2Z7ZA

Crystal structure of h2o2 treated cu,zn-sod
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of H2O2-treated Cu,Zn-superoxide dismutase
rcsb
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 33
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2z7zA00
1XSOA 2VR8A 1IBDA 1HL5A 1F1AA 1TO4A 1E9OB 2GBUA 3GQFA 3MNDA 1UXMA 1Q0EA 3QQDB 2LU5A 1E9PA 3ECUA 1JCVA 2AF2A 2GBTA 2AQPA 4A7VA 1B4TA 2C9VA 3GZOA 2AEOA 3KM2A 4B3EA 3ECVA 1COBA 3HOGA 1QUPA 1SDYA 2E46A 1PZSA 1AZVA 4N3UA 2Z7WA 2JLPA 2WKOF 5KBLA 4OJAA 2WZ6A 1OEZW 3RE0A 2VR6A 3ECWA 1OAJA 4BD4A 2Z7YA 1OALA 4FF9A 1SOSA 3S0PA 4A7GA 1Z9PA 5KBKA 5CU9A 3GTTA 1RK7A 2ZKXA 2XJLA 3F7LA 2ZOWA 1JK9A 2V0AA 2XJKA 4A7SA 1P1VA 2Z7ZA 3KBEA 2R27A 1OZUA 1IBFA 2NNXA 1SXNA 2WWOA 3L9EA 1IBHA 1F1GA 2C9SA 1FUNA 4MCNA 3F7KA 1UXLA 2ZKWA 3CQPA 3L9YA 4L05A 3HW7A 2JCWA 1E9QB 2Z7UA 4OH2A 4U4IA 2AQRA 2WKOA 1F1DA 2AQSA 2AQNA 1SXCA 1XTMA 1PU0A 1MFMA 1OZTG 2K4WA 2WYZA 3LTVA 5KBMA 2WZ0A 4BCZA 1ESOA 1JK9B 1SXBA 1DSWA 1F18A 1SXAA 2WZ5A 3GTVA 3PU7A 1E9PB 2APSA 1EQWA 2WYTA 3KM1A 1IB5A 3CE1A 1IBBA 3GZPA 3KBFA 1B4LA 1N19A 1CBJA 1Z9NA 1S4IA 2ZKYA 3H2PA 4N3TA 4MCMA 1N18A 1SXZA 4BCYA 3MKGA 1TO5A 1DO5A 1SXSA 2C9UA 2AQTA 1E9OA 1XTLA 4A7TA 3HFFA 1SDAB 1CB4A 1L3NA 1EJ8A 2GBVA 4A7UA 4A7GF 1YAIA 2SODB 1E9QA 1SPDA 1SRDA 3QQDA 3H2QA 1BZOA 3GZQA 2AQQA 3T5WA 4A7QA 2VR7A 3SODB 2WWNA 2E47A 1PTZA 1YSOA 2Q2LA 3KH4A 1KMGA 1HL4A 1U3NA 3CQQA 3K91A 3KH3A 1YAZA 1BA9A
chains in the Genus database with same CATH superfamily
3REWA 2R69L 3MV11 4DESA 2GTZB 3BKCH 5CGBA 3TBBA 3QXUA 3HG5A 4IIQB 3TT3L 5ANHA 1DN2A 1GCYA 3QUMA 2EO7A 3V7MA 3NJXA 2IAMC 3TN0D 1B4TA 1KTRL 1B3IA 4FHKA 4BQ6A 3SDAB 5I6KA 2F54A 3VQMA 4F1ZA 1M71B 1EHAA 4X7DC 4LKXA 3QUZC 2WCPA 3MYZA 5ESVB 2I9LA 3CFEB 2FATL 2V33A 3RUGE 1AGDB 1XZ0B 5IW3A 4W9GC 3HPLA 4EQ3A 3EXLA 4R4ND 3PGFH 2DH3A 3QULA 1OTTC 2G5BA 2QHRH 1S3KL 1LP9B 2ADFL 3GMLB 5ITBL 2AJXH 2OXHA 4E9TA 3WFHB 4Z7UE 4CGTA 4GP4B 1LO0H 1HKLL 1T0PB 2XVBA 5IW1A 4PRDA 3RJQB 1MFDL 1WBZA 4FJYA 1XWVA 2I27N 1VKXB 3S2CA 4OGQC 4U7MA 1M1XB 2O61B 3O4LA 4BM7A 3BT0A 3VCLB 1L0XA 3BAEH 3SZKC 1E5ZA 2I26N 5B7EA 4YPGA 4N2LA 3ECBB 2XQYA 1LD9A 4P9HH 3U7AA 2HKAA 4YZWA 1L9TA 2PW2B 3LIZL 4H13C 1GZQA 4KV5E 4LLYB 4DO6A 1E6OH 4HHGA 2ZXWB 4F7CA 1DSFH 2GFBB 3ARRA 1OZTG 5JW3L 1GTNA 1G9MC 5FKAB 1IZJA 1CQYA 3VE0A 4HGWA 4TMPA 1KJMB 5J1TC 2IDSA 2YUZA 4JGJA 4C4BA 3EO9L 5GZNC 3LKSB 3EOTL 3QDGD 3HLKA 4WU7B 4PJDE 4D9QD 4L9LA 1QFHA 2X4UB 4PGDA 3V9FA 3ECBA 5C92A 3MA9H 4KUZH 1F4WH 1BIIA 1DO6A 1SJEA 2XA8H 3WN5C 5C0IA 4GNKB 2R8SH 5F3HB 5GS2D 4ZG1A 3EJZC 4JFHD 4AG4H 4MKTA 1QZ1A 3V6OC 4RWHA 5B38B 3QDJE 2ZYHA 2P45B 4JCMA 4Y5VA 4RGOL 3MNWA 3VFWB 3X1GA 3PWVA 4GG6A 2WLYA 3NTCH 3ARBC 4I1PA 4YSOA 5ETUA 1ZWIA 2CXGA 3CCHB 2OMWB 3MRHA 3U0TA 5C0AB 4APQA 1TCMA 1HIML 4Z3HA 1DQIA 2YPLD 2HFEB 3MROA 1UD8A 3QH3A 4RSVA 4U1KA 3SJVE 3ZDYE 3ILQD 1XX9C 3APFA 3AXLB 3QZWA 4Y4KD 5KOMC 1FGVL 3FN9A 2DEXX 3JVGC 1UCTA 3KDMA 3VDAA 1TJGL 4XVUC 4LF3B 2WXKA 3FSOA 1DFXA 3FOMA 5K1VA 2AF2A 5JDJA 4IRJA 4NZTH 3A4FA 4P2RA 4WNSA 4Y5YC 4HGMA 5JYLA 2F8VA 4ZQKA 5DRWB 3PV6A 1F3DH 4J3SA 1WD8A 2VSKB 3QCUL 4R9HA 4PRIE 2F19H 3U2SB 2HFFB 1LVEA 2K7QA 4YDJA 4BUGA 3QAZC 3KHOA 3PGFL 3BAWA 2EADA 4OZFA 5AALA 2HG0A 4OLWL 4PJAF 1L7IH 1R1CA 4G6JH 5TGBA 3FQRA 2QLYA 3LN5B 3O4LE 1QSFA 1YRKA 1R75A 1HKLH 3ECWA 4DZ8A 4HUXB 2PCYA 2ZP9A 3QJFA 4U1NA 4UM8B 1CDUA 4PG9A 5IHZB 1BM7A 5EEZA 3ZHLA 1NKRA 1AGFB 1K6QL 3MLUH 1QHPA 2EDRA 4JZJB 3U9UB 1M6UA 3CWGA 1ZEAL 4XBGA 1OAKL 2JSFA 4WW2C 5D7JC 5AW2B 1DVFC 1IM3B 1C7TA 1AO7D 2XIBA 3FCSA 3B2UD 4JRXA 2YN3A 2JF1A 3LEYH 5KYXB 5C0CE 4EOWH 2R2EA 1JF1B 2DQJL 4LRIC 1NGYA 1IE5A 2F7RA 2IWFA 2UZYA 2VE6A 4H5SA 2XVKA 4HW6A 3VG9B 5CAYB 2BZCA 3BHBA 4GAYA 1VZHA 3K4DA 2H32H 2Z64C 4G5ZL 1D5ZB 4IKJA 2X9XA 4RFNB 2VXVL 4Q0XL 2DQ6A 5MI0B 1IV8A 4OZIA 4LLVB 4GAJH 4MZRA 1OF0A 4E36A 4JHAH 4Z7VA 4GKNB 5C0CD 1WZAA 2EXWC 1SY6H 5CGYC 2A77L 4IIZA 3OHMB 3LD8B 1I8AA 1I4FB 3TN0B 1IC7L 1U8OB 1HNFA 3REWB 3W0WA 2BXYA 4P46B 1X7QA 4YHML 4ZMLA 2J57A 4JM2A 4BCXA 1SY6A 5EOCJ 1PG7W 1U2HA 4LESA 5E8DL 3G6JB 3SDXB 3OMZA 1XCWA 5EBWB 3FT4B 3ARED 3GYRA 2Z8VC 1R3LA 1SPDA 3HZYB 2JJSA 1A6WL 3SKNA 1J9RA 1IC4H 1NKOA 2BSCA 5DCCA 5C0BB 1VADA 2H2PD 2NCMA 4QHKJ 1J9QA 3LXBA 1ILUA 3I50H 3BRGC 4GMTL 4U3XA 2R9HD 1I1YA 4QHLB 3O3AB 1TFHA 5IM7B 4KNUA 1FO0L 5GRVL 4K5LA 5FGBC 4P2QD 2AHIA 15C8H 2C1PA 3S3CB 1YEWA 1MFCH 2JXMA 4AQOA 4ZXBA 4ZTEA 5JIKA 4GXUN 4M93B 1CQKA 4JFZH 3UTZB 4OCXL 1XDTT 1HYSC 1JCVA 1ZA3A 5IF0B 1X6LA 3UTPD 2MPVA 1QFWL 2N1KA 4B9IA 3QFJE 1YMME 3N9GH 1U33A 4PJCA 5GGRB 3T2PA 1FLRL 1KEGL 3OLDA 1JXGA 5C0AD 3F3HA 3HRZB 3NN8B 3QI9A 1FYHB 1HU8A 3SKOB 1ZGLM 4ZX3A 3ULUC 4LU5L 4TVPH 4YIQB 2WKOF 1UOWA 2ZUUA 4FNPA 4A1RA 3ZTJG 3ARBA 2QELA 2AW2A 4FDWA 5LBSH 1J12A 4IHBA 1PG7H 4OZHB 4X4YA 3DETD 3H9YA 3ZHDA 3JWDH 4GW1A 4ZODA 1J5OH 4BZ1A 3ZPDA 2V3DA 4XNBA 3FN0L 4PMEA 3MCLL 4IKKA 4I5BB 1MVUA 4AM0B 1BAGA 1GC1C 2ICWJ 3VFNA 3G08B 5GSRB 1T6VN 4HXAH 3WMPA 3CMGA 3BE1L 3CXDL 2IADB 1VEOA 3B9KA 2IQAB 2J2ZA 4JREB 5KVDE 4NEHB 4FN0A 4XB3A 5CINL 3NACL 1FNEB 1KULA 2AJZB 1Y07A 2KBGA 4Y19B 3RFRA 4MCZA 1SXCA 4HH9B 1HEZB 1CS6A 4ZQKB 5INDA 3CIQA 2YO3A 1FGNH 4NZUH 1FNFA 1W9XA 4XBPB 4NKMB 3A67H 3T09A 2YPLA 4ELMF 4QRTA 1AG6A 1TJHL 4P59H 1CBJA 4V1DA 1BSIA 4J3OC 1V7MH 1T7YA 2DIJA 4MAUH 4PWHA 4C47A 1YNKH 4YSEA 4DK5A 3MLPA 1IFHH 1OE2A 4E68A 2GEQA 1XH0A 5AAMC 4JN1H 3TH2T 4LCVA 4OJCA 2X5PA 4YJZL 1JPST 3AY4C 5AW4B 2N7BA 3M1OA 2DQHH 5J9PB 5JW4R 3Q8FA 1JGDB 1EIBA 2DBLL 5E6ID 2XUWA 1ZLWK 4W4OC 1QP1A 3KPRD 1FJ1B 3IXTB 5HDOA 3QDHA 1PVHA 5JA9A 4KXDA 5C09B 4RAHA 3SE4A 2AZAA 5AL0A 5F1OB 4ZO9A 5JDSB 1IKFH 1KB5A 1XF1A 1XD1A 2XV6B 4J6RL 1ZHKA 3K1DA 1PKQB 4DTGH 5C97A 4KH2A 4QHPA 3WIHL 4B27A 1BD2B 3JZYA 4XZUA 2TSAA 4GSXA 4L4TB 4OZFH 2B1HH 1BJMA 3GMMA 5D2NE 2DM7A 3OLGA 4WFEE 5HPMB 2VIRA 4ONFH 2WVTA 2BP5M 1KN2H 4JG0H 4CC0A 1QBLH 2HTKC 1A7RL 2HJLB 3FFCA 4N9OB 4OI8A 4HIXH 1M2VB 3WFBL 4ZT1A 3GBNL 2VW4A 1MCWW 2CPUA 5E1IA 1OGAB 4ODSL 4X7FC 1NPJA 4X4MA 2ZXAA 3BUPA 1MY7A 1QNZL 2F18A 4ZS7H 3DMMD 5LAXA 5KTEL 3EO0B 5JPNA 4LGPB 3FB6B 4ZUSB 4HUWA 4JR9L 1OP5K 1PZSA 2DV6A 3FTUA 3LZFH 4LVEA 5LDUA 5C71A 4OZIB 5DLMH 4OGZA 4EZMA 2P3YA 2C1OA 4IM8A 4FEMA 2M8XA 4AMXA 1K2DA 2DYPB 4QTIL 4LDLB 3UZQA 1MI5B 1JHTB 3FO0L 3EH1A 3HTLX 3HUJF 1ORSB 3P2TA 1BX2A 4NXSA 2W38A 3O4LD 1JZGA 1REIA 1QRKA 5C0JB 1FI8C 1WZ1H 4YDLC 5I6XB 5IB3B 4M48H 3PDGA 3R4DA 1WBYB 2W91A 1LE9A 1F90L 1CFVH 1RKRA 2P24B 2I24N 3QJSB 3SQOH 4GAGH 4CU7A 4AKPA 2C9SA 2FZ3A 3C2AH 1T7VA 2VAAB 4PJ6A 1T04A 3QDMD 3OKLA 1XZ0A 5T1LB 4BK8A 4F2ME 1O7SA 1I7TA 1BZ7B 4CILA 1KIUB 2KZWA 5FO7B 1A4JB 1AQKL 4DZBB 2HXAA 5HYQA 2NOYA 5KSBE 1X9UA 3ABKB 1JF5A 1HSBA 4NRZA 1ZT4B 4M7ZB 1N0XL 2EH7H 1NICA 3QUKB 4Q6IA 1JGEA 3T04D 3DX1A 3TF4A 5B7FA 2VLRB 2X4OB 3EJTA 2IAMD 5LJYH 1XF4B 1ZHNA 3VYNA 2VR3A 3TFKD 1AXIB 4OI7A 2IEPA 1X5LA 2MKLC 5EORL 3IEAA 1OP9A 4Z3JA 3W37A 3E0GA 4Y8DC 4KXCA 3ZMNA 3K8LA 4Y9FA 4ONFL 3IM1A 4X9YA 2UY6A 4G3YH 3VFTB 1LD9B 1N5AA 2ZXQA 4J3TA 4LF3A 5HJDA 5ECJE 1P53A 5IK3A 3VFPA 5DSCB 2JKLA 3V5DB 2WSPA 5J89A 3QSKB 4KOCA 5GGSB 2FJGA 5DD3H 1EO8H 4KI5E 4NI3A 4OSUH 2HKHL 1UJ3C 2GC4C 2VXQH 4FFTA 1EVTC 2DKMA 4PJDF 3PHOB 1KNOB 4Z7OF 3QH3B 3DUSA 1HX0A 3FH8A 5KSBA 3ZZSA 3QQDA 1D9KD 3PQYB 3HN5A 4UILH 1UFGA 3TVMB 3QI9D 1CT8A 3VNYA 5ACLA 1AGCA 3DA0A 4K8RD 5IEHB 3IGKA 2EO1A 2G60H 3DXAA 5JPMB 5J6GA 1BVNP 2ZWYA 4DFIA 1P6AB 2K8MA 2NY4D 1E42A 2CBQA 3U9UA 4ONGL 3QPXL 2NY3C 4MQXD 1GH7A 1XCQB 2HTLD 4RDQG 1KCKA 4K5PA 4MMZB 4OLWH 3TVMC 4RMTA 2BP3A 1DJGA 1WPCA 5ICYB 1V5JA 3N1FC 3P9MB 1XF2A 3GSOA 4FL4B 1R0AH 5BW7A 5TGBB 2YJLA 2WVVA 3F05A 2PF6A 3TJHD 4ZJ9A 3NQKA 4JO4L 4PQXA 4H8HA 2DLGA 3HOGA 1F2QA 3L5XH 1C8PA 1C7SA 1VENA 4J3OD 5ILTL 2JB6A 3W1ZA 2H6OA 3A47A 3VAEA 3D48R 5H8DA 4BA0A 3NVQA 1BJ1H 3QEQD 1KCUH 4F33B 5HHMB 2AEPH 2OMZA 4Q9RL 3RVXD 4E9QA 1H8SA 1ETJA 3KCPA 4LVHC 4JQIA 1CD9B 2DKUA 5LG1A 1Q9KA 5HGBA 1FBIH 3KBEA 1T1YB 3SKJH 1MCWM 1UKSA 4HWBL 3ZW3A 3LEXB 3KPRB 3P69A 2F53A 3U0TB 1SDDB 1AHKA 2B0SH 1N5YH 5K69A 1KBVA 5DMGD 2KYIA 4S1DD 1DVFB 2VLKD 3ILPA 3CZFB 2H1LM 1HILB 3I75A 2IH3B 4KTYA 3PJSA 5CLWA 4IRZA 2AXGB 3RWEB 3FOLA 3AB0B 1ZE3H 4H1LB 1RZ7H 4BELD 2D0FA 1TTGA 4KDTA 1MHCA 2BSRA 2XN0A 4NIKB 1HN1A 4POUB 4Z3IA 2B1HL 5ALBL 4E9XA 4LKCA 1PD6A 5EU6E 3GMRA 4F91B 4DGYL 2FJFA 1EAOA 5CSZB 3ASOB 1RK0A 1KFGA 5E1HB 1VESA 3MLXL 1GZPA 1NC4D 1JGUH 5J6HA 1OGAA 3QUZD 4MCMA 1VIWA 3OL2A 3QQ4B 1N64L 3LKPB 4GLRI 4DOHE 3FQNA 5F9AC 1LQSR 5BO0D 2HPTA 2GSIA 2GUOB 4L8SC 2ZCKL 4APQD 5KVDH 4YDVA 3L9RB 5CZXC 1U30A 3NZ8A 5ESAB 2GBVA 3JYCA 2E6JA 4XNUL 1OP3K 2J55A 2UZYB 1VZIA 1CE1H 4H5SB 4UWQB 3VXRD 3MJ6A 3EYQC 4N2NA 3T2OA 4KO5A 3G7TA 4MAUL 1DQJB 4HALA 5C3LD 5JHLH 3FCSB 3ULSB 4MHHI 4WW1B 2VSCA 1LO0L 1NUFA 4RESB 3LQAL 4E5XG 4N0YL 1E40A 2DQDH 3MRKB 4P2RD 4XO8A 1S7SB 2VSMB 3NK3A 5E1AA 2EIKB 5I1DB 4A2MA 4PRDB 4HISA 3VXRB 4FCHA 2UZPA 1R34A 5DQ9A 1G1YA 1CXKA 1G0DA 1A6TB 1CDYA 1LLAA 1GMEA 1UEYA 5FM4A 3CFJA 5EUKA 4N2HA 4C59B 1Y7VA 3T6XA 3VJ6B 1S7UA 4FNQA 5FM8A 4EZLA 1NFIA 3NZ8B 5ESAA 5HJ3B 2CKBA 3GXMA 3WJLC 1WWBX 2XWBA 3FQWA 2AS5M 4WUUE 3NCYS 3MCLH 2VDPB 4JO2H 4WK4B 2WBWB 5EWIH 4AQAB 3MGOB 4RRPM 3ZBMA 1MAJA 2ROXA 4KO9A 5AVWB 2FD6L 4PY8J 1I9IL 2XTJB 3MV8E 3IJ7A 4A2DA 5BVPL 5T1KA 5TJWK 4W9DC 4X5XA 4AVIA 3QG6A 4IKLA 2V8LA 1NCUA 4RMVA 3UBXA 4PY7A 1QPKA 3ARDC 1ADQL 3GINA 5IQLA 3T0BA 5A40E 5A2JH 4HEME 2XPYA 4L4VD 4POZD 1PZDA 3ARUA 4F15B 3O6KH 1G7JB 2VH5L 3FW6A 5CEZD 3D7PA 5F1NA 5I6XC 4OM1L 1DFBH 2JMRA 2ZT9C 2Q76B 4YDZA 4EBQL 2FGZA 1SLUA 2DQGL 1MZZA 2W65B 4WJG3 2XRAH 4HV8B 3NRFA 4M5YH 3H9HB 1E8XA 2K9FB 1GC1H 2QV2A 3GSWA 3HNSL 4LCWE 2Y7OA 4UQ3B 5I71B 3WNLA 2V5TA 4MRCA 3PABA 2IBGA 1A4KB 4RDBA 4A6YA 3DGCR 3BVWA 1DANT 1NSNL 3FNKA 5D7LA 3GWJA 3ETTA 3GS7A 3QUHA 3K71A 2KH2B 2YBRA 5D2LE 4LSUH 3FFCB 1U58B 5JIIA 2EDYA 4M7LL 4WTWA 1RCYA 3VRJA 1P69B 4UZUA 4HIXL 4PH8A 2YQ3A 2EUZA 1U3HA 5DEGA 5BQ7B 4XRCB 3TA3A 2ZD0A 5EUOB 5F7BA 4RFNC 1MIEH 2XTSA 3O3EA 4QOKB 5MEPA 1YEEH 2ZP8A 3OMNB 5ADPL 1BVNT 1HKFA 1ETB1 1OCWH 1GYCA 3LQMA 4XWGH 2FD6H 5E5RB 2WBJC 3NA9H 4X6CB 1OTTD 3ATBA 3DWTA 4WTZG 4PTUB 2WYHA 3ULAB 4W9FC 1SM3L 1MI5A 4K9EC 3T8XB 1KV7A 1ES0B 2FR4B 3J7HA 3DRQB 3WFCH 4E41B 1KNOA 3MR9B 2E9BA 4KNTA 4FP8L 8PAZA 3H7BB 4AH2B 5KBNC 2BSSA 3DX6B 1WWWX 1M71A 4JN1L 4KK6D 2PCPA 4NZJA 5CLZA 4O00A 4DH2A 2AV7A 5IJBC 1CI5A 1AJ7L 4WW2F 1J8RA 4WCYL 4P05A 3CTTA 4OQ1A 2Q6WB 1O5PA 1XSJA 3MJ7B 3VQ2C 3BAEL 3MOBL 4UV7L 4PRPA 3MHZA 5D4IA 2HKFL 1V7NH 3AU1A 1ECZA 1XAKA 5A1AA 4ICXA 3GNML 2OYKA 4P9MH 4A7SA 4P4RA 3QWRD 1B9KA 3Q06A 3OKMA 2V7NA 4GIAA 2E7MA 2Y69B 1WLHA 1EDQA 1LGVA 4NFBA 3NACH 1ZAGA 1HH6B 3VXSB 2WLLA 2VLJB 1A7OH 3M86A 3FT2A 5HVGB 3JUYA 3HJEA 3GI8H 2P9RA 3ZTNH 3FTVA 3W5MA 1QR1A 1HIMH 1AJ7H 4X9BA 5FCUH 3SDDC 3WEXA 5I1LA 3CFCH 2AQNA 2ZUTA 1J0YA 1SMAA 4XX1G 2CK2A 1AHMA 5M94B 1NBZA 1TCRB 4MX7B 4Z7NE 5KTEH 1IAKB 5GS1C 4NNXB 2VDNL 3AAZA 5LVEA 5BOPA 5E9DA 1ED3A 4KI5F 3TEZA 4ZOCA 1TTUA 3CLEH 1VDGA 2A9NH 2APWA 3KPRA 2ESVA 4P07A 2GJPA 1R3JB 1T21B 4GKSB 3WD5L 2PTTB 3K8MA 4P3CL 4U1HB 5KSVB 3QR1A 3MFGB 2BNUA 3E8UH 4PVNA 2OV0A 4BHUA 4MA1C 3RPBA 5M95B 1CLZL 3MRMB 4JRYE 3TLRA 4Q14A 1WT5A 3BLKA 1HXYA 4G42A 1TZGH 5EN2B 2DD8H 4LHJB 3UTPE 2XA8L 4D94A 4F24A 4H2AA 1BEYL 3PL6D 1KJ2H 1YMHA 2HLFD 3I2CH 4OLVH 2R2HB 3SYAA 4MD4A 4ISVB 2X2YA 1QO3A 4AGNA 4U0RB 1P7BA 4X6DE 2DQTL 5FYLD 4POZC 2PP9A 2JKXA 2XQBH 5F88A 3UAJC 4L4TA 4WVRA 2DZEA 3IMVA 4PRHE 4JAMB 5BUPA 1XF2B 4P4KD 4ZPVB 2Y06H 2EE2A 3E3QE 5A43C 2EJ1A 2XN9A 5EU3A 3SKMB 3F7VA 1A6WH 3DJZA 1MW3A 4UCFA 3C5ZC 1DJIA 1KEMH 3RDTD 1A1MA 1NEPA 3OBAA 3REVB 4X5QA 1SJEB 3VW3L 1SBBA 5HHVL 4U6XA 1RPKA 2Z34A 3TFKC 2Q7YB 3GK8H 1R3IH 1IKOP 4DP1X 1E3ZA 2Z1PA 2CK0L 5L7XH 3MRMA 1KTDB 1TTCA 2A3TA 2H1PL 2H26B 5SX5K 3FQTB 5KVEH 1Y18A 4U31A 5JIMA 4NBZB 4HJIA 1W0VB 4JO8A 1PKOA 4TSBL 5TE6H 1G4RA 3PREA 4PMFA 3US9A 3MRJA 4QWWD 1P7QD 1S9VA 4WHTB 1RU9L 4DAGL 4LLWA 4B9YA 4TQIA 2N1TE 2YPLB 4OKVB 3VSUA 1FFPB 3IDXL 1TVHB 3CZJA 3H3KA 5EU4B 1FNAA 4I87A 2JTYA 3NZUA 3RQ3A 2JK5B 3HUJB 1JMXA 2I5YL 3CX2A 5FYLH 4QXUL 4S1SH 1XGQA 2J72A 5GGRY 1PZUB 1R17A 4PGEA 4XPFH 1WBXA 3IF1B 4JHAL 1EBAA 5GRYA 1RXLA 2IAMA 4HMEA 4M8RA 5DD3L 3WUWB 2V17L 4MXVF 1HC1A 4N6RB 2NY3D 4MQXC 3FB7A 1VFAA 2X1QA 2YEVB 5IBTL 1JL8A 2DJSA 1J86A 2WLIB 3D2UD 2QVMA 4FOMA 1MHEB 2X2IA 4LASL 2P46B 2VM4A 5CZVL 1G94A 4MDIB 5FM5O 2NY4B 4H8WH 5HHMD 5CGMA 3VM7A 3TN0A 4GG6E 3VFRB 4QRBA 1HCVA 3U46B 1B4LA 2J4WH 3DYMA 2VJ8A 5IMOB 3F6LA 2OAAA 1B2WH 3BKJH 3RFZC 2P8MB 5KSAB 3P2DA 2BNRE 4C56B 1MI5D 5AW9B 1JPTH 2GK2A 3UO8B 4IIQA 1J1XL 2AV7B 2QV4A 2HZHA 1QW8A 1IGCH 4UM9B 2A83A 4NGHL 5HD8D 7PCYA 3B7TA 1KOAA 2Y23A 3GMQB 2VE6B 3WEMA 1TJGH 5F70A 3RIKA 5C6WH 4FXTA 1WUNT 1DQKA 3TOPA 2YIHA 4YFLI 4QJ5B 1UYWL 1T2XA 4LLQB 4ZXBB 5BS0D 5CJXC 5AKVA 1MCRA 3SCMD 1QSEB 4FZEH 1M2OA 4UIMA 3TYFB 2AC0A 1FV1B 1KEML 4BEIA 3MBEA 1B0GA 3NFPB 1MCSA 4FG2A 4R7NA 4ZS7L 2Y36L 2QQLL 1UZ6F 3QFDA 4L3CA 5F7FA 3UPRB 4Z76B 2NX5B 4JFEB 2VITB 1MRCL 1K8IA 2FWSA 3GSRB 1QUNA 2WXGA 3QCTL 2WWMC 4BK5C 4L3EA 4HK3N 4AIZB 4JK0D 4D7BA 2VDKB 5C07E 5EZJA 1SYSA 4PJGB 2VZOA 5HDWA 1JJUA 4BWWA 3I9IA 4UIMB 3B1UA 3JV4A 5F1SA 2BVYA 3BGMB 4GO6B 5BZXA 2ICES 3GSVB 2XN1A 1EZLA 4CSTA 3D6GA 1XB3A 5JW3H 4LPTA 4BSVB 4UU9B 1NMBH 1I7RB 3EFFA 3K0YA 4EI5A 2WIMA 2MQGA 5FCUL 3T65A 4FKEA 4K8RC 2F08A 4L1TA 3VXQB 2G3ZA 5IB5B 1WYJA 1WZLA 2UYLA 2AI0L 4JM2F 1HILA 3I75B 4GW4B 5C6PB 2BIMA 1FRGH 3U82B 3UG4A 3C5XA 2ENJA 2WAQA 1EDHA 5JW4Q 5JW5A 2PWFA 1NM9A 2K4WA 3ZKNC 5F3HA 1MFAL 4X7SH 2EE0A 1NBCA 4U3CA 5F96L 1RK1A 4KKZA 4N5EC 4IK6A 1JPSH 1YEHH 3NJGA 5JQ6H 4TTDC 5D1QA 1GGCL 2I07B 4NQUA 4ZNCD 3WI9A 2QTVA 4IRJD 1CLYL 3TJHC 4PR5A 1UZGA 2WNKA 5F9OL 1ZTXL 2EE3A 4L0ZA 4RCAA 5JO5A 3UJIH 3A6CH 3H2PA 3JXAA 4J3BA 4QF1A 1EUTA 1RUPL 1NMCC 1QBML 1FGVH 1LTXA 5E9NA 5FV2A 4BV1A 1L6ZA 2Y7QB 2FX7L 3MRFB 4NQCE 2NCEA 5B8CA 4M3HA 2J3SA 1YEJL 1E30A 2JK5A 3HUJA 4I8DA 1T0MB 3JV6A 3NPZB 3FB5B 1MFEH 2X4OA 3L95A 4RFOH 5AVUB 3VMOA 5MEQB 5EN2A 3EH2A 1SM3H 4M1CD 4HBCL 4ZMYA 1LEIA 1JGVH 3EDEA 5C0FA 5BZWB 4HKJB 2VDRB 1MFNA 1FCGA 3CFDA 5DJDB 1JZEA 3QJXA 5E94B 2Y7NA 4Y1AE 3W56A 2AJVH 3H42H 1KCWA 5AAMA 1Q1JL 1HSAB 5I0VA 1B4RA 3K6OA 5HVWA 3ZX1A 3PP4L 4C56D 1YEEL 2EABA 1JVLA 4HWZB 4TVPL 3NBNA 4HKBB 4F2MA 3CX5K 4PJ5D 4M9PA 2ZXBA 3EFOB 1AIFB 4PJIA 2W80C 4X5PA 1XGTB 4BK4A 3NA9L 3DUSB 1ZTMA 2GBTA 1D5BA 1AGDA 3OKOB 4LLAA 2AXFB 4X99B 1C08B 2FE0A 1N6UA 3KPMB 5HP5A 1IM9A 4FKHA 4A66A 2EP6A 4R5VA 1CPUA 1PZCA 3S6CA 4B5ZA 1NUGA 2HFGH 5DEFA 4BK5A 1S78C 3DC0A 3O8XB 3S5ZA 5IJKC 2VTFA 3DVFA 3HIZA 3EJPA 3RWGB 3E9UA 3IJSA 4LCCB 3AUWB 1OAJA 4PLKD 2R1XB 3FQXB 4HXBH 4OFYD 3FUDA 2ZOLA 1SLWA 4AEIL 3LZNA 1I85A 4K4KA 2WXJA 3O2VH 4KBPA 3FFCD 4JPKL 3WLWD 4XB8A 1FVCB 2IPTH 2Q86A 3O6FC 4LHQB 4DK3A 4P5RA 3GM0A 4DP9X 1ZT4A 5DR5L 2JJVA 2XETA 3FXIC 3KVQA 1WEJL 2PO6C 4KVNL 1D6EB 2EKSB 1XEDA 4EDXB 1KIUA 5FO7A 4DSYA 4F7TB 1KYDA 3BOVA 2EDQA 3VD2A 2PPCA 3W81A 2E7BA 3GSQA 2JWYA 4M61A 5DTFA 1AD9B 1INEL 1O9ZA 5T1MB 2X3CA 3F7YA 4LP5A 4HAGA 4Y5XA 2UWEF 4NO5B 1R47A 5GGVL 3LB6C 4Z0BL 1HL9A 1H15A 3C5JB 3IU3B 4QYOB 4NUQA 4GW5A 4L9DA 2XQ0A 4WNQB 1X5KA 1Z9NA 5GRUH 3TT3H 2W0KA 3V79C 3BYTA 1VPOL 1B6DA 1NBVH 3QXAA 3EO1B 5FYLE 3FTYA 5EIIG 1HH6A 1SBSH 3RYMA 1XH2A 4ZUUA 4KTEH 4X9GA 4V1DE 4W9LC 3VGGA 3MC0A 5DEGB 5BQ7A 5IQNA 1KENH 1AO7A 4G6MH 2FK9A 3HG3A 4PGBA 4XMWA 1J1OH 1PFCA 4JQXA 2VERA 3O6MH 5DS2A 1KLUB 5T5FH 1C5CH 4L3FA 3FFDB 3NFSH 4BFRA 4NT6A 4PJIF 2G30A 2IFGA 1R19A 1LQBC 2DWEA 5KVEE 3S4SG 2W8CA 4OAWB 4NQCA 4X8XA 2ICWI 2C3XA 1NLBH 5GRXG 4AM0A 1PLGL 4ODHL 2DN7A 4MDJB 3B8SA 4FMKA 4YNYB 5I0DA 3EO1A 3BGFB 3BH4A 1FFQA 4KZ0A 1YDPA 4ICWA 4N5ED 1UA3A 4ODWA 4GUCA 4N0YH 5BO1H 5HHQB 3C8KB 3AS0A 3MGTA 3TWCH 2B16A 1ZV5A 2YEQA 3RDJA 3ULVF 4FZ8L 4U33A 3OG6B 4X5LA 5SV4A 3BDYH 1D9KA 1AD0B 1F90H 1JV5B 4XC1H 3ULUE 2E46A 5KYYA 1GAFH 2NY6D 4N0FA 5E8PB 4I1NB 4XI5D 2NQCA 2YKLH 1OD7A 5HDQL 2OW7A 3DIVA 2Z91B 4AUJA 5F7KC 1JK8B 4DN3H 1OCCB 1T1WB 3G5VA 3BZFB 5ENWA 1HZKA 3V0WH 2Z7ZA 5C86A 1OB1A 4CVZB 2R27A 4LQFH 5AVRB 4OLXL 4O2EA 1GIGH 2AANA 1KV3A 4H44C 4KRPC 4HVBA 5IBLD 2HVKA 1FP5A 1T4WA 4XNMA 3RRQA 3EF7A 4DUXA 1I7TB 3PGCA 4MCYA 3IFOB 5LGHL 3VVWA 4A38A 2V5MA 4KMTH 5LWYH 3RKDD 5HHPA 2B9AA 3MA9L 3MO1A 4PJ8A 3E6HA 4QHKI 4AGOA 1OPOA 3FCUB 2EDEA 1MHPH 3WKML 1T2JA 2R69A 2R4SL 1GHFH 4ZTOH 2V2WA 4Z23A 5F93C 1TZIA 3FT1A 5D2NA 3LKNA 4ZI8A 4RFEB 3H3PL 5GISL 1MFCL 3CSFA 1FAIL 4ZFQA 3UO1H 3SCMC 3QIBA 2L7QA 4Z3FA 1IKNC 5DHYB 4G6FB 2JCCE 3MRKA 3BVNA 2IH1B 1OCRB 4QWWC 3MRLB 5F0PB 3CVBA 4AYID 1DR9A 1G9NL 3ARGC 3OR6A 2WLNA 3D87B 2Y36H 3CDGB 3D39A 2F5AL 4LVNC 4MAYC 4PLKC 1NEZA 2YGNA 4YPJA 3L3OC 1RZJL 2LTQC 2YPKB 1V10A 2IF7A 1DSYA 1P7KA 1WC7A 5EC1B 5L0QB 4XCFH 3CFEA 4G8FA 1VRSA 2DQIH 3Q43A 3GSUA 3MV7B 4JFDB 4OD1H 3H8NA 4ODTH 5K59F 4RISH 4Y1SA 5DMGC 1LDPL 2BW5A 3V5KA 5FUZL 2E59A 3IDIB 5EU7C 5EOCH 1SEBB 3QORC 5KBDA 4MQ7B 5SWZA 4FNLH 1F4HA 4JANA 3K91A 3SDYL 2ADFH 3TBWA 4AK1A 1UM6L 2X2HA 1NC4A 3GIZL 1LEGB 3NJIA 1HWWA 2HJKA 4X7SL 4JN2B 4L5FE 3NSYA 4TF4A 5B8CB 4X4KA 5IVNA 4ONGH 5I0ZA 3IDJB 5LBSA 4C4KO 1C5BH 3WN5A 3X1NA 2JVUA 1L7TL 1KXQA 3BP7A 2LVCA 2KC0A 2VL5B 5ANMB 2R15A 5EEUA 4KAQL 4NC0B 4HPOH 5HI3D 2UVFA 3A3YB 5DS1A 4Y1AA 5DD5H 2D31B 4NFCA 5IFHL 3KWWA 4WLCA 1QFWM 2NY1D 1UZ6E 2A4ZA 1OSPH 1PX3A 4QRPE 4LP4A 5CEYA 1MLCA 3QHZH 2P49B 4JZOA 3IJHB 5MEOB 1UM5L 5E8OB 4IEFA 4P2RB 2YA0A 4OCSL 4KNQA 1KTJA 1E5BA 3JVGA 4OV5A 1NQBA 3QDGE 3NFNB 1ZT1A 1FVCA 4Y88A 5AVXB 5IBUB 1KWKA 1L0YA 1S5IH 2VM9A 2KDGA 1F86A 3QT2A 4OLYH 4KUCF 5CLXA 3SGKA 4CVUA 3VXUA 5E4AA 4RMWA 1HEHC 2OKMA 3GSXB 5CJ5A 2X2JA 3LZQA 2VXTL 2JIXA 5DVPA 25C8L 2Q8BH 2WKOA 5ACZA 1BOGB 2DOCA 2WZPD 1A0QH 1HNYA 1QTPA 4PVMA 3F65A 1BG9A 4FQIL 2D7PA 4XBGB 3LPFA 4I77H 3FZUD 3B3IA 3PHQA 3CH8A 4AQ1B 3X3FH 2RCSH 4XMUA 4JGMA 2YPVL 4MJ5B 1TTRA 2OL3B 1ZXKA 2A4CA 4KK9D 4Z77B 2V5RA 3DHJA 1UC6A 4FJZA 2EH8L 4AIZA 4ZW3A 4WY7L 2BS71 1BYNA 4XN8A 2ATKA 4PJHE 5I1AA 5I0WA 4ZFOA 2XG4A 1WG3A 32C2A 2TRYA 4W6YB 3RFZB 5C7ZA 3UBXI 1C1EH 4XAWH 1QNZH 2XI9A 3TBYB 1NDMA 4BKLB 2NY6B 2XZQH 4FTDA 2WP3T 5TDPB 3NIGB 1NJ9B 4PHXA 3GSQB 3NIDE 3ZL4L 4FKKA 5FO9B 4JRFA 1KGJA 1ZVHA 1S9KC 2HT3D 3SDXF 1E65A 1BZOA 2HH0L 1EXGA 1EA9C 2CIIB 1X5YA 5JW4N 1GRWA 5ALBH 2VR7A 3WHE0 3KL3A 4R8WL 4XNQB 4UQ3A 1NAMA 1YEIL 3PUCA 5C2BH 3WNMA 4CAGA 3L17A 5D7LD 5I1CH 3VB9A 4YPGB 3I02A 4GUOA 1XGPB 2ZOLB 1BQ5A 3VFVB 1NM4A 43CAA 4U1IA 2KLSA 3LCYA 2PYEE 3VTTA 2GI0A 1FNGA 4MYPA 2ZYRA 3ZSSA 1M9SA 4PW4A 1A64A 1DN0A 4AKOA 3SKNB 4QXWA 1J0ZA 1NDMB 2J1ZA 3PHSA 1U21A 5IGXL 1TENA 3T4YA 2SEBB 2IPKB 3KG5A 4J6RH 4OZGA 3HMWL 4BZ1L 5BXFB 3O2DA 3CNKA 4X98B 1F11A 1LP9F 1T5XB 4MB5A 2VDKL 2WLKA 4UNTA 1JZHA 4JFXB 2ETWA 5HHXL 4PAZA 4UQDA 2PCFA 5T3ZD 3WAKA 4LHUG 4JHZA 2CDGB 3AGVA 3G9VA 4A7GA 2F54E 1J9TA 5CHNA 2N0MA 3L7FA 2YHGA 2ERJB 3WUZA 3S35X 1Y6KR 1ROWA 1GOFA 2GKIA 1H9DA 1V7NL 2GFBA 1F3DJ 1ID2A 2NR6A 2UWEE 2H1PH 2DICA 1ZGLA 5H37H 4HKXB 5TD4A 1RUKH 4NZUL 3IT8D 4Q52A 4R96B 4FA8A 3EYUL 1NZRA 4OF3A 4YR6B 3OJMB 5I1JL 4YHZL 3DTUB 2FDBP 3KLAB 3DNKA 1CXHA 3CU1A 1K85A 1DQLL 5FXCH 5H37A 3IJEA 1ZHNB 1UENA 4V33A 3PY9A 2V2XB 2BJML 2ZXDA 3A21A 1CFBA 3ZDXF 1AOHA 2BRRH 1LXMA 1S9YA 5HJGA 4PUBL 2LE9A 2JKRM 3ZE2E 1ZK5A 4LU5H 4K94L 1DUYA 1DL7H 4ZDHB 3ZKQD 4M7KH 4WWOA 1I1AD 4AW4A 5AB2A 2I60L 3WN5B 1CDCA 1MCOL 3INOA 3S36X 1MFBH 1CLVA 4WK2B 4XHJC 2AKRB 4KROC 3WGUB 5MI0C 3DUUB 1I53A 4H7VA 5IG7B 1WFNA 5T1LD 5IB3A 1S9WB 3QDJA 3D25A 1MRFH 3BUYB 1A21A 3RUGF 3MDJA 4M56A 2D73A 1FLRH 2DQFA 4ELKA 2X6MA 2O4EA 2A9NL 4E5XA 1Z2KA 4HBQA 4R7LA 2PO6D 4W9JC 2UZIH 5DK2A 3BCFA 2AEPL 4X5WA 3ZZ1A 3I02B 3A23A 3KYAA 3UBGA 3KGUA 3KH3A 3VI3B 4UQAA 1YNTB 3R0MA 4KQ4L 3ULVE 2WNGA 3D09A 4X4ME 5I66B 1W80A 2AJSH 4IHOA 2M83A 5AOIA 5BV7B 5J13B 2BHUA 3MLWL 2LU5A 3D25B 3C6LD 4FYTA 1KLGA 3FZUC 1P7HL 5I30H 2W9DL 4HIEA 3O9WC 1IL1A 3JT0A 2YGQA 5E6UB 3APCA 5LCVL 1SVCP 4MNGA 1A3RH 3QNFA 1JXFA 1UYWH 5IBLC 1PZBA 4FLOA 3GXIA 2J1YA 2KQNA 1YLBB 1UWGH 3GMMB 4DKEL 4NM8L 4EQ2A 1U0QA 3KXFA 4PJXA 3VD4A 2CLZA 3KWWB 2NY2B 3RBSA 2F54D 2IADA 3OHXA 4OTXH 4N87A 2KZKA 5E2VL 2CO4A 4U6VL 4Q97A 4L0YA 3EUDA 1CUOA 3X14A 4ENEC 4EXPX 1E3XA 3I6KB 2Q1EA 4PSRA 1MJJA 2ZOWA 1IAOB 3T3ME 3PGCB 4MCYB 4NB7A 2LU3A 2BWIA 4HJGB 3RDTA 2G9HA 4M1CC 2RA1A 5D8JH 2EYRB 2LU4A 4X0KB 3V4UH 4AYEC 4PJ9A 1OCOB 1U8JB 1F4XH 1NFDE 4M43L 1A6PA 5CZVH 1M7UA 3NH7L 5FPIA 1UEMA 2HVJA 3BAXA 5E9DE 1ZHLB 3VFMA 3I3DA 3CC1A 3HRZA 4U05A 2GB2A 3MRCA 4XE0A 2Q20A 4X8JA 4OD3H 1F02I 1VFBA 4UBDD 5TE4L 2JKWA 4L5FL 4A2FA 4TXVB 4JRXE 4I9XA 2DQEH 1CFNA 4HZLB 5EOTA 5A3ID 3KLSA 1HOEA 3TNNB 2XIIA 3F2LA 2QGDA 3RWIB 2APSA 1INDH 3GMOB 1FL6B 2HUHA 3ZTDC 3UTSD 4PHZA 3V0VB 1IAMA 3WJMA 4F9LA 1TYJA 3V4UL 5DZJA 3O3UN 1KT2B 2V9TA 1H0DB 2WNXA 4MWFA 4PIRF 5TDOA 5EF3A 4HWEH 3Q05A 1HOCB 1N0XH 2WQAA 3HR5A 1N18A 2NXYD 4PN6A 4RAVB 3QEUB 2Y2YA 1IIIA 4BDVA 1NWOA 3AJ7A 3VTMA 3QCUH 4A6YH 3U6RB 3QXDB 1FHNA 5FUZH 2IBZY 1A1OA 1E9OA 3G6DH 1YECH 2AJUH 3S8FB 1URIA 1I7UA 3K72A 4PRPE 4GMSL 4XNAA 3BIBX 3TN0C 1M05A 4OF7A 5I8CB 1FFTB 1GGCH 2DQDL 3P77A 2WCGA 3EHBC 2CK0H 3L1FA 4KQ0A 2IGLA 3D0LA 1A9BA 2ADGB 3ARSA 3B34A 3WELA 4FNTA 3T2LA 4K3DL 5E6YA 1TKWB 1V3JA 1E4WH 1YMMA 4RWYH 8FABB 3C5SB 3WEBA 1J0KA 2C34A 2Q2EB 1LK2B 4P23D 2ZIDA 1RULL 4O02L 4JFOA 4HXAL 5EC1A 3IJYA 3V6BR 3MX0B 1A14L 2F0CA 1IEBA 4JQIL 3BFQG 3C12A 3HHRB 1NEZB 3ECQA 4AVHA 2AEWA 4F7MA 3SPCA 1RZ7L 5IMLB 4NLAA 5F89A 1NMBL 3FTWA 5F0LB 3QS3A 1H15B 3C5JA 4QYOA 5ADOH 5E8PA 5I73B 2A6DB 2E74C 3EOTH 1BQKA 3M17A 1IBGL 3N0PB 2R4SH 5E8EB 3OXSA 3BWAA 4BXSV 4YQXH 4XNYL 2XNAB 4Z77A 4DUVA 4PJ7A 5DRZB 5SWSE 2DY2A 3B2VH 3F7LA 4KVCH 5F21B 2R83A 1MIML 5FLVA 1G7JA 3QJTB 5DRXA 4F5CA 4YEEA 5IB1B 2DI7A 4R8WH 3DURA 5I76A 1A14H 5EB9A 1NAMH 4DPCX 3HI1B 2ZPKL 2Y5TA 2ROYA 4JDVB 3LN5A 1J8HD 3MBXH 5E6SB 4XMKL 4EUPH 2FYYA 4XPTH 1OP3H 4K15A 2EDLA 3JWNH 3FFDA 5DK2B 3T6WA 3B3BA 1BWWA 5DJAB 3RZCA 1AGBB 1X4XA 4MJIE 2R39A 4QO1B 1FZKA 4NNPL 1DSWA 5CR8A 4QXGH 2WYTA 1W8OA 4WWID 1BQUA 2OMUB 3HHMA 4JDZA 3KL5A 5D70H 3BD5A 3U4EA 3ETBJ 4JHWH 4OW6A 2P5ED 2BP0B 3QPQC 4KU1A 3QJQB 1S7VB 5C0CA 1SXZA 5JQHC 3HHSB 4ZDHA 3TWCL 1V05A 1Z66A 4PRPD 4S1QL 3M45A 4FFZA 3CHRA 3ZK0A 3KGRA 5F9JB 3O9WB 5E4EB 2HCZX 3HC4L 3RWJA 4DVBB 3AADB 5SWZD 1ACYH 3FAWA 4U49A 2G5UA 3GRBA 1SLVA 1YJDH 3DV6B 4YSUA 3GBEA 3M6DA 1TUPA 2I85A 5JUEH 2BPBA 4E0RA 1L5GA 2KHAA 2XTJD 4XC3H 2BHYA 3QNXB 5D4JA 1GSMA 3G5YA 2X70A 2B59A 3U9PH 4UILL 3VXSD 5JHAA 5IKCB 1S9XA 2CD0A 4B9CA 4XVTL 4HH9A 4E42B 5KANG 4EXKA 3NDYE 4L8CA 3C09C 5B22A 3O6LL 2GSIB 2HYMA 3NH7H 5C0GB 1RQ5A 3VFGL 4ZAKB 3BCDA 1WS8A 2DDQH 3BKMH 4PJ9D 4QHNB 5E2TH 1B3JA 3FTXA 4L8SA 5KN5A 1FNLA 4WUKH 3HG4A 4JO3L 4LCUB 5DD5L 5D7LB 5TE4H 5JO5B 1DDTA 1UB6B 1E3FA 1D7CA 3DTXB 3IS0X 4NHCH 5DYFA 3VQLA 1KBWA 3U6RA 4YWGH 1OO2A 2D3VA 4TNVK 4YN3A 1AZVA 1DBAL 1NTDA 2DQMA 2K70A 3KWVA 3VD3A 3ZL4H 5DC0A 2NYKA 1Z9MA 4XP9L 3D2TA 5EHFA 1HQRA 2ZG2A 5E56A 3DSNA 3HG2A 2F53D 4YFLF 1TVBA 2F1BA 1FAKT 1I9RH 1KTLA 4X80L 4NIYE 3IDGA 1W0YT 3QEGH 2QQKL 5MENA 4WTQA 3INUL 1AIFA 5FUCE 1IVTA 2QADD 4H0GA 4OM0L 4WI0B 3ZHNA 3OJDB 4OTXL 1KN4H 4YVNA 1JMZA 3QIUD 3I6GA 1TZAA 2F9BT 2XN9D 3DK2A 3T2QA 1E9QB 1BREA 4NQQA 3OB0K 2Q8AL 4HS6B 1YPZE 3UADA 3D69B 12E8L 3BPOB 3WKPA 3VXPA 1H9VA 5A2CA 1WA1X 4QGTA 3MBED 2W9DH 2P1YA 3NP3A 2GJZB 1B2YA 1ZSDB 3AREC 4P23C 4Z7QF 5IIEB 2E0PA 1IAOA 1SXAA 4QTIH 3KJ4B 4HD9A 3VFUA 3I6KA 3CFIC 1EPFA 2KL6A 5DD6B 1MJUH 4MXWH 2XFXB 1CGWA 2VJ0A 6CGTA 4LLYA 1FYTE 3VXMB 1RJLA 4ODSH 5EEVA 2AZUA 4L3CB 1MXGA 3JTSA 2YR3A 3HE6D 4HV8A 5E2TL 3L3IA 3X13A 5F44A 3ZDXE 4P5KB 1YQ2A 5D93B 4YHOL 3P2BA 2KS0A 4X4XB 4ELDA 4Z3GA 3VXTB 5DFVD 4OT1H 3EYFA 1EEQA 1WFIA 4GQ9L 3MREA 3UGXA 1NH6A 1UD5A 3TBSB 2CBMA 2G5RA 2ADJB 4XNZC 1GGUA 5DJ0A 2AEQH 2WOBA 1FL6A 2LOEA 5TFSH 2RFXB 3WTXA 4S0SD 5KSBB 1QQDB 4J5VA 4P2CG 5IHWA 4JB9H 3RWHA 1YNKL 2BNQE 3V52H 4WFFD 3VM5A 1M57B 2Q5BA 5CEZH 5DZAA 1TO4A 3C6EA 1IILE 1M7IA 2P8PB 5FUCC 1E28A 1IE4A 2X87A 3JTBA 3S48A 3MUGB 1O6TA 3VH8A 1S8DA 2B77A 5I1HH 4NWUL 2NNCA 5L4JA 1AQKH 1AZBA 4PCKA 4OD2A 3FJTA 2AQPA 1G43A 4NQEB 2OZ4H 3GZOA 1FGNL 3Q3GA 3QRLA 2NZIA 3PPSA 2ADJA 5FHAH 3B7RL 3H9ZA 5D1XB 2BXZA 5GRWA 4LLUB 4ZD3H 2CWRA 1DCLA 1CFTB 5AWNL 5IUSA 1ACXA 3GZKA 3TA3C 4HYTB 3RURA 4AYGA 2B2XL 1MJJB 4BGDA 3ZIYA 5JOPD 3QWOA 4XPAL 5CWSB 1K5WA 4OLUL 3BE1H 3QJFB 2FQFA 2IXQB 1X5ZA 2NR6D 4ZMNA 3IWVA 1CVSC 4PR5B 4BHUI 3GIVB 2GJRA 4B9FA 1WIOA 1WIPA 2UZXB 3H7LA 1I1FB 3FQRB 4FLHA 3PQYE 1U8IB 1G7PA 1EZUA 3WS3A 3CN3A 4I0PB 3VB8A 1H3VA 3IDJA 3L6FB 1T66D 4YHPB 1SDDA 4HG4K 3IGAA 2O5YH 1F1GA 1HI6B 2X6CA 3F7PC 5TQ0L 2AJ3B 3IU4L 3OHXC 4R4BA 1Q9KB 5HGBB 3D05A 4Y7OC 6PAZA 4RIRA 2ICWB 3EOAB 5H94B 3QNZA 2D7TL 3S8GB 4LOUD 5LBSL 3OKNB 4AX3A 1YJDC 2VDQL 4OIIH 2BSBA 3VD5A 1JDCA 1BQSA 2ZKHH 1ZCRA 4ZUTB 3TNMA 1SXBA 4WO4B 1U4EA 1P7KB 2BSDA 4K7PL 3CXHJ 5ADPH 5GGTH 3GRWL 2QQLH 4JVUA 4FA6A 5L4FA 5EU6A 4UM9A 4JPWL 5FDWB 4PB9H 4HCRA 5FYKU 3HRPA 2WNWA 3NRQA 4J23A 2IH1A 3NZHL 35C8L 4X2UA 2UXGA 1I3GL 3HBPA 4M7JH 4PRID 3CFBA 4O02H 1P6FA 2QKSA 3KPMA 3R18A 4JG1H 4A7UA 1S2EA 2GK0A 4MA7H 5DRNA 2TSBA 2ZWKA 4OFYA 3B3IB 3PHQB 5DURB 4MFHA 2HWZH 1RIUH 2MTAA 4JPIB 4JUSA 4JM4H 1BZQK 2F8XC 4N1CA 4R5TA 1VACA 4B0MB 4WFHD 5CMAB 3VYOA 4EUPA 1KJMA 4DP4X 5TF1H 3EJSA 1CFMA 3IDMA 1J1XH 4FS0A 5FYKH 5DMYA 1AXSB 4YSDA 4NI6A 3IF1A 2XXGA 5LQBL 1NCNA 2AMUA 1ZT7A 2VDPL 1G6RH 1IGYB 2L3BA 5AOLA 5DFTA 1Q94A 3T0WA 1I3GH 3CVHB 4WEMB 5J3HC 5BUGA 4QRPD 2IWGA 1UCBL 4EKJA 4NP4L 3DO7B 2XT1B 2QGBA 5A7BA 3D39D 2NZ9C 1OCZB 4ENZA 2IDTA 4KZEL 2WLMA 1W6LA 1YEGL 1OAZH 4ZK8A 1THAA 2Z93B 4XX5A 4Q58C 1H6UA 5BV7H 1HXKA 3NCFB 3EDJA 4YE0A 4I0CC 3W0WD 1FH2A 1I9IH 4H8WL 1MUJB 3AG3B 3N0AA 3WJJC 5DUBA 2V17H 3OWRA 3HZVA 5D1QC 3U30B 1VLXA 3FU8A 3RUGB 3TBCA 4ACTA 4QXUH 1SLXA 1W72H 4OGYH 2EXYD 4KK5C 2D7QA 2R56L 3QUYB 5IQ9A 5DXWA 5JIPA 2B8OT 2JCCF 4N2EA 3B4NA 3DECA 3R1GL 5K9JL 1A4CA 3MOAH 4AW7A 2D2OA 4PP1D 4LCUA 1RU9H 3IK2A 4DAGH 1SYVB 4YDIL 5FYJH 4GW4A 5I6NA 3QJHB 1EO7A 1WCQA 3NJNA 4O2CB 3C5ZB 3VXRE 2K4AA 1U3ZA 3T6ZA 3W9EA 1KLFB 1L7IL 1U9KA 3IMSA 4G6JL 1GY2A 4N2FA 1PF3A 3H6JA 5H4YA 5KYUB 4BIKA 5ID0A 2CHXA 2K1MA 3S5LA 5L7XL 3IKKA 4XP6H 4O5LH 1LEKA 1WVZA 3PU7A 4RGNB 4K5MA 3EAKA 4I0PC 3JVFC 1G9ML 4R7XA 3KLHD 2CIIA 1TU2A 2L7JA 4IRSD 4K23L 3EFDH 2F19L 2QFPA 3WHE1 5CJQH 3PWUB 1CD8A 3FUMA 4Q9BA 2XTJE 3MV8B 2XQBL 1AE6L 2K78A 5B3JE 1CF8L 1P1ZB 3X13B 4A7TA 1LO2L 4TQEL 1ITBB 4Y2DA 1QW9A 4F8NA 4F2EA 1JZ5A 4A7GF 3EGDA 2HRPL 4D0DB 4HWBA 3THMH 3RPIB 2YXFA 2Z4QB 3EDFA 2HFGL 4KO7A 4QHUA 1NBZB 3MCYA 3VI4B 3MLYL 2DEWX 2ZAGA 4HJEA 4BFIA 3UYPA 3VG9C 2PN5A 3SKUD 5A2BA 3M8OH 2XQYG 1B90A 3X1EA 2QPFA 3IMRA 4EIZC 2OTPA 1N7MH 4PBWD 3FT2B 5F2FA 4CU6A 4F20A 3QS2A 2ZQKA 4JFPB 4L4VE 4LOUC 3SJVB 1O7DE 3DUHA 3MXVL 3P4NA 5E0FA 1RJZB 3PWUA 1UUSA 3ZT5A 1U95B 2N3JA 1A3ZA 4F57L 1AIZA 3VFSA 5TPWL 2RJMA 2MTPA 3GXPA 3LJ3A 4QUOA 3ZYJA 2Y7LA 2NW3A 4Q9QH 1HCFX 5DK0B 3ME0A 1LO3L 1P9MA 2BM3A 3BP6B 3FFCE 3QIUC 4J7RA 4W9ZA 3HC2A 5JHDE 1A6UH 3OAYH 5L2KE 4PG2A 2O5ZL 3BZEB 2XNAA 3BWUF 1UD3A 4MS8D 1XR9B 4Q2ZB 5FYKD 5MEND 4NLHA 1F97A 5JOPE 1N0LA 1PAMA 2Y22A 3ZDYF 3CZNA 4BH7B 2G2PA 4ODWB 1OAXH 3F6IA 4WTZA 2QKIC 3NEEA 4N2CA 5E1QA 1HOCA 4MD5B 4MDJA 3P3RA 1Q9WB 3A22A 4YNYA 1G5AA 3OXRA 1KBBA 3DTXA 1ORQA 3PF2A 4CMMB 2PUQT 4IDLA 3K2UL 4KK8C 4Z7QE 3QCVH 3N40P 5DDHA 3UABA 3DOHA 1C12A 3I3BA 2VDLH 1N3NA 2FSEA 3MFFB 4B9GA 4G9DA 4WEBH 1IC1A 3OZ9H 1ZLDA 4Q6IC 2VMEA 1UADC 4P2OB 5KZCB 4P4KB 2UXVA 4PJFE 1CR9L 5EUOA 3LZLA 4GI9A 4LBEA 5T5FL 4A68A 5E5LA 3BKYH 5IQOA 1SEBA 4ODHH 3FT9A 3HB3D 1IVLA 3MYJB 4GRMA 4QRFA 2NNFA 4B53A 4Z5RB 3KCWA 2LHAA 2FATH 1JXDA 4M9OA 4XH2A 2PABA 4OT1L 4G1EB 4FABL 2R1YA 3BUTA 4AL8H 1MPAH 4Y9EA 3DGGA 4G8IB 2FGWH 2P5WD 1SN5A 2AK4E 4MJJA 3SE9H 1UZ8B 3C60A 1KGUA 3FDWA 1EEYA 5F8RC 4J8RA 4WWKC 4F7EA 3TJEH 3HFFA 2C1PB 1KENL 4G6ML 1UM4H 1ZVSA 4L3EE 3ARYA 2KQMA 4GRWB 3ROLA 2I07A 4W9CC 3WUWG 1ZE3C 1PLBA 1IM3D 1UXWB 5IM7A 2WHVA 3ABGA 4J6IA 2GCYB 5FLUA 2R29H 3LKNB 4JG5A 1SOKA 3WMSA 4F5CE 5TK4A 3GXUB 2EYSB 3WDHA 3V0VA 1J5IA 2VM3A 1XF5A 4OAWA 3MNWB 4Y2LA 4ZYKB 4LARL 5FA3B 1N2RB 1VFMA 3MRIA 5DHVB 4JHUA 3A5VA 5B38A 4G1EA 1WFTA 1HL5A 4OUUA 5EDXA 1BM3H 2WO4A 1JGLH 4K8RL 4FFWD 3ATAA 5D4QA 3RY6C 2AGJH 3AS2A 3ECUA 1SJHA 1HTYA 1T22A 3N6YA 5C08B 1U3HB 1FC1A 2LLNA 5C0EB 3GSVA 3T8MA 5L0QC 1E4JA 3V0EA 1A7QH 3BMWA 4PWKA 2PO6A 1IFRA 2DLTA 2CHNA 2Y7SA 1BMGA 2W95A 2WXPA 3PS6A 2YD4A 3M1CA 4JRYB 7FABL 3EDDA 2WQ8A 2H2SC 4CNIB 4W70A 3FONB 5D7SH 1QSZA 1I8LC 1WK0A 2PXYD 5FYJE 1KZYA 1C08A 3Q6GL 1KGYE 4OBSA 5GJSH 5DFVC 2E27H 2OJZL 3UPRA 1EZVY 3MBXL 1WH0A 4X9FA 4AEEA 3DVGA 3FK3A 3QFDB 4UUJB 3S98A 3MUZ1 4G43A 5IOKA 5FGCB 3AMLA 4P46D 5CIPH 3LH9A 3V0AC 2VMCA 4HIEB 2ZUYA 3FUHA 2XWJA 4XXCC 1BAFL 1U8NB 4NQTA 4IW4C 1NCCH 5D2LA 5IHZA 3BQVA 1F1DA 3J2PA 3KLAA 3KXFD 4IHOB 1HH9A 2R0KL 4X5WB 5BVPH 2XYBA 5BZWA 1DEEA 4HJ0C 1LP9A 1BV8A 2EEDA 2FLBT 3VFSB 3QWOB 2ZONA 5BMFL 1KPVB 5DD1H 2ED7A 5CD3B 3LEYL 1BYPA 1DANU 3HNVH 3MRDA 4IGBD 3SDCB 4M6ML 2L7EA 4W9HC 3O8XC 4Y1AD 5F6HJ 3WS6A 3R06A 1RH8A 4ZBJA 5I5RA 4X8GA 5HVHB 2VXUH 2DWYA 4TOYH 5HYJA 1KWGA 2NR6C 4M62L 4H1LH 4RMSA 1E8ZA 1HHIA 1QD0A 1PZ5B 4LCYA 4F7PA 3QIWB 2PWGA 1I3UA 5LXGH 3PNRB 4GSDH 2ICEC 1DUYB 1DEEB 4IU3B 5IHLB 5CGYD 4FADA 5ID1B 3IU3A 1ZJBA 3RWIA 4GMSH 1J0JA 1D5MA 1MFAH 4W93A 4RZKA 1YEFL 3WFEL 4PLJD 5I1DA 2X09A 3OGCB 4HWUA 4TSAL 4LMQE 5IROC 1AY1L 1JGUL 2ICEB 4XPTL 3FF8A 4X7TB 1BD2E 1MELA 4R4FL 4R3SA 3JWDC 4WUUA 1SEQL 4J3OG 4DGYH 2ZICA 1AVAA 3CZSA 1JV2B 2PYEA 4JQVA 1GKOA 3KCPB 1CGSH 3J07A 1RUQL 4XVSL 5K9OB 4TRPL 3C60C 1KJ2L 2PWEA 3QUYD 4R97B 2QQNL 2BNRB 4ZUWA 4DIXA 2ITCB 2DJ4A 1KB5L 4O2CA 3EGXA 2YK1L 3T0DA 4NPKA 1A7BA 3FQYA 5I17B 5D7KD 1JVOA 5E7FA 1JFHA 3GMRB 5ALCL 1OK8A 3HNTH 5T1LA 3LKOA 3SPGA 1ACZA 4X9HA 5ICYA 2J1KA 7TAAA 3DVNB 3QFJD 4GUPA 2O61A 3QZPA 4H8WC 1QSEE 1FCCA 2EDBA 1QTYT 4PWIA 2DMGA 1KPUA 1Q72L 2X6UA 4HIIB 3CFUA 1X5MA 4YHIA 5G4MA 4I48B 4B97A 1YYLL 4OU3A 1Q1PA 4ETQB 1TQSA 5A2FA 2YUXA 5ILTH 4P2OC 1PFOA 1UD4A 3H9SE 1CGYA 3ZY7A 4BBWA 4E9SA 2ZCHH 3OLEA 1XB6A 2BHFA 3MUUA 4HKBA 4F2MB 2IALA 4TNEA 4ODBD 2AABH 1P4UA 3F85A 1O75A 4N6QA 2XN2A 3U1SH 1X7SA 3VWKB 1U6AH 4FTVE 1SEQH 2WLHA 1QLEL 4PJBB 4J28A 2E4FA 3O6FB 2VLKB 5B3JF 5DQDH 5BQDA 4JFQA 3U2IA 2QDWA 4A63A 2XZAH 2VLRE 1AY1H 3NDZE 1MFDH 4XN4A 2XIDA 1QR4A 3ULVD 3FB5A 4PFEA 3DGGB 4XOCA 43C9A 2NY0B 2YOCA 5D1QD 4YXHH 4U1MB 1R0AL 2BRQA 1LHZA 1U3HC 1GZHC 1JHLH 4NWTL 4W1TA 2IPUG 4I3GA 3KPSE 4MDIA 2XKNA 1KCBA 5B38G 5PAZA 4M3KB 2AJUL 3APMA 3P9MA 2NT1A 3C8DA 3GIVA 4PREA 3B2PA 3VCLA 1I3VA 3GMPB 1IU1A 1QI4A 1UA6L 4MMZA 4P5TB 1N6QH 4K3JL 5GS1B 1AI1H 2EVJA 4GI6A 1RZ8A 2VXUL 3DYPA 3GJFK 5IMMA 5IESL 1UOLA 2MPAH 3SY6A 1MCIA 2HG5A 1NMAH 4KXBA 4YHKH 3TGXA 4MS8C 3S34L 5FECA 4MSWA 1QI3A 1Y6NR 2VXQL 4LAJH 3T2NL 2E5EA 5I74C 4OQTH 1INDL 3GHPA 4AENB 5IOPA 3MOAL 1U93B 1ND0A 1UH4A 3VXQA 1O9WA 3NABL 5AW0B 1XIWB 4LLWB 3VXNB 1KXTA 3TBVA 5DSCA 1F2XK 2OSWA 1QQDA 3VFPB 2IGFL 2QBWA 5F1IA 1R3KA 2ZX6A 5LGJB 4Z7IA 1C5BL 3ZR5A 3P0YH 1TQWA 2CDGA 2NSQA 4GXVH 4ACPA 4IJ3B 3GLZA 1T2QH 3IFPA 4N2AA 4IMLA 2WTOA 4NDMB 3BRDA 5BRZB 1JTOA 2C4FT 2DBJA 4LSTL 4QRSB 4DF9A 2XCMC 4P48A 2DB8A 2JKJA 4Y1AB 4S10A 4HG4J 1JVKA 2Y72A 3SDDB 1DJSA 3FOLB 5DZPA 3TPKA 5CEXB 2V8MA 1MVYA 3NJVA 4NQDE 3TTSA 1Y0LB 3VDBA 3KPRE 2C4FU 2LFEA 2QPDB 3F7RA 3GI9H 1CE1L 4H8QA 5ABDE 4PJ7B 3KPLB 4ODXA 3ZRSA 5B3SB 2NXZD 4YDLB 3B6SB 4CVXB 1ASQA 3ULUF 2AK4D 2NNAA 4OLZH 1TDQA 3HS8A 4DP2X 1HESA 4HS3B 1UKQA 5ICUA 4MQ7A 4XN2A 3GKWH 3QI9B 4PJAB 3Q44A 3C6LB 1BEYH 4GQZA 3C60D 4DCQA 3QUYC 1YG9A 3QORD 4U1JB 4BH8B 4WF7A 4QD2E 4YDKH 3FTZA 5KYNA 4G1MA 1IC0A 3NA4A 1NAML 3NESA 4M6NH 3K80A 1M4KA 2AXWA 4OZ4A 2Z91A 3MRGA 1PYWB 4R2GB 5ESQB 1QEWA 3UTQB 1MIMH 5CFHA 8FABA 5EBMA 3N42B 3IFNL 4NO0B 4UYPA 1ZY9A 4U6HA 4Y2NA 2W9EL 4R97C 1YEIH 4N2IA 1UG9A 2E75C 3T77B 2COVD 4GIPD 2ATKB 5HJBA 4LQ1A 4NZRH 5PCYA 1J8HB 3N40F 2VC2H 4HD5A 3EZ8A 4UOZA 4OUUB 1UXSB 4LIQH 2FSEB 3O2DL 4EF3A 4ZPVA 3GSNL 4HWBH 2VO8A 3B9KB 3W5NA 1NOFA 5LBGA 1BLNB 5F7DB 2Z8RA 2WLLB 1YQVH 5EPMA 2FX9L 4WJKB 2Y3NA 3AUVA 5IEHA 1E9OB 3HFMH 4LPYA 2GY7B 2VAJA 3MNDA 1M1SA 2IH8A 3WNNA 4FQHA 1KC5H 3QQDB 1YEKL 3F01A 1ZS8A 4PBDA 1F42A 3UTSA 4IMKA 5E0QA 3MJ9L 3V8CA 5T1KB 2FCBA 4M1DL 1BD2D 2GJZA 5GIRB 3LRMA 4NQCD 5D72H 2MCG1 2B08A 4MTMA 4TSAH 2FBJL 3E2HC 3LH2H 4MMYA 3TIEA 2OFQA 1IJNA 1XCXA 5BVJA 1FNHA 1KB9K 5F71A 3ROOA 5EZIH 3F83A 3HE6C 2ESVB 4OZGF 3A6BH 3S35L 2JTDA 5GGRA 4W9EC 2VUOA 1UT9A 5HHOD 3ZKND 4PVBA 3GBML 4M02A 3VMPA 5LAPA 2OCJA 4H0IA 2B39A 2QVKA 1HS6A 2FH6A 4XVUD 2TAAA 4PJFA 1JK9A 3C75A 3G6DL 2HVJB 1QLFB 3P3SA 4IGBC 4LDOB 4ELMA 1TCRA 4MX7A 3VXUD 3RX9A 5I15L 3D4GA 3N91A 3ERXA 4O2FA 1A6AB 4MBRA 2GEEA 1WUZA 4KKAD 1GY1A 3SO5A 5LCVA 2ZKWA 1BW8A 3MFFA 1HHKB 4MRBA 1T0OA 2PXYB 3O3AA 1W72L 5DZVA 2FB4H 4JKWA 4U2ZA 2ITDA 4X4ZA 4ZFGH 4GBXD 5IVXF 4GFXA 4HCFA 3A6OA 3GSNH 4OSUL 5C9KA 4G7SB 3ZYZA 1FVDA 4H1LG 5LUMA 1X4ZA 5DVMA 5ES4B 1HT6A 3SO3C 5IFHH 2VLJD 3KNBB 3KM1A 2O6FA 5C0GA 4RQQB 5DJXB 4ALAC 4JFZL 1I3RB 2G2RA 4TNVF 3CZLA 1M7DA 2O6DA 5KVMC 4E42A 1KCVL 1UATA 2C1OB 2ZP0T 3EBAA 1UA6H 3T3PB 5HGAB 2YPKA 1QFWH 1PX8A 3SKOA 3WIIL 4EDWH 4ZMPA 3QNXA 4OF0A 5EMYA 1G0YR 4GRLD 2H2SD 4PPTA 1NEZG 2A74C 2MNWA 3MLYH 1WRFA 3E1F1 5D5MB 3QDMB 4NXKA 2XKUA 2R23A 1U8NA 1ZV2A 1HFUA 3KYKH 3BVNB 3U6XS 3B2MA 3VGHA 4YFEA 3VWKA 5KAQF 1ZA3B 5J6SA 5IF0A 3NCMA 4KZDH 1KXTB 3BP4B 2EAEA 1LDPH 4MXQC 4RA0C 4JO5A 4BUHA 3OKNA 1I3RA 2G2RB 2GYSA 2GTWB 3WN6A 3SSGA 1EJFA 1X9RA 1X9QA 5A2LH 4H0HB 1ZVYA 2Q8AH 3U4AA 4AMKL 1OQOA 2BP0A 3EYSL 2NNAB 2X05A 4PJHF 3V6FB 5MENE 5T1JA 1QRNA 1H3PL 1I7ZA 2GBUA 4XOAA 1IQDA 2CO3A 2NRDA 4GXVL 1AR2A 5C0BA 3VGDA 2O72A 4R90H 3QUYA 1OGTB 4UQBA 1KBGL 3PGDB 4Z78A 3WLWC 3BIKA 3IMBA 4KY1L 1CL7I 2HVKB 2CO1A 5LNGA 5J12C 3G6JA 2H2PC 3O4OB 4QOKD 4FXGB 4X50A 2P5EA 1ETZB 5FYJU 2JCCB 5DUPH 1S7QB 3LXAA 1T5WB 3CZGA 1E0OB 3IJEB 1HYRC 2O1AA 3NCBB 4K2UL 4TULL 2ARJA 1CZ8L 3FT0A 3MBWB 2R1WB 2GAZB 5AB0A 2XWBB 4FF9A 4RZCA 2CG9X 2DLFL 3ARFD 4YR6A 3KJ6H 4Z7VB 5CIPB 1QOKA 1GJIA 4OVVA 4HKXA 4EZJA 4QRPA 3CVDA 1U8MA 3D18B 3ATDA 1KJ3H 3KW8A 1ANUA 2FUQA 4G6AD 2W59A 1CN4A 1L7TH 5I6MA 3C8KA 1RZFH 3V6ZA 5D2NC 5JUEL 3TS8A 1E4HA 4XMLH 2YJQA 1XXDC 1I1AC 1EEZA 3PAVA 3IAQA 3ROLB 1JNHB 2R7EA 1SHSA 3V0DA 4YSCA 1E50A 5I26A 2AQSA 4PJIB 2WY3B 2R0LL 3BT2L 4YDNA 1BMWA 4WWNA 2PCFB 2VW6A 2EDHA 4QRRB 3CGTA 4PYHA 4MAYA 2AJYL 2H47C 2YAEA 1BGXH 1CBVH 2KMWA 4X4XA 4ZD3L 1HNGA 2WUBH 1CO1A 3ARBB 4TYUA 3CN1A 4LT7A 3BQUB 4IBLT 4M6AA 2NDFA 2FJGB 3EJYD 3I6LD 4PGBB 1R5IB 1CLYH 1EV2E 3BWUC 3RY4A 4QRPB 1UOVA 4AUYA 3DJ9A 4PI0A 2X4UA 3VH8G 3U7YL 4HJSA 5D1XC 1H5BC 2C9QA 4S1RL 2FT6A 4YHNA 3MRNB 4PS7A 3QIBD 4L8BB 3MLWH 1YQVL 2BS8A 3MRGB 4LSPL 4CKVX 3QO0A 1Z1WA 5FUOL 1NIFA 2GI7A 5HGHA 4DPRA 3H3PH 1MHCB 3CFJB 5EUKB 1ZSDA 4JL1A 2XBDA 3CVIL 2QVFB 4FJ6A 3MI6A 1CXLA 4FFYL 4KPHL 3SBPA 2A6JB 1AOZA 5EZPA 4KH9A 4PJBA 1IIKA 1HL4A 3LRKA 1A4AA 5DMIH 5EN3A 4DGIH 4B41A 4U1KB 3C09B 2XA3A 4PS4L 4X6DB 1YUHB 2CDFB 4X6FA 3ZE2F 4X7TA 4Z95L 1ZWIB 1OW0A 3CCHA 3LS5H 4N0UB 2IIJA 5E03A 4HGKC 1YHPA 4HIQA 4BRJA 5FK9A 2WXMA 2JELH 3TBTA 4YSSA 1NCCL 3NEXA 3KYOA 2YRBA 2AVFA 1JZIA 4PJHB 1MLBA 1NOLA 2CKNA 2OULB 3H0TA 4U1SB 4B9JA 4UTAL 4IRSC 2WGXA 2EC9U 4XVSH 5FGBA 3G5XB 1VGKB 1U8QA 3LIZH 3EKCA 4FFYH 3NRPA 3OTTA 4FD0A 4WI4A 3SGKC 1BQHA 1LE5A 3QFJA 1NDGB 3CDZB 2PW1B 4EI5C 2RHEA 3PJLA 3VD0A 4UAHA 3DTDA 2XJLA 3QUZB 4LSPH 4ALAH 2JKNA 2CCVA 4FZ8H 2Y1VA 4WSJA 4HKZA 2ZAHA 1II4E 1X5GA 3FMGL 5LNEA 2WANA 1OQXA 4JKPL 3O2VL 1NFIB 1A1NB 5D55A 3LNHA 5EIVA 4HPYH 5IB2B 3C08L 3KYOB 1FL5A 1FZJB 3HUJE 3QXVA 3G6AB 2CLZB 4WW2B 3NIDF 5K9KA 1MNUL 2PP8A 2IDFA 2CR3A 4KJWC 4ZX4A 3ZGIA 2BVQA 1YECL 1VFAB 4QEGA 1BGXL 2ERJC 4HHWA 4OUOA 3MJ9H 1W16A 4GEJA 1FC2D 5GGQL 1RY7B 2Z35A 1YZZA 4ZW6A 3ZUCA 5JIDA 1HWGB 1D5MB 4QIRA 1E67A 4CN6A 1S7WA 4D0CB 3SGDI 4CBZA 3C2SA 1FH5L 4UQ2A 5D1QE 3UROR 5C0FB 1T7XA 4NQVB 2LGNA 1N6VA 4MHHG 3G6AA 4C58B 1FL3A 1RI8A 2DI8A 5DI8A 5F7EH 2NPLX 4PWJA 5IEKA 3MNMA 3GDCA 3SDDD 4NP9A 1NGWB 3WFZA 3L4WA 3TV3H 4JN2A 2BNQD 3UYOD 3FOMB 4OZFG 4UQEA 4K3JH 3MTRA 4QO1A 5KZCD 5FGSA 3ZO9A 3BUDA 2J8OA 2BFGA 3RGVA 4AL8L 1OIOA 5F7WC 5IVOA 1KMGA 1S7TB 1YNLL 4YHLH 3CH1B 4KRNA 4M4RA 2CE6A 2W60A 3A4EA 4OLEA 3DO4A 2BOCB 1UJ3B 4RGND 4QKXB 5C7XL 3GEWB 2Y07H 4Y4FD 3WNKA 3TBTB 2V2XA 4JAMA 4BQ8A 5DUMH 4OZGE 4S0HA 3S97C 4LSUL 3KR3L 5KW9L 1FO0B 1TF4A 3B9VA 5DJ8A 3WIHA 4DP0X 1RFDL 1XGPA 2UUDK 4JO1L 3U1SL 1CE6B 5KJRL 5L88L 5CJOH 1T4KA 4UU9A 2NY0C 3S5LG 2MSPA 3HS0A 3SQOL 4HCGA 2UV3A 5F72S 2VR6A 5C07B 3AREB 5GJTL 2JQAA 2R29A 3Q8CA 2J7LA 2GITB 2YD7A 1V3KA 4WK0B 5CBAA 1OWRM 2YBGA 1Q72H 3IJYB 5C0RL 5IVXE 2FO1A 2M1KA 1NFAA 3QO0B 4TPRL 4NNYA 4YL4A 3O6KL 5D1ZD 1PY9A 3UC0L 2VL4A 3UP1A 2CO7A 2WGNB 5FO8B 1RUMH 4WI8A 2LLLA 3X12B 1Q4NX 3E7JA 2XXCB 2G2NA 1MW0A 1IT9L 3NTCL 1A7PH 1C16A 1U91A 3N5AA 4QAWA 5C08A 4L05A 1JWMA 5TPWH 3FSWA 3V95A 2WZAA 32C2B 3LXUX 3K2IA 4KX7A 4IDJH 4FERA 1JPGB 3PAZA 4MGXA 2A9AA 2VERN 4GAAA 3ALXA 1TLMA 2I7SA 3RI5F 2K0RA 4WI6A 4R26L 5DHVA 1RIVH 3HKZA 3IDGB 3PWPB 3Q2LA 3VDCA 4WEUD 4WZ9A 1NCDL 4PP2B 1E9PB 4QRRA 5G5DA 2J6WA 4D0DA 4K3HA 4L37A 3DXAB 3L13A 4LSQL 3K6NA 3BD3A 2DI9A 2B3IA 4ABUA 5F9JA 2GTWA 1A1OB 1MCEA 3TVMA 2FVNA 2G5BB 5M7QA 1TJXA 3U9PL 4PLJC 2A74B 4PJDA 2MEJB 4WHCA 2I9LB 2WQUA 4EJ1C 3FB6A 3V6ZB 1NAMB 1EEUA 2A0LD 1AZNA 2WN3A 3KLQA 4G8GE 4BSWB 1IFHL 1U8LA 4GSUA 3V0WL 5E08L 1HAUA 3L45A 1BZEA 4YHZH 1Q9LA 5EG6C 3OZ9L 4LSVH 2XWXA 3CG8A 4OJFH 1NGQH 5HGHB 5IB4A 2EEAA 4XT1C 3S5LB 2VLLB 4N1HB 2A6IA 3NJKA 1ZIBA 4N9GB 5AOZA 5SX4H 3ZHFA 1E8YA 3VNZA 4QRQB 4YXHL 2XPGA 5E9DB 3SODB 4GAYB 3FFOA 1GL4B 1EFXB 1ZPLA 5F8QC 4GKLA 3SPHA 1Y1UA 4E41A 2MHAB 4TLKA 1BD2A 2GJ6E 2ZUVA 5E99H 4WAFA 2P80D 5LHDA 3QG7H 5H2BB 1FVDB 3AFLA 1KB5B 1FSKB 3D34A 1HSBB 4HPYL 4NRZB 4MLSA 5CZXD 5JXED 4EI5D 2AI0H 1AKPA 3FUIA 2YQBA 2VL5A 1V3LA 5AUMB 5DA4A 4OZHA 4CN1A 4X4YB 3N04A 4AT6A 2XU9A 2OCFD 4JKKA 2PNDA 2MNJB 1WBXB 1O6VA 3WY1A 1G7HB 3RX7A 2CRIA 5IP4A 3CUPB 3OXSB 4Z7WE 3VI4A 3NPSB 4F3FB 5T3XE 1KIQA 1VSCA 3ET9F 4NENB 3NG5A 4ZMXA 1S7VA 2E6QA 4CVWA 3CIAA 3B8YA 3FB8B 1OEZW 4LEOB 1E28B 5MERB 3X3GL 3L3JB 5EBLA 4PRPB 2FECI 3ARQA 4RA3A 3GTTA 4NKMA 3O2WH 1CTOA 5E1GA 1XGRA 3Q0HA 4TSCL 4J3UA 1CZ8H 3SDCC 3BPNB 5T3XD 4HLJA 4F57H 1GGIH 4XGZB 2HRGA 1XXFC 1OARH 4A6YB 5MEOA 3RZCB 4UTBH 5IFAH 4GSRA 4GUQA 1MREL 2XKSA 1NCGA 4IDJL 3VACA 3LVTA 3EJCA 2WIIA 4PJ5B 1T5WA 4Z95H 2CH8A 4YAQA 3HN3A 5IROD 4A2LA 4L9LC 4R4NC 3ZVVA 2X4QB 1O6SA 4KY2A 5DWUL 4J4PA 1EO5A 5LLIC 1W15A 5EU3B 1F6LL 3FKUS 2EDKA 5I5MA 3VI3F 4JFVA 3T0EB 1IQWL 3RX8A 4ZMAT 5BZDB 3PGDA 4UQ9A 4MNGE 4RRPA 3VXMA 5I1EL 4GRLA 2O5NA 5CP3A 1PKQA 1RMFL 5T1DL 4K5NA 3EFDL 4Q6KA 2P44B 2J88L 3LPGA 2XWCA 4EIGB 15C8L 1EXUA 4TS6A 3DROB 1H3WM 2EXTA 4N3TA 4PY7B 3KLLA 1AE6H 4FQPA 1FZOA 4PJ5A 1L6PA 2O5XL 2Z4QA 4XNMB 5A16A 4M5YL 2HWZL 3SE8L 3RUGA 3QEGL 2OYPA 4NOFA 3LKSA 3P9LA 2YGPA 1FN4A 1JUFA 2H32B 1SDAB 4DVRH 2CSPA 1G9HA 2CM6A 3QO1A 1QBAA 4CUCA 5FKAA 4ZUVB 3B5HA 5LN4A 1T0NA 5DO2C 4OFVA 1RURH 2ENYA 4V1DB 5D2LF 3DIFB 3U4KA 3WKNA 1DBBH 4G7YL 1SHWA 3O3DA 1T83A 4O4YL 3TH3T 2FEDD 3UGUA 4D7PA 4OGXL 3RTQC 4AIEA 2JI2A 3DGDA 1E4XI 3ARVA 1EXUB 2UXTA 5DHXB 2JIXD 4HT1L 2OSXA 3T6VA 2VDNB 2H6PA 3P3YA 3HNVL 2WZPA 5AG9A 4A2EA 4AT6B 2LAAA 4K3EH 1JI1A 3QUXA 4IU2B 1P2CB 1JZ3A 1BXAA 3S34H 5INCA 3VXSA 4ZFOL 4EUPB 2VGLM 4MB4A 4F8PA 2J5LB 3PP4H 1RD6A 2IXQA 2BY0A 4E9YA 4EN3A 1WV7T 3PP3K 4I2XA 4U6YA 1E6JL 3WSQL 3TONA 4M4RB 1P5VA 2B20A 1X7QB 2B14A 1WICA 2WXIA 4AKQA 1ZLEA 4MDRA 4UBDC 5CN2A 2L4OA 1QTSA 4IKNA 4DP6X 3LS4H 1EBPA 4MBOA 5HYJB 3IMWA 4NJ9H 3T4YB 1F3JB 1QKZL 1CXFA 1F58L 4HOMA 4OD2B 3V0FA 5GXBB 2GSMB 4TNGA 3IRPX 3OKDB 3VH8B 2J1WA 4UMSA 1ECYA 2OYMA 4DKAA 4P2AA 3ZDZF 3PFQA 2QJDA 1TETH 3BPLC 1IGIL 3US1A 3CSGA 4KMLB 1CC3A 1KBKA 4WWKA 2FBJH 5IHBA 2WN2A 3VI3A 5CO1A 1G6RL 3I84A 3HW7A 1FL3B 2OMXB 5E23A 2R2EB 4J2QA 4MMXC 1XIWD 2AP2A 5LG6A 3Q6FB 1G4MA 2AXGA 3RWEA 2JXMB 3DJSA 4XXWA 2VDOB 4FHBD 5DQ9B 3RX5A 5I1EH 5JXEC 4DGWC 4NQXB 3MLTA 3GDBA 4H20H 1YO4A 1WS7A 3BJLA 3GTVA 4KTDL 5D7LE 4K8RH 4XCYB 5I75B 1W6WA 1AKJB 1OSZB 3FUEA 5KJ7E 1FG9C 1YY8A 3ZDZB 4IOFD 5H2BA 3L6FA 4ZW7A 4QCIA 4AJVA 1JWMB 4ZNEE 3AT0A 4NZRL 1CU4L 3P30H 4WW2A 4AIOA 4HMCA 1WA2X 1UQSA 3LN9A 4TV3A 1IKNA 3WNOA 1EAQA 1KF9B 1DQTA 2PPFA 3EJRA 5IFJA 4NBYB 2OK0L 4ZOEA 4PV8B 1TJMA 3BPOC 1PCSA 2OL3A 3U83A 4ES9A 5HYSA 1L4IA 5ICZB 2ZXEB 4XNYH 4H88L 1CYGA 5F9WB 1B0RB 1QNIA 2AK4A 3RWDA 4CSZA 4NDMA 2E8YA 1FWXA 5SV3A 3SDCD 1HK6A 1CF1A 3ESPA 3IJ8A 3WTVA 1MCCA 2R2BA 4KDTC 5FDWA 2RQ8A 2R0WH 4YC2C 1OKEA 4LLQA 1M7XA 1ZK9A 3ESNA 3EBGA 3W2DH 1JGVL 2GBAA 1I8IB 4EVNB 4OIFA 4ZOBA 3MA7B 3LPPA 4LNRB 4DCQB 2P8PA 1ZPUA 3QC5X 3CXFA 2Q76A 2VRAA 3CC5B 2UX6A 1MHHA 3QP3A 1JWSB 3AITA 4L8DA 4LFHD 3MODH 2APFA 4OCWL 2O5YL 4X6DF 5HI4C 5C0RH