2Z7ZA

Crystal structure of h2o2 treated cu,zn-sod
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of H2O2-treated Cu,Zn-superoxide dismutase
rcsb
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 33
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2z7zA00
3GQFA 2WKOA 1HL5A 1E9QB 2WWNA 1N18A 1UXMA 2C9UA 3H2PA 1XSOA 2ZKYA 1EQWA 1EJ8A 1F1DA 1BA9A 1JK9A 2VR8A 1B4TA 2GBVA 3GTTA 2AQPA 3HW7A 2ZKWA 2Z7UA 2AQTA 1CBJA 4OJAA 1S4IA 2K4WA 1Z9PA 3CE1A 2APSA 3ECUA 1L3NA 5KBMA 3L9YA 2WYZA 1U3NA 1SDAB 2Z7YA 2SODB 3L9EA 1CB4A 3GZQA 1N19A 3S0PA 2LU5A 3KH3A 2WZ0A 1IB5A 2GBTA 3MKGA 4A7SA 1SXBA 1B4LA 1XTLA 1ESOA 1YAZA 3LTVA 1TO4A 3GZPA 3SODB 3H2QA 4BD4A 3QQDB 1OZUA 1E9PA 3PU7A 3ECWA 2AEOA 1PU0A 2Z7ZA 3T5WA 4A7QA 2JLPA 1RK7A 3KH4A 1F1AA 2AQNA 4A7TA 1HL4A 1OZTG 3ECVA 2C9SA 2WYTA 4BCZA 1UXLA 2E46A 1QUPA 2XJKA 1IBBA 3KM2A 3HFFA 1E9QA 1E9PB 2JCWA 1DO5A 1SXAA 2AQQA 3QQDA 1E9OB 1SPDA 3HOGA 1SOSA 1SRDA 1COBA 3KM1A 2WZ6A 5CU9A 3MNDA 2VR6A 1SXZA 1F1GA 2WKOF 3K91A 1XTMA 2NNXA 4N3UA 1AZVA 1IBDA 4BCYA 5KBLA 4A7VA 1BZOA 2C9VA 3F7LA 3CQPA 4A7UA 1IBFA 2E47A 3F7KA 1YSOA 1SDYA 2ZKXA 1DSWA 1JCVA 2ZOWA 2VR7A 2Q2LA 3CQQA 1Q0EA 2WWOA 3KBEA 1KMGA 1Z9NA 1FUNA 4MCNA 1OEZW 1SXSA 1PZSA 2GBUA 2AQSA 2Z7WA 2AF2A 1OAJA 1P1VA 4A7GA 4N3TA 4U4IA 4A7GF 1MFMA 2AQRA 1SXCA 1E9OA 3KBFA 4FF9A 4MCMA 1F18A 2XJLA 3RE0A 1JK9B 2V0AA 2R27A 4B3EA 1SXNA 1YAIA 4L05A 4OH2A 2WZ5A 1IBHA 1TO5A 1OALA 1PTZA 3GTVA 3GZOA 5KBKA
chains in the Genus database with same CATH superfamily
5ESQB 2ITCA 4K7FB 2YGOA 3GQFA 3I6LD 5CJXA 2XBDA 3FB6B 3FTSA 1LHZA 1M1XB 3IDUA 4G8IB 3RNQA 4OB5H 4P5KA 1G9NL 4WU5B 2EYSB 1U8IB 4KKBD 4HWZB 4YHIA 1SBSL 4N1HB 5LNEA 3VYOA 3D85A 1GJWA 2HFFA 3IMUA 5ADOH 1V27A 4JMXA 1D5XA 1OGAE 2A4ZA 4J2QA 3BVNB 5EPMA 4W4OC 3UZEC 5JXAH 1SXBA 1TJXA 4XODA 4F7MA 2DH3A 1ZLVK 1QNZL 2J20A 1NBVH 4YVUA 1TMCB 2CDFB 2EINB 4LFHD 4QHMA 1XF2A 3B3IB 4F8QA 3P3RA 3C08L 3CX2A 4IS6B 5F96L 5F0PB 3LZLA 4PWKA 1N3NA 1MPAH 2ALAA 3FW6A 4TTDD 4LCUB 1IGYB 4XXCC 3LNFA 3L16A 5D70H 3OR6A 3ZYIA 1R5IA 3HFML 3MRDA 3W39A 3RZCD 1YLBB 1WICA 5KVFH 2ATKA 2OTPA 3WEXB 3QG6B 1VZGA 4AJWA 2R7EB 3D0AA 4PTTB 1AFVL 1DLHB 2XWRA 3L81A 1JYWA 3QO1A 3WAKA 4PJGB 1I7TB 1E40A 1U91B 4LF3B 4OJDH 3LKSB 3PAVA 3PS6A 1X5GA 3FONB 2WCSA 4KX9A 5DZJA 3V8CA 1MRDH 3EH1A 5TDPB 1A1OB 2H1LM 4XNQB 1LO5A 1LNUB 2AV7A 4DP1X 2GJRA 5TQ2L 2IAMC 3OSKA 4NKOB 3TN0D 4ENEC 1G7IB 1VCAA 2HUHA 1NCAH 4ODVH 4R96A 1ZE3C 5EBLB 2B59A 3C6EA 4XBEH 3QJHA 3GSOB 3F7KA 1GYCA 3O8XB 1K5WA 5DJDA 1YPZB 3GSUB 4I9WD 2BP3A 2Z0UA 2DMGA 4NQSA 2QVFB 3G6JE 3ULAB 2FO1A 3LKQB 1KIPA 1MI5E 3T09A 3VXNA 2QQNH 2NY1D 3LXAA 2WHVA 5GGTA 4X80H 1GSKA 4ZFOB 5KYNA 2RCSH 4KU1A 4JFVA 5CILL 2MOQA 4GRWH 1KPVA 2C1PB 5DHMC 5FPIA 3QJZA 5JHAA 4F3FA 4X7DC 1NANI 3LZFH 4QJ4B 3VFUA 2DRUA 2BC4A 4NO0B 2APFA 1DVTA 3P4OB 3JWDL 3ARGD 4X9GA 1MHPH 5J06A 5DWPA 2EXWC 2V2XB 5C07E 3QIUC 4JRYD 5EU6E 3TH2T 5SWQB 5E6ID 4H26B 2VC2B 4ETQB 1MJ7L 1VFBA 4IU2B 3L8QA 5CD5D 5K9KB 1CD8A 3NSCA 2IH3B 4WKZA 5K39B 1KEGL 2LT9A 3CDGB 4MWFA 3K71A 3QB7C 2UXFA 1HK6A 4S1DD 3CZJA 2GSIB 1X44A 4X6BA 4CMMB 4PCKA 3SIKA 3TTYA 3CPUA 5MEND 1UCTA 3L9EA 3GZQA 1RUKH 1J9TA 2PKDA 4TUJA 2P48B 3KPNA 3KLLA 4XH2B 1JV2B 3D25B 2A74B 2AXFB 2A1WH 3IEAA 2P5WB 4MQ7B 1IAKA 4WO0A 3T5WA 3WL9A 1WIUA 4LLUA 3IF1B 1G4MA 4P23C 5HY9A 3STLB 4N0FB 3P73B 5IB2A 1A6ZB 2P5EE 3F58L 5AOJA 4BEIA 1KGWA 1X5YA 2XQYA 3MJ7A 5JW4Q 1BD2D 4P5KB 1JIBA 2NY4B 3GIVA 4FKHA 4PR5B 4R3SA 3QWOB 4I3SH 1BMZA 4KDVA 1IQWH 5TTRA 5F0MB 3ULUL 2P80D 2RHEA 2ZCLL 2CUMA 5AB2A 5I6XC 4DVRH 3FB5A 3O3AA 3ZDXF 1W0WA 4J1UB 4LHUA 3VH8B 5KVGE 4X9FA 3U4KA 5JIPA 1WD8A 4PJBA 3HPJA 4LVNC 5KS9F 3QPQD 1UM5H 4GP4B 5TK2A 5DGQA 1LDPH 5JIKA 2LFGA 2I7OA 4U1JB 5D1QD 4FQLL 4UQDA 1I8KA 2EDRA 2P8LA 4HUCA 3X1BA 4R7NA 4O5LH 1CXKA 1UWYA 5ENWA 3E9TA 3TCXA 1U8QA 1U2HA 1QABA 1S5IL 1XAUA 2YRPA 3BUYA 4WFED 9CGTA 2JB6B 3GJFH 1OAJA 3KPTA 3GSWB 5I2IB 3BZ4A 5CN1A 1SGKA 1GCFA 3RZCA 4ZQTA 4XMLL 4PGBB 4TULL 4GG6B 1NUFA 4Q9RL 3T0DA 2CGRH 4L8SB 4HC1A 3DOSB 4J3SA 3WIFA 3UYPB 5KBKA 1CT8A 5CD5C 1LNUA 2AV7B 2ORBH 2OTWB 3HC0B 5IEHA 2VR9A 1FZMB 1HEZA 1NOFA 2ZUYA 4HAKA 3SPCA 3S5YA 4GIPD 2DWDA 4ZO6A 4ZD3L 3AWFA 1UA6H 2Q3XA 1YNTB 2HRGA 4FP8L 3GS0A 4BKTC 4DGYH 3KZ8A 4FTVB 5IB4A 2DYPB 4ODSL 2AQTA 4GKLA 5HVFB 3LMJH 5BRZB 2VITB 3KYOA 2NXZC 3ETTA 5HYJE 3IMWA 1ETZA 1QEWB 3CNKA 4OFKA 2GJ6A 4C56D 2UZXB 4MBOA 3OJDB 4R4FH 2EP6A 2YMXH 4U1KB 4YHIB 2BINA 3FT2A 4GSXA 4UV4L 5MEPA 2IF7A 5KOVC 4WF7A 5CCJA 2DIEA 3Q7JA 1TYEB 3RUGF 4N6QA 3S3SA 5E8EB 4OJYA 1SHSA 4LSDA 5EBWA 4JPWH 3AACA 3TZVC 3IDNB 5A7EA 2G3ZA 5KBDA 1K5NA 3U7AA 4PV8B 2D7NA 4W70A 4X2UA 2FDBP 4A55A 4Z3FA 3VRIA 4X6FA 1MWAB 4XVTL 2AJXH 1A7NL 4TSCH 1A7PH 1E9QA 3ZMEA 4IOIA 2K6ZA 3QCVH 4RGMB 3W38A 2EKJA 2FAUA 1UM5L 2Z4TA 3B8YA 4HKBB 1UACL 4FG6D 1L5GB 2AXHA 4JMNA 1S7SB 3F7YB 1BZ7B 4JY5L 2ZUSA 3PWJB 4Z9KB 4QJ5B 1M1XA 4YPJA 3FT3B 1DVFC 1SM3L 3IJSB 2FX9L 4C56A 2JCCA 4HQQH 1J8HE 1NEPA 4K2UL 4AQ8C 3DMMB 2OZ4A 4G71B 4ZYKB 3F7LA 3VFRB 5KVFL 3C5SB 4M6MH 2YQGA 3I9IA 3BRFA 2XU9A 3ZIYA 2CBMA 3MACL 5EULV 1ADQA 2HKHL 5G4MA 3ZJAA 4LCIL 4XNZC 1KYOK 3LQZB 2WWMC 1FUNA 2VC2L 1JGDB 1YJDH 3FTXA 1D5MB 5EOTB 2B59B 1LEGB 1WFJA 4J3BA 2R8SL 3OD3A 4IU3B 3H1ZA 2H32A 3PWPA 5AUMB 4YS4A 4ZDHA 1QFWH 4RWYL 4ZX4A 3WN5C 2VDKH 5JTWA 4N9GB 1H6TA 3I6GA 4KZDL 5D1ZI 4AYFB 4AZ8B 2E7DA 1XO8A 2X3AA 3U0PA 4NRZA 2XIDA 3FB5B 4YSQA 3FQRA 1PEWA 1JI2A 3MJ8A 3W0WE 4AQ1C 5HGHB 3BX7C 1JNJA 2F9BT 2J8UA 5TFSH 1WWBX 4M3KB 3V0VB 1E5YA 5E5MA 1RPKA 1JPGA 3UMNA 3EJUA 3D51A 1JWSB 3HI1A 2G5BA 3IS0X 4MS6A 2KS0A 2E4TA 4K9EH 4YDMA 3M07A 5DHVH 4Z7WF 2QVKA 4Y19B 2AJXL 2NSXA 1JFQH 1P4IL 2YKKA 4HKZB 2BJML 3B9VA 1IEHA 5LGJA 3LZPA 2DIBA 3PWVB 2GC7C 1I85C 1QSFB 2HX8A 5EIIG 2EVGA 1WBYA 3BUPA 2AJZA 2YD2A 3IGUA 3CFKB 1TTGA 3E3QE 4LSQH 1A6WH 1DE4A 2WLLB 3SOTA 3EOTH 4PVLA 5IW6B 5DSCB 1QSVA 3IB4A 4PMFA 2O61A 3RNQB 2C7UB 4OLWL 4PCSA 2A7BA 5I24A 4N5EC 3HG1E 4LNRB 5EU3A 2OK0H 5IW1A 3Q2NA 4JFWA 4HOWA 3NVQA 5D8JL 5DA0B 3SDCD 3C60A 3U82B 3LNDA 4Y5VA 3CVIL 4N5ED 2P5WA 3D09A 5J13B 3TNNB 3GXNA 3CHRA 4MA1C 4Y88A 5C92A 4DNLA 4PW9A 5C0IB 5IFHL 1GR7A 3FBKA 3WS3B 5B3NA 1N8ZB 4NJ9H 1F4YH 1S3KH 2EDTA 1G7PA 3FOMA 4F7MB 1YEGL 5BQDA 1AD9B 1KTCA 1FIEA 3U36B 5CLYA 4Z5RB 3CK0H 5DGRA 3G08A 4NKIL 3TM6A 5JHDB 2CUAA 3EJYD 3WTWA 1IGCH 25C8H 1M05B 2G5RA 4KFZC 3HC3H 5LGKA 1CG9A 3Q3GB 4H1LA 4UQ3A 1WBZB 5FOBA 1GOGA 1D9KB 4UT9L 2E74C 4XZUB 1AFVH 1HYSD 1S7RB 3JUYA 1NBYA 4GRWE 3GRWH 3M1OA 4J6RH 5GZOD 5TD4A 3MU3A 5J9PB 5CLWA 4I87A 4I3GA 4MLIA 5CN3A 1P2CA 3QP3A 4R5XA 5BNXD 3H85A 3V5DB 3ZTDC 3CLWA 2IADB 4GW1A 3EYFB 1JHKH 2LLGA 1M3JA 1PD0A 4OCYH 4ZFZA 1I9EA 5C0GA 3EOAA 3TJEL 4GSUA 3WMQA 3L1EA 4W9FC 5TGBB 2UXTA 5HI5D 5FO2A 2X4SB 1UD5A 3MV7E 2FHFA 2BSRA 1QTYT 2JE8A 3L3JB 2IMMA 2VDPH 4RAVB 1SLWA 1X5MA 3EOBA 3D69A 4M6NL 4XP9H 3SCMC 2FWOB 3HC3L 1CCZA 3MLVL 4XO8A 3V4UH 1BZ9B 3AREB 1AKJA 4XNYH 3BKJL 1G7JA 1E42A 2DQCL 5KUKA 3WSQL 5EF1A 5I6XB 1CMOA 1EX0A 1I9IL 4OKVB 3Q8CA 1AS6A 1CLVA 3VB8A 2BW5A 5CP7A 2QQKH 3ZTEA 1PG7H 2VLJD 2KMWA 2D8KA 4MNGA 3C6SA 4LDEB 1KYAA 2MCPL 1DSFL 2W5PA 2ADJB 2Z92B 2G2NA 4M1CD 4HWNA 1RHHB 4TUOB 4OCYL 3V5HA 2Y7QB 5F7AA 3V4VL 1RSYA 3FPYA 5SWSE 5AW5B 2OK0L 1EXUB 2V17H 2SEBA 4RGNE 3AU1A 5DQJA 1AG6A 2XWJA 3KPQA 1PIGA 4AKQA 3S88L 4NAQA 1AGCA 4QHUB 3QZPA 3OLEA 3H7BA 2WXNA 4JFFA 1K3IA 4F58H 1P69B 2FEEI 4RDBA 5IMKA 1PSKL 2A6IB 3I3BA 1W8OA 3CH1A 2UWEB 2I9TB 3MJ9L 1PDKB 5MERB 3KM2A 3K71B 4FXGC 4PGBA 3QDMB 2P7TA 1BF5A 1UD6A 1G0YR 4Z7IA 1MZYA 4PYHA 3IJ7A 5KAQG 3C5ZA 4ZSOE 1QW8A 3ZLQC 3BAEL 4G5ZH 1JZGA 1QBAA 1T22A 3RWCA 2QBWA 2MJWA 1ZXKA 5EO1A 2V2WA 5DQDL 4KI5F 1K8DB 3N40F 4UYQA 1IKOP 4PJIA 3MREA 4HSQA 1HHHA 5AW4B 3Q2CA 4D7BA 5IJVB 1IJ9A 5I8CB 3BT2L 1CDHA 1BBDH 4HS6B 1KZQA 4PG2A 4U1HB 4YHLH 3CQQA 5GRWA 5L2KB 1NC2B 4PJ8B 2DN7A 2F6AA 2Y7MA 4MZ2A 3DX4A 1MCKA 4XHJD 3MKKA 2E6PA 3C5SA 4OCXH 5FM5O 2W9LA 3SDAA 1J1OH 2ZUUA 4LSTH 2WLMA 4ZRGA 3IMSA 4WWPA 5BZWB 3AU0A 3PJNA 3U46A 5ILTL 1KXTA 1FO0H 2J1ZA 1DN0B 4BZ2H 1D5MA 2JI1A 5EOTA 3RBSA 1KB9J 4KNTA 3ZKMD 4WFGE 4EUPA 4MVBC 1MCOL 1BBJA 5I1HH 3UBXA 2Y7SA 3RA7L 3SGEI 2QEJA 3BVDB 3LKRA 4X6CA 5LBSH 5ISZD 5F9WB 4G9FE 1GC1H 1E9QB 1ZLWH 1NCIA 2WWNA 4MKMA 4L1SA 3JSSA 4CVZB 1BZ8A 2DV6A 3KGRA 1AR2A 3QAZB 3FCGA 3TBTB 4NXKA 4IGBA 3BXNB 1BXVA 3S6CA 4AQEA 1S7TB 1JK8B 1SY6H 1IE4A 4W9CC 4F1ZA 3U0TB 3C5JA 3P9LB 5C0AB 4NAJA 5BRZA 2J71A 5I6LA 1ZS2A 5DVKA 5C0CB 1KBVA 3TA3B 2WTPA 1OF2A 4NDMA 3CC5B 2WZ0A 5D70L 5E8DL 2NZ9C 1I3GH 3M1CA 1M71A 3GHBL 5KUMA 1J1XH 3HMWL 3BHBB 1PAZA 4F7EB 1XGUA 5JPMB 4LPTA 3ARSA 4UOW0 2CNZA 1NAMA 2K78A 2OZ4H 3QO0B 4P5TD 4PS4L 2BS71 3FFCD 1CT8B 2ZUVA 1CFSB 2XPGB 1MHEB 4PTUA 2HRPH 1M42A 4JHBA 4M4PA 1EVUA 5EZOL 1EO7A 1PX4A 1QA9B 1ZSDB 2AJZB 1WS7A 3IDNA 4MD5B 4ACTA 4BFOA 4R4BB 2DOCA 3EYQD 3GSVB 5DD6A 1BBDL 4ZDHB 3S96B 4LIQH 2YA1A 4L8CA 3G6DH 1Q1JL 1ETA1 5HGDB 5IQNA 4ZG1A 4AZ8A 1KB5L 5F7DA 3KPPB 4RQQB 2CIKB 2P1YA 4KMTH 3QQDA 4DW2H 1IL1B 1A0QH 3HG5A 4KK6D 4X99A 3L3IB 5EU3B 3WTVA 3L5XH 1DQLL 2D31A 4M8RA 3TF4A 1HH9A 5T3ZD 2DI7A 2VDRH 3QWNA 1G1OA 2CHZA 5FO8A 3UYRL 3RDTA 2P8MB 1QHQA 2EYRA 1JPGB 1GZPB 1X5XA 2W59A 1A7QH 3GM0A 4KXCA 4NQDA 5ERWA 4AX3A 3BYTA 1OM3H 4HUKB 3O41A 3NMEA 2E7LC 5H4ZA 1KBKA 4LPVA 4XRCA 4N2LA 3S3DB 3MRQA 2G3NA 4LP8A 1S9KC 1S7QA 5GGVY 4QEGA 5I30H 3V4PH 3U30B 5HHPA 1BQHG 2WOYA 5F7UA 4U6XA 4BA0A 4J23A 3VVWA 5GS1A 4NQCE 4PRIA 5M7QA 4DZBB 2WN3A 2F1AA 4AWJC 1DJZA 1J9SA 1XD1A 2AF2A 1KULA 1CFVH 4GRLA 2VWEC 1CVRA 3P4MB 2V7NB 4PGCB 4IRSD 4LPUA 1BJ1H 4PRDA 2QSVA 2X4RB 4XOCA 4YR6B 2A77L 5FKPB 4A37A 4GAYB 5E2JA 1A4AA 3KJ4C 3RVTC 1TNNA 2AGJL 2BNQD 3CFBA 1AP2A 4HBCL 4KPHL 1AE6L 1T6VN 1ZPUA 2X4QB 3BH8B 3B8SA 3EADA 4MDIB 4K7PL 2HB0A 3FT4B 3VFRA 4GW4B 4YHZL 2QADB 1ZPLA 2OBGA 2WPGA 5DJZA 5TE7H 1F3DH 3L4CA 3O2DL 1DJIA 2DWSA 4KQ3L 2AV1A 4G7VH 3S4SB 1JZ8A 4FCHA 1RY7B 1EJ8A 3EFFB 4GAFB 4IK6A 4NNPL 3CSTA 1OAQH 1PKQE 3KDMA 4JFED 2HP4A 2E9WA 3VFPA 4YGAB 3UTSB 1TKWB 1SF5A 1AD9A 4HUXA 3D0VB 3DX3A 4LKXB 3RGVB 3S34L 4Z78B 1J05A 1S4IA 1QLRA 3JBG7 1ZTXH 1N6UA 2EICA 2KLTA 4WNJA 2X6VA 1WE5A 5E9DD 1BG1A 4LSPL 2EIEA 1KENL 2UYLA 3SOBL 4M5ZL 5HVWA 3FFCA 3CZEA 3O6LL 5HI3D 5I0XA 2R56L 4Y4KD 3HJEA 5SWZA 1FGNH 1T5WB 3K4DA 3C6SB 3TA3D 1PU0A 2QT6A 5SWZE 2PCXA 3FN3A 2R2BB 1IT9L 1DVQA 1DQTA 2ZX6A 2IQAA 3LDBB 3B9KD 3CN1A 3P2BA 4CADB 2IPUG 4I8DA 4WDIB 5DEFA 5DUBB 5IUSA 2XPYA 5DQJB 2I85A 2CR3A 4FTDA 2ZNWA 2VN4A 3AB0C 1Z0MA 1UM6L 5GRXG 3UEQA 4X98B 2YUZA 4WSJA 2BNRB 3JWOL 1PBYA 4OLXH 4WQOA 5C08D 3FCTA 5C0FB 4P23D 4PJ5A 2UWEA 4OF0A 5CU9A 3U2SB 1UB6A 5ANMB 3DJZA 4OLUL 5GJTL 3FU5A 5BMFH 3MV7B 2MQCA 3PWUA 1BG9A 5DR5L 1CG9B 1Y6MR 4IIQC 4XCNA 4NQED 3UZQA 4EN3D 1HHGB 3WAJA 3C09B 3FO9A 1KIRA 1JZDC 1BM3L 5HJBA 1FVEB 3ARED 1SLUA 5KAQF 1ODAA 3PXLA 4HIJA 1G7QA 1X4ZA 4LDLB 5CKAA 4MXQC 4H88L 1HNGA 3IU3A 3B2DC 4JCMA 3BW9B 4XC3L 4CJ1A 1QPKA 2B4CC 3D2TA 4EVNA 4HHGA 1IAMA 3QPQC 1GGUA 4MRCA 3KWXA 5DC4B 2PWGA 3KPSE 1FJ1A 3QAQA 2VN5A 2BY0A 5CBAB 5C0GB 5T8IA 4WI7A 3DVIA 2G60L 4JHVA 5JHDA 4YK4C 3RVTD 1F0LA 2QSQA 4JR9L 2AJSL 4LOUD 4CNIB 2F19L 3Q6FA 3CUPB 2HLAA 4GG8B 3VFMB 2APWA 3WHE1 2UY6A 1HZHH 2F7QA 4MNGE 2EYRB 5BRZD 3U9UA 5GISL 2EVHA 4PJGA 2CO1A 5BZWA 2OMUB 3MTRA 2HT4C 1Q9KB 4GSDH 2ZYHA 4HIXL 3LS5L 5JO5B 1JAEA 1NM4A 2Y72A 4HOXA 3C5ZB 1A8JH 5DJ0B 3TBVB 2EVIA 1X7QB 5G4OA 4ERSH 1SN5A 4MTMA 2WXQA 5JHDD 4MMXC 2RJMA 1Z9PA 1OVZA 1BQSA 3B34A 1N6VA 2V9QA 1UM6H 3OLIA 5HHQA 4M7ZB 1MREH 5JHLH 1H6UA 1Q0YL 2OL3L 3O4OC 2LU5A 5T3XE 1GS6X 3S3PA 1TO4A 3GSUA 4Z7VF 3C5JB 4LU5H 4L3CB 3RWJA 1YQVH 3V9CA 5C0NC 2Q0ZX 4HUMB 4KK5D 4N20A 1HHJA 2XKNA 1ZVSA 4KNUA 2HFEA 2C3HA 4KQ4H 5CJBA 1NGWA 3X3FH 5C97A 3BHBA 4KK5C 5T33H 1NAMB 3KYAA 3OR7A 2GBAA 4U1SA 4OZIB 5KYUA 2H8PA 1QBLL 4Z1PA 4ZUTA 4Z7OB 1VGEL 3T2OA 3TTSA 2H7WA 5IVOA 3H4FA 2F68X 4HCGA 4LOUC 4ZPVB 3NSDA 4MD5A 3TS8A 2GT9A 2A9MH 4KROD 1WCQA 4QY8B 1JZFA 3MRIB 3PDDA 1FCGA 1I9JH 4H26A 4OJCA 5ID1A 4L8CB 4MAYB 5IROC 3EKCA 3V4UL 2PYED 2VE6B 4Y19E 4EUPH 4HOMA 4G6FD 1BVKB 5GGRA 2YO3A 2COVD 4WVRA 4JFYA 1RMFL 5HDQH 1LE5A 2FR4B 4HAGA 5E08L 3D9AL 4E41D 3VACA 4WO4A 2NY0C 4MQTB 4TSBL 4A7UA 2Z8WC 1H8LA 2Q76A 3FT9A 2AI0H 3TA3A 1WA0X 1P1ZB 1IT9H 4W6YB 2JJSA 4FFZA 4PP1D 4JFFD 4O51A 5JPMC 1Z9NA 5C0RL 2FBJL 2WXLA 2B3IA 2RA1A 4FKEA 2WP3O 1VLXA 3FONA 3VXUE 2AEPL 1FNSH 4K4KA 4RMWA 3P0GB 3QI9B 4KKLD 4LQFH 5IHUL 1OGTB 1YEKL 2XWZA 5C9KA 2XTJC 3L08A 1BD2A 4NGHH 4A04A 1INDH 1G7IA 4R96B 1R47A 3MNWB 5IESL 3MJ7B 1I8MA 4PRIB 3T8MA 2DLTA 2J4WH 3NCYS 1HHHB 2VZ3A 2WUBH 1JSYA 1BIHA 1GRWA 1UWGL 3GSNB 1T20B 2OXHB 2CO7A 4OT1H 1WWAX 3MLZL 3SKJH 2JKNA 5F7DB 2QJDA 3GINA 1HHKA 1BGXL 3O3DA 1PG7X 4P2QB 4JY5H 2Q86B 5F93C 2PP9A 4OLYL 4J1UA 1J8HB 4LHUB 4BGLA 1UA3A 1TCRB 2J5WA 1QW9A 1WFNA 4WI0A 1DVFB 2BOCB 1DLHA 4C4UA 4RMQA 4HH8A 4WNSA 2P24B 2Y23A 4FXLA 4YBHA 2XBTA 2Z7YA 3QEGH 3ZPDA 5MENA 3SE9L 3A6OA 2WOBA 3N1PC 5ALBL 3MXVL 3MKGA 3S0PA 2BVYA 3SD2A 4D0BB 5KTEL 1MFBH 1VB9A 4I0KA 3FO0L 3PG2A 2YD7A 1LO3L 1YEKH 4OY9A 4AXWB 2OS7A 4L1BA 3FSAA 1NEUA 2OPCA 1R3JB 2QLYA 4Y2DA 2IALA 4PI0A 2H9GB 1J9QA 4HS8L 3VH8A 1JK8A 3AY4C 4HJJH 3RPBA 1NCTA 2H3NA 1TLMA 4NWTL 3PGDA 4ELDA 3RDTD 1L9QA 3BAWA 5C2BH 3G5XA 3UAFA 1NM9A 3HE7D 3T2LA 1JCKA 1R0AH 2IQAB 2EYSA 3KW8A 5ANME 3KPMA 1J5IA 4LVNB 3C2AH 5C0ND 3LRSA 4NQCA 3WLWD 1QTSA 4AGNA 1VGKA 3ABKB 4S11A 3EGXB 2VLMD 2J8UE 3AXIA 4UTBA 4R8WH 5DJ8B 1F1GA 5FF6B 4HH9A 3MNZA 2DYPA 2J4WL 2XVBA 3FRUB 4TTGA 3UTSA 4W9IC 4JM2F 2IOOA 1NH6A 2NY0D 3OG4B 4DN3H 1HZKA 1MCOH 2G5UA 3GI8L 3MLWL 3Q0HA 3FUJA 1FA4A 3NA9H 3QEHA 2FQFA 4J8QA 4E0RB 4ZMZA 4P2RA 3QDGA 3EFDL 4I1NB 3AAZB 1FN4A 1U41A 1UUSA 3RVXC 4ZNEA 3MV9E 3Q44A 4ZJ9A 4CVXA 1EGJL 2CUHA 4OM0L 3R4DA 1NGQL 3SY0A 5E9DB 3ME0B 4H0HB 2I9LA 5IMMB 2QFRA 5I82A 2VUYA 4OCRL 1G7QB 5FKPA 5KVDE 3MR9A 4GW5B 4NFDA 3RIAF 2YD6A 1KLGB 2ICWJ 3BW9A 3V0EA 3WNMA 4AQOA 2WQSA 5KSBA 2Z34A 4EBQL 3TYGL 4BYHA 5TDOB 3U7YH 1JYNA 1U42A 2K8QA 1QLFB 4JB9H 3IKCA 1CTNA 4ZPTB 2DL9A 3ABZA 4FNLL 2QR0B 3ASNB 4Z7WB 3UPRA 2XWEA 4IQHA 4NIKB 5JZ7D 3JTBA 4N8VB 2CHXA 4JE4B 3K1KC 2CRYA 2J6EH 5IY5B 3O3EA 1O6VA 1VGEH 2QGBA 3DRQB 1ZWIB 1UT9A 1XD0A 4X8JB 2BIPA 3N0AA 3VWKB 1QO3B 2D4FA 4YHOL 1RVFL 3QFJA 4UT9A 1ESOA 3ZOAA 3TIDB 2I27N 1RZIA 4G7RB 3GSQA 3GFUA 3NDZE 4AYMC 2UWEE 2XQBH 2R2HB 5CILH 2XZAL 4HK3N 3IWUA 3NZHL 2CE6A 4DQAA 3K4AA 2XX0A 2E7CA 4OZHA 4HKBA 1PL3A 4GG6F 3E0GA 4EI5A 1C7SA 1UEMA 2DMCA 4EN2A 2ZOKB 4RBPH 3VD9A 3DETD 1YYLH 3FU7B 3DLQR 3QQ3B 2YAQA 3QNXA 3NSXA 5C09E 3O2VH 4ZTPL 1G1CA 1QLRB 4I1RA 2ZWYA 4M48H 3G5ZB 1AQHA 3O6FB 4AG4L 5ID0B 2XA3A 3H3PH 3J2PA 4KMQA 1BOGB 1GZQB 3MRHA 4NNYA 2UY6B 3MRCA 5AYQA 1CXLA 5HP5A 4MNQA 1JL8A 1FE8L 4PD4J 4F20A 5I71C 3HN8A 2AKRA 4NXSA 1RIVH 2NW2B 3KVDD 4D0CA 1HDMB 3WNJA 3KL3A 1J0IA 4JM2A 3IFOB 1CIUA 3TBYB 2VDNB 4DVBA 4ELKA 3FUNA 3KVPA 1UTDA 2B5IB 4JDEB 1YEWA 1V7ML 3G6JF 5T1DH 5FA3A 1A3LL 2FWLB 1BV8A 4WY7H 3U0PB 2WXFA 1XF1A 4NM8H 1NGPL 2KZBA 4FTVA 3VVVA 2Z7WA 4B41A 4JJOA 2E9JA 4GINA 2LE9A 2V2TA 3DV6A 3BZ5A 3IJYB 1QEXA 4WEBL 4EIBA 2M8XA 3FOLB 4WUUE 1X5IA 4EZJA 3L1OH 4GBXA 2AEWA 4LCIH 1AO7B 4KVNH 4YFEA 5E1QA 3HPLB 4ZYKA 4TSBH 1KPUB 5JXAL 4P5SA 2XLLA 5AVSB 4WSGA 4DKEH 3QCTH 1SEBA 4B6ZA 5ISZB 5FF6A 1BPLB 5GXBB 3C6LA 3P11H 3ZKND 2M2DA 4N8UA 5EBWB 4NLAA 3ZE2F 1OTTC 1PLAA 1MRFH 1M6OA 3Q2VA 4UQEA 2IWEA 3P0VH 5JOFB 1INQB 1DP0A 4XP9L 2JKLA 4NT6A 3W57A 5D6CB 5BOZG 4HJSA 4U33A 1M05A 1CLOH 1TSHA 3RL1A 2DJUA 3NSJA 4HEMA 2DQUH 5AW1B 1N0LA 2Q7AA 4I5BB 1DL7L 1MH5B 2FWUA 3US0A 4MAYD 3CVHH 3TT3L 1UZ8A 3IAQA 3QPKA 4UQ2A 1A7RL 4FNSA 4DT2A 2UZPA 4DPAX 3OJMB 1CJYA 2X0VA 3ISWA 2DQGL 1QQDB 5AOLA 4HCFA 3AXHA 3CV5A 4DK5A 3GK8H 3V8OA 2HKFL 4PG9A 4YSSA 4FLSA 1WTLA 4QHKJ 1BOYA 2F5AH 4H0GA 4DP4X 4OD1H 2FBRA 4P2YA 4LSQL 7CGTA 3B9KA 1T2JA 4PQXA 2EH7H 1TTCA 2R0WH 1IBBA 4DP8X 2OQJB 1RUML 2W9EH 1IU1A 3HFFA 2WQUA 2HTKD 3D07A 5E00B 4K5PA 1RJLA 1UD2A 3MBWA 1IGCL 3D5OF 2JKXA 1UXWA 1QSFE 3VXOA 5A2FA 1L6XA 4Y4KA 1MEXL 1QWUA 2F58H 3R18A 3WJLC 2D3LA 2V7HA 4XCEB 1I8AA 3AG4B 1AKJB 1S9XB 3CN4A 5I0ZA 5KYXA 5CIPH 3Q06A 4QTIH 2Y1YA 3RILA 1SFDA 2WKGA 1NSNL 3ZKNC 2VTFA 5D1XB 4L9LB 1ZHNA 2F58L 2JCCF 2BSSB 1ILUA 2WY3B 2XACC 3JTTB 3G7TA 5C09A 1ICTA 2HFGL 4ZOBA 1E2VA 3ARFC 3N2JA 3EOAB 1X6LA 1AMXA 4UNTA 3G6DL 1X5AA 3RB5A 4BSWB 3GI9H 4M1GH 4AJYV 3FCSB 2EE2A 4C83B 5E0FA 1KMGA 3WS3A 1AC6A 4FI7A 2WZPD 1BYOA 3RI5F 5E70A 3CFCH 2M83A 3UO1L 1P6FA 2R4RH 3GMNA 1KCUL 4YPGB 4X6CE 1R9FA 1FZJB 1RUAH 3FH8A 5E6ZA 3ZT5A 1JG9A 2QKIC 4DQOH 5A2KH 4I2XA 1SXCA 4OVVA 2IAMA 3FT1A 4R0LA 3KG5A 3TN0A 5JNYA 4L3ED 3STZA 1JJUA 2WQRA 3ZL2A 5E6SB 5EZLB 2PR4L 5IBUB 1XGRB 1BIIA 4N8CL 1IBHA 5IJKC 2BVPA 4TF4A 3U25A 3BJLA 1YEEH 4O58H 1CGSL 4P4KD 2G2PA 1N2RA 3TBBA 4KOBA 3SDXA 1FC2D 1RK0B 1R75A 1W6LA 2WINB 5IJDC 4TQIA 5LBVA 2AJVH 4AQAA 4TLUA 2YXFA 4HHAA 4RMBA 5C0BD 4YDKL 3V5DA 1FWXA 4ZMTA 1J88A 3BZFA 4BA8A 3B43A 5KZCD 3APNA 1RK1A 2D7TL 4I4WA 2B1OA 3NSFA 1FG2A 1K6QH 4PRHB 5IB5B 3WY3A 4Y9CA 1XX9C 3QCTL 3O6KL 3OKOA 3CZUB 1NWOA 2ZNXA 3US9A 1CDGA 1FAIH 3CHOA 1CFTB 2R39A 4JHUA 4NWUH 4QRAA 4BFIA 3BIKA 5ABDE 3GRWA 3NIDB 2YR3A 5CHNA 3QEHB 2OMBA 1UVQB 2YPLD 4G72B 2WQXA 1PAMA 1FH5H 4G8GD 5F96H 2EZ0D 3W2DL 4QNPE 4HPYL 1J11A 2JLPA 3FUHA 1ND0B 4XN8A 1TZGH 2P42B 4UM9D 4JPIB 4J3XA 4UV4H 1THCA 2GKIA 5I15H 4PJ7E 2YQ3A 3UTQB 3IXAB 1CLCA 1EEZA 3VJ6B 3KWWA 4ZMVA 3RX8A 2ZKMX 3K2KA 4BWTA 4P8QA 5DMKB 3QBTB 1JWSA 3ZT7A 1JZ4A 4Q56A 5BCAA 4NYLA 2ODHA 5G5DB 4UIKH 2D73A 3CXHJ 3RWFB 3BI9X 4XMWA 5LBSL 2GJPA 5ECGA 3GWJA 2ITCB 4K7FA 1KFAH 3K91A 1JNHB 3L54A 2IQ9L 3RFRA 4L0ZA 3SQOH 1YEEL 5JR1L 1OCWL 2HLFC 2V5YA 2RAMA 1J0JA 4K9JA 1F97A 2E47A 4Y5YB 5LQBL 5DS2A 3KPSB 3BPOC 5C7XH 4FGMA 3R06A 4MS8D 4UT6A 5IK3B 1XGUB 2ZWLT 5HYEA 5MP6L 2XPZA 3G5XB 1M2OA 1T04B 2IWGA 5CMAB 3WJLA 2WVUA 5D7LE 4WW1A 5LWYH 1PZ5A 1MFMA 3H55A 4YSTA 5T1KB 3JV0A 4MCMA 2ED7A 3NSYA 3U9WA 5EWIL 3GSOA 4IGBB 3ATFA 1A7RH 5DJDB 5GS2D 4Z3JA 2R1WB 3HE7C 5FCSH 1KC5L 1WAEA 5HHME 3HZ3A 1YECL 3DSNB 2ZOKA 1NEZA 3MV8D 4MJ2A 4PJHB 5DHYA 3ARFA 3Q2WA 2Y36H 3CIQA 4DP7X 4JO2L 4GRWF 4AMWA 1RZQA 5E99L 4OLZL 4JAMB 4KITB 2IG2L 2DDQH 3ARWA 3GHPA 3KNBA 2I60L 4B95C 5JPMA 4GIOA 1D2PA 3T71A 4XZ4A 3QRBA 1GZQA 3MRHB 1LJMA 4GMSH 2A6IA 2EIJB 2VZVA 4X4KA 5CCGE 3MOQA 2FX8H 3IFLL 3SDAB 3WFCH 3DX9B 4G59C 5ERWB 2HG0A 1ZVYA 1UWXH 4M6NH 4U0RC 1U6AH 4GUOA 3K6IA 1QO3A 2J43A 4TQEH 2Q8AL 4I13B 1PFCA 1RZPA 4RMSA 1JGEA 4A7SA 4KHTL 2X05A 5TDNB 3WJMB 2D0GA 3O2WL 3H42L 4Z7OE 3LKRB 1DBJL 1N3NB 5CGBA 1W0VA 5K1VA 5D7EA 2GI7A 3CFEA 4Y4HB 1IARB 4MBRA 1FFNB 5IROA 3CFTA 3GBDA 3ORJA 3KLSA 3T0AA 1AHWB 1MDAA 1CI5A 1KGXA 3QJTB 3RVVD 1OIOA 1UH2A 4UNUA 5B1CA 1O7DE 3DX8A 3P9LA 5C0AA 5DMIH 1HCFX 4UM8B 1BQUA 2VXQA 2VDQH 3QIBA 4JZJB 4ONGL 2NR6D 2IBBA 5D1XD 3D9AH 3LX9A 1OGAA 3VXSB 4G6AD 2JCWA 3K80A 5ELIA 2N3JA 5L8JB 4HIIB 4ONHA 2DI8A 3E9UA 5FGBA 5KVEE 1F00I 2ITDB 4UUJA 2XTJD 3MCLL 3IVKB 2YRZA 4ZMLA 1EZLA 2CKBL 3VFUB 5CFAA 1A6ZA 4ZX3A 1WRFA 2QQLH 4S2SB 3SSGA 4FFZH 4R26H 2CXGA 3TO4A 1QI3A 4YAQA 4UT6L 3EAKA 5KBLA 3LN5B 2YEZB 4JO2H 3KYNB 1XCXA 1UD8A 2DQFB 3ISRA 3BN9D 3O6MH 4JHAL 4OUUB 4QT5B 1DTUA 4TLSA 4M4RA 5F1IB 4ZUVA 4ETQA 4HDIB 5DYFA 5IFAH 3FQYA 3TCTA 5GGVH 1AP2B 4G42A 2KDGA 2YXVA 5E6UB 3HZKB 4OSUL 2VWEE 3OXSA 3S8FB 3GGWA 3TCLB 1XZ0A 5DURD 2NT1A 1KLUA 4PTTA 5L4FA 3HG0A 3W5MA 1KF9B 4F2MB 3CH1B 4AIEA 1ZHLB 5KANG 5DEGA 5HDLA 4OF8A 1RURL 2W65B 4WI2A 1I7UA 4KHTH 3DO7A 2BRQA 1A2YB 3MRMA 4Q9QH 1MIEH 5D1QA 2CO6A 4X5QA 2X6BA 1LVEA 2HTLC 3KXFA 3N42B 1ZANH 1URZA 4H25A 4ODUA 3N91A 4UQ9A 4XBEL 4J3UA 4YHNA 3P9WB 2EE3A 3UTPE 1IGIH 4FJZA 3L5IA 3SQOL 5JDSA 4DHLA 5L0QC 1OO2A 4LHUD 4NKMA 1QX1A 1VESA 3QJHB 4HCRH 2B7DT 2X87A 1OARL 4DZBA 4LSVH 1UB6B 5ANMA 4BUHA 1HE8A 1R3LA 4M43H 3NIFB 1RZ7L 3U4BH 3P3YA 4J4PC 1YECH 3IDJB 4KV5E 2V2TB 1HQ4B 3ZE1F 3O2VL 1DJGA 3DXAE 2ID5A 2ZYIA 3VXNB 4U05A 2F54B 3ML9A 2HVKA 1WT5A 2ZUXA 4PGDA 43CAB 5IV2B 1GYVA 4KO9A 5DUBA 3BUDA 1K9TA 4ONOA 5JHLA 1IAKB 4OZGE 5CCKL 1OZUA 3QO1B 4LAJH 3NQKA 1LM8V 1BQLH 2A9BA 2BW4A 1I7ZA 2OTUA 1G4RA 3VGHA 1W8NA 4XC3H 1RZ8A 3ZKSD 1JGIA 4AYSA 1A02N 5I1LA 5KOMC 2FNBA 1M2VB 2W1NA 1BBJB 4ZAKC 2AJYH 2P4AB 1OTTD 1CGUA 3HNSL 5FWQA 1GHFL 3MODH 3QXVA 1V3LA 1X9QA 3OJDA 3MACH 1O9WA 3V4PA 4APXA 1FNHA 1QR1A 3SQBA 4F2EA 4UILL 1CL7L 2DWXA 2X6CA 1C12A 4FG4A 4ZXBB 1E9PB 2VLRB 1BD2E 3MRBA 5EZJA 2PPAA 1I9IH 3HIZA 3P4MA 4YHPB 2CKBH 1YPZA 4HIJB 3EYOA 8CGTA 1G1KA 4YLQT 1I1AB 3T0EE 2DZEA 2NR6A 2G4GA 3S2AA 1CUOA 5CU5A 1S9WB 4NO2B 4ZO8A 4ZODA 1WG3A 1N0XL 4LRNH 2X2YA 4J3WA 4PJDE 3MFGB 2P8LB 4JRYB 3C87A 4ODBD 5GGTH 3EHBB 2B1HH 2Y69B 1S7VA 2HN7B 2QMJA 1QBBA 4JJHA 4ORGB 3A5VA 3NTCL 3VXMB 5BOPA 2PCYA 1A7OH 1ODUA 4R5VA 5CSBA 2FJHB 3UDWC 3SKNB 1EGJH 3WLWC 5I2IA 4NM4L 4HYTB 4WI6A 3FSZA 2BLFA 4YPGA 3BKCH 1H5BB 4NQXB 1WFUA 4L23A 3DMMA 3P54A 4KO6A 3EOYG 2BWDA 3WE6A 3CVHB 4PJXF 4C8XA 3BN9C 1FP5A 3QDAA 5ADOL 5DUPH 1SEQH 3GJFA 4OZIA 2ERJB 1UQSA 2IGFL 4JK0D 5C0BE 3IU3B 2BK8A 3S36X 4JANB 4QNPF 4HIPA 2Z9TA 4PJDB 5DO2C 4LPCA 4QT5A 4Q6KA 4YBQC 5HHVH 2WNWA 3I6GB 3MRQB 5SX5H 3OJVC 3O4OB 2Y06L 4IKKA 3HR5B 4HETA 3D39E 2JMRA 3T4YA 3R4RA 3JV4A 4N85A 1R5VB 4HMEA 2HA1A 3ZTNH 2Q76B 3VM5A 2FJFB 1K3ZA 3L3HB 1NCWL 4WI4A 1RU9H 1TIUA 5I8EA 3QS3A 1T5XA 4WFGD 4GNKB 1OWWA 3NK4A 3KJ6H 4KVCL 2OMWA 4OGZA 4FQ1H 1A4JB 3U9UB 4MNQD 4FFYL 4HIQA 4RGNC 3GSNL 4U7SA 4FQ2H 2PYFB 1K5NB 2DMHA 3MZGB 2X4TA 5INCA 4XHQA 3RG1C 4JN1L 5D7IB 4BK5C 1SVBA 5FLUA 3NBNA 2VUOA 4AIXA 3GZKA 5CWSB 3GIZL 3E7JA 2DWDB 1VFOA 1LEGA 1XQ4A 4YBLC 2XKUA 2OCCB 1Z9LA 1B0RA 3H9HB 3IXTB 2DLFL 3OKOB 1GGTA 3DNKA 4NQEB 2RB8A 4TQPA 4CU7A 2AMGA 4LVHC 4D7PA 2WIIA 1DEEB 1FJ1B 3QDJD 1XIWA 4WUUA 1MCWM 4I77H 2C7UA 4G43B 4HUUA 2W0PA 4TUKH 5I8KL 4D9LL 1YCSA 4BELD 3SB3A 4DVRL 5DFTA 3HMXA 4RNRA 4CU8A 1YEFL 1ZT7B 3VFMA 2IGFH 4Y5XC 4KRPD 2F1BA 3QUZA 2R0WL 3BRDA 1KCRH 4GIAA 3NJIA 4QRTB 4PRHD 2XG5B 4WJG3 3TESA 3AMLA 1PD6A 4JVUA 2RTTA 3QEQD 4MMYA 4LQFL 1S3RA 2PMZA 4IRSC 1A14L 5GIRB 2Z1KA 4W4OA 3UZEA 4X50A 1NUDA 3CU7A 3D6GA 2BIHA 3Q8AA 2MCG1 2AEQL 2P44B 4IRJB 3SZ6A 3MGOB 4F8LA 1SXSA 2B20A 4W9JC 1TETL 4C47A 2DQGH 2LFEA 1MWAA 2XZCL 4NCDA 1E4XL 2OM5A 3K6SA 1CZ8L 5DHEA 1S7WB 4P3DB 2P28B 3QG7H 5I17A 3CFIC 3M8OL 3WS6A 1EVTC 4IDJH 4KTEH 1WZAA 4PVMA 3VGEA 3H42H 2JFCA 4PUBH 5I1DB 3A4EA 5F89A 1TPXC 3SPJA 1UJ3A 4MYWB 3JTSA 2Z4QB 4ONFH 5H94B 5BVPH 4HX1A 4XX5A 3VXQA 3ZHFA 2VAAA 5F7NC 2WLKA 1NGWB 3CMOH 3SKOA 1N59A 4UYPA 3LHPH 4OJFL 4KTGA 1FZOA 2E6JA 3UDWA 1LWHA 2BWQA 5IG7B 5AG9A 2H47C 3QIUB 3NESA 1UG9A 2GBVA 1QFWM 4X83A 4P2CG 1FBIH 3LQAC 1I75A 4XGZB 3MRKB 3US1A 1QSFA 3AS2A 2PXYC 4ZSOB 2YQ2A 3NJVA 4ICWA 1LO4L 5IREA 3CVIH 4PJFB 1B4LA 2YLHA 5CEYB 2DYRB 2EIZA 2OXHA 2C9QA 3FC8A 1T0OA 3NG5A 2B8OT 3F3HA 3CFCL 3DBSA 3N44F 3D48R 2R59A 5AVTB 5H4YA 1A3RL 3QJFB 3VO0A 1J8SA 2FSEB 4QGTA 4TLKA 4U1MA 1MCCA 3JV6B 5DMGD 5I73C 5DC9B 3EGXA 2MFNA 2P5WE 3MLPA 4JUSA 3UEZA 2HLEB 5KSBB 1F8TH 4HFWB 1A2YA 1X4XA 3P2DA 4ODVL 2WZAA 1I4FA 2X1XR 1XF3A 4PJHF 1SRDA 5FYLD 1SHMA 3RWDB 1MUJB 1AQMA 4KC3B 4Y2DD 2Q2EB 3HMXL 4Z7UF 3V4PB 4JKPL 3VTAA 3DMMC 5JDSB 4K55A 4LE8A 4DSYA 1IAIL 1M1SA 1BD2B 1DBAL 3P30H 1FFNA 1SVCP 4PWGA 2Q1EA 1NGYA 2GPZA 2OJZL 1DE4B 3MRNB 5LVEA 2FWOA 3IMRA 1NBYB 1XCWA 3IBEA 3GBNH 3G6AB 1AXSA 4UANA 3SDYH 4BK5A 4GRMB 3HNVL 2ZQKA 4FLQA 4MVBD 1MIMH 4W9DC 3OSVA 2TSAA 2X1PA 3OBAA 4YSCA 4BFGA 3TFBA 1RJYA 4AK2A 3TYFA 5BS0B 3HG1B 3IPBA 3GGWB 4N1EA 2ZSWA 1VGKB 4Y4HC 3FB8B 4F2MA 4XWOC 5D7JD 3GDCA 5TGBA 1SNRA 5FYKD 4XHJC 3TNMA 5BUGA 1PIFA 4JDTL 1CE6B 3VGFA 3GB7A 4H8WL 2GTZB 3AQXA 3GHBH 3JYCA 2X9YA 3GXIA 3WUWA 4N1CA 4WFHE 5I19L 2XWJB 3KPQB 4UNVA 4DH2A 4M7LT 4RISH 5EO9A 4LK4A 4UAOC 2HT3D 4ZUVB 4ABQA 2NY5C 1AIZA 4XP1L 5KYWB 2GK0B 2L4OA 2VABB 3NFPA 3VXUD 1KJVB 3FQUB 3D39A 4OLUH 2IALB 2FUQA 4P4KB 4QRQB 4XPTL 2GITA 1NMCC 1PDKA 3GEWB 3KPRD 5T1LB 1FHNA 3IE4A 1DVFD 2CJTA 1Y1UA 3P11L 3O9WC 3PF2A 1Z5YD 5JQIB 1JZ3A 4Y7OC 3DVFA 2C1OA 3QUXB 3RA7H 5IGXH 1QATA 1WT5C 1N4XH 1KJMB 4XVTH 1EXUA 1M7UA 1HXMB 1NFIB 3BISA 1FDLL 4NBXB 4BD4A 4FTVD 4KKPA 2VH5H 2X6AA 2YQBA 4O2FB 2QPFA 4JPQA 4AQEB 5INDA 1C16B 3OGCB 1G5GA 3BJ91 2V3EA 3FMGH 1EAOA 2QPEB 2Q9OA 2YGNA 4FEMA 4NM8L 1RK7A 1A22B 1NBVL 1X7TA 2Z8SA 4N68A 4ZUWA 3STBA 1M2VA 4JO1H 5LNDA 2WLLA 4GBXB 3G08B 1D5IH 3LPFA 2NRDA 4FA6A 2BX5A 4FLOA 3S2CA 4NLHA 2EXYD 1JYVA 3FRPG 3IFPA 3RIFK 2AQQA 2ERJC 3V6OA 4PI2A 1YNKH 5CJOL 5DQ9A 4XGZA 1AXTH 4PGDB 3MA7B 1TNMA 4E9QA 5IT2L 3A6BL 2F54D 1XCTB 5EU5B 5FWRA 5F1NB 2CCLA 4A6YB 6TAAA 4ZNCD 5ITFB 2YK1H 5AENA 1IFHH 5D5MA 2FQDA 2XQYG 3MLXL 3TURA 2HTLD 1T4KA 4W6WB 2OJ1A 3DV6B 5BZDB 3X11A 1M9SA 4ZPTA 1XSJA 1A1NA 3UPCA 1PEZA 3RWIB 3CHXA 3QUXC 4ODXA 2JIXA 4ZOAA 3JV4B 1TTAA 1WAAE 5I6NA 1YY9D 4GBXD 2P46B 4PH8A 3TO4D 2WYHA 5BQ7A 3TONA 3WCYA 1FSKC 1WD9A 2J25A 2MEJB 1EEYB 3EF4A 4XWOD 4Q6IA 5J0BA 3WTTA 3VMOA 2EKSA 3KYMB 3T04D 3LKOA 3N5AA 4ORZC 4D0CB 3SDXF 3C2SA 5JOFA 5KVGH 4F7TA 4B3EA 4DP2X 1YUKB 1MJUL 1HQRB 2CQVA 4JGMA 1D5BB 1OAUH 2Z35A 3V0GA 1DSFH 1PFOA 4YNYB 4LVHB 5GJSL 2WKOA 4QRUA 2R2CA 3ZR5A 4MMZC 4B96A 3BKYH 3ELAT 3GBLA 4WI5A 1Z7JA 2KQMA 3H2PA 4PBWD 1PCXA 4JRWA 1T2QH 4R90H 2I5YL 2A38A 1MXGA 1DEEA 1WITA 2WIIB 3N41B 3OAUH 4RAHA 3IDIB 4EEEA 2WUBL 2AJVL 1LWRA 4LXFA 4IKJA 5IROD 2WGNB 4DEWA 3L3IA 2WW8A 3QA3B 1SEQL 2AP2A 3VSQA 4HOZA 3NDYE 5F70A 2XWTB 3UC0H 3VW3H 1F42A 3LIZA 1T03L 4ZTOL 3LQMA 4OKDA 1FO0L 5I1KL 5DFWH 4GAJH 3GHEL 2QQQA 3GZPA 4KI5E 4LLMA 2PTVA 2HH0L 4HKJA 5EN2A 1A6VL 1T3FA 3S5LB 1IBGH 2ESVB 2N7BA 2IWKA 1CDIA 5F7YC 1MF2L 1MCFA 3QCUL 4O4YH 4PJ9A 4EKXA 3UJTH 2CDFA 4WRLA 2HH0H 4P46D 1WFOA 3ZK0A 4PY7B 3QDJA 5D71L 4KI5C 2K3HA 2UZIH 3FXIC 5F97E 4ATWA 4H5SB 1A9VA 1EIBA 3TBTA 1XGRA 4Z7UE 3UBHA 3I9GL 5JOEA 3T4YB 2EXYC 3CDGA 3X1EA 2BVQB 2V33A 1R5IB 4FNPA 1R5VA 2X28A 35C8H 4GMTL 4YC2C 3T3PB 3ZE1E 4F8PA 4OCSH 3T9WA 4EIGB 5C0CA 5JW3H 1KEGH 5HYJB 4CSSA 4ERSL 1TZOA 5SWZD 3A67H 2CNYA 1O5PA 3SDCB 1LE9A 4A2FA 2FCBA 4X9BA 1L0PA 4JGJA 5GZOA 4U6HA 2E8YA 1SYSA 1TVHA 1FFPB 5E23A 3AGWA 5IJCC 2NYYD 5BV7H 1UCBH 3MTXA 1MHEA 5ILTH 3NCJH 3HI6L 1RZKC 4N0CC 1YSOA 1NCCL 4KZ0A 3D3VE 1NUNB 2X88A 1H9VA 4Y7MA 3T6QC 1R24B 4J4PD 3LZOA 1MJJB 3PJLA 3QIWD 4FQ1L 1IFGA 2AZUA 4LNVA 3CSYB 3N3EA 3BSGA 1W0YT 1X4YA 1ZD6A 4BWWA 1YEJL 3K2UL 3WY1A 3UIZA 5L2KA 4JPIA 1Q0YH 2OL3H 1IMHC 4Y1TA 3SE9H 3FUDA 3WEXA 3DURB 2R0ZL 2XYBA 5H8DA 2FZ3A 2P47B 3GEFA 3I2CH 3CZFA 5I66A 5C0AE 3QJUB 5HYQA 1IFHL 1YC8A 5ITFA 2XICA 2EUXA 3KDPB 3PLYA 2AKRB 2K6WA 5HHVL 3UTTB 4M6OL 3OG6B 3IE9A 2GEQA 1E4WH 4F7EA 2O5YH 4K8RL 3WXWL 2EO7A 3A23A 2D2CC 3F83A 4XNQA 3OHMB 2X7LA 3R1GH 3ASWA 5IKCA 4E9TA 2CIIA 1CLZH 3LD8B 3GUTA 1JNHA 1CE1L 1DQMH 3K6SB 1QA9A 1ZSDA 2DJSA 2UYLB 1KXHA 1FVCB 35C8L 3Q8BA 3MJ9H 1BFSA 2ALWA 3MLUH 4DOHE 3K72A 1D7BA 4M8QA 4FXTA 1AXSB 2ZE0A 3DJTA 4NQDD 4Y4FB 5D2LA 1P9MA 5DMIL 1NMAL 4WFFE 5D71H 2VQTA 3KPPA 1WWWX 3NJJA 4RQQA 4HX1B 4OCRH 5BS0E 2CALA 2BP0B 2X4QA 3ZXAC 4KGJA 3ZKQD 2XCMC 1WISA 4D0DB 4L2YA 2R56H 4LMQI 4Q0XH 1NFIA 2GSGB 5IVNA 1HJBC 5I0DA 5FO8B 2G30A 4DTGH 2ZJSL 4QWWD 4QXVA 1YNTA 4R7VA 4M3HA 1E3XA 5LO7A 4YXHH 1KDIA 1U8CB 3FBQA 3QGVA 15C8L 4DEPB 1N64L 3ULUF 3HE6B 2Q8AH 2QQKL 4F7CA 3PWNA 3FO2A 4LKXA 4MA3A 3RGVA 4FFZL 3VSTA 5CBAA 1FFRA 1QRKA 1IUZA 1CE1H 1AJ7H 3P0VL 5MI0B 4PJFA 3A47A 4PJ9D 3WIHL 4AEHL 1F3DJ 1G1YA 1I9JL 2VDQB 4KDWA 1R3IH 3T65B 3UC2A 4DUVA 3D39B 1LEKB 2MHAA 2E8ZA 2DEWX 5DD1H 2UXVA 1T7WA 2BP8A 2X4NB 4XP5L 2I60H 1ASPA 4Z0XB 4UMGA 3FFCB 1WAAF 4FL4C 2WZPA 2A0LC 2PW1B 4Z7UA 1UZ8B 4TNEA 3N9GH 5F6HJ 4E36A 5ITBH 1HKLL 2DMBA 3II2A 1D6VH 4OD3L 4AGMA 3MRIA 2AHIA 4LLYB 4Q0XL 4QRPD 1GGCL 2V3DA 1MFDL 3HUJE 3K2UH 4FYQA 4JPKH 3T6VA 2W91A 5DHYB 1A6TA 3LNEA 5KYYB 1J0YA 4WTZG 2WLJA 3PHOB 5BUPA 5IB5A 4XBPB 3RWDA 4PJEF 2AV1B 1OP4A 4ZZFA 3KNBB 4J6RL 1EAPB 3BAKA 5FO9B 1EJ6A 4UOZA 5KS9B 5E9DE 3BZEB 1FH2A 2KQNA 3GSWA 4R4FL 3FZUD 1RVFH 1EZVX 3QIBB 4JN2A 2EC8A 2NYKA 4CJ0A 1UENA 2MKWA 1KYOJ 2CZNA 2V7HB 1OXYA 2Y22A 4CMHB 3P1VA 5E5RB 1UGNA 4F33A 3VFOA 4PJEB 3GSXB 2YBRA 5L88L 5CMAA 4OLYH 1TJIH 2XN1A 1IVTA 1IGIL 1CDUA 1PJWA 4XPAL 2E9IA 1E3FA 3QT2A 1OAYL 3X17A 3DECA 3HKZA 4YSDA 4LAQL 2E27L 3L4TA 1NQBA 2D9CA 2PTTA 1JD9A 4U2ZA 5BZXA 4MAYA 4BRVA 3K6DA 1IB5A 4XE0A 4G9FD 1ET7A 2XV6B 5I1JL 3WJJC 2JIXB 4FQXD 2GTWA 2OMYA 2OZNA 1IGTB 4Q97A 3TH3T 3DHJA 4LSUH 4EXPX 4FNQA 4GG8A 5CLZA 5MEPB 1B88A 1A6WL 2WSPA 2VERA 2EZ0C 4NC2B 3IGLA 2P43B 2PPDA 2WANA 1OTUD 3C6LD 1HCZA 3LKOB 4IIQA 1HYRC 1JS4A 5ECJE 3SCMD 1BM3H 2DEYX 1G0DA 3GJEA 2GT9B 1O9ZA 4L5FL 3SGEH 4PV8A 4LRNL 5T3ZE 3CZSA 2YHGA 3F7RA 1KGIA 4X5LA 1P4BH 5EB9A 2R51A 1QI5A 2OCFD 3O9WD 3PYCA 4PREA 1DQLH 3RVXD 1FYTD 4GAAA 3WFEH 1NMCB 4WJKB 4KWUA 4RAUA 4ZFFB 3LRGA 4UTAH 1TQWA 1XF4A 2CO3A 5L8LB 5GRVK 4B5EA 1A4KB 1LP9E 1TJHL 3WO4C 2QSCH 4N8PA 3BIKB 3G3LA 3TYGH 5AZ2H 1MHCA 4BZ1L 3NFNB 3PRZA 5J4MA 5F6IB 5D55A 4YWGL 2D3NA 3RWHB 1ECYA 2DBJA 2LVEA 5ICYB 1FQ9C 2GYSA 4WI0B 3EYVA 1X5FA 2DQEL 2GBUA 2QGCA 1FVEA 3VXTA 2QKIA 4XNMB 4XN7A 1GW6A 1KB9K 1L9RA 4L8SC 4U4IA 4WHYG 4F7PB 2X09A 5AG8A 4NI3A 4TLTA 4E42A 2R27A 2A1WL 2TRYA 4YQXH 1MAKA 5LCVA 4WIQA 1W9XA 4YBLB 4E0RA 4KKCD 1MIML 1W8EA 5EA0H 5HDRA 3T65A 1I8KB 1X9UA 4QIRA 3ZKMC 4AV5A 1TZIA 4MZIA 4RGOH 1XSKA 3ISYA 2AFNA 1BEXA 4PVNA 2ZG3A 5F2FA 3LNIA 5HVGB 1F6FB 3DUHA 1FC1A 4MDJB 3V0FA 4M7JL 1RKRA 4ODWB 4RIRB 4Y8DC 5IB1B 5D7SL 5B22A 4BWUA 2QHRL 4HLZG 5AQ0A 5TE4H 3ZBMA 1KLGA 5EU4A 4JG1H 5DU7A 3PHQB 1AQKL 1GMIA 3LEYH 5F3BB 2CK0H 2H2PC 4ABWA 2JJWA 2Y36L 2E7BA 5EIVA 4AEEA 5FUZL 3RFZB 1JTOA 1QKZH 4OQTA 1G94A 5C0EA 5E7BA 1SJVA 2K70A 2SODB 2DWEB 2OP4L 1ZGLA 5A2CA 5K9JH 1KNOA 1XVSA 5ACZB 2FYYA 1MFCH 5TF1L 4AW7A 4XP6L 1IEAA 4OCMC 2CIIB 4KZEL 5GHWH 5LNGA 3WKYA 1JPEA 2OULB 2QFPA 3D4YA 1DQVA 2VDLL 4NENB 2X4UA 4Z7NE 2VSCA 4N0UB 1QWNA 4WK2B 4UBDD 4MJ6B 4HPHA 1N68A 3FB7B 4XXCA 3ZE0E 4KRNA 1JGVL 4JZOB 3D39D 4R9HA 4LCWB 1AY1H 5I75B 1NDTA 3KPMB 1NDGB 5FFOA 3ALXA 2IQ9H 3BPCA 3ILQD 4UTBH 3LEVH 2IBZY 5I5JA 1AQKH 2J8UB 3UMTA 1JPTH 4HJTA 1N7MH 4MASA 4UM9A 4YE4L 3OQ3B 3RHWF 3LPWA 4FXGB 2HX7A 5DD1L 1H3WM 5E2UL 1V7NL 2B0SH 1DSYA 3OJ2C 4I88A 2ESVA 1DANT 1A9BA 2PO6D 2SEBB 5D7JA 4DW2L 1SMOA 4OGYH 1QSEE 5LXGH 1YMMD 1GW0A 4HT1L 3QPXH 2BDNL 2W9EL 2W95A 3IN2A 2DMKA 4OZFG 4XNZB 3I02B 5E4AA 1KACB 1WYJA 2EXWD 2KZWA 4O2EB 4OIAA 2H0FA 1N64H 1W0VB 4PV1C 3QNYA 1UH3A 3OWRA 1Z6JT 4MB3A 1L9MA 1MVUA 5FHBH 2HKFH 4H7VA 5D1ZA 2DYPD 4OAWB 5AKRA 3DHUA 5FYJU 1J12A 1X5KA 5EDXA 2AS5M 2NSQA 3H7LA 3WMPA 1ZTMA 2J44A 2WBXA 4G8GB 1HIMH 1SDDB 2LU3A 1LILA 1KTDA 3CFJB 4QRFA 4UU9B 4P99A 1XH3B 4HGWB 4POZC 3DXAD 2ZWZA 2JJTC 3PQYB 5IW1B 5I8OH 2QMKA 3H9SD 3VRJA 1DL7H 2CJSA 1CL7I 3WFHB 1GGBL 4KK6C 5D7KD 4POZD 4AL8L 5KYYA 3LZRA 3S35H 1MCPL 3HCVA 1SJXA 1V8HA 1OW0C 5I75C 2BPBA 3CCHA 1SY6L 2R69H 3ECBB 3GNML 3PDOB 4HT1H 4PJ7F 1A4KA 4YC2B 3PWNB 3REVA 2DQCH 2C9UA 1CFBA 3B7RL 5AL8A 3T0EC 32C2B 3N44B 1F11A 1YEDB 2DEXX 1W72B 4JM4H 3AQZA 2YEZA 2OMWB 1SYVA 3CXFA 3FQXB 1BVLA 3G6JA 3CSPA 4I77L 4JKLA 2KPWA 4NFBA 3HVDA 4ODHL 3PL6A 3CSYA 4WWKA 3UZVA 4OD2B 1E4KC 3LEVL 4TS6A 2VLRA 1MAML 4MXQD 4ZBJA 1U93B 4EAEA 3NJXA 2W60A 2MSPA 1T7YA 4HBCH 1HSBB 4KPHH 1QLEL 1OQXA 3V0VA 1F41A 5CINL 1U3YA 4FX5A 3RZWA 2ICEA 1I3RA 3POCA 3UBXB 1V5JA 4GQRA 4QCIA 4YFLF 5B8CC 4JY4B 1W2KT 1X9RA 5E94B 2H0JA 4TNFA 4E41E 4ZI8A 3GRWL 4S10A 2YWYA 2QPSA 1MFCL 2Z6FA 5TF1H 5KBPA 2E27H 4W1TA 4FHKA 4B9ZA 3T77B 2KH2B 3QG6A 3U1QA 4RH4A 3VWJA 3WDHA 4Z3TA 1WZ1L 2FJFA 3KPOB 4MZ3A 2CLRA 1OPGL 1BF2A 2J8UF 2VM4A 3IRCA 4LGSB 1HOCA 4AYID 1H8NA 2PCPB 3CK0L 3N0PB 4PG9B 1A3ZA 2AXWA 4L1TA 3CX5K 4IGBD 3ZHKA 3QIUD 3LB6C 4A2DA 4JFDA 3OMAB 3J07A 3OKKA 1B0GB 1TJMA 3BP7A 4OFVA 5T1MA 5B38B 4B9GA 2FGWH 1RZJL 1S8DA 5EOQH 4NS0A 5ISZA 3V6FA 1LYQA 1KBBA 3W9DA 1QRND 3MNVB 5ICZB 4U1IA 3ET9F 1BFTA 3ARUA 3CQPA 1CICB 4NBYB 2GIXA 4NENA 3VFTA 4N22A 3MI6A 4WENB 1PD1A 1U8LB 4LLAA 5FV2A 1HEHC 3QEQA 1JPSL 4AVIA 1RURH 3PABB 2JKWA 3V2AR 1JGUL 3V5HB 1GMEA 2F61A 2RR3A 2MKLC 2J56A 4UMSA 1KXVC 1V3KA 2ZPKL 3ZDYB 3EBAA 4B9IA 3JTSB 7PCYA 4NO0D 1HIML 3AM8A 5FECA 1MFVA 2IOIA 1J7VR 4XBPA 4KXAA 4B9FA 1U2CA 3NCXA 4DKFL 4Q2ZA 3O11A 1MY5A 1XR8A 5HSFA 3KBFA 2ZCHH 4CSZA 4RNRB 1GKOA 5IMKB 1OT2A 4I0PB 1C12B 1TMQA 4U49A 3HI6H 3BD3A 4YMPA 2ICWA 3BUTA 1LQSR 5I6OA 2QGEA 2Y1ZA 3GTVA 3O41B 4AYDC 4RDQF 4YX2H 4K3JH 1HHIB 2NW2A 3WHXA 2C9XA 2HZHA 3DMMD 4M29A 1XZWA 3TBYA 4DVBB 4ELKB 1B0IA 3WFDL 4MRBA 4FQIL 5BRZE 3WSQH 1H6FA 4Z8FH 2BFVH 1PZAA 1NCDL 4GRLC 4FTVE 2DD8H 1KV7A 3N04A 2BZ7A 4BE6A 3G9VA 4TUKL 5I8KH 1G9ML 4A1RA 3DTXA 3R0NA 3WXVL 2ARJQ 2VJ0A 2WWMD 5AZEL 2HJKA 5T3XD 5F3HB 1HKFA 4BBWA 3AT0A 3S37H 4ZFOL 4FD0A 4KVNL 5KYXB 2H3KA 5HDBB 3HTLX 1CXFA 3RTQD 1WIPA 2OYKA 3Q5YA 3RVVC 1KCVH 3QQ3A 1IM9D 4JFZL 1DFBL 3SODB 2XIIA 3TA3C 4ZW8A 1O7DC 3PCYA 3NZ8A 3P3SA 2VAJA 2YGVA 2VO8A 3Q9QA 3QUKB 1YUHA 4U0QB 1FZOB 4PGZA 4G82A 1VEPA 3ULUD 4MNQB 4Q6IC 3RLSA 1AO7D 2EE6A 3NP4A 3STLA 4QGYA 1BMWA 1CS6A 1P4UA 1FPTH 2ZOLA 4DN3L 3D4CA 5EHFA 3TF7C 2ICWI 4Z3EA 2X4UB 5KSBF 4CN6A 3O81A 3CZNA 1LP9A 5EORH 4APQC 3VWJD 3V6OC 5SWQA 4MMZB 3SGKC 4LCCA 3S7GA 5KYWA 3IS1X 3D2UB 1F6AB 3BFWA 1IAIM 1XB3A 4L4JA 2WZ6A 4U1LB 5FGCE 4YHYB 1UA7A 4FFVC 3UYRH 2O5YL 4K8RH 4LEOA 1KGCE 5AAMC 3TJPA 4JNXA 4NNXA 3B2UC 4GY4A 5JYMA 5AOMA 5B3JE 2DLFH 3VA2C 4IW4C 3C60C 4D9QD 4PFEA 1KOAA 4OGAD 3E8VA 4P5MB 4PN6A 3S9DB 5AEAA 4FOMA 2LW3A 3HBZA 3E80A 1XSIA 1FNEA 5KSBE 3BGMB 4F5CA 2F74B 3P0YH 4M7KL 3QRGH 1T5KA 1X5JA 1MHHB 1KNOB 3GMNB 3GSNH 3S36H 2WMPB 4HXAL 1I1RA 4R7DB 5GS2H 1YPZE 1OP3H 5C07D 4NP4H 3VXRD 3CAFA 1MCNA 2XC8A 1U92B 3U4AA 2W07A 1KCSL 2ED8A 1NUGA 2ZZUT 4JM2C 4CAGA 4LVOB 2LHAA 4Y9EA 2FBJH 4KKZA 4JFUA 1DZ0A 2TAAA 4H0IA 5C7XL 2YD1A 3OAWA 4MJ6A 2NYYC 5TPWH 4GQ9L 3BSZA 5IK3A 3ZDZB 4UTCA 4O00A 4A2EA 4YWGH 3DOSA 4N2IA 1ES0B 3U79A 3EH4B 4QRPA 4WHTA 4BKSC 1A7QL 1S8DB 3MLYL 3BD5A 3FTUA 4GRWB 4S1QL 4X0KB 1QZ1A 1XH3A 1R5WB 1S2EA 3AROA 1W0WB 3MNVA 3PXHA 4HGWA 3LS4L 4XBGB 5IBUG 2DI9A 4WW1B 1HXMA 1KPUA 3NUKA 2BXZA 3EJYC 3UTOA 1AH1A 4JGNA 2KHAA 2GJZB 2RQEA 3DK2A 1FRGH 5CGYC 1UWGH 2BNQE 2GFBB 2VM3A 5GSVB 5AD0B 3L3OA 1BFVL 3QHFH 1ZLVH 3RTQC 3RFZA 1HYSC 2J12B 4NN6B 3ECUA 3IU4H 3P40A 2WXIA 3B7UX 3EO9H 3HLKA 3ZGIA 4L5FH 1FI8C 4V33A 3GIVB 4R3SB 4OI7A 4N2KA 1MLCA 3JWNC 4MAUH 4XCFH 4EI6B 5GS1B 2N1KA 3UTSD 2OR9H 4R2GC 3UPAA 5ESAA 2VABA 3NJNA 3UX9B 2DM2A 3TV3L 4B27A 2B08A 3ABLB 3PU7A 4YL4A 3IAPA 1VHPA 3B2VH 1AMYA 2XN2A 1Z1WA 1NOAA 4AMXA 4DKDC 2FECI 4UQ2B 4J4PA 1JXDA 4GAYA 1K8IA 4PB0L 3EJZC 3UYPA 4UQBA 4RGMC 3QHZL 4D2NA 5CEZL 4LCWA 1JF1A 3O3BB 4I1PA 1JVOA 3ATDA 3H2WA 3CZKA 3MYJA 4MAYC 2WNXA 1KPVB 2C1PA 5EF0A 1SLVA 3F01A 1FG2B 1VACB 1B6UA 3TX4A 4YDKH 2JSFA 3IETB 3U48A 4AJVA 4F80A 3F12B 3TT1L 4XAWL 5JIHA 3RKDD 5L88H 1FCCA 2QVTA 5EBLA 3EHBC 1E4WL 4XVSL 4Z78A 1DDHB 2YFNA 3L5WB 3QC5X 3QUZC 5I1HL 1T0MB 1IBDA 2VDPB 1CURA 2YMTA 4N5UA 5CJQH 5DJYA 2XWTA 4M61B 1NPUA 3ECQA 2HCZX 5B7FA 2WV3A 4JDTH 4FE9A 1RCYA 1HQRA 2NY3C 4UB0L 1KCSH 3QORC 4MWFB 3VMPA 5DQ9B 5HHMB 5FUCE 3IN0A 3CXHK 3M1BA 4HJUA 1IEBB 4NP4L 1YC7A 5D7IE 3VFGL 5BJTA 4XE5B 2CR6A 1JRHL 3VFTB 2GJ6D 3FCSA 1EBPA 3Q6GH 5DMKA 5I76B 1JWMB 2FBOJ 2FX7L 2XRAL 4GQZA 4X5PA 3K2MC 4HULB 3UP6A 3X11B 2IV9A 5FECB 3FQNA 3AGVA 2FR4A 3FU8A 3RWIA 4JAMA 1MUJA 2BIIA 2XG4B 5D5ME 5AAWA 1AVAA 5F9JA 3I02A 4LRIC 1NFAA 5JHLL 5JNYB 4G2AA 2EAEA 5KJRH 3FT2B 3BT0A 3VRLF 5AYUH 3EH2A 2YXWA 4PJ5B 3QXTA 1OPOA 5DD3H 3LPPA 2E0PA 3BAEH 4P5MA 2VXUL 3T1WA 3FFCE 3ZSSA 1BA9A 1QHOA 1F58L 4QLRA 1H3PH 2B1AL 5FM8A 2C3GA 4OUOA 3TBCA 1P7QA 2J3SA 3QYCA 4GXUN 4KY2A 3PL6B 4OJAA 5LJYH 2X9WA 3MNMA 4L4TE 1ND0A 3LPOA 4F7KA 2ZP0T 2WO4A 1OAZH 3NIGE 4WCYL 3BDBA 4UDTA 1ORQA 3JYBA 4ENZA 4YXHL 1ONQA 3OQRA 4PJ8D 1AZUA 2A0LD 3IMVA 3QEQB 4XXDB 1E8XA 3P3TA 5HY9B 2P45B 2JB5L 4IBZA 1U95A 4FI8A 4IBVA 4P5TC 2A6JA 1C08B 1ZT4B 3CG8A 1K4CB 5LAPA 2JCCB 1S7XA 4CDGC 3RDTC 3HHRB 1DZBA 3VXPB 5EO9B 3FQXA 2MCPH 4N2NA 5MEQA 3QEQE 3EF7A 4LSPH 3THMH 1SZNA 2F7RA 2X89D 4Z7VE 1CLOL 1MRCL 5IVXF 5J8OA 3DETC 4OZFA 2P80A 1V54B 1TZ8A 3LEXA 3IGFA 4ISVB 4QXGL 3Q9PA 3LJ3A 2ROXA 2IDQA 5SWSA 4J5VA 4EOWH 3ULVD 4YHNB 1H3UA 2IPTL 2KI6A 5ACMA 3ZZSA 4BCYA 3ARPA 5HGAB 1TQCC 5TE7L 1S78C 3MLYH 1L3WA 2YAHA 4Z7NF 1DQQA 1XIWD 1WBZA 3OZLA 4WUUD 1GYWA 3TBWA 1L7IL 3BUYB 3QDJE 5F3HA 1WA2X 4WUKL 2EH8L 5F21B 2F08A 1WC7B 2IEPA 3QC6X 4XPBH 2YEQA 1XIWC 3U2JA 3AG2B 2HPTA 4IKLA 2NXYC 3MX0A 3ARFB 4XOEA 3FAXA 2CLRB 5IEKB 1VFMA 1ZTXE 2MOGA 4IMKC 4Y5YA 4MCYA 5JW4N 1ROCA 1NMAH 4GG6A 1DUZB 4P2OD 4ONHB 2NW3A 3MOAL 1FFPA 1NTDA 5HDBE 3ROLA 2ISDA 2V8MA 5I1GH 3TPKA 3BH4A 3F12A 1RPQA 3GKWH 5DRZB 5ICZA 1HJCA 1F4WH 3WE1A 2VZ1A 3QARA 2DY2A 3VRLE 1MWAL 1SBSH 2M26A 4DPRA 2K7PA 5ETUB 5BPPA 1OCWH 4Y9FA 1MFAH 4LL4A 3QUYB 3PABA 5AB0A 3AXLB 3WNKA 2Y5QA 4Y4FA 3BESR 4IJ3C 3DUUA 4HD5A 4OTXL 2G4EA 3UABA 1F6AA 2QHRH 3GD1C 1ZXQA 2VDRL 2ZICA 3TOPA 3A67L 3Q13A 4IEFA 2EIBA 1MHPL 4RMVA 3R7QA 1SUJA 3L1FA 1CGWA 3QUML 4XMPH 5CP7B 2F54A 3BVXA 4PHZA 1F8TL 4U6YA 4W81A 1HS6A 1LXMA 4WU7A 1ASQA 2FYVA 3C60B 2KZKA 3J8F7 4I9XA 5KSAC 1M4KA 3CGTA 3OKYA 4G7YH 3MGAA 4BZ1A 4HUVA 2X10A 4XX1E 3FF8A 4JANA 4KY1L 4C55A 3IK2A 1S9YB 3OKLB 3T8XB 1XF5A 3SJVE 3MOBL 1U8JA 5E8OA 1QSEA 4BFNA 5I73B 4WNQA 3BKCL 3QEUB 4LGRB 4P46B 2YOCA 4Z5RA 1VKXA 1J18A 3FQNB 4OZIF 2ENSA 3N1QC 4FFWC 3IVKA 1G0XA 3WJMA 1ORSA 3OZ9H 2XVGA 2W94A 4YDJA 4XXWA 2VL4A 4XCCL 2BSED 1P5VB 4A68A 4IOIB 1WBXB 4OJEH 5E8DH 2BJMH 3SJVB 2R1YA 4KMLB 1EA9C 4KKNA 2HAZA 4BZ1H 5IJKA 4BKLB 4PJGF 5I71B 5CR8A 2J6EL 2JI3A 3IDJA 1JNLH 2IPTH 4WHTB 1EV2E 4IHOA 5FYKL 3A4FA 4G70B 4ZMXA 4JDZA 4G6FB 2BSEA 3W9EB 2JWYA 1H3TA 3INUL 2Z31B 1N12A 5FDYA 1O6SA 5TFSL 3V52L 3W1ZA 2VMEA 1MWOA 2WKOF 4JRYA 1DVFA 2BOCA 3GS4A 1XV8A 3AG3B 3RX5A 4Z76A 1HXYB 2IVFC 3QHZH 3VXQB 4YX2L 1RXLA 3UH8A 4PJDA 1A6UH 1QBLH 3JWNG 3FRUA 2FJHA 2PR4H 5D1QB 4RWYH 3FSVA 5HHNB 3U0WH 4LLWA 4ANUA 2V3FA 4HWUA 1T66C 4MX7B 1I1YB 2WP3T 1NGQH 2LU7A 3ARDA 3PWVA 2VDML 4M4RB 5F1IA 1ZA6B 4J3OH 4YZFE 4FA8A 4N9OB 1A7OL 3O4LB 4NNYB 1YN7B 3ARGC 2CKBB 1USZA 3II3A 4G7QB 1NGPH 1LE5B 4NN7C 3Q5OA 4IRZL 3M7FB 3D52A 5F7LB 2H1PH 2NY2D 1HI6B 4XNXH 5HGHA 4KY1H 4H20L 2D3JA 3GLAA 4MMXA 4MMYB 3PGDB 5DJ2A 3SE4C 2O61B 1DN0A 1G43A 4GQPH 4YDVB 3KMDA 1K6QL 2A6DB 3G5WA 3GXFA 2VLKE 4N2FA 5DD0H 3EBGA 3NPZB 3O2DA 2WLIB 3QAZC 1MELA 3AUVA 1E3ZA 3L1GA 5I76A 3MYJB 5J1SC 3VD3A 2OJZH 5FA3B 2YK1L 1S7WA 2VMJA 4P3DA 2CO6B 1TCMA 1F58H 2ZKYA 4IHBA 7FABL 2NXZB 4P2OA 1Q94B 3RU8H 2A9AA 1J8RA 2FB4L 5DRWB 3LZQA 3VI3E 2FD6H 5D2NC 3WIIL 5HBBA 4R5TA 3ZTJH 1NKGA 4J3OD 4FMVA 1RZ8B 3KBPA 5C07B 1GOFA 5E6IA 3UTPD 2EDOA 5DRNB 3K6NA 2MCMA 3ZYZA 2BWIA 3DRQA 5DJYB 4NKDA 5MEOA 4HWBA 2Y7OA 3SGDH 4KJPC 4OZFH 5EF3A 3ARTA 1E9PA 4JO1L 5F0JB 4A2MA 4JCWA 2Q86A 3RUGA 1GGIH 5LBGA 1BM7A 1ZMYA 2IWFA 3DPBB 1PF3A 2PW1A 3KJ6L 1HC1A 1ZHBA 4KVCH 5MHSD 2UY7B 3LKNB 3ARBA 4GOSA 5GHWL 1ONQB 1RZKH 2R2HA 4GI9A 4LP4A 2V17L 5ETUA 2E9BA 2ADYA 4XC1H 5DJXB 4G7YL 4IJTA 4EDWH 1B0RB 3H9HA 5SX4H 2XJKA 3AQYA 2OTUB 4NRYB 3A4DA 4QO1B 1MG2C 1XGTB 4KDTC 3D30A 3WKQA 2MQ0A 3N40P 2CRZA 3QZOA 1ZEAL 4W9GC 1UGKA 4IOSA 1QFWI 5TQ2H 1MLCB 4YSRA 5DZVA 2E76C 3U7WL 1TSRA 3FTGB 5E4EC 2CMRL 2L7QA 4MDJA 3KPSD 3SO3B 1GPOL 3U0TA 5BMFL 2CBQA 3W5NA 5DVLA 1IKNA 4ES9A 1BAFL 3IDGB 2DD8L 4XN2A 4UQ3B 1NLDL 1F4XL 4AM0A 5PCYA 2Z8RA 5AALA 1WDAA 3BPNC 4XNBA 1IQWL 3CMGA 3GBML 1HCYA 2XN9B 4QF1A 3HHSA 5HYFA 1DCLA 3BLKA 1W80A 4JY6B 5F0LB 1S5HB 1I1AA 3CVHA 3VFOB 2XTJE 5DK2B 1OCRB 3V4LA 3GMPB 3G04A 2CKNA 3ILDA 4PJ7B 4U6XB 12E8L 2IADA 3V4VB 4BQCA 5ABZA 1BYNA 1EK3A 1DQQB 1LEIB 3SJVA 5GS0L 2EDNA 3QFDB 1H6EA 3TWCL 3WS6C 3GS7A 1ZVNA 1EJOL 2DQIH 3QUYD 4YXLL 2UVFA 4HALA 3IJYA 3EJJX 3ZZ1A 2EUVA 4MNHB 5HI4C 3WY4A 2BSTB 4L37B 2BSSA 5AZEH 2J1WA 3D33A 1N0XH 3TYFB 4HEPG 5C3TA 3O6FA 2UX6A 3HE6C 5ICYA 4PY8I 3CFDB 2CG9X 1LGVA 2EE0A 3P77B 4G6JH 1XGPB 2XN9E 3C8DA 1IAIH 4C4BA 2CA3A 3VXTB 5IOPB 1OL0A 4PRPD 3UJJL 3BVVA 5C2UB 1YEGH 1RUQL 2P5ED 4FFVD 2AITA 2OSYA 4QXTB 3GYRA 4PW3A 4NQUA 1J05B 1G9EA 2Z92A 1TJGL 2ADJA 2VQ4A 2C8NA 3Q1SL 1OLZA 3QDGE 5DS8A 1NMBL 5IIEA 1YMMB 4LCYA 3FL7A 3VG0H 3PGFH 1Q9OB 1L9PA 1JF6A 4O2EA 1P53A 4PWFA 3FDWA 1ZV5A 2NSMA 3AT9A 3ROOB 3CBJB 5HHMD 3S3CB 5TQ0H 2YN3A 3WBDA 4MA7L 5K39A 3QQDB 2JKTM 4MLSA 1NFDF 4JFFB 3OMNB 4GRMA 2QGDA 2XA8H 4QPEA 4X80L 5C6TL 1RERA 2H32H 3PXJA 4YLCA 2WWKT 3LIZL 3T3MF 5EF2A 3CFBB 4JO4L 1HL4A 4JZNB 3POHA 5MP6H 5H35A 4IMLB 4G83A 5EC1B 4NUGH 2FATL 2E7LA 1XGYL 3ZMRA 5IG7A 5D9SB 3MXVH 1UKTA 1EHLL 4PJXE 3TZVB 5KZCB 1DJHA 3SCMB 4H13C 3U4BL 3HZMA 1SXAA 4OZFB 3S35X 4AEIL 3P2TA 1SJEA 2LTQB 4N0FA 1M57B 3R1GL 1PG7W 1BXUA 1TJIL 2VDMB 2YC1B 2OMNA 3F65A 5L4JA 5GIRA 5AOIA 1JVLA 2QHLA 4HIXH 1ZGLM 4E9XA 3T6WA 4DUXA 4XCYB 5JXED 3G6AA 2EDFA 4N26A 1J48A 1Y07A 3T3ME 2ZXWB 1U3HD 4FQJL 2AJUH 3F64A 1SQMA 4EZKA 4FNLH 3JQOB 4CKQA 1SDDA 5CP3A 3E8UH 1HNYA 3O3AB 4TL4A 3NZUA 2BOBA 1RZKL 3NOIA 1YNLH 1YMHA 3QQ4A 4X6DF 1N67A 3FB8A 4I9WE 1VAHA 4PG2C 2WQAA 3TEXA 4H8QA 1OF2B 4NDMB 4K94C 4PVBA 5E51A 5GZOC 5IHLB 1DVSA