2Z7ZA

Crystal structure of h2o2 treated cu,zn-sod
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structure of H2O2-treated Cu,Zn-superoxide dismutase
rcsb
molecule tags Oxidoreductase
total genus 33
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2z7zA00
1CB4A 2WZ6A 3RE0A 3H2PA 1SXCA 1ESOA 2AQPA 2AQRA 2V0AA 1IBBA 2Q2LA 2K4WA 1RK7A 1SXZA 2ZOWA 2AQNA 3PU7A 1OAJA 4A7TA 2WZ0A 4A7VA 1HL5A 2ZKYA 2VR8A 1B4LA 2WKOA 4OJAA 1JK9B 1YSOA 1SOSA 1SXAA 1F1DA 3KM1A 3ECVA 1SXSA 1TO4A 1IBFA 1TO5A 2WZ5A 5CU9A 2JLPA 2GBTA 3HFFA 1SPDA 3CE1A 1B4TA 3S0PA 3QQDB 5KBLA 3KM2A 1E9QA 2Z7YA 3GQFA 1HL4A 1Z9PA 4B3EA 1DSWA 2GBVA 1CBJA 1OZTG 1FUNA 3MKGA 2JCWA 2GBUA 4BCYA 1E9QB 4BCZA 2AQQA 1F1GA 2R27A 2E46A 2XJKA 3KH3A 1SXNA 2NNXA 2WYZA 3LTVA 1Z9NA 1YAZA 1EJ8A 1OZUA 1PTZA 3HOGA 4FF9A 5KBMA 4BD4A 5KBKA 2WKOF 4A7GA 1XTMA 2Z7WA 2AQTA 2ZKXA 1YAIA 1JCVA 3K91A 2XJLA 2APSA 1SRDA 1OEZW 2AEOA 3KBEA 1F18A 3L9EA 4L05A 2SODB 3H2QA 1U3NA 3KBFA 2ZKWA 3KH4A 4OH2A 2AQSA 1BZOA 2Z7ZA 3HW7A 1P1VA 1AZVA 2VR7A 4N3TA 1XSOA 1IB5A 1XTLA 1N18A 3GZQA 2E47A 4N3UA 1BA9A 2VR6A 1OALA 2WWOA 2LU5A 3ECWA 1UXLA 3ECUA 4MCMA 1SDYA 2AF2A 1PU0A 4A7UA 1KMGA 2C9UA 1JK9A 2Z7UA 1S4IA 1SXBA 4A7GF 1E9OA 2C9VA 1UXMA 2WWNA 1N19A 3F7KA 3F7LA 1EQWA 3L9YA 4A7SA 3GZPA 3GTVA 1COBA 1DO5A 3GZOA 3MNDA 3QQDA 1E9PA 1E9OB 1F1AA 1L3NA 1PZSA 4U4IA 3CQPA 3T5WA 4MCNA 1Q0EA 2WYTA 1IBDA 1SDAB 3SODB 1IBHA 2C9SA 1E9PB 1QUPA 3GTTA 1MFMA 4A7QA 3CQQA
chains in the Genus database with same CATH superfamily
3EKCA 5DZLA 1FA4A 4NT6A 3EYVA 3T6QC 2V2WA 2A4CA 4B27A 2AQRA 3QNXA 5I8KL 5FYJL 4UQBA 1IGFL 2WLLA 4M93C 4PYHA 5EUOE 1W72H 5D9SA 4OD2A 4AM0A 2VDQL 5HYQB 1BVLB 3K2MC 4LEBA 1F3DH 4I0KA 1OV8A 5GGVH 2WVTA 4KQ4H 3RTQD 8FABA 5FDWA 3TA3C 2ADJA 4G1MB 2OYLA 4AH2A 4NLHA 5EORL 1AZBA 2QELA 4KKZA 4P2YA 4TVUA 3KJ4C 1GAFH 3D25B 1G9NL 3QEHA 3IS1X 4MXWH 3HI5H 4JG0L 5JIKA 2IH3A 3OAWA 5I0WA 2MWCA 3SE9L 4UZGA 3IJHB 3PJNA 4WSGA 3DPBB 1D5XB 4R0LC 1RSFA 5EN2A 4JGJA 1OAZH 2B4CH 2N7BA 2AMGA 4TL4A 3T0EE 4TSCH 1M3IA 4DEWA 2VIRB 3FQ2A 2YPVA 1F3DJ 4G8GE 4XWGH 4F9PA 1F6AA 5F7LB 1NUFA 3OC8A 1RZKC 5B21A 4XI5C 3C5XA 4N20A 3QS3A 4FI6A 1NGYB 4R96B 4UT9L 5DC4B 1FZMB 2C3VB 1FCGA 4BK5C 4YNYA 3HZMA 1H6TA 1LMIA 3NESA 3Q06A 1CFVH 1ECYA 4YHYB 2CLZA 2EE9A 3QHFL 5FF6B 2Y5TB 3K6FA 2VB5A 3KH4A 3P4MB 3PQYE 1J1PL 1A6TA 2PR4L 4OAWB 3ZZSA 3ZX1A 4OKVA 5C08B 4NRZB 1CD0A 4Z3IA 2WLJA 1MZZA 4BHUA 1P4LB 5D7JB 1WBXA 3G6DH 4XMPL 3JWOH 4MNQA 2K8MA 4KRPC 5KJRH 3QI9C 2IAAC 3ECUA 2IVFC 2J20A 4HJTA 4BH7A 1WG3A 4XP4H 3ABMB 2JTYA 3QO1A 2DI7A 3TTYA 4NAJA 4A7GF 1WSST 4EN3C 4N2EA 1MNNA 2ZF9A 4ESKA 4M6NL 4MD4A 2WNWA 3L3GB 3LKPB 1ZLUK 5J1AA 1ANUA 2DIEA 1EFXB 4UBDC 5J12C 2ZONA 4U4IA 4HCIA 3TGXA 4K07A 3EYUH 1UD3A 3RKDC 3KW7A 4BWUA 5JR1H 2IH1A 3M1BB 1REIA 2JMRA 4XN2A 4TSAH 1CB4A 2F53E 3X1GA 3FPYA 2BXYA 5D6DA 3R8QA 1HT6A 4NFBA 3QUYC 1HN1A 4Z8FL 3UTOA 4XC3L 3VI4A 1DVQA 3MV11 5CEXA 1JYVA 4OM1L 1GHFL 4JE0A 1HCFX 1D6EB 3A23A 1NBYA 4E0RA 2KI6A 2Q0ZX 4HISA 4GQZA 2Q86B 3RPIA 3LIZL 3S3SA 5GZOC 3INUL 1CMOA 3U4BL 1QLFB 1SPDA 2QQNH 4P2QA 3S0PA 4MQ7B 4YSPA 4DKFL 2IALB 2NLJB 1SUJA 1QLEH 3ATEA 4UUJA 4PV8A 5DJDB 1PZUB 5F88A 3HE7D 1SZNA 4P46D 1QATA 5HDWA 4EZMA 3N44B 1OCZB 5T1DH 4XVSH 1GKEA 3D18A 5EC2A 4ZOBA 4B9PA 2KDYA 1MIEH 2EIDA 4MA8H 2J1XA 3KPPB 1H6FA 4IMKC 4PJ7A 1BD2D 2CO3A 4X6FA 4KMQA 2AQTA 5GRWA 2QVFB 1YEIL 2YMTA 3FHEA 4X7DC 3PY9A 4FULA 1E7UA 2Y7SA 4K9JA 6TAAA 4KRLB 3VGAB 1T2QH 5DZ9A 4QXTA 3H2QA 4BFOA 4EDXA 4JG1H 4N25A 5B22A 4N8CH 2P5EB 1OAZL 2B4CL 5JQ6H 1YUHB 1TJXA 2WQWA 1EVUA 2WXPA 4FI7A 4TSCL 2WVVA 4AJYV 1T5WB 3CIAA 3EJQA 4ZX5A 5HGDA 1A6ZA 4MZ3A 1INDH 3DRTA 4NWUH 3IMSA 2IAND 2NX5E 4W9GC 5L8LB 2V4LA 5IVXE 1BZ9B 1E4WH 4D9QD 1PAMA 3RIAK 2VDPB 2J21A 2FH8A 4WKZA 3QULB 5DJZB 5IG7B 1I85C 3BEWA 4P4KC 1WAAE 5BJTB 4OZIE 2DQMA 4GXUN 1UWFA 1K72A 1ORSB 3ZE1F 3EYQC 4A2DA 4GMSH 3IYLW 1KGYE 5HSFA 1W0WA 4NO5B 1BBJA 3VXNB 3ZKMD 2DZEA 2BW4A 1WA2X 3QDMD 2YD2A 4G8GD 1VESA 2ZOKA 4UAOB 3HBPA 3G6DL 5I76B 2Y7MA 3JWOL 3FQNA 43CAA 4Y9CA 4PCKA 5DQ9B 2VC2L 1VCAA 2ZWKA 1MAMH 3N5AA 3ZHFA 3QZNA 1FNGB 4DP7X 3B34A 3QA3A 3OKDA 3GSUA 1DQQB 3IFPB 4GXFA 4KI5E 3QQ3A 1I1RA 1BD2A 2W9EH 2OMUA 1NCTA 1ZJBA 1UWGH 3B6SA 3PWLA 4HLZH 4OUUB 3FFDB 4FXKC 2OULB 1N6QL 4LGRB 3CSPA 1ETJA 3G08A 3VXMB 4M1GH 2F54B 3OPZH 2VXTH 4YSOA 2VN6A 1RJZA 2ZCLH 5JR1L 4DP5X 5FOJA 3FQXA 4ODVH 2EE6A 1KC5L 3EDEA 3KPTA 3NRFA 4IU3B 4MAYA 2CO6A 4TSAL 4M02A 5CWSB 4YO0A 4XNUL 2AV7A 5HI5C 2OK0H 5IUCA 2O6CA 2IANA 1OZTG 3V0EA 5HYJE 4M43L 3GDCA 3D06A 5TDOB 4GG6A 3FT1A 1WS8A 5CJ8A 1EERB 3L3JB 4Y4FB 2R27A 5BW7C 5C0JA 3DURA 2MCPL 2FWOB 4FXLA 2DQGH 4AQAA 1KXQA 1S5HB 4LIQL 4QF1B 2FO1A 3E8UH 4KJWC 2Q8AL 1NSNL 3HAEH 2WXJA 2N1TE 2QKIA 2GITA 3RU8L 4XN4A 2E6JA 3TBSB 5HHQA 2B4CC 2OXGA 2JLLA 2KC0A 2YJQA 4EMZA 2F53D 2DPKA 2VLKA 5EPMB 4GSQA 1TFHA 2PTTB 3X2QB 1RK1B 2VAJA 3AB0B 3S35X 3K6SA 3NUKA 3MYZA 2R1XA 1KJ3L 1B2WL 4KZ0A 4XO4A 1E50A 2VRAA 1QHQA 1D7FA 4G80B 4UOQA 4X99A 3H85A 1RZGA 3BH9B 3LHAA 3ML9A 3OMIB 5T1DL 2W91A 1QMUA 3K74B 1X4YA 1MCWM 1ZPUA 4ZUUB 2DQFB 2IBZY 2NY6C 3PIQA 2PCXA 4H0HB 1R3HA 2AJ3A 1FVDA 3LIZA 5GGRY 2EIBA 4OCXL 1UGNA 4OCLC 4BQBA 4K3EL 4B6ZA 2IOMA 1JN6A 4JFEA 5ICYA 1X5IA 4FNTA 1OARH 3JWOC 2X4SB 1WBYB 5F1OB 3QEUB 1QO3B 3MRDA 4NN5C 4FXKA 4N8CL 5DYFA 4YK4C 4MMXB 5JORB 5I71C 2X3CA 5A16B 1OGAB 2F7OA 3DC0A 1JNNH 4JFXA 3VXTB 4PJFB 1SDDB 1INDL 4LP4A 4G1EA 3GNMH 3Q7JA 1TMCB 2KUTA 3HN8A 3P73B 4ZFFA 4WI4A 4MQXD 2MOQA 4KAQH 4NCDA 3NIFE 1K6QH 5SX5K 3VFVA 3PFQA 1HAWA 4MX7A 5DWPA 2IFFH 1PZCA 4B9KC 2A83A 3B2XA 3K72B 2VR8A 3DRQA 3IRPX 4NFCA 3RVTD 2ALWA 3DIFA 3ASNB 3LN4B 4NO0D 2R2CA 1OTUC 4XPGH 3RGHA 2HP4A 3PWVA 2WZ5A 4FEMA 1PZ5B 1JNLL 4AJWA 3JV4A 2G9KA 5LGHH 3W5MA 2HJFB 1JYWA 2NX5D 4YUEH 1F11B 1ADWA 4JCLA 1MAML 5A2CA 5AOMA 2ZKHL 4Q97A 4NO2A 5FFLA 1PEZA 1JWUB 1IGIH 1CBJA 5DJXB 4V1DE 1YYCA 1UWGL 1DQMH 3F64A 4YWGH 3E2HC 3SCMD 4ONHA 1OHQA 2XXMB 3BN3B 1Q9WA 43C9B 4URKA 1L6XA 4RGNC 4Q2ZB 1KJ2B 3D39A 4HXAH 2IGFL 4PJ9C 3PGDB 1U3YA 2VLJB 2W81C 2X4QB 5ADPL 4YXHH 5F7DA 4IRZH 4NZUH 3FJTA 3G5WA 2O26U 3NEEA 5TE7L 1YYLH 4ODVL 3SJVA 2CHNA 5T8IA 5IESL 5GXBB 1U8IB 3TIDA 5D1ZD 5IP4A 3ECBB 1QWUA 1JPST 3AROA 2ISDA 5JNYA 2FB4H 1I1YA 1OCRB 4OLEA 4XHQA 1CL7I 3BAWA 1OGPA 4GG8A 1L5GA 2WXRA 3LZNA 2Z31D 3ZL2A 2BHYA 4X7TA 5C0EB 2DJMA 1ZVYA 3E8UL 4QD2E 4G42A 1RUKL 3NJIA 3W3BA 2BP0B 5F0PB 3UAEA 2P8LB 3LH8A 4FLSA 3QHZH 4NWTL 2ZPKH 3FQWA 2Z92A 5DQJB 3TPUA 1NMCB 4NQDE 2CMRH 5HYJD 3HRZA 4HETA 1RIHH 4LOUD 5CEZH 5K9KB 3A47A 1DUYA 3MROB 1KXVA 1F86A 2GC4C 1TCMA 1HH6A 1Z1WA 2OMTB 1U36A 3MLUL 4HS8H 4HSAC 2OMYA 2Q8BH 4QO1B 2C1OB 2YUZA 3POCA 2Z8RA 4UI2A 4XWOD 5HHME 5I1HH 1GGCL 2CDGA 4AT6B 4HKXA 2DN7A 4OCRL 3J2PA 1LTXA 4PLKC 4OVUA 3L4ZA 1MWAH 4AQEB 2NXYC 4G71B 1BFVH 3LX9A 4IRJA 4RX4D 3T6WA 3UEQA 4D2NA 1MI5E 5KVDE 2X6CA 3DDGA 3ZBMA 5HHVH 4BZ1L 3QZBA 1GY2A 4RGOL 4G6MH 5GS1C 1OARL 2XBZA 2HTKC 2Y36H 4I77L 4AW4A 2YD0A 2W0LA 1RL1A 2CLRB 2JCCF 5EZOH 3EXLA 4QHUA 2VMFA 1AXTL 1OAQH 4TVPH 2ODHA 1JNNL 3I2CH 3HUJF 1AQ8A 4ZAKC 4WHYG 3C09C 3GNML 1WK0A 3HI1A 5I1LB 1UD2A 2FUTA 2Z31A 4ATTA 2QPUA 3HG4A 3LS4L 5F89A 4Q4IA 2G0LA 3MZGB 1K6QL 3WO4B 2YAHA 2CR3A 1QSED 1WAPA 1E2VA 2O61A 2JKJA 2ROXA 4ONFL 4U1KA 5CSZB 3W39A 2HRHA 4MBOA 5DJ2B 1UC6A 4GB9A 4ZTPH 2P8MB 1R46A 2VDRL 1HWWA 1YY8A 3IEAA 2VMEA 3GIVB 3NIGB 4Y4KC 3UTPE 4HJUA 1CF8L 4RZCA 4KHXH 1DVFA 5JW5B 1EXGA 3TBCA 2Y7QA 2ZCHH 2GI0A 4RISH 5CGYD 3SSGA 4LL1A 4N28A 5JZ7D 4K9EH 4LCWB 4X4MA 4W9EC 3K91A 2XJLA 3M8OH 4L1SA 3V0VB 3EO0B 1AKJA 1LO4L 1IGIL 1Q0YL 2AV1A 2OFQA 1IEAB 1BZEA 1WCQA 2XACC 4Q7DA 1AHWC 4HUXB 4M6OH 2AQ3A 4NN6C 4R4FH 1KCRH 3WU1A 4JM2F 3E3QC 1NIEA 3MOBH 3E1ZA 5CIPA 2B77A 5K1VA 1TETH 2GEQA 4PB0H 5JA8B 4HXAL 3FSVA 1DSYA 4BRVA 3AG3B 4Y1AE 2X42A 2E9BA 2CO1A 4E9WA 3Q48A 1BV8A 4IRZL 4NZUL 1RZFH 4YSEA 5LN8A 1RLBA 1UM4H 2FBJH 3B4NA 1INEH 4WHTA 3EOTH 1YYLL 4AEHL 2VABB 2X10A 3FU5A 2ATPA 3P9LB 3ASWA 5D71H 3BKCH 4WFEE 1UOLA 2R7EB 4V1DD 4C8XA 2PW2B 3T3MF 2FB4L 2PCPB 1FF5A 2Y2TA 1M1XB 1NINA 3T0DA 3K2IA 1ZS8A 3GZPA 1AMYA 1RZ8B 1H19A 1QSEA 2E9WA 4L29A 5EHFA 1QABA 4IIQC 4KK8D 5EEZA 4G43B 5C09A 2BSDA 4KNUA 1AIFA 4NAMA 1QFUL 3ESMA 4JPWH 3UPRA 3QWQB 3FTSA 3EO1B 1OTTC 1U92A 4K2UL 4N5EC 5I74B 4GS7B 3D12B 4UQIM 3TO4B 4AEIL 3ALPA 3HN5A 3L9RB 3QHZL 2FSEB 1CCZA 2NQDA 3CSYA 4NQXA 5GRVL 3RWFB 2XN1A 1II4E 1OT1A 2QADD 2ITEA 3CFDB 1OE2A 3F7VA 4N9GA 3UIYA 1P53A 1JPEA 3POHA 3K81A 2AJVH 1J0JA 2CMRL 2WTOA 3FRUB 3OXRB 3R06A 4L5FE 5HJGA 1KBVA 3NCYS 3RL1A 4X4XA 1PX4A 3TU6A 2ZKYA 3HMXA 5IJCC 4MAZA 5CEZL 4I2XB 4Q9QH 1YQVH 3DA0A 3QDJA 5A6LA 1WZAA 1AHMA 3QJVB 4O2FB 4QRRA 3AQZA 1KIUB 3I6KA 3LKRB 1NLBL 4H8WH 4S10A 4AQ1B 2Q8BL 4P49A 4E41B 5I1HL 4G9FE 3L5XH 5L4FA 3DYMA 3CFQA 1BIIA 3Q8EA 1N10A 3QR2A 1M6UA 1MWAL 2HLFC 4I3GA 4JM2C 1O75A 4NQDD 1L6PA 1XH2A 3DJTA 4OT1H 4Q89A 3MJ8A 3UPCA 1OGTB 3WCYA 4G6ML 2WZPD 2H1LM 2VXSL 3GIZL 2Y36L 5DK2A 5ETUA 3W82A 2EUWA 4A2FA 5D4HA 2QHLA 4FMKA 3O2VH 3QUXA 4PG9A 3U7WH 5C0GB 5C0DB 5IKCB 3LRLA 1WE5A 1XGRB 3QEQA 5JOFB 3GLZA 4X5LA 3DJ9A 5KBMA 5HVHB 5G4OA 2EXYC 2CHXA 4NKIL 5HHMD 3BRDA 4MS6A 3RHWK 4IK7A 3OKEA 2V33A 4BKSC 3QORD 4X8XA 1PIFA 2WJ5A 1K9TA 4PLOB 2BZ7A 2JK5B 5EEWA 2YXWA 4KDTC 4Y5XB 4Q6IC 4XN5A 1BPLB 1MI5D 1JF1B 1H0DB 3NJLA 5BZWB 1U41A 2VDLB 4JJ5B 3NT0A 5CJXC 5KUMA 1OAUH 2GPZA 5DRZA 4JB9H 4L4VB 2CKBB 3KPQA 3SKMA 2WNKA 4MYWB 2XPGA 3MJ6A 3RZCC 3U83A 1DR9A 4Z7QE 1KIRA 3CXHK 3IU3B 4KHXL 4BZ1A 3SYOA 5GGSB 5F7UA 2J71A 2NYYC 5I16A 3B7SA 2AZAA 2X2IA 4RISL 1KELH 2ITDA 3S88H 2O5YH 2KPNA 4EN2A 4JREB 4K9EL 3PE9A 5T3ZE 2YD6A 4LSRH 5G4MA 1ADQH 3M8OL 1DE4A 5DS1A 2H8PB 4GYBA 1CDHA 3QUZD 1RD6A 4X7CC 3B7RL 3NABH 2CPCA 4ZXBD 2Z4QA 4AMKH 1A3RH 2O6FA 5E4OA 4LMQE 3L1GA 2FEEI 4U2ZA 5CLWA 3TBYA 1KCRL 1JXGA 3UTPD 3SPJA 4EI5A 4MQTB 1E5YA 2P49B 2WZPA 1E8XA 5DZJA 5KEZA 1N0XH 3H0TA 4TULL 4ZYKA 3WDIA 1BQHB 1SYSB 3AG1B 2DWEB 3ARDB 3UL4A 3C8KA 2BO0A 1UM4L 2IG2H 4I9WE 1INEL 1SXCA 4P23D 4CW1B 3VCLA 3BDXA 1MHHA 3EOTL 5GSVA 3VXUE 1XAKA 3QJZA 3AABA 1LEGA 5D71L 1ORQA 3BKCL 3WIAA 4K0OA 4PWIA 4FABH 4N5UA 3BMWA 2PYEE 3RPKA 4JO3L 3NN8B 4LSTL 1MW1A 4L1TA 3VFTA 5AVUB 1OPGH 5FYLL 1OWWA 2H1PH 4ZUSA 4KTDH 4QHLA 4FQHB 4N90D 4Y1AD 3HFFA 4R97C 3QIBD 2D0HA 1Q1JL 1N5YH 3SY0A 5PAZA 3VD3A 4MZIA 4NS0A 2XZQH 4WWNA 3V0FA 3GUTA 3QH3A 2Y7LA 4KDTA 1JWSB 5ESQB 3B2VL 2NR6D 1QP1A 2JCWA 4H0IA 4WFED 5FOBA 2AJVL 2Z1PA 3US9A 4BQ6A 3MV9E 2E6QA 4FNLL 5DC0A 1MIMH 1NCWH 3PP3K 2EYSB 3ZQXA 3RZCA 4Q9QL 3OAYK 2OR7A 4PG2A 2KS0A 3QUZA 3J27A 1RZQA 3BPNB 1YG9A 3TO2A 4H8WL 5KAQF 2R1WA 3QP3A 3IS0X 4FE9A 4Q4EA 3RUGE 1V5JA 5L4JA 1QFHA 3L5XL 1NCAH 3L16A 2RQ8A 3WHE0 1AYRA 3MRIA 4JO4H 3VXPA 5KZCB 5DZVA 4PU2A 2AEOA 5E95B 1HEZA 1JGDA 1THAA 1WAEA 3HZYA 4NZRH 1MF2H 1RULH 3C6SA 3KCPB 4OQTL 4OT1L 5EO1B 5HHOD 5AOZA 1OAYH 3P40A 4HU2A 4K9EC 3EUUA 4HGKC 4R8WH 1LWJA 2DYPD 2BZCA 3O2VL 3U7WL 5FUZH 4RNRA 1OF2B 2CM5A 1IKFH 4R2GB 5E9DD 4PJEE 4PWEA 4QOKB 3U0PB 4G9FD 1KDJA 3KD4A 5FECA 1HU8A 1TR7A 2BOLA 3D30A 1TJIL 2GK0A 4XPFH 4X50A 4GKLA 2A74B 5DSCB 2XTJE 1A3ZA 1FHNA 4CVXA 3DV6B 3S5YA 3QNZB 1S7XB 5DRWB 1E5UI 2DWYA 5C7ZA 1G0DA 1E9OB 2VLLB 4KDWA 2FGWL 2XQYA 1HHJB 2N3JA 4PLNC 1QFOA 4NJ9H 1TQTA 1XZ0B 4B0MM 4YE0A 4OGAD 4AE0A 2Y1AA 5PCYA 5I5JA 1KELL 3S88L 1M1SA 1A4AA 1URLA 4BSVA 4RRPA 4YZWA 4M6AA 3MLRH 5CZVH 1ADQL 1AY1L 4NPYB 2NYKA 2QMJA 3MNVA 4G6KL 2ZOWA 4NQVB 4Z3HA 1XIWA 3SKOA 1VACB 1NBVH 3JWNE 2HVJA 2WANA 1YPZA 2YGQA 5DEFB 2WZ0A 5EV7A 4AMKL 1A3RL 4NGHH 2APVA 3QXAA 4XBGB 5HYEA 2OS7A 4UM9D 4J6RH 3RWEA 3TZVD 3L3HB 4D0DA 4M62H 5HHOA 3KPSA 3AREC 1A3QA 3AJ7A 1E5BA 4OZHB 1EHLL 2WGXA 1N0XL 3DNKA 1CFQA 5I8EB 3GMOB 2DYPA 3DGGB 3IJ9A 1DBJH 2IG2L 5T3ZD 1BDYA 1FVEB 1ZHKA 1TVBB 5E9DA 5I1CH 2Q3XA 3QDHA 4HJGB 2A6IA 2BNQE 4H8WC 4XBMA 5BZDA 1EZVX 2GJPA 2B20A 1JNHA 4WDIA 4EXKA 4KO9A 3F7QA 4JK0D 1QEXA 4L8BB 4JDTL 4L8DA 2DH2A 2DMGA 4IRSD 1OPGL 1YAZA 3TYFB 2F68X 4JKWA 3RB7A 1NQBA 3VFSA 1OAKH 1JYXA 3Q5TA 3KLQA 5IEHB 1A9BA 1F4WH 2XLLA 3DI3B 4MD5B 4OCNC 5EU6E 5IBUB 4NHCL 5FLUA 3FSAA 4I9WD 5JHMA 4KMTH 3IDMA 5EO0A 1HCYA 1LWRA 1MNUH 2XV0A 1T66D 3ULUE 4IDLA 2LU4A 2GJZA 2SEBB 2XKNA 3CC1A 4W6YB 3HNSL 3Q9PA 1H8OA 3FUKA 3U9PH 4XE5B 2A9ML 2XQYG 2V37A 3CJJA 2X7LB 3F6LA 4X6DA 5JW3L 1MIML 1NCWL 4NQSA 1I7TA 4JQVA 2VWEE 4UV4L 5D1XB 1LXMA 2D9CA 2BIHA 3HG1B 3ZDZE 1NDTA 1BZ7B 1TTGA 3GZQA 4RRPG 2FHBA 2EKJA 4DOHB 2OCFD 4UM9A 3T77A 1VFAA 5I19H 3NZ8A 1I8LC 1U8NB 3IRZA 1NCAL 1ACXA 4HUWA 7PAZA 1QBMH 2XOTA 1S9VA 2B5IC 4WK0B 2F1AA 5DC9B 4UTCA 3MJ9H 1RULL 1AQKH 1VZIA 3P9MB 1D5BB 1Z5HA 2IADB 1SVBA 3DVGA 2DIJA 3MV9D 3FCBA 3P3RA 5JOPD 2XFXB 4D94A 1E3XA 3ESPA 3AZUA 2E8ZA 2GCYA 4NERA 1AQDB 2FZ3A 3LKOB 3BC9A 1AG6A 1KSRA 4MSWB 4OGZA 1JGEA 1IBDA 4XPHH 4MJ4A 2UWEE 2JKRM 1BF2A 3X14B 2AFNA 3CVHA 5TH2B 1GMIA 1J9CT 3O11B 4JMXA 1X9QA 3X1BA 4CSPA 4PGEA 2Z4TA 4HVBA 3SIKA 4MHHI 1OSPL 3FKUS 1I8IB 4JRLA 1QHOA 3RVUD 3PV6B 2J43A 4K5NA 1S7SB 2ALAA 3GXFA 3KDMB 1B0GB 1HL5A 5FO7B 1UVQA 1IFRA 2J57A 3W2DH 3UAAA 2BSED 2ETWA 3V4UH 2FJHB 4OQTA 4A04A 3ECVA 3MGOA 5A2FA 3DV4A 3KG5A 3SQBA 1Y0LA 4CJ1A 4I18C 2J5LB 5DVLA 3CFTA 4XVUD 3ZVVA 3KJ6H 4DSYA 1PLGL 1ZT4B 4NCC1 3FOLB 3O0RL 4ZDHB 2R23A 3SDXB 3VI3E 1B0RA 1QRNB 4Y8AA 3C2AH 5T1MB 4QDGA 4U6HB 1NBVL 5H94B 5IMOA 3TV8A 2R0ZH 3BXNA 2JXMB 3D6GA 1Y18A 4NGHL 3MRGA 1T1WB 5C0AD 1XO8A 5E5RB 2PP9A 4AEEA 4MLIA 4J6RL 5GGTL 5EZJA 5K59E 3BRFA 1U8OB 4FYSA 2RH0A 5K5YA 2HPOA 3T1FB 1E5ZA 5DMKB 4PJXB 1I8LA 2JB6A 2DQUL 2VZ1A 2K4AA 4I0PB 2WHVA 2QVKA 4OGYL 1CLYL 5BRZD 3V5HB 3S4SA 1JK8B 3WJLA 3VTMA 3KMDA 4HJ0C 3UAJD 2NXZD 1DBJL 5KAQG 2OJEA 1XF4B 2GFBA 2UXFA 3TIEA 4C59B 3RDTA 4JFYB 2LVCA 2RJMA 4RAUB 5DJ6B 5I1CL 1SY6H 3MLWH 1FO0B 4NBXB 1O9VA 2VR5A 4Z0BH 1EO8H 1QSFA 1I7ZA 4HIIA 2MNWA 5SWSE 3BP7B 1U8QA 4QAMB 1R5WB 2H47C 4N3TA 4H1LH 3QEGL 4PJIA 2I9LA 4U3XA 4M7LH 2YPLD 1G7MA 1PLAA 4QRTB 1I4FB 1JERA 3ZKNC 2BSEA 1YY9D 5FUOH 2DMKA 1R24A 2Y69B 3BZ4B 4CSZA 4KMTL 3AY4C 4ZFGL 1KLUB 4QRPD 3QRGH 1L0PA 1MNUL 2G3ZA 2LLLA 2IXQB 1QNIA 3DGDA 4MRCA 5GGSY 4M6MH 3IGLA 3R0NA 1YNTF 3HI6H 3U9PL 1HYSD 1OO2A 1X7QB 3W11C 3ECQA 2L8AA 4LCCA 1NBZB 4X5XA 4HHGA 2DLHA 1GR7A 1C12A 3NFPB 4YDIL 3MRLA 3N43F 4FTVB 2XRAH 4BINA 1MG2C 2BINA 1HSAA 2VL5A 3H9SB 1U8HB 3MOQA 5L0QB 1QBML 4NQCB 3OF6A 5FFOA 2BOCB 3ZLQC 1S7UB 3ULUD 5BRZA 2IAMD 3B3IB 3DTUB 1BBDH 3QXVA 4A7TA 3S8FB 4S1DC 1AQKL 5D55A 2FYYB 4EVNB 5LBSA 2BVEA 2K9FB 3HZKB 1WBZA 3H3PL 3X3FL 3TASA 3GSNH 4OI9A 3FU3A 2A3TA 3ARZA 1KEMH 4LKCB 4DP9X 1KWGA 5HGBA 3T0BA 5GGQL 2Z0BA 3GSVA 5FHBH 3GJFK 4EDWH 1NFDA 3B9KA 1NCJA 3GZKA 4IGBD 5DD5L 2YPLA 1GVIA 2J88L 1TPXB 4LPUA 1T04A 3PABA 5DRNB 1ZA3A 3SGJA 2OAAA 3GK8H 2HPTA 1HZLA 1A6WH 2JNZA 2VLRE 1DQIA 3TFKC 5KSBF 5HDBE 1WC7B 2A73A 1T5KA 4O2EB 5ISZA 4S1QL 4X6CE 3W2DL 4PY7A 2LVEA 4QRPA 3ROOA 3V4UL 2K8QA 2RR3A 3L3DA 4QCIB 4WU7B 2DH3A 2OMZA 5IMKB 1W8OA 5I6OA 3MCKB 3GWJA 2F8OA 3QIUC 1KB5H 3HLAB 1L9TA 2DQIL 2CR0A 4RMVA 4WJ5A 1QPKA 5FUCC 4Z7WF 4ACPA 2WBJB 1A6VL 4PJDB 1SRDA 3MQIA 2E9GA 2KHAA 5FKPB 3C2AL 3TYGH 4IS6B 4FQQA 3PJSB 5C0CE 3N85H 4Q9RH 2ID5A 2UV3A 5I73C 3A3YB 4AYFB 3DYOA 1FZKA 3IETA 1PKQA 2NY2B 4S1RL 1CD1B 2YXVA 4UAHA 1FFTB 4F57L 4Y19A 4Q8BA 2D3VA 3CFCH 1CLVA 4ONOA 1JHTB 3OHXB 5ANMA 3SDCD 3D1MC 2GJ6B 3BJLA 3SY6A 3IXTA 1OALA 3JBG7 4JR9L 4OLZL 5D8JL 3RGVD 3LQAH 2GUOB 1PGRB 4XNXL 3AADB 4FLQA 4RESB 4Z7NB 2A4ZA 3WMSA 4G5ZL 5EF0A 4C4KO 4BFKA 5BO0D 1WLHA 3WIFA 3F7LA 4IGBA 3SOTA 3IDXH 4Z0BL 1A4KA 2CLVA 1UATA 2PO6D 1EO8L 3DJSA 3PREA 2Q76A 4FGMA 2OL3H 1LE5B 1TVHA 1IAKA 1CT8A 2WCPA 1TDQA 3FB7A 3L2LA 3CHPA 1JPGA 4XNQB 5DR5H 4MNGE 4U1LB 5HY9B 2Q7YB 2V9RA 4HS6A 2DWSA 5F1NA 4ZX4A 5GGTA 4Q56A 4U1HB 1G84A 3SQOH 3OAZH 3MTRA 4KROD 3Q2CA 4R7DB 3SE6A 3MLZH 3PL6D 3MGTA 5FYJE 3SPIA 3QRGL 4B0MB 1RPKA 2WLKA 4NT6B 1J11A 2V2WB 2UXVA 3QNXB 3HI6L 5SWSD 5BOPA 2R0LL 1UJ3A 2PUQT 2WLLB 3SOBH 5I2IA 1TF4A 5DHVH 1N26A 2R2EA 5IF0B 3REVA 5D9SB 4OD2B 5CO1A 4UB0L 4OM0H 3ALXA 4XCYA 3SGDI 5DLLA 2B1OA 3GBLA 1MCBA 2ADJB 4Z0XA 2XRAL 4AH2B 4EZJA 1Z2KA 3L2NA 2ARJA 4EF3A 5I5IA 3DTXA 1JUFA 4YSRA 4UF7C 4RMWA 2L7JA 5AVVB 4JN1H 5FM5O 1IM9B 4AZUA 3GKWH 4UT9A 1IUZA 1ZANL 1F4YH 2JFCA 5CKAA 3L7EB 3LN9A 3WFCH 4GMTH 3IGFA 4XMTA 3GBNL 4YIQA 4XZUA 4F8LA 2X4TB 1NGQH 5EN2B 2H0PA 4C83A 3FZUD 4KZEH 2G2NA 2X6MA 4FF9A 1V7MH 3GSNL 2PO6A 5AAMC 3E80A 4PJ8C 2NT1A 1F6AB 3CLFH 5FHBL 3CZJA 1TYRA 5IW6A 4OSUH 2Y5EA 4XP6H 5ICXB 1LLAA 2UZXA 3GK8L 5E0QA 3P3SA 4YNYB 5K39A 5FA4A 1P9MC 3FH7A 3NRPA 2NY3C 3HZMB 4GP5B 1BMWA 1MHPH 5E5UB 3MBWA 1SLXA 3MAWA 3MLVH 1TJGL 1TG8A 2CLZB 2Y72A 3FBKA 2X1PA 1FYTA 3GBEA 3R4RA 4HV8B 4RAHA 4XOEA 5GIRA 3CPLA 3TH4T 3L3OA 3FUMA 1A6TB 1BQLL 5EIIB 1KGWA 1IVTA 2HH0H 3GXUB 4JJHA 4NOBA 4J8RA 4AENB 4CVZA 5I66B 3HC0A 5AD0A 1WBXB 3M1CA 2AF2A 3AAZA 1IQWH 3V8CA 1H3PH 3ZYOA 1R33A 3TA3D 2HT2C 4FFYL 2O5ZL 3KWXA 4WGWB 3VXRE 4BH7B 3TYGL 3OWRA 4DTGL 1EQWA 1U2YA 2VLRD 3N85L 4P2OD 5F3HA 3WFHB 5BQ7A 2VH5H 4Q9RL 1E30A 4HF5L 2Q6WA 5TJWK 5CN3A 3KYAA 2YQBA 3CFCL 4GQ9L 5AG9A 3B9DA 3DXAD 3EGXB 5FGBC 5T3XL 1I9RH 2BIPA 3ROLB 1KJMA 5HYIA 1BW8A 4PTUA 2JELH 1FL3A 3L3KB 3LQAL 2CKNA 4EUPA 2IDCA 3QXUA 4BIKA 1MHCB 5AW1B 5KSUB 3CFJA 5C0CD 1DVXA 3DBXA 3OZKA 1TZ8A 3DIVA 1D5MA 3IDXL 2AJUH 1CUOA 2F5BL 5DZAA 3WUWA 1P5UC 3VI4B 2OL3L 3JV6B 4AL8H 1KTRL 1YVLA 4IBUA 3B2MA 1NZRA 3UMNA 2J55A 1MRFH 1NBYB 5DR5L 4E0RB 3SYQA 3RPIB 2RQEA 4OBRA 4HWBH 5K1NA 2XA8H 4WU5A 3U9WA 3SQOL 4L0ZA 2V9TA 1CIDA 1HNYA 1P9MA 1MJJA 3JSSA 3R1GL 2ZX6A 4DZ8A 5AL0A 1IEBA 4UUJB 3K80A 5IQNA 4FQ2H 1QSZA 3MSPA 2NNCA 3EJYC 4YBHA 3SOBL 3QI9D 5EWIL 3VD0A 1SN2A 2W1NA 2XG4A 1RP9A 3C5ZC 4OM0L 4JUTA 4P2OA 1J88A 5JIIA 3EOYG 4N0CC 4MXVF 3D18B 5EC2B 1T1XB 1QR4A 4F20A 3VD5A 3ARSA 3VYNA 4WO4C 2HZHA 4FX5A 4PRID 3FUHA 5F7NC 1DBKL 3DXAA 2YGNA 1XFPA 4X6FB 4OGXL 5DVPA 4JN1L 1FSKB 4A2GA 1SUHA 5FB8A 4DPBX 1F2XK 1F4YL 4Y2DA 4YX2L 3SO3C 3NCBB 2XXCB 5I8CA 3EH3B 1XWVA 3IJEB 3IDYC 1P1VA 2I9TA 5I1IH 4QXTB 4PB9H 2Y4SA 4EDXB 4AVHA 3DHUA 3QUYD 4HIJA 1KN4L 1HQ4A 3WFDH 3X12A 4EOWH 2YZ8A 2VYRE 3WYRA 3T08A 5I17A 1T0NA 1LO5A 1UURA 4ZW7A 3CLFL 3SGDH 3DRTB 4WV1C 1SF5A 4UV7H 4P5TD 3V95A 4HFUL 5E6ZA 3TJEH 4UILL 4XP6L 3WUWG 4F7TB 5E7BA 1V3MA 1Z3GH 4OB5H 5BVJA 2OV0A 1DO5A 2J4WH 3FUEA 4WKZB 1DZBA 1JZ3A 3KLAA 2CJUH 3LQAC 1UWEL 3BEWB 1O7VA 3HC2A 4ZW6A 1JF6A 1ZV5A 2XZZA 4HXBH 4H44C 1GC1H 5C8JA 3WIHH 4FAAB 1XGTB 3T2NH 2ZUWA 1S9XA 5FW7A 1YUKB 2WCGA 3D0VA 3HE7B 3LKSA 1UG9A 4O02A 4P46B 1MCOH 4XP1H 1KTLB 1HZHH 3HN3A 1IQWL 1GZPA 3FQNB 1CDJA 3D5OF 2KYIA 2K4WA 1RK7A 3BSZH 1DEEA 4UNIA 43CAB 4BV1A 1PEWA 3KL0A 4ILDA 4GI6A 2K6ZA 2WQ8A 3QA3B 2PTVA 4PRIA 1T80A 3OKDB 3B43A 1CLZL 1ZHBA 3UJTH 2VH5L 4W81A 1BD2B 3PWLB 2OMUB 3GSXA 5IBTH 3KWUA 3C5ZA 4HBCH 4HZAA 1TEGA 1VPOH 1AFVH 3IJYA 1DQDL 5IGXL 4EQ3A 5T33H 4MXQC 4WO4A 1I9RL 5KS9E 2XVGA 1VDGA 2ZSWA 5EUOB 3HR5B 3EYFA 2JELL 2Z0UA 4DQOH 1ZS2A 2QQKH 4BFFA 5BS0D 3HMWH 1RJZB 2WNGA 2CHZA 3BSGA 4OKDA 4M8QA 3FQXB 3QDGE 1KXTB 4FNQA 3VXOB 1VADB 2C4FU 1F1GA 4NZDA 4YO0B 2AV7B 1SLUA 3BUIA 1ZSDA 4UINL 2FYVA 3QW9A 4P5TA 2IANB 2AJUL 3QHTC 5EU7C 3VFRB 1LE9A 2VJ0A 4GSUA 4X80H 1WIOA 4FFYA 4AGMA 5HXMA 4LIQE 4PP1D 5C0JB 3DURB 4KQ0A 3QZWA 4PFEA 4AQAB 4G7YH 3DO3A 2ICWI 1MRFL 5I26A 3RDJA 4DZBB 5J89A 1JWMA 1JIBA 2B3IA 4WV1A 5CCHE 4HWBL 1A65A 2IQ9H 1Z9SB 3EYQD 2QKIB 4RGNE 4KUZL 2B2XH 5HHQB 2OXGB 4E9QA 1CDBA 1CU4H 1GGYA 3D4YA 3V6ZB 3QDMB 2VLKB 4XBPA 4QTFA 3LZLA 1YEFL 1U3HC 2Y1YA 3K6SB 4GUQA 3L8QA 3QRFM 1KPRA 3GF8A 3RVXC 2GT9B 3V9FA 1UADC 3ZKQD 1MSPA 4M5SA 4CMMA 4FFZA 2P44B 4CC1A 1IKOP 3APFA 4GXUM 3GS7A 1ZEAH 3PIQB 4DESA 2F58L 2G3XA 1R3HB 1BGXH 1F41A 2AJ3B 4OZFH 5ENWB 3G6JF 5L7XL 1LEKB 1Q4NX 2DBJA 5BS0A 3WEMA 4RVBA 5CGMA 1RJYA 3HNTH 4X5RA 3UERA 4DKTA 3WKYA 1ET7A 4L0YA 4JFEB 5D1QC 1D9KC 1LNUA 2DF3A 3O3DA 1I9EA 4LFHD 4CVWA 3VWKC 2OMVA 4PB9L 5E6IA 1TFPA 5HI5D 1EANA 3QRBA 2EDHA 3V0GA 3WS6A 1W0YT 4ZMOA 4ZO7A 3MR9B 5DUPL 3STBA 2QV2A 2P5PA 3CSTA 1FFOA 2GTWA 2EVGA 4JFXB 4KZDL 1PY9A 3D08A 3EO9L 4LLVA 1IBGL 4D3CL 2CAKA 3RBGA 4N2BA 3KBPA 3TJEL 2ZNXA 4ZFFB 1GGIH 1NC4D 2C9QA 5ADOH 4KJWD 1VEPA 4OB5L 1U33A 3ABGA 4HOZA 4MX7B 1M7UA 1KYDA 1LK2A 2H3NB 3I9AA 2C5DC 4NUQA 5D96C 3QZWG 2BSTA 3IM1A 2F53B 1K85A 4M5ZL 1B3JA 2A83B 3DRQB 4HXBL 1EDYA 4LNRB 3V10A 2J6WA 3DIFB 1B4TA 1LO2H 3T2NL 3IDIB 1MN4A 2B15A 3O3BA 1PZ2A 1PBYA 1JGVH 3PWVB 4XP1L 1MCOL 1HZHL 1I1CA 2BC4B 3JV4B 4GQPH 4TRPH 4AL8C 4XNDA 2YN5A 3HPLA 3UABA 4X9HA 4TLKA 4JHZA 4F7EA 3U1QA 1BFOA 5C0BA 3OZ9H 2PKDA 3T65A 4NO2B 5AAWA 2NNXA 4XN9A 1NCUA 4J4PC 2CU9A 2Z91B 2KZWA 1Z3RA 1BXUA 1ZV9A 4JL2A 4ONHB 3UBXA 3I9GH 3DSNA 1AFVL 2WLYA 5BNXD 5EO9A 1S9YA 3ULVL 4PEEA 2IGTA 3O9WD 1MFBH 2XTLA 3NAAL 5F7DB 1FN4A 1U8PB 1JZFA 1YN7A 3FU7A 4AGNA 1F18A 2WYIA 1EUUA 2A99A 2SODB 1MFUA 3MUUA 4JPKH 3LMJH 4QKTA 1F4AA 2W8CA 2NUTA 2HKHL 4POZD 3TIDB 4DVBA 4LCYB 1ZY9A 5KVFH 2J6EL 3PF2A 5AW3B 5I82A 4DIXA 2P24A 4HHAB 4X80L 1P84K 1AZNA 3HIZA 4DCQA 2D7TH 4G7YL 1KTBA 4I85A 4Z7UB 3MRQA 4X7TB 4M5TA 2A38A 3VFPA 4ZUTA 2HVKB 2IQ9L 2RIKA 2PTUA 3E3QE 3QBTB 4XPTL 3V4PL 4OF0A 5DJ0A 5A2IH 2D7OA 3CZFB 1DSFH 1OTUD 1SLVA 5CNHA 4F2EA 1J86A 2EDYA 2OI9B 4RIRB 5AW7B 5IEKA 3FCGA 3EFOA 3F7KA 3FQWB 4GRWH 2ADGA 5TGBB 2VDOH 1ZLWK 2V2TB 3DSFL 3TPUB 4GKZB 3WMQA 3HRZB 3LEXB 2JJSA 3KGRA 1NL0H 1SEQH 1WZMA 5I9QB 5HYFA 2AITA 4XC1L 3HG0A 4D0BA 1Q0EA 3HNVL 4HLEA 1MHEA 1SDAB 1T83C 4HEME 2X4UA 4QXWA 3WKNA 1DUYB 2JCCE 4Y4HC 2YSSB 2CG9X 1HH6B 5DJCA 1OVZA 3BAEL 2OMYB 5D7LA 1U93A 1Q9OA 1UZ6F 4P9HL 1GCYA 3KPMB 3HUJE 5A2AA 1T0OA 4RGND 4U1SA 2CDGB 1ZEAL 1UM5L 4HKXB 4QYAA 3RNQA 1P2CA 2ZSVA 4RZKA 4TSBL 4K5MA 4J4PA 3O9WA 2EC9U 4UZSA 4DUVA 3CDFA 4PBDA 5FO8B 2D9QB 2X70A 3UBXG 2YXMA 3D50A 1KCVH 3N41F 4GUCA 1YEWA 2EC8A 5F6IB 4J3TA 1A1NA 3CSFA 4X6BA 3VD4A 2Z7YA 1H5BB 3CXHJ 2QGBA 2VQUA 3ZE2F 4PTTB 4R4NC 4Y9FA 4R90H 1TQCB 3BKYH 3GJFB 1TJHL 1TZGL 3HI1B 4XNMA 1SJHA 3CDGB 2Z31B 2ICWJ 2HLAA 3LH9A 4YBQC 4U3HA 4KK6D 5TF1H 3K8LA 4HA1A 3ZTEA 1I1AC 4H20H 1AZZC 1ONQA 3MREA 2O61B 3VXQA 4U1KB 1O9ZA 5INDA 3VRIA 3PLYA 4PJBF 2BP8A 4F93B 3RL2B 4IK6A 1YY8B 5E1AA 1IU1A 4R9HA 4U7SA 4APXB 1F0LA 1HCZA 5HYJB 1FLRH 1YC7A 4I5BA 1P1ZB 4G9DA 2Y7QB 4XOBA 2EDOA 3EOBA 3BN9C 1DQTA 1S7TA 2ESVE 4OU3A 4KZCA 3UX9B 3D4CA 5GPRA 4RA0C 1NFIA 3BWSA 3PP4L 4ZFQA 5ERWA 5DDHA 4DJMA 4PLJC 5IFHL 2VDMB 2AV1B 4PLKD 2BY0A 3T3ME 4L1DA 2ZUUA 3U36A 4YSQA 3S3BB 1NJ9B 4N0UA 3VFWA 3ZTJH 4XAWH 1QOKA 1WPCA 5DFTA 3DX3A 2BVQA 5CIPB 1T1YA 2YQGA 1UXSA 4K8RD 2HTKD 4WY7H 4BXSV 1MVFA 1JK9A 5F7HA 1MFBL 2DJ4A 1FH5L 4C58B 4HAKA 3R7QA 2FRGP 3BAYA 3M07A 2ADFH 4Z1PA 3BZDA 5E6SB 2IOOA 1TQSA 1NANH 5KYXB 2ATPB 4P99A 1MOEA 1CICD 5D2NC 2D2CC 4ZAKD 4ANKA 1J0YA 4B96A 1JZ5A 1CO1A 3GMQB 4PRDA 3QCTH 4TN9A 2CDFA 5KG9A 1ZS8B 3WAJA 5FW8A 2PWEA 3RYMA 1QSEB 5AUMB 3KYKH 3OJDA 4ETYA 3KZ8A 2D7TL 2DY2A 4L9LA 5C09B 4L1HA 4U1MB 3FL7A 3UG4A 2WZ6A 5AAPA 4WJG3 3UPRB 1IC7H 1ESOA 2XSKA 4TPRL 1QSVA 4Y4KD 4KKRA 1U8MA 2L7UA 3QR0A 3IDNA 4BRJA 4LSPL 4M4PA 5KANI 2APWA 1DDTA 4OUOA 4KNQA 4WWKD 2COVD 3GPSA 3CSYB 4F8PA 1JVLA 3WHXB 4HJJH 3BP5B 5CEZE 3II3A 4N9GB 3EH4B 4HPOH 4W68A 3AQXA 1NL0L 5EMYA 4E9RA 3HE6D 4XE0A 5DK0A 1ZGLP 5BRPA 5DFWH 3QDJB 2MH4A 2J6EA 3E0GA 2KQMA 1DUZA 3I6KB 4E42A 4OJCA 4LLYA 2XU9A 3NGBB 3OKMB 3TA4D 3KCWA 2R0KH 12E8H 4GRWF 1XEUA 1T6BX 2BOBB 3UZVA 3LNGA 3TBBA 4MMZC 1CGSH 4Y2OA 4HD9A 1NFKA 1FNLA 2HTLD 4HD5A 3V4PA 2WCSA 3IKCA 4KK9D 2DBLH 4ZW3A 1UQSA 3C9NA 2XZCH 3MJ8B 1CE1H 3D3VE 4FKHA 2XICA 4TOYH 2QV4A 1MRDH 3CCHB 5B38A 1ZLVK 1RUQL 3T3PE 2NY7H 3D48R 5ETUB 1CICA 1DLFH 1SOQA 4TVPE 1GJIA 3EOAA 5F1IA 4GFXA 3WNMA 4E9SA 4XGZB 1QFWH 4V1DB 1L9MA 3OG4B 1YPZE 2IWFA 4U05A 1UD4A 1EMTL 3W37A 3BKYL 2IEPA 4LL4A 4WVRA 2JQAA 3LSOA 3AU1A 4CN4A 1PD6A 2X2UA 3KVQA 1MWOA 5TF1L 2UX6A 3D69A 4H20L 1JRHH 4DERA 2WQSA 3WFBL 4C56E 1DTUA 4HIHA 3VG9B 4HQQH 4WWKA 4JZJC 4PJHA 2DQHH 3WSQH 2P8PA 2QADB 2P45B 2XPGB 1T7WA 2B3RA 1FLRL 4U6YA 4PRBB 4KTEH 4CSSA 3HE6A 2X38A 1IJ9A 2YRBA 1EFQA 3BWUF 4J3WA 5LXGL 4ZOCA 5AG8A 4UQ9A 4GUPB 1A7OH 1IGTB 3NCWA 1W2KT 1N19A 3F7RA 2P52A 2D7NA 4NN7C 3IF1B 3OMNB 4U3SB 4KXDA 3TEZA 2XHNA 1X5XA 1A3LL 4TQHA 4EAEA 3VM7A 3GSOA 5D1ZI 1KCBA 4NI6A 2HLFD 4XH2A 5C9JB 1Q1PA 4PGJA 2YPKA 4HCRA 2JJWA 3TBYB 4JM2D 4EI5B 2C7FA 1B9KA 4MWFB 4U6XA 3RIFF 5IK3B 2AABH 1N7MH 5CKGA 2JB5H 4J8QA 1FIGL 3H0TB 4WY7L 1NCOA 4ZYKB 1BVNP 5L9DL 1VGKA 4MMZA 3S5ZA 3C8KB 3Q5YA 3O41A 3WNIA 3VCLB 5GSVB 3Q2NA 4C54A 5B38G 3VFOA 2OTUB 1LEGB 5EBWB 1G1CA 1BYPA 1ORQB 5DHYA 4G82A 5ALCL 3FF8A 3RWCA 5BO1H 4K71B 5FYLE 3LS5L 1HEHC 5BV7B 3QORB 5DS8A 1M2VB 1U6AH 3DX9A 3NEOA 3VFTB 3OGCB 3TJPA 1KTJA 3QC5X 1MI5B 2VQ1A 4NKQB 5F7EH 3QIWC 1A4JB 3EFDH 5FV2A 2GUYA 2AVFA 5AB1A 4DO4A 1IC7L 1L9SA 1QQDB 1RZIB 3SY0B 4B50A 3WENA 4TLUA 1QWHA 2A6DA 4L1BA 3GUTB 2NYYD 4LBAA 1OOWA 1SXNA 1TMQA 2D8KA 4HJJL 1AJ7L 4PJGA 2BIOA 4PREA 5LCVH 4JZJA 3WNJA 2IDFA 4PSPA 3NPZB 3QPQC 3LDBC 2OSXA 3NK3A 4JNXA 3RLSA 4J7RA 4KXZH 3RVVD 4ODTH 3DX6B 1KLFB 2FO4A 3TL5A 1NBQA 3BWUC 5DMGD 3U36B 3QUZB 3ULAB 4ZXBB 3FU6A 2WK2A 3TO2B 4YHYC 4ALAL 1VJSA 2R1WB 4N2KA 5JPMA 1JCKA 1AXIB 2FD6L 12E8L 3CMGA 4ES9A 5JO5B 1YEKH 1CDCA 4QMEA 4ICWA 3FUJA 3VXPB 5D7JC 1AO7E 2VERA 4FA7B 5HGAB 1G7HA 5M95B 3B7UX 1T22A 1CGTA 3HZYB 4LDLB 4XXWC 5K69A 1CE1L 5FK9B 4XPAL 4HGMA 5D7IF 3CV5A 4ZNCD 4U31A 2NY0D 1S7WB 4HHWA 2ODIA 3LXUX 3GXTA 4WFGE 4AC2A 4BGLA 4OJEH 1QFWL 2MPAH 3UZEA 5HYQA 4PJAF 4Z7VF 4MJID 2OTWB 4BE5A 2MKWA 4MZRA 5DFAA 5FECB 3FT3A 1UXMA 1J87A 2VDPL 4Y2LA 2HT3D 1P6WA 3QIBB 5HJ3B 3WGVB 3OL2A 4U33A 3Q1SH 3FBQA 1JRHL 3D25A 4FZ8L 5I8OL 4HQQL 4CVXB 3FYEB 5D2LF 4MAUH 1KWKA 2I26N 4IBYA 5I5MA 5IB4B 3IJHA 1MQKL 4TVPD 4V33A 1D5XA 4I1RA 3T6VA 1X5LA 4A39A 1MY7A 5IQ7L 1KBBA 3CBJB 2ADYA 2XN9E 1IFHH 1AR1D 1GKOA 4GAFB 4HCFA 3QUGA 2VIRA 3B8SA 5F9AC 3DJRA 3ZRSA 5E9AA 4E9VA 4BSVB 3JTTA 4P5SA 5MEQB 1A7OL 2D03L 1J05A 2MNJB 1DJXA 4JRXE 1X9UA 2WB1A 2A77H 3MNVB 1XIWB 1FZMA 2C3VA 3SKOB 3T0VA 4C56D 5BXFA 1MPAH 4F1SA 2YMOA 2WKGA 4ZFZB 2CUIA 2CHDA 3QXAB 2NQ3A 2IWGA 3ARPA 3ZQWA 4D0DB 5HHOB 4XMZA 1X5KA 5FF6A 2Y5TA 3L4XA 3P4MA 1BOYA 4YDKH 2WWKT 4OAWA 3UYPB 1N7ML 3FO1B 2JB5L 3BH8A 5C08A 2W0PA 3FDWA 1CFQB 3LRKA 2DYPB 4FQXD 5D7JA 3P9WB 5JA9A 3V4VB 1WWBX 3BQUD 3NIDF 4MMYA 4DVRL 3V79C 5ICUA 2ZXGA 2CGRH 1ZHKB 5E9DB 3IVKA 4NRYA 4U1IA 5BZDB 2A6IB 2WQRA 3LTVA 4MJIA 4ALAC 4G9FB 3VTAA 2CBMA 4FL4B 2BFVH 3EIFA 1PTZA 5BO1L 1BHGA 1JOIA 4MTMA 3R4DA 3UEZA 1RJLB 2YXFA 4L8DB 4S1SL 1DVZA 4E9YA 1FJ1B 4NBZB 2QHRL 3NA9H 2FSDA 3VFSB 3VFMA 3ATFA 5J3HC 1A9BB 2Y7NA 5LHDA 1PMYA 4WW2A 3DK2A 1Z5LB 1ZLEA 1V54B 4WCYH 2DQCH 1H3XA 4L4TD 5DUML 3HC4L 4GUOA 1BQUA 1WWWX 3GRWH 4NPKA 3VVWA 3CVIH 1MCJA 3IDMB 5AW5B 5IB5A 3M1BA 3CD4A 1IGCL 4C4KT 5LCVL 4PWHA 4M7KL 2AEWA 5TF0A 1NFDE 1U8JA 1V27A 4X6DB 1H3VA 4N3UA 3SBQA 4NQSB 4EXPX 4JW3A 4WUUD 4ETQB 3WEAA 4HUKB 5I0DA 3EYOB 3O4OC 3STLB 1QI3A 4PJ5A 3V6OA 1GOHA 2XX0A 4XZ4A 4UM9B 4PQXA 2Q86A 3TZVB 2NDGA 3ARED 4Z7QB 4RGMB 4POYA 5IBLC 2ZKMX 3I3DA 1S9VB 4UAOC 1Z9OA 2OXHA 4KKBD 4NP4H 1KTKE 4PI2A 2IALA 3CZGA 4HBQA 5GJTH 2E8YA 1Y6MR 3AWFA 3SYPA 3DVGB 3KNBB 3VX1A 2B7DT 2Y23A 1OAXH 2GCYB 3V0HA 4JGNA 2FZ3B 4MA7L 3TNMB 2MPAL 1N67A 1JGEB 4ZMNA 1H3GA 2IBZX 4N1EA 5IIEB 3Q8BA 1PKQE 3CVHB 3CX5K 4IRSB 4QRUB 5F9WB 5IROC 3O6FD 5JHBA 2VR3A 1AD9B 1T0MB 4M1DL 4P5RA 1AO7D 3AMKA 2J1ZA 2O93L 1XF3A 2YWYA 5IJDC 3MV8E 1CBVH 4L4TA 1UVQB 1KY7A 5DUBA 3NZUA 2X4PB 1VFOA 4ATWA 1DVSA 1YMMD 4L9DA 4XN1A 3DV4B 2P5EA 3SQBB 1YUHA 1IFHL 2FBOJ 1Y0LB 2YD3A 2YK1H 4Y4FC 3K2UH 5T5FH 3RKPA 3U7AA 1KIPA 3MRPA 4WUUA 3TWCH 4TUKH 2EE0A 2Y2YA 2R23B 4FQ1H 5IVZA 4F7KA 3RRQA 3VW3H 1B0RB 3H53A 5CM1A 1I8MB 2A77L 3DROA 4DGUA 1L9NA 3UZQA 3PJLA 5IMOB 2B0SH 4A1RA 2JI2A 1ZVSA 2NNRA 1X5YA 4NX0A 5AENA 4L3EE 1Y18B 3G5VA 3MRGB 4OCSL 5IG7A 1KJ2L 2X0UA 3IGUA 3AB0C 5EZJB 1EK3A 1RZJH 5AB2A 1BOGA 5HI4D 2XN9D 2Z8WC 3MV9B 4QT5A 4YDKL 1X5AA 4DO5A 2H6PB 1NGXA 3AVEA 3MRNA 4XAKE 1A6UL 3BLBA 3S4SB 3JT2A 2AJZA 4LP8A 4TNEA 5DO2D 2YD5A 5I76A 2BPBA 2X1WL 2GFBB 4HCGA 2AAAA 3NTCL 3HW7A 1YEHH 5DJ8A 1AKPA 5DQ9A 4IDJH 3W56A 4H7VA 5FUCE 2BFVL 3O6FA 4TQEH 4I1PA 1I7ZB 4HIIB 3IFPA 4Z7OB 4YGVA 3A67L 3ENEA 3NACH 3WTUA 4OI8A 1WAAF 4MBRA 2I9LB 4PJIB 4OZIF 3K4AA 4WKXA 1O6TA 3BYTA 4FZEH 2A9AA 4BZ2L 2E7HA 2Y06H 1R24B 1BF8A 3VTTA 4A6YH 2DQCL 4YSUA 2QGEA 3QUMH 1YJDH 2R29A 4K3HA 1FGNL 3ZGIA 2CBTA 5ILTH 5MEND 2FR4B 2XX1A 4MB1A 5EUKA 4KI5F 1HIML 1G9ML 3EJUA 4LCCB 5EB9A 5TDOA 1NKRA 3L4WA 2AI0H 3BPOB 3OLDA 1C12B 4AYDC 4F9LC 1BEXA 4UYPA 5E94B 3U1SL 3MRLB 5C0AB 1S5HA 3O45B 1T5XB 1V7NH 4HIPA 3QQNA 3DX8B 2VN3A 1EEQA 1PX8A 3GYRA 2VL5B 2DKSA 2NYZA 3QVAA 4M8UA 3B9VA 1ZK5A 2MMXA 2FJFA 5BRZB 1EPFA 4HJ0D 3KYOB 2ZG2A 2VSKB 4FERA 2HJKA 1NKGA 2NXZB 3MNZA 4PJCF 4PVMA 4ZPVB 3KLHD 4K3JH 1WGOA 5CP7A 4OZGE 1GYAA 4JM0A 1KV3A 2FEEL 2B1AH 3DETC 4A38A 3TV3H 4CMHB 4G80A 3S37H 1URIA 3LNDA 4XVJL 5JDSB 1KB9K 1MVYA 5HGBB 3GI8H 3TEYA 1Q90A 4ZUUA 2DQFA 2QDVA 3B9KB 4EI0A 1SOKA 2YPLB 4H2CA 1T04B 3PABB 1ZA3B 2YD8A 2YWZA 2ZUVA 3W9EA 4LVEA 3BE1H 1CBVL 5J13B 3G5XA 3PS6A 3TBTA 4CRPA 5CUSH 4QRPB 4Z3TA 4QHNB 5IW1A 1WBYA 3VYPA 1I3GL 3QEUA 1X5FA 1NOFA 3IJ8A 2OMZB 5IW3A 1ROWA 2ORBL 4AM0Q 3IMWA 2YK1L 4MMXA 3V4LA 5JORA 2VUYA 4WJ5B 1G87A 1U3NA 4ZPTA 1J5DA 5DJYB 3VXTA 2VXVH 2XI9A 1SDDA 4PJFA 4KWUA 2VJXA 2Y3AA 4ZO9A 4CGTA 4AYMC 2VCOA 2WIMA 2C9RA 5EOCH 3CVBA 2HRLA 2FL5A 3MV8D 4I89A 2WXNA 3BO8B 2WTRA 4EBQH 4U0QB 1V3LA 4ELMA 1KLGA 2FX7L 5HDQL 4Y19B 1NMCC 5IHZB 4LMQI 1RZJL 4S1DD 4WFFE 2BY2A 2FO8A 4J3OH 2BNRA 5CHNB 2C9UA 3O2DL 2CBQA 3LN4A 2J73A 3U9UA 1HNFA 2B59A 4WHCA 2BHZA 3LV3A 1PD1A 4UTAH 1G9MC 2HX9A 5E2TH 1U2HA 3L9YA 1UT1A 2EXWC 4P8QA 3X3GH 4U1JB 1MVUA 1A6PA 2N0KA 1AAJA 4XX1E 1P7BA 1OGSA 2G4GA 4W9ZA 1K5WA 1WITA 1F11A 1S7QB 4IDJL 3WIFB 3SGKC 4IGBB 2UY6B 5HJDA 4AUUA 1A4KB 1JWUA 2CLVB 4HP5A 2DTSA 4UDUB 5DJXA 3CX2A 4X8GA 3RVWC 4I0CC 1IAKB 3GXNA 1CT8B 4X9FA 1XH3A 2ZJSH 3NA4A 5SWZE 3TFKD 3QPXH 3N1QC 2OM5A 3FB7B 5HPMA 3G04B 3DX2A 3BGMA 4J2XA 5LO7A 4FZEL 4AUJA 4HS6B 1KJ2A 4RMQA 5F1NB 3O6LL 4ODHH 4XAKD 3UACA 3PGDA 2CE6A 3DMMC 4FFVC 3W1ZA 2X4QA 2Y06L 3MNWA 2BVPA 5A7EA 1A5FH 2UWEB 1ZHLB 4P9MH 4TNFA 4D9RD 1A7PH 4DW2L 3MUY1 5FM8A 4L2YA 5CU9A 1OCOB 1U8IA 4G6AC 4ZSOE 3U6XA 3LXAA 1UJ3B 3WO4C 5C2BH 1SYVB 3HJEA 2R2EB 3REVB 3RIKA 1NKOA 1C16B 2EINB 3EDJA 3FMGH 4XCYB 5C9KA 1MJ8H 3UDWA 2ZX5A 3TBWB 3O81A 1ZD6A 3I50L 3HHMA 3K6OA 4Z0XB 5F72S 5C0EA 4PHXA 1KBKA 4CAGA 4JDZA 1F4HA 4NFDA 3FONA 2ARJB 4KO6A 5EZIH 2BP0A 2WP3T 3AUVA 4IOFC 1P4BH 1OT4A 3UP1A 4N87A 4BZ2A 2Y25A 1NDMA 1UH2A 4FS0A 2VAAA 1E2ZA 4PY8I 4U7MA 4BYHA 2UZIH 1BJ1H 1ZE3H 4XZUB 3T6XA 2B08A 1XCWA 2J8UA 4YSAA 1KBWA 4ZBJA 4JUSA 4GNKB 2APBA 3TV3L 4TF4A 3S37L 1FFRA 3GHBL 4ZNEE 2PO6B 3GMRA 4NM4L 2W0KA 5HJBA 4C4BA 1CD8A 3C8DA 2FNWA 1F56A 4QO1A 4R26H 4Q9CA 2Q7NA 5IW6B 2FJUB 1RZJC 5J9PA 3IMBA 4WF7A 1TSHA 2VDLL 3X1NA 2X28A 5K39B 4HEPA 1NH6A 1K4DB 1RIVL 5HHPB 3BE1L 3FSZA 4R83A 5I18H 2CKBL 2EDNA 4KROB 3MBWB 3I6GA 3PWUA 2VDKB 5GIRB 1ZMYA 3L3OB 4YOKA 3S7GA 3QG6B 4TMPA 4WIQA 5F9JB 1G9EA 2CLRA 5L4IA 3SN6N 4WEMB 5SWSB 3TF7C 1SEBA 3ARFD 1K4CA 2OZNA 4J8RB 4CVZB 2BWIA 5GS2D 4AIZB 4A7SA 1LYQA 2FQEA 5D6CA 4QPEA 1KYOJ 1E4KA 4UNVA 5EU3A 1YYMH 3ABZA 5EOCL 4GS7C 3TO4C 5BQ7B 5F3HB 2G5RA 2N1KA 1EAJA 3FAXA 4RMBA 1GZQB 5T3XE 4LSQL 4W93A 1NUGA 4EBQL 5DXWA 5DJ2A 2OQJA 2P8MA 2PXYD 1HWGB 1WUNT 3WKPA 1L7TH 3C08H 2VE6B 3CC5B 3U25A 4PTUB 2KERA 1WTLA 4UTAL 4R7LA 4ELDA 1NMBH 1FL3B 3OTTA 5E2TL 2OR8A 4C55A 4EUPB 4AQ1C 2YIHA 2KLTA 3GLAA 5AZEL 3WTWA 3CFBB 1B4RA 1RU9H 4QWWD 2CUHA 5ITFA 4Z78A 3CHSA 2LHAA 2F7QA 1IAII 1KCUH 3DBXB 4Q6YA 1D5MB 1DBML 3V0VA 7CGTA 4JQIH 3JZYA 3LNFA 2HB0A 1UB5B 1IEAA 1UM6L 1YN6A 3GHEL 3DYPA 3E6FA 2NY3D 2FVNA 1CIUA 3DKHA 4HUXA 4WFFD 3QPXL 25C8H 4QRQA 1RCYA 1UUSA 1Z9MA 3O6MH 5KVGH 1M4KA 3ZZLA 1TXKA 5KJ4A 3L4TA 3I9IA 3F84A 4HEPG 3ZO9A 3W0WD 3O2DA 1HEJC 5HVHC 8PAZA 3ARFA 4CBZA 1MJJB 4LSUL 3JYCA 4PGDB 2VABA 4DZ8B 1F90H 4Z7WA 3NCCB 1NPJA 2ZP9A 4UOW0 3TA3B 3HB3D 5C2BL 4Y5XC 2HMIC 2PW2A 4U3CA 2PCPA 3OKOA 4J1UA 4WLCA 2DDQH 1RZ8A 5SWZD 4P2OB 3FMGL 1MJ8L 5EU7E 5GZNA 2Y3NA 4G43A 4X6CB 3EJRA 4F8QA 2OP4L 4F58H 3FO9A 5CD3A 2PXYA 3PXHA 4MS8C 2VSCA 3DXAB 4P4RA 5EZIL 3QFJD 3WNLA 1P4BL 3TO4A 2QSQA 4WRLA 1OK0A 2EH7H 1U3JA 2HX7A 2PLTA 5I8CB 1ID2A 2PR9A 3PPSA 2TRYA 4JMNA 4O51B 1HILB 4XP9H 1FBIH 4KQ3H 4X0NA 2Q1EA 3FRUA 3N2JA 2JE8A 4Y5YA 3VQMA 1P4IH 3MGAA 4G8FB 4XTRC 3AXLB 4ZQKA 3MCLH 1KMGA 1IE4A 1ZIAA 1PJWA 5DLMH 2NY1B 2VSMB 3OKKB 5C2UB 4LRNH 3BFQG 4ODXB 3SDAC 2L7EA 2WINB 1LO5B 1MREH 4X7SH 5F6HI 3U4KA 4G6JH 3FN0H 4R26L 2PPDA 2JQMA 1FNSH 1EX0A 4ERSH 4J3OC 3D85A 3TPKA 1T21A 4LASH 3ARDC 4KVNH 2AW2A 3CU1A 1UD6A 1PZAA 3BLPX 3LEYH 4V11A 1B4JL 5A3IC 4JO2H 5DFVD 1J1OH 4HUVA 5D1QE 1JI2A 4L37A 1XB6A 1S9XB 3EJYD 1ACCA 3D0VB 1LWHA 3KDPB 1BM3H 1XGRA 1N9PA 4O02B 5JOFA 1MJ7L 3S2AA 4CNIA 4MCZB 3KXFE 1K5NA 1KOAA 2BP3A 3TX4A 2VSDA 3KBHE 1G7IA 1CXKA 1YYML 5GRVK 4PRIB 5DCCA 2OPCA 1ZHBB 4Y5XA 3GSXB 3QFJA 1H0DA 1JF1A 3LQZA 4WI9A 2N7AA 4F8OA 2XN0A 4RWYL 2BS8A 5I1DA 1R3JB 5T1KD 2DYSB 1P84J 2CKBA 4F2MA 1L7TL 5DU7A 4PRHE 2NY5L 4QXGH 3IU3A 2ED6A 5ITBH 3FFCD 1GTFA 2XQBH 3EYFB 1MFAH 3QUYB 3N91A 5LWYH 1Z6JT 2P47B 3RPBA 3DX4A 1FO0H 2ZCKL 3S3JA 1Z7JA 2YGPA 1RU9L 1ZTXH 3B8YA 3ML8A 4IBWA 3C2SA 1QASA 1ZSDB 3JTSA 2DTMH 1TNNA 2H8PA 3KVPA 4OZHF 4P5TB 5DZPA 5KVEH 2AQ2A 2UY7A 1G5AA 5GS0H 2XQYK 1LP9F 1NCCH 1ODUA 4HUUB 2H2SC 3HBQA 1DN0B 1HDMB 1QTYT 4XO3A 3GD1C 4ZUWA 1JWMB 4ZT1A 1GIGH 1E5AA 3O6ML 4P05A 1ZE3C 4I3RH 1KTDA 5KVGL 5FM5M 1HXMB 4HMEA 4HUMB 4NSKA 3JUZA 1SYSA 4R2GC 3SE3A 3N40P 3G6JE 3O2WH 1L3WA 1IGYA 2VKXA 4R7NA 2LAGB 5AW0B 3RJDA 3BKML 2D31A 5GJSL 3H4HA 2P5WA 1IAIH 1PU0A 2AK4E 5C7XH 1ET5A 2VM9A 1AS7A 2IDUA 1NFAA 1XR8A 4HUNB 2F08A 4F58L 3VSVA 4OD3L 4MXQD 1B3IA 3UC0H 3U4EB 3DUSA 4XN8A 4JFFA 3GSRB 3RTLA 3FFCA 3BPLB 5A2LH 1ICTA 4LEOB 3ZN6A 3T2PA 2Y2WA 5BS0B 1RJYB 2E7LC 1XXDC 3GMMA 1LNUB 2GKIA 4XP9L 1FBIL 1LO3H 3I74A 1UCBL 3O3DB 1U4FA 5AEAA 5E6IB 3Q3GB 4FG6C 4XO5A 3L9BA 3H6AA 4NUJB 2ZUYA 5DLML 1LQBC 2HXAA 2O5XL 5I1GH 4CA4A 2GTWB 3L13A 5JMRA 3GBDA 1FWXA 4X7SL 1E42A 4LLVB 2EYTB 3FN0L 4HZ1A 1JBJA 3P02A 6PAZA 4HDIB 4P2RA 4IBQA 4LASL 1E0OB 4KVNL 3BIKA 2Z1KA 4QXUL 4XCCH 35C8H 3KCPA 2BSTB 3LIUA 3ARGD 4YQXH 1U9KA 4JO2L 4N0YL 1U3HD 4WHDA 2RGSA 4NUPA 2FX8H 4KTGA 3BVDB 5E8PA 3CU7A 1A9EA 3O3BB 4J3OG 1BQHG 3ILQC 4K7PY 3RVXD 1OF2A 2C3XA 1D5ZA 2R2BA 3IPBA 4IBZA 4QOKA 3U0PA 1QNZL 4UIMB 2G3NA 4F7MB 4S0SD 2P43B 1O6VA 3HOGA 3T65B 2FQDA 1GYCA 1OB1A 2R0WL 2A74A 2MOVA 4LRIC 4M8RA 5DSCA 1RVFH 4GRLD 1WFJA 3DV6A 3UBXB 2OX5B 3QNZA 1C5BL 3DSNB 1M05A 1W72B 4ANVA 5EO9B 4LESA 1S9YB 4F3FA 3VWKD 3BMVA 3ETTA 2P28B 2CNZA 4QXGL 5D1XC 1AMXA 4XPBH 4K23H 1XZ0A 2A0LC 3KXFD 4GQRA 4PJEF 4LSVL 3GSWB 2QQLL 3FULA 5LWYL 1JTTA 3FU7B 4E5XA 1FO0L 2E7LA 3FQ1A 3BPCB 4P5KB 4AK1A 1EH9A 4G8EB 1YC8A 5F6HJ 5EA0L 1N18A 1BG9A 4NPYA 3VMPA 2D0GA 4ABVA 2DTML 5KVEL 2QPSA 4PJXF 1NC4B 2P24B 2YSTA 2IH9A 3VVVA 5AVQB 1SDYA 5F7MC 1DFBL 4XBGA 4DCQB 1TTAA 2G2PA 4TL5A 1ZAGA 1TTRA 4PRHD 3MRQB 3VFPB 1UZ6E 3ARGA 4ZUTB 3UTSE 5I30H 2A1WH 4G59C 1U21A 2ZXBA 3ZE1B 3W81A 1IZJA 2WSPA 2OSLA 5DJ0B 2L0DA 3GMOA 3UYOD 1E6OH 2Q5BA 2W9DL 2M83A 4PWFA 5A2BA 2X53A 2JV6A 3EFOB 3O2WL 4WUKH 1JZIA 3TH3T 1FVEA 4RFEB 4XNZB 4FOMA 3FXIC 3S37X 5E8EB 1T89C 1R75A 2ZQKA 3TWYA 5D2NE 1MHEB 3HBZA 2X4UB 5C7XL 1JXKA 3MLYH 3MXVH 1NEPA 3TYFA 4LEXH 5DJCB 1YDPA 5D7LB 4HSQA 4GRLA 1U93B 2KZKA 2ENYA 4BDVA 1F13A 5CSBA 5IB2A 4U1SB 4EZKA 3WKMH 4MD5A 3RNQB 1P2CB 2ZSVB 1F1DA 4ZS6C 1J9QA 1PS3A 5E24E 1EEUA 3O9WB 2JKTM 4JN2A 2DIAA 4ZJ9A 3EHBD 3A21A 3ARBD 3HKZA 1UZGA 1LO3L 2SEBA 5AZ2L 3HVDA 2UVFA 1NDGB 4ZX6A 2AK4D 2X7LA 1RMFH 1A1NB 2YPVH 3EBHA 1OM3H 1S7RA 3EH1A 3HG1A 4YHNA 4YFLI 3VXSD 4BCZA 4DN3H 2G5BB 3MRMB 5CBEA 3DX0A 1XSJA 1VCBC 2VM4A 2CNYA 2XJKA 4PCYA 2ZZUT 4URTB 5BVPH 2E0PA 2W07B 2WYZA 1VKXB 4XNMB 3ZTNH 1SJHB 3PV7A 5BMFH 2HLAB 3N0PB 2Q9OA 4I0PC 3E7JA 3OB0H 1XTMA 1GYUA 2QSVA 5INDB 1KN2H 3BT2H 3L95A 4FQJH 2BP8B 1D5BA 4NHUA 3GBMH 3TH2T 2HT4C 5E1AB 4M7LT 3VUAA 3FCTA 2XFXA 1RY7B 1AQDA 3LKOA 1DLHA 2D0FA 2F7IA 3FT9A 4I5BB 3OJ2C 4H13C 4G9DB 4KGJA 4GAJL 1DJSA 3ARYA 4YR6B 2QFPA 4Y4HD 5AWNL 4XMWA 5GS0C 1F02I 3EOBB 1GL4B 3CDYA 4HAFA 4TXVB 4YDNA 1JVKA 3ZIYA 3K6NA 1FG2B 1U8CA 2ZWSA 3P77A 1L0YA 1TENA 3E2HB 4JO8A 3IFLL 1AS8A 1NFIB 2R59A 7PCYA 4RGNB 1QLEB 3ESNA 3NK4A 3KDMA 1RVFL 3QZMA 3OJVC 5L2KD 3MRKA 3X17A 4N0UB 3VFWB 4ZTOH 4LCVA 1PDKA 1HNGA 1S4IA 1T1YB 1FZJB 1O6SA 2FJHA 3ARBA 3MCG1 3N40F 4PJDF 1ASPA 2MOGA 2ITCB 1UXSB 1MAJA 5C92A 5IBUG 2RALA 1I8KA 4LHUD 1UB6B 5EG6C 4K23L 3CZUB 1PG7L 3MA9H 3UTTA 4LB8A 4WNQA 1AC0A 1ZT4A 5CMAA 2F8XC 3FOLA 1QPPA 5KVFE 3VXSA 1EWHA 4R4ND 2DMCA 3MPCA 4CKVX 2XWTA 3ATAA 1JPSH 1HI6A 5HTSA 5T1MA 3GHPA 1XH1A 4PRDB 4XP5H 4YBQD 5L0QC 5H94A 5JYLA 2EDEA 1HHHB 1NLDH 2CDFB 3MLSH 1I1AD 4RMUA 5DVOA 3DX1A 1Q72L 4M5YH 5KG9B 5FYKD 4AUYA 2I69A 4PM1A 1BEYH 4L9LB 3ZDYE 5B39A 2DEWX 4UQDA 3PYCA 1WGVA 4LCIH 1PKOA 3HS0B 3T1FA 4DN4H 5DMKA 1U8MB 3IN2A 1I8UA 5CCKH 3IDNB 2WNXA 3D0AA 4IOSD 1JGUL 1SHMA 3T1WA 3VI3F 4L8SC 1XF4A 3CE1A 4KMLB 2D7PA 4B97A 5DJ6A 1TPXC 3B7TA 1OQOA 1MFCH 2E74C 1RUPH 3HG2A 4QI3A 2BW5A 5DK0B 4AQOA 3BP7A 4PBVC 2OR9L 5IHUL 3CK0H 4X42A 3MXVL 3U2JA 1WT5C 3IGAB 3MKGA 3SKJL 4GAGL 5K59F 2EUZA 4AQZA 4E42B 3ETBJ 1FYHB 1AZCA 2X40A 5L2KA 4QRTA 2X5PA 3UTSD 1I4FA 4KKCD 5ABDE 2C9XA 2UZPA 1KDIA 1T1ZA 4ZMQA 5KUKA 4MB5A 3VQ1C 1JPFA 3BD5A 1GPOH 4Y2OB 1UENA 3NP4A 1KZYA 4HKJA 1PQZB 4FXTA 3RI5F 2WPGA 5E08H 1QW9A 3VNYA 2IV9A 3X1FA 3UTQA 1KLUA 4X6EA 2EP6A 1AGBA 3KEDA 3NFSL 2IXQA 3PAZA 3QJQB 1AP2B 5I8KH 1CICB 1IGFH 3OKLA 4W4OC 4EKXA 1AOHA 1RMFL 2AXGA 1EGJL 3ILPA 5F1IB 1OM3L 4YVNA 4BH8A 1WZKA 5IWLC 2NY2C 4WEUD 1FFPB 2XWCA 4GW4A 5K9QI 1SQ2N 2W0FB 1Y7VA 4M8VA 2PCFA 3SDDD 1A02N 1CWVA 2DWTA 1UD5A 3OHXC 3WNKA 1A7RH 3SBRA 4G83A 3ZTNL 3LH2L 4NRXA 2PWDA 5EORH 5BMFL 1HKLL 1IMHC 3AU1B 2ZP8A 4Z18A 1AS6A 1WV7T 1L9PA 3FRPA 3D69B 1SVZA 2V6HA 1G9NH 2BOCA 4LLUB 4HIHB 2X6BA 5BOZG 3BT2L 4WWKB 3B3IA 4GFTB 4IOSA 5B39G 3UBGA 2P8PB 2FYYA 4EVNA 1GA2A 4LHJB 4FFWC 2ADIB 3HZKA 3V6FA 2CZNA 2MKLC 4JRYD 2JSFA 3HE6B 2JI1A 4F37F 4M3HA 1GMEA 1KPVA 2D4DA 2XIDA 4U6VH 4Y7OC 5B7FA 3MU3A 3QZPA 3LPFA 4Q9BA 1J8SA 5AKRA 1AGEA 1ZTMA 1AHWB 4UT9H 1I9IH 4TUOA 3SE8L 5DRNA 4DKEH 3VWJD 5IOPB 5CFHA 1UCTA 1UWXK 3CH1A 4XH2B 2KPWA 3BP6A 1UKQA 2YPKB 4UMGA 1ML0A 1N3NB 2X4OB 3QHFH 4U6XB 1H3UA 4PW4A 1J1PH 2PR4H 3BW9B 3BCDA 1A1MB 5IMKA 1NIDA 4B5EA 3DVNA 3HLAA 4JHUA 2TSBA 3O41B 4K7FA 1MLCA 5AFAA 4PJ6A 1A2YA 3VFOB 2WBJA 5M94B 1NM4A 3HUJB 1PW3A 3QJTB 1DQKA 4OZFA 3SDDA 2OW6A 1JPSL 4G70B 3RWCB 3PJSA 4KY2A 5LVEA 5HD8D 4W4OA 4D7BA 4B3EA 1NLDL 3MLSL 4KKPA 3FUFA 2W60B 3MVSA 4JO1H 4M48H 5IQLA 1KCLA 3ISWA 1CD1A 3SPVA 4QNPF 1BEYL 1LO0L 3IN0A 3L3IA 3NCEB 4LT7A 4HOWA 1KULA 4WK2B 1NPNA 1UH4A 4DN4L 5ESVA 2GJ6A 3L5HA 4QUOA 3APNA 3VI4F 2AXFB 3QE5A 3D87B 4F9PC 3AM8A 4ADIA 4PREB 3F12A 4IKNA 1IGMH 3L45A 2EE3A 3IAPA 5D7IE 2P9RA 4Z8FH 4HJSA 3ETBF 1S9WB 1KY6A 2HRPL 2XETA 3S48A 4BQCA 2QPDB 3VWJA 2EDDA 4OM1H 5CLZA 5KOVC 2IOIA 3HLKA 3X13A 4L1LA 4U1LA 5HY9A 1GOFA 5D7KE 3LIZH 3T71A 2EDKA 2V9QA 4NOFA 5G4NA 4LO9A 1GPOL 2PPCA 3BVVA 2E3VA 5E2WH 4KK5C 4F5CE 2P5EE 1Y6NR 3BGFB 4WI7A 2RHEA 5E08L 1G7HB 3BIAX 4KFZC 4R7DA 1T22B 4DKFH 3D05A 1UUNA 2X2HA 3OQ3B 5D2LE 5GGVY 1BIHA 4E9LA 3BUBA 1AGFB 3HC3L 1RHHA 3OC5A 3BHBA 4TS6A 5IQOA 1DBBL 4PJ7F 4H8QA 1HTYA 5IF0A 2IDQA 3T3MB 1DDHA 2QMKA 3CBKB 3NZSA 5HBBA 4L2LA 2AXHA 4X5WB 1UACH 1A7RL 1B88A 2XY1A 3QIWD 4E36A 3FT3B 3GXMA 3SGEI 4YFEA 1NEUA 4J39A 5KWYC 3G5YB 1X44A 5H8DA 4KJPD 1YEIH 3S97C 1IM9A 5C07A 4CUCA 5LAXA 1YNKL 2FGZA 3RE0A 3L7EA 4GQQA 3K6DA 5B1AB 5D6DC 2YAQA 3PDOB 1E7VA 3MBED 2X4TA 4LU5L 4D9LL 3QPQD 4BE6A 4FNUA 5LGJB 1ROCA 2RFXB 1G4MA 2V17H 3MV7E 3L4UA 4HYTB 4U6VL 3RWJB 1EGJA 3ISYA 2QDWA 3G9VA 3JTTB 1TO4A 3NIDE 4KRMB 1J05B 5IQMA 5E70A 1I9IL 5JXEA 2FDBP 5ICXA 4DKEL 3CGTA 5BXFB 4FEIA 5J1SC 1N8ZB 3VXME 1CLCA 2CIIA 2F54E 3CN4A 2C4XA 2IDTA 5E1QA 5CBAB 4HV8A 3FNKA 2ZXDA 1BMGA 2FIRT 5EIIA 3ZL4L 3BH8B 4YFLF 3P0YL 5LNEA 2NY0B 5JPNA 4M1CD 2WYHA 1OW0A 4FQCL 4WHYH 4FLHA 3R8BB 4AENA 1F5WA 5I66A 1X9RA 4MMYB 5JOEA 4Y9GA 4AGQA 3NSXA 3IVKB 4NRYB 4U1IB 4XR8C 4BCXA 2VC2H 5JQHC 4MJIB 3RTQA 3NJFA 2AJYL 3B56A 2LAAA 4J3UA 2RTTA 1FSKC 4XOCA 3WFHA 4R97B 2Q7AA 4M48L 4JO1L 3Q8FA 4N2DA 4DNLA 5M7QA 1GZHA 1F6LL 3F04A 1J0ZA 1MCQA 2C3HA 3VFMB 4AQ8A 3EGXA 2R9HD 1YCSA 1M7XA 5I15L 4I8DA 2Z7ZA 5LAPA 3ROLA 3MBEA 4PWGA 4N1HB 1N6QH 4WW2B 1IC4L 5CLTA 4GG6F 2YFOA 3L3KA 5IB5B 1BJMA 3K0YA 4GPVA 5IMMB 1AR1B 1MHCA 1KC5H 2NMSA 5E4AA 3FT2A 1IGML 1P0SE 4FFTA 4XNUH 5KSUA 3LJ3A 1U8JB 4M43H 2FWLB 3JV6A 4WO0A 3TT1L 4BQ9A 4C56B 4NQEE 5J11B 3K1DA 5GRYA 2RA1A 1G9NC 2MCPH 3VA2C 3EUDA 1V8HA 4PJ5B 1W16A 5AYQA 2Y5QA 2MNUA 1KB9J 2ZOUA 4LIQH 5CINH 5CGTA 2Q8AH 1MUJB 1KT2A 1NSNH 1F1AA 3WN5A 4WI3A 3RU8H 2HFGL 3SD5A 5E2WL 2HCZX 1BZ8A 2OMXA 4N2FA 2XIIA 2OXHB 1XCXA 5C3TA 4FQXB 2YRZA 1SVCP 1OGAE 4EJ1C 3BQUB 1TZIA 2DD8L 2IPKA 4PGCB 2Q2EB 3O4LD 4KTYA 1KJ3H