2Z7ZA

Crystal structure of h2o2 treated cu,zn-sod
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structure of H2O2-treated Cu,Zn-superoxide dismutase
rcsb
total genus 33
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2z7zA00
3ECWA 1Z9NA 1TO5A 2JCWA 1OZTG 2GBUA 1XTLA 1QUPA 2ZKWA 3KH4A 1SDAB 2AQTA 3MNDA 1SPDA 1Z9PA 1E9QB 1F18A 4FF9A 2ZKYA 2NNXA 2V0AA 2AQSA 1SXBA 3KM2A 1IB5A 2AQNA 1TO4A 2GBVA 1E9QA 3CQPA 1P1VA 3KBFA 4MCMA 3GZOA 3F7LA 2WWNA 4OJAA 1N19A 2XJLA 1OALA 1E9PA 2APSA 1AZVA 5KBKA 1ESOA 1SRDA 1N18A 1E9OB 2Z7WA 5KBLA 1L3NA 1RK7A 1CB4A 1IBDA 2Z7ZA 4L05A 1PU0A 1SXZA 1E9OA 1BZOA 1F1GA 1OAJA 1SOSA 3QQDB 2GBTA 4A7UA 5CU9A 4OH2A 3PU7A 1U3NA 1B4LA 1B4TA 3KH3A 1SDYA 3QQDA 2C9VA 1F1DA 5KBMA 2Q2LA 4BCZA 3GZPA 1FUNA 3H2PA 3K91A 3L9YA 3GZQA 2R27A 1F1AA 2WYTA 2AQPA 1UXMA 1YSOA 2VR7A 2AQQA 1EQWA 2WWOA 3HOGA 1JK9B 1HL4A 2K4WA 1COBA 3HW7A 2VR6A 1IBBA 3LTVA 1DSWA 1JK9A 1YAIA 3ECVA 2C9SA 1DO5A 4A7QA 2AQRA 4A7TA 2LU5A 1XTMA 3H2QA 2SODB 2ZKXA 3KBEA 3ECUA 2E47A 3SODB 2WYZA 4BCYA 3CE1A 1OEZW 1EJ8A 3KM1A 4MCNA 4BD4A 2WZ5A 3L9EA 4N3UA 1HL5A 1SXNA 1SXCA 4A7VA 1MFMA 1JCVA 2Z7UA 1BA9A 1OZUA 1XSOA 2C9UA 2XJKA 4A7GA 2WKOA 1IBHA 3T5WA 2ZOWA 2E46A 3F7KA 2AF2A 1IBFA 1Q0EA 1S4IA 2WZ6A 3MKGA 4A7SA 1PZSA 4N3TA 1CBJA 1E9PB 1SXAA 3CQQA 3GTVA 4U4IA 1UXLA 2JLPA 3RE0A 4A7GF 1KMGA 2WKOF 3GQFA 2AEOA 3GTTA 1PTZA 2Z7YA 3HFFA 1SXSA 4B3EA 2WZ0A 2VR8A 3S0PA 1YAZA
chains in the Genus database with same CATH superfamily
2FYYB 2HLEB 4AEHL 4YXLH 3JWNE 3TBBA 3ARGB 4M7LT 4NOFA 3TCTA 4JM2C 4QHMB 4FFZA 4FTVE 2Y1YA 3EYQD 4ZMAT 4XCYA 5FHAH 3EGXA 1QSVA 4FF9A 4NO3B 5HXMA 4E5XA 5AAMC 3OX8A 4P99A 1B88A 1F8TH 3SZ6A 4ZFOA 2GBVA 4M8QA 2DQEL 3FFCD 4UBDD 2V33A 1FVCB 3QJXA 4XO5A 1RUAH 2YN5A 1JDAA 5FUCC 5BV7L 1LWHA 1GXEA 2VLLB 2BVQB 2XRAH 1FVDB 1RJZB 2Y6SD 4G9FB 4FYRA 2XWEA 4GRWF 1OAYH 4OJDH 4C83B 4Y0GA 5INCA 1E5ZA 3GSXB 2OCCB 3CC5A 4YQXL 5B3JE 3FTGB 2M8XA 5IQLA 3MLYH 4RIRB 4DTGH 4W6XB 3FO1B 2APTA 4WSJA 4B97A 4ZS6C 4XI5D 3CU1A 2PXYC 4PR5A 4HIEA 1IIIA 2HKHL 4Z7UF 1KC5L 3T2LA 4KU1A 2HG5A 2XIIA 4JDVA 4K3DL 4CVZB 2R83A 3Q8EA 4ZSOE 4PM1A 5B7FA 5IHUL 3VFSB 1JGIA 2QFRA 4G1MB 3PNRB 2IDUA 3QYNA 1SOQA 2WV3A 1WT5A 5EOTA 3PWUB 3RFZC 1UD2A 4ABWA 2C9QA 1DFBL 2NY5C 2AQQA 4JUSA 2J88L 3A47A 4X7CC 4BSVA 4HJJL 1J1OL 1CYGA 1TF4A 2EEXA 3HFML 3LKNA 1HHKB 1IGIH 3UZEC 1ROCA 4PV8A 1WGOA 3HMXL 1KIPB 3QUKA 4Y4KC 1I8LC 1U8NA 2VH5H 3ECVA 4N8VG 3CFJA 4HSCX 5TF0A 1Z9MA 2NY4B 5L0QB 3TJEH 4YZWA 4Y1AD 3H9SA 4JY4B 2PO6D 2V2XB 5LGHH 1XD1A 3BE1H 2LTQB 4QOKD 3PQYB 1G9NC 5T3XD 2EYSA 5F7YC 4UV4L 2J3SA 5C07A 5C97A 4OD2B 1JV2B 2JJVA 1JWUA 2H45A 1HILA 3O2VH 3V0VA 4HWUA 3C5ZA 3WS6A 4HEPA 1FZJA 5FFOA 4CN4A 3ALXA 1NGXB 3DXAD 1HOCA 2BS9A 4Z0XA 4CC4C 1ZV5A 3RWJA 5HJ3A 4LBEA 5HHQB 1XL6A 2VRQA 3B9KB 4K5MA 3N42F 1NBCA 3NSYA 5LXGH 4GS7C 2LU3A 2XFXA 3ZTNH 1ZLWK 4J7RA 4ALAL 3OKMB 3JV0A 4EOWL 1K8DA 1IEHA 3NA9H 5FYJL 2YAEA 1BBJB 2DBLH 4PVNA 3SPVA 1A1MA 3HE7A 4NZUL 4TUOA 4YZFE 3VGHA 2QVTA 2QV2A 1UM4H 4LSTH 2O4EA 1SLUA 4Q56A 1MFCH 3MLWH 1R5IA 1V7NH 3DX2A 1P7QD 4WW2A 1JWSB 1SYSA 1AG6A 1KPUB 4JHWL 4XPHL 4EVNA 2KQMA 5C3TA 4J8RB 1ANUA 5L8KB 2DL9A 2WGXA 2ZP8A 1KIQB 4GRMA 3P77B 2J8UE 3THML 2HJFB 4N9GA 1D9KB 4HOXA 3FCUB 3AWEA 3FB5B 5EU6D 1IV8A 3HZYA 4OJEH 1XZ0A 1QRKA 3QDAA 5C9JB 3IWVA 2ZUTA 4ZPTA 2X70A 4PJXB 1FPTL 5GZOA 3EYOB 5SWZD 1ZSDB 1IM9A 2VCOA 2MPVA 1BQRA 5LNEA 1U8PB 4GAYA 4FZEL 4I3SH 2HT3D 5KJ7E 3WD5H 3DVGB 2P1YA 1RZFL 2FEEI 4OVUA 2RQ8A 4KROD 3F05A 5D9SB 4MNQA 3WOVA 4N85A 1NQBA 5JPNC 3FUMA 4N26A 3EFDH 1GGCH 1N3NA 2PW1A 2H32A 4J4PC 3VGAC 1NCWH 2K8MA 4JO4L 1XR8B 3OXSA 3VVWA 3MJ8A 1CFNA 4Y19E 2V3FA 4G7VH 1AQDA 1HZLA 4NQSA 5F3FA 1U8CB 3GMPB 1TJHH 1PY4A 3P30L 3PP3K 2EH8H 3RBGA 3MJGX 4X0KB 3CHOA 2Z8RA 4IIQB 5DJXA 1USZA 3QARA 4BQ8A 2ATPB 1ILUA 3WKPA 2GKIA 3BZ4A 3MRMB 5E1GA 5LGJB 4YHIB 1CFSA 4CDGC 1JHLH 2DWEB 5EEUA 4H0LC 4LPVA 3DX9A 1HXYB 1IT9L 3GRGA 3C6LB 3HNTH 3RZCB 5DR5H 5E8EA 5IREA 3D9AL 5DD1H 1CFVH 1N26A 12E8H 2WP3O 5HD8D 4LDEB 5I0YA 4L37B 1INQA 4XOCA 3H53A 4FQ1L 4PEEA 1NGPL 1PZSA 2YD9A 4MA7H 3UYPB 2HVKA 3QUGA 1QSFD 2UX7A 3LSOB 5GIRA 3CC1A 4RFNC 3S5ZA 5C0ND 3O8XA 5TE4L 2VLKA 2GG1A 2Q5BA 3V7MA 3WY3A 5JW4Q 3I02B 4RRPG 3DI2B 2NR6A 4AE0A 1YEIH 2DWSA 3L5WB 4MAZA 3FQNA 4ZK8A 4JFPA 2NY0D 2EYTB 3ULAB 3QR0A 2IXQB 1XF4A 4DQOL 5CAYB 4LQFL 5AAWA 3FO0L 3L3OB 3LEYL 5EA0H 4PJ5A 1YMMA 1G7PA 1JJUA 4IS6A 1YEGH 4NC1C 3VSUA 2NTFB 1DJWA 3VFRA 2CRIA 4S0HA 3F7LA 1DE4A 3TT1L 2X4QB 5C0IA 2AJYH 3V5KB 5JDSB 4FS0A 4IOSA 4JFUA 5FDWA 5JXAH 3IFLH 4JFSA 4GBXC 2YD4A 3MV7D 1TETL 3E2HB 1ZHKA 4OM0H 2X6CA 2NQDA 2YA0A 3UJIH 4HVBA 4TUKL 2FWLB 4HSQA 3MUY1 4ZI8A 2X4TA 2GBTA 3CLFL 3B7YA 1N8OE 4FXKA 3U0TA 1CVSC 3MNVB 4X99A 3VFUB 2MKWA 3WY2A 3OKNA 3VXSA 2WOYA 3B5GA 2HT2D 4EZMA 1QLEL 3KH3A 4ZUSB 4ODSH 3KL3A 2XETA 3LZOA 4U1NA 3CHPA 4XX1G 5EOCJ 2NW2B 2Y6TE 4S1DD 4BCZA 3ARYA 3O0LA 3EO1A 3MGTB 2DKUA 3HNSH 1QZNA 1V8HA 2MRYA 3GMQB 4BFOA 5E6SB 5L2JA 1NMCC 4GQPH 3MBWA 5IWLC 3C60B 3KYMB 3QXTA 3VFNA 4LP5A 1VFAB 4KXCA 4OZFH 1COBA 1R24A 5J6HB 5I8EA 3BQUD 4N87A 1UG9A 1G7JA 2DI7A 4JFHE 4EDWL 2YZ8A 2DTML 2HCZX 1AOZA 1Z9SB 3WFZA 1YNKH 4L8DA 1LO0L 3K81A 3VRJB 5IMKB 5IJKA 1UA6H 2AEIT 2CCWA 4UCFA 1EGJL 4ONHB 1AKPA 4NXSA 5AVRB 5C0BD 3EYUH 3ROOB 1LGVA 4XHJC 3DUHA 5IBUG 1JPFB 1L7TH 4R7NA 5I1JH 4HKXB 3IJ9A 3SGEH 3L3KB 4Y4HD 3TH3T 4AH2A 1Z66A 3DX8B 3LIUA 4MB5A 3VFTB 4Z7VF 5HY9B 4YXHL 1MCEA 4O2CA 4JDEB 4OLXH 3T65B 5G4NA 5HYEA 5SWSB 1GR7A 2FJFB 3TF4A 2IH9A 2OFQA 5FO9B 4YSDA 5EDSA 1E4KA 4JZJA 1MI5E 2CSPA 4Z76B 4PRAB 2B2XL 3DX4A 1EGJA 3D4GA 4J5VA 3LB6D 2EKSA 4UU9A 4XNAA 2FTAA 2CGYA 5G5DB 2FJHB 3DO4A 3WTXA 4C58B 3U6RB 1KBPA 5E5UB 2EDBA 1KTDA 3APNA 1JTTA 4R4ND 15C8L 2VXVL 1H3PH 4OCWH 3F12A 1EHKB 1BMWA 3VFGH 4E9QA 4G6AD 4K71B 4NM4H 5HDBB 1Y1DA 3D1MC 4LMQE 1G84A 4YHKL 4KMQA 3ESPA 5D1QB 3K71A 1ZT4B 4FHBD 1GH7A 4DP2X 1VSCA 1G9MH 4KY1H 4JPVH 2Z92A 2C9AA 2YGNA 3GXNA 4M9PA 3TF7C 5D2NE 3TA3A 1CU4H 1JGLH 3EHBD 4UV7L 4HWBA 1P5UB 2LU4A 4KMTH 4M93B 4MA8H 5JXEA 5MEQA 1BG1A 2IPTL 1IAIH 1Q38A 2UXTA 4JR9L 5TE6L 2H3NB 4U1LA 4NJ9L 2OJ1A 4BJLA 3QW9A 3VXOA 5HPMB 5I0WA 4JQIH 2X9WA 1N6QH 5I9QB 3SBPA 3A67H 1BLNB 1DLHA 1LDPH 2W9LA 4U1GC 3FQXA 1FFQA 1ZVSA 2QSCL 4ZMLA 4TSAL 2XWZA 4HBQA 5CJOL 1OB1B 1C1EL 2WVVA 4MX7A 3NIDE 3WXWL 3FHAA 4DUWA 1UA7A 3OD3A 2P5WA 5CLWA 3WNNA 3JTSB 7PCYA 5AEAA 4N6QA 3SDXB 2XNAB 3IDNB 2YK1H 4FTVB 4QXTA 5TH2B 4KQ4H 5F9AC 3VWKD 1R3HB 2GW5A 3KWUA 4RMBA 5L7XH 4K94H 4JEGB 1HQRB 3P3YA 1HAWA 4C56E 5BO1H 4M8VA 4NQDD 3C5SB 3QI9A 3AB0C 3QIBA 1E7UA 3UBXB 1UCBH 2ZCHH 2LLNA 4JFFA 1Y6MR 3KYOA 4BFEA 4IBVA 1KCKA 1NAKH 3J27A 5BVPH 3RUGA 2X9XA 3HUJA 4PRID 4BFFA 5ICYB 5D6CB 1Y18A 2W92A 2FHBA 2OX5B 3NJVA 2H47C 2X4NB 4U3SB 2MCPL 3H42L 2Y7NA 1YN6A 1YQ2A 5DK2A 1ACYL 2VDMH 2Z93A 3RVUD 1DQML 2FH8A 3F7YA 1QR4A 2AGJL 1IO4C 2ZWYA 4LEOA 3Q2WA 1CF8L 1PQZA 2P26A 3PGCB 3PWLA 4XI5C 3T5WA 4DKAA 5MEOB 1I82A 1KELL 2XPGB 2D3JA 4U1IB 5K59F 1MKFA 3BXNB 3L5XH 2R4SH 3MV8D 4I1NB 1F90H 1PTZA 4NZRL 4G43A 3BCFA 4RGNE 3TM6A 3L3JA 4JRWA 3O0RH 1AZCA 1QQDB 2O5ZL 5HHNA 1BOGB 3LS4L 3RVVD 1EZVX 1QUPA 4TPRL 1WK0A 4WO4D 1HHIB 2RCSL 1OL0A 3H85A 4CC1A 4M7KH 3V7AG 5F2FA 4P2YA 1T66D 2OMVA 4MDIA 4KXAA 4V11A 1JUFA 4LIQH 3TCLA 4B9ZA 4LKXA 5EBGA 2AV1B 3FTWA 4BRVA 2CUMA 3AAZA 4KKAD 3M86A 1XSJA 4BH7B 3FOLB 3VRIA 4CGUB 2XN9D 3OAUL 3VFMB 1L3NA 3WTVA 3D25A 5FB8A 2EQDA 2X53A 5AYUL 3LS5L 5GS0L 1AR1B 3N1MC 2JMRA 2I07B 4MB1A 1C08B 3TNMB 5FECB 2BNQD 5J0BA 3SBWC 3VWJB 2QADB 2X0VA 2AC0A 3S88L 2AZUA 4P2OA 2NNRA 2Y7LA 4NPKA 5GS3A 3KLHD 4H8PA 4ZMYA 5IROD 3UGXA 3BCDA 3QDJD 4X5WA 1M71B 3FQ4A 1AQKL 2ZP9A 3UTQA 3AADB 4PP2B 5GGTH 4NHUB 3QXAB 1OV8A 1W72B 1DJYA 1IC7L 2B4CH 3INOA 2XUWA 3JVGC 3QFJB 3QZWA 3AWGA 4PRHA 4XBMA 5C07E 1Z3RA 1WC7A 2V9TA 3IRZA 5T3XL 1RJCA 1MCQA 2Y2YA 1ZHBB 4XPAH 1JZ6A 3CBRA 2CNYA 4HUVB 2ICEA 2OTUA 4ELMB 2R2EB 3BH8B 3E3QE 3UAFA 2VO5A 1TUPA 2BSRB 5I23A 1NFAA 1FNAA 3IU3A 2WYZA 1EZSA 3US1A 1MIEL 2KL6A 1AH1A 4PJ9D 1FAKT 1YJDC 2E27L 5DJ8A 2AKRB 1F45A 1A4JB 5EEYA 1OXYA 1ZLUK 4R90L 3EDFA 4BXSV 5I19H 1FO0H 2KKQA 4IIZA 5T5FL 5E2VL 1QI4A 5DT1L 3FRUA 4PD4J 1IGYA 1GJUA 2HT3C 3C2AH 4BZ1A 3WTTA 4FI6A 2BNRD 1EEYA 3IJYA 4Y5XB 5D7JB 3A0OA 5EWIH 1T80A 3ARBB 4KROC 1I3GL 1Z5LB 3K8KA 1QBLL 4NWUL 4F3FA 5A43C 5MP6L 1G7LA 5FYJE 1AMXA 3FYIB 5CWSA 2G75A 3ECWA 4S1RH 3KYKH 4W9KC 3CFNA 1I8IA 5C92A 4F33A 2EDTA 4ETQA 3Q06A 2F1EA 2X4SB 2A6DB 1KULA 1U8MA 1SMOA 1ECZA 1Q1PA 3HG1D 2X87A 1N59B 3RX9A 2E76C 1ES0A 3W38A 3VFPA 1HI6B 3TEUA 3RWIA 1A3QA 1VCBC 1F2XK 2WLJA 1XF2B 4R97C 5E03A 2XFGB 4R3SA 4H4NA 4CSPA 1UWXK 2W60A 3WYRA 4MCYB 4FLOA 5MEPB 3GEFA 2DM7A 2DKSA 3MBED 4F58L 4QJ5B 4MNQE 1JXFA 2GJRA 2NX5A 4MMYA 4MDRA 3WFDL 1A9VA 3VSVA 2Z0BA 2VAJA 5IFJA 5HHMB 1NDMB 2EAEA 4MRCA 2H0FA 3EH5B 3O11B 4ISVA 4NQCB 5DLLA 3L3DB 3S35X 5HD8C 1LNUB 1F1GA 4UTBL 4JG0L 4LASL 4P9HH 1GSKA 3MRQB 4JVWA 5LN8A 1NTDA 3OR6B 1MCRA 3ESMA 4Z7QB 5B1JC 3AC0A 4L4VD 2FWSA 3SDAB 3QORB 3WXVH 3ZHDA 1OO2A 5C0NC 3VFWB 2XXFA 1MRDH 2ADGA 1FGVL 1ZLSH 1CURA 1K3ZA 5DJ2A 2DQIL 4YHYB 2NY0C 4HU2A 4X5PA 3HAEH 5I6MA 1R3JA 2ZXAA 2OXHB 3K0YA 5J11C 4FQJL 4FQXA 2A4EA 4JN2B 1UD4A 1KBKA 3S2CA 3MRFB 3DDFA 3MUGB 3SOBL 4GAJH 3WSQH 4UQ2A 2HFEA 2ERJB 2DEWX 1EFXA 3UJJH 4PJAA 2Y23A 1WEJH 5GSVB 2FK9A 2N1KA 2WZPD 3TBTB 3L3HA 3QUZB 2VLKE 1KJVA 1NJ9A 2HRPL 3OSKA 4G8FA 3FUDA 3TGXA 3VH8B 3ARZA 3WJMB 1JPEA 1MHHA 3D2UA 2QPFA 3MRGA 2EKJA 3TNNB 4OFYD 1NFKA 3RDTB 3ARDB 2FJGB 2HT2C 1XGUB 2ZYHA 4KK9D 4DFIA 4PTUA 2WZ6A 1A21A 3EBIA 3N9GL 1UM6H 2VERN 3EH4B 4I13B 1LTXA 3EH1A 2DLFH 3ARFB 2AP2A 4NZTH 2CCVA 4PJ5E 1EX0A 4YWGL 1T89A 4N4YB 1XT5A 3V4PA 3U36A 4CL7A 4B9FA 3LPFA 4G5ZH 1FWXA 2CDEA 4YAQB 5K33A 1AGEA 1HHHB 2ZZUT 4EUPG 1MVFA 5ITBL 3MZGB 1QABA 4LLVA 4M61A 1H6EA 1MRCH 4EXKA 2E7LC 1AANA 2JCWA 2R29L 1NL0H 1MCWW 5SV3A 3BQUC 4XCFH 5C8JB 5IW6B 3KE0A 3KH4A 3WL9B 3ZYOA 2HLFD 2HLAB 2JV6A 3TEXA 5L4MA 3VXSE 4HJEA 1A1OB 3TT3H 4ENZA 1Z0MA 1CGXA 1D2PA 4LRNL 3VFTA 1I75A 4KVNL 3GMLB 4LSSL 4HG4K 4HJ0D 2VZSA 1SUJA 2WXIA 4PW4A 5F0LB 3RWDB 1NMAL 3OAZH 1GRWA 1BX2B 3KJ6L 4D8PB 4XMLH 5I8CB 4XC3L 4Y4HC 4FAAB 4BFJA 2NUPA 4KGJA 1AJ7L 1U3ZA 1IBDA 5FUOH 2Q6WA 2WJ5A 2R9HD 4BZYA 1T1ZA 5IB5A 2VXSH 1D6EB 3RKPA 4JPKH 3QEQD 1O7SA 5F1KC 3FU0A 4KK8D 2OL3H 3AQXA 3DURB 3S7GA 2BVUA 2Y69B 1UYWL 3OJMB 4JG1H 4OZGE 3BVNA 5JNYA 1H8LA 3LB6C 4YNYA 5KTEL 3MA7A 1J5CA 1DUYA 1KLFA 4WCYL 4UDTB 4WFHE 3UO1H 1XIWD 3ARSA 2K70A 1H8OA 4L8SA 4HK0A 4MA1C 5ADPL 4R4NC 1GGBL 3BPNC 2C7UB 3IXTA 2OR7A 5DUML 2ALWA 4ZNCD 1L6ZA 1G7HB 4PI0A 4G6AC 4HC1H 5CZXD 2C3GA 3ILPA 5B8CC 2XKNA 3ZGHA 4K0OA 3NAAL 3S98A 1F3RB 5C6TH 5D5MF 4NX0A 1BZ9A 1SMDA 1SZNA 1Q9LA 2FVNA 2MEJB 4GXFA 1E28B 4Y5VB 4Z9KB 5T1KA 2X6VA 5FYKL 4UT6L 3V8CA 4JRXD 2V2TB 2XTJB 4APQA 3GK8H 2CBTA 4NQUA 4FE9A 4X4ZA 5CFHA 4LGRB 5E5RB 1OE3A 5E56A 3EHBC 2QSVA 2P47B 2JJSA 3IB4A 2P5EA 2Q3XA 4O02L 4ZX5A 3UH8A 4L18A 2EIJB 1YY9C 1KACB 1TTGA 1JCVA 2IGFH 3BAKA 1PAMA 1U21A 1JMZA 3E1F1 1IKFH 4F5CA 2XJKA 4YGAB 4U3CA 3C75A 1BFVH 5DRWB 1EAOA 4KKBC 4ZUWB 4LQ1A 3ZL2A 4Q2ZB 2GUOA 2QQLH 4AQAB 4AYDC 5T33L 1ZS8B 1CFTA 4B7LA 1UACL 4UT6A 1T7VA 4WU5A 3NIDB 4PGEA 1G4RA 3HA0A 1X5MA 4ZQTA 5HI4D 2YAOA 1AC0A 3GRBA 3OKKB 2P24A 4XN5A 3I75A 1UD8A 1WAEA 3QWNA 3SZKC 3X13B 4IHOB 5CIPH 3T4YA 1CS6A 1CGYA 3IRCA 4O02A 2IVFC 4IJ3B 4XCCL 5ESQB 2D31A 1ZTMA 1RIUH 3NIGE 4Z7AA 5AKSA 1SBSL 4FNPA 3VWKC 3I6KB 1OF2B 3UC2A 3NZ8A 3CFBA 3QJFB 1C9SA 1DN2A 3ZDXB 3Q2VA 1WSST 4U6HA 3TN0A 3Q9QA 3QG7H 4P2QB 4AQEB 3EG9B 2O1AA 2BOBA 5ENWA 3HS0B 2ZWKA 4JFEA 5GZNA 1E9QA 1XBDA 4E42B 4PJDE 2OJEB 1AS8A 4BYHA 2NNAB 4PY7A 1U58A 2CHWA 5ID0B 2NZ9D 4XVJL 3DX1A 3ECQA 5DVPA 4AIZA 3RVUC 2P5WE 3B7TA 4F2MB 1FNGB 5DHMC 2C1OA 3OAYH 3IF1A 3MLUL 2FECI 2A4CA 2ZAHA 5DSCA 2NXYD 5IB4B 2QDWA 3I6LE 4GW1A 2DIEA 5DD5L 3FFDB 1XBRA 4E9RA 2UZYA 2F53A 2WBXA 4AQ1B 3QQDB 2Z9TA 3SOTA 2CZNA 2G9KA 3PY9A 4J1UB 5D72H 5L2KA 3MYJB 4G7QB 2NDGA 1NCCH 3RWEA 1BVZA 1NBZA 3AZUA 1OHQA 4KI5E 4TYUA 3SGDH 2QKIB 5FXCH 4PJIA 5GGUB 3RUGE 3BPOC 3HUJE 4KVCH 1FL5A 4WI4A 3W37A 3H0TB 3IU4L 4J6RH 4PRNA 3TFBA 2UXFA 4HWEH 3BX7C 2AQPA 2JB6B 4LCIH 4F9PA 2NZIA 3RVVC 3CFMA 3U48A 2QT6A 1RULH 5I1IH 5K9KA 1EQWA 4WO4C 3CZLA 2DY2A 2GJZB 3QWOA 4ZW8A 4BH7A 4YEFA 1RVFH 4H1LB 5D2LF 1T66C 4MJ5A 4NQXA 1W72L 1BQLH 5A6IA 1WS7A 2I07A 1IM3B 3W39A 3GF8A 5EN2B 5FECA 4KKAC 2GTWB 3SPIA 4A37A 3PPEA 1TZGL 3ESNA 4P23A 3CDGA 5DO8A 1H8NA 2XPYA 4MNGB 4ZX4A 1OEZW 2VLJD 3AU1A 3BDYH 3OWRA 1F4YL 4FNSA 4G1EA 4MMZB 4KH2A 1XGQA 3BAEL 2BVTA 5EZOH 2IH3A 2XV6B 2Z7UA 5LO7A 5I1DA 3VXMD 1NCNA 5KVGL 2R0WL 2W07A 4YVUA 2W0FB 3QQXA 4HXAL 4IKKA 5HVHB 3KLHC 5C08B 5HHVL 2X42A 3KPPA 3P4MA 1R3KA 1F4XL 2Y07H 1NEZG 3BJLA 4MKMA 4GIPD 1TR7A 5AAPA 5AVTB 3IVKB 2ZUQB 1YY8B 1MH5A 1T4KB 4MCZB 3TBYA 4ZAKB 2CNZA 3DV4A 4ZFZA 1BJ1J 4OR1A 2WK2A 1H19A 3MLTB 4Z3EA 2XIDA 1F42A 4RA0C 4NN7B 3CSYB 3G3LA 2P7TB 4KKCD 1Z3GL 3MNDA 4PRDB 2O6PA 1A3LL 2OJZH 3DROA 3C12A 2NY5H 3PGDA 4Y2DD 1CF1A 1GW6A 1A4JA 3L54A 4DKEL 2AQSA 1QBML 4F37F 1SJHA 4XH2A 3FUKA 4BSWA 2WLHA 3IJEA 4IMKC 3DSFL 3LEXB 4AM0B 5D7EA 4HKZB 2B0SL 1S9YB 3ZU8A 2H41A 3VGGA 5JPMB 2BVPB 3TASA 3RIKA 3QEGL 4PJ9C 4Q97A 5JHLH 1S9VB 1HIML 3IKKA 3QJSB 1OAQL 3KJ4B 4PYGA 2ITDB 4OAWA 1O6SA 1JAEA 4YIQA 4PRHE 3NZHL 4PLKC 5AOMA 3IFNH 4I87A 3ZTJG 2F54D 3D87B 1E3XA 3LZFH 5FKPA 3G6DL 1TXKA 3RGVA 2E56A 1I9RL 2BFGA 5BRZD 2GJPA 3G5ZB 1E6JH 5EHFA 1QEXA 3L5JA 3BZ5A 3ALPA 1HCYA 5KBMA 2FECL 3NZSA 3QDGA 4N2AA 4NUJB 3EO0A 4PJCE 1ASOA 4PJXF 2WYTA 1FFNB 2N59A 1U3HD 3BIAX 3QQ3A 4OGYH 5A2FA 5CBAB 1H15A 1Q9KB 3UACA 2ED6A 4UQ9A 4QRPA 2R56H 5E8OA 4BQ9A 3Q01A 5BW7C 2EIKB 3FQRB 5I1AB 4BGDA 1RK0B 2BERA 3KEHA 4UQCA 1T7YA 1JPGB 1P69B 2YD1A 3PV6A 5AZ2L 1ZDQA 3T0EB 3N43B 4O9HH 5C71A 1Q9OB 3HJEA 1GC1L 4HW6A 3SY6A 3ZTEA 4MSWB 4OCNC 1II4E 1OAZH 3G04B 1IC5H 3TTYA 2NT1A 4DKDC 4ZX3A 2CA4A 2W81C 3MBEC 3OKEB 1UD3A 1E42A 4QKTA 5FO7B 1TU2B 1FGNH 3KWXA 5KVEE 2QGEA 2H26B 1KXTA 3HZVA 1M2VB 2R0KL 2Z1PA 4XX5A 3CK0L 1J1PL 2QELA 3BYYA 4ICXA 4NRXA 5K39B 4DVRL 5DWUL 1NLBH 5H94A 5I74B 4I5BA 4XTRD 2MHAB 2ZD0A 5F6HI 3STZA 2EJ1A 1JD9A 2YPLB 1KT2A 4GQ9L 1SHWA 2FSEB 4NJAH 1YEJL 4NPJA 1L3WA 1E9PB 5LG1A 2Q8BL 3TZVC 5JW4M 2A77H 1TVBA 4GOSA 2XVBA 2OBGA 4A7GF 3REVB 3GB7A 1S7SB 5I1HH 4KDVA 4ZXBC 5LVEA 5H37H 1GKEA 1U91B 3FSZA 4KQ0A 1XMEB 2XBZA 4KJPD 3PDGA 3P2TA 1UKTA 3TJPA 3BKMH 2XPZA 1ORSB 2Y5TA 1AGDA 2XZQL 3B56A 3HPLB 2C9RA 5T1LD 3ULVL 2NXZD 1H3UA 1NIFA 4KOBA 1CMOA 3KBHE 1ACCA 4ENED 1J0ZA 3OG6B 3WO4C 4JDTH 4MCMA 3CLEL 1P5VB 5I8OH 4WSKA 4XN8A 4G71B 4QHLA 4EI6A 5KBKA 4IEFA 3FONA 4JHZA 4S2SB 4TOYL 4V2BA 5CKGA 2FZ3A 1DQKA 4LNRA 3LEVH 2HUEA 3JUYA 4RZCB 3SSGA 3BAJA 5D71H 1TMCB 2GK0A 3NH7L 1Q0YH 2ARWA 4UILH 4KK9C 3WTYA 4G8GE 1XB8A 3DC0A 4H25A 5I1LA 2JJWA 3KW8A 2Z1KA 3UTPE 3WFEH 4HHWA 4X4XB 2FUTA 3PUCA 1VFUA 3GZPA 1MOEA 3KPLB 3U4EB 2XKSA 1AGFB 1NC4A 3HRPA 3HR5B 5DC9B 1T5WA 4MMXB 2DQTL 2Y72A 2C9XA 3L4TA 2ICCA 3WDJA 2FX7L 2OULB 3WGVB 2HLFC 4AIOA 4XVUD 3LH2H 1J10A 1JZIA 4JZNA 5F9DC 3VE0A 4FQ2L 4OZ4B 4OZIA 1HKFA 2X89A 2V8LA 1D5MB 4HJ0C 8FABB 4ZOEA 4LCCA 4DVBB 3RIFK 1WBYA 3L95A 5IB3B 1N0XH 3DO7B 1AFVL 4C4BA 2AQRA 4Z3IA 3N50A 5DLMH 3MV9A 3IXAB 2G5BB 1MNUH 3NRFA 4BA0A 3F58H 2G30A 2R9HC 5GGRY 1UB5A 3BSZH 3WEXA 4DT2A 2PCYA 2P9RA 4Z0BL 4NPYB 4Z18A 1IGTB 1THAA 2YAHA 4FXGC 4AGOA 4IBWA 5CCHE 4KK8C 2BCKB 4LAQH 3AY4A 4OZGB 1MIML 2NCMA 3G7TA 1YYML 4MQXD 1KWGA 4LVOB 1D5IL 1I1RA 3IT8D 1CFMA 1Y07A 1XIWC 3FN0L 5DJZA 3MRBB 3UTZB 2HPOA 3G5VB 3GTNA 2QHLA 3U7WL 1HQ4B 3PXLA 2J71A 4NAQA 2AJXL 1DQTA 3VGFA 3P4NB 1JZHA 2KLSA 2J12B 4CVXB 5L6YL 4WHYG 3REWA 2ILLA 1GPOH 3T0XA 3UZVB 2AK1L 4RNRB 1WBXB 4WFFD 2YXFA 2CPUA 3RG1C 2IDTA 2J1XA 3PWVB 2WYIA 1LE9A 1HJBC 4G3YH 4XN2A 2CGZA 1AY1H 3G08B 3MRHA 5GSRB 1I8KB 1BD2B 3VXRA 4QRUA 5JOFA 1PS3A 5FKAA 5FYLH 4AVKA 3AABA 3NESA 4ABQA 5DVKA 3UCRA 4X6FA 3JV6A 1EUTA 3TCXA 4LLWA 1KTKE 1RK7A 1JF1B 1JS4A 3VO0A 2DQGL 3GI9H 5HDBF 4DEPC 5EBMA 3L1GA 4AVIA 4IBZA 4MA3A 4GW4A 1HH6A 4AUUA 2IOMA 4PRPA 1DBKH 3I50H 3WN6A 1PD0A 1NUDA 5IMMB 2P5PA 4PWGA 3GI8H 3MJ7A 5IKCB 4G9DB 1NZRA 2IC2A 1CK0L 5HI4C 4FZ8L 3CG8A 5B21A 1U6AL 1SVCP 1X5KA 1I53A 1SOXA 5JW4R 5E2WH 3JTTA 2CLZA 2IH1B 4P5KB 3WKMH 5IT2H 2P5EE 4BZ2H 2NNAA 5DQ9A 2EDYA 2EIDA 3FB7B 5K9QG 1G7MA 2P45B 5CZVH 2P52A 1OANA 1HFUA 2MQ3A 4E41A 1S5IL 4KHXL 4M48L 4PV1C 3VB8A 5DMGD 4E0RA 5C0FB 4PJDB 2V7NB 3K6SA 3BGFB 3QUYD 32C2B 1ND0B 2R69H 4MYWB 2VQ4A 5FYKE 1CFQA 4HEPG 4WEBH 4EIZC 2NZ9C 3ORJA 4Y2NA 4O2EB 3FBKA 4P0DA 3SDXF 2QV4A 2VC2B 1RSYA 1QPXA 1SQ2N 5EFIA 1WBZA 4A6YL 4KC3B 2X6AA 2NXYC 4PV9B 3TV3L 1I1FB 4KGLA 4L8BA 4YSOA 2H3KA 4YN3A 2ZUUA 4M5YL 5T8IA 4IU2A 3SDCB 2AQ3A 2O6FA 1XR9B 2OXGA 3ASWA 3MXWL 3KPMA 4KPHL 4EN3D 2BSSB 2ZOKB 2RFXB 5FCUL 3GXTA 3MI6A 2FJUB 3WIHL 4GFXA 3ZDYB 4RFOL 3HE6A 1TYRA 2X05A 2MKLC 5B3JF 4JFEE 2KDGA 1CT8B 4RSYA 5IIEA 4X5QA 3TJHD 5C0RL 1YEEH 1TTFA 5LWYH 1PDKB 3T0AA 1HEZA 1ZV2A 4A6YA 3DSNB 2GFBA 1ZTXH 4FI7A 3SCMB 1DJIA 4N0UA 2LFEA 2AEQH 3K3QA 5DO2D 4PVBA 3F5WB 3H6JA 2CQVA 1TJMA 5IW3A 2Z91A 1GJWA 4HA1A 2F53E 2N1TE 3B4NA 2V9UA 3WIHA 1SPDA 3INUH 1UWGL 4UAOB 2B08A 4YBLC 5EIQA 2CDGA 1KDIA 2SEBA 5G2NA 3FNKA 4ZUUB 2Z64C 5I16A 3BWAA 3MXVL 1A4CA 1LWRA 2P42B 1IAOA 3W82A 4A2DA 1BP3B 1HSAA 1DLFL 4CN6A 3QIWD 1OALA 3EYVB 5IB2B 4ONGL 3MFFB 4HS8H 1MPAH 4Y4FC 1C8PA 3LQAL 5J9PB 1A7BA 1FNEA 1SOSA 2EE9A 4YLCA 1XGRB 2GI0A 4NO0A 2ZQKA 2ICES 1EFQA 1E7VA 1UB6A 5EO9B 2QPEB 3MN8A 2APBA 3V52H 1B4LA 2PTUA 4D9QD 4YHLL 3MACL 1RUPL 5IR1B 1UJ3A 1IBGH 2J4WH 2J25A 4MWFA 4QEGA 4P9ML 4DZ8A 1B4RA 3LAFA 1FHNA 4U1HB 1J5HA 4PB9H 1ETJA 3Q2NA 2BC4A 4NENB 4YX2L 2K78A 1OPGL 4XE0A 1QZ1A 3MNMA 3TLRA 4MQSB 3WKQA 3GSNH 5ALBH 2VAAA 3NGBB 1CGWA 3KPRB 4I2XA 4NO5B 4KKCC 4Z7WA 2A4ZA 2VXUL 4YSRA 4Y2DC 5EO0A 3QEUB 2CBQA 1DR9A 4GAFB 2X09A 2CJSA 3BFQG 3NCJL 5C7XL 5KSBB 1BAFL 5E6IB 4YZFF 3MODL 3CVHL 5A1AA 1I1AD 4H8WL 3HHRB 2A74C 1AHWB 5E8PA 4L23A 2FATL 2HSIA 2F5AL 3LN4A 3KGSA 3GXIA 4BCYA 3DHJA 4AGQA 4YXLL 4WKXA 2XA3A 2ZX7A 2X1XR 5ACMA 1E5AA 5GISH 1CD0A 3RPIB 4F8OA 2CIKA 3BDBA 1J11A 5ERWA 5FHAL 5HYJE 1ZXKA 3HRZC 4RSVA 3L9RA 4PW9A 5E5MB 1SHMA 1F8TL 2GCYA 4KAQH 4DETA 4U1MB 1MVUB 4TQEL 4ZYKB 3OKOB 4ELMF 4DGVH 2V9QA 1E2VA 1RUAL 3AM8C 2CM6A 4PJCB 3ASNB 2IADA 3CVHA 1EUUA 2XRAL 3MC0A 5C1MB 1OAYL 1ZT1A 3MOAH 4YL9A 1ZV9A 1NCGA 3K5SA 3PG2A 3L6FB 1VDGA 2HYMA 1LD9B 1U3HC 4LCWA 2K6WA 1QLRB 3MLYL 1BVNT 1NC2D 1T20A 3IDJB 3PREA 4LSUH 4B0MB 4DTGL 2BSCA 2DWYA 4JO8A 5BQ7B 4QRBA 2NSXA 1QX1A 4KX7A 4NSKA 4JHUA 3F7VA 3S35H 2QL1A 4Y19D 3M17A 1C5DA 1NUGA 1D7DA 4TQHA 3ZMEA 1GCFA 4RX4A 4W9GC 3FUJA 5IJVA 1PZCA 2KERA 4DSYA 3QEHB 5GS1B 3N1QC 3HB3B 3QDGE 4AL8C 3H3PH 1E9PA 2PCFA 2P8MA 3BZFB 2WGNB 4FADA 4U6XA 4LVEA 4UM9B 1U3YA 1J9RA 4W9IC 1IGIL 1BGXH 5H35B 3NJNA 3GGWA 3VFOA 1PLBA 4QRPE 4XTRC 4Y2OA 2VH5L 4H40A 4XZ4A 1AOHA 2PLTA 1NLDH 2X2UA 1BQUA 4A66A 2OQJB 2V3EA 4TM9A 2ZYRA 2VDMB 5IFHH 3TJEL 1OGPA 4IBLT 3FB8B 2VL5A 3CPLB 3IWUA 3KEDA 4WWNA 2CIIB 1F5WA 2YXWA 1F4HA 5LGHL 1R3LB 3BE1L 1YG9A 3DHUA 1NOAA 1GMIA 3RWFA 4CADA 4HP5A 4QY8A 3E38A 5ETUB 4LRIC 5JW5B 4P46D 1UT2A 4F7CA 3DVFA 1JFQH 1JGEB 3KL5A 4L0PB 3H54A 1S3KH 2EDWA 4B9YA 1L9RA 4KJPC 5GGRA 3O2VL 5C7ZA 4RMSA 4Z7QF 5DWPA 2HG0A 1FORH 5LHDA 3RGBA 3O3BB 2VR5A 4U1SA 5B39G 4YJZL 2NXZC 2WXJA 4HIHB 3FFCA 1T7XA 3A23A 4H26A 4ENEC 1HN1A 4UQDA 2FBRA 4HDIA 4LLAA 4QDGA 4K5OA 9PCYA 4PW3A 4JUTA 2WBJA 3WO3B 4KNQA 5LXGL 3GKWH 3ZTNL 4H5SB 5IVXB 5J06A 2XXCB 1IC1A 3QHZH 3NA9L 2RB8A 4Z7NE 4QT5B 1T5XB 4CU6A 3HC0B 4HJ1A 2DBLL 2EC9T 5CGMA 3BRFA 4X6DA 2Q7YA 4KKLD 1HCFX 3BWSA 2WAHA 3KM1A 3RY6A 4HKJA 1FE8H 3KPOB 1FYTE 1UM4L 4LSTL 4G8GB 4IBTA 4XN9A 5DRXA 1MJ7H 2CO2A 1CLZH 1FN4B 3O9WA 1CE1H 3MLWL 1V7NL 3QR2A 4WI8A 3DOSB 4F2FA 2CKBH 4Q58C 1KY7A 4IRJD 3HZKB 4QHUA 3GIVB 4XPFH 2YUZA 4U4BA 4G80A 4DUVA 1K8IB 4NRYB 5HHXH 5I6KA 3ZUNC 4HMCA 4LLUA 1AQMA 3RIAF 3DO7A 4DEUA 1DSYA 2KMWA 2QMJA 5F96H 3FOMA 5I17A 1R0AH 4RVBA 2OSXA 1EV2E 3CZSA 4GAGH 3V10A 5IW1B 1BVKB 1BYNA 3MLXH 4XVUC 1LE5A 1SDAB 2C8NA 2D4DA 3P4OB 1CI3M 2NYKA 4I3SL 4BWUA 1BXAA 3WD5L 3FSVA 2AAAA 2BP5M 1ZE3C 2ZPKH 2GJ6A 2PO6A 4NN6B 1ZLDA 3EFDL 1NUFA 1GGCL 4L2LA 1NCWL 3CZFB 5DGRA 5F89B 2CBMA 3ULVF 1VKXA 4EI5B 3CDCA 7CGTA 4G7VL 1A4BA 3VYOA 3L4XA 5TGBA 5E1QA 2CDFB 5C0AE 3RTQB 3WIIH 1P7BA 4FCAA 1TJHL 4EF3A 4L3EE 3QDMD 4YL4A 1CICD 2EH8L 2WLIA 3P4NA 1A47A 1ORQA 4NNYA 4MQXC 2DL2A 4NAJA 3VDAA 4QWWD 4OZIE 1BQHB 1HHGB 3BVVA 2AS5M 3U1QA 2VR4A 3ZHKA 5A7BA 3OGOE 5BRPA 1URLA 2QVFB 3PWVA 2AK4A 2EILB 5GRVL 2WSKA 2C26A 5D1ZD 1JHLL 5DHDA 3S2AA 3MV9E 4JVPA 1OGAD 3GIZH 5EDXA 3WMQA 3B2MA 4IK6A 3GSUA 5D7LA 5B22A 5LG6A 3ZSTA 4X7TB 3R8QA 1MI5D 2DMCA 3HNTL 5DR5L 4NT6A 3M7OA 1ERNA 4ZOCA 2YMOA 5DD1L 2V5MA 1CFVL 2W9EH 3HG3A 4IDJH 12E8L 2BVOB 1K5NA 4YDVA 3WJJA 4ZFFB 3DTDA 5C2BH 1KIRA 1E8WA 2ODHA 1X6LA 1HEHC 2XWJB 1QYGH 4IRSD 1WWCA 4JRYA 3JZ7A 4HPHA 2YKLH 2HFGH 4UTCA 1W80A 1CLCA 4TN9A 5F8QC 3NCEB 3L5HA 2BP0A 3EGSA 1G0DA 3SDYH 4JG5A 5EU6A 1VFMA 3MJ9H 1MZZA 4PG2A 4PJ8A 5AW4B 4DCQA 4R7VA 1YEIL 3K72A 4PBXA 2PF6A 1O7DE 4XXDB 3RB5A 2WZ5A 3FO9B 5FS5A 5EUKB 5HHPB 3D3VB 4RBPK 3ULSB 4GH7B 1OGTB 2GJJA 1JWMA 4KXBA 2VM4A 5IOPB 1R5WA 1B2WH 4QRRD 2XVLA 4GRLB 4MRBA 2CMRH 3RWHB 1CD1B 3D39A 1CPUA 2GIYA 2VDKH 3UPRB 2IO5A 1YEGL 1QSEA 4JFOB 1RJYB 4M5ZH 4CMHB 4RAVB 1RPQA 4A7SA 4FHKA 3VXRE 2AJYL 4AQ8C 2FSDA 2BFVH 3IFLL 1EAJA 3V8OA 2X38A 3RILA 4LPYA 4K5NA 4YSEA 4OM0L 1KY6A 5E8DH 4OKVA 1OSZB 3UJIL 5DJ6B 1T1WA 3HI6H 1HYRC 2UYLA 4WIQA 3IK2A 1LO5B 4KUCF 1D2OA 1EAPA 3IDXH 5DMGC 3STLB 2DYPA 3JWNC 2YRLA 3EAKA 4PV9A 3VXPA 5BJTB 3C8KB 4PRPE 3NIDF 1NMBH 4ODSL 2P8PB 3QUYC 3H4FA 5AUMA 2K8QA 3HAEB 1WIOA 2YD0A 2X6UA 3O45A 3Q8FA 3AJ7A 4HH9B 4C56D 4YSAA 3HNSL 2EDNA 3QUHA 5IQOA 2OPCA 4EXPX 2YGQA 5EZJA 5FFGA 1QVOB 3DI3B 5CU5A 1KBVA 2A0LD 3T0VA 2KI6A 3ZDXF 4EN3C 1UQSB 2MWCA 5F3BB 2VITA 1RZ7H 3BKCL 4XNMB 5F9JB 4CBZA 1A6UL 4PJ7B 2A9AA 2JKSA 3D18B 4M5TA 5E1AB 3SCMA 4E41E 3QZWG 2DQDH 4ODTH 5EO1A 1GYUA 1QSFA 3VMPA 4MJIE 1MFEH 1YNKL 1ETB1 4WY7H 2P3YA 5T1DH 1EHNA 2ZG2A 4MZIA 1UA6L 2ENJA 2DMHA 1FL3B 5T5NG 3SN6N 3TJHC 2V7HA 5EN3A 1A3ZA 3BIKA 2ESVD 1V3LA 4HJGB 5H4ZA 1KFAH 3DLQR 3DV6B 4N0YH 5I1JL 3TS8A 1WO2A 1L7TL 2C3VA 2MOGA 3IGUA 3BVXA 1KTJA 4ZUUA 5DO2C 4OZFA 5C0CD 1A4KB 5F21B 1Z9OA 1CQKA 3H9HB 2UWEA 4OLXL 3HKFA 3ZR6A 5LQBH 4FERA 1JMXA 1Q4NX 2V9RA 1D5XA 1DVTA 1OCRB 3FT2B 2Q76B 1DSWA 4Y16A 1RHHB 4JGMA 4ZQKA 3IEAA 4M3JA 5J9PA 5EH1A 3MO1A 5JIHA 1ZAGA 3MV7A 2D0HA 1EZLA 2IBGA 3LKRB 3UTTD 5B38B 3Q6FB 3S3SA 1XVSA 3C9NB 3SODB 5F44A 2EDDA 1H3PL 5E51A 4OCWL 2V8MA 1CTOA 5A2IH 1FNSH 3C5XA 4N0UE 4R2GD 3VFGL 4NM4L 3F3HA 4X6CA 1Q0XH 3GM0A 1QMUA 3FAXA 3QUXC 3Q1SH 5IQNA 4I8DA 5J13C 3VA6A 1D5ZB 1TPXB 1KFGA 1AE6H 1DEDA 1CL7H 4NC1E 2Y5QA 1G9ML 2B59B 4KY1L 4JPVL 4N8PA 4HBCH 4QNPE 3DUSB 4MJ4A 2EDXA 5TDOA 4ZPVB 1CU4L 1JGLL 3IJ8A 2G4EA 4KMTL 4U3XA 4MA8L 2NY3B 3AG3B 1IAIL 3LV3B 3H9SD 4PGZA 4OZHE 2ADIB 2KZKA 4BKLA 2F61A 5J12C 3BD5A 3KCPA 4JY6A 4Y9FA 5AB0A 4DP1X 3KL0A 4JQIL 1N6QL 2WVSA 4GKSB 3A67L 2W59A 1LDPL 4GPVA 5C07D 5AW8B 5F1NA 1A7PH 1PG7X 2FHCA 3D0LA 4W4OC 1H9DA 4HQQH 4Y5YC 1I1AC 4POZD 4ZMZA 4GI6A 3C5ZD 1TLKA 3KXFB 4H8UA 1IE5A 4U0RB 1FSKC 4U1MA 3CH1A 3PHOB 4KJWC 1MY5A 4TRPH 1VHPA 2YK1L 3HHMA 5HYJB 2I7SA 4KQ4L 1KLGB 1BWMA 4WQOA 5L7XL 2XTLA 4JQIA 4K94L 3V6BR 4Z7WE 4WGVB 5BO1L 1PVHA 2KDYA 3CD4A 3HE7D 1UCBL 2CK0H 2ZCHL 2ZAGA 1I3RA 3RURA 3ZIMA 4B60A 5BVPL 5F3HB 1LEKA 1IKNA 4AT6A 1NWPA 3QIUB 1U93B 2AJZA 1KJMB 5I75C 2VDLB 2BIOA 1OTUD 2DQHH 2VDML 3KWWB 3L1EA 4LLYB 4R8WH 3QNXB 1OGSA 4MHHG 2FBJH 3MPCA 1ZVHA 3I6GB 3V4VH 2BY1A 2WQXA 3I3EA 2ITCA 5FYJD 4ODXB 3S96B 3TO2B 4EAEA 3IJSA 4OSUH 1BXXA 3P9LB 4OI7A 4P5MB 1OQXA 1J05A 2OMWB 3L5XL 5GZOD 3OBAA 2R4SL 3R4DA 3Q43A 5IBTH 2CR3A 1IM9D 2XWDA 3KYNB 1IGCH 2VE6B 4L8CA 4EJ1C 3O0RL 2DJSA 4RLDA 5L4IA 5KYUB 1P9MC 1DEEB 4LCWE 4MNQD 4TMPA 4H8VA 1Q94B 3IKCB 2CLVB 3PJSB 4M7KL 4WVRA 3N43F 3VXQA 5C3IA 5LLIC 1VGEH 2CRMA 2IPUG 1H6UA 4LIQL 5IJCC 3T6XA 5D7KE 4OUUA 3PABB 1AXIB 5F7DA 3DYPA 1WV7T 5DC2A 3BYTA 2YJQA 3CSFA 4P3CH 2EUWA 4JKMA 2IALB 3P3SA 4JAMA 4ZW7A 1UURA 3BOVA 2FWOB 4ALAH 3I9GH 3OQRA 5A16A 5H2BA 1X5GA 1S5HB 3VGBA 3PJLA 1SVBA 2VDRH 2AABH 1NCUA 2K3HA 1G9HA 1WHOA 2Y7QA 3PWPA 2X9ZA 4PHZA 1BXUA 1U8KB 1T0MA 2YUXA 2JJUA 4XPHH 4JHWH 2D7NA 5F7FA 1KB9K 3QC5X 1Q9WA 2XKUA 5GGTL 3DJ9A 4AMKH 5KANG 4KKLC 1FYTB 2B4CL 1KXVA 5E24E 3ABLB 4U1KB 4OIFA 1EH9A 4JM2B 5HYQB 1G5GA 3O8XD 2VLKD 1CG9A 2UY7B 5DYFA 1IL1A 4G42A 1MLCA 2GSGA 1AIFB 3EJSA 4YH6A 3HLKA 3ZO0A 4XPAL 1OAJA 2NR6D 3BZEB 5AW1B 1RP9A 5DHVH 4IRJC 3Q05A 1YQVH 3FFCE 4OH2A 1RIHH 2YD5A 1NINA 5GS2D 5GGVH 1DN0A 1YNLH 3QB7C 5EF1A 3ULUF 2I32A 2Y9RT 4YO0B 1B0RB 2WKGA 3QE5A 5DZLA 4QYOA 5HGBA 1N12A 1YMMD 1JGDB 5E4OA 4XNZC 2AV7A 1QWNA 5E94B 4ZS7H 1RMFH 4X6DE 2HJLA 1SJMA 3DJTA 4WHTB 5ADOH 1FDLH 3MCG1 4IOSD 4BK5C 5I19L 1FO0L 4FLSA 2PXYB 5TDPA 2XV3A 1PJWA 3BSGA 2ZKMX 3C2AL 1Z1WA 2EZ0C 1T21A 5EWIL 3UMNA 3UO8B 3S37X 1TJXA 3QFDA 1FFPA 4L9DA 4NKDB 3RA7H 4JFQB 3CFKB 5EOCH 3B43A 3VXSD 2VL4A 5IMOB 4YHMH 2IWGA 3WHE0 1W9XA 3RFZB 3A22A 1BQHA 2YAMA 4HLZH 5C0JB 2PKDA 3QYCA 5C0AB 3QO1A 4NERA 4PJHB 4S1RL 3KYKL 5JW4N 4L3EB 5D6DC 1LO4H 3P9WB 2JK5B 1J87A 1FO0A 1X7SA 3R4RA 1CICC 4Y4KB 2DRUA 2ZWNA 3EGDA 1LEIB 2DWTA 4Q9QH 2QJDA 5F1IB 4QWWC 4XMUA 4MD5A 5IROA 1J8HB 1FZKB 3HCVB 1WIPA 2X2JA 3QHFH 1CBJA 4MXWH 4PUBH 5D1ZC 3OKDB 1QFWH 3ZYZA 4QOKE 4TUJB 2YGOA 5T3XE 5D8JH 5ANMA 4X8GA 3HN8A 3U46A 3W3BA 3SGJC 2Y3AA 1J7VR 1TZIB 2V2WA 2EXSA 3EFOA 4WV1C 4I3RH 3WLBB 4OZGF 1EEQA 3IDIB 2AMGA 3GMOB 4P9HL 3IN2A 3BP7B 4GLRH 1NCAH 3DXAE 3FS9A 4IRSC 2I69A 5T1JA 1A14H 5FO8B 3WXVL 2WQVA 5E0FA 2XZZA 4GS7B 1RZIB 4PJFB 5IHLB 5K9JH 1P7KB 3S6CA 4A63A 1MRDL 3TBVA 3D33A 1MHEB 5CLXA 2OMZA 1ZLSL 4QJ4B 5AZEH 4NZJA 3T8VA 2X1QA 1IAKB 3BAYA 4BFIA 1ESOA 5D2NC 1B0GB 2K9UA 3HG0A 4IGBA 4NQEB 2VUYA 3SKJH 3IBEA 3SKNB 2DOCA 3ECBA 4GAJL 3WSQL 4F8LA 4NKOB 3V0WH 5DFAA 3WBDA 5I8KH 2DKMA 3FSOA 3UJJL 4WUUD 4JRYE 1WEJL 2OW7A 2VQUA 1MHCA 3FBQA 4FQPA 5M7QA 3GINA 5C0DA 1TCRB 5EU6E 1QR1B 3CFDA 3SKOB 1FLRH 1VEPA 1CXIA 4OF6A 2FLRT 1SMAA 1SJEB 5SWZE 2A9DA 4ZMTA 3O6MH 3TA3D 3DIDA 3KLDA 3U9UA 4N8VA 1UM6L 2Y2WA 2AANA 4NZTL 4O51B 5JXED 2DLFL 1MRFH 1U2HA 5A40E 3E8UH 3H7LA 3NIGF 5JPNB 4G5ZL 4C54A 5E8NB 3VGAB 4E9VA 5I76B 1MFAH 5TQ0H 3RNQB 3WU1A 1G0XA 1MEXH 2F08A 3ARGD 4OV5B 4WNJA 5DJDB 3V9CA 2NW3B 1MRCL 3KLAA 5DURB 5EU3A 3O6KH 2A0LC 1NL0L 1JF6A 4XCFL 4YBHA 4C4UA 1MELA 3V0IA 2EACA 5BZXA 1XCQA 3L81A 2GTZA 4K3HA 4BSJA 2P5WD 4PJDF 5KJRH 4RMTA 4IU3B 4MJIB 4OLUL 2IQAB 2EDMA 1PLGH 4UTAH 3TT3L 3V5HA 3I6LD 4KDTA 1TZOA 3FU8A 1Q0EA 1Y7VA 1HH9B 1TNNA 2YFNA 3LYRA 2O30A 3Q8CA 5IBLD 4OCSH 1GTFA 3PAZA 4XMLL 2F5BH 1T2JA 3QI9D 3QIBD 4YS4A 2GY5A 4JFFD 2Y06H 4KI5D 5FUOL 3SGDI 5JIIA 1BIIB 3ZZSA 4RGNC 4N2HA 4DO6A 5EEXA 4WWKA 1IC0A 3X1EA 1T0PB 2VXSL 3HZMA 2A73A 4JPKL 3ZDYF 4CDHA 4GIAA 3I74A 2JKWA 1WFUA 2OL3L 3C9NA 4QUOA 4BXVA 3PP4H 5KEZA 1GY1A 2A6IA 3BISA 4XNXL 4JG1L 5HHOB 4RFNB 1QSFE 4I77H 4MQTB 1T3FB 3UO1L 3IMBA 1C7SA 1QTPA 3CPUA 4GG6A 1DQIA 3ZQWA 4U2ZA 5CJQH 4OFYA 5INDA 1E8ZA 1LP9A 4W68A 2APFA 4R2GC 4WJ5A 3CDZA 4HC1L 3UJTH 4L3AA 1ZJAA 4MAUH 1WT5C 2OL3A 2UWEE 5C6TL 3IMVA 3VSTA 2XX0A 4DH2A 5I0VA 1G7QA 1YO4A 4EZKA 3PU7A 4N6RA 4ODUA 4TNVF 1RZPA 1LEGB 3GK8L 4ZD3H 2CRZA 4WTZG 4GBXB 2D4FA 1YEHH 1F6LL 3P73A 3MV7E 1FUNA 3HC3H 2H4EA 4K7FA 1XV8A 4UZSA 5ES4B 4OZHB 1B0WA 4HC1A 1MWAB 1I4FA 2R23B 5H8DA 4FNRA 2IGFL 4I9WD 2A9MH 1AO7B 1CE6B 1IKFL 4WEUD 3UTOA 3NCYP 1BFVL 4L29B 4X6CE 5C0GA 4LPCA 2QQLL 5EU4B 5DU7A 4JANA 4MDJA 1AD0B 3K6IA 4CSSA 1GCYA 1BV8A 4POZC 2E74C 4K3EH 3C5ZC 3WS6C 43C9B 5TQ2H 2BDNL 4J3OG 4LF3A 1YPZE 1RHFA 5I6PA 1NMCB 3L2LA 3PWJA 1RXLA 2SODB 1RIUL 2WSDA 2Y1VA 2H6PA 2ZXEB 4PWFA 4JCWA 4YFDB 4CMMA 2EDOA 4W9EC 3CAFA 3G5XB 4QRTB 1AZNA 3UADA 1EMTL 3QNZB 1JV5B 4JPSA 1R34A 5CD3A 2X6MA 3HE7C 3MV11 2YBGA 3QG7L 5LDUA 3ZT5A 5GS0D 4PRHD 3PHQB 3VD5A 4HGWB 4R4BB 2E6JA 4WW2C 1L0XA 5CIPA 4D94A 1PKQB 1T5KA 2A3TA 4FG2A 5SX5H 3GBMH 1I7ZA 3NEXA 4K7PX 1VACA 2OW6A 3EJJX 5CCKH 2YD8A 4PSPA 4ZW6A 3VACA 1UT1A 3KDMA 3MRJB 3FUIA 4NZRH 1Z9NA 3IGAB 1PFCA 2ARJQ 3FYEB 5D72L 3DBXB 5KW9H 4PJCF 4HUKB 1NCCL 1T7WA 3OZLA 3X12B 1MCPH 3LNGA 1M7UA 5GZOC 5J6GA 3B1TA 1Q94A 3N85H 4HYTB 1JBJA 1S78D 3RFZA 2HX8A 3O6FA 2WLLA 4KVCL 3MRKA 4I1RA 3QJTB 4J6RL 5LDSA 4FL4C 4HWEL 4KY2A 4L1HA 4LCIL 2M2DA 1E2ZA 1RULL 4XHQA 5I1IL 2APSA 3GJEA 2NY7H 4MD0B 1RVFL 1IE4A 4K4KA 3S48A 2TRYA 2ZXBA 1KPRB 1BQLL 1SHXA 1KENH 1V55B 4HCGA 1N5AB 3P2BA 4GINA 3A4FA 4PCSA 5T3ZE 4YFEA 2R2BB 2F7OA 1U8IB 2UZPA 1R9FA 1KCVH 2C1PA 2HJKB 3FQUB 1F3JA 4M8RA 4OD1H 1NGQH 2EDJA 3BGMA 1XCWA 3N0PB 5CP7A 2X9YA 4AC4A 4AKOA 4TVPE 5MENB 1I8UA 4WK2B 1L5GA 3BDYL 2VXTH 1H8SA 5J3HD 2AXJA 2ZOLB 3QULA 5EZOL 4HFWB 2G3NA 4IKNA 2NX5D 2ZX8A 3QRBA 1IC7H 1JK9B 3NDZE 4U1GB 1VENA 5FK9A 5DMKB 2LVCA 4TSBH 2YRZA 1S3RA 5DFWH 2WO3B 1UUSA 4E9TA 3OKLA 4HIIB 9CGTA 1MJUH 2Y07L 3KDPB 2EVFA 4J3XA 4F8NA 2I85A 2ZCKH 4HUUA 4ONFH 3T6QC 5IEHA 4L1SA 2FAUA 4XCNB 3GDCA 2GYSA 3L4UA 1XGPA 4AL8H 3NPSC 4P48A 3HMWH 2NR6C 3G6AA 2OJZL 3AB0B 2NY5L 4P04A 1QW8A 2W65B 4NQDE 5I82A 2D2OA 5SX4H 3V79C 2CUIA 4XP6H 5IVXF 4LIQE 4FQXD 2R0ZH 4XWGH 4PLNC 5E00B 3PWPE 5AAWC 5BS0A 4MZ3A 4ERSH 1Y6NR 5JO5A 4KK6D 1MCOH 5FOBA 3T0DA 2CALA 5JHLL 3UFIA 3N04A 1YDPB 3QDHA 1EFXD 3P4LA 1AD9A 2UXVA 4AYID 1EZVY 2WZ0A 3U30C 3IFNL 1MCSA 2VDPB 4P4KA 4HS6B 1YEDA 2QDVA 3M6DA 1R19A 3D2UD 3LZFL 3EJYC 4FQQA 1QWUA 3GHEH 1PBYA 3UG4A 1E6JL 2IPKB 2B15A 4FXKC 2V0AA 3V4UH 5IY5B 2AQNA 2YPKA 3P9MB 5CMAB 4UF7C 3TOPA 5JHLA 3C60D 4BM7A 1TQWA 4U1JA 2GHWB 1BECA 3QO0A 4KI1A 1A1NB 2PYEB 3AT9A 4OGYL 4X6BB 4EMZA 5GXBB 1HOEA 4MS6A 3OKDA 1F13A 5IK3A 2JSFA 2R56L 4GKZB 2ATAA 1ZT7B 2E6PA 1YYCA 3KLLA 3M46A 1CWVA 2I60H 4HZLA 1SXZA 4XVSH 3FQYA 4Y1AB 4E9WA 4O9HL 3QISA 3ALWA 4MB3A 1A3RH 1OAZL 3OR7B 3QT2A 1IC5L 2I9TB 3R7QA 2N0MA 2ISDA 3B3BA 4XOEA 3PWNB 1T1YB 1GZPB 1U95B 5KVFE 4RAUB 3T3PE 3GBDA 4Q6IA 2QGBA 2XN9E 1FGNL 4G59C 4IOIA 1WAAA 4PJFA 3VCLA 3VQ2C 4H20H 4PP1C 1NDGA 4UINH 5IJKC 5EPMB 5DYOA 1L6XA 3PL6A 1U2CA 3MRCA 4PTTB 3VI3A 3DXAB 1ZKAA 5HP5A 5CEZH 2AJVH 4TL5A 1NLBL 3LY6A 1ZHLB 1O9VA 2BNQE 1CDGA 1BFOB 4L9LA 4NJAL 3CVIH 4D9LH 1JZ8A 3EXJA 2A77L 1MCDA 1P4BH 2H1LM 3EIFA 4XRCA 3QWRA 3QDJE 2F8XC 2E3VA 4N2OA 4I4WB 4NKQB 4PJGB 1LK2A 2EC9U 5I5JA 1E4KC 2XG5A 5I1HL 4JZJC 5TFSH 3OPUA 1ZE3H 2P4AB 3D06A 5ANME 1I7UA 4L3CB 3BT0A 1CZ8H 1P7QB 1L0PA 1MZYA 2X4UA 3WS3B 1KDJA 3B3IA 4AYGA 3BKML 5DVNA 1JDDA 3ZDZE 3TBCA 4HOWA 4FA7B 1HS6A 3DIFB 3VTTA 3EJRA 3OJDB 5I71C 2Q87A 2PCPB 2VLMD 2JKJA 4JDTL 4UOJA 1T83A 4H7VA 4MD4B 1FV1B 2DB8A 5I8OL 5JQ6H 3LCYA 4Z3HA 3TBSA 1XSKA 3TPUB 3GSOA 1ZVYA 4N5UA 5H37A 3UAJD 5SWZB 3LEVL 4QTHA 1TZHB 1KB5B 2GEQA 5LGKA 4X4KA 4APQD 5D71L 5EEVA 1QI3A 3GXUB 4A2HA 1EWHA 1Q0YL 3U2SA 4UILL 4AEIH 3TA3C 4HV8B 5JORB 1HXMA 2X5PA 2P5ED 2YBRB 5JXEC 1ACZA 2BNRE 3WFEL 4KROB 1RUKH 2R1WB 3DETD 2NY1D 2VRKA 4YMPA 4NNXA 2N4IA 1T0NB 4FDWA 3W11D 1A4AA 3DX0A 4K23H 3ETSA 3LDBC 5SWQB 2ARJA 1KCRH 2PW2A 2W95A 1DVFA 5FYKD 5KSAA 1N8ZB 1QI5A 1KG0A 3KNBA 3NABH 4QYAA 2A83B 43CAB 3GSQA 3MNWA 2RJMA 4UIMA 3I9IA 3GLDA 2OSWA 3MRDB 4R97B 3ARVA 4LO9A 4ZTOH 5DK0B 2I9LB 2LE9A 4HFUL 3QXWA 1KTLA 3L3IB 1P84J 5CU9A 4H0IA 5IBLC 1N0XL 2BZDA 2VZ1A 2QTEA 2VLRA 2P8LB 3M07A 3LKSA 5DLML 3X1NA 5ESAA 1DQDH 1MNUL 4HWZB 3QI9C 3QP3A 3QIBC 3TN0D 4Z78A 3F58L 2CO6B 3B34A 3KBPA 1W2KT 2CKBB 3PNWA 4KI5C 5GZND 2C4FU 4JFED 1J1XH 1GGYA 3BSZL 4TLUA 2NPLX 1BVLB 1URZA 2JKXA 4PJ7F 3X2QB 4DP6X 3IMSA 4F7TB 2PP7A 3QA3A 4MQ7B 3F7QA 1DSFH 5E70A 3FRPA 4LAQL 4N2IA 1KV3A 1VADB 1X7QA 2IBZX 4CW1A 3JV4A 3VSQA 2GHZA 2WWKT 2X12A 3T3ME 2NZ1A 2W88A 4APXA 3I85A 4I85A 3JWNH 2F53D 2VZUA 2F0CA 4FFWD 5L2KD 1UZ8A 3WN5A 5DTFB 1NPUA 5EUOB 4A7QA 4NUMA 2NY0B 4P5TA 2IQ9H 1CYXA 5J11B 3BSZA 1GPOL 3BRDA 1JZGA 3SGKA 2AJUH 3S4SB 3CFTA 4OF7A 3K8LA 5E08H 5IVZA 3G6JA 4Z3TA 2ZWZA 1E3FA 5C2UB 2IV9A 2KBGA 1NANH 2DF3A 2ATKA 2QKSA 4G8EA 1U8JB 3MGOB 4HS3A 1AY1L 2VISA 1M42A 3ARUA 3CXDH 1IEBA 4ACTA 1XF3A 3EOTH 3OJVC 3D85A 4OUOA 1M6OB 4XBEH 5FYLL 3QAZC 4AYMC 3CZNA 5L9DL 1KF9B 2IJ0C 1PG7H 4M6NH 4P2AA 5MERB 1IQDA 5KS9A 3VVVA 4URKA 1NCHA 5FGSA 4Y9GA 1P1ZB 4PJEE 5ESVB 2ZSVA 1B6DA 1ZWIB 4LL1A 5DD6A 3GI9L 5F93C 3QWQB 5DGQA 1DYZA 1PZ2A 2QADD 3VWJD 2ZOTA 4P23D 4LSRH 1O6VA 1DBKL 3I50L 3GI8L 3TVMA 3TYFB 1BSIA 3VI4A 1IFHH 3UX9B 2N01B 1JPSH 3EOBA 3ME0B 3V0FA 1YPZB 4FLHA 3WUWB 1XSIA 3CJJA 4BQCA 5E2WL 5E6YA 5F97E 5LJYH 4P2OC 2G2PA 1GYVA 5TJWK 5IT2L 3L4WA 5FV1L 3SQBB 3WKML 5JOPE 3HBQA 5ICXA 3HLAB 3BQUB 4HISA 3SYQA 4BZ2L 2W0KA 2BWDA 2C3XA 4WGWB 1M7DB 4IQHA 3UZQB 1AGBB 1AQ8A 3BP6A 5KSUA 1BJ1H 5KYYA 3SE4A 4AUYA 1S9WA 1HSBA 2PP9A 2R2HB 4Y9BA 2G60H 5D4IA 2R69L 1ICTA 4CUCA 2FHFA 3SHSA 5C0BB 2Z31A 4WEBL 5BVJB 5F0JB 4X4YA 2LLGA 4HUCA 1F0LA 2M83A 3DTXA 3G9VA 4Y4HB 5HGHA 1RD6A 2ICEC 2Q3AA 5IEKA 2CLRB 4ZUVA 1M7XA 4BZ2A 1Y0LA 5KYWA 2EYRB 3AS3A 3OXRA 3IDGB 1PX4A 2FDBP 2YQ2A 1IVTA 1MREH 2FL5A 2IF7A 2VKXA 3FU5A 1QA9A 2EVIA 1SDDA 3ZMRA 4HULB 5DEGB 2VM3A 2AVGA 2CHNA 4GJTB 1DUZB 4B6ZA 1S7TB 2R69A 1J8RA 2NLJB 5KSVA 1S78C 2ADJA 3BAXA 2HFTA 2OSYA 2EDHA 4RWHA 2PR9A 3GUTA 1YEEL 2Z65C 4RDQF 2DD8L 5EZLB 2YUVA 4MA1B 5LWYL 3WFHA 3RGVD 3BPNB 3T1WA 2OMXB 1ZTXL 5CD5D 3NIFB 3WHXB 1PZBA 2AEQL 2XZCL 3U4KA 3W9EB 5B8CB 3QDGD 1JHTB 3ZZ1A 4AZ8A 4MAYA 3NBNA 3MR9B 2AXFA 3FUFA 5LNGA 3INUL 4A7VA 4NFDA 1FZOA 3ILEA 2I26N 4ZMXA 3EADA 1XSOA 4LLQB 3U2JA 4GSDH 2WKOA 3Q5YA 5BO0D 4QRPD 1G6RB 1RZJH 4JRXE 4OLZL 2XQYA 4A55A 5ILTH 3EHBB 1EPFA 1UUNA 5FOJA 4N0FB 1D7CA 3HG5A 3QJZA 1FG2A 3B8SA 5J3HC 5TD4A 5DUJA 2VUKA 4HS8L 1MPAL 4OV6F 1WFOA 3O3UN 1FFRA 2VDOB 4WDIB 1TJGH 4GI8A 3T77A 3BVWA 4B7IA 1W8EA 2QSQA 3ENEA 2O6CA 3V52L 2YEQA 3ABZA 1IBGL 2J4WL 3C8DA 3HZ3A 4XX1E 3QZPA 5EIIA 1SXBA 1KGYE 2WCGA 3EZJB 4PB9L 4J3OD 1E4XH 2YSSA 3CBJB 5DQJB 1JNHB 3SY0B 3T8MA 2ICWB 3FQWA 5EF2A 2FQFA 3VWKB 3WGUB 1ZGLB 2WM0A 1M05A 1S7QB 1CLVA 3GSNL 5ALBL 5A2CA 3X1GA 3MCYA 3F7PC 2AXHA 4ES9A 2EE6A 4Z7UA 4Z7VA 1EJFA 4JFDB 4I48A 3A24A 2AJ3A 2X3BA 4UOZA 3HI5H 1GSMA 4FQXC 4PRIB 4MLSA 4HUWB 1ILSA 1R75A 4FNLH 1U8OB 1S7XB 5DJYA 3EBAA 3D52A 3NTCH 4KK6C 4U6YA 4GW5B 3S37H 4HHAA 1HTYA 4JM2F 2Z35A 4WEMB 2A6JB 1N68A 5GRZA 3W0WA 2YPVH 4L1DA 2HFFA 3GSNA 1RK1A 5GISL 2PTVA 5I24A 1AS6A 3ZKMD 4AI7A 2DQFB 4NI6A 3H7BA 1I8AA 4XB3A 3AUWB 3QCTH 3U7AA 2D0FA 5I2IA 2E7CA 3LKPA 4JLRB 2PYEA 4JJ5A 3KVDD 4YHOH 4KAQL 3BMVA 3D51A 4K3JH 4DGVL 2ITEA 3MV8B 4FFYH 1NA8A 3BPOB 1U2YA 1B4JH 5F88B 5DRNB 3E6HA 5BS0E 3QIWA 4LVNC 3MOAL 2CWRA 3O4LA 4F7PB 3ZN6A 4P06A 5DDHB 1O5DT 4PD4K 1T89C 1EXUA 2X4RB 5IOKA 4LSUL 4WO4B 4OCXH 1BEXA 2WMPB 2PPFA 3UTSA 4JKLA 5C0EB 4WSGA 3S35L 1GGIH 4C55A 3FT4B 4QHNB 4GG8A 3RWCB 1NGZA 4G11A 1QFUH 1OP9A 1WYJA 5F7MC 3GNMH 4XCEA 3ZE0E 4UMSA 4M29A 2XN9B 3SEPA 1A6VH 4PJHF 2H8PA 3NACH 3VG0H 3B6SB 3H3PL 4XMXA 2X89D 2E9JA 3QUMB 3W57A 2FO4B 1XAUA 1TT6A 2VLJE 4M7ZC 1XGZA 5J1AB 4OIBA 4Z5RA 3LN5B 4NO2B 2BNQB 2YLKA 1BGXL 4JKPH 5CSZA 1U8HB 3MV9D 1QRNA 2KZ1B 2GABA 1A7RH 2NYZA 3FZUD 5DS8B 1NLDL 3QDJB 3WS3A 5IFHL 1YN7B 4JKKA 3F62A 2BLFA 2J57A 5I30H 3KG5A 3V4VB 3MREB 4EBQH 3GJFH 5DJ0A 3S5LA 3VXNA 5KUKA 1OB0A 1S3KL 1WAAE 2BY0A 3IE4A 4HK3J 2ZCLH 4AE1A 3CSPA 4L8SC 1FORL 3VI3E 1VGKA 5JHDA 3BN9D 1PY0A 4OZFG 3WENA 4I89A 4TOYH 2YUWA 2Z6FA 1PZUB 2XTJD 5T1MB 4NUGH 1A02N 2HVJA 2ZSWA 4ELKA 5E4EC 4JBSA 2B5IC 3GKWL 1WCQA 5AOIA 1YEWA 3QG6A 3TX4A 4P57A 5BUAA 5EU7E 1SDYA 3QHZL 4PJ9B 1RZQA 4ZOAA 4RFEA 3BPCA 3NCBB 1NFDB 3BRGC 4HKBA 5I1KL 2VZTA 3VM5A 2FT8A 3VXRD 4D8OA 1SQMA 1FE8L 1XGTB 3MRPB 4APQC 1EK3A 1CFBA 4LP8A 1HEJC 1MJ7L 1CLZL 3HG4A 1CE1L 5DFTA 2JJSC 2VDQB 2BNRB 2H0PA 3P0YH 4JHAH 2CKBL 2YD2A 5IG7B 1QUNB 4TLSA 3CFEA 4JDZB 1ZSHA 2ED7A 1FC1A 2NY1C 3DETC 4XPFL 4HGKC 5DZJA 5JW3H 1UVQB 4KO5A 5FCSH 5IF0A 1S8DB 1FIGH 1R33A 4XP4H 2WY3B 1NAMB 3OKYA 2X4OA 3GSVA 5HHXL 3SE3A 1X4XA 2JIXA 1N0LA 3MROA 4X4MA 3WKNA 4AV0A 3N91A 5F96L 1SOKA 4KJQD 3AGVA 1R0AL 2VT0A 3HG1B 2Z4QB 4BFBD 4GAGL 5KG9B 3MLXL 1I1CA 5DZPA 3M45A 2O61B 5FF6A 4FKHA 4F92B 5JIPA 1D5BB 1MLBB 3V7AE 1E5BA 4TV3A 1SVZA 2ZPKL 1V7MH 3MBEB 2WJ7A 3H6AA 1EDHA 5AW3B 3Q9PA 4E41D 3TN0C 1NEZA 4P46A 3GMNA 5GZNC 3IJHB 3KPSB 4GAAA 3DWTA 4NBXB 2PYFA 2HN7B 1DDTA 5ID1A 3K46A 2IDCA 3WIIL 4C59B 3F83A 3BO8A 1WZ1H 4BGLA 2OP4H 3N41B 5IV2A 5D7IE 4L4VB 4QRQB 3ZLQC 3MX0B 1G7IB 1KNOA 1OT4A 2OAAA 1Q8MA 1AP2B 2LR4A 2AMUA 3TZVB 1V5JA 2D9QB 1O0VA 3WNJA 3GPEA 4FFWC 2ZOUA 4QF1B 2VLRE 1HK6A 1TKWA 3GMRB 3KHQA 2DM3A 3ZK0A 3AW5A 3GIZL 3OC5A 4LCYA 1K9TA 4ZXBB 3HE6D 3GXMA 4HD5A 3Q5OA 3L45A 2OS7A 2W9EL 1M7IA 4IDJL 1AZVA 3LNHA 5KBLA 1E9OB 5C2BL 3MDJA 2FCBA 4FI8A 1DJSA 5BUGA 1C5BH 4F9PC 4RZKA 1QYGL 1YEFH 4YOKA 5AVUB 4YDMA 4LXFA 4N24A 2YKLL 4L4TA 2HFGL 3WO4B 1BFTA 1N64H 4GKNB 3QXDB 4QKXB 5ICZB 4R0LA 1RKRA 3O3DA 4KVPA 1V3JA 5CHNB 3SDYL 2YS4A 4FG6D 4CNIA 3MJ9L 4PJEB 2IPUK 5D1XA 4DP8X 1S2EA 3K4DA 3N2JA 4CSZA 2OM5A 1V3KA 1JERA 4S0SD 3K4AA 5FGCE 2L7EA 3BUYA 3AREA 1JZ7A 1G5AA 2OCJA 4P23C 4JZOB 1BZDA 2X41A 2BOCB 3NCFB 3G6JE 5C08D 3IMTA 5FHBH 2YD6A 1MJJB 3VFVA 2CMRL 2W80C 2VDKL 1DVUA 5HJGA 2PTTA 5C09A 4M5ZL 1M7DA 1HDMA 1N70A 2Q0ZX 4P3DB 1N67A 3N40P 1K4CA 3MJ9A 3ZE2E 5EOQH 2BFVL 3IFOB 5C9KA 4OZHF 2E75C 2CPCA 4FFTA 1VCAA 3GC3A 3X1FA 1TVDA 5E8DL 3VU2A 4H1LH 1RZKC 3HI6L 1JK8A 1S7VA 4R9HA 1UXWB 1F11A 1GGUA 1MN4A 2OMYB 2VSMB 3E0GA 4FN0A 4K7PH 3CE1A 4WI0B 5ITFA 3IDXL 1SNRA 2CLRA 4OD3H 4OCRH 4FFVD 2HVBA 5KVDE 1LM8V 1NMBL 1E8YA 2GBAA 2ZAIA 1TENA 3NZUA 4CU7A 1A65A 4ZZFA 3P3RA 3B9DA 3PDOB 3VI4E 2DBJA 5HYSA 2RALA 4I0PA 1E0OB 4ONOA 1N6VA 3TURA 2DWDA 3X14A 5KBDA 3GTVA 1A9EB 4GSUA 4DO4A 35C8H 1HT6A 5D70H 3UCQA 2VN6A 1CD9B 4HJIA 1OTSD 3QEQB 4FXGB 3X17A 3GZKA 3VA2C 3LNFA 1RZ7L 1XHHA 2HH0H 1QPPA 2NSMA 4X98B 5FM5O 3ISRA 3EOAB 4HZAA 5PAZA 4AYFA 4JPIA 3CN1A 4PMEA 2DQDL 4ODTL 4P07A 1ZLVH 3U4AA 2DPKA 5DEZA 5F7UA 2J6EH 1MFEL 2Y1AA 4WY7L 5T1DL 4AXWA 3UPAA 1XIWB 4UQ3B 4X5XA 2B20A 1CI5A 5K9QI 1RV6X 2VQ1B 4GUPA 5HDWA 5CBEB 3LRLA 3RGVC 2HRGA 3COOA 1KFAL 3VXUA 5I6LA 4N0YL 5LKNA 5CD5C 3PHSA 4V1DA 3V95A 2J2ZB 1W0WB 3QPXH 5IMLA 4OJAA 5I73C 3TO4A 2EVGA 1H3VA 4WFFE 2HX9A 1PZ5A 1RJLA 5LQBL 4V2CB 3T0ED 3RVXD 1JN6A 1KTRL 1TQTA 1HAUA 1NGWA 4HAFA 1YEKH 4JQVA 3MBXH 4LLMA 1XGYH 1YMHA 4JRXB 3VJ6B 3RVWC 3L16A 1NGYA 1I9EA 4JFYA 2BPBA 4A39A 3RNKA 4ICWA 5CLTA 3FDWA 4JGJA 2GTQA 1ODUA 4F7EB 5BOPA 4IHBA 2EH7H 2XWBB 2C9VA 3FCSB 1KLUB 2YA1A 4RX4D 5GRYA 5AB2A 4DEPB 3T4AA 3MCKA 3QNFA 2XBTA 1FNSL 1JL8A 4DQAA 1BM7A 1BJ8A 1BQHG 1NCDH 2L7JA 2NMSA 5EBLA 1Q0XL 2XWCA 4HCIA 4BV1A 3TXAA 3Q1SL 2AZAA 1OPGH 2NNCA 5I18H 2H6UA 1SLVA 3VTMA 3LD8C 4HX1A 4Q52A 1A6AA 1WD9A 5DJCB 1AE6L 1CL7L 1W8OA 3H55A 2WCSA 4FQHB 4HBCL 2OYLA 4F24A 2JE8A 5DS1A 3ES6A 1AXSA 4J3OC 1GC1C 1U92A 3B5HA 1ZTXE 4YPGB 5IQ9B 4I18A 4BQ6A 3DMMA 3ETBJ 1MCWM 3WIFA 1DQJB 4JO1H 4NIYE 2IANA 2EUZA 4PREA 4JW3A 1SEBB 2ZOOA 3L2NA 3AXLB 1ZS2A 1KIUB 1LO3H 3EF4A 4EE2A 1A7PL 4LCUA 1LHZA 2I7OA 2H32H 1EANA 2BP8A 4HQQL 4PG9A 4UOQA 3SPCA 2FR4B 4AC2A 3VX0A 2YO3A 2ESVA 2F9BT 1MCBA 3LN9A 3EO9H 4GRWE 4XNQA 1NFIA 1IX2A 3CQQA 4TQEH 2NXYB 1DQQB 5IBUB 2V37A 4TRPL 1TVHB 2H9GB 4G6JH 3HPJA 4D0BB 2B3RA 5C0CA 4NP9A 2WBJD 4FMKA 1S7UB 3Q5TA 4DZBA 1DDHA 2RA1A 4IW4C 2I27N 5DRZB 4KITB 4NB7A 4QRSA 2OMUB 1ZA6B 1T1XA 4KHTH 1M56B 5FUZH 5D4JA 2CK0L 4TTGA 5CILH 4FQIH 1L7IH 2ICWJ 3QH3B 4P4RB 2AI0H 2BSDA 3BKJH 3PV7A 4NYLA 4FABH 3VXTA 1AHMA 3OTTA 1B9ZA 2BJMH 4MNHB 3O9WD 4UDUA 2ZKYA 4YBQD 4ZUTB 3AUVA 2G9HB 2L04A 3T6WA 3DX7A 5D2LB 3UTTA 5MHSE 1U8QA 1MFBH 2X40A 2DQHL 4HIJB 5BZWB 1XH2A 4GP5B 4AITA 2WWNA 3NFNA 4R8WL 5HGGS 3W0WE 4YGVB 5E9DA 1CDHA 1RZGB 3D4ZA 4YHNB 1O75A 2FBJL 2O6DA 3V4VL 3W9DB 3S9DB 1SF5A 3HAEG 1DQVA 3GLAA 3BHBA 1C12B 3BH4A 4OSUL 3GSWB 4YBLB 1JYXA 3BT2H 3UBGA 1BZOA 4BFKA 3ZBMA 2ZUYA 4PHXA 4PGCA 3HVDA 4G8IA 1N5YH 3ULUH 5IBTL 5KAQF 2O72A 1L9NA 3BFOA 4LPTA 2VLJB 3IPBA 4W81A 4X9GA 3L7EB 1I7RA 1IGCL 1BAGA 2P43B 4KH9A 3O4LE 1F1DA 4LCCC 3SDDA 2O6EA 1VFBB 1ZK5A 3FO2A 4Y4FB 2A2QT 1OD9A 1YN7A 1A7OH 2GJ6D 5DI8A 3VXMB 1M6UA 1JF5A 3O4OC 3TEYA 4LHUA 1KYFA 2UZXB 3FPXA 3QJHA 3DUUB 4D0DA 1U42A 1TMQA 1SYVB 4Q4IA 3UTSE 1VGEL 4J3VA 1PSKH 1B90A 4QXWA 1OP5H 3V55A 3VX1A 5CR8A 3OB0K 4D9QE 3O3EA 3HMXA 3RWGA 4ORGA 3CVCA 1NBYB 1JPST 3NCMA 4GLRI 4WU7B 3AY4C 4PGBB 3HR6A 3RQ3A 1K4DA 4PBVC 2Q86A 4BDVB 2BS8A 4P3CL 1W0YT 3F04A 3FQTA 1OCCB 2AK4D 3I9GL 2RQEA 5EC1B 4XP9H 4Y2DB 1QNZH 4KUZH 2V4LA 4JFXB 3X11A 1QRNE 3BEWA 3BN9C 5D7LD 1O7DC 3FT3A 1BD2D 2VDRL 2AABL 3MRIB 2QHRH 2QFPA 1M1XB 4KMLB 5FGRA 2EIBA 2CO7A 4PJGF 3KPNA 2A74B 3B2PA 4J3WA 3BUPA 2P28B 4PGDA 2GSIB 3QQ4B 2CK2A 3F00A 4AMKL 4E36A 1UXSB 4TNFA 2WXGA 3R19A 4HUXA 4JRYD 1WFJA 1JNLH 2HXAA 2VW7A 3AWFA 1ETZB 5EBWB 2F54B 2W9DH 4FHJA 5AW9B 3L3GB 3EFFB 3HRZB 2QLYA 1QEWA 4W9CC 5BRZB 2XICA 5MI0C 1MCHA 4PJ8D 3UGUA 3IDYC 2DLGA 4NCDA 1WFTA 2BSTA 2ZXQA 4S11A 5JHDE 4WKZB 3MRNA 1YQVL 1HVXA 1DBJH 1QO3B 3GMMB 4OT1H 1RIHL