2Z7ZA

Crystal structure of h2o2 treated cu,zn-sod
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
151
structure length
151
Chain Sequence
b'ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
molecule tags Oxidoreductase
publication title Crystal structure of H2O2-treated Cu,Zn-superoxide dismutase
rcsb
total genus 33
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2z7zA00
2NNXA 3L9EA 1S4IA 1HL4A 1EQWA 3K91A 1PZSA 4BCYA 3S0PA 2WWOA 1F1GA 1BZOA 1SXSA 2Z7WA 1Q0EA 1KMGA 1F1DA 3HFFA 1EJ8A 4MCNA 1E9QA 1PU0A 3H2QA 1JK9B 2WZ5A 3MNDA 1DO5A 3GZQA 1E9PA 2JLPA 2C9VA 3CE1A 5KBMA 5CU9A 2AQPA 2AQSA 1OEZW 1DSWA 1OALA 2VR6A 2AQTA 1XSOA 4A7TA 2AF2A 1SDAB 1SXCA 1YSOA 4A7QA 3F7LA 3T5WA 1MFMA 4FF9A 1SXAA 2AEOA 1YAZA 4A7UA 3RE0A 3CQQA 3L9YA 1N19A 2WYZA 1TO5A 3H2PA 1BA9A 1XTLA 2Q2LA 1SXZA 2ZOWA 1ESOA 1CBJA 4A7GF 1CB4A 1JCVA 1IB5A 1UXLA 1F18A 2Z7YA 4L05A 1N18A 2E46A 1SXBA 4A7VA 1OZUA 1P1VA 4OH2A 2APSA 3PU7A 2C9SA 1IBBA 2JCWA 1TO4A 1Z9PA 1AZVA 2WZ0A 1XTMA 3KH4A 2WKOA 3KM2A 1HL5A 1YAIA 1UXMA 1PTZA 3KBFA 4BCZA 1FUNA 1OZTG 1U3NA 2AQRA 3GZOA 2VR8A 2ZKWA 2E47A 3ECWA 1E9OB 3F7KA 3ECUA 3KH3A 2Z7UA 3GZPA 2SODB 2AQNA 1B4TA 1SXNA 3GTTA 4MCMA 2R27A 5KBLA 2WYTA 1JK9A 4A7SA 3QQDA 2WZ6A 3GTVA 3LTVA 1F1AA 1RK7A 1B4LA 3HW7A 1E9PB 4OJAA 2GBVA 1E9OA 1IBFA 2WWNA 3QQDB 2V0AA 4A7GA 4N3TA 3KM1A 3ECVA 1COBA 2C9UA 3SODB 2GBUA 3MKGA 2VR7A 3HOGA 1QUPA 1E9QB 1OAJA 1SDYA 1L3NA 2K4WA 1IBDA 3KBEA 4U4IA 3CQPA 2WKOF 2LU5A 2XJKA 2XJLA 2AQQA 2ZKXA 2ZKYA 2GBTA 4N3UA 4B3EA 4BD4A 5KBKA 1IBHA 1SRDA 3GQFA 2Z7ZA 1Z9NA 1SOSA 1SPDA
chains in the Genus database with same CATH superfamily
3NSJA 4OB5L 1RK1B 1OCWH 1A7RH 4S1RH 4UOW0 4HH8A 4JFFE 4F2ME 5F70A 5ETUB 4LCWB 2L7EA 3CX5J 4W4OC 2M1KA 2BNUA 3PLYA 4KNSA 4FFWC 2X9ZA 4LCYB 1WIUA 4DERA 1RUAH 2DM4A 3PXLA 1IGMH 2VOTA 3CFQA 1JZJA 1FO0L 2BRRH 4N0FA 3FOLA 4AENB 5GGQL 1R3IL 1WT5A 1CDIA 2G75A 3I9GL 4QUOA 1KIRB 1GPOL 2BVOA 4J6RH 4KI5D 1L9NA 4Y4HC 5DJ6A 4XBPB 1JDAA 3C6EA 1W80A 4AQEB 1DSWA 3B7RL 5CNHA 1P4IH 1PLGL 5IQOA 4N8CH 4XBMA 1VFMA 4APXB 4G1MA 4CVZB 3HUJF 3GS4A 4LVHB 3CBRA 3FTYA 1F0LA 1MSPA 3F62A 4Z7WA 1ZDSA 2KZ1B 1RZKL 1WUNT 1FVDB 3OKDA 3KE0A 4CSZA 1MY5A 1NCOA 2IADB 1UOVA 1DBBH 4QRPD 1KGIA 3D0AA 1F3RB 1PQZA 3I74A 4FG4A 1UH3A 1LO3H 3F04A 3MRBA 4P48A 1UADC 3CN4A 2EDJA 5I30H 4HFWB 2YKLL 1AZZC 1SJHA 7TAAA 5KVGE 1JUFB 4K2UH 1LMKA 3PP4H 2BP8A 2P26A 4LF3A 3PHOB 2X2JA 4NHCH 1ZLUK 2OULB 4LRIA 3SKOA 4AQOA 3VFSB 4GEIA 1L7TH 3LH2H 5ES4B 2GJPA 3K46A 1R0AL 3HHRB 2HCZX 4I89A 5I73C 3UC0L 2VR4A 5G4MA 3X12A 3WXVL 4RAVA 1MRDH 3SBRA 3P11L 3LIZH 2CG9X 4D0CB 3U25A 4QT5B 1RJZB 3HFMH 4DP5X 4OD2A 4PJFB 2A2QT 4RMSA 1E2VA 4ZW8A 1V54B 1DQQB 2VLRA 2ICWI 2ZUSA 4XZ4A 1V27A 4OD1H 5CIPB 2GTZA 1RU9L 1X9UA 1KENL 2BS8A 2WXGA 4HP5A 4QTIH 5HI5D 3F84A 1VJSA 1ITCA 1MHCB 4Q56A 1BM3L 3EFDH 4NQUA 4BKTC 4X6FA 4YIQB 2MPAL 3GMPA 4NIKB 3F7VA 2NLJB 1IC1A 5I75C 4XT1C 4JFDE 1J8RA 2N59A 1XF5A 4XRCB 5JIDA 5EOCL 3LZQA 1BGXL 2P5WE 4ODVH 5FOBA 1DQML 5F3FA 4PEEA 3GHPA 4IU3A 5D1QB 3T4YA 4YK4C 5IKCB 3EXJA 1Z32X 4ODSH 1RH8A 4WW2B 2QQQA 1FH2A 3ROOB 4G80A 1PD1A 3V6OE 4JFYA 2DLHA 3HFFA 4QHUB 1U8HB 3GZKA 4EBQL 4I18B 3U30C 2CGYA 2VWEC 5LKNA 1YPZA 2GUOA 2WXNA 2BP0B 3OKEA 4GKNB 3GJFB 4BK8A 3VI4E 3PHQB 1G87A 4A6YL 2WPGA 3IJ8A 4M7LT 2JELH 4AXWB 2XTSA 4UBDD 3F6JA 5AYQA 2WK2A 1ACYL 3O4LA 1HHHA 1OP5K 5FUOL 4C57C 3QP3A 3QWOA 4GQ9L 4FKHA 1TNMA 4JKPL 4K8RL 1P6AB 3EFFA 4HGWB 4KDTC 4E41D 5IMMB 4MD0A 2QDVA 4X99B 3SPGA 4WKZB 4ODUA 1AYRA 1QWNA 5CN3A 1ZXQA 2DQIL 1U3HD 3FN0H 2EEAA 3TT1H 2A83A 1BD2B 1X5ZA 3SOBL 3UBFA 2D7MA 4PGDB 3QXDB 1VIWA 4OZIF 3PWPD 3DO3A 4IYKA 2W65A 3FU8A 4NZUH 5DMKB 2ARJB 1CF8L 4EIUA 3SE3C 1EDYA 4UNTA 1KTDB 4XNQB 3CLFH 5EBLB 2IXQA 2HKAA 5GZNA 1RZIB 1CDUA 2APSA 3MRGB 5TDOB 5SWZD 1ZANL 5B22A 1H6FA 4LVNC 3MCLL 1JMZA 3LN9A 3P77A 4GBXD 4Z7QE 1B9KA 2EKSB 4JFEB 4PP1C 5AW0B 3Q43A 1XB3A 2FJSA 1IL1B 2AJZB 2J57A 3II1A 2HKFH 5DZ9A 2CAKA 3Q2WA 6FABH 2NY7H 4DP9X 1FGNH 2P5ED 4KI5E 1CS6A 4UTAH 4E9LA 1JK9A 4MJIA 4A55A 3X12B 4UI2A 2VLKA 3NIFE 4FMFA 4LCUB 1EIBA 1GHFH 1KBGL 2SEBA 1E9OA 1LVEA 2IANE 3KGRA 3KR3L 3TJEL 4Q9RL 1C5DB 1P2CA 1I1FA 2EEDA 4P4KB 1NUFA 3RY5A 4HJ0C 3MV7A 3JT0A 4DEPC 5JXAH 4K7PY 3ZDYF 3AAZA 1QO3A 4DPAX 5C0IA 3MBEC 1A3LL 1ED3A 1SJMA 4PJBA 2MWCA 3C6LC 3VRLE 4FA7B 1QLFB 1SGKA 5FKPB 3HUJB 4PG2C 4JZOB 4YK4B 1GYVA 1D3CA 1DVTA 1S5HA 4LHUD 1ML0A 4QRTA 3JWOC 4Y0GA 5DU7A 5E2TH 4FG6C 5DZPA 5SWSD 4G7YL 4IRZA 1UKTA 3KS0J 1ZGLP 2B77A 2CGRL 1PZSA 3UACA 4LPXA 4OVUA 3FT2B 3LZRA 4BEIA 4KV5E 5CP7B 3SQOH 1GR7A 5H35B 2QFPA 5B21A 1B0GB 4BUGA 5FS5A 2HRLA 3LHAA 5CGYC 2LFGA 3QUZD 1W0VB 2DJSA 2AJ3A 3QZPA 1CGTA 4HEPA 4CILA 5DEZA 4KMQA 5J12C 3VRJA 4DSYA 4LNRA 4XO5A 5D6CB 1A4JA 3LNEA 2FHBA 4RMVA 3KWWB 1ONQA 2VDPH 5DUML 3VXRE 1P7BA 3GMLB 4Y2LA 4LL1A 3FZUC 4WUUB 4J3BA 3ZDYB 2Q86B 4OCWH 3PWVB 4HEME 2COQA 1DVUA 5F7EL 1UB5A 4ADGA 5DMIL 2QEJA 1NM9A 1CDBA 5L8LB 3WN5C 3T6QC 5HDQL 1PL3A 3FQ4A 2AVGA 25C8L 3GRBA 5K39A 3QZNA 4MVBD 1LEKB 5HVGB 4AQ8C 4BFFA 1IEBB 2Q2LA 1NCTA 1OGTB 5D5MB 3ZRCC 3CFDA 3MCG1 2FEEL 2W07B 4A7VA 2YD5A 2QZQA 2MOQA 4H8WC 4XC1H 3OKKB 3B2MA 2WKOA 3PJLA 5DUPH 2UVEA 1FZKB 1SOKA 3BSGA 4HHAB 5L0QC 4KTDL 2A73A 4U6YB 3ECWA 3MRCA 4F7TA 1BLIA 2IQ9L 3GZPA 3QDMB 2VSCA 1A3RL 1PAMA 4R9HA 1HHKB 3FK3A 4N8VA 4AXWA 2EC9T 2EYRB 4AZUA 4DO4A 3ZW3A 2ENJA 2X6UA 3L08A 1CXLA 4UINL 5I76B 5JPMB 5EUKA 1C7TA 2FD6L 2D7NA 1OGAA 3QQDB 1A6VH 1NCDH 1TR7A 4NKDA 5ECJE 1J5CA 1BAWA 1IGJB 1I82A 3UC2A 4F5CA 4FLRA 5E00B 3TZVB 4NM4H 2O5YL 5HPMA 4FCHA 3MSPA 1YECH 4WF7A 1A7OL 4NKMA 5LXGH 1KIPB 4UQ3A 1FL6A 4MD4B 3ZSSA 4F1SA 3ARZA 2IWGA 3A22A 4G8EB 4YHML 4L37B 1T1YA 2VERA 1R5IA 1ZHKB 1NGPH 1FHGA 3G5YA 4JY5H 5CWSA 4DK3A 5GZNC 1SOSA 2NNXA 1QQDB 1IBGL 2FR4B 5EZOH 4AYFA 5F3BB 2DQCH 3T6ZA 3SDCA 2XWDA 1RZJH 3SQBB 1F3DJ 3AVEA 2QMJA 3HTLX 4JX0A 2EDEA 4Z3IA 2AMUA 3FOMA 3PL6A 4P59H 2JQAA 1QFUH 5DJ8A 5D1QC 3L45A 5DRNA 5BXFA 1CWVA 3OMAB 1NC2D 4XB8A 5LGHL 2DH3A 1G7IB 4HA1A 4KQ3L 4PGEA 4Q4IA 3PJSB 1IVTA 4K3EH 1IAMA 4KUCF 1DLFL 2UZIL 4GW5B 4AVIA 4LQFL 1ZLWH 4HIIB 2IO5A 3HG4A 3PWLA 3VU2A 4XPHH 1T0MB 2UWEA 2NNAA 1BLNB 3HKFA 5DK0B 5JIHA 2VR6A 3TN0C 2QV4A 3G04A 5DUJA 3K5RA 4N0CC 4NKOA 3KLSA 4J2QA 4FJ6A 1MFMA 1UM6H 4Y1TA 2COVD 1BVNP 2AFNA 1FSKC 4LCYA 1WK0A 1ZPUA 5IHUH 4NQXA 1R3HA 1T3FA 4EQ3A 1H6EA 3BH8A 4PJXF 3RJDA 3D18B 3ZMEA 5GZND 1ESOA 4NNXB 3IRCA 3UGUA 1CDYA 2Z8WC 3WEBA 5FCUH 4ANKA 5AOZA 5E00A 5IQLA 4G9FA 1KC5H 4JVPA 1IM3B 3QDJA 1WDAA 3PWNA 3O8XD 3F8UB 3ZU8A 2R9HC 2JKTM 3U0WL 3MUY1 1CXEA 5AVSB 3U6RA 1GC1C 3G6JE 5GZOD 2RQEA 4JG0H 5FLUA 3UBXA 4M62L 2F58L 1KYFA 1VEMA 4WNJA 4JZNA 4QXGH 2Q3XA 2OMTA 4QKTA 1UA6H 3G5XA 2WIIA 1A6WH 1QTPA 3RGBA 3VXRD 2A6IB 4G7SB 3QDMA 4KJQC 4ENED 2O5ZL 3ILPB 5KBLA 3RKDC 1KXVA 3HE6D 1IAII 3L7EA 5CP3A 1FYHB 3FHQA 5DYFA 2OZ4L 3KNBA 4MJ5B 4MXVE 4N8VB 1H3TA 2DWEA 2VW6A 1B0GA 3P0GB 4TVSa 3W82A 4APQC 4C8XA 2YEZB 4APQA 2C9RA 4GLRH 1KXTB 1UQSA 2G60L 4XPGH 5C0AE 1NCAH 2VDML 3KPQB 5IB1B 4MB1A 2MRYA 4DHLA 1DEEA 2WB7A 3QUZC 5E1AA 1JZ6A 4LO9A 1RK1A 2ZG2A 1S7SB 4XVJH 1WC7A 3IJ9A 4OFDA 5HDWA 3OWRA 1UACL 5I75B 1IJ9A 4ZODA 2EP6A 4YDIL 1HEZB 2Z64C 3FSVA 2ZX7A 4XNXH 3FT1A 4CSPA 3CFIC 3Q8AA 3QRBA 4L4TA 4BQ8A 2PCFA 4GLRI 2XZCH 1VHPA 3AUVA 2F8XC 3B2PA 2H6OA 2E7HA 1F11B 1S9WA 3QCUL 1R5IB 5CWSB 4H25A 4GKZA 3BMVA 5D1QD 1NFIA 1BZOA 4PG2A 2OSYA 3KCPA 2NYZA 4P07A 1A4KA 4PJHB 2DWTA 3FT3B 4XPAL 2H8PA 1I1AA 1W72L 1UB6A 3AT9A 2KUTA 2QV2A 4DZBA 2WZPA 2YGOA 4NZ8A 5D8JH 3WJMB 3N0AA 3FQXB 1XD0A 4YQXL 2A0LD 4P2YA 1IFHL 3VCLB 1DQQA 2EVIA 5EO1A 3D30A 3PJSA 4UQEA 1CGWA 2BH0A 2YR3A 5FUZL 5JPMA 3SZ6A 5FDWB 1UXSB 2ZP0T 2OSLB 2XYCA 4XP6H 4ETQB 3VYOA 5TF0A 3QXAB 3B5GA 4Y2OA 3F7LA 4M3JA 4ICWA 3DX4A 2A4EA 4Y5VA 1EXGA 1K2DB 2CBPA 1CDCA 5AAWA 3LZFH 4X0KA 4IBUA 3RE0A 1QSZA 3MRLB 1JXKA 2PYED 1URLA 4CRPA 3C5ZB 3ZYZA 1PKQA 4KFZC 1IC4L 4TQEH 1J88A 3CHXA 3EJUA 4NQXB 5C0AB 5TE7L 4D7PA 2HKHL 5CO1A 2V5SA 4RX4A 3UG3A 1ACZA 4HWNA 1F86A 2WZ0A 3B7TA 1DEEB 5KW9H 2B0SL 3QCTH 2X4UB 4UQ9A 4X83A 5EOCJ 2VO5A 5EU5B 5AB9A 1DSFH 3UTSA 2NQ3A 1AO7D 3DSFH 4LLYB 1X7QA 1G7MB 4DIXA 1WZLA 3FC8A 4K8RC 4L0ZA 3FTGA 3PGDB 4H0IA 3K0YA 4QAMB 3WJJC 2JIXB 4FMKA 4AGMA 1EJOH 3ESMA 4JZNB 2X1QA 4U7SA 5I0WA 5FIEA 1G9MC 3EDDA 4WQOA 1QUNA 1EZVY 1CTMA 2VH5H 5DURB 3RU8H 3V95A 2GK0A 3ARDD 4Y4KB 4KK6D 5CJ8A 3SODB 4AEFA 5L8JB 4BIKA 1Z5HA 2BY0A 2EKSA 2CUAA 4PS8A 1QI5A 3MR9B 5ICXB 3U2IA 1IZJA 2IV8A 1QLRB 1U9KA 1N0XH 5C07E 2X09A 3ULVC 1HEHC 2JIXD 4RWHA 1KCSL 4Z1PA 1H3GA 1RIHH 3ZT7A 3BP6A 2JKJA 3ALWA 2PO6D 3H9SD 4FQIH 4QRSB 1KGCD 2XZQL 3IMRA 2Y3AA 3QJZA 2JJUA 3F64A 4GMSH 4OZIB 4KDWA 1BIIA 2AV1A 4QXVA 4DTGH 2J5LB 4Z7UF 3NSDA 1ROWA 4LDLB 5F8QC 1XX9C 3KPOA 4LKCA 1CGSH 2YA0A 1NMCB 2DW5A 4JO2L 3JQOB 1AGFA 3FO9B 4M7ZC 5D1XA 1WLHA 5B38B 1QSFE 1RHHB 4OZ4B 2AJXL 3GUTB 4N9GA 5DFVD 5J13C 3RDJA 5ADOH 4OFYA 3NAAH 1ND0B 3HS9A 4L0YA 4IKNA 2C34A 1JZFA 2HX8A 3K3QA 1DBJH 1MVUA 1U58A 4PMEA 3VUAA 3LNDA 3DMMC 3RNKA 5F7WC 1VFBB 4XCEA 1F4WL 1JXJA 2GK2A 2P5EB 3V9CA 4TUKH 4LCIL 2R29A 3WYRA 3FT2A 2FJHA 4K9JA 4W93A 3TV8A 3ZBMA 2WWKO 3UADA 5B38G 1MHHB 4JO5A 3FUFA 4E5XA 3LKRB 2W0LA 3L95A 4ZMYA 2QSQA 2J55A 5F7DB 3ULUL 5KSAA 4L8BA 4RWYL 1KB9J 1SLWA 4BWUA 4GI6A 1MF2L 1JGVH 5FA3A 1G1OA 3QNYB 1ADQH 4XVUC 2H9GB 3BN9D 3HBZA 2BZ7A 1E5YA 2ZICA 1E42A 2KS0A 5EF3A 3IU3B 4FN0A 4IBYA 4RESB 3N43F 3WNOA 4I3SL 3CDCA 5FAAA 3TU6A 4URKA 4OLVL 1PYWB 1I7RA 3LRSB 3PQYB 4FFYL 3QDGB 4FDWA 5GGRA 3RWIA 1GYAA 4JZOA 1GC1H 3FF8A 1UB5B 2QSTA 4PD4K 4OZIE 3HCVA 1G7LB 2WD0A 2AQRA 4GSDH 5GGQH 1E9OB 2Q3AA 4PGCA 3KWWA 1NOLA 2E9WA 1GPOH 1OSPL 3UTSE 3ATBA 3DTXA 3UO1H 1HKLL 2YBRB 1TKWB 2V4LA 1D7FA 1CFVL 2VE6A 3P3SA 2ADYA 1II4E 2HVJB 1AXSA 5CBAA 3IAPA 4JFPB 2BIMA 2H8PB 3Q8CA 3UTOA 1XIWD 4X4MA 5E2WL 4KI5C 4X6EB 3NEXA 4AENA 4BZ1A 5KUMA 4N3TA 1U3HC 3V5DA 3SPCA 1AXTL 1U42A 1A0QL 1XGRA 3F12B 2TSBA 4Z0XB 5TK2A 1FZKA 4E9SA 5FA4A 4I0CC 1A9BA 3GLAA 2X4TA 3PGFL 3ULUF 3T3PB 3BAEL 3O41A 3SJVA 2VDNL 4LLYA 4H8WL 5IJBC 2W07A 4MWFB 1QP1A 5IHHA 4UDTA 1R3LA 4AYMC 1G9NL 1RPQA 4JFZL 4RBPK 5CCGE 1TYEB 2EIEA 4OI8A 1FVDA 4NZRL 1PZ3A 1SHSA 4HGKC 3QNXB 5DFVC 3NCXA 3ZDYE 4J3TA 1RULL 1JGUH 4JR9L 5F96L 5JOFB 1K3IA 3KPLA 1FO0B 2K9FB 4IBZA 1PSKH 4AQEA 4TMPA 1JFHA 4YHOH 1MRDL 2PYFB 4G9FD 5C08A 2MQGA 4G82A 4RFOL 4AL8L 1NL0H 1GL4B 5IFAL 1CE1H 5LO7A 4CAGA 1AI1L 4Y7MA 3EJJX 5DJ6B 1R5WA 3SN6N 1FAIH 1MHPH 4PRNB 4MB5A 3UX9B 5KSBE 3SDDD 1TQCB 3CSYA 1UC6A 4N68A 2G5UA 2H1PH 5ETUA 4C56A 1KIUA 1TTUA 5JIKA 4XO9A 1DZBA 2V7HB 3HN5A 3QPQD 3ZE0F 3CSGA 3N5AA 5CP7A 4HJTA 2GITB 3BUYB 3CN1A 2Z6FA 1R3KB 2XICA 4YSDA 4TQPA 3NESA 5KAQG 3J2PA 4KK6C 3C09C 5C07D 4L8CB 1S78C 3U4EB 4PJIA 3WKYA 2L8AA 5GRXG 1WHOA 5KBNC 4YNYB 1F90L 1CE6A 4UIKL 4ZSOE 1E28A 3DV6A 3MV01 1U2CA 2AQ1A 2OJZL 4JQVC 2XV6B 3RHWK 2VZVA 5LBSA 3WNNA 2V3EA 1FZOA 3WHXB 1QWHA 5C0FB 4OCMC 1RD6A 4ZTPL 5ICYB 1G7PB 2D3LA 3LPPA 2HA1A 3T3MF 4ZPVB 3DVGA 2OPCA 1GMEA 1JJUA 1VRSA 4PJ5E 1TVDA 4OLZH 2VUYA 3VD2A 1IAKB 4N0RA 5CZXC 4GO8A 2V5MA 3VI3F 3Q6FB 3UGXA 1XCXA 2MNWA 1FNEB 3KLHC 3O6KH 1M9WA 4OD2B 5D4QA 5C9JA 3S4SA 2F1BA 1U58B 2Z93A 4LHUA 4XXDA 3MRQA 3WEAA 3GXDA 4AM0Q 2B20A 4NCDA 3TT1L 1RAMA 1CI3M 5CU5A 3GUTA 3IFPB 4EUPA 2VSDA 2P3YA 3IKCB 1E7UA 5T3XH 3DHJA 1G7LA 2EH7L 5D7HA 3WLBA 2A7BA 2DI7A 1XR8B 3HR5A 3VA6A 3VGAB 4BZ2A 5BW7A 4L1HA 2WUCH 4JO4L 1BOGA 3BVNB 1FF5A 3U6XS 2VJXA 3T0DA 4ZTOH 3K6OA 3PUCA 4XXCA 4ADIA 2UY6A 3WFHA 3CVHL 3LH8A 2ENQA 3P2DA 4F3FA 2EDQA 3F7PC 2W60B 3CH1B 5CJOH 2GTQA 1S9XB 3B6SA 3IDNA 3NTCH 3O6LL 4DGIH 2D0GA 2ZTBA 3NQIA 4M6AA 5K1JA 1HAUA 4YSSA 1DBAH 2LAAA 2PW2B 3TN0B 4HMEA 5CD5D 3TESA 5H2BA 1RJZA 1MJJB 2P9RA 4FABL 4YHIB 4PRPA 4RA3A 5J6GA 4O4YL 1S8DA 4NP9A 5FW7A 4H0LC 3TA3C 4UOJA 3TBBA 3QYNA 2AMGA 2NY2D 5IBTL 5C3IA 3G6JF 1GS8A 2VN7A 3KW8A 1Q0YL 5B7MA 1IM9D 4HAKA 5EEUA 1FFTB 3NQKA 3H0TA 7CGTA 4NOFA 5T1DL 2YK1H 4HXBH 4R5VA 3HRZA 3R19A 3WTUA 2YQ2A 3V0GA 4GKZB 2PP7A 1LEGB 2EDHA 2NXYD 2DQJL 5D5MF 5DS1A 2AQ2A 4X4YA 5I73B 3DTXB 4A7QA 1TIUA 1UYWL 3OKYA 2WYIA 2NR6C 3CVIH 5KVEL 3A3YB 1I8LA 2MHAA 3IDXL 4XX1E 4DGYL 2OMVB 5ISZB 2PCFB 1MH5B 2O93L 1U36A 3BKJL 2A9CA 4EOWH 1J05B 2ZOUA 4A2HA 2H3NB 5E56A 2R83A 2WOYA 3ILQD 4AITA 1IX2A 1KGUA 4KITB 4NWTL 3JV5A 1T20A 1I3RA 4HJGA 3PWJB 3Q1SH 4PB9L 5EOTA 4OUOA 1NMBH 1EO8L 2XVKA 4G42B 4LSTH 3QQXA 5C0AD 5IUSA 2IVFC 4FHJA 3P4NA 5JORA 1RUMH 2B59A 3OKOB 2VQUA 1EFQA 4LP4A 4PRHE 5D1XE 2Y9RT 2JK5B 2EVGA 1RJYB 4BCZA 3GSXB 4AOFA 2BDNH 1XZWA 3T2NH 1DBML 4DZ8A 4XP4L 3QQNA 4NNYA 3QEUA 3ZYOA 2PO6A 4PN6A 4G59C 1A4BA 4JDTL 3UCQA 5EIQA 1GH7A 2Q0ZX 3M6DA 3VG9B 3QZBA 4EZJA 2E76C 1TQCC 1NFDE 4R96A 4V1DD 5DQ9A 4OJCA 3ETTA 4YHYB 2Q7YB 2P8MB 2LTQB 4KK8D 3IDGA 3NEOA 2ATPB 3BWAA 1ES0A 2JQMA 3LRLA 5IV2B 1Z1WA 2PPCA 4KRLB 1UD5A 1UJ3B 4M43L 5JO5A 3MLRL 4ODXA 1BMZA 1DQDH 1EUUA 3QR0A 2ZXDA 3SYQA 1QYGL 2JJSC 3S8GB 5EU6A 5I19H 1F8TH 2O61B 4OW6A 3GMQB 1KXQE 1DUZA 1NGXB 3CPUA 5F7AA 5AVZB 1WT5C 2BRQA 3ZO9A 3D3VE 3O3DB 3SPVB 4M93B 2Z7ZA 3J7HA 3FFCE 5GS0C 3IMSA 4LOFA 1J8KA 2PYEB 3PV6B 3AW5A 2YAFA 3WD5L 2OR8A 4E2OA 4KDTA 5FHAL 4AIXA 4X9IA 1EGJL 3VFOB 5I1EL 4S1SH 4ZK8A 2WBXA 4H5SA 1MFDL 3EGDB 1RIUL 4ZMTA 4K5MA 1Q9WA 2GHZA 3THML 2NY1B 4PVBA 1RMFL 3EOAB 4HS8L 4MNQE 3BUDA 3ZL2A 5T3ZL 5GJTH 3X13B 1JWMB 1UT9A 5DEFA 5JDJA 2QADB 4L3ED 4P5MB 1QHPA 1H9VA 2CPUA 2PPAA 2XI9A 1FFRA 3QJXA 5DUBB 1HE8A 3QFDB 3QQ9C 5KSBB 2OCCB 1J87A 2R7EB 2C3XA 1SYSA 4CBPA 1RJYA 5BMFL 3IVKA 3TH4T 5EORH 2J5LC 4UQBA 4UZUA 3MRIA 4ZQTA 5LXGL 3MUGB 4E5XG 2XRAH 2VQTA 2FX7L 4MA3A 1EGJA 4N2CA 5J13B 3VXNA 1ZTXE 1FORH 2K6YA 4KUZL 3MV8A 4M7ZB 4DP6X 4WW1A 1UXWB 2CR6A 2Y7QA 3O2DA 2E9BA 5IB4A 5ITBL 4XNMB 4PJ7E 5C0CE 5EU5A 1FFOA 1TTGA 4UT6H 5MEPB 5JA9A 4DCQB 5LNEA 5FYLL 1BFVL 1E27B 1GY2A 1MFAL 1U8OA 2D3JA 3KPMB 1RZJL 1RUQL 4XHQA 4HS6A 4Y16B 4DPRA 3ARQA 3DUUA 3VFRA 3ZTCC 1GCFA 2N7BA 3DKHA 4O2EB 4DEPB 5KYUB 1KGJA 5CR8A 3WDJA 3IU4L 1R5VB 3WE1A 1NOAA 1AIFA 3WS3A 3N04A 2DKUA 3MRLA 2E6PA 2E9IA 4F8TA 2CHDA 2IWKA 2DJUA 4WHYG 5AD0A 4P46B 3CNKA 5ACLA 4YH6A 1O7VA 3BVDB 4IMKA 3QJRB 4Q6IA 3SDAB 1UJ3C 1XVSA 2WNWA 3CZFB 3CTTA 4P23B 2XV3A 2VNCA 5D2NE 2PF6A 1CFNA 5F9WC 2VXTL 1GJIA 3G6AA 4GW5A 4XPBL 3PRZA 3UTSB 2XHNA 3SIKA 3ATDA 3RWHA 4OIAA 1Q38A 2B15A 2TAAA 5CINL 5E9DD 1U8JB 4F1ZA 4F57L 5KSUB 1XCQA 4PH8A 3QIUC 4G8FB 4L5FL 3KBEA 1EXUB 1A4AA 1P6FA 1HDMA 5F1KC 2ZKYA 2X70A 4H88L 2MCG1 3ZTJG 5JW4M 1DUZB 1IC0A 1NGXA 4FLOA 3ARWA 2QLYA 1AQDB 2D9QB 4H26A 5EMYA 3HVDA 3S5ZA 3D18A 3S0PA 3ABGA 4PRIB 4XP5L 1U8LB 5DA0B 3RB5A 4K4KA 3JT2A 4L2YA 4MQTB 4N2DA 1T7VA 1GHFL 1KBGH 2J6EA 2EYSA 1UA6L 5F1OB 5TD4A 4WEBH 4FI7A 1LEIA 2IGFH 5IFHH 3REWB 5J11C 5A43C 3NBNA 1D7CA 4FE9A 4X2UA 4YXHH 4ZMPA 2VDRB 2XWZA 3WIIL 1HL8A 4NXSA 4UMGA 3TOPA 4Q0XL 1PY0A 1DJSA 2QZ5A 4Y7OC 5CLWA 3IRZA 1M7DB 4AV4A 5BS0B 5GS1C 3WO4B 3T0EB 3VFNA 3UEQA 5ANMA 3RI5F 2UXGA 4LF3B 4MAZA 4JGJA 2VDMB 3BWZA 2F7PA 3EO0B 2YSSB 4LKCB 1V8HA 2CGRH 2XG4B 3QWRA 1YY9D 1U91B 5C0GB 2VB5A 4LARL 1MJUH 4XZUA 3M1CA 2Z34A 2WXJA 4TOYL 4ZFGH 1XL6A 1T04A 1P5VA 1Y1DA 2OBGA 3FYEB 4QRFA 1G6RL 2QQNH 2EDRA 1V3LA 2DIAA 4Q74A 2ZOKA 2X6CA 1K5NB 2X1XR 4JKKA 2HG5A 4U05A 4FXKB 1BXXA 4PP2A 4PGDA 3RUGE 2LVCA 3BKYL 2OAAA 2OS7A 4BKLA 4KJPD 3GXNA 3NJIA 1Y0LA 1ZVSB 5FO2A 1R5WB 2A6KB 1ZMYA 2NR6D 4LLVA 5DMIH 4YLQT 2X9YA 3D5OF 4GRLC 1C1EL 5G4NA 1TJXA 1JPFB 5H4YA 4FL4B 25C8H 5DEGA 3G04B 4NI3A 4QRBA 1BFSA 3SYOA 2QVIA 3P9LA 3DX6A 4QRPA 1UASA 4K0OA 5J56B 1H5BA 1FV1B 3EJYD 3N91A 5CMAA 5ICYA 2P80A 1RUAL 5AVRB 4E0RB 2VXSH 1JWMA 1J7VR 1A1OA 4LHQB 4QHUA 2DWDB 1R3IH 2BZCA 1T21B 3NH7H 3O4LD 1AGCA 4LL9A 3KYKH 1CR9H 4PJ9B 2O72A 1U41A 2RD0A 3O4OB 2CO3A 4LLMA 3AZUA 3KYAA 1YNTA 3GIZH 3PNRB 4YHPB 5I1KH 1E7VA 5IHZA 1DSFL 1PX4A 3BPOB 2DPKA 3VGHA 4EN3B 1PKQB 2QGEA 4GG6B 3NZHL 2NLJA 1NDTA 1NUDA 1UD2A 4P5KA 4BH8B 3EGXB 2YQGA 1CE6B 4KX7A 2FD6H 5DJ0A 3TBVB 3X11A 3BDBA 3HHSA 4HOXA 1DQKA 3WUWG 4M00A 5A16A 3KJ4B 4HMDA 4KJWD 5DZAA 2HT4C 3KDMB 1G7HA 4OF3A 5E6IB 5E6YA 3RL1B 4QHNB 3S4SB 5A3ID 3I6LD 5ICUA 1R3KA 4PV9B 4FKEA 2R29L 4R3SB 1XCTA 5E8NB 4JKNA 4ZDHB 4G6AD 2JB5H 43C9B 3RU8L 4FQQB 5IREA 3U82B 2E8ZA 3D39E 4QTHA 4FFZL 1RY7B 5IVZA 1IAKA 1L7TL 3LN4A 3LN5B 5L8KB 3ZZLA 2A5UA 3M07A 5BVPL 2UXTA 1X5KA 4YVUA 4C4BA 5FUCE 1BBJB 4K3JH 3ZQXA 1U8QB 2D2CC 2YUXA 1A6TA 3UTPE 1KDJA 3FN9A 4TULL 1FNSL 2PTTA 1BVZA 3WUZA 1MCOL 1U8IB 1NCBL 1TO5A 4ALAH 3ZL4L 2BOCB 1J10A 2EC9U 2XPGB 4M61B 4P59L 1AE6L 1JZ8A 1DJWA 3F7YB 4X80L 2V2XA 2RGSA 1YEFL 1J0ZA 3OGCB 5LGHH 1QKZH 1WA1X 4OD1L 1F18A 4K3EL 1ERNA 3M1BB 4JO3H 5TE6H 2MIZA 5FR3A 1R34A 3KBPA 1CGSL 4F2MB 4DPCX 5DMKA 1NCWH 2QHLA 3L5XH 4XO4A 3S48A 4AYSA 4XX1G 2E47A 1JWSA 3MLXH 3TNMA 5ISZA 4OLWH 1AFVH 4JFED 2XT1B 5EPMB 1RFDH 1A6ZB 1K6QL 1EDHA 4Y5YC 4RETB 4WI8A 1G5AA 3H9SA 2H26B 5KVMC 3CX5K 2EYTA 4UAHA 5CUSH 1F4XL 3W2DL 1FH5L 4LAQL 1P9MA 2BSRB 5E4IA 3APCA 5JMRA 2EUXA 2Y5QA 3AXHA 3CLEH 3GI8H 3MRCB 1FN4B 4Z5RA 2YAMA 3VD3A 5CD5C 3RZCB 3B7UX 3O6FB 5FFLA 1U0QA 2ARWA 3VG0L 1J5OL 5DJ2B 1SJEB 1ADQL 1XEUA 2CCVA 5F9WB 5B3JF 1AKJD 2BNQA 2XWTB 3KPRA 4KKAC 1TZGL 4G9DA 1SDYA 1JF1B 1E5AA 4ZUWB 3NDYE 4TLSA 4H1LH 2DLTA 3H9ZA 2K6ZA 3H6JA 5IQMA 4P49A 2ZUQC 4DP8X 3GM8A 2HFEA 3D4ZA 3E2HC 2F74B 5FPIA 3AQZA 5JHLA 4RQQB 2IDCA 5FYKD 2XUWA 3GQFA 4H7VA 5GRVL 1H9DA 2FUTA 2VGLM 3MKKA 4UU9B 5KVEE 4Z7NF 3U0PB 1MREL 4OV6F 35C8H 4Y16C 2O5ZH 3V0IA 1KLFB 2A9ML 4QYOA 3UTQA 2H0FA 2VYRE 5FM5O 3BUTA 5ANHA 3R0NA 4HHWA 3F65A 4N2AA 3RDTC 5CD3B 3VTAA 1OAQL 3HR5B 2VLJD 4D0DA 2Y5EA 3R06A 2FEEI 4OIIH 2EC8A 1IT9L 1WWCA 1KGCE 3MREB 3QPKA 3H9YA 3HPJA 3BRGC 3Q2CA 1YEWA 2X9WA 2ADFH 2Z8RA 1RVFH 5KBMA 1E3ZA 4N2HA 4BFNA 2JKSA 3GMRB 3LOWA 4MBRA 2J25A 4BKSC 3B9KD 3I02A 1KPUB 2EDNA 4OF7A 2NW3A 2VDNH 1G7IA 1E8XA 3GINA 3EBHA 5DJCA 3EYSL 1NGQH 4G3YL 4ES9A 1G9NH 4NM8H 4PJ5B 1A14L 4YDNA 4DP4X 5BQ7A 3JTSA 2GFBA 4YBHA 1MCWW 4H44C 2G3MA 1GAFH 2DIJA 2ZOWA 5I71C 4LBEA 2YLHA 4FNSA 4OZIA 1B88A 3P73A 1U8IA 2R4RH 2OL3B 3AT0A 1LWHA 3P4MB 1MCSA 3GSQB 4NO0A 3WTVA 1IUZA 4JPIB 2DWYA 4E5XB 2ADIA 4HWBL 3UG4A 1NJ9B 3FTUA 4RFOH 1A2YB 4KJYA 3E1F1 5FUZH 1GIGH 2X4PB 2YPLE 3MLPA 3MJ9H 3OTTA 5T1MB 4EN3D 3D3VD 2DLFH 2R1XA 5E2TL 3WHE0 3HMXA 5FGRA 1M05B 4CBZA 1EEUA 3ARGA 3GKWH 2H1PL 4GMTH 4ZX4A 5E8NA 5EPMA 1D5MA 4J3UA 3L54A 2ITCA 5J89A 4P5TC 3HB3C 1P84K 3QIWB 1DP0A 3OPUA 1HU8A 4S1DD 5FYKU 5ID0A 1G7HB 4FQ2H 3C6SB 1MELA 1TJIH 1A1NB 2ICEB 3S97C 2NTFA 3NGBB 3ROLA 4L3EE 1AY1L 1LP9E 5IESH 3QEQE 3G9VA 3N50A 1K4CB 4UIKH 5FV1L 3ZKMC 5DZVA 2W8CA 1TTAA 3G08B 3FTXA 3BQUC 3GKZA 1I7ZB 1UA7A 3QAQA 4G8IA 3U9UB 2BOCA 2XPGA 2GT9A 4JM4H 1SFDA 2L4OA 4O2EA 4MYPA 3PGCB 3OWEA 2F18A 2IWFA 2BOBA 5IHBA 4NUGL 1KGWA 2DQUL 1JHKH 3IS1X 4UT9A 4PJIB 4UQDA 5FYKE 1CGXA 1AQHA 4LGRB 2QADC 2C7UB 3K91A 3NCCB 2GI7A 5AQ0A 4TF4A 4XNMA 1AIZA 2G9KA 3LQAH 5DGRA 4IRSB 5HI3C 4MWFA 4HCRL 5BVJB 5EFIB 2V7HA 1YNTF 2UX6A 4PCTA 4JPWL 1UTDA 3VFUB 2MPVA 3NCWA 4XNUH 1TZHB 3MRIB 1JGLL 1M7IA 2YD3A 3C9NA 4FZ8L 4AH2B 3OAYK 4MZ2A 5KVFE 3B8YA 1NCNA 4ZO8A 3A5VA 3V5DB 3U2SA 5IWLC 1KTBA 2ZPKH 2HAZA 4KAQL 4XB3A 1OHQA 5CGMA 5GRUL 1E4JA 1FG2A 3WEMA 2PYFA 4FOMA 1HOCA 3RTLA 2VAAB 3W0WE 5AWNH 4LLDA 2Y7LA 2NSXA 2BJML 2V33A 3IRPX 4JREB 1DE4B 4AMXA 4GP5B 4QHPA 1R5VA 5DD3H 4GUPA 3RVVD 4DTGL 3MV7E 5CXPA 2VXQH 1H15A 4U1NA 4RFNC 2KKQA 3SGDH 3MUHL 1SEQL 5E9DB 3INOA 3SCMA 3APFA 4BZ2H 3GRWA 2E46A 4JZJB 4ZAKB 4O5LH 3CFUA 3KW7A 4PREB 1DFBH 4DGIL 4KBPA 2EEXA 5MEQB 2QHRH 4B9FA 4M48H 4JPKH 1PD6A 1UUNA 2BOLA 1W0WB 1CZ8L 4UOQA 2FB4L 4AM0A 3Q2VA 1DBJL 1NBZB 4XPTH 3JWOL 4RAHA 4F9PC 3RWCB 2OFQA 5IBTH 1AOHA 4XOBA 1CFTB 3SDCD 2WVUA 1WC7B 1NH6A 2PPFA 1QBMH 4OZHF 2ZXGA 5HYQA 4XBGA 3MV8E 2CDGA 3GWJA 5F89A 1KJ2B 2KBGA 3AMKA 2FGWL 3BFWA 3UBGA 3EO9H 3T0EA 2ETWA 3N3EA 3S5LB 4HOWA 3WHE1 2CSPA 3MFFB 2I5YL 2VDRH 3QR2A 2P7TA 2DMBA 4C4KT 1T66D 4WI9A 3CVIL 1GYUA 4RFEA 1LK2B 3WS6C 3EJRA 4ZT1A 3VD1A 1AAJA 2WIIB 4PY7A 3LB6D 4OSUH 1UWGH 1X5YA 2OJ1A 5IB5A 1W72A 4OLYL 3T8MA 1HHIA 5EZIL 5K5YA 1TLMA 1ET5A 5LBVA 3UERA 1T5WB 1OAXL 1ASPA 2WLMA 4B3EA 4E36A 2R0LH 3EBIA 2BVUA 2OTWB 3O9WC 1HNYA 4R0LC 1TTBA 3RPBA 1FSKB 2ICWJ 3EYFA 2CR0A 3FRUB 1S7UB 4FA6A 2FWLB 5EOQL 4WWKD 4I0PC 4PRBB 2EH8H 3EZ8A 4G6MH 4YJZL 3QH3B 4WUKL 1T1WB 2FSEA 1Q1PA 4ZX6A 5A7EA 1IM3D 4FJZA 4EI5D 4R2GB 3P9LB 3NSCA 5T33H 3GI9L 3S5LG 1OB1B 3H2QA 3K2MC 3OC8A 3T3ME 4AEHH 5D93B 4R97C 4PJ7F 5ACZB 2CDFA 3MBXH 5CMAB 3GHBL 3RVVC 4WTZA 1ETJA 4DZBB 1DHKA 3OPZL 4U3XA 5ESVA 1NGWB 4ENEC 5E08L 3ZDXB 1RI8A 5DA4A 1EPFA 1RZPA 2Z31C 1UCBL 1YSOA 3IPEA 4F7TB 1H8NA 1RULH 3P4LA 3P0VH 5BRZA 1J0YA 1CXFA 4RDQF 4L2LA 3C8DA 4LLUB 3EYOA 5E7FA 4F7CB 1LD9A 2JTYA 3OKKA 1IU1A 5ECGA 4MJJA 4YHOL 4CJ0A 1T03H 1EA9C 1DUYA 4Q58C 4UB0L 2C26A 1VCAA 3P4NB 5KYNA 5IJKA 5I1EH 5CCKH 4IU2A 1UKSA 1AD0A 1IBZA 4X7EC 1V05A 1X5GA 2FGZA 5FGSA 4Z7VF 5DCCA 1DL7L 4PI0A 4WLCA 1I7ZA 5L9DH 3VWKA 3MBWB 4GT7A 5GJTL 1QEWB 2ED9A 3AU1B 5I8CB 5EEWA 2VR8A 3KYNA 4Y5VC 5J1AB 5I76A 4FNUA 2WTRA 5C92A 4LP8A 4IKIA 3GT6A 1XMWA 3MRDA 2Y4SA 3RRQA 1NDGA 4M5YH 2VWEE 3HC3L 4MZRA 1BIHA 5F89B 3F58H 2PW1B 2K4AA 1BF2A 4WK0B 2AEWA 1DJXA 3Q6GL 2OM5A 1L6ZA 4HJSA 3QHZH 4RMUA 3MUZ1 4XCYA 5JZ7C 5D8JL 1HTYA 3TWCH 3QDJD 1QSEB 3OGOE 4P5TB 1I8UA 4P2OB 5DZOA 2W0PA 5EC1A 5FWQA 1BP3B 4Y5YB 3E6FA 4PRID 3IAGC 5HHVH 1QQDA 5CBEB 1Q9KB 2VABA 3SKNA 3TJHC 3BWUC 3VRIA 1GZPB 4PWEA 4PR5A 4D2NA 1K3ZA 3ZT6A 4O9HL 3OJMB 1AZUA 2RH0A 2CHWA 4LLQB 1J1PL 5ERWB 1M6UA 5TQ2L 5KVGL 4YDVA 1CURA 3GMMB 3NT0A 2A6JA 4RFEB 2VIRB 3ECBB 4JDZB 2FEDD 1H15B 1EUTA 3WFDH 5DHVA 4IBVA 2MCPL 4YHNB 3LKPA 3NFSH 4U1IB 2XA8H 4GRWB 1JIBA 1FGVH 1PFOA 4M7KL 3IDGB 3H7BA 4FJYA 1GGCH 3VDBA 5IOPB 4XPBH 3CVBA 4XC3L 1QNIA 1BYNA 2B3RA 4KNUA 5HVHC 2KZWA 1FJ1A 2Z35B 3C75A 5DWPA 4F7EB 5F9JB 5D2LF 3QCVL 4XBGB 1IGTB 4RRPM 4UM9B 1T5KA 4E41E 2FR4A 3B9KC 4WDIB 1XGQA 3LRGA 4HZ1A 4MA7H 3CIAA 4MQ7A 1MI5E 3VGDA 3HVNA 2R9HD 2BFGA 3BP4A 4UNIA 3H2WA 4JFVA 3A4FA 3VXQA 1PIFA 1T80A 5ILTH 3MV9D 1SEBB 1JVKA 1QG3A 1QMUA 2O61A 1OF2A 1VACA 3QORB 5I6LA 3G5VB 5C0EB 1CC3A 4MCZA 4YPGB 2OL3L 3QXVA 1IGYA 2YAOA 3KPSA 3FL7A 3Q0HA 3AS0A 4JVWA 5AKRA 2ERJB 1IKFH 1XEDA 4W6YB 2WJ7A 4NT6B 4GAFB 2YK1L 3OB8A 4NQVA 4MS8D 3TONA 1A9BB 4YXHL 3S3DB 1KTCA 3AG3B 4PJIE 4MJ5A 3UDWA 4XXWC 3ESUF 4P57B 4TNVF 4A1RA 2DDQL 5K33A 5MI0C 1WD9A 3K72B 1IGFH 3LKNA 4J28A 1PG7H 4XWOC 1Q90A 2X4QA 4EOWL 1MI5B 4JPQA 2WZ6A 3MBEB 5LN4A 4Z3FA 3FB6B 3RY6C 4N6QA 3Q3GA 1RZ7H 4Y19E 1T1WA 5KSBA 4MJIB 2IPTH 1I1YA 2ARJQ 3W9DA 2QDWA 1HIMH 5GISL 1A2YA 5BZXA 2E7BA 3UP6A 5HDBE 3P9MB 3RGVB 2HT2C 2R23B 3QEQB 4WTQA 3PXJA 4AY0A 3CVHB 2WO2B 3BLPX 3GPEA 4R7VA 4CU8A 2WKOF 3O2VL 3H9HA 4AQ1C 2FLMA 1ZK9A 3VVWA 3CVCA 3Q8FA 2WYHA 4XVSH 2VLME 1XF5B 3UROR 3QG6B 5AALA 3NYKA 3LCYA 4YE4H 1OOWA 3T71A 3RZCA 4JZJC 4YSPA 4OTXH 3V4VH 4UDTB 2XN9A 1EHAA 3Q1EA 2CO6B 5C0CA 2DV6A 3SZKC 4KNQA 2Z7WA 5EWIH 3RUGA 3HMWL 5A2BA 3KDPB 4YOKA 4K5PA 4NO2B 3MX0A 1CK0H 2Z8SA 4P2OA 1NGZA 5F9DC 4KTGA 3AWFA 3ZHDA 3HG1D 1UWXK 2P5EE 2F7OA 2FBJH 3N42F 3BSZL 4H1LG 5I0VA 2X40A 1NZRA 1XIWA 3LJ3A 1DO5A 1C8QA 5FOJA 1AS6A 2EZ0C 5I19L 5FGBA 4FCAA 3N1PC 3S6CA 1ZEAL 5F3HA 1CJYA 3IXTA 4XP1H 4P2RD 5KEZA 4ICXA 3SDXF 4KROD 5C0BE 3L5HA 5D9SB 4TRPH 4U6XB 4DKEH 3BJLA 1A1MB 4JPSA 2IOMA 3P4MA 4NP4L 3UBXG 4F27A 2JF1A 2AK4E 1G6RB 4AKPA 1YMMA 5GRYA 4IK6A 5LGYA 1AQDA 4H26B 4S1SL 4U1JA 5EUOA 3FB8B 1P1ZB 3MV9B 4WUUD 4PTUA 4IS6B 1K4DA 5DLML 2W65B 3BH9B 2CKBA 4HIHB 3U79A 1I1AC 1IB5A 2AK1H 4G6KL 1AXTH 4IRJD 5E23A 3ZTNL 2KPWA 4KX8A 3F00A 4G6JH 5FGCE 3WAJA 3KWTA 1MRFH 4BFEA 3Q01A 5B4MD 1D5IH 3MGOB 4JM2C 4EIGB 4LLDB 1HN1A 2ITDA 5KVDL 5ISZD 4C56D 4HIQA 4LSUH 3TO2B 1G9HA 5D72H 1NAML 5JPMC 4C4KO 2BVOB 2X10A 5IROD 3D7PA 2A9NH 3GMNB 5TQ0L 2RB8A 4ONOA 3BO8B 3HZKA 4MNGB 4ZMLA 2BLFA 4OZ4A 3LEXA 5E5LA 5HVFB 2CO7A 4U3SB 1NPJA 4QCIB 1FL3B 1CD8A 1XB8A 3ZK0A 5I6KA 3VFWA 4YBQC 5E8EA 4OCSH 1LO5A 5TPWL 4KVPA 1RK7A 4Y2DD 3HW7A 2IOIA 4JCLA 4XMVA 3II2A 1WE5A 1E5UI 4CC4A 2I07A 1BIIB 2AV1B 4W6WB 1XV8A 4Q2ZA 3I6SA 4Y1AB 5JYLA 1ZVNA 4PJ8D 4AQ1B 5J3HD 2RFXA 2YA2A 4W9LC 5FECA 4HS3B 3HI1A 5EUOF 3V5HB 1WD8A 1QOKA 2KH2B 4NQVB 2UZXB 3W11D 2XLLA 1M9SA 3VXMA 3EOBA 2WY3B 1U2HA 4NJAH 5E1IA 5F6HI 2BSDA 2O6PA 1CF1A 4GRLD 4EZMA 4XP9H 4Y2DB 1AQ8A 2EE3A 5LG1A 4QO1A 4MA8H 5I1HH 4N2LA 1SBBA 1F6FB 1TEYA 2R69A 5T1LB 2XY2A 3T2OA 3RL2A 3OHXA 4HT1H 5D7EA 1U92A 1N70A 3CJJA 3KXFE 4LSVL 3WKQA 4PJEB 3FTZA 3WMPA 3D0VB 2FH6A 4ZO9A 4B95C 3ELQA 2H4EA 2YXFA 3UPAA 2LHAA 4AMKH 3GBEA 5DR5H 4ZO7A 4U6HA 5D96C 3RUGF 2JLLA 4FA8A 3IS0X 1FC1A 5HDLA 4JE4B 1AXSB 1ZKAA 4FLQA 3D9AH 5KN5A 2N7AA 4NNPL 3TYFA 1Q9WB 2H26A 1T2QH 2YD2A 3HHSB 1NEPA 4P2RB 3V0WH 1SMOA 1VGKB 3HCVB 3CC5B 3MV8D 2XVBA 3FU6A 2BHFA 2Q5BA 2XACC 4ELME 3HRPA 5IUCA 1E4WH 1YUHA 1I7RB 4XN9A 1Z5LB 4HIJB 5DVPA 3L7FA 2BVYA 2J1YA 4ACTA 1MREH 4JRXD 3NSFA 1SLXA 4OFPA 2VLMD 2B1AH 1F02I 4J23A 2A9MH 4JHAH 4HIEA 1SUHA 3T08A 1G4MA 1KCLA 2GCYB 3ISWA 3L13A 3NZSA 1JBJA 4TVPD 5DJXA 1TO4A 4HC1A 2KHAA 3QXWA 4PLNC 1E90A 5DK3A 4JO4H 3WE6B 2YMOA 3PAYA 3ZZSA 4X8JA 3ARTA 4WGWB 43C9A 2FJHB 4ZOCA 4JFFA 2XETA 3RNQB 2YQ3A 1L0QA 2CCLA 1T1XB 4J12A 2VCOA 2G2RA 4GXVH 1Q9LB 2DEWX 4MD0B 4X99A 5BRQA 3NJKA 4M6NH 3BO8A 3O3EA 3HG1B 4DF9A 3QYCA 3SCMD 3C2AH 5DFAA 3EYSH 4G3YH 5C0BD 4YHYC 5L2KB 1JCKA 1BBDH 2VZ1A 3UDWC 3V9FA 2FIKB 4O4YH 1D6VL 3G6JB 4HUCA 2P42B 5E8DL 1ZHNB 1OPGH 3AT8A 2XTJE 3AMLA 2BSSB 3VXTA 4L4VA 5IB2B 2YZ1A 5TDNA 5A6MA 2IXQB 3SDAD 4CNIB 3SGKC 1AD0B 5LCVH 1WIOA 4F2MA 2AANA 4KQ0A 4HWBH 4XN5A 1TSRA 2WP3T 4NQEA 1OTSD 2KQMA 4OFVA 2A83B 5GRVK 5AB0A 4ZSOA 1LO4H 3EJCA 3PV7A 3KPRB 1LD9B 5I16A 3BH8B 3LEYL 4PYGA 4AW4A 4ZFOA 3P9WB 4OT1H 3RA7H 5KS9A 3MV9A 5GS2D 2WXIA 4AQ1A 3U9PL 4OI7A 1HOEA 4BK5C 1X5XA 1XZ0A 3Q1SL 3X1GA 3M8OL 3QIUA 2A6IA 4DETA 3AFLA 3R8BB 4HQQL 1LL1A 4B0MM 3GSWA 1LK3L 3ZN6A 3CFMA 5TE4L 2F7IA 2O6FA 3NJVA 2TSAA 4Z95L 4G43A 4JM0A 3QUKB 2VSMB 2R2CA 4HUWA 1S7WA 4ZPTB 2UZPA 1IO4C 4BV1A 5EN3A 4TQIA 3T04D 2XDHA 3X13A 4QT5A 2WXQA 3ROOA 32C2A 2TRHA 4JDTH 3UXFA 1CICA 2J71A 3NZHH 2XXGA 1AQKL 2NY0C 3HS0C 4KJYB 2CH8A 2ENYA 3TPUB 3K4ZA 3WIHA 1KOAA 1WRFA 3NK4A 1IQDA 1S9WB 2KQNA 3T0ED 3LQAL 1GOGA 1YZZA 2VT0A 3L3OC 3H3PL 3KXFD 3OSKA 4PW4A 1YNLL 1Z9PA 5IQ9B 3ULVL 3IXAB 1IGML 1HEZA 2VISA 5C9JB 1DVFA 4N8UA 1AS7A 3I9GH 1MCIA 2J6EH 2ZPKL 3WELA 5DJAB 2AS5M 2CJTA 2AXWA 3GC3A 4U7MA 3WFEH 1IVLA 2M2DA 4J1UB 2ZX5A 3QHTC 1U33A 5J1TC 5F93C 4EE2A 4PJGE 3D05A 1SBSH 3O8XB 5I5JA 4JHWH 4LOUD 1PBYA 1TOXA 2ZOOA 2XBDA 3JVGC 2Q6WB 1Q94A 2CHXA 2VDQL 2VJ0A 3QPXL 5MEOA 1EZSA 1AZBA 4W68A 1MCQA 1MNUH 1PD0A 4HCRA 5BO1L 1P4IL 2CA4A 3AREB 4UYPA 4WI0B 3G9AB 3H54A 3U7WH 4I1PA 4M4RB 5C97A 4LLAA 2CUMA 3ASWA 5EIIB 3TT3H 1NGYA 1JPSL 4JRXE 3S8FB 1LO3L 3L16A 4G6FB 4G1EB 3RBSA 5LDUA 4HSQA 1RZKH 4Y19A 1FI8C 1DJGA 2GBTA 3EGSB 5I0XA 1G5GA 3SPHA 4DKTA 2OP4H 4G42A 3BD4A 2C3HA 4WHCA 5H37H 3BE1L 2J21A 2HT3D 3JWOH 4ZD3L 4OCYH 4IEFA 3PPEA 3RTQA 1QVOA 2X2HA 3JBG7 1AO7E 3QQ3A 5I66B 4B53A 5IOKA 2WHVA 2FJGB 4K2UL 3EO9L 1UM4H 3OSVA 3N55A 1ZA3B 4HPOH 1KPVB 2WV3A 1QRNB 1GW6A 1JP5A 1KG0B 2GUYA 4WGVB 5LXVA 2VDKL 1I7TB 2ZCHH 2HN7B 3OB0K 4P3CH 5HDOA 4NRZB 3AS1A 2ADGA 4ZUUB 2DL2A 3CFCH 4HJUA 1F6AA 1QUNB 2ZWZA 1Q0XL 1N2RA 3BXNB 4Z18A 1EX0A 3IGAB 4PCYA 3HJEA 2BPBA 3QUXA 3QZWG 1SDDA 1X7QB 5FYLD 2RTTA 4JHUA 1UA3A 2X38A 2C1OA 2HTKC 1B3JA 1PKOA 3TLRA 5IEKB 2N56A 4HFUL 3CN3A 2FEJA 4Q14A 4JMXA 4DAGH 2R0LL 4G83A 4DKAA 4HG4J 2B14A 1WA0X 5EOCH 1ZWIA 4WSKA 1OAQH 3ARGC 1H0DB 2VXTH 3G08A 1SHXA 3WFHB 3LXCA 3N41F 2Z7YA 4ODSL 1IT9H 4IGBD 3TF7C 2ZE0A 3S36H 5I5MA 1OSZB 2B5IC 3CU7A 5K59F 4GKOA 3BP5B 4PBDA 3OG6B 4XMUA 1IQDB 4F57H 2NQDA 2GSGA 3QC5X 3IMWA 4WDIA 5C08D 4EUPG 4L5FH 4G8EA 1KY7A 2G3NA 3FH7A 4H0HB 5K39B 1MXGA 1UHVA 1P69B 1T4WA 3GZOA 4MXVF 3GMLA 2LU3A 4A6YH 3U30B 4AT6A 1XAUA 4KVNH 5G5DA 8FABB 1C12B 5KZCD 5LWYH 1N6QH 5D7SH 2QGCA 1IKOP 3L9RB 5BRPA 2D7TH 4LIQH 2CPCA 3F7RA 4ZQKB 3LRMA 2VAAA 5HBBA 4HKZA 3SYPA 1GTFA 2FSEB 1GSMA 1HNFA 1E65A 1R6VA 3LSOA 2IPKA 3MRFA 4UTAA 3FFCB 3TBSA 4ABWA 1S7WB 2BVPA 1KJ2H 2RAMA 5T5NF 5D6CA 2W0FA 4X5QA 3RWCA 5KS9F 4Z78B 3VWJD 4AGQA 3PWUA 4LVEA 1BEYL 3RPKA 2G3XA 1RIVH 1S7UA 4HC1H 4DVBB 3RFRA 5KYYA 5BPPA 5KANI 3QIUD 4R7DA 3TO4C 1U2YA 4F33A 1JHTB 1P4BL 3U1QA 3CK0H 3IU3A 4PREA 5K9OA 1TTRA 5EOTB 2RHEA 3C60A 1Y18A 4K9EL 4PGBA 3S34H 5ITFA 3V4VA 4JCMA 3UAAA 1W8NA 3T2QA 1E67A 3MCLH 4TSBH 2QPEB 2OSWA 4PD4J 4U1MB 3HE7C 1NPUA 4GRMA 4LLUA 1JGEB 5JR1H 3FFDA 4MB3A 3P54A 3CUPA 5BOPA 1E8ZA 2EECA 2CLZB 4FG6D 1P4UA 1QATA 1PKQE 1N68A 3CFDB 3SGKA 3CWGA 3F01A 1BPVA 1CMOA 3DK0A 5K1VA 2ZCKH 3B9EA 4TOYH 4ZFGL 2O5XH 4O58L 1FGNL 1XT5A 3ME0B 4PRPE 5DQJB 1UXWA 1S7VA 3PL6C 5EBMB 4YR6A 4HLZG 3HC3H 2D03H 1AVAA 4Z7WE 8CGTA 4J3VA 4FL4C 1C8PA 4XN8A 4B9PA 1AY1H 1ECYA 4FYQA 4F15C 2ESVD 3FO9A 1YEIL 3MDJA 5D1XB 5DXWA 2V2WB 4CMMA 5I1CL 4FQXB 2FIRT 4N9GB 3VFVA 3DV4B 4Q9RH 2QBWA 4OZHE 1REIA 4KV5F 3HNVH 3D2UD 5KVDE 5ISZE 3J8F7 2GSIB 5CD3A 2OX5B 3GLDA 1ZIBA 1OCRB 3H85A 3HZKB 4A7TA 1YQ2A 2ZOLB 4JFXB 3BSHA 2AI0H 4J1UA 2AXGB 5BRZE 3DMMB 5LDSA 1LE9A 1QR1B 4GW1B 1XGYH 5IVXB 4ALAC 4FEIA 3TJEH 4DVRL 5C8JB 3E6HA 3DUUB 2IALA 3CSTA 4S1RL 3VFRB 3KPRE 5IKCA 4V1DA 3EGDA 5TQ2H 3LV3A 2OYPA 4GFTB 5I8KH 4GY4A 2H6PB 2DYSB 4RMBA 4MBOA 1FO0H 2BRRL 1PZDA 1TZIA 3INUL 3NRPA 4FZ8H 4ANVA 4IGBB 1WSST 4N2KA 2K78A 2C9SA 4S1QH 2PP9A 3LVTA 3AXLA 3PWPE 5HVHB 5E8PA 1G6RA 5KYWB 5CLXA 1YCSA 3KYKL 2ZXQA 4BXVA 3F7KA 2BP5M 3KH3A 5CLYA 2ZSWA 2UWEB 1TJGH 3MLVL 4YEEA 4KTYA 5CSBA 3ZDXE 2CM6A 4WKZA 3AG1B 3U36A 2DMHA 2Y7OA 3NZ8A 3FKUS 2IAMD 4FFVD 4HCFA 4P3WA 4OFKA 2JJTC 1OB1A 1WP6A 3IDUA 2F5BL 3S3JA 3LY6A 2DKMA 5DQJA 1COBA 1X4XA 4Y5XA 2VMDA 2ZUTA 2E8YA 3K6SB 1S6NA 2HWZL 1CFSA 1OARL 4Y9EA 2IOOA 5F7EH 3RWGB 1CLYH 1L3NA 2P52A 1CG9A 2YUZA 5HDQH 3GD1C 4HX1B 4AZ8A 1TZOA 2R56H 1KELL 1KCRL 1U8LA 3I2CH 3ZJAA 5TTRA 3FO2B 5J6HB 4F15B 4X7SH 4ELMA 4YX2H 1AJ7L 2WWMD 3HA0A 2AK4B 3WXVH 2NT0A 1PZ5B 1HL9A 4X98B 2AABH 4PRIE 1FVEA 4XNQA 4S0SD 3BQUB 4RMQA 2PTUA 3X1NA 1SHMA 1P53A 4IW4C 2SEBB 3WIFB 2W80C 3VXTB 1A5FH 1H6TA 4FC3E 1O5DT 1WO2A 3CC5A 3JZYA 1C5DA 3V52H 5B39A 1VPOH 4TVPE 3IJSA 3MLSH 5FFOA 2V2TA 4XVUD 2IPTL 4PJBF 3GPSA 4HGWA 1THAA 2EIDA 1HIML 2DEXX 4MNHA 4WI3A 1A3RH 5GISH 1M1XA 4L3FA 5EZLB 2O5YH 3IDJA 1N5YH 2ORBH 3LKNB 1MQKH 2XQBL 2Z0BA 3SGJA 1NJ9A 1HILB 3Q2NA 3O45B 4M03A 5D7IE 2WLZA 4KRPC 1QX1A 3O2VH 2O5NA 1M3JA 4NDMA 3QG7L 1ACXA 1FH5H 3DX9A 3FBKA 3GXIA 4JQIA 1RJCA 4I18C 4LAQH 1E3XA 4U1SA 1SMDA 3OC5A 4EN2A 4YE4L 1ETA1 2N0KA 2DD8H 3FCSB 3MA7B 5JPNA 2HFGH 4MCZB 3QEQA 4NZDA 4Q6YA 2IBZY 2MEJB 3B3IB 4TNFA 3LZPA 2WN2A 1J11A 1E8YA 1B3IA 4L4VB 1HSBB 1NCGA 4JQXA 5EN2B 4E0RA 5GZOA 3K8MA 4D8PB 4LMQE 3ZTEA 3QO0B 3NCYP 1U3NA 4K8RH 4EXKA 5IVOA 4U3CA 1CLOH 2M8XA 2OXHA 2DQCL 2UZIH 2R0WL 3FT0A 1NTDA 1R3JA 4GAGH 3GTNA 4JQIL 1UCBH 3HG2A 1YLBB 3EDKA 1FV1A 1QFUL 3FFOA 3BGMA 3QEHA 3BX7C 4I8DA 2DTSA 4AIOA 2X9XA 4QJ5B 4HXAL 5CZRA 4BK5A 1ZY9A 3DVIA 4UB0H 4MJ6A 3RJQB 4LNVA 3KM1A 1OTUD 4R26L 1GGBL 1XSKA 2HTLC 2ZWYA 2EDFA 3Q5TA 3E3QE 4FXKA 1XGUB 4P4RB 2CCWA 3D2UB 4M93C 2CMRL 3JWDL 1PPIA 4LVOB 5L88H 2IH8A 1H3PH 1KTJA 1DANU 2QSCH 3CDZA 2GPZA 2QQLL 2Z91A 3TEXA 1YEDA 4PQXA 3VXQB 1BVNT 1R19A 1QNZL 2APFA 1EAOA 3VXUD 5AZEL 5IY5B 1TYJA 4WGKA 2WIMA 2NY7L 3V0VB 3HEIB 5F7DA 3L3JB 1EFXB 3DA0A 4PTUB 3GXUB 3ALPA 1FPTL 3O3DA 2NDGA 3DURA 1ET8A 3FT9A 4XBEL 4YDLC 3S2CA 4BHUI 1XSJA 1BBJA 1KV7A 4UTCA 3DX9B 4YSTA 3N40F 3ZKQD 4U6TA 5KSBF 3QHZL 1OP9A 1T7WA 1R24A 2FYVA 3HZVA 1P5UA 2JFCA 2QLVB 4XNYH 2HVJA 3DI3B 2NYYC 3FO0L 4QRQB 4MNQD 4UQIM 4HBQA 4W9EC 5MENB 1B0RB 2P8MA 1HXYB 2JLPA 1ADQA 2YPVH 3DJZA 1IGCL 4DN3L 2MQ3A 2A1WH 3IJ7A 1QABA 1Y6KR 1LWRA 3IF1B 5LBSL 3LKSB 3DXAB 1WCQA 4AJVA 1J1PH 3DX8B 4Y16D 2EDLA 4PJGA 1KZYA 5E99L 3UJJL 1X5FA 4AZ8B 3S36X 3UFIA 4P2RE 3T0XA 2E7DA 3JWNE 4GKSA 5EU7E 1RSYA 1A7BA 5IMKB 5GGSA 4NBZB 5CEZL 1N18A 1FNLA 1KWKA 1TF4A 2OQJB 5D2NA 4M02A 1H8LA 4E9XA 5MENE 1XTMA 4HWUA 3HAEG 5AW2B 4PW9A 4AQ8A 1SJEA 3BHBB 1ZGLB 3LN4B 3N44B 1AOZA 4CVZA 3L95B 3FB8A 1BWWA 4YHKH 4B9IA 3UTSD 3ZGIA 3FBQA 2X4TB 4B60A 1UURA 4R3SA 4HS3A 1A25A 4KKBD 2MQCA 1HK6A 5HHNB 2P47B 4NWUH 3VFWB 1KBPA 4MMXC 2G75B 2VMEA 2X2UA 3KPTA 5AD0B 1WTLA 5KJ7E 2D4FA 5IJKC 2E4TA 4XVTH 3O3UN 3IFLH 3RY4A 3MPCA 3K1DA 2XA3A 2V9RA 3MACH 2IFGA 2XCMC 3GNML 3WJLA 2BP8B 4XNUL 3VWKC 2E0PA 4FX5A 4C58B 3TEZA 3WGVB 3SE6A 5C09B 3BVWA 1YPZB 2GUOB 3OKEB 4GKNA 3WMQA 2W59A 2KI6A 2Y69B 3TVMD 4NRXB 3EYQC 4IIZA 5IR1B 3U0PA 2Q8BL 4DJMA 3LS5H 5IROC 4ELKB 5KANG 3FSZA 4G8GD 4EI6B 4JKLA 3FB7B 4Z7UB 3FW6A 2BCMA 4N8CL 2IQ9H 1CLVA 1T7XA 4BSVB 3JYBA 4JM2D 3VXNB 1JMXA 2WUBH 4JEGB 4X6FB 1WBXB 4A2MA 2H32B 1CT8B 5GZOC 4TQEL 1S7XB 1Z3GL 5BV7B 3CHSA 4POUB 2I27N 3B9KA 2BHZA 4BCXA 1HCYA 4JG1H 5LQBH 3QZMA 4NUJA 1A6VL 2YJLA 1NAMB 2I60L 4PCSA 5D7JA 4BZ2L 1C08A 4NCC1 3VXUA 4JY4B 5I30L 4LZKA 1YYLH 1IARB 4CSTA 4YSUA 1PCXA 1RLBA 1TU2A 2GAZB 1USZA 2ZUQB 4AK1A 2XPZA 1H8SA 3ARBA 1TYRA 4NHCL 2OSLA 3K2UH 1QPPA 2BIOA 1A9EB 2Q76A 4OFQA 3ABZA 1OY3B 1TQBC 2HZHA 1QVOB 2Y06H 4XODA 5HJBA 4A38A 1A64A 4ZG1A 3VQ1C 1QBML 4FXKC 4JO1H 1JRHH 3B9DA 4RGNE 4WY7H 2IDTA 1EEZB 4JFSA 4N2IA 4PLKD 1WVZA 3EHBC 4FF9A 3ETBF 4X5PA 5FB8A 3BP5A 3GS7A 3UPRA 4NN7B 2VDRL 4FFWD 5IQ7H 5FO7B 1NEZA 3HAEA 4QXTA 4EMZA 1LO4L 1O9VA 2ZUYA 4H2AA 4OCXH 2L3BA 2MNUA 1N0XL 2IAMC 3F7QA 4JVUA 4ELDA 4JANB 4OT1L 3RA7L 4NQEE 2EO9A 3V0VA 4ENZA 1KCSH 1T2XA 3U9PH 2C5DC 5K9OB 1IQWL 4XTRC 5E2JA 1KPRA 3RHWF 2BVPB 1L0YA 5EC1B 1LK3H 3CH8A 3U4EA 1NMCC 3CFTA 1BVKA 2ROXA 4Z3JA 3BPCA 3CPLA 1XF3B 3L7EB 5A40E 1BGXH 5J8OA 3TCLB 1B4TA 1DQMH 2Y5TB 2G5BA 2UYLA 2PP8A 3QULB 2YEZA 4G72B 5DWUH 1IIIA 3NJLA 1NM4A 4LAJH 4IRSC 4IHOB 4BBWA 2LT9A 3ULAB 3GSWB 5ADOL 2VLJA 5DS2A 4PB0L 3ULUH 4O02B 4XMLH 2J1ZA 3LNHA 2VN4A 4CMMB 1WFOA 4M6ML 5T33L 5DMJB 2WN3A 3EH5B 4RGNB 2IH1A 5FLVA 3GO1H 1SLVA 1FLRH 1J8HB 4TUKL 5A6IA 3S35H 1A4CA 2XWEA 4M9OA 4NN6C 5KS9B 4I77H 1TZIB 3EF4A 1ACYH 3H8NA 4ZOEA 4MJIE 5CN2A 3ZKXB 3K81A 2ARJA 5D72L 1L7IH 4G8GB 4WJ5B 4KHXL 4NRXA 4CVXA 5T3XE 5LHDA 1JZ5A 1GC1L 2R2BB 3TIDA 4LEOB 4XXCC 3SDYL 4F93B 3IKKA 5C8JA 2VDQB 3FB7A 3QJFB 3CSBA 3T2PA 2Z4TA 2IQAA 1O7SA 3GB7B 1MFBH 4BFIA 5K9JL 2WC7A 3MAWA 3B83A 3HB3B 3L5JA 3HRZB 5IB2A 3QJQB 4K8RD 2Z3FA 2PWFA 2X87A 1BZ8A 3BP4B 3E9UA 4A39A 1BQSA 1GKOA 3LKOA 2WAHA 2YKKA 1A7NL 1KNOA 5CCKL 4BA8A 3DIFB 1XXDC 3FF7A 3L3HB 1UACH 2CQVA 3DETD 3NSYA 2VDQH 3QPXH 1GVIA 4JRFA 5HY9A 3TTSA 4U1IA 2HX7A 4HHAA 1Y0LB 1ZVSA 3F85A 1NIAA 2F6AA 1Q72L 3VRJB 4X6BA 1E43A 2DN7A 4PGZA 2V5TA 2XZCL 4ECNA 5E6ID 3I6KB 5BZDA 2MQ0A 2HKFL 5H2BB 4LOEA 5IQ9A 2UY6B 2FO4B 3TNNA 5M95B 2BFVL 4TLKA 4WHTB 2VLLA 2XOTA 4GUCA 4B50A 1BQKA 1EMTH 2D0HA 1NLBH 4JRYB 4AM0B 5I17A 3IPFA 5TDNB 1XGTA 3V6BR 4ZD3H 5HD8D 4YEFA 5EZPA 4QGTA 4W9ZA 3U1PA 1U8MB 4OZHB 1DJZA 3NIGB 5JXAL 4JJHA 3N42B 2FWSA 4PJDE 2NY4B 4NZRH 5IT2H 3ZKMD 1UXMA 5KJ4A 4MDIA 1CIUA 3D9AL 5ADPL 5F96H 5K9KA 3W56A 5E6IC 2VDKH 5DQDH 4KY2A 4N1CA 1AHWB 5AZ2H 4XTRD 3QFDA 3FO1B 2Z92A 3VWJB 4WFEE 3T0EE 1MHPL 4HF5L 5F8RC 1TTCA 1INEH 3J07A 4ETYA 3POHA 4TUJB 1DCLA 1FNFA 1GZQB 1E4WL 4V1DE 5H37G 3X3GL 3VD4A 4N24A 4ZS7H 4J8RB 2R0KL 1WFJA 2MKLC 2CIIA 4J3OC 3FPYA 1HQRB 1IEAA 1S7TB 4I85A 2F8VA 1MVYA 5HDRA 4C83B 1IC4H 1N7MH 1C08B 1P7QD 2VERN 2WB1A 2HKHH 1KFAH 3BVUA 4BA0A 1SFHA 3IWVA 2F53A 4R2GC 3TFBA 3QIBD 2RCSL 3GIVB 2WSKA 4RZCB 3TBTA 4M8QA 4ZUTB 2B0SH 3F5WA 3QCTL 4Y16A 3VW3H 3QUHA 3B2VL 4PFEA 3SDDA 4N86A 1F4YH 2UUDK 4F24A 5D5MA 2AC0A 4OCWL 4RBPH 1U8PB 4ZTPH 1FRGH 1ITBB 1KF9B 2ESVA 1EEZA 2P4AB 4HUUA 1QBAA 5EV7A 2R2BA 2JKLA 3R18A 4JS7A 4OLZL 5DLLA 3EOBB 2ZAHA 2VQ4A 4D94A 2B1OA 2WLKA 4NQSA 4BELD 5JHMA 5IW3A 1IRAY 4HPYL 3L1OL 3O0RH 1T7ZA 1PNCA 4OF5A 1TQUA 4OQTA 2ADGB 4ZUUA 3BWUF 4KY1L 4LVHC 1DVSA 4IM8A 4NNYB 1FIGL 2Y6TE 2XFXB 4AEIH 2WLJA 3ASNB 1ZS2A 5SWSA 2CDEA 4HBCL 1IM9A 4KTDH 3B2DC 1BVKB 3BEWA 4KZEL 4JHBA 4QRAA 2PXYC 2FT8A 2VC2B 5ID1A 2YC1A 2W9EH 1INQA 1OAZH 1Z3RA 2VSKB 4OJYA 2XZQH 1I9JL 1OGAD 3R8QA 2NZ1A 4P2OC 4NOBA 2APWA 3DO7A 4ZOBA 5SWZE 1D5RA 3DUSB 3NRFA 1CU4H 2HFEB 1KB5L 3OHMB 4KKLC 4TSBL 5D2LB 4I2XE 4N1HB 1CTOA 1NUNB 4OGXH 1CXIA 5HYJB 4WNSA 4JO2H 2IEPA 3D85D 3QFJB 4L05A 2LE9A 1F13A 1UOLA 2H45A 3NTCL 4HQQH 4P3DB 2BNQB 1HJBC 4PRDA 2YRZA 5IEKA 1I8MB 1M6OA 2QQKH 4P9HH 5E5UB 3P73B 4FABH 4Y1AA 5JIPA 3WO4C 5GS1B 1LDPH 5TFSL 1W8EA 2PCPB 4QHLA 1RZ8A 1IV8A 3GLZA 4JJ5B 4LPWA 2YRPA 3EBGA 1YEIH 1LE5B 3DUHA 1F6AB 2XZAL 4UV7L 4NB7A 1TCMA 5CIPA 3SB3A 3MROA 5DTFA 5KYYB 1U3YA 3ZVVA 3DOSA 1XGUA 4ONFL 4MXQC 3DXAA 5IW1B 5EZOL 3CN2A 4G5ZH 3WCYA 3DOIA 4RWYH 1G7QB 4P5RA 1O75A 5CILH 5I82A 4DO6A 3UZQB 3ZE1B 4DGYH 1FLTX 1MCRA 5CJXC 3PFQA 1HINH 1ADWA 3EH3B 4OZGE 4HD9A 4WO0A 4RISL 4YFDB 2GBUA 3L9RA 5GS2H 3D12B 4J27A 4C59B 4PJIF 1DLFH 3ULVH 3IMBA 5EIVA 1QD0A 1T6BX 1IBDA 4P2QE 1G7PA 4NO3A 4D0BA 5KVEH 3LVEA 1FYTA 3SGJC 4CJ1A 1Q9OB 2ZKXA 5DJYA 1RK0A 2CD0A 1S9VB 3MRGA 4PJGB 3QFGA 4DP0X 3QZWA 3KLAA 5DFWH 4DKEL 4AV5A 2HJLA 2YMXL 1QFHA 4NSKB 5KSAC 3WBDA 3IGFA 5IROA 4B7LA 4HPHA 5BQ7B 7FABL 1XF2B 1RUML 3K71A 1KMGA 1NKOA 5DLMH 2EJ1A 4IIQB 1MLCB 1KIQA 2VR3A 4YLBA 5INDA 3WEXB 4PRNA 5D2NC 1OWRM 1JG9A 1ZSDA 4JDEB 1SQ2N 4C56B 2JXMB 1V3JA 2XTJD 5HYSG 3C12A 5EA0L 1KTRL 1NOFA 3QIWA 3TT3L 2AEPL 1AR1B 3KNBB 3OR6A 2PCPA 3ML8A 3IJYA 1DQDL 3NRQA 4K5OA 4YBQD 4MJHA 3VYNA 5BO0D 1FZJA 1NAMH 1CLYL 1SDAB 3QXTA 2OP4L 1YNKL 4B3VA 3QYMA 3PG2A 2AKRA 2JE8A 2R56L 4JR9H 3V6ZA 4NQSB 4F3FB 5ICZA 3AXLB 2V8LA 1RJLA 4YX2L 3P77B 2I9TB 4Q9BA 3HHMA 1QRKA 2JV6A 2Q1EA 4HJGB 1AG6A 3QUML 3BVNA 4OFIA 3JWDC 3KL3A 1KEGL 3S98A 2CWRA 3VX1A 1I3VA 2QT6A 2XIIA 1AKJA 2BNQD 1UWXH 3CMOL 3HZYA 4MMXB 4ANWA 1NDMA 4ISVB 1D7DA 4MRCA 3DMMD 3FO2A 1A5FL 4X5WB 5J6HA 3BEWB 2IALB 3L2NA 1QLRA 1ZJBA 2GT9B 3PDGA 4NJAL 4TTDD 1I7UA 3MTRA 4NO3B 1OVZA 3MBEA 2LOEA 4XNXL 2YQBA 3HNSL 3TO4A 3DV4A 2YWZA 2FX8H 3DPBA 1EGJH 1S46A 5JOPE 2WSDA 3SBWC 4MHHI 5B1KA 2XKNB 2W38A 1GS6X 2EDOA 3ARGB 3TBCA 4QXGL 4PJAE 4GUOA 1X6LA 3R0MA 1N67A 1NICA 4S1DC 3RNQA 4ZW7A 3S96A 3TCTA 2F5AL 4MMZC 4YBLB 2MTPA 1BQHG 3RTQC 3RUGB 3ZIYA 1J0IA 4FYTA 3ZRFC 5C3LD 3ES6A 1JVOA 1AGFB 1TCRA 3BKCL 3C6LD 1K5NA 5TGBA 4UT9L 5B38A 5BMFH 3O4LE 5HHME 5DF0A 1BM7A 1HXMA 2BCKA 4PCKA 4PJFE 4XN2A 5IIEB 4KQ4L 5CZVL 4JFWA 1R4XA 4NGHH 3NPSB 1UWFA 1XFPA 1YVLA 2ZSVA 5IJCC 1P1ZA 2AERT 1FORL 4KUZH 3SGDI 3GSVA 1KT2A 1OE2A 5I1IH 5I6MA 5DGQA 3FQUA 4MAUL 3HC2A 5DC0A 5C0GA 5D93C 4LSDA 4NDMB 3HG1E 4PRDB 1CBVL 1SY6H 1O6VA 4BSJA 2N01B 1Z66A 2R0WH 2YIHA 3MOAH 1PZCA 2B9BA 4I3GA 4AEEA 1NC2A 1I1YB 3D52A 2BSRA 1WH0A 2ZUUA 2FLBT 4KMLB 2GJ6E 4LCCC 1KACB 3RIKA 1CPUA 2OYMA 1NAKL 1PU0A 4GBXA 2QJDA 3DBXB 2EO1A 1K8IA 4L8SA 4V2BA 3KXFA 3GZQA 3AM8C 3KPSD 4P9MH 3ARSA 1KIQB 4NN7C 2AK4D 2EDWA 3UJIL 5D6DA 2LAGB 2VM9A 3VMPA 3K74B 3VXSE 2HLFC 4ZTOL 1RHHA 1AG0A 5L88L 4TUUA 4GP8B 4PVLA 4PRHA 3UTPD 2WKLA 2IF7A 3GMNA 5GGVH 4ZW5A 3VGBA 2CJSA 4ELMB 1YAZA 3K6DA 2ZCLH 4OU3A 1MAMH 1JWSB 3POCA 4DUXA 4WFHD 3H9HB 4LU5L 1MZYA 5DZJA 4FXGC 3C5SB 3X1EA 1I1RA 4UNUA 3FCSA 3MA7A 5CINH 2EUZA 3QG6A 4XGZB 4IU3B 2IV9A 2NXYB 1DDHB 3LKRA 1HSBA 3VA2C 3CDZB 4FFVC 3QI9C 1NUGA 4WI4A 2F54E 5ALBL 5E8DH 2Z91B 1LNUB 4KC3B 2V37A 4X6BB 1FYTE 3FT4B 2EDBA 4FHBD 4OZGB 5A2CA 1LHZA 4Y5XC 5H94B 5AKVA 4QNPE 1EAJA 2R69H 1MIMH 4X5XB 4PUBH 1G6VK 4Q0XH 1MW1A 2DQJH 4YZFE 1F6LL 4Q6IB 1PY4A 5GSVB 4U6HB 4KDVA 3PQYD 3GBNH 4WEBL 5I1GL 2JXMA 4CN4A 1OHZA 2EXWD 1CLZL 5A16B 3VX0A 2NY6B 2X4SA 4XB7A 2XN0A 5ABZA 3OMNB 4JE0A 1AHWC 1D2PA 4RMTA 5DUBA 2EVJA 4YFEA 2E6QA 3JV4B 4YL4A 3NJNA 3PWNB 4YSRA 3CZGA 3M8OH 1TKWA 2YBRA 4E9TA 3IEAA 1MJUL 2YXWA 3LZLA 1ZSDB 3HS0B 4U33A 4OI9A 5GRJL 2K0RA 4JNXA 1XAKA 2C4FU 5D1QA 4IKLA 2VDNB 3OG4B 5C08E 2P1YA 2QKIA 4U4IA 3GK8L 1A8JH 4HWZA 2OK0H 1VESA 3BH9A 4Y1AE 2OMUB 2PR4H 4PJHA 2DMCA 1QWUA 5EF2A 3PHOA 4JB9L 4NRYB 3MNWA 3VRIB 5C7XH 2PTTB 3ARVA 5INCB 1PYWA 3LRSA 3PQYA 3Q8BA 5IVXF 2ZXBA 1JI2A 2V17L 1XH3A 4KRPB 4F33B 5FHBL 5EH1A 3RP1A 4BZYA 2V2XB 4UAOC 3AQYA 4HISA 3MODH 1JGVL 2X41A 2VLJE 1XGRB 3F12A 5AZUA 3TEUA 1ZCRA 4YSAA 4LGSB 4ABQA 1EHXA 2EIZA 3GIVA 1NLDL 3SKJL 4ORZC 4RZKA 4ODHH 3QNZB 3SBPA 4J8RA 3ZZ1A 1UXSA 5JMOC 1F2QA 4PJFA 1BXUA 2V3FA 2CKBH 4U3SA 3V4PB 2H41A 1GYCA 3BKYH 4OLVH 4HKBB 3WFCL 1VADB 3IJHB 1A3ZA 3ATFA 4J3OG 1YQVH 2WXLA 4NN5C 1O6TA 1EHLL 3CD4A 4L9LA 5HHQB 3H7BB 4JRXB 2I7SA 4BRVA 2HN7A 3CHOA 4X42A 5F1SA 2F19L 3TO4D 3WD5H 3KYMA 2AABL 4AT6B 1CR9L 1I1AB 2EIKB 3LKOB 1HKLH 3U0TB 1R9FA 2EXTA 3RZCC 1JN6B 3P4OA 4X8CA 3VDCA 1T04B 5I8EB 1DFXA 5LB1A 5ESQB 4JHWL 3GSVB 4FADA 1UFUA 3P2TA 5K1NA 1UZ6F 1KTDA 5JW4N 1VPOL 3QUXC 2JJSA 4HCIA 4Y4HB 1MNUL 5I26A 1QSFA 2WQXA 3HAEH 4FQ1H 4PWIA 4Z78A 5DJCB 1AYOA 2YPLD 3NFPB 3GIZL 3NIDE 4WHTA 3W5MA 5EIIG 5F88B 4CSSA 1JYWA 2GJ6D 4KPHH 1AMYA 2R29H 3JSSA 4UOW1 2QPDB 4JFQB 1HWHB 1VLXA 1JDDA 5GGTH 2JB5L 2W9DH 1ODUA 5DD0L 3DVFA 3K2UL 3EO0A 3BE1H 3RGVD 3MRDB 1ZS8A 1JGUL 4H13C 4IGBC 4KXZI 5KOVC 5MI0B 2Y06L 5IW6B 5T1KB 1ZLVH 2DOCA 5BVPH 8FABA 4LPUA 1JRHL 4J39A 1PSKL 4PS4L 2F0CA 2IDQA 1CDJA 3UOAB 3MYJB 4A67A 1D5ZA 4XWGH 3MRNB 2KYIA 1D9KD 5I1AB 2F1AA 4X80H 1WICA 3QJOA 2XNAB 4GINA 1L9SA 1G94A 4MMZA 4MMYA