1AZVA

Familial als mutant g37r cuznsod (human)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKRLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Subunit asymmetry in the three-dimensional structure of a human CuZnSOD mutant found in familial amyotrophic lateral sclerosis.
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords COPPER/ZINC SUPEROXIDE DISMUTASE
total genus 39
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1azvA00
1SPDA 2AQSA 2ZKXA 1FUNA 3PU7A 2NNXA 3CE1A 3GTTA 1QUPA 2WYTA 3QQDA 1F1GA 1IB5A 3L9YA 1JK9B 2ZKWA 4OH2A 4A7GA 4L05A 1HL5A 1BA9A 1XTMA 4MCNA 1RK7A 1U3NA 1E9PB 1MFMA 4U4IA 2ZKYA 1B4TA 2SODB 1OZUA 1BZOA 1SXAA 1XSOA 1YSOA 1JCVA 1Q0EA 2AF2A 1F1AA 1YAZA 3ECUA 3H2QA 3MNDA 3KH3A 2VR8A 2AEOA 3GTVA 1DSWA 4A7QA 4A7SA 3HW7A 3F7KA 2AQQA 1SXZA 2WKOF 1AZVA 4N3TA 3S0PA 4MCMA 2Q2LA 1EJ8A 3GZPA 3KH4A 1P1VA 1PZSA 2VR7A 3CQPA 1PU0A 2JCWA 1EQWA 2AQTA 2VR6A 4A7VA 1YAIA 4A7TA 3QQDB 1OALA 1UXLA 4A7UA 5KBKA 2R27A 1UXMA 1ESOA 4A7GF 4OJAA 1L3NA 3GQFA 4N3UA 3T5WA 1SXSA 2GBTA 2AQNA 3KM1A 3RE0A 2Z7ZA 5KBMA 1E9PA 1CBJA 1E9QA 2E46A 2WWOA 3L9EA 2XJKA 1SXNA 1KMGA 1N18A 1IBHA 1IBDA 5CU9A 4BCZA 3HOGA 2Z7UA 1SDAB 2AQPA 2WZ6A 1E9OA 4B3EA 1OAJA 3KM2A 3GZOA 1PTZA 1SDYA 2Z7WA 3ECVA 1IBBA 2WZ0A 3CQQA 3F7LA 2C9UA 1Z9NA 3HFFA 4BCYA 2GBUA 3K91A 3KBFA 1CB4A 1SOSA 1OEZW 3ECWA 1OZTG 1F18A 2K4WA 2JLPA 5KBLA 1Z9PA 1HL4A 2LU5A 3MKGA 3KBEA 1E9QB 4BD4A 1COBA 3SODB 1TO4A 2WWNA 1F1DA 3LTVA 1IBFA 2WZ5A 4FF9A 1SXCA 2APSA 2V0AA 2WYZA 1E9OB 1SRDA 2XJLA 2GBVA 2C9SA 1JK9A 1TO5A 2AQRA 2WKOA 2C9VA 3GZQA 2E47A 3H2PA 1DO5A 1SXBA 1B4LA 1N19A 1XTLA 2ZOWA 1S4IA 2Z7YA
chains in the Genus database with same CATH superfamily
4ADGA 1YEKH 1BYOA 4GG6B 4ZSOA 3N41F 3WXVL 1E2WA 4KOBA 4LU5L 1RKRA 2YAEA 1WD9A 4K15A 4JO1H 3ATDA 4NLHA 2YSTA 3RDTD 2O5ZH 2B1HH 1CFVH 2VXQH 5BXFB 2NY6B 2YPKB 3EYUH 3S35H 3WLBA 1BA9A 5I1AB 2BDNH 3WELA 2NRDA 2YGPA 4OZGE 1BZ8A 4FS0A 4PV9A 5AAWA 2FLBT 3QG7L 5D8JL 3LQZB 4UT6H 4I1RA 3UBXB 3O41B 4OQTH 3VB8A 4Y1AB 3RUGF 5JQIB 4MD4A 2HFTA 5K9QI 2H1PH 3LXBA 3BVXA 1HOCA 4JJOA 5HHME 3ARGD 4Z77A 2WP3O 4FQJH 3KWUA 2A4CA 1WGVA 3CBKB 3SKMA 3SQOL 3U2IA 4FFWC 4YHPA 3S4SG 5MEPB 4ANUA 4LDCA 3K6FA 3QUXB 5KOMC 4ZQTA 4KKRA 2XRAH 4URKA 5A7EA 1GCFA 1XGTB 2B4CC 4XMWA 1CBVL 1IFHL 2PXYB 4PVMA 1X4XA 4ETQA 3MRDA 2UWEF 3E8VA 4MMXA 4XPGL 4PJHF 1QZNA 4JFOA 4Y5YA 5CIPH 2BIIA 2GBAA 3VI3B 2ZSVA 2Y0SA 3QXTA 4LP5A 3X14B 3IFNH 4G2AA 1DQKA 1G7JA 4BHUI 1LK3H 1MI5D 1DUZB 1A66A 1NBVL 1JGDB 3AT0A 4GMSH 3WNOA 1M42A 5D6CB 4BFNA 4GO9A 1JDDA 1D5MA 5GGTL 2W9EL 5EORL 5D1XC 3DIFA 2HKHL 4YL9A 2ESVE 2J5WA 3N3EA 5IVOA 3UAJD 1SBBA 4M8UA 5GRVL 4W9EC 4NO2B 3TBSB 1A1MB 3RWFA 1QWUA 3L9BA 2EVJA 4YK4B 4XE5B 3X3GL 4O51A 1SHSA 2V4LA 4QJ5B 3V95A 4P46C 4MAYB 1QX1A 3RGVC 1XF3B 1KJ2A 1NLBH 5DK3A 3W56A 2Q6WA 3H2WA 4LLMB 1A9BA 5MP6L 2YMXH 4FF9A 1SXCA 4GS7B 4P4RA 3KGUA 3OXRA 1XT5A 2ALWA 5F2FA 1OW0A 1EX0A 1IAIM 3HZMA 3PAZA 3TPUB 4YDLB 3T8VA 1A1NB 2C9VA 3L17A 3VXMA 1UH2A 4HIEA 2HWZL 2K8QA 4K7FB 4JY4B 5F1OB 5EOQH 2H1XA 3K80A 2UXTA 2E9GA 3EJCA 4QPEA 1I8KA 2HX7A 4M5YH 2NY4C 2HRPL 3JYCA 5D93B 5FC9A 1W6LA 5ADPH 2JE8A 1QUPA 3FZUD 5HJGA 4KKAC 4XBEL 5GZND 3QUYA 5CJBA 3ES6A 3VSQA 5DI8A 4RSVA 3GMNA 3HAEH 4KKQA 3GI9H 1U8PB 3DPBA 4XZUB 5EIIG 3F7YB 4PJ5E 4DN4L 2YXMA 3BGFC 1N68A 5AEAA 1RIHL 3I6LE 4DQOL 5TPWH 4BFBD 1E8WA 5DT1L 3N85H 5JYMA 1B4TA 3TO4A 2QBWA 5E8PA 3QNZB 5F89A 3KYMB 1JERA 3H2QA 1KF9B 1TTBA 1I7UA 3MTXA 3TF4A 1UM5L 1TCRA 3SKJH 3E6HA 2W81C 4G8IA 2LGNA 4OD1L 3PUUA 4PRDA 4V1DD 2AJ3A 3K1KC 2Q2LA 3ISWA 1PZSA 3BKYH 3HBZA 1IARB 5GGQH 4ZTPL 5D7LD 1XD0A 1HEZB 3DSNB 4N2KA 4LOUC 3QSKB 4JB9H 2RH0A 2XN2A 1RK1A 3FFDA 1AIFB 3MNMA 2YA2A 4JM2F 4YSOA 1NSNH 4PLOB 4Y4FB 2XJKA 4PS4L 5TDNB 3LPPA 3I9AA 4LKXA 4Y0GA 1PKQA 2J1XA 4OJYA 1F3JA 3HNVH 3IN2A 4AC4A 4L29B 4PB0H 2H2SC 2DQFA 2XIBA 5HI4D 3L8QA 5I16B 1AOZA 4AQZA 1ZV2A 1RZFH 4NDMA 5CJOH 3Q6FA 3TYFB 3D1MC 1CLOH 4XOAA 4ZUWA 2A3TA 3LCYA 1T80A 4XMPL 2VDRH 3TV3H 3W11C 4J8RA 1I1AC 4MNQD 5EC1B 4P57A 4QRQB 5D6DA 1F4XH 4PVBA 4YVNA 3HAEG 2OK0L 3OHXB 5GGUB 3GD1C 2JI3A 5DQDL 2ERJC 4GRWE 1NANH 1W8NA 2X6CA 3EHBC 3M1CA 4D0DB 2XPGA 4WKZB 2Z64C 1JXGA 1P2CA 2I32A 4LPWA 1NPUA 1K4DA 3BAIA 3QEUA 1QFOA 1T1XB 2O30A 4Y4HC 1IGYB 5EZLB 2P5WE 4RX4A 1INQA 2VXTH 2YPLD 4DHLA 3ARDB 5I1EH 1ZSHA 2HG0A 3PP3H 3V0WL 3EADA 4PGDA 1TXKA 3UBXG 4NNPH 4N85A 2V17H 5G2NA 3OV6A 5I8OH 4JRFA 1YNKH 4QTIH 1NCUA 4YVUA 2KBGA 4AZ8A 1PLAA 4M4PA 4KJYB 4NQCB 5B1AB 1MKFA 4A2EA 5A16B 3KPRD 2W92A 2N56A 4G6JH 5B4MC 1BX2A 4HJ1A 3ZQWA 1Q9WA 4JDVB 4YX2H 3UPRA 3ARVA 3F00A 2HLEB 1LJMA 1J10A 2NR6A 3MBWA 1NKOA 4LBAA 3B8SA 4N1HB 1K72A 1T6BX 3MRGB 5PCYA 1I8IA 3DX6B 3B56A 3A6CH 3AM8C 4WHCA 4GAJH 3BUYA 4AYFB 3QEQA 2EO9A 1RULL 2C4FT 2N7BA 4PREA 3KH4A 5GZOA 5FYKL 3QI9C 1WG3A 3V52H 4PJCE 3MV7D 3U2SB 1X5ZA 1T0MB 2GT9A 4DGVL 4JY6B 3MRPB 4POYA 1QUNA 1FNAA 2PPDA 5E5MB 1W9XA 2NNFA 5ISZB 5E8OA 2OV0A 3SE9H 1KFAH 1TFHA 3Q6FB 1NDTA 2UY6A 4M5TA 5E94A 1WISA 5TFSH 7PCYA 1ZVHA 3T08A 1PQZA 4EBQH 4QHNB 3N6YA 4JFDD 1SXNA 3GEFA 1NC2D 4P9HL 1VEOA 4S10A 3BDYL 1WEJH 1CXEA 5E9NA 1BJ1J 1AGFB 4KROC 3VX0A 3WJMB 1VZHA 2HH0L 4WO0A 3DUSB 1P69B 3IMRA 2PN5A 4WNQA 1JGIA 4LSSH 3QFJB 1NBQA 4QYAA 4Z76B 5A40E 4NM4H 3RL2B 2ZTBA 1CURA 2R0LL 5IMLB 3BP7A 2J4WH 2VXVH 1U8OB 4HKXB 1V55B 3JWOL 4IBZA 4JM4H 2X4QA 4EZMA 4ZFFB 3IPBA 4H44C 4ILDA 1T2JA 4IYKA 2X3AA 1MZYA 5IMOB 1OZTG 1BEXA 2CLZB 3NPSB 3RVVD 3EGXA 2APTA 2IPUK 2Y1YA 3HS0C 3O3UN 3BUYB 5CLTA 3V6OE 1YPZA 4Z7UF 2BVOA 3IM1A 5I1JL 2WO2B 3PCYA 4HEPA 1LO0L 3QNFA 3ZE2E 5K9KA 2WP3T 4OM1H 1ADQA 3BE1H 1QA9A 3IDMB 3D9AH 3AS3A 4R5XA 4PJIA 1XDTT 3BHBA 4DW2L 1HSAA 2EILB 1H15B 4K3EH 4ODSH 4C57C 5L2KD 2AITA 3L08A 4KJYA 4NQCA 1YN7B 3WMSA 4Z7NB 3GSNB 3C5JA 5HJBA 2FIKB 5IVXA 3BP6A 1CZ8H 5I73C 1OD9A 2Z0BA 1V54B 4YXKL 2DYPD 3IJEA 1OW0C 5JQ6L 1P4LA 4WUUD 4B9CA 4PS8A 4YXHL 3O6FB 4KI1A 5C09D 3P4NA 4ZQKB 2A6IA 2XY2A 5DO2D 3FFOA 4EIUA 5TTRA 4IDJH 1Q72H 2MCPH 4HIPA 5AVYB 3VI3E 4GO6B 5GRUL 5EUOE 4QAWA 1ZGLP 4UILH 4ZMAT 4ACPA 3CSTA 1M2OA 1N6QH 3N1PC 1T83A 4U6HA 3SHSA 5CBAB 4PG9A 5JHDD 2X4PA 4HLJA 3HLKA 3B2DC 2WBJB 3GTVA 3VFSB 1ET5A 5DD6B 3GMOB 2EEXA 3D4GA 3PFQA 4AQEB 2VZ1A 3UBHA 1KGUA 3BD3A 3O2DL 4WI6A 3O3EB 5DMKB 4OF7A 2BRQA 1D5XB 4H8HA 3ZMNA 2WBJC 4IOSD 4OFIA 4JRXE 1IVLA 1YMME 3I50L 3N0PB 4HBCL 4MKTA 3IGLA 5AKSA 4QGTA 3GSNH 1K6QL 4HMCA 4U4BA 3D87B 3MCKB 5J9PB 4KK6D 1TTRA 5CO1A 5I6PA 1UM5H 4W9CC 3EF4A 3UZVA 1N5YH 1NM9A 1DEDA 3MLYH 4G7YH 1DBMH 5JDJA 5FO2A 5IEKB 1TJHH 1HILB 3KDMA 1MXGA 4NERA 3HNSH 3RFRA 3K6DA 4JFWA 1MLBA 3IF1B 4TULH 3SE3C 5DRXA 4X9HA 1Y6KR 2GITA 2QQKL 4MCZB 5B3SB 3IDNA 3MV8B 3IGAA 4ICXA 1PNCA 1OXYA 2WUBH 4AVKA 1CF8H 3WUZA 2D7QA 3BVTA 5E23A 1MNUL 2EIKB 3OAYH 4U1NA 5DVMA 5KAQF 2QSCL 2XWEA 2MNJB 3SDCB 4WW1B 4D7BA 5C3IA 4L9DA 5EBLB 5FX3A 1BG1A 1FAIL 4BDVA 1XZ0A 2OMWB 2Y1AA 3OB8A 1U8MA 4UZSA 4ZD3H 1I1AD 1XBDA 1WCBA 3HHRB 3EJUA 3VG0H 1CLZL 1G5GA 2CDFA 3P0GB 4HIQA 2NTFB 4GI9A 3GM8A 5JIIA 1FH5H 2C9SA 3IFLH 5DI8B 1RURH 3IU3B 1KCVH 4HXBH 1G7PB 3NSFA 4LSRH 5DVPA 1MCOH 3C60C 3DX2A 2X6UA 4RAUA 5D2NB 1DVXA 2JTYA 3JSSA 1KIPA 4X4ZA 3OGCA 3ILQD 4NPKA 4NQCE 4OCXL 3NRPA 4IOFD 1R19A 5A1AA 5JA9A 1FNSL 2D31B 2XCMC 4WI0B 5E6IC 3KYOA 5IKCA 4QRPD 4Y4HD 4I48B 2YZ1A 1EDQA 5AOKA 1KB9K 1KENL 1R33A 5TGBB 2RCSH 4JFFE 4Z0BH 1PD0A 2DLFL 3GO1H 2VH5L 3EYSH 3QXAA 4OZFA 5TDPA 3S97C 2DQEH 4OCLC 4XB3A 5C07D 2NY1B 1ZA6A 3NUKA 4NP9A 4YIQB 2P28B 3KJ4B 4R7XA 1U8IA 3QUKB 4KK5D 1GTFA 1UADC 4C83B 5BZZA 2XVLA 3BWAB 3UZEA 3RY6A 3PREA 1GH7A 4I85A 1I31A 4O51B 2FATH 3FRPB 1H3WM 1KACB 2VDOH 7TAAA 3QJSB 3MO1B 3QQDB 3MBEA 1HYRC 1FVCB 1N8ZA 1UC6A 3CXHK 1R24B 1UKTA 3L3JA 3PJNA 2VLKD 1NAKH 3L6FA 2CKBH 3HVNA 3P4OB 4U6XB 1SBSL 2GVYA 2AGJL 2X70B 1DUZA 1W8OA 2GHZA 3IXAB 3KPPB 3U36B 2CWRA 5LDSA 4FDWA 4PJXB 4DOHB 1J1XL 1MHPH 4U6VL 1AO7D 4BEIA 3BD4A 1W72B 3SPCA 3WTWA 4QHPA 4X8JA 2VABA 1UACH 1V3KA 1NFIA 2VM4A 3BWUF 4NZDA 4XN5A 4EI6B 3OHMB 1ASPA 1W80A 1NH6A 2R83A 2ZXEB 3B5HA 1JGUL 3NJHA 3EXLA 1F4YL 2ZF9A 3NJVA 3ASNB 1IGIL 3U7AA 3RZCB 2VABB 2XWDA 2GSMB 4BFGA 4C59B 4K94H 4OLUH 1TYRA 3MPCA 4OZ4A 2MIZA 1CI3M 2HYMA 1LP9B 4WK2B 2V33A 3VFUA 4M4RB 1E90A 4P8QA 3D4YA 3MZGB 4P9ML 4XMTA 5C9KA 3CHQA 2H26A 3VXPB 2HN7A 3V9FA 2DH3A 4JY5L 1RZKH 3X3FH 1HHGB 4NNPL 3IDIB 4NP4L 3JTSB 2ZG2A 3MNWA 1CXIA 1ZTXH 1MCHA 1DVYA 4AI7A 1MJ8L 2ZCKH 3QDGA 3AG1B 3G6AA 4KDTC 2QDWA 1P7QD 1DQIA 1GKOA 3B9DA 2PF6A 1YEFH 3QNXA 5AKVA 3U4AA 5HJ3A 4ABWA 1R4XA 3AQDA 3MYZA 5E70A 4JHWL 5ERWA 4WFEE 4JM2A 35C8H 3TIEA 2OL3A 3Q2VA 5C3TA 2FHFA 4F7TB 4HOXA 3SYQA 3E2HC 3OKYA 3W0WA 2AKRB 5JQHC 1U8IB 3BIBX 3UO8B 2DM7A 4IU3A 1T1WA 5AVTB 3VFTB 3VFOA 2F7IA 4F24A 5IMMB 1CG9B 1WFNA 2ZAHA 1MHHA 1AHWB 1P4IH 1YQVL 2XFXB 4H2CA 1JGLH 3EH4B 1FL3A 4R26L 2BJML 3KEHA 1IMHC 1XSOA 5DYOA 3HC4H 1N59A 5DJYB 3LS5L 3T4AA 4AW7A 4PCYA 5FO9B 1BWMA 4KFZC 1M71B 5EULV 4HMDA 4PJ7E 4B5EA 1MI5E 5F1IB 3V0JA 4Y89A 3ARFB 1SN0A 1KFAL 3GSUB 3KGTA 4OCNC 4WU5A 1PU0A 1RJCA 4LK4A 1XIWB 5T1DH 3SDDD 5C0CD 3IJSA 2BNRE 5D4QA 3R0NA 5C9JA 1M2VB 5GGSA 3ME0B 4PTUB 4FP8L 3K71B 1BG9A 5J56B 2KLTA 2LTQC 4PY7B 1K4CA 1N4XH 4AQ8A 4PJDE 4DZBB 5F7UA 1MAJA 4ZK8A 3EYVB 4PB9H 3OAUH 2GQHA 5CEYB 1NGZB 1OT4A 4JHBA 3AREC 1KJVA 5EU3B 3S36H 5ENWA 3VRLF 2IV8A 4E9SA 1T1YB 2I07B 3ZT6A 4NBXB 2ZX6A 4WK0B 2J4WL 2VXVL 4TQ8A 1NCOA 4I48A 3WBDA 4AVJA 2WINA 4PJFF 3WS6C 1PCSA 2E75C 4EQ3A 3X11B 4WLCA 1TZIA 3CUPA 2VR9A 1TJMA 4P4KD 4NI3A 2GFBA 4WO4D 3IETB 1DQDH 5F9DC 3OVUB 1DJIA 1DBJH 1RZ8A 2CM5A 3QDME 4CNIA 2FTAA 3WIFA 2J8UB 4KHTH 3QIUD 3VXUA 1HI6A 5EZPA 3H85A 4U33A 1T1ZB 1NGQL 5DEGB 1TTUA 3CLEH 3TA4D 1K6QH 1HIMH 3WNLA 4GMTL 5DD1L 4I7ZC 5IBLC 2HA1A 5HGHA 1IIKA 2I9LA 3QWRD 1FZMB 2B14A 5GGVL 2CE6A 4NT6A 1TETL 4QRFA 4NHCL 4NSKB 5EBLA 1IBFA 1L9SA 4P46B 1PCXA 2FJFA 4N0YH 1WA0X 4OJFH 5EA0H 2IQAB 3GKWL 2C7UB 4NFBA 2QVFB 1DSFH 4HISA 1DR9A 1E4XL 1NGWB 5FO7A 3RUGA 1CDHA 1MAML 1KEGL 4KO7A 1IM9B 2E74C 2EYRB 2A38A 2F8IA 5C08A 2WUBL 1RUQH 4LLUA 1Z0MA 4NI6A 4DP0X 1JTPA 1MLBB 5FYKD 4UILL 3WE6B 5C0IB 1M7XA 3BJLA 2AQSA 3EW3B 4XVSH 3TVMA 4DEPB 3KPTA 3D34A 4PJ8D 1CFBA 1HDMB 1JGEA 4ZPVB 3SPHA 3VYOA 1ZAGA 5HGAB 2Q9OA 3MZTA 1LEIA 1T0NB 3UTTB 4L05A 3DDGA 5CGTA 2YUVA 3LQAL 4PJBF 5T1LA 3C6EA 3WY2A 3NCMA 2ZOKA 2PR4H 5ECJE 4QOKA 3KAAA 1QPXA 3BI9X 3BN9C 4NYLA 2I69A 5E7FA 2NUPB 1CE6B 1TNNA 2Y07L 4U3XA 4PIBA 1UT9A 3HB3D 4KMQA 2ATAA 3ZGIA 5B1BB 1N64L 1NCAL 2XKSA 3DECA 3UL4A 5ITBH 1KB5A 3DSFH 3H9ZA 1UXSA 1OSZA 3D05A 3ZHNA 4Z7OF 2NY4D 1HSAB 2NTSP 3OJ2C 2UYLB 4PJCF 4P2QE 4XVJL 4DCQA 1QSFA 4P4KC 4WWKA 3RVWD 1JZDC 1L9OA 2NR6D 4ZS7H 4J28A 4B41A 5L0QB 3F65A 3ABMB 4KHXH 1EMTL 4M3JA 3AG3B 2KHAA 4MMZA 5AOMA 5F72S 1ZLVK 2BNRD 2ZPKL 2WBWB 3HHMA 1RUPH 4FERA 4PWIA 4UZUA 1XB3A 3CZJA 1VHPA 2XKNA 3HZKB 4ABVA 4F7PA 3CMGA 1FCCA 2F74A 2A6JA 1OPOA 1UA7A 2UXVA 3A6BL 4OV5B 3DUHA 3U6RA 1RK0B 1OTTD 4HS3A 1RLBA 1CF8L 1XGQB 3MJ9A 3BP7B 3RU8H 1FNGA 1J0ZA 1G7IA 4IS6B 4FG2A 4RX4D 3CFCH 1PD1A 4P5TB 3SCMD 3MLUH 1ROWA 3UDWC 5HVFB 1IBGH 2VZOA 4JG0H 3L1EA 4Q9QL 1XVSA 4JK0D 2R69A 3K6OA 4RMWA 1D5ZB 4QHUB 2YXFA 3FTYA 2A5UA 1QA9B 2B16A 2C34A 4FHKA 5F7HA 3OMNB 4JRLA 5KVGE 5K9KB 5E5MA 3V0DA 4B9YA 3CLFL 1Z66A 4MJ5A 2G4EA 2ZICA 3BZDA 3UZQA 3HS9A 2GJPA 2GT9B 3C2AL 1QRKA 4HVBA 2EAEA 3NN8B 4N22A 3U46A 5D4IA 3GHEH 2C5DC 4GQQA 1F56A 1R3LB 3MR9A 4MD5B 1UM4L 1V10A 5F7AA 5CAYB 1BXVA 2VH5H 1B2WH 4MA7L 4GY4A 4N2IA 3C5SA 3F7QA 5T1LD 2X5PA 3Q2NA 2YMOA 3TFBA 1ACYH 1ZSDB 1SYVB 3DURA 2WQXA 5DLMH 3TTYA 4F2ME 6FABH 2Y7OA 4YBHA 4F33A 1AGFA 3HRPA 1X4YA 1CFNA 3IE4A 5FYKE 1SOQA 2ATKA 2UXFA 1SQMA 3HE6B 4XMLH 5DJXA 1G7HB 1OM3H 1KC5L 2DQCH 1GA2A 3BVWA 1G7LB 1PQZB 1MFMA 3ROOA 2D3JA 3HNTH 5ESAA 2X4UA 3LHPL 5E6IA 2CO4A 4OD2B 2CAKA 5ISZA 3GF8A 3SKUD 4KX9A 1OAZL 5ABZA 2OMVB 5CEXB 5EZLA 5IROD 3U82B 3KLLA 2NNCA 3RY5A 2OXHA 1G7IB 3SD5A 4YHMH 4N2OA 4UM9A 1U8KA 5BMFH 1NL0H 2VN7A 4KKLC 1HH9B 1DQTA 3G08A 3LKQA 4NKMA 4OV5A 4NO0A 1CGSL 2W65B 4PPTA 2J8OA 5I1CH 1UZ8B 2FBJL 3AS2A 2E7DA 4ES9A 1B6DA 1G0XA 2DI9A 4OIIH 5F9AC 3TWCL 3ZDZB 5CLXA 1WUZA 2OL3H 5DZPA 1OGTA 4DQAA 2JIXA 2DDQH 1IE4A 4PR5B 4YDKH 1IGFL 1KBPA 5FM8A 3WUWA 2RD0A 4TNEA 3BKML 3HG1E 3Q7JA 3LZOA 3KNBB 4Z7OE 4P07A 2QADB 1GY1A 3DJ9A 3C8DA 3ECQA 1GGTA 2DQFB 4EI5D 4PFEA 4M93C 4PG2C 5J13C 4WHDA 4UINL 2X9WA 1MZZA 2YD5A 4PEEA 1WO2A 1ZTXL 4WI8A 4WUUE 2XLLA 4WW2F 2XV3A 4E9YA 3FU3A 2K8MA 3QE5A 1S9VA 3NK4A 1INEH 2H2PC 2WWNA 5F6IC 2CDGB 4K3GA 3V2AR 3ZTJH 1AIFA 4TTGA 3N41B 1KY6A 3FHQA 1PFOA 2NPLX 3C6LC 1FH2A 2E9BA 1HEZA 3CHXA 5D5ME 1MCKA 4FG6C 4IW4C 1F4WL 2GJRA 4FZ8H 5E8EB 1DVFA 5AVVB 3RWCA 1JNNL 3U1SH 4WEUD 1JGVL 2XTJC 1W16A 5EO0A 4CMMB 4F3FB 3K6IA 4MJ5B 3E80A 2PCXA 1NPJA 3HR5A 1NMBL 2F54A 3P9LB 4I89A 4KRMB 4D9QE 4ZUUA 3T71A 5F89B 2AJSL 1QO3B 4QTHB 4XP9H 3KLHC 4X5XB 4U1MA 2BY0A 5D1ZA 5BUPA 1MRDL 4Z7WE 1ETA1 4ODHL 3TBBA 1PJ9A 5SX5H 4MD0B 4W9DC 2BY1A 3FAXA 1S9YA 3I6KA 1Q38A 1PX3A 2UWEB 4KDVA 5DSCA 3DDFA 3L1GA 3OZ9L 2LLLA 4FP8H 5EPMA 1QSVA 3ROLB 2GIYA 3UBGA 3PJSB 4Q6IC 5E4EC 1RUQL 3X11A 1XR8A 1OO2A 2WGNB 3GZPA 1WZ1L 3CN1A 1S7TB 4CSTA 3MJ8B 3DV6A 5C2BL 1DVFC 5PAZA 5MEQB 5EFIA 1NLBL 3HUJB 4IRJA 1I7ZA 3NDYE 4DAGH 1E4JA 5MP6H 1EJOL 2ITDA 2K9FB 3OKMA 1S3KL 3F58L 5BZDA 1QHQA 3RURA 4D0BA 1CWVA 1WUNT 2FIRT 5BS0B 1QSFB 4WWKB 2GBTA 3GPEA 5DXWA 4ZNEE 4XAWH 5JXEC 4PIRF 1AZRA 3ZRFC 2XACC 3VTAA 1JCKA 4QY8A 2ZUSA 4BFKA 1XWVA 5JPNA 1NEZB 5FO8B 1OARL 2YXWA 4XCNA 3TU6A 1LK2B 4RWHA 4KROB 2FJUB 4B3EA 1SOXA 4OFVA 3V6FA 1MVFA 2Z4TA 4QGYA 3PQYD 1NC4B 4NO2A 5CZRA 3W81A 1AZNA 2VT0A 2XIIA 4XMPH 3HRZC 1S7UA 4K23L 1OKEA 1I1YA 3E1ZA 3RLSA 4FA8A 4MMYB 2EICA 1JZ6A 1KT2B 3T0DA 2XQBL 5K1JA 1KCLA 5DT1H 4C56B 2ITEA 1HWWA 4FLQA 5BQ7A 1NMAH 3VDCA 4PD4J 3UAAA 4IBLT 1U3HA 4O02A 1G1OA 4CN4A 3JUZA 5D2NE 1A9BB 1TPXB 1IGJB 2ZXAA 1Q0XH 5C0IA 1KLFB 1JN6A 3OHXC 1BAGA 1KJ2B 4MQTB 4Y5YB 5E1HB 5FUCC 4DO4A 1AY1L 2ZWNA 1E2ZA 4NUQA 1UJTA 1FFPB 3JTTA 2DM2A 1BIIB 3O6LH 2EH7L 5DZOA 5E1IA 4RETB 5DO2C 4BWTA 2Y6TE 4AIZA 2HUHA 1BZEA 1U8HA 2DQGL 4ODVL 5DHMC 2IH9A 1MLCA 4CC1A 3SQRA 4PMFA 2AFNA 3H6JA 4XC3L 4KXZI 4Y1AA 1HHIB 1NLDH 1NFKA 2IAMD 1IIIA 1TQTA 3T04D 2F6AA 5D6CA 2R59A 4K2UH 1HXMA 4UNTA 4DGWC 4O2EA 3RBGA 2W0PA 4GAAA 1IL1A 3U4BH 4MA3A 1MVUB 1Z6JT 5F3BA 4KTEL 5DJ6A 1HI6B 4S0SD 1NCWH 4OCSL 4XBPA 2SODB 4GKNB 1MCDA 1C8PA 3VXUE 2K6WA 5JW3L 5I1GH 3NZSA 3AMLA 3ULVC 4GG6A 4DKFH 2BPBA 2VLRB 1UM4H 3CSYA 1HQ4B 2F58H 2BCKB 2CGZA 2Y06L 4MMXC 4RA0C 5E4IA 3VFWB 4KHXL 1NFIB 5GISL 3EO0A 1E3ZA 1A6VH 4P4KB 1RUMH 5KSAA 1G1KA 5ELIA 3JWNG 3K2UH 2IH3A 4NQDB 1S7XA 4TSCL 1DBAH 1HOCB 4K71B 2Y2WA 1ZIBA 2C3HA 1MH5B 2A83A 2D2CC 2HVJA 2FX7H 1Q8MA 3NABH 1IVTA 2YAOA 4PY7A 2MNWA 2DQDL 4Y5VB 2CPUA 2VITB 1NFDA 2IPUG 4MQXC 2EXYC 1UA6L 4IHOB 5SV4A 4PGEA 4JQXA 1ZY9A 1Q0YH 1NFDB 1FL5A 2OR8A 1EXUA 1HHGA 1NEZG 5E2TH 4Y5VA 5JXED 2RBLA 4G9FB 5JLZA 2J1KA 1VZIA 2B4CL 2GUYA 2EDEA 3KW7A 3TCLA 1RMFH 2WLNA 2VB5A 1O6SB 4NB7A 1WWCA 2W38A 2Z7WA 2HTLD 3GMQA 4P2OB 2VZVA 3ARBA 2Y7NA 4I0CC 1BLNB 2CIKB 2DYPB 5HDWA 5HI3C 4J2XA 3H56A 3CFJA 2VN5A 1HKLL 3E6FB 4HWUA 4MZ2A 4NPYA 4XP1L 3PXJA 3SEPA 5EU6D 4BJLA 2WXPA 2X9XA 3UPCA 5JUEL 4E41D 5IV2B 4YZFF 3QJOA 2D7PA 2YAHA 2O6DA 2ZWZA 3N44B 4O2CB 3WNNA 4DP6X 3D30A 1Z3RA 5ERWB 4MA7H 4LKCA 1K9TA 4DW2H 3GIZL 2K7QA 3W39A 3U0TA 3NH7H 4F93B 2QPFA 5D2NA 1I9JL 4NUJB 1ROCA 3U4KA 3O4LE 1HXMB 3I6SA 3AXLB 2O4EA 4U1SA 5CBEA 1ECYA 4U31A 3TN0D 1C7TA 1JVOA 1N8ZB 5BRZB 4KH2A 2BRRL 4GAGH 1E7VA 5CGYC 3VXPA 4CVUA 2R4SH 3ULVH 2BO0A 1I85C 2R51A 3HNTL 4AK1A 3NEOA 3WFDL 4KRPD 5DS2A 5I71B 1LP9A 2VLJD 3TH4T 3SYCA 1BFSA 4K73A 3T2QA 4E9QA 1OAUL 2WXJA 1KPVA 4JREC 1CR9H 1U33A 4JN2A 1JWUB 1JZ7A 1PG7W 5ESQB 4UQBA 3NCXA 3WKMH 4N2BA 1A9EA 2V7HB 4F7EA 3E38A 3DHJA 2J12B 1UWGH 5FA4A 1R34A 3INUH 2A99A 5F7LB 1MWAL 1A8JH 2OKMA 3B5GA 1U8CA 3QXAB 4OZFB 1WBYA 4R90L 4B95C 5L2KA 3O2WH 1QSED 3LHAA 2UZXA 2WIIB 4JPWH 3VU2A 1OL0A 1K3ZA 3TWCH 2XZZA 3O2DH 3L7EA 4WCYH 2A9AA 2Q76B 2PWDA 3LKPB 2GTZB 43C9A 3GLDA 3P4OA 1HTYA 3JV6A 1KIPB 1QR4A 3PP4L 4K8RH 1KOAA 4U6XA 4ZMZA 5A2KH 1NIAA 4Z7WF 1MFUA 5DVOA 4J23A 3ZZQA 1P84J 1MI5B 2W5PA 4XCNB 3VYPA 2AQNA 4IJTA 2FO8A 2X1QA 4R6UA 3SQBB 5A43C 1FNFA 2NY7L 3ELAT 3NT0A 3F6JA 3HPLB 4IGBC 3NP3A 3PXLA 4XT1C 2Z9TA 4NN5B 2FB4H 2AW2A 3JTTB 1KB9J 4QRTA 1OLLA 3PPEA 1WZ1H 2AK1H 4MLSA 1FPTL 3WO4C 5D7IE 1T2QL 2JJWA 4TUUA 5GS1C 3QUKA 3C6LB 1A7PH 4JDZB 1WFUA 4ODWA 4YIQA 2A9BA 2R15A 1ITBB 1DQQA 3FB6B 3P3UA 5IW1A 1T0PB 3VFRB 3LRGA 3CN0A 5H8DA 4B9KC 3R7RA 5MEQA 4M6OL 1ZA3A 3CZGA 5IB4A 4F7MA 5HYJA 1N6QL 12E8H 1RU9H 1KXTA 3GSOB 4A6YH 3VD0A 4LSPH 2CHXA 3AC0A 4I18C 3VXQB 3SGEH 5J6GA 3QRGL 3UERA 3C5ZD 3ROLA 4B9FA 1ZHLA 5MERA 1WAEA 5FW6A 4ZUVA 1D9KA 2Z92B 5E4AA 5IHZB 4MSWA 2NX5E 2AJZA 1NUNB 4WGWB 2E7LA 5C07E 2CJ3A 5EU6E 2HB0A 3GSXA 1N0LA 2IJ0C 1FH5L 3M1OA 3VH8A 3L1FA 5KAQG 4TLKA 5FPIA 4YDLC 1GZPB 4IRJC 2FIKA 4Q7DA 5IVXB 3MNVB 3V4PB 3LH2L 3P30L 1JPSH 1RV6X 3QEHA 2VTFA 1A7RH 4FZEL 4ZYKB 1FI8C 3KE0A 3TNNA 3MCLH 1XZ0B 2ED9A 2Q8BL 3N1MC 4MQXD 4P49A 4XMKL 3IVKA 2YO3A 4N90E 5IW6B 2NCEA 2R1YB 4TM9A 1N9PA 2FD6H 2HTKD 1XMEB 1PGRB 1W72H 2DLFH 3L9YA 5ANMA 1BVNP 2BK8A 2BMKB 3ARFC 3WDIA 4UTCA 2RGSA 4G42B 5HYSG 3TL5A 4XOEA 1TJHL 1L9RA 3EGXB 3PWNB 4JANB 3DV6B 4LEBA 1Y7VA 2ZOUA 3IGAB 5IMOA 4OFQA 3NP4A 3BQUD 5T1KD 4H20L 5FGCE 1ZOXA 3EYOB 5E1QA 1Z0NA 3ECUA 1Z9MA 3MA9L 3LRKA 32C2B 1ES0B 3B8YA 3MUY1 3FTSA 1KSRA 5C0ND 5DHVH 3BWZA 3RJDA 2AV1B 4WWPA 4YGAB 2K3HA 3RWHB 4PYHA 3AQYA 3GBDA 4AEHL 3I9IA 4YSRA 5SX5K 4Z3JA 5KYNA 4B6ZA 2OP4H 1AXSA 1R3KA 2UVEA 3B2VH 2J43A 1OE2A 3SDXB 1HHJA 2NT1A 3T0EC 3KYAA 2ZXQA 3UCRA 2KZWA 3GINA 3EOBB 1D5XA 4KMTH 4C58B 1MFDL 3GMRA 1BF5A 2WXRA 1AXIB 4JW3A 4MNHA 3EF7A 2Y36H 2IDFA 2HJFB 2CRYA 3L2MA 1OHQA 5D2LF 4TUKH 4MFHA 5E0FA 3RVXD 4Y2DA 4IKIA 1OAXH 1F90L 2AERT 3ULVE 2D0FA 3SDXE 1UB5B 1V3LA 4TVPH 3TESA 4UTAA 2LABA 1SJXA 1JNHB 1W0YT 1YPZB 1FL6A 1F2QA 1KJ2L 1MJ7H 2X4PB 2YJQA 2CGRH 3IRPX 4NOFA 4B3VA 2DL9A 1WT5A 4NQEB 4WFED 4UZGA 1T5KA 3MRQB 3Q8FA 2WZ0A 4PS3A 3ZU8A 4U0RC 2HT4D 3O11B 5GPRA 1MHEA 1LQBC 4NGHL 5F70A 3TOPA 1F3DH 2R39A 3MSPA 1E5BA 4YZWA 4P2QB 1NBYB 4TSBL 4K5OA 3HMXA 1EHAA 4GRWH 4LARL 1NC2A 3BAKA 4JG1H 4WTZA 4DERA 4BCYA 2ZAGA 1Q0YL 1YPZE 3D85D 1JZFA 4AL8L 1NGYA 4U7MA 3GDCA 2ZUUA 4IRZH 3SGEI 4OLXH 1KIUA 3OL2A 3D06A 2J20A 5EZIL 4ODVH 1X9LA 1BQRA 3DK2A 4JKPL 2L4OA 1E9OB 2EIBA 4N0CC 5AOJA 3S98A 4AQ1A 5B7EA 3WOVA 2EDHA 1QFUH 3BVDB 4CUCA 3T8XA 3A0OA 1WZLA 1AE6H 4PJ8C 1E7UA 3HEIB 3AZUA 3M8OL 1S7RA 3AU1B 3DV4B 1TJGL 4KJPD 4AYEC 3MRPA 2EE3A 4N0UE 1QNIA 4WIQA 3ALXA 4N8VB 3QXVA 5JW3H 1QBMH 1PLBA 4Y88A 3EG9A 2W95A 1U8LB 3SY6A 3TA3A 1EEQA 1LDSA 3GJFK 4JO2L 4HKXA 4AYFA 1I85A 1A14L 5A2JH 1JNJA 3FSVA 3Q5YA 3NAAL 1DVFD 3GSQB 2A0LD 3NFSH 1KCSH 4OIFA 1JZ2A 5SWSB 3QWQB 1ZLEA 4N8PA 3VD3A 3VXMD 3BX7C 3FTVA 1AGBB 4ZXBB 5L7XL 1HH6B 4F27A 4UM8A 5HHPB 4BSVA 2DEXX 2OI9B 3CH1B 3ZSTA 5C6PB 1GGBH 5CKGA 1JUFA 4ZFOL 5E08H 2FQEA 4LLDB 5D5MB 4HEME 4EN3A 4QXVA 2PXYC 2YC1B 4P9MH 5HHPA 2UX7A 1CFSA 3BZEA 4HK0B 2L8AA 3GRGA 1E42A 3MU3A 3QPKA 2E27H 1SYVA 3DURB 1DSYA 3DGGB 1CN4A 1RZKL 4G7VH 1QSFE 4CU7A 5E8DH 1IEBB 3WKYA 4DUXA 3PWJB 1S46A 3F84A 4N2EA 3ARBD 4L8SA 1RK0A 4JY6A 4JHZA 4YS4A 1EJFA 3LSOB 3QCTL 3PWPE 4D9LL 1EV2E 3NRQA 1RPKA 4ODTH 3BSGA 4M6MH 5GGVY 2ARJB 3OJDB 3HZKA 4JJ5A 4WWOA 5D71H 4GRLC 1MJUH 2DS4A 2QKIB 1ND0B 4OAWB 2EEAA 4G82A 2AK4E 1N7MH 1I3RA 1PIFA 1RERA 1NBVH 3TWYA 1I8IB 1UOVA 3DRQA 2N59A 3RNQA 2DH2A 3IB4A 5AOZA 2V5MA 5EU4A 3ZTCC 4G8EA 3LH9A 4QEGA 1K3IA 4EDWL 1E3XA 3T6ZA 4HIIB 1D5ZA 2D03L 3KJ6H 2EYTA 5F9WC 3IWVA 4ZFGL 5EIIB 4BFIB 4AH2A 2KKQA 5AENA 2JKTM 1PZ2A 2EIZB 5JHAA 4XMXA 4NJAH 4P9HC 3AMKA 4Z7NE 5DD5L 4MB1A 5JIHA 3PDGA 4XXCA 5FGRA 5LVEA 1TETH 2VDKL 3S36X 4F15B 5L4JA 1BVOA 1MIEH 4XN4A 3OR7A 4X80H 2OJZH 2X4NB 3RX7A 3LMJH 1MCNA 2NW2A 2WUCH 3JT0A 2CBOA 3F8UB 4DFIA 1QNZH 4OM0H 4X9BA 4AXWA 2X4TA 2MQ0A 2HKFH 4NEHB 4AWJC 1KEGH 3HG1B 3MLWL 4YNYA 2AV1A 2YMXL 1NMCC 3CGTA 1T04A 3CSPA 2P5WA 4P2OC 3H4FA 4M5ZH 2JB5H 1B0WA 1DLHA 3HC3L 3A47A 3GBMH 3SJVD 2GC7C 5FYLL 5FECA 5C0DB 1CIDA 1R47A 1ZKAA 4KUZL 5SWQA 5DCCA 5EN2B 1YCSA 5BRZE 2FGWH 3MRNA 4GSDH 7CGTA 3PWNA 1WC7B 3LQAH 4UT9A 5E6SB 1QASA 2QVKA 1MEXL 4K94C 5DFTA 1EGJH 4I2XA 5E2UL 1CQKA 4JFVA 5LBGA 4NKIH 1FBIL 4WTZG 4P23C 2R69H 4JFQB 4NENB 2AJYH 3Q3GA 2Y2YA 5LCVH 1BBJA 3TNMB 3CDFA 1J8HE 3PP4H 4G1MA 3ARDC 5CMAA 3OZKA 2FX8H 5DUBA 3RI5K 3DSFL 2BY2A 4Z7QB 5LKNA 3KGRA 3X1EA 4LLQB 1ZTMA 5LB1A 4RFOL 1BXUA 2X12A 5MHSD 1FIGL 3SKJL 4ZS7L 2AJXL 4WI5A 1U21A 4W1TA 3FK3A 3MRJA 4RVBA 4N0UA 4YE0A 4OJFL 1ZLVH 3WFBH 4H20H 4BUGA 1ET7A 1WE5A 2FJGB 4W9HC 4R83A 4TVPE 1A6ZB 2NQDA 3KL5A 2XN1A 1KCUL 5HYJB 4TL5A 5FO7B 3LKRB 2IDTA 3CC1A 1PLCA 3ILPA 5DUPH 3FTZA 2E7CA 4H25B 4YHNB 3QQ4A 5F6HJ 3ZQ9A 4LAQL 2C1OB 3APMA 4BKTC 4IBUA 3DHPA 3BZ4B 4ONFL 1RJZA 1ZWIA 2H6PA 2CK0H 4GOSA 4LCWA 4YUEL 4L0YA 1E8YA 1YN6A 4K5MA 3TURA 1RZFL 4P5TC 4HV8A 4RBPK 4CU8A 4KMTL 5JOFB 1JWSA 2R2HA 3MACH 4D8PA 3QIWC 2F5AH 3GS0A 4BH7A 1DZ0A 4FQCL 4YLCA 5HJDA 1UWEH 1FV1B 1UZGA 1CE1H 2VXQA 4Q89A 4A2GA 3EUUA 3PNWB 1G9NH 1ZIAA 5KSBA 2PABA 4GIAA 5EBMA 2DQMA 4D8OA 4F92B 1IX2A 4PRNA 5F6IB 5E9AA 4LE8A 5GS0L 2Q3AA 3DMMA 5DRNA 3MCLL 3C2AH 2BVEA 1J0YA 4E9VA 4HU2A 1XQ4A 3LS4L 4TUJB 3A67H 4H40A 3HMXL 4HAFA 4IEFA 2OJEA 2JK5A 5INCA 2QDVA 4GT7A 5IBUB 5AL0A 5BV7L 4HIJB 5A6MA 1S7SA 2BP5M 2EKJA 2ZUYA 5CNHA 4MMXB 5DFWH 4RQQB 1UJ3A 5D1ZD 1F13A 2PTUA 1A4JA 4JHVA 4LPCA 4ONGL 1NCBH 2CKBA 2W88A 4PCKA 1IC0A 1OGAE 1H3VA 3A6BH 3T3ME 2QGCA 4AENA 4GEIA 3V7AG 4OH2A 4KKZA 4Y2DC 3RVWC 1YNKL 4L9LA 4QTIL 2A9MH 5FYKU 4J6RL 4BXVA 2WYIA 3DX7B 3UBXA 1TF4A 3U30B 3MRLB 1PG7X 4G5ZL 4I1NB 2IPKA 4PB0L 3ZDYB 4M4RA 5IB5B 5BV7B 1MCLA 2DYRB 4F91B 5JW4R 1M7DB 2RALA 5GSVA 1S2EA 2DJ4A 2DM3A 4NWUL 4U7KA 4Y4KA 4PHZA 4JDTH 2M1KA 3O4LA 4NUJA 3UAJC 1A3LL 1T7WA 4ALAH 1P5VA 1YY9D 1EQWA 2A9DA 1AKJB 1DANU 3PWVA 2VW4A 2QQNH 1WHOA 2J1ZA 4A7TA 1U8JB 2B2XL 1T1WB 4KJWD 3VFTA 4PM1A 1FNEB 4W4NA 1S9XB 3HUJF 1SVCP 3TGXA 1F4XL 1R17A 3SDYH 1KNOA 1B6UA 1CD1A 1I82A 4JM2B 1Z5LB 4ZX4A 4Z7AA 2FNWA 1E9QA 4WEEA 3MLTB 2GUOA 2AJVH 1KG0A 1FE8H 1HQRA 3D52A 3GGWA 4GO8A 1P53A 1AGCA 2XDHA 3FSAA 1ETZB 2ERJB 3IXTB 4YLQT 5DMGC 4NWTH 2PWHA 3D3VA 3CSGA 3MXVL 1J8RA 1W0VB 3TPKA 4OUUA 5KVEL 3SBPA 3ALWA 4R96B 5D1XB 1VFUA 3D12B 1TEGA 1RIUH 3HLAB 4EPSA 5I66B 3FNKA 4X50A 5T3ZE 1FFNA 3VGEA 1ZJBA 3T8MA 5DFAA 2B5IB 3PDOA 3QIWB 1G7QA 5E6YA 2BH0A 1EXUB 1GY2A 5F7EL 3VFUB 4KO9A 4GQZA 2ZOOA 3KWVA 1OP5K 5K93A 1IU1A 4HZ1A 5DQJA 4DF9A 3JT2A 2IQ9L 3CC5A 2EDKA 4BGDA 4XXDB 1TQUA 4YDJB 4LRNL 4IRSA 4TS6A 1AE6L 1UJ3B 4GP5B 3RDJA 3V4UH 3FQNA 1S7SB 4W6WB 4WKXA 1D2OA 3VXSE 2KL6A 3BDBA 2DBLL 3QR2A 3BQVA 3P77A 2RJMA 2XYCA 5TE7H 3VM7A 1THAA 1BREA 5ALCH 3KYOB 3BESR 4RAVB 3BEWB 4WWNA 3LRLA 3G6JF 1WZAA 1EZLA 1ZK5A 3H55A 5HHVH 5KVDH 1CGTA 3O3DB 4I3RH 5JMRA 3VO0A 1LMIA 2QVIA 4QJ3B 5HHNB 1HNYA 3PU7A 4HC1H 4HOZA 5K5YA 1RIVL 3CDZA 3LEVL 3QQDA 3APDA 3ARXA 3IU3A 5ACLA 2Q7YA 3D3VE 1HL9A 4M9PA 5I82A 5LG1A 1BXAA 3AUWB 3DI2B 4YXHH 3FUIA 1KWGA 1SF5A 3L4TA 4G83A 1RK7A 3TZVD 3AXIA 5DD0H 1I3VA 4MZ3A 4KKNA 3MRMA 3QJXA 5C7XL 2EABA 2Z8VC 4PJXF 3FF8A 3ZYOA 5SWZD 4HWBA 4PJ7B 3F12B 2R1WB 2F68X 4TQIA 2R9HC 3VW3H 3HC3H 1RJYA 3L3HB 3QZLA 3TT1L 2AQQA 1F6FB 4UI2A 2MMXA 3KS0H 3WY4A 4X6CB 5CN3A 5KYWB 3QIBB 3MV8A 4DAGL 4G6MH 4FKEA 2ZNXA 4YOKA 2DD8H 1JN6B 3WEAA 4FJYA 1N0XL 2C9XA 2PPAA 3BWSA 3QUXC 4BUQA 5JIPA 1VKXB 5E9DD 2HT2D 1U3HC 4XAKE 1E4WL 4WJ5B 1BD2B 2J73A 5KSAD 5K1VA 3RX9A 1H0DA 2X3CA 1CK0H 2XXMB 2CJTA 4LP8A 2F1BA 4KX8A 1DJYA 4FL4C 4LOEA 2WB1A 5DJ6B 5J3HC 1MXDA 1RZ7L 4XCYB 3B43A 2H0PA 1UM6L 5JO5B 3WAJA 3OXSB 3TH3T 4FLHA 3GTNA 3KBHE 1MRCL 2B5IC 4ABQA 4H4NA 4Q9RH 4G1MB 5CMAB 4EZLA 3ULVF 4RMVA 1V7NH 3L3IB 4YR6A 3UZEC 2F18A 3S37X 2FLMA 1SFDA 1YNTF 2OX5B 3DOIA 1QLFB 3N0AA 4ZMWA 4OLZH 4YFLF 5JPNB 2J88L 4YHNA 4Z23A 2P52A 1I3GH 4FXGA 3BN9D 4UU9B 1S7WA 5K1NA 4PJXE 2DJSA 4DOHE 1QNZL 2A73B 1JAEA 2YD6A 3P0YH 5HD8D 2YBRA 1DHKA 3FTUA 1NM4A 4XNAA 2WBJA 5BVPH 3BQUC 5D72L 4E42A 2X28A 2QSVA 1OWRM 4M5ZL 1TO4A 1ZHBB 2QKIC 1E67A 4U2YA 1RHFA 1XF2B 3WD5H 3B2XA 1NCCH 1RCYA 3NA9H 2IANE 1JK8B 2HLFC 3WTYA 3J7HA 2PO6B 2WXQA 3GJFH 4QYOA 3NA4A 4WFGD 1FJ1A 3WSQH 2P8MA 2WBXA 5SWZB 3KHOA 3OAWA 1XR8B 4PP1C 1V7ML 5IHWA 3AFLA 3I74A 4OF3A 3E2HB 5HPMB 4EVNB 1BEYL 1TEYA 5LXGH 4QHMA 5D7LE 1NKGA 3KEDA 2IBGA 3VD4A 3U79A 4JNXA 3GSWB 4KKCD 4DJMA 1L3WA 3O3EA 5DMKA 2QT6A 5AYUH 1ONQA 3GUTB 1PG7H 4KTEH 2ZSWB 2J56A 4EEEA 3FO0L 3DTXA 3MOQA 2GTQA 3IE9A 1HZHL 5C09B 4QHLB 4QTHA 3L3OB 4TQEH 4WW2B 4L1LA 4KXAA 1AI1H 2OMZB 2AXJA 1BVLA 2XETA 3D3VD 4YHKL 1ZRUA 4GUPA 3MRNB 4MQ7A 3HB3B 5LN4A 4PRIB 1OTUC 4QO1A 2V2XA 4GRWB 3I9GL 1IM3A 5I75B 2JKNA 1IAIL 1YECH 4HPOH 1XCTB 2V9UA 2NY2D 1DLHB 2HFEA 4IU2B 2X4QB 4K7PH 3WL9B 1YJDC 1EA9C 1UOWA 5FOBB 3DHUA 4R8WH 4F8PA 1FVDA 1U8OA 3SGJA 5I6NA 2WLKA 1WSST 1F42A 4L8SB 1XB6A 3B7SA 3IJHA 3MJ7A 4KZDL 4HHAA 1G9MC 2FQDA 4Z7VF 4JO3L 4HEMA 1R3JA 4MA8L 4P99A 2K0RA 3GDBA 4NQEE 3WJMA 4RGNB 4JFHD 4JN1L 1OLZA 4Y4KD 1E6JH 3AABA 4YDMA 4Z3EA 2G0KA 5JHLH 5LBSL 2GIMA 1OSPH 2ADIB 2WLIA 3HOGA 4OCWH 4WAFA 3KLAB 3MQIA 4ZOBA 4WTXA 3QHZH 1NCHA 1A4AA 1ACXA 2F5AL 1U9KA 4LPXA 3CVHH 4U1IB 2PYFB 5GS1B 4OGZA 1J1XH 1MHPL 3K72A 4S1SH 5FW8A 1KIQA 2GEQA 1FYTD 5CSZA 3DO7B 3MLSL 1LEKA 1G84A 1I3RB 4IKLA 4X6EA 4WY7L 4M43L 3P3TA 4D9RE 4XVUC 3KYKL 1YY8B 1IQDB 1NCWL 1GSKA 2F54D 4FNTA 4OCXH 2YKLL 5E1AB 1DUYA 3IFOB 1P7KA 4NZUH 1QVOB 2P42B 3CVIL 3SD2A 3HZVB 5J12B 1XCQA 3OF6D 1I1AB 3D2UD 2Z31C 4X42A 3QO1B 5T5FL 1QHPA 5C86A 1T03L 4OI7A 4FFZL 1F1DA 1H3PL 1CDCA 1BSIA 3U83A 3ZYZA 1AD0B 1QPPA 4YMPA 3UAJA 2VAAA 1JF5A 4QKXB 1JIBA 3RVTC 3SCMA 4LSQL 4KVCH 4HK0A 4UBDD 2I9TA 5B38B 1DBAL 4GSXA 1PAZA 3V0GA 3F3HA 5JHDA 3FONB 3BMVA 4PGBA 3U48A 2PYEB 2WMPA 5CJ8A 4ADIA 4GRMB 5LAPA 2XWJA 3HE7D 1MRFL 3DBXA 2NUTB 3ARRA 1V05A 4G5ZH 4WV1A 4JRXB 1G7LA 1OGSA 2EEDA 1OCZB 2AVGA 2Y1ZA 1JFQL 5INDA 1ZVSB 3M86A 1E30A 1RFDH 4DO5A 1J05B 2X7LA 4W9FC 1MY5A 4F33B 1KGWA 3MHZA 3PY9A 4PR5A 4U6TA 3WKML 1LLAA 4QRRD 1IAOA 5D96C 4PREB 1J5IA 2GJ6E 2XPGB 4WKZA 4Z3HA 2CJUH 1OPGL 2GSGA 3P11L 4B60A 3FKUS 4ZMXA 2WB7A 4AEEA 1KZQA 5DUMH 2NY3B 3BUDA 1HESA 1TKWA 3KH3A 4M7LT 4LLYB 2WC7A 3SDYL 1DUYB 2DQJH 3C09B 2XPZA 1V8HA 3UTTE 3NFNB 1P5UB 4PJ7F 5F21B 1T66D 4EIGB 3OTTA 5KYYA 3UPRB 1F58L 2W0LA 4JS7A 2DN7A 4K8RL 4KAQH 2ZX7A 4PJFB 3NYKA 5E1GA 1F02I 4R4FL 1HEJC 3HJ0A 4YPGA 1UQSB 2IVFC 1Y18B 1BD2E 4WK4B 2X2YA 3B34A 3MX0B 3NH7L 4IDLA 1G43A 4PGDB 3FFCD 4L29A 4X6DE 2WBKA 3RNKA 4OCRH 5F9JA 2XV0A 1WCQA 2GIXA 3FONA 1WAAE 5AD0B 1T1XA 3VG9B 3OM3B 1E5ZA 1CD8A 3GXDA 3BPCA 3AROA 2A74B 2BHUA 4G80A 1R3JB 1E27A 3I3EA 4XNXH 2YK1L 3GUFA 2P8PA 4TKWA 5CINL 1B0GB 1BBDL 4GFXA 5KUMA 1JNHA 2BSRB 1UB5A 4JO8A 5IWLC 4LNRB 3SKOB 4MAYC 4FKHA 5EUOB 4HH9B 4XCFL 1B2YA 2HWZH 5JPMA 4J8RB 1AFVL 2K4WA 3CFTA 3D48R 3D39B 2YAMA 3MXWH 4PWKA 2Q86B 4GS7C 3T0EE 5IUCA 3SDAC 1RZ7H 3FMGL 4X6EB 4B9GA 5AW4B 2Q2EB 2GJ6B 1A6UH 2HRPH 4EXKA 5IFJB 3QWNA 5MEND 1RUKH 2D9CA 4BYHA 2UYLA 1CL7I 3VGAC 5HHVL 5KVDL 2R4RL 3FOMB 4ZW6A 4BZ1L 3NSYA 4KRLB 2KI6A 1JPSL 1PMYA 3JWNH 3WG7B 1QW8A 4OLWH 5FLUA 4AZUA 4ZMOA 4OLZL 5LNGA 4N4YB 3N9GH 2CQVA 5EA0L 1EERB 1Q90A 1JV5B 3X13A 1IT9L 1MWAB 1S4IA 4MBRA 5DD0L 4ERSH 3NPZB 4PP2A 2H47C 4WWID 2A77H 3DYMA 4OD1H 3ESMA 4MXQD 4ZFOB 1FNGB 4FQJL 2ORBL 3CZKA 2P5EB 3GTTA 3VXQA 3KCWA 4HF5L 4ZS6D 5JORB 3QB7C 3QZBA 1Y1DA 2OQJA 3ABLB 3GRWA 4X6DB 5TDOB 3TPUA 4A7GA 5CEZD 5FDWB 1U91A 3II1A 1XTMA 5HHOA 2ENPA 2A6JB 4A63A 2WCGA 1I1FB 1PD6A 4NCC2 2OZ4L 2PWEA 5FUZL 3FO9B 1XCTA 1YEJH 4WGKA 4XPGH 3A23A 4Y16B 4JDZA 5ISZE 1LEGB 4NZ8A 5BV7C 4KKLD 5ECGA 5D7SL 3SDDB 3ZE1F 4A7QA 3IMBA 1DE4B 1FDLL 2IAMA 2FWUA 2ZX8A 5C0FA 1A47A 4AEHH 5G4NA 1CFQA 2HMIC 3CQPA 4JKNA 5TE6H 1LILA 2JNZA 2MPAH 4JR9H 3VDBA 1MI5A 2VC2B 4NSKA 5D5MF 5CR8A 4HPYL 3V6OA 1L5GB 5ITBL 1R5WA 5EG6C 3P3RA 2AXWA 5FR3A 1X5MA 3QFGA 3ZE0B 5FB8A 4P5RA 3T5WA 4PV8B 4X9IA 2Y5QA 4MDJA 2H32A 3RE0A 2WTRB 2ZD0A 1WIUA 4DN4H 5F7KC 3D85B 3LX9A 3RYMA 2H7WA 4WI3A 1OTSC 3WIFB 1I3GL 5C8JA 2DOCA 2DWEB 1LTXA 1UH4A 1MG3C 4TVPL 1ZLWK 2CXKA 4NQSB 4RDBA 4XMKH 5ES4B 5JYLA 5KVGH 3F7VA 3ATFA 1EXHA 3EGSB 5FA4B 3V0FA 1H8LA 1RZKC 3QFDA 4RGOH 4M1DH 4MA1C 4G8GB 3NQKA 2R2BB 4FTVD 5DC4B 3O0LA 2Y72A 4AKOA 2XN0A 3TT3L 5D1QA 2BOBA 3TV8A 1E5CA 4FXTA 3MUUA 2JI2A 4JN1H 4KXDA 3JUYA 2IQAA 2P5ED 1A1MA 1TVBA 4MD4B 1UOKA 5EOQL 2XQ0A 5IBTH 1UCTA 2VM3A 2IOOA 5IR1A 3UPAA 2GTWA 2R0KH 4DNLA 4Z0XB 2ZX9A 1Y6NR 3MOAL 1CVRA 4ZX3A 3H54A 3FPXA 4NRXA 2BHFA 2XKUA 3RGVA 4OTXH 3VFNA 4QXWA 3TXAA 5ALBH 2CO3A 1J9QA 2Y07H 3VE0B 3ULSB 4HKZB 3FBKA 4QXTB 5CD3A 3NCYS 5HP5A 5FA3A 3CDZB 2OBGA 1DJWA 5HHNA 4ZNCD 5I1KH 3QA3B 3A6OA 3PIQA 4MWFB 3O4LD 3I75B 3UDWA 2AC0A 2NY6C 1CICB 3D07A 2XFXA 2EZ0D 2YPLE 3D18A 4H88L 5I18H 4RZCB 4TUKL 5IJBC 3PGFL 2VLKE 3RP1A 1LE9A 2OAAA 1HL5A 1GR7A 1U3NA 2FT7A 5ENWB 4IU3B 5DLML 3B1TA 5F88B 3V6ZA 2BIHA 4A2LA 5LN8A 1BOGB 2AXHA 3SE9L 3SBWC 4F80A 1OAKL 1ZT1A 2A4EA 2BVUA 2OM5A 3CIQA 3GFUA 3NJKA 4CW1B 4A7SA 1QEXA 2DRUA 1B90A 5A2AA 5F8RC 4N3TA 4PTUA 4NO3A 5C9JB 1MELA 5IB3B 3WLBB 4UV4L 3JWNC 4PLJC 1PS3A 1RXLA 1WD8A 2RQ8A 1IBYA 4AL8H 1TZGH 1E6JL 4EUPH 4TNVF 3O45B 1BQHG 3AU0A 4FI8A 3QZWG 4PJDA 5HHXL 5IQLA 5HYFA 4ADJA 4NZTH 3V4PL 4ZMNA 5CFHA 2FWSA 2ZUXA 3IGKA 1CDYA 3G5YA 1VACA 3QORB 2Z1PA 3V4LA 4YX2L 3ZT7A 5DUML 4Z7QE 1GMIA 5GS3A 1LWHA 3VG9C 3KLQA 3QH3B 4WJG3 2QPEB 3RZCA 2ENJA 3SKNA 4F7CB 1BQHA 1AJ7L 1AP2B 2AQPA 1SDDB 3GB7B 3P77B 1BIHA 1CD1B 4Q9CA 2P26A 1VJSA 3B2UC 3KPNB 3MLZH 3NGBC 3GMQB 3QRLA 1KYOK 4YK4C 5KTEL 2IC2A 3FSOA 4HGKC 4NAQA 5DO8A 1SY6L 3SJVB 2YD2A 5IVZB 5DURD 3C87A 3BFOA 5HYJE 1K8IA 4M03A 1BQUA 1HXYA 1TPXC 1AHKA 1YMHB 2VQUA 5T33H 5JOPE 2ADGB 3C6SB 4FTVE 2N7AA 5T5NG 3U9UB 3C60B 1DVQA 2X9ZA 3C6SA 2EP6A 2YMTA 3EHBB 1FFNB 2JIXD 3MRLA 2PPFA 5CIPB 1MVYA 2FE0A 3M6DA 2NX5B 3RKPA 3VCLA 5EZJB 3SYPA 4MAYD 5HGDB 4M6NH 1DBBH 2WNWA 1CMOA 3D3VB 1INEL 3MN8A 4XO9A 2ADYA 4ZPTB 4HT1L 4XPTH 4XO5A 1T5WB 3T3PB 2E8YA 4MYWB 3SDAB 1NGXB 3C5ZA 3T77B 4LCCC 3G04B 2BLFA 1GC1L 2ITCA 1JZ4A 1GYAA 1BGXL 1RP8A 3A6CL 3NIGF 3DX0A 4LMQE 3LDBB 3ZYJA 1QRNA 3NSXA 4JM4L 3QH3A 5AOIA 4GT0A 1FBIH 4WDIA 4PJXA 2WWKO 1G6VK 4HS8L 2COQA 4TVPD 3D85A 4MMYA 3U36A 2JJSC 2AJSH 4OY9A 2ZXCA 2QFRA 1JSYA 4IBSA 1IGFH 3AUVA 4Y4KB 4PMEA 4UTBL 2H8PB 1A3QA 5DA4A 5BUAA 4XNMB 1OSEA 2X88A 1PZ3A 1UA3A 3S96B 2VIRA 5J1SC 5IR1B 3L3DB 2P48B 4Q6IB 5E4EB 4EBQL 1EHXA 4FFYL 2NY5L 4I0PB 1AR2A 3ZIMA 1P4BL 2BSSA 2H0FA 4G7YL 5JXAH 1WEJL 4P2RA 1CFQB 2VR6A 2OJZL 3JV4B 3ZUNC 1ZT1B 4ZG1A 2C9RA 2AXGB 3BKCH 1QBLH 2IAMC 1GCYA 1OTTC 2WVVA 4G6AD 3V0VB 4EI0A 5KG9B 4FXKA 4OGYH 2V7NB 4S1RL 2ITDB 2BNUB 4K5PA 2CMRL 1IGJA 5EEVA 2LU4A 2D7TH 2VDNB 2A6KB 4W9LC 1EJOH 2XC8A 3DVNA 4HDIA 5GRUH 4GW4B 3VXRA 2EYSB 4FNLL 3AACA 3BP4A 5CUSL 3LNDA 4EI5A 2EH8L 2YRZA 4XHQA 3D18B 4KI5E 5D7SH 2AXFB 1YMMD 3Q5TA 3IDNB 4CVXA 3FBQA 4LOFA 1QSEE 3EJZC 3DYOA 4GJTB 4K3DL 3MJ6A 2Y6SD 5J1AA 4N2NA 3MTRA 4BQ6A 3WGUB 4N0UB 1PLGH 1BZ9A 2WQ8A 2WKLA 3NCWA 1S5IL 4YWGH 5EC2B 4WI9A 3FQ2A 5IBUG 4AKQA 3F7LA 2VDLL 3UEQA 4DZ8B 3RHWF 1XF5A 2X1PA 2WXMA 4Y9BA 1OGAD 5H37G 3RGHA 5J5EA 5C97A 1MCOL 2DKSA 4PN6A 3LVTA 4D2NA 3QK0A 5T3XE 3VRLE 1ZLWH 2H6PB 2DKUA 4BZ2H 1TVBB 4F3FA 4L3CB 5LGHH 1J88A 3CPLB 1OOAA 2JKXA 4GSQA 1BW8A 2XG4B 5K9JH 4WW2C 3CFKA 2BZ7A 3SGKA 4L5FL 4U1NB 2FCBA 3EJZD 4BWUA 4IRJB 4MJ6A 1OB1B 4D3CL 2Y3NA 4FMVA 3TEXA 4NIKB 3ZKSD 1U91B 4OB5H 1BQLL 3VGGA 4X6DA 4CA4A 3PWPA 1O0VA 3QI9A 2LAAA 2FEJA 1RHHA 2QJDA 5BVJA 2YPLB 3KBPA 5A2LH 3QWOB 5AVUB 3OMIB 4L3EB 1BYNA 4NKDB 3FH7A 5GJTL 3V4VA 1QBBA 5HGBA 4Z7UA 3T4AC 1JV2A 1PZAA 2A9ML 1MNUH 2NYZA 3PL6D 1B0IA 1BM3L 2VSMB 4Q2ZB 4PV8A 4Z8FH 2UZIH 1MCBA 3K5RA 4CVZB 2LU7A 3DX3A 3UO1H 1QG3A 4QRPE 4HETA 4PBXA 3JWOC 4Q0XL 5GGTA 1YEIH 4K5NA 3WHE1 5HHQA 4OBRA 2HT4C 3GJEB 1TTCA 2GJ6A 3MV9D 1RURL 2FH6A 3FB7A 4OZHE 4NN6B 1J8KA 1FYTA 3BGMA 4UAOB 5D1XD 2VN6A 5HPOA 2VR4A 2ICWB 4RIRA 1FQ9C 4WO4C 3WAKA 4F9PC 2EC9U 2V8MA 4Y16A 4TQHA 2H9GA 4ABUA 2P43B 4X4XB 5BW7A 5K33A 5HHOB 3ZE0E 2FBOJ 4NO0B 1UVQB 4X5WB 1TNMA 1PDKB 1TJXA 3F2LA 1MFAH 4QF1B 4Q97A 1E27B 1Q0XL 4LVOC 4OQ1A 4UDTA 3BH9A 2P5EA 3HBGA 2F9BT 3VAEA 1O9ZA 5IMLA 3O2DA 1M6UA 1SDAB 1AGDB 2DIJA 4AMXA 4AL8C 1NCBL 4JFDB 2J55A 4BH8A 4LEEA 1MWAA 4K8RC 3O0RL 1SLUA 1AOHA 4HCRH 1AHMA 5IJVB 4LSVL 1SJHA 3DIVA 5BS0E 2NW2B 1JHKL 4P3DB 1S5HB 3OR7B 5J6HA 1D5RA 1SVBA 2JF1A 3ERXA 5AOLA 3BZEB 1VADA 1YNTB 3LNHA 1CXLA 1ORSA 1AAJA 1H15A 3O8XC 4MMZC 1QHOA 2QZ5A 3QDMA 1FZJA 1SGKA 3O6KH 3D39A 3K8KA 4XWGH 3GK8L 5FCSH 3JV0A 5GRZA 3RNQB 1JWMA 4YHIA 2AGJH 3TZVB 3AGVA 5D1QC 5J0BA 2GY5A 1KJ3L 2BS9A 2Z0UA 5DFVD 4XTRD 2OCJA 4F57H 5CCKL 1B9ZA 5I28A 5CZXD 2D0HA 1ZT7B 2BIMA 1C5DA 1JD9A 1P9MA 2YPVH 4PJ9D 5B1JA 4OGXL 1L7TL 1MF2H 2E47A 3P2TA 3S37L 1EVUA 1NJ9A 1R5VB 1RUML 5C0CA 1J1PH 2K6ZA 2O6CA 4FCHA 4R2GC 1ZT4A 3OQ3B 3QZNA 3EYUL 4NHUA 5C0BE 2P5EE 3S35L 4XBGA 3UTTD 2J8UF 2P1YA 2IANB 3IGUA 1L0PA 2IG2L 4ZO8A 3MGOB 1Q9WB 4JDVA 1HSBA 3CG8A 2N01B 4UT6L 1AQKH 4Z7WA 5IB1B 5JHDB 2FWOA 1LHZA 2BWDA 4Z7WB 3T1FB 1HSBB 3NSJA 3B2PA 4HWBH 2XXCB 2VJ8A 1CR9L 1ZSDA 5IM7B 2R8SL 1AGBA 4QR7A 4GQ9H 3U9PH 1SEQH 2YA1A 1NAMA 4Q4EA 1U8QA 2Y5EA 3KPQB 1KDIA 4JFDA 4HWNA 3VWKD 3E8UH 5MEOA 4P2QA 1ASOA 4GUCA 4QOKE 3NJXA 2LR4A 3IFOA 3PWUB 3WDJA 2HFEB 3N42B 4L4VE 5IUSA 2CG9X 5H37A 2OYPA 3RI5F 4KNQA 2RQEA 2X4RB 3MVSA 2BXYA 2VDQH 3ARED 3E9UA 4NCDA 1KN2L 4KO5A 3CIAA 4IGBD 4E5XB 4G7QB 1E9PA 3CLEL 2BINA 2X2HA 1UXWA 1TQCC 4CKQA 2O72A 1JYVA 3LV3A 2IF7A 1ORSB 4LO9A 1TZAA 3K0WA 4FNSA 3GJEA 4FQLL 3UAFA 3WJJC 2MQ3A 4A1RA 2PYEA 3MV8D 4QAMB 5FW7A 1CLVA 3EFDH 3QUXD 5HYQA 4JZOB 3HI6L 4N2MA 4HX1B 3FSWA 3FUFA 3ZPDA 3AVEA 1BZDA 1CYXA 2HRGA 2IMNA 3CQQA 4L4JA 4OI9A 5F3HA 4ZMYA 2ADFL 1JF6A 1A7PL 2GBUA 4RH4A 4UAHA 3J27A 2WM0A 3QAZB 1DBBL 3QEUB 1TT6A 2IGFL 4IOSA 4W68A 4EE2A 2IAND 4QYOB 3RWJB 4WHYG 1AYRA 1P4UA 2MQCA 5I15H 4OF5A 3WJLC 2YUZA 4HT1H 4JHWH 3ELQA 4LGRB 1PDKA 1UD4A 3HVDA 4H26B 1P7KB 5C08B 4BE6A 2EUVA 3FUKA 4GUPB 1U93A 2XJLA 3EDKA 3BGMB 4I4WB 4IOFC 4PRID 3I6GB 4KY1L 3FO2B 3VGAB 3IAGC 4A66A 4UMGA 1B4JL 1UB6A 3CFBA 4HD9A 4JGUA 1NTDA 5GS1A 3IVKB 1IQWH 3ULAB 1Y0LA 4Y4HB 3SGKC 4DQOH 2YGVA 1I9RL 2BP3A 2DZEA 3CZFB 3FUEA 3K4DA 5I16A 4CVZA 1XH0A 1ODAA 1YJDL 2WNXA 3QPQD 4O5LL 4Q2ZA 4UYQA 4XZUA 4LVNC 3ASOB 3IDGA 4HUKB 3ZTNH 1HIML 4XCYA 4JHAH 3GSRA 4IRSD 5T8IA 3KCPB 1NBZA 1JZ3A 3FW6A 2QVMA 1FVEB 5G5DB 1NQBA 4DK6A 3Q8CA 3MLVH 3S5ZA 4DP7X 1URLA 1HX0A 2AEOA 3B4NA 2V2TA 4KXBA 4W6XB 1MCRA 1XSKA 1T6WA 2BY3A 4U3SB 1PF3A 3S0PA 2J6WA 3REWB 1IM9A 3QJUB 1T7XA 2ISDA 4J27A 4PJ8A 3HC0A 3VWJA 4HUXB 2VNCA 2M8XA 3RA7L 3T4YA 4KZDH 4XO8A 1A6AB 2W9DL 2WD0A 3CAFA 4LLMA 1M57B 3HAEA 2FLRT 1ZE3C 2OMBA 3LXAA 1M7IB 4HWZB 4GUQA 3BAYA 2R1YA 2N0MA 1K8DA 2X2IA 1QFWM 2YOCA 5F7MC 3ME0A 3L1OH 4XXWC 3G5VA 3Q1SH 3FT4A 3FUJA 4KHTL 3JV4A 4EOWL 1NGQH 2WLMA 4LHUG 3BH8A 2GG1A 2LVEA 2JKLA 2NX5D 15C8L 5DS8B 5DD1H 4DVBB 1XV8A 4F5CE 2WWMC 4POZD 4HD5A 3UJJH 3STBA 4YFLI 4WUKH 3MLSH 2BERA 2ESVA 2LQRA 1RIHH 5IFAL 3VD1A 3T6WA 4QLRA 2Y69B 3ZT5A 2CUHA 3FCUB 2CCVA 5L2KE 4OZGA 5GSRB 1EZUA 1ZEAL 2Q7NA 5C0EA 1MFBH 1KJ2H 1MJ7L 1G6RA 2CGRL 1F6AA 2EXSA 3KMDA 1C5BH 5FGSA 1S7VB 2UZXB 1X5GA 4MDIA 3T0EA 1H3PH 4HDIB 3VWKC 1E28B 4QRRE 5I9QC 1SLVA 1BQLH 4BHUA 4PY8I 3ISYA 5IG7B 1Q94B 4N9GB 4XE0A 4RISH 3HTLX 2V8LA 1LNUB 5KG9A 1M56B 3SDAA 3F7RA 2DPKA 1BJ8A 3RBSA 5B3JE 4YSAA 3LH8A 4TPRH 5C07A 1U95B 3Q2WA 4G6FB 4NKOA 4HGWB 4LXFA 3L3OC 2BIOA 1K85A 1E50A 1XTLA 4JFEA 4CKVX 5HDLA 2H26B 5E95B 1WBZA 5FHAH 3T3MB 4LFHD 1RFDL 2Z4QB 4U1JB 1W2KT 5KYXB 3SOBL 4DN3L 4FFVD 1YMHA 1W0WA 3QUMA 3WYRA 1CLOL 3LY6A 3BEWA 1D7BA 4OVUA 4MCNA 1HQRB 2CJUL 3GGWB 3GS4A 3P11H 1M53A 1N6VA 1UHVA 2FECI 4YQXL 1EFXA 1T3FB 1GYVA 1MCJA 4XP4H 4BRVA 2WJ5A 4W9GC 3VXSD 1UEMA 5I1LB 4EI6A 3BPOB 2ZT9C 1X7QB 3EGDA 3H3BC 3W0WB 1F45A 2J25A 3QUYD 4NNYA 3QZMA 3GM0A 1A9EB 2J3SA 2EDOA 3LRHA 4UT6A 4ZPTA 5HJ3B 1KPRB 1AKJA 5IROC 1OANA 2VJ0A 2LTQB 3FU8A 4G8FA 3ZTJG 3BUBA 1G0YR 3UH8A 3ARFD 1DJXA 1AMXA 3F12A 3SKMB 5ACZB 2PW1B 3KLKA 3UC2A 4D7PA 3CHSA 4BQCA 1YYCA 4TSBH 5FM5M 4AIXA 4E41E 1FVCA 1L3NA 2FX9H 2CBQA 3DO4A 3TEZA 3KLSA 5JHLA 3N06B 4IOIA 4XMLL 1BOYA 4ODXA 5TK4A 2XBDA 2RACA 4HA1A 4XO3A 2GI0A 1DQJA 4C56E 4RGMC 5BOJA 4NM4L 3TO2A 3FC8A 3LRSB 1CD0A 2O61B 5SWZE 1G1YA 4P2RD 5FCUH 1QW9A 2GUOB 3L54A 1PW3A 4NM8H 3IAQA 5C71A 4UNVA 3AXHA 2XI9A 3M46A 1JFQH 3E3QC 4FYSA 1SJVA 1D5IL 1BOGA 1P6WA 3GMLB 1AC0A 1BFVH 4HIJA 4YO0B 8PAZA 2Y7QB 4BE5A 4LPYA 3KWWA 4RNRB 3M07A 3WJJA 4GB9A 2KMWA 2FQGA 3VTMA 4JPQA 4DPBX 4TUJA 4EO5A 4WI0A 2RB8A 3FN3A 4FLRA 2YPVL 5CLZA 1RUKL 1T6VN 2VLLA 4UQ3A 1GGIL 4OFKA 4XOBA 2F5BH 5LAXA 1M7DA 5GSVB 1OQXA 1NMBH 3V52L 1F4HA 1JZ8A 3G7TA 3L3JB 2XFGB 3LN9A 2WZ5A 2UZYA 3MNZA 2VERA 3H7BA 3ULSA 4KQ0A 2X10A 3RFZC 2X1XR 3QBTB 2G3MA 4JPVH 4BXSV 4IHOA 3RGVB 3VFNB 2NY0B 3EJYD 1ZWIB 4LCWB 4XI5C 5D1XA 2YRPA 4JPKL 4L4VB 1KGCD 3L95A 5HGGS 5CZVL 4XHJC 1PAMA 2HH0H 3QQ4B 3D4ZA 4E0RB 1E40A 3ETSA 2VZUA 3VFPA 1I8AA 3VXNB 1HK6A 4UQ2A 3ZIYA 1KPRA 3LKRA 3R1GH 3MA7A 4AJYV 5IFHL 4NCC1 5D1QB 4MJIB 5FUZH 4IKJA 1Y07A 1TMCB 1XH3B 4Z95H 4HKBB 2EC8A 2BZDA 1WZKA 2E0PA 3IU4H 4FFZA 4MKMA 4YSQA 4XX5A 1HQ4A 1BVKA 3ET9F 5D93C 2N7SA 5E2WL 1RPQA 5TD4A 1JNLH 4OIIL 3MV7E 2JI1A 3ZE2B 1JS4A 1N7ML 5D4JA 1JTOA 3DARA 4RAUB 4QRPA 1A9VA 1A0QH 5FXCH 4KBPA 2XNAA 2BFGA 3ALPA 4JZJB 4M48H 4K07A 4ZXBD 4Z5RA 3VE0A 3D9AL 5D7JB 4Z0XA 2IPKB 4H0IA 1EAOA 4K3EL 1ZPUA 4ODSL 3CZFA 2RAMA 1HHIA 1QLEH 2ZX5A 1NC4A 4RMUA 2OMWA 1U8NB 4XVOA 1M7IA 4JKKA 2WUCL 2OFQA 1NMAL 2CLVA 3VDAA 3BSZH 2R2BA 3NG5A 4RFEA 3CCHA 2ZONA 2ZIDA 1EK3A 3ARPA 1OGAA 1FFPA 1SEBB 3GHBL 1O5DT 4M8QB 4P2OD 4RQQA 2OR9H 3NCEB 1PTZA 4KMLB 3RKDD 2DEWX 3HIZA 2IGTA 1IGCL 4BUHA 3L3GB 2VDLB 1LO5A 4N0FA 2AK4A 3GKZA 4NQSA 2FUQA 2AI0L 2GY7B 3DETD 1DQVA 2IBZY 1BPVA 2OQJB 1SJEA 3RPIB 4AXWB 4L3AA 1S3KH 4G6KL 5BNXD 3UROR 1JGVH 3MRHB 1KELH 2VXSH 3IDGB 4B9PA 2B15A 1I1YB 4M7LH 4BFRA 4JLRA 2WQAA 3IJEB 2QELA 3LKNA 3U0WH 3SDCD 5I17B 2G0LA 3HE6C 4Y4HA 1NFDE 1BQKA 5KW9L 2VXUL 2M83A 2EIMB 1X5XA 2NY0C 4NBZB 5D7KE 3LJ3A 1M3IA 3V5DA 4AM0A 2N1TE 2EDLA 1KUMA 3IDYC 3B1UA 4I2XB 2YEZA 9PCYA 4GPVA 1K8DB 3LS4H 4G8EB 2DWTA 3U7WH 3UTPE 2VLJB 4UQCA 3OZ9H 1EZSA 3D6GA 3OQRA 4MASA 4DKFL 1MFVA 4D9RD 5BS0A 2DJMA 3QZWA 2HG5B 2ENYA 3LZNA 2PW2A 4WQOA 4YHYB 2QV2A 1ZVYA 3Q43A 4L9LC 5CBAA 4ODUA 4AGLA 3D7PA 1TDQA 5E6ZA 3FO9A 5HDQH 5JPMB 4RCAA 4YSTA 2VISB 2ARJA 4JJ5B 1IAKA 1YEEH 5EUOA 5DHVA 4HJEA 4UF7C 4HAGA 3G9VA 1CFMA 4FABL 4IMKC 1DZBA 5E0QA 2IWEA 3EZJB 4X7TA 3RIKA 1U8QB 2NY2B 3HE6D 5I24A 2BVPB 3O6FA 2W9DH 3M1BA 4HX1A 3BLKA 4OKDA 3H9HA 2X4NA 3G5ZA 1T2XA 4W81A 2NY1D 4YGVA 1ZMYA 1IGTB 2VKWA 1M05B 4EN3B 2HT3C 2LW3A 2CO2A 1R3IH 1J5CA 1J0JA 3EUDA 3MCYA 4L8DB 1E2VA 1E4KC 1BAFL 1EO8H 2C9QA 3D25A 4OV6F 1BBJB 2XVKA 1RZJC 4Y4FC 5LCVA 3WV0A 3FOMA 5KVFL 2F54B 3KPSA 3BUPA 3P9LA 3P0VH 4A7GF 1ZGLM 5TF1L 1ZT4B 1T5XB 3F04A 4NHUB 2WSKA 4JCMA 1CE1L 1FGNH 1T0MA 4JFSA 5HY9A 4EN3C 5KVEE 2CLRB 2O1AA 1CBJA 2GABA 3H3PL 1VRSA 4JZNA 4PJ5D 5JOEA 3RWCB 4PJFA 4ZO9A 1WHPA 4I2XE 1KEML 4JFFB 1FNSH 4XNUL 1ACCA 1A3ZA 2R2CA 1MQKL 2C1PA 1JI2A 1VEPA 2EE6A 4FCAA 5I1GL 4FYTA 4R4NC 1VCBC 4FNPA 3KGSA 1A3RH 1KIRB 2BXZA 4JL1A 4K94L 4O58H 4HG4K 1OOWA 3FQXB 2WQSA 3GO1L 3WN5B 4GLRI 5BV7H 2YAQA 2X3BA 5DVNA 1O7DC 5I5RA 5FOJA 5AD0A 1P0SE 3CHOA 1KGIA 4DT2A 4J4PD 1CFSB 5F3HB 2W07B 3D69B 3CFEB 2OXHB 4LLDA 1NZRA 1OP4A 2PMZA 3MFFA 2PTTA 1OP5H 4EIZC 3X17A 2XVGA 5FF6A 4TPRL 2RA1A 4A38A 1Q4NX 1LVEA 1T7ZA 5EEUA 1AO7A 2DQDH 2OYLA 1HH6A 4F15C 2UY6B 5E94B 3PNRB 3PRZA 2X4UB 1BF2A 1E5YA 2XUWA 1JDAA 4XC3H 4YDIL 5J6SA 1AO7B 5T5NF 4OVVA 1MDAA 1ZS8B 4XBGB 3RDTC 5EB9A 2GCYB 1BVZA 3LQAC 3Q5OA 1UXWB 1UD3A 1TJIH 2G60H 5EEZA 2C3XA 5ICYB 4OFYA 5ABAA 3RJOA 4O02L 1X5IA 3CQFA 3QPQC 5D7IB 3RUGE 1MW3A 3FQRA 4HZLB 3MRQA 2D73A 4Y9GA 3RTQC 1U58B 1JOIA 2EXWD 1IJNA 2IDQA 4MNQB 3FO1B 5SV3A 2HJKB 4X4XA 3FQXA 2P9RA 5F7NC 3UYRL 1J7VR 1GJIA 2WVSA 1USQA 3C8HA 4XP6L 4HZLA 1JGLL 3QHFH 2BJMH 1Z2KA 1GL4B 2WVUA 3AREA 4LU5H 3P3SA 3IFNL 5E1AA 3UTQA 3WIAA 2IGLA 4K9EL 1XCXA 3AY4C 3POHA 3T0ED 3CPUA 3QEQD 3OC8A 1JPST 2HJFA 1KBGL 4WV1B 2EEBA 3BLPX 3II2A 2OXGA 2AJUH 2BDNL 5DMJB 5EORH 5ESVB 4MDRA 2UXGA 2VUOA 4JM2C 5ANME 2FX7L 5HHQB 3P73B 1NIEA 1YEKL 4NDMB 1XGUB 2JCCA 5ICXA 2I24N 4P3DA 1I9JH 5FGBA 1TQSA 4RDQG 5IJVA 1A02N 1IAII 3TVMD 4J3VA 2QQLL 3N91A 1TZHB 2CO7A 1PY0A 3PGDB 3QDJE 3AS1A 3HS8A 1NBYA 3ZRCC 4JMNA 3AJ7A 3GXUB 5SWSA 1I7RA 5DJZB 4LEOB 3OPUA 5CILH 4LCVA 4WRLA 1OF2B 1MIML 2LHAA 4S2SB 1KIRA 2BHZA 3M1BB 4IS6A 3NIFE 4QNPF 1RHHB 3RWDB 4FQIL 2NYKA 5F44A 3U30C 3ZYIA 1AZZC 2FRGP 1R3LA 3MR9B 1YY8A 4JGJA 2JVUA 5F0MB 2LLNA 4G42A 1DQDL 1KTKE 3WFEH 4F37F 3U4EB 3M45A 3ULUF 3FJTA 2PNDA 3N1GC 4K71C 3CFKB 4GP8B 2YJLA 3VWJD 3N1FC 4WENB 4MMZB 5IW6A 1I7UB 3Q2CA 3KPSB 5F0PB 3VRJB 4N2DA 3T3PE 1OV8A 3QZWB 1IO4C 1P4IL 2N1KA 4PBDA 3D51A 4Y5VC 2HKHH 3OKEA 5ADPL 1LYQA 5C0AD 4HJUA 1HAUA 2MOGA 2DV6A 3VXOA 4AEIH 3FQUB 1IC4L 2B59B 4OUOA 4AT6A 2ICEC 3D39D 3IKCB 1NUFA 4GMSL 4QHLA 2RIKA 4FQXA