LB 2Q6WA 2WVTA 2OPCA 3FT9A 4L8BB 4MQXC 2OYPA 2P5EB 4L3AA 1EQWA 4PJBA 4QRSA 5K5YA 3B2VH 3CFEA 4MSWB 1F58L 1OB1A 4G6FB 1Q0EA 2ADFL 3KZ8A 3VI4E 2BCKB 1OPGL 3QP3A 1LK2B 2Y5QA 2QBWA 5KYUB 2DQGH 4KRLB 3C6EA 4UINL 4P46C 4PRID 1MFEH 4HIHA 1D5MB 3FUNA 1OP5K 3UX9B 4ZFGH 4AQZA 4EXPX 2WK2A 3JWOL 3UTZA 3FFCA 4WIQA 4PWGA 1E43A 3ZE0B 5JNYA 3PQYD 3Q9QA 3VFOA 1CK0H 3G6JF 1NDMB 3O41A 5CP3H 3UMNA 4TNWF 3V4LA 2H8PA 1RZ7L 1OE1A 4JPIB 4K3EH 3U4KA 2AP2A 2CG9X 2RBLA 3VXMA 4D9LL 1MN4A 1RZPA 2OR9L 3KWUA 5DD0L 1E42A 1TVDA 1ZT4A 5DZPA 1HNGA 3QZWB 3TBVA 3DK2A 5DYOA 3ZL1A 2A83A 4XO3A 3UPRB 4K94H 2YD9A 1ML0A 2QVMA 3D51A 3ZTJG 4E41E 4G7VL 3FN9A 1V05A 1JXDA 2Z91A 2H9GB 3QW9A 3F04A 5IFHL 1UZ6E 2HVJB 3F58L 5CEXA 4L1DA 3D33A 5JDSB 1GMEA 2XV2A 2ZKXA 4Q8BA 1I9IL 2CDGB 4AIZA 3LPGA 5FA4A 4JDEA 4JL1A 2KPNA 3QA3B 4FJYA 3QUYD 3VI4B 3B2DC 5D5MA 2IOMA 3ENEA 2EINB 1CTOA 3ESOA 4LPWA 3SZ6A 3QDAA 1FYTA 5E7FA 5CBEB 4LCIL 1FL3A 4JRYA 4U6VL 1M3IA 1HXKA 3NK3A 2NUPB 3F7LA 4GW4B 3WFEL 3BPNC 2OL3H 1FC1A 5FYLL 3VAEA 1CFMA 1GPOL 1MIEL 1ASQA 2EIBA 2JB5L 1TZIA 3MX0A 3UJTH 2JI3A 3MRIB 5BMFL 4F92B 5L2KE 4PJEF 1NCBH 4R4NC 1RZ8B 1JF1A 5D2NA 1OT2A 1Q0YH 3QUMA 5DJ2A 1OQOA 1A6PA 5JIDA 1O5PA 2CAKA 1I7TA 3TT3L 1YEDA 3T0EE 5T5FA 5I28A 4WUUA 4ZAKD 3DTXB 2KLTA 4JKNA 1CURA 3ML9A 3W39A 4CW1A 4J1UA 4Q9QL 1ZA6A 1WCBA 2Z0BA 5HJBA 1WDAA 5T3XH 2Q1EA 5AW8B 3LEVH 5C0BA 1NMBL 1SQ2N 2E4FA 5IG7B 1MRCL 1NH6A 4E41B 3RY6C 1GL4B 3UZVA 2X6MA 1HX0A 1Q90A 5L4JA 3MRMB 1UYWH 5HVGB 2X4NA 3A21A 4P99A 3E9UA 1BBJB 3H0TA 5LBSL 5KYYB 1JZ6A 3P9MA 2R56H 3B9VA 1ONQB 4Q97A 4YL9A 4W4NA 3WS6A 3C60B 1F11B 5AZEL 1NOFA 2HWZH 2DLEA 3B2PA 1NAMH 1I9EA 4P5TB 4D3CL 4M43H 3S88L 1MFDH 3CUPA 4JVPA 3MCKB 1DVFD 2XX1A 3BMVA 5J11B 1YEGL 2BSED 5EDXA 5I71C 3KBHE 1BVLB 5FYJH 4PGBA 4I3GA 4HUWB 1QUNA 1ITCA 1X5GA 4P23B 1QA9B 2YS4A 1CICB 4M4PA 5GRJH 2K6WA 2NX5E 1CD9B 5L2KB 3O6FD 2R4RL 4D94A 2AJZB 1VFUA 1KELH 5I1JL 1BQRA 4K7FA 3GLZA 3T0EB 5I19H 2A6KA 3IPBA 2OMUA 4ZBJA 3RVUC 3IDNA 3RL2B 3CZFB 1QSZA 1MCEA 3MJ6A 4ZD3L 5I73B 3IXTB 3TWCH 3BFWA 4YUEL 2VO8A 1H9DA 1K4CA 1F90H 2CWRA 3QFJD 3VWJD 2DQHH 2PLTA 1X4YA 4Y88A 1UGKA 1JZ3A 4KKCC 2DKSA 1OGTA 2BP8B 5JW4M 2VT0A 2LQRA 4F37F 4NJ9L 5INCB 3UMTA 5HYQA 4G43B 1MQ8A 1Q9KA 1NCGA 1TOXA 4L3EA 4APXB 5F89A 3FN0L 4UNUA 5E5MB 5L8JB 4MZIA 4NNXA 1WT5C 1QLRB 4LGSB 4XPHH 5I1IL 5AVQB 1LQSR 3HC3H 3PJLA 4C4KO 4BFIB 4F2FA 4H88L 1SY6H 2X1WL 5SX5K 1MVYA 2ZCHL 3GI9H 3WNKA 3SGDH 1FORH 4CC4A 3K6IA 5K33A 3EJZD 3QIUA 5D5ME 4I2XE 3DVNA 4LPCA 3O11B 4EI5D 1I53A 1FYTE 5LJYH 1SM3L 2GJZA 2KBGA 1X5HA 1J12A 3E7JA 4F7MB 2NX5B 4BK5C 5JOEA 1L9NA 2IG2L 1S9VA 2NY7L 3RDTD 2OSWA 3UTZB 3OR7A 5ABZA 2QDWA 3W0WD 1CR9L 3GMRB 5JNYB 2BNQE 3F6LA 4MQXD 3SGKC 3O45A 4GG6A 2WD0A 5D2NE 3IETB 3BKCH 2F7RA 4E9LA 5I0DA 2NR6A 1LO2L 1F4XH 5FLUA 1XMWA 2ZX8A 2EEFA 2WUCH 3L3HA 5MENE 4L48A 5C0BE 3FQXA 3P30H 4P46D 4WWID 5D9SB 3VB8A 1RH8A 1URZA 4FXKA 1HE8A 5ETUA 3FTGB 3EGDB 4EE2A 3QJXA 2VXTH 3QUZA 2P44B 5DGRA 3S36X 3L5WB 2E75C 1LO0L 3I6GB 1ETA1 3W9EA 5CEXB 5IROC 4HJJL 4S0TD 5GRWA 4Z8FH 3OB0K 4Q2ZB 4ZMXA 1ZXKA 3TS8A 1H3TA 1OE2A 5FA4B 1AQDA 4FFWC 2EDTA 3B56A 3GLDA 3US0A 5D5MB 1AQKH 4I2XB 1E9PA 2IWGA 3B2XA 3LKRA 2C3VB 4OV5B 2A2QT 4K4KA 4N6RB 4PQXA 1FYTB 1B4LA 1D3CA 1BF2A 4UUJA 4DHLA 3CTTA 5DURB 3WY3A 3BD4A 4APQB 4JAMB 5D7LA 2MQ3A 1CFNA 5JOFB 5L2JA 3WTUA 4H1LA 5IOPA 1FH2A 2BNQB 2DYPA 3FRPB 1LLAA 3IN0A 5DD3L 5I8EA 1JF1B 1WGOA 2WQ8A 4IK7A 4Y4HB 5D2NB 2N7BA 4G8EB 1VGKA 4X5PA 3SJVE 3O3UN 4MAYA 4WJG3 4K7PY 2E7CA 4NZ8A 3VG0L 1ZRUA 4G6JL 4CW1B 4J1UB 4WFHE 4WAFA 4XCCL 5MENB 5I2IB 2HRPL 4QJ3B 5C0BB 3KDPB 4M93B 1UENA 1FHGA 4J3WA 3VQ1C 4QT5A 4I4WB 2K8QA 1OSYA 1ED3B 4PY7A 3UBXI 1E8ZA 3GMPB 1AAJA 1HNFA 4FZEH 5DJ0A 3SDDA 2D7TH 3FT2A 4N2MA 3I3BA 3C60C 3MOAL 4X50A 3PWUA 4PRHA 5FO9A 3SE3A 4R4ND 2IGFH 3VI4F 2ZOKB 5TE6H 4P5TC 3VMOA 3KLQA 3FFDB 1FNSH 4PVMA 2GFBB 5J11C 5IQ7H 1FBIL 2BRRH 3FS9A 4KTDL 1JZ7A 3DI3B 1DVXA 4P23C 5E6ZA 1E4WH 3HNVL 1CICC 1GS8A 5A2BA 4G82A 1E65A 1ZS8B 4JE0A 3QCTL 4TM9A 4ZFZA 3UTTD 1ZA3B 4H8WH 3VXPB 3FZUC 1D5XB 1QVOB 1QHOA 2X4QA 3T4YB 3VXUD 3QJRB 1WIUA 4GS7B 4G8IB 3T0EC 1C5DB 2YAQA 4YHOH 2BOBB 1K3IA 1E7VA 3SJVB 3ZX1A 2WYZA 1Z9LA 3IXAA 2R51A 4NQDD 5TDOA 1UWYA 2OMUB 1R5IB 1NKOA 3NCWA 3RWEA 2VJXA 3B2UC 3MYZA 3TN0C 3VI3E 5JIQA 5IFJA 5HXMA 2ZX9A 4DEUA 3MRLA 1IILE 4GBXA 3ARBD 2A99A 3X14A 3JT0A 2V3EA 5LO7A 4ERSL 4GEIA 3SGJC 5IREA 2ENQA 4KK9C 4CNIB 4XCEA 4FZ8H 4AKQA 5CSBA 3PWPE 1ETB1 5TDNA 4XAWL 5HYQB 1Q9KB 3VXSA 2VQUA 5IVNA 2ED8A 3ALWA 3FYEB 3PXLA 1GAFL 1X5JA 4NNXB 4A6YA 2FX8L 5IMOB 2FT8A 2KUTA 4JFFE 3BQVA 2OK0H 1M7IB 3PP3K 2HRLA 4X7FC 2LFEA 4BKLA 1E6JL 1KBVA 1GZPA 3GIZH 2AJVH 3DVNB 4ELMF 2J12B 1EZVX 3LHAA 3IJHA 3GO1H 4QO1B 2GJZB 1J88A 1JVOA 1ACYH 5IK3B 1BOYA 4FAAB 1BSIA 4U3SA 4N6QA 1PAMA 1A2YB 1EGJA 2P5ED 1MCWM 4QTHA 4PI2A 2JXMA 3OR7B 4ZW7A 5AB2A 5EWIL 2ZKHL 2P1YA 4PV1C 4G6FD 1M6UA 1WTGT 1DJZA 1IGFH 2R4SL 2B4CC 5B3JE 4NO0A 3T2QA 1NKGA 1WITA 3O45B 1VPOL 3VI3B 3T3PE 4AG4L 2Q20A 2IF7A 3DC0A 1I1AA 1SYSA 1XQ4A 2AJYH 3EYFB 2KS0A 3D34A 3EO1A 3EO9H 2D8KA 3VM7A 1P4LB 1WYJA 2PO6A 3C5ZA 5EIVA 5AAPA 4NC2B 1L3WA 4OKDA 2O5NA 5CU9A 4DEWA 3L3HB 4DKTA 4BE6A 3WJLA 2OX5B 4GXVL 4AY0A 5IUCA 4TMPA 1YEIH 4Q14A 4PBXA 4FXKB 2B9AA 5ALCH 3BSHA 1G9MC 3MNDA 1X5ZA 1DBJL 2R9HC 3PWPB 4YOKA 3QUZB 4LLUB 3AXIA 1T6VN 3AY4A 4K9JA 3MGTA 1MI5E 3RIAF 5KBNC 5E8NB 4PRHE 5ANME 1NFIA 4LRNH 2VE6A 4X83A 2VLLA 3DO7B 4JFFB 4CKQA 2XPGA 1AQDB 1G9HA 1K2DA 4L05A 1YEEL 3IFPB 1E9PB 5JHLH 3KYMB 4APQC 3QDJE 3S36L 3P73B 5FECA 2IDSA 2Y2TA 4PGEA 5FK9B 3LJ3A 3MRGB 4WI5A 2R0LL 3D2UA 3K6FA 3JTTA 4Y4HC 5BVJA 5D2NC 3QYMA 5DTFA 2GHZA 1MY5A 3QQ9C 5FUZL 2VDPH 1F4YL 1CT8A 2QADB 2XWXA 3PFUA 3WSQH 3RGVA 5AVTB 2DTMH 1BXVA 1QFWI 2XU9A 1YNLL 3T3PB 2H3KA 4RH4A 2BVUA 2DI7A 4BCZA 4HG4J 1NDGB 4FFWD 4M93C 2WM0A 2RIKA 4UDUA 3OV6A 5HGGS 1FLTX 1RCYA 5FB8A 3H42L 1CGWA 2AXJA 5BUAA 2AV7B 1KYOK 1JPGA 2OMYB 4TUJA 4ZO7A 1WFMA 4ZXBB 2NY0B 5LWYH 1JGUH 3NRQA 4F58L 3P0VL 4BUGA 2OL3A 3ARFB 4YHNB 3BOVA 1D7BA 1OEZW 5DJ0B 2H6PB 5I1AB 2AJ3B 1ZE3H 1G9NH 1MI5B 1FLRH 2PCYA 3CSPA 3N42B 3MODH 4PRHB 5ANMB 3CN0A 3VXSE 1LO4L 4AZ8B 5E9NA 5D5MF 4QXUL 4DSYA 4KKQA 5BV7B 3TBTA 4HFUH 1EJOH 4IRZH 1KG0A 4E41D 2PWGA 2OM5A 2EDLA 3L2LA 5JR1L 1P1ZB 1CXFA 3NA9H 3QDJB 1T4WA 5C0AA 3GHEH 2EKJA 2VZ3A 3DX7B 3JUZA 1QFUH 4GS7C 3E6FB 4POZC 3HR6A 5IB5A 4E5XA 4QOKA 1I3VA 2BOCB 4XVSH 2CR3A 1A5FH 3D4CA 5C07A 4DH2A 4XVJL 2K6ZA 3C60D 3K6DA 2VDMB 4XPFH 1GGUA 3QG6A 1NPUA 4YZFE 5BO1H 4P5TD 2C3WA 3IBOA 1TFHA 2D3JA 3PAYA 4KRPB 1FJ1A 4QXWA 5LQBH 1OF2A 4PJHA 4AUJA 5EPMA 4X6DE 5I6XC 3JWNE 2IH8A 3MVSA 2FBOJ 3S34L 4OCMC 3NA4A 5IEHA 2VISA 4CJ1A 4IDJL 1U8LB 1CLOL 4P23D 1CICD 2WO3B 3MRLB 2JVUA 3RPIB 2FGWH 1FNEA 5L2KD 4HIIA 3FZUD 5K9OA 4OGYH 3DJRA 5AOMA 4F7TB 5B38B 4UTAL 3IFOB 4K55A 3T0ED 3BDXA 1AFVL 5TDNB 1LM8V 2Z9TA 3VXSB 4X8XA 3R8QA 1YY8B 1WA0X 5E08L 4KY1L 3REVB 5IW1A 1C08B 1DQDH 1MVUA 1QBMH 4A6YB 1I4FA 3B2UD 4YBQD 3QIUC 4GFXA 4BUHA 1CLZL 3OC5A 2APWA 2F7IA 4FFYH 4KAQH 5SX4H 2HPTA 3MUUA 2RQ8A 3LHPH 1HHJA 1KGYE 4BKLB 2YD6A 1GZPB 1IKNC 1MJ7H 1MHEA 1SDAB 4JREB 4FGMA 1R75A 4QTFA 3TIDB 3IJHB 2HXAA 5BZWB 5FKAB 4WGKA 1QLEH 4TNVF 3VH8A 2AW2A 4ZMYA 4RAVA 5C1MB 4YSTA 4KK9D 3ZL4L 4YO0A 5B8CA 5KANI 3HZVA 2YGOA 4DZBA 2FO4A 4ELKA 3GJFH 4ZUWB 4K3HA 1IAKA 3PCYA 4Q56A 5DMJB 4AGNA 4NO0B 4HKBA 4X6DB 5DFAA 4IJ3B 4AV0A 3F5WA 4OZHA 1N4XH 3QUXB 1OK0A 1SHSA 4H44C 1SYSB 4JO3L 2Y7LA 2NTFA 3EO1B 1RZJL 4I1RA 3GZQA 3VWKD 3I9PA 1A6UH 2NX5D 4FXKC 5EIIA 1EH9A 4DN4H 3KCPB 3OBAA 4GMTL 1N8OE 4GIAA 3IB4A 3QUZC 3N1QC 5KBLA 1CXHA 3G9AB 4HMDA 2OP4H 3K80A 3S96A 3TESA 4TQEH 4HSAC 2EXTA 3VH8G 1AD9A 2EDWA 3P2DA 5EFIB 2XQ0A 2CDEA 4PH8A 3TV8A 4LEBA 2CRMA 1KTLB 1RV6X 2X1QA 1VENA 1VSCA 3CNKA 1ZWIA 1RURH 5KVFE 1T7ZA 3EYOB 1MHCA 4LVHB 1D5BA 5A6IA 2VN3A 4OUUB 2LGNA 4MZ2A 4UWQB 2VXVL 1KCBA 1X5IA 2WYIA 3CXDL 3DURB 2J6EL 3GSQB 3GBDA 4XODA 4ABWA 4B95C 1MJJA 4UQ2B 3MLWL 4PGEB 2V0AA 3TF7C 2H26B 5C0AE 4QHNB 4NQVB 1M6OA 1EJ8A 2R9HD 2QADC 5PCYA 3RWFA 1B0RB 4QOKE 4F8PA 1ZTXL 4I88A 4KH9A 1IC4H 2Q7AA 3B3IA 1RP8A 3DV6B 3QEHB 1FPTH 4GG6F 2ATKA 1GC1H 2XACC 2QPUA 4G1MA 3LH2H 5B39A 2IAMA 3QXAB 1YEJH 1RULH 1TZ8A 2E9BA 4A2HA 3UTQB 3TBSB 3MRRA 1U3JA 4FL4B 2ZSVB 1DSFH 3HJ0A 4GSXA 2GTWA 4PJHE 4U4BA 3VD7A 2F8XC 5DURD 4ZXBC 1RJZA 3MFFB 4KI5E 4BFGA 2NY0C 2XWRA 4FLQA 1ZT7A 5SV4A 4APQD 5FB8B 3OAZK 2EO7A 4I3SL 3ARFC 3ARDA 2BNQD 2V17L 3Q0HA 5IEKA 4CMHB 4IRSA 5DZOA 4ODVH 3WE1A 5C0GA 1E30A 2XQYK 1UXWA 4Y4HD 3CVIL 2BP0A 3QQ9D 1NQBA 1K4DA 4F2EA 1CE6A 4ORGA 5BV7C 2CKBH 4OCYL 2BNUB 4J3OG 1QR4A 5MEND 3PYCA 3KMDA 3KYKH 5IBLC 2LTQB 5C0BD 2Y3NA 4F27A 1DBAL 3P3YA 1COBA 3NQKA 1JZ4A 1E5YA 5A6MA 5T33H 3FSWA 4YHML 1XR9A 5IBUB 2W0FB 1HCFX 3OG6B 1IGCH 5J89A 5C0AB 4ZPVA 1I82A 5ABAA 3VCLA 1UWFA 4HF5H 4QOKB 2O1AA 1JFHA 3FYIB 3LH8A 4JG1L 5AVZB 3T3PF 3IGFA 4IHOA 4KRPC 4EBQH 1N68A 1ROWA 3UDWC 4X6CA 4NGHL 2OZ4L 3FQNB 5G4MA 2NUTB 1FJ1B 2X89D 4YHYB 2F74B 3TV3H 1JGEA 1U21A 4OCLC 2AHIA 4OCWL 2VISB 5EOCJ 4IYKA 2E8ZA 4UNVA 1NEZB 5DRZB 2AEPH 3M46A 1NPNA 4R3SA 4HSCX 4PMEA 2LVEA 5SWSD 1FNEB 4IMLA 4POZD 2J57A 3UC2A 1BYPA 4HIIB 3N42F 3VFGL 4UM8A 4WENB 3BEVB 5K9OB 3Q5OA 3FCSB 3SJVD 3ROLB 5DVKA 4GINA 5HYEA 5B4MD 1WFNA 1I8MA 3LS4L 3LKNA 1F2XK 1ETZA 1T7XA 5DJDA 1OP5H 4H0LC 4X80L 5JYMA 2Z34A 2ZXAA 3HMXH 1JDAA 3UCQA 5J5EA 3I85A 3K0WA 4S1QL 1TO4A 4JREC 4O00A 3OJ2C 2EE6A 4ONFL 3NCCB 1RIVH 1VFBA 3VFWA 3VGFA 1TJGH 4GQQA 4IHBA 3BVXA 2J4WL 4DGVL 4PJDE 1JSYA 2HVBA 1E4HA 4OB5L 5ES4B 4WI9A 5IESH 4Y9GA 5A16A 3S8WA 3BAJA 3QAQA 1Z9NA 1ZLWH 4PWIA 4Z7NE 1CG9A 2C9XA 3A0OA 4MXWL 1T2QL 4GUOA 4IJ3C 4DZBB 2VW4A 3JWNC 3TZVA 5KBDA 5KVEH 3QUXC 5IQNA 4A7QA 5IGXH 1I1AC 3KR3H 2YO3A 4HIXH 1H3GA 5GHWH 1Q4NX 4X7DC 4JUTA 3JVFC 2XFGB 2ZAIA 3VFTA 2NTFB 3CPLA 3MLUL 5HDQL 2HX7A 3LPFA 2JKNA 2AEIT 2FB4H 3QK0A 3FL7A 1AC0A 4B60A 1SEQH 3GTNA 3U4EA 4HT1H 3Q5YA 5CSGA 1NA8A 4ZJ9A 2V7HB 1G94A 3UZEA 1J8KA 4O02B 4XBGA 3S96B 2R69H 4Z5RB 2GY5A 2FWUA 2GJPA 3TEZA 3PWVB 2ZWNA 4JQIH 2FVNA 1TDQA 5JLZB 1IZJA 3MRHA 4LVHC 4M8QA 1AXSA 4S1SL 1UXMA 1U8QB 4WV1B 1ZWIB 2WQSA 3O8XB 4PTUA 3P9LB 4O5LH 5EU4A 1D5BB 2UXVA 3STLB 2VDQH 4LHUG 5HP5A 2QGCA 1MXGA 3Q1SH 3K8KA 1QO3B 4PJDB 4ANKA 4E36A 3PWPD 4NZUH 1DJYA 2FECI 1NBZB 3QR0A 1G0XA 4YZFF 1C7TA 4R96B 4PB9H 4Z7NB 2AQNA 1XEDA 3H4FA 1KXQE 1DL7H 5ANHA 3B3IB 1KCLA 1ILUA 5AVSB 4JFFD 2ATKB 1B88A 4J23A 1JZ8A 5T3ZL 1MCDA 4FL4C 1M1XA 5B39B 1RIUL 1J8RA 3F2LA 5T8IA 3ZYZA 4XNDA 1FRGH 2R2BB 1UASA 4K3JL 3MV11 3HUJE 2MOVA 4J7RA 3CVHL 2X28A 3ZGIA 2HJLB 5JHLA 1UD2A 1CFVH 1L0PA 4AYEC 4WHYH 2DAVA 2K8MA 4CMHC 3BCFA 5CAYB 5LDSA 1AP2A 4IKKA 3MLRL 3ME0A 4E2OA 3VFPB 3AVEA 3GMNA 3TA3A 5I1EL 4K9EH 3PL6B 2QADD 4J8RB 1OGSA 1YYLL 5C08E 5DJYB 3MCLH 2BP0B 3UJIH 1MWAB 3MMEA 2R2EB 2LU7A 1W0VB 3GK8H 2LTQC 4YE4L 5IR1A 3BDYH 1HHGA 5L7XL 4Z7OE 4A37A 3TONA 1AY1L 4AV5A 2PW2A 4WEEA 2EICA 3QWNA 1E8XA 1AGBA 1K8IA 5FS5A 4ZXBD 3ULUL 3K2KA 2NY0D 1AVAA 3QFDA 1CXLA 1J0KA 1YMME 5KVDH 2YWYA 3MPCA 4OD2B 1O9ZA 2IH3A 2IMNA 1WTLA 3ARFD 3JV4A 3RFZA 3CFBA 5F3FA 5LBVA 1MI5D 5F7DA 4GAGH 3VCLB 3GHPA 3GXPA 1A1OA 4KXAA 4PWKA 3C9NA 2UZIH 4Q0XL 5DT1H 3V52H 4B9PA 4N68A 1ZT1A 3F3HA 4RAHA 4C54A 1KFGA 5CP7A 1HSBA 4M6MH 4Q89A 4HHWA 3KDMA 2IGLA 3FCTA 1CGSL 4KI5C 2MCG1 5JW3H 4O2EB 2Q7YB 1DBKL 2IV9A 5GZOA 2ICWA 5IBLD 3QDJD 1WD9A 1RMFL 2DJMA 3HUJB 5MP6L 3BWAA 5F1NB 3QBTB 5CD5C 1DBBH 1UH3A 4LLMA 2I25N 2DQUL 3SKUD 4DP5X 3HFML 4LSVH 1DJIA 2Q3XA 2BFVH 3JSSA 4IMLB 4XOCA 2EUVA 4MJJA 3QQXA 5C08B 3TVMB 15C8H 3BSGA 3EHBB 3WDHA 4DCQA 4DN3H 2B3IA 5MEOB 4PCTA 2VDLB 4Z7OB 3QE5A 1ETZB 1JP5A 1UWGL 5DMKB 1HQ4B 2X40A 3OPUA 5DFWH 3GC3A 2YAMA 3QSKB 3IFLH 4N2CA 3GZOA 3D87B 1IVTA 2GSGA 2O93L 3D3VA 1OD9A 3FU3A 5DHYB 4LOVA 4H2CA 1YMMB 3RPKA 4FFZL 4HGKC 1DVUA 1QI3A 4B9CA 4DPCX 3SEPA 4RX4D 1A3RH 2FJUB 1HI6B 2F5AH 2WNWA 2C5DC 5SWZE 4FQJH 3LDBB 1T1WA 2O5XH 4XN5A 2X53A 1S7TB 1P7BA 4XR8C 5A16B 3NFPA 3ISYA 4OLXH 2KI6A 1JF6A 2LAAA 3V8CA 1CLVA 3U0WL 4PJHF 2W65A 4PCKA 3KPSA 1JRHI 3BD5A 4KI5F 1K8DA 3E8VA 3KPRA 4GT7A 5GPRA 1OP3H 1XDTT 1F1AA 3EFOA 1DQTA 4QUOA 1F86A 1IGML 1UM4H 3OKMB 4ZSOE 1SHWA 2X0VA 3ZTNH 2WQUA 2E6JA 4FFYA 4XXCC 3CPLB 5ALBH 3VFTB 3L81A 1DEEA 4XNXL 7FABL 1A7BA 4OJDH 4JY5H 4AM0A 3CJJA 4PGJA 3NZSA 2FD6H 3HG0A 4KQ3L 3LKQB 4HD9A 5DF0A 3C6LB 1FCCA 2WW8A 3O3BA 4K23H 1JN6A 3C5SA 4BWWA 4PS8A 4I3RH 4PU2A 4CVZA 4LPUA 4NUJB 3PPEA 3FTWA 3MRKA 1FH5H 1LMKA 5HJDA 5J9PB 2EIKB 3QUXD 3O8XC 3GJFA 4ZMWA 1NINA 2CUAA 4YGAB 5D1XE 4ODSH 5F7EH 4XB3A 4GAFB 1OPOA 1NJ9A 4GO6B 5J57B 1S5IL 2Y06L 1Q72L 3Q9PA 4MKTA 4Q9RL 1KEGL 1TYEB 2DQTH 2ZXEB 3PWLA 4GQRA 2A6JB 3F7YA 3MUGB 4KVCL 1XD0A 4ISVA 4EF3A 3A6OA 5I6OA 1CFSA 1EVTC 5SWZB 4P5KB 1J1XL 4UDTB 4XNYL 2Z7YA 1RY7B 3ZYJA 2OSYA 5PAZA 2ZF8A 1NTDA 1MJUH 2IAMC 4YHLL 3JTBA 2EXWC 3PP4L 4YXHL 4ENZA 1OB0A 1WFJA 3PHSA 4OZHF 3O2WL 3SY0A 1O6SB 2BVOB 2ESVE 4D0BB 5HVWA 3FQ2A 4TNFA 1O6TA 4ZSOB 1UWEH 2DWSA 4H8UA 2GUOB 4JDVA 4DERA 2KDGA 3FN3A 4NO5B 4KU1A 3VX0A 2ZWLT 5LGJB 4HKJB 5C8JA 2F58H 3PL6C 4LSQH 3MLXH 1J5IA 4GI9A 1Z3GH 2IAAC 1ACCA 1C5CH 1Y6KR 2HKFL 1CZ8L 1ID2A 3HC0B 5FFOA 5CN3A 1TUPA 1A4AA 1CFTB 4L0YA 5D1XB 3RJOA 3WXWH 1AGDB 1NUFA 3B34A 2NYZA 1JPTH 5IB1B 3QI9A 2VR8A 3OMIB 2GT9A 1M9WA 4U1JB 4PJDF 5GXBB 3NIGE 4YEFA 1AGBB 2HT2C 2ZJSH 4NX0A 5AVRB 3SYOA 5IHHA 2XN9A 4NT6A 4OT1L 4U1HB 5HHVL 3SPVB 4N9GA 4QYOA 4Z7NF 2CCVA 2F08A 3KW7A 2NYKA 2QHRH 3CFBB 1U95A 1SPDA 5JHDD 2BIQA 4DAGL 1GMIA 1OZUA 5J56B 1WZ1H 4MB3A 3C9NB 2F54E 1BG1A 5DLLA 5LVEA 4Y2OA 3HOGA 3HN8A 2ESVB 3ARYA 4ZFQA 5ECGA 5JORB 4AYMC 2CKBA 3QB7C 4ZTPL 4YSRA 1MCWW 2QSCL 4FA8A 2V6HA 4H5SB 3GPSA 1S5HA 1UT9A 3KPRE 1TQTA 3THMH 5IJKA 2QTEA 1KJMA 2ZUYA 5ICYB 2PWEA 3ESNA 1ZANL 2APVA 3POHA 3BAIA 1GTFA 5AYUH 4QOKD 3M88A 3TVMC 4U6HB 5GISH 3EHBC 4OFYA 3CDCA 3OKEB 1HHKA 2IPKA 1G5GA 3HHSB 4OKVA 3PP3H 3V0AC 2V8LA 2BHZA 3FH5A 2QV2A 4ONOA 1FYHB 2AI0H 2W9DH 1OAJA 4GG8B 3WD5H 4A2FA 5GGQL 5TH2A 2FX9L 2MQCA 1IGYB 3QARA 4NKMB 5KVGH 1H0DB 3AAZB 1WJ3A 5DHVH 2G3MA 4ANWA 2FTAA 1HAWA 3NIGB 1WZKA 2WBXA 4RFOL 5CD5D 5ESQA 3FU6A 5DS8B 4YDKH 4TVPE 4W9EC 1W2KT 1KB5A 3V55A 2WQVA 4CBPA 2XBDA 3LDBC 3NABH 3LN5B 3PWNA 1F45A 5JO5B 4GRLA 5DHDA 3VU1A 1VEOA 3V5KA 5BV7L 3POCA 4K5MA 4R90L 5C09E 2YMOA 3RIFF 4JR9L 3KGTA 4H20L 3T0VA 5E99L 1T1WB 2CK0L 3VMPA 5EBGA 2HA1A 4XVTH 1IE5A 5C7XH 2F54B 1IU1A 4MJ2A 5CHNB 4X6CF 2J72A 1M05A 1W15A 3C08H 3DIFA 3L3KA 3W2DL 1DP0A 3UTOA 1UG9A 2I24N 4YXLL 1EFXB 3BP4B 5IKCB 1DJGA 3ZDWA 3L4CA 3L45A 1IAIL 2DTSA 4PJ6A 2O30A 2IAND 3E8UL 4RWYL 3QDHA 1ACXA 4IBQA 1FO0B 1DO5A 2W8CA 3C6LC 3DX9B 4FABH 5EO1B 3U4AA 1FNGA 4W68A 1T03H 2XC8A 3V79C 2YUZA 4FMFA 3WL9A 3C5SB 3MV8A 4Z7OF 3DTDA 5DUPL 2FJFA 3HG2A 3SPGA 4CVZB 1ZD6A 1B0GA 4F2ME 4OF7A 3ILPA 3N5AA 3CHPA 5ISZA 4OZFG 3W11C 4AYBA 3LNFA 4U3HA 5AVUB 5F3BA 4FQCL 5IJCC 2BCMA 1NBYA 2P5WA 1E2VA 1XSOA 3QDME 1BMZA 3RNQB 3WEMA 4F8TA 2VC2H 4Z78A 5EV7A 3QPXL 2E7BA 4M5YH 5C09B 1XO8A 1KPUB 1WEJH 1TETH 1JYVA 3G5VA 5C0IA 3CN1A 3FB6B 1S7XB 3WKQA 4P4KD 1FFOB 1TLMA 2R69A 1E67A 5BVPH 4GT0A 2OMZB 3HKFA 5B7EA 2IPTH 4JQIA 5BOZG 4PWEA 3O8XD 3QR2A 2XNAA 3PGFH 4H26A 2D7QA 1I85A 2VIRA 3N3EA 3UJJL 3T77B 1AGCA 3VFVA 3HI6H 2B3RA 4FHJA 5J1SC 4PJGE