1S7UB

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
total genus 13
structure length 99
sequence length 99
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7uB00
5EBWB 3OZ9H 1BLNB 3F65A 5GHWL 4D9LH 2I9TB 1JPGA 1D6VH 1JK8B 3LRSA 1RUKH 5CLWA 1TXKA 1UH2A 1DSFH 3MJ6A 3VWKD 2EXYD 3O4LA 3FCTB 2ADGA 4NZJA 1H8SA 2XY2A 4WW1A 1INQA 2BERA 3V6OE 3U0WH 1HHHA 3GMMA 4I9WE 3MRNA 4MJIA 1H3GA 3FN9A 2DQDH 3ZTNH 4U1SA 1OAQH 2P8LB 2EE3A 3HR5B 2Y06L 4MYWB 5GIRA 4HUUA 4DGYL 1W8NA 2W9EH 1OAYH 5KVDL 4HIJB 3RVTC 2ZCLH 3O2DH 1QRND 3SN6N 3ZLQC 3TFKD 3DSNA 3LVEA 4ZS7L 3FL7A 5DD5H 4X7FC 2DIJA 3S3PA 1W72B 2CRMA 3BKYH 5I75C 3JVGC 3WEXB 5GS3A 5F88B 5HHOA 3H0TB 3T8XA 1JJUA 1I1AC 5LQBH 5DF0A 3QIBB 3NCJL 3JV6A 2X44D 4JB9H 3X11B 4JN1L 3MCLL 4TTDC 2J3SA 3QI9B 1ZT4A 2BY3A 2ESVE 5CP7B 1B4RA 3OGCB 1QPXA 4MJ6A 2XY1A 1CDHA 1CGUA 3MRBA 5HHXL 5F7MC 1QSFB 4PG9A 3W9EB 1U95B 4PJ5D 1R3KA 3P30L 4KMLB 1F11A 1T1XA 4JFYA 2FCBA 4OGZA 3RVXC 1FNAA 2NYYC 3MNWB 1R24A 2ENYA 3VCLB 1DEEA 2UVFA 2X2YA 4N1CA 1QOKA 5GGTH 1DLHA 4TSBL 2GW5A 3HZKB 1A7RH 3QUZA 4KVNH 3FMGH 3O0RL 4TPRL 4ODVL 2YC1A 3MLZL 2AEWA 3CVHL 2CIKA 1SYSA 4KHXH 1J12A 1KXQE 5F3HB 1TPXC 2PYEE 5HJ3B 4HWBL 4RA0C 5C2UB 3AXLB 5DA0B 4PJ7F 3BP6B 2IANE 3P4NB 3VXUD 3RTQC 5HHNA 1MAKA 2F58H 4U6TA 4G9FE 2E7MA 3KPLA 4U6YB 4XNXL 2IPTH 1J10A 4IOIB 3S9DB 1O0VA 3GNMH 3DHJA 2R29L 4WO4A 4YIQB 3RVWD 3GSUA 1YA5A 1KSRA 1T04B 2NZ9D 4OQ1A 5F7UA 4Z7VF 3NIGF 4LLVA 3ZKMC 2WUBL 3O8XA 4Y4FD 4FQJL 3GSNL 3I2CH 3VFWA 1AQDB 3BD3A 2HP4A 3TV3L 3TO4B 4UV7H 1VKXA 3K2UH 3KPSA 3MLRL 3P2TA 3O9WA 4JFPB 4XPTH 2BSTB 3BSZH 4G6AD 1WWAX 4U1HA 2H2PC 3MGOA 2C7UA 2EECA 4R96A 5GJSL 1HHKB 1NMBH 4NN6C 2CDEA 3EO0A 1KPVA 1ADQA 3ZKQD 5C0EA 1MHEA 5E08L 3QXAB 1KXTB 5IMMB 3PJSB 5DJAB 1VB9A 4CKVX 1I75A 4YR6A 1BD2B 4MNHA 3CUPA 4FFVC 4NQED 2DIBA 2HLFC 4ZUUA 1A6AB 2XZZA 3NIGE 4MB3A 4S1RL 1LP9B 1UQSA 5C3TA 5I8KL 4O2CA 1U8JA 1XGUA 2HVJA 2HKHH 3A6OA 4JFDA 2AK4D 3P0YL 1EHXA 4PJIF 3QUML 4NHCH 4I2XB 4P2RD 4DTGL 1Z0NA 3VXOA 2L4OA 4ODTL 5AG9A 4MAYC 4Z7WA 4XPBH 3BQUB 3KNBB 1KENH 3MJGX 1F45A 1Y6MR 4K71C 5E4IA 2NNAA 3D85D 3PWJA 5T5NG 1HCFX 5JHLL 4WJ5B 2P24B 5F9AC 1AR1C 5GRUH 4PRNB 1H15B 4LSUL 3MV8B 3RGVC 2FATH 5L7XL 1N6QL 1FNEA 3RL2B 2FBJL 4HGMA 3DIFA 3L5XL 3BUTA 2X70A 2QL1A 4FQ2L 2EYRB 2CJUH 2IQ9H 3EZJB 3L3OB 2DM7A 4UT6H 2FJFB 2DYPA 5I1HL 3SKUD 1PG7H 2GSIA 3VD3A 1EH9A 4XP5L 3LIZL 5K33A 3SOBH 5EZOH 1DUYA 4GKOA 4AEFA 2X4QA 2GAZA 3HNVH 5CHNA 3PDOA 3ARGD 3G5VA 4QTIL 1A6UH 1BF8A 3UTTE 2GJJA 4O2EA 2VZUA 4NZRH 2GT9B 2VAAA 2CO7B 1MH5A 1XF4A 2XZAL 3NIDE 3ARBA 4ELKB 4WFHD 2OL3B 4J1UB 1EJ6A 2RJMA 1PYWA 1TZIA 4ONHB 3HNSH 3QULA 3F7VA 1KTLB 2HKFL 3CZFB 2W0FB 1RZKL 3HC4H 3JV0A 4OFVA 3CX5J 4MWFA 5CD3B 4MZ2A 3KYOA 3U36B 3W82A 3BZ4B 4J4PC 5I71C 4JREC 5DC4B 1BBDH 1KPUA 3FO9A 2ICWA 5B8CA 4WU5A 1UZ6F 1P2CB 4R90H 1WAAF 2VZOA 3C5JB 3WNMA 3GRWL 3WFDL 2EZ0D 3MOAH 1DLFH 5E00B 3RNQB 3CXHJ 1I4FA 1VGKA 3RDTA 5CGYC 3DJ9A 2CXGA 4QY8B 1J11A 4JFFA 4ZSOA 3RWDB 3UTSD 5IVXA 1QSFE 1AE6H 1K5NB 3REWB 4RWHA 1SY6H 5ERWB 1EEQA 4XH2B 3EYQD 3V5HB 5C3LD 3VFNB 1R3LA 5HVWA 2FX9H 4HKBA 4L9LB 2ZJSL 4WCYL 4OQTH 5I18H 5T1DL 3CXDL 1OLZA 3WSQL 1CD1A 4LIQH 4JCLA 5MP6L 2EKJA 3G04B 1DBKL 3DMMD 5KVFL 4WUUA 1UZ6E 4MQXD 3FO2A 3T0EA 5IBTL 5LG1A 4ZYKB 4ELMB 1WAAE 2AQ1A 4H1LA 3CSGA 3U2SB 1EAPB 3UPRA 3ROOA 1EEYA 3HG1D 4APQB 4BH7B 2BNRD 1QSED 1GGBH 1IFHL 1YECH 2FD6H 1BWMA 1KEML 3VJ6A 4X6BA 4MNQA 4XCYB 4I3RL 4K7PY 4Z7UF 5DC9B 4X9FA 5GS0L 1T03L 2AEPH 5E99L 3S8WA 3HRPA 4P2OD 1S7UB 4W4NA 3V2AR 4NM4L 5HI3D 3KYKH 1C7TA 1L7TH 4LVNC 4OD2A 2FBOJ 3FJTA 1AXIB 2FYYA 1LP9F 3HC0B 4HT1H 4JM2A 5DVKA 5F9WB 4HFWA 5DMGD 1U91B 1NAMH 4MD0A 5ETUB 5JOPE 3PQYB 4GRWB 5IB1A 3RPKA 4N8VB 3R8QA 35C8H 1G6RL 3V6ZB 1YMHB 2Q86B 4NWTH 4Z78A 1T1ZB 2ZSWB 3NFPA 1W0WA 1ZHBB 4HGWB 4LF3B 4AMKL 1P7QD 1A3RL 5I1LA 3WUWG 2IH3B 4U1LA 5DQ9A 1KB9K 4O00A 3GSQB 2R0ZL 4B7IA 1IM9D 3VWJB 2Q87A 2BSED 4JM4H 5JHDD 3MZGB 1PW3A 5HYSB 4J8RA 3KPOA 4GRLB 1RUAH 2X7LB 4R4BA 1BD2E 3CLFL 1U8IA 2Q76B 15C8H 4HKZA 4Y4KA 4LGRB 3ARED 3ZDYE 4L5FL 1QO3B 5CEYB 1LP9E 1L9NA 3FQRA 4Y89A 5C0BA 1GAFL 1HHJA 2B1HL 2Y6SD 3HLAB 1FPTL 1G0DA 1C1EH 3DTXB 4P4KC 5HYFA 3FB5A 5KG9B 5IM7B 1F90H 4NT6B 2KKQA 3QYCA 1G6VK 4I2XE 3W9DB 2P8PB 1BBJA 1Q9LB 4HWZB 2DQUH 3QFJB 4AH2B 4JFEB 4ODUB 2WINA 4BQ8A 3QRGL 4RMUA 3SGJA 2DJSA 4ENEC 1G9NL 3KYNA 1T7XA 3MV8E 3M1BB 3UTZB 1EDQA 3ARVA 3FN0L 3TVMC 5I8CA 3VXMB 4PPTA 1CK0L 3IDGA 2AJZB 1CYGA 5INDA 3O6FC 1J87A 1GJIA 1XAUA 5T3XE 4Z95H 2OTPA 4NO0A 1QFUL 1TTGA 3CMOL 4TVPD 4HWNA 1K6QH 3S34H 4IIQA 1T80A 3D0LA 4BFIA 2EC9T 2AK1H 2RHEA 5GGSY 2XWBB 1CE1L 3D48R 1UC6A 3N9GH 4QRRD 3UZEA 2F8VA 2BHUA 4L4VB 1KTRL 4QF1A 4KPHH 4DKEL 5IBUB 5E8NA 5IB5A 1YEHH 3TPKA 3OKNB 4XMLH 4OZFH 1VGEH 1UA6L 4K8RD 4ZQKA 1CFTA 1S8DB 2E7BA 3BZFB 4QXTB 4JO2H 3QEUA 1IQDB 4ZS6D 3MV7D 1MIMH 2YRZA 1JGEB 2E9IA 4ZTPL 5D9SA 4R7NA 3KJ6L 5T1KB 3PV7A 2VUOA 4XWGL 5AZ2H 4P5TA 5FEBA 5J3HC 4ODXB 5KS9B 5BRZD 4IRJC 2NY4D 5I30H 4GW4A 2G5BA 3O6MH 3ETBF 5D2NB 1T20B 1NFIB 4ELMF 3GSXB 2IC2A 4LP4A 2P7TA 2O5YH 3E8UL 3PHOB 1FZOA 3SPVA 3TO2A 2HMIC 2Y07H 3MA9L 1WITA 5DHYA 4ESKA 3T08A 2JJVA 2I07B 3BIAX 5BO1H 1NGYB 4I9WD 5D7JD 5DEFB 1S9XA 2R8SL 5J11B 4QCIA 1HHIB 1I7RA 5J13B 4GUPB 4JKMA 3PE9A 4XP4L 1TLKA 3QWOB 4LHUA 5IOPA 5EO1A 4YHOH 1BMGA 1Y6KR 1FG2B 5GGSA 2OTUA 3MRLA 4HC1L 2R2BA 1FZMB 1KNOA 2X10A 3ARWA 1RJYA 4G8FA 4JPVH 4H5SB 2RAMA 1XIWB 1YN7A 5LAXA 4ELME 32C2A 1AI1L 3T4YB 1HI6B 1FJ1B 3HE6D 3QXUA 3H42H 3TPUB 2JELH 5LCVH 2IAMD 4M43H 4UV4L 4MDJA 4P5MB 3BPLC 3KDMA 2ZCHL 3SKOA 1T21A 4Y2DD 2ESVD 3KS0J 5BZWB 3QQ3A 1OAUL 4OFYD 5JXEC 3FOMA 1I3UA 3QCVH 2GJZA 3NACH 1JPGB 1CD8A 5IWLA 1UYWH 3LRSB 2WANA 3O4LB 3D1MC 2ADGB 5EUKA 3D69A 2IG2L 4WW1B 2MSPA 1INQB 3PQYE 1NDMA 3GMLA 4GRWE 2VTFA 4H88L 4OD3L 4BUHA 1HHHB 3GMMB 1FZJA 3TZVC 3MRNB 3QDAA 4MJIB 5F9OH 4EXPX 1JBJA 1FAKT 4U1SB 1MJ8L 3I3BA 4DN3H 4XT1C 3VDAA 5FCUL 1F97A 5L2JA 4WRLA 4HUUB 3SDDD 4YDLC 1YEIH 3QIWD 2PYED 4AEIH 3U9UA 2UWEA 1L0YA 1GIGL 1DQMH 2IAND 4M1CC 4PJBA 1OY3B 1VA9A 4G9FD 3BPNB 3QDJA 4M7KH 2OCFD 2DQCH 5CZVL 4KQ3H 1KCRL 5TF0A 4BKLA 4LFHD 5FXCH 5CSGA 4XPGH 2QV2A 1U3YA 2HRPL 4Y5YC 4FOMA 1S9VA 4EVNA 3T8XB 5HHOB 4HPOL 4LHQB 5F3BA 3JV6B 4TNWK 5DFVC 4UAOC 1CI5A 4L8SA 1BEYH 1ZT4B 2J8UA 4PLNC 1R5IA 3QFJE 4MJ6B 3F58H 4JFEE 3MRBB 2X4SA 4PG9B 4L4JA 1JZ5A 4CBPA 1R3KB 4HG4K 4J3XA 5GS1C 3VXPA 3IJHA 1F11B 2QSTA 1T1XB 4JFYB 4H25A 4NNXA 3QUYD 3FKUS 5ID1A 2B0SH 5DO2C 1DEEB 1YQ2A 1PX4A 3VXME 5DMIH 1DLHB 2D7TH 3CIQA 2FJGA 5EDXA 3UBXA 5LGKA 2A2QT 1CXEA 1MWAL 1IGYA 3QUZB 4JHZA 5FDWA 3Q0HA 1JRHL 4QGYA 2ED7A 1I8LC 2YC1B 1N5YL 2CIKB 1SYSB 1GOFA 1PX3A 5SV3A 4J7RA 4G7YL 4JPKH 4M6NH 5IV2A 3BYYA 4HBQA 4FFWD 5HHNB 4L4VE 3H9HA 1LO0L 3ZDZF 2V5TA 3KPLB 1NSNH 2YZ1A 2CK2A 1GGYA 1JZ3A 4WO4B 3KYMA 3GSUB 1C08A 2B1AL 4RAUA 4F33A 3I75A 3RIFF 3PIQA 5F72S 1P1ZA 3MRPA 4J3SA 4YX2H 1XR8A 4LLVB 4UTAL 5L6YH 3O8XB 1JZ7A 4KQ4H 3PGDA 2R2CA 5GQBA 5F9JA 3VFWB 1OAZL 4TNVK 3T2QA 3S5LG 3CCHA 5KS9E 4KDVA 1VKXB 5E5RB 3KPSB 1QFWH 3O9WB 5D2NE 1BM3H 3IGAA 4NOBA 2D0FA 3ARQA 4W68A 2FH6A 4U1HB 5DT1H 1OAXH 2H32A 3MGOB 2C7UB 4R96B 4LLYA 1GGIL 5ISZA 3AROA 2CDEB 3EO0B 2I26N 4WU7A 1KPVB 5C0EB 1MHEB 4L8BA 4GMTH 4G6MH 1OTUC 4YR6B 5L8LB 1DP0A 1NBYA 4EJ1C 3BKCH 1CWVA 2OP4H 4MNHB 3CUPB 1EJOH 4FG6C 2Z8WC 4ZUUB 1UQSB 4OV6F 4NKMA 3WIFA 4O2CB 1U8JB 5C0IA 4FFZH 1XGUB 2HVJB 3I50H 4JFDB 3IFLH 2YRPA 3JV5A 1FFNA 1HQ4A 2CR6A 3VXOB 4Z7WB 3U7WH 3GJEA 3DRTA 1EZVY 2NNAB 3HAEA 3PWJB 2A73A 3HE7A 3UO1H 2EYSA 3QIBD 1TETL 4ZDHA 3QPQC 4I0PA 5DLMH 3KJ4B 1F4XH 1YNTA 3J7HA 3BZEA 3QI9D 1FNEB 4EDWH 1QFPA 2FGWH 4LSSL 3DIFB 3MOQA 2XQBL 5DYOA 2NY5L 2X70B 5FUZH 3U82B 2F74A 2PKDA 2QQQA 1QSFD 3PL6C 2EC8A 4BQCA 4X8XA 3VXTA 1U92A 4S11A 1NGPL 3WD5L 2DYPB 1TJIH 2OK0L 2UVEA 4R4FL 1FBIL 2GSIB 1LO3L 3WXWL 1AJ7L 3O4LE 2YD5A 1BQSA 2J6EA 4Z7OE 1DUYB 4JRWA 2X4QB 2GAZB 5CHNB 4RDQG 3PDOB 3G5VB 4MJIE 4KMTH 1KN2L 3KYAA 4O2EB 2IGFH 4GS7C 2VAAB 3PP4L 1MH5B 4N0FA 1XF4B 5D7SL 2HT3C 3ARBB 5FECA 4LVOC 1PYWB 1TZIB 3BI9X 1YZZA 3F7VB 3QULB 1B3JA 5BV7H 3CK0H 4MWFB 2DBLL 1Q94A 5E9DD 1MCHA 1X5HA 2UZYB 3KYOB 1MPAL 2BOBA 3RY6C 4HCRH 1KPUB 3TYFA 3FO9B 2ICWB 5B8CB 4WU5B 1J05A 1JHKH 1P9MA 4LMQI 2WWMC 5HHOE 1KJ3L 1FNSH 4XNMA 4KKCD 4TSAH 4XPFL 2ORBH 3OZ9L 1I4FB 1VGKB 3RDTB 4B53A 4D9LL 1I3RA 3CU7A 4RWYH 4D3CL 4JFFB 1NUFA 2F19L 4ZSOB 1RUKL 4W81A 5JOPD 5IVXB 3TO4D 4L8CA 5BV7C 4Y5XC 2AERT 3EYSH 4NPYA 5EU4A 3VI3F 1R3LB 3A0OA 3U0WL 2MHAA 4HKBB 3TA3A 2VQ1A 2WV3A 5B39A 3ZTNL 1CD1B 1MRDL 4NN5B 4YXLL 4X7EC 3C87A 3LS4L 2YD6A 3P4LA 4KTEL 1CDBA 2JCCF 3SHSA 4WUUB 4Y4HA 1R0AH 1BD2D 1RPQA 4LPVA 1ZANH 2WNGA 3FO2B 3T0EB 3O2DL 1P6AB 4KXZH 3N1PC 4H1LB 3B2VL 1VFUA 4Q9RL 3UPRB 1SQ2N 1ZHNA 1RY7B 3ROOB 1WISA 1J0HA 5DD5L 1EEYB 3OXSA 4Y4FC 4JY6A 3CVIH 4G7VH 3BKYL 3VJ6B 1D5IH 4X6BB 1A7BA 4MNQB 4WWKA 1UACH 3MQIA 3BQUD 4KROB 3L5WA 3VXRA 3WHXA 4YZFF 3VI3E 3CFBA 1K4CA 5ENWA 3KGRA 5DFWH 3LCYA 4OD2B 2NY1C 2YD7A 2FYYB 3B83A 5EO9A 3G5ZA 4JM2B 3DWTA 4Q97A 4HFWB 4DKAA 3MRCA 4MD0B 1BWWA 3LQMA 5IB1B 3HUJA 3HC3L 4K94H 4ONGH 4XAKE 3KPSE 4Z7WF 4J3WA 4Z78B 5T3XD 3NFPB 1W0WB 4YQXL 5GGTL 5I1LB 4U1LB 5DQ9B 5I6XC 1X4XA 4F7EA 2R56L 1NEUA 3I6KA 3WDHA 3DVNA 4J8RB 3KPOB 4OIBA 3DO7A 5LVEA 3HR6A 4R4BB 4XXCC 1U8IB 3ARTA 4L4TA 3RVVD 4HKZB 4Y4KB 2F58L 2EDQA 2W07A 4K94C 5C0BB 1INDH 4PB0L 4WI7A 1PAMA 4WWID 1HHJB 1T83A 3WS3A 4EN3A 4G8GD 1NCBH 4JFDE 4LL9A 4M7LT 3FB5B 3F8UB 2YXFA 1NDGA 2R9HC 3SE3C 1BBJB 3MLSH 4Z7WE 12E8L 1HCVA 2WINB 2HT2D 1L7IH 3I2CL 2BVUA 5MEQA 1BJ1H 4JQIL 1G0XA 3P11H 4TQEL 4UV7L 4V1DA 3TC9A 3K2UL 3KYNB 2I5YH 4XPTL 4ZFGH 5ILTH 3BSZL 5DMKA 5I8CB 2QQNH 5K9JH 3IDGB 2OLDA 5INDB 3VXQA 3FO0L 1YY9D 1IAII 4URTB 4NO0B 5FYJE 4X98A 3VH8G 4RMSA 2GTZA 5D96C 4IIQB 4NM8L 3QG7L 5GZNC 3D0LB 4BFIB 1PEWA 3BD4A 4M48L 3CFJA 1G9EA 3C60C 4YBQD 1OW0C 4DW2H 1D9KC 4CU6A 1RV6X 2X9XA 4QF1B 3WLWD 3PWPD 3DETD 4MXWH 5F7NC 2F8OA 1QYGL 5JW4N 4N0RA 5ICXA 4WHDA 1BAFH 4KJWD 5E8NB 5J57B 2BVPA 2HKHL 3QPXL 5HGGS 5IB5B 1V7MH 5K9QI 2R0KH 2VLKA 1LNUA 4EI5A 3KVQA 4ZQKB 5CIPA 4APQD 1CFTB 1IAKA 4OLWL 4XPBL 3QEUB 5M7QA 2QLVB 1KENL 4GG8A 3NTCH 3NZHH 4PJ8C 1DUZA 5D9SB 3WN5C 4QHNA 4OB5H 3EYOA 1LO2H 2OTWA 3C09B 2XN9A 2W38A 4R7NB 2GJ6A 3S36L 4P5TB 3MRMA 5I0ZA 2CD0A 4M3KB 1KC5L 4OLUL 1OOAA 4GW4B 1ZLSH 2G5BB 2FATL 3BJ91 4PY7A 5JW5A 2P7TB 1FZOB 1DBJL 2CJUL 1KCSH 4KJQC 3SPVB 3UPAA 4KI5F 3TO2B 3RIAF 3AU1A 2CLRA 4JFFE 3FONA 5SV4A 4ZSOE 4DZ8B 5DHYB 3EDEA 3NA4A 3PQYD 5KJRL 5IVXE 4F9PA 1A1MA 1ES0A 5C9JA 1S9XB 4XP1H 2WK2A 4QCIB 1I7RB 3JUZA 3CVHA 3L9RA 4QTHA 4M7ZC 1H3PL 3V7MA 2VXSL 4LHUB 1LK2A 3F12A 5C70A 3VWJD 2KPNA 4JPWH 1SHMA 5E7BA 5EO1B 3V8CA 3L95A 5IOPB 3ARPA 1D5XA 3O11A 2JJTA 3EAKA 4JM2F 4E0RA 5GGSB 2OTUB 3MRLB 2R2BB 5GXBB 4GRLD 5HD8D 5JOFA 4O51A 1KNOB 1RJYB 4G8FB 5DK0A 4WUUE 1OGTB 1H3VA 4ORGA 1YN7B 5LAXB 3T0EE 5E24E 32C2B 1PG7W 2HTKC 4PBVC 3BRFA 3VFPA 3HC4L 4IEFB 1MFDH 2AKRA 3H9YA 4KI5E 3FTGA 3L3DA 1PZUB 4HUWA 1P7HL 4DK6A 1GGUA 1MCFA 4MDJB 2KZWA 3GSNA 1K8DA 3KDMB 4MNQE 2XNAA 4OZFG 1CTOA 4Q0XL 3SKOB 5KSVB 1T21B 2WQRA 5ADOL 1WZ1L 2R4SL 2VMFA 3QFJD 3PHQA 1DLFL 4JFED 5I1KH 3QQ3B 1J1XH 4XVTL 2W9LA 5CGMA 2NXYC 3FOMB 2GJZB 2V5MA 4PBWD 3WNOA 2A9NH 4CNIA 1AE6L 5EZIH 5EUKB 1FNHA 3BE1H 3D69B 4ZD3L 3MBXL 1FAIL 1NDMB 3GMLB 3VXMD 1FZJB 4ODBD 4OQTL 2YK1H 4WFEE 1RZ8A 4W4OC 3PP3K 4CN6A 4X9HA 3VD7A 4ZPTA 3OPZH 4BFBD 5L2JB 1RQ5A 2DJ4A 3U9UB 2UWEB 2BSRA 2HFGH 3U4EA 5M94B 3MCKA 4CVXA 3QUMA 5BVPH 4PJBB 2DQJH 3QQ9C 4TVPH 5IQ9A 3QDJB 5C2BL 3K81A 5GS2D 5IJKC 2FD6L 4BKLB 5C0BE 1GOHA 4EVNB 1FDLL 1S7RA 1CQKA 1S9VB 2EYTA 2BXYA 4LSTL 4UBDD 3SE8L 1S5HA 5F3BB 5CSZA 1BOGA 3GK8L 6FABH 4L8SB 1L7TL 5C6TH 5HYIA 2J8UB 5E2UH 3GO1H 5T1KD 1R5IB 5ALCL 4K8RH 3RVUC 1PLGH 3S3JA 2X4SB 3BOVA 2DQGL 3RZCC 3VXPB 3SEPA 3IJHB 2OJEA 1HXMA 2ZUYA 1AR2A 1UCBL 1F4HA 1FVCA 2OR7A 2LFGA 4NNXB 3EJZC 1RULH 35C8L 4MHHG 1T5XA 4EXKA 5SX5H 3H3BC 5ID1B 1F13A 5AAWA 3MPCA 2ARJQ 4M8QA 2CGRL 5FUCC 5CJ5A 2FJGB 3UBXB 3DX7A 1IGYB 2ZUVA 1NANI 1QLFA 5FDWB 4O2FA 4JM4L 1NMAH 4JQVA 4JN2A 2W60A 5IFAL 4NCC1 1RUAL 3JWDL 5IHUL 4QOKA 5IV2B 15C8L 1NGZB 4MJ4A 4EUPH 3H9HB 3MNVA 1DQJA 5TFSL 3MACH 4B5EA 3E3QE 3NFNA 1TJHH 1XIWD 1NCUA 2P1YA 1J8HA 1CICA 4GFTB 2HTLD 3QA3A 3D25A 5ICZA 3KYMB 4Y19A 1C08B 1Q9WA 4N9OB 4RAUB 4NQUA 5DFTA 3GRWA 2IFGA 2MQ3A 2NY7L 3I75B 4IMLA 4F33B 4DZBA 2JIXA 3PIQB 1P1ZB 3MRPB 2DQUL 1XR8B 2DB8A 3HA0A 3PGDB 2DQIH 5F9JB 2FEDC 1FLRL 1V7NH 3T3PE 3CCHB 4LVHC 4MCYA 4XNZB 2A74A 5D7JC 1M71A 2APFA 2CUIA 2Y9RT 1JPSH 2AV7A 3U48A 3IGAB 2XWJA 1FP5A 4OGYH 1ZLWK 4PRHA 2A6KA 2N56A 5E56A 3O4LD 3DO3A 4KVCH 4LLYB 4Z95L 2D7NA 5ISZB 3RWJA 4WU7B 2N1KA 2J88H 4MJID 4L8BB 2FDBP 5FO8A 3WKNA 1IBGH 1WBXA 2GFBA 1PKOA 1FE8H 5A1AA 1NBYB 2C5DC 3N9GL 3VRJA 1TFHA 1MEXH 3BGFC 2V6HA 2WBJA 2X4NA 1SJEA 5E8EA 4I4WA 2ZUSA 1M4KA 2HVKA 3WIFB 4NKMB 4U0QB 5C0IB 2ILLA 4XZUA 1GHFL 4R0LA 3WHE1 4XMLL 1WTGT 1PJ9A 1FFNB 2DTML 1HQ4B 3TN0A 3GMQA 1I1CA 4NDMA 3GJEB 5F6HJ 4JEGB 2EKSA 3P9LA 1MCOL 3DRTB 3HAEB 5HHOD 2A73B 3HE7B 1LE9A 5AZ2L 2EYSB 4ZDHB 4I0PB 5TE7H 2UWEF 5I30L 1YNTB 3BZEB 3O6ML 3NIFF 2VXVL 4HF5H 3R06A 5DYOB 1G6RA 4XC1H 2F74B 1Q72L 2DQTH 4LNVA 2IMMA 3VXTB 5DD3H 1U92B 2EIDA 2Y07L 3QIWC 1RUMH 1RIVL 4EOWL 5F7DA 3LQZA 2ICCA 1KFAL 1RUQH 1TNMA 1IILE 1K4DA 1KYOK 4K07A 3WKMH 3D9AL 4P2CG 2LU4A 5JA9A 3OJMB 3QUZD 3LB6C 5ID0A 1U8LA 4N5UA 4RSVA 4YHOL 1NMCC 4N0FB 4U1GB 2AJXH 5FECB 4HX1A 3GGWA 2UWEE 4JPVL 3ESVF 3KG5A 1GVIA 1ZKAA 3NIFE 3P0GB 1P4IH 4PJBE 1DN0A 2YSSA 4LSDA 5I74B 1Q94B 3BMVA 3MV9A 3QDJE 3QZWA 2BOBB 4U2YA 3TYFB 4WO4D 4CDHA 1OP3K 1J05B 4ZODA 4FTVA 4XNMB 5T3ZH 1CR9L 1JNHA 4IOFD 3O8XD 1ORSA 2AJVH 2VXTH 2Z8RA 3QCVL 1I3RB 2J8UE 3NACL 3MLUH 1UYWL 1JIBA 5BS0A 1BECA 1LE5A 2N7BA 1HIMH 4L8CB 1YQVH 4XAKD 3KPSD 3AGVA 1KCKA 3O9WD 3J8F7 4EKXA 3KPRE 4KUCF 4NPYB 5EU4B 5TGBA 3VGEA 2MHAB 3TA3B 2FR4A 4GKZA 1PZ5A 2VQ1B 2C3HA 5B39B 3VDCA 4XCEA 3GJFA 4DN3L 3SGKA 3VA2C 5I16A 3FO1A 1UM5L 4AEIL 4MD5A 1MFEH 5C08A 1LO4H 5DD6A 4OCSH 4QT5A 4Y4HB 1DQML 4LCIH 4ZTOH 3ZMRA 4UB0L 1MREH 3AFLA 3MREA 1ZHNB 4BZYA 4PV9A 4LSRL 4M7KL 2X09A 4X7TA 2D31A 2DQCL 4JY6B 4KQ3L 4RGMC 3TBTA 4HWEH 4JFDD 4PP1D 2VNCA 1TENA 4WWKB 2VWEC 1DBBH 3GBNH 5C0RH 2RFXA 4N9GA 5D93B 4XHJD 2VZTA 3OR6A 3L5WB 1I85A 2J5LB 3VXRB 2NY6B 3WHXB 1MVFA 3CFBB 1K4CB 5ENWB 5J12B 3HMXH 1BEYL 3MOBH 1KELH 4M8VA 4KUZH 3WUZA 5KSAA 5EO9B 3G5ZB 4HDIA 4GOSA 1W72H 4BZ2L 3K4DA 3I9GL 5EFIA 2VR4A 2QADB 1F4WH 2LABA 3MZTA 3MRCB 1MNUL 3EDJA 3HUJB 4WY7H 1SBBA 2BHYA 3LDBB 4M9OA 4W6XB 1WT5C 2DYPD 4OV5A 5DMIL 1HNFA 2APVA 4M93C 4ZUTA 1GPOH 1LEIA 4F7EB 1CF8H 4LRIC 5ISZE 4H20H 3I6KB 4HC1A 3QO1A 4NUJA 3DVNB 3DO7B 4WTWA 2H45A 2R0WH 3CH8A 4L4TB 3W11C 5ANMA 3ARBD 4IJ3C 4KY1L 4NRYA 1J0KA 1D5BA 3WS3B 5EORH 3OB0K 4QRTA 4EN3B 4JO4H 4JG1L 1RK1A 1JFQH 3Q2CA 1NDGB 1A1NB 2O5ZL 4K7PX 4PR5A 2VABA 3OKYA 4P3CL 5D6CA 5E2JA 7FABH 4PLJD 5L6YL 2D4DA 2B7DT 5L88H 2MCPL 5MEQB 3WUWA 3MXVH 1KIRA 2EDDA 2M1KA 2OSLA 1JPTH 4NC1C 4V1DB 3RDTD 2ADIA 1F2XK 4JFFD 1KIQB 5DMKB 5HDBF 1AXTH 1PQZA 4E42A 3VXQB 2B20A 3HI5H 1XH3A 4X98B 2CRYA 2GTZB 3MROA 4P46C 4GMTL 1HSAA 3NPSC 2NTFA 2XYCA 3ILQD 4AY0A 3CFJB 1Y0LA 3FAXA 3BKCL 5C0ND 3REVA 1N4XH 3ALWA 1EJOL 3P73A 2EEBA 3LKRA 4NCDA 4NKDA 4NYLA 1XEDA 5ICXB 1KF9B 3SDCC 3MLXL 4BSJA 3T0ED 3I50L 4XP9H 2BVPB 1UKSA 2EE9A 3IFLL 3A67L 5IIEA 4L3EA 2VLKB 5L0QC 1LNUB 4EI5B 4KI5D 4NWUH 5CIPB 3E2HB 1IAKB 3RKDD 1TZHA 3V52H 1G84A 4R8WL 1M1SA 1H3WM 1TCRA 2I25N 4GG8B 3G6DL 1DUZB 4MNQD 3BDYL 4QHNB 3TO4C 2OTWB 3EYOB 3LEVH 5DVNA 2XN9B 2CSPA 2GJ6B 1ZWIA 5D70H 5L2KA 2XZQL 2I24N 3MRMB 4JDTH 3R1GH 4KROD 5D1ZA 5HI5D 5J0BA 5JQ6H 3ZYIA 3LN4A 1QP1A 3CSYA 1RURL 5EWIL 4EDWL 2FGWL 4H8WC 1P5UA 4PY7B 5JW5B 4PD4J 4XC3H 4Y2OA 1B0RB 1B0WA 3B4NA 5MI0B 4BFEA 5KW9L 4PUBH 4OCRH 5HDQH 1OCWH 3AU1B 3LZFH 4YHYB 4JM2D 1MY5A 2CLRB 2O61A 3FONB 4N0CD 2VKXA 5TH2A 4GW1A 1YEGH 1A1MB 1ES0B 4CMHB 5C9JB 4WFED 4KV5E 4FMFA 3ARYA 3CVHB 3L9RB 4QTHB 3K80A 4F2MA 3CPLA 4OCMC 3QUXC 1LK2B 3F12B 3KPNA 3MA7A 4XMPH 1RUPH 3B2UD 4FQXC 3L95B 1V05A 4K3EH 1EUTA 1D5XB 3O11B 1U93A 4E0RB 4HXAL 5T3XH 1BVKA 4JKKA 1IVLA 5JOFB 2NXZB 4O51B 4ZAKC 2ZCKH 3HUJF 5DK0B 1CFBA 2AXJA 3BRDA 1CGVA 3NAAH 4ORGB 4RISL 5TQ2L 4Y4KD 5FM5O 2D9CA 3VFSA 3EIFA 4N5ED 3VFPB 4RFOH 5BV7L 4OZ4A 2AKRB 5D71L 1W0VB 5DR5L 1T89A 4HWUA 1MCIA 3FTGB 3L3DB 3LKQA 4PRIA 4HUWB 5CD5C 4HCRL 2UZIL 3GHBH 3GSNB 4JKPH 2ITCA 1K8DB 3JUYA 2XNAB 3O2WH 2A6JA 1FNSL 2ADFH 2K7QA 1Z5LA 4F80A 3TH3T 2J4WH 4TSAL 4X4MA 3PHQB 3VXRE 2ORBL 3VXSA 1T0PB 2ZUTA 1TQCB 4ALAH 4K3JL 1RI8A 1KTDA 4CNIB 1INEH 3ULVE 2CMRH 1U36A 1IEBA 2IALA 3M8OH 4HQQL 2AEIT 5BQ7A 3NZ8A 1DBMH 3HUJE 4FQLL 1TQBB 2ZOLA 1RZ8B 4XCCH 1YJDL 3C5ZA 4GBXC 3CU1A 4NO0D 4U2ZA 3B8YA 1CLOL 4ZPTB 5CKAA 4WW2C 3TIEA 2EH8L 3S4SA 1EXUA 1W0YT 2BSRB 3S35X 3U4EB 4X4XA 3MCKB 4CVXB 3QUMB 3VRLF 3QIUC 5IQ9B 4HS3A 1AY1H 3CAFA 4L4TE 3QQ4A 4LARH 4R26H 4OGXL 5TE4L 1DL7L 3T1FA 4CVZA 2XWTA 2CK0H 1S7RB 2DD8L 2EYTB 5FA3A 5TDNA 1S5HB 1Y6NR 2IBZY 1S78C 5CSZB 1P4LA 2ENSA 1BOGB 2AV1A 1QLRA 1B4JH 3FFDA 2VSCA 4P5TD 1F6LL 5E5UB 5GRXG 2MTPA 1U8PA 3ZSSA 3TBWA 2OJEB 1HXMB 3O2VH 4J3OC 4ZFZA 1JHLL 1FVCB 3BDXA 5FF6A 1VFMA 5IKCA 4K94L 4V1DE 1T5XB 1HH9A 1OTSD 3K1DA 1OAKH 4P23C 4MXQD 2YD2A 4NNPH 1BZQK 3VRLE 1NEZG 3DETC 4M8QB 3V9FA 1XT5A 3DX7B 3EJYD 4HULB 3IKCA 1JZ6A 4DCQA 2NY0B 1QLFB 5SWZA 3QEGH 3SE9H 4O2FB 1F5WA 3LY6A 4JN2B 2W60B 4GRWH 4LHUD 1JGVL 1SBSH 2VL4A 2Q6WA 3ILPA 4QOKB 2Y1VA 1DQJB 3MNVB 1CD9B 3ZL4H 3QH3A 1KCLA 3NFNB 1INDL 2VB5A 3C2AH 1MLCA 5EA0L 1MHPL 4LPCA 2XRAL 3U30C 1J8HB 3BIBX 5C09A 1CICB 43CAA 3QA3B 3D25B 4OBRA 5ICZB 4Y19B 1Q9WB 5KANG 3T4AA 4IMLB 4DZBB 3MLSL 2JIXB 4LCYA 3Q3GA 5J9PA 4CN1A 3HB3C 2YR3A 3RUGF 3FQNA 5BJTA 2NY2C 5HHPA 2JJWA 3QXVA 2XN9E 4MCYB 2GJ6E 2A74B 1M71B 1FGVH 3VG9B 1JUFA 3U0PA 2DLIA 2GCYA 5TJWK 2AV7B 1B0GA 2XWJB 3HI1A 3FRPA 2XG4A 2R2EA 3JVGA 4PRHB 1IAOA 5ILTL 5E8DH 2A6KB 2E6PA 3GSOA 5DUPL 5EO0B 5IT2H 1I1AA 4IDLA 3RWJB 1NLBH 2GITA 2X4OA 4NIKB 4YHMH 2VXUL 1B2WL 2VLRA 4O9HL 3FT2A 1IC4H 5FO8B 1WBXB 1CFVL 2F5BH 2FB4L 2GFBB 3ARFC 3O2DA 4GAYA 3VGAB 2EO9A 1HE7A 3VRJB 2QQKH 1RVFH 3ZT5A 2WBJB 4GSDL 3T2PA 2X4NB 1SJEB 4XX1G 5E8EB 4I4WB 5F6IB 2Q8AL 2HVKB 4S10A 1MCJA 3RUGE 4XZUB 1EBAA 1BAFL 5I1IH 4R0LB 4OCXH 3N1GC 1UH4A 5AYUH 4QWWD 5FAAA 1BQHG 3QDJD 3TN0B 1NCAL 4OKVA 4ONOA 4HS6A 3BFOA 1UM6H 3H9ZA 3GMQB 4PJAA 5IQ7H 4EUPG 4NDMB 1CBVL 2MQCA 5IFHL 1H5BC 2EKSB 3P9LB 1JYNA 3GKWH 4OB5L 4HZAA 1LE9B 5TF1H 4GAJL 2X41A 4JO1H 2OBGA 5GS2H 4RNRA 1ZLSL 3NCEB 3RTQA 3R06B 1G6RB 4NUGH 3DV6A 3IRZA 2A9ML 3SY0A 5GGTA 4PREA 2Z4QA 1G7LA 2DTSA 1IC5L 4F58H 5JLZA 5F7DB 3LQZB 3UJTH 1IAIL 4I3GA 2DMCA 1K4DB 1Q8MA 5ESAA 4JFZH 3H6JA 4OTXL 4X5WA 5ID0B 1UM4H 1U8LB 2IQAA 3NN8A 4AG4H 4NFDA 3MGTA 3QAZB 3NMEA 4HX1B 2AJYH 3GGWB 1J8KA 3MJ8A 1FSKC 2ARJA 2XZCH 2O5XL 4TSCH 1A21A 5ITBL 1DN0B 4XBEL 1GSMA 2YSSB 1FL6A 1MFDL 1U8HA 2ZSVA 5I73B 3LD8B 4C57C 3IDYC 3MV9B 1BQUA 3ULUF 3QZWB 5I8EA 4OD1L 5ACLA 4YHPA 3DX9A 3VGDA 3PWLA 4MQTB 1GC1H 4KUCD 2OZ4H 4FTVB 5HI4D 1EZVX 1MRFH 3F6LA 1U8MA 5I1GL 1JNHB 1ORSB 1J1XL 1EPFA 4FZEH 4LSVL 2AXFA 2FEEI 1T22A 5BS0B 1LE5B 2QEJA 2HJLA 5EZIL 5AZEH 2VDML 5D2LA 4MAYA 4LFHG 1RIHL 3INUH 5FYJL 5TGBB 1A4KA 4YDIH 1MCRA 2FR4B 4GKZB 1EA9C 1KJ2H 1PZ5B 1WIUA 3L3HB 1MCWM 5ISZD 4XCEB 3PNWA 3GJFB 3S7GA 3RGVA 4WTZG 5I16B 3L7EA 1XIWC 3FO1B 4MD5B 5CJQH 5C08B 2PXYC 1N5AA 5DD6B 4X9BA 4QT5B 4OFKA 2HFGL 2RQ8A 2AVGA 1KCUH 1XF5A 2IFFL 2WP3O 3DYOA 3MREB 4MS8C 2DQJL 1X5ZA 4HV8A 4PV9B 4QOKE 4X7TB 2D31B 1HYSD 3GIVA 3TBTB 3MUJA 3FN3A 3WJJA 2OMBA 1A02N 2ZNWA 4MQ7A 1L6XA 2RFXB 1J8HE 2EDBA 4N9GB 2OJZH 3OR6B 5DDHA 4TOYH 1T4KA 4Y19E 3WLBA 1UWXH 3L7FA 3HNTL 3S37X 1NGXA 5C6TL 1A6WH 2F9BT 5E2UL 3HE7D 2LE9A 4I0PD 1PLGL 2YA2A 1CLCA 5KSAB 5EOCL 1FIEA 4HDIB 4ZXBC 4DEPB 1CT8A 5EFIB 1NLDH 4X8JA 1WFTA 1ZS8A 4XXDA 1TITA 2VYRE 1N64H 5C0AA 4WFFD 4J4PA 4X83A 5JPNA 3C6SA 4PRHE 3VFRA 4OV5B 3O3EA 5GGUA 4ZUTB 1ND0A 1LEIB 5DD1H 1RZ7H 2YA0A 4O58H 3LRGA 3QO1B 2VH5L 2ZUQB 3V4VH 5E2VH 4NUJB 2EH7H 3BH9A 4XNUH 3LKSA 2QR0A 3BAEL 1G7MA 5F7WC 2R23A 5EC2A 1V3MA 2EDRA 3ALPA 2WLZA 1TTFA 1QKZH 1J18A 5ANMB 2FWOA 5IGXL 3FB6A 4NRYB 1TJHL 1D5BB 3G6JA 4QRTB 2XKNA 2VXQH 4LGPB 5K9KA 1RK1B 4P9HH 1MVUA 3BGMA 5HVHB 5D5MA 1NFDF 4PR5B 2VABB 4JDVA 1XGPA 5D6CB 1E4KC 4NZUL 1VPOH 5CJXC 3ZE1F 1CLYL 5BVJA 2HLAA 2DQIL 1FO0H 3VFUA 1V7NL 3WUWB 3TH4T 1KIRB 4PJ7A 4QHKJ 2CPCA 5T5NF 2NR6C 4MB4A 2OSLB 3ES6A 2ADIB 5C8JA 1JPSL 2DF3A 1YNKL 4OQTA 4NP4L 5DRZA 3LKPA 5CGTA 1PQZB 4KVCL 1U6AH 4P9HC 4E42B 2CLZA 4TYUA 2RCSH 2ERJB 1MFCH 4KJPD 3AS1A 4HUNB 1XH3B 2VZSA 5DUBA 4Z7VA 2UV3A 3MROB 1J0JA 3STZA 3TA3D 5I17A 2J88L 2DAVA 1HSAB 2NTFB 4K2UH 1ZHLA 2Q20A 1Y0LB 1FE8L 1YYLH 3REVB 2PW1A 4IRZH 2ADJA 4XNYH 5AG8A 1NC2A 1TNNA 3P73B 3LKRB 3SO3C 4NKDB 3ARDC 1T66D 4NYLB 3ZE1E 4Y4HD 3QR2A 3UAJD 4M6AA 1NCWH 3QXWA 5IIEB 2G60L 1ADQH 4L3EB 5AYQA 5IBLD 2AJSL 1EHAA 3O8XC 4XAWL 4JGUA 1TZHB 1VSCA 2DQHL 1TCRB 3ULUC 1H8OA 4WWKD 3NA9L 2BY0A 3MV9E 2VDKH 1ZWIB 5L2KB 5D1ZB 1NGWA 5KSUA 3VXRD 2NY6D 4FTVE 4WGVB 5DZNA 3LN4B 3CSYB 4YHKL 2ID5A 4ZNEA 5CFHA 5ADPH 3VH8A 3U6RA 4HS8H 3NGBC 5J06A 5BZDA 2GIYA 3UYRL 5C86A 4PJIA 1OTTD 4OSUL 3ULVD 2QADD 2O61B 4P4KA 2XQYG 1RUML 5BS0E 5TH2B 4NQDA 5DJCA 4GW1B 4KDTC 5FGRA 3UTTA 1SMOA 3PG2A 1I9IH 5IG7A 3EHBC 2CRZA 3WKML 4PLKD 4F2MB 3CPLB 1CDCA 2YPVL 3KPNB 3MA7B 1EX0A 4LPWA 4RIRA 1MAJA 4PP1C 1VFAA 4TVSa 1U93B 2ITDA 4K3DL 1BVKB 2AJXL 4OBSA 5C08E 3TVMA 3UTPE 4HEME 1X3DA 3O6FA 4RA3A 4L4TD 1TJGH 2VISA 3VFSB 3B9KC 1XF2A 4OZ4B 3ZKXB 4X99A 4B7LA 4LU5H 3NCYS 3LKQB 4PRIB 5F1SA 4EN3D 3ZZ1A 1BQLH 1I8IA 1IGFH 2ITCB 4BUGA 2F54D 3G08A 2A6JB 3GSVA 5T3ZL 1Z5LB 3D0VA 4M5ZH 3R8BB 3OF6A 3VXSB 4LKCA 1R3HA 3TJHC 3GSWA 4X80H 3U4AA 3MLUL 2Y72A 3GMRA 1HIML 2JKXA 4KZDH 3F7PC 1KTDB 4V1DD 4WFGE 5I15H 3W2DH 5DEZA 5D6DC 5I8OL 1Q1JH 1IEBB 5CMAA 1F4YH 1MHCA 3THMH 2IALB 5IP4A 2EDOA 5LWYL 3UYPA 5BQ7B 3NZ8B 3U0TA 1A7NH 2ZOLB 1MOEA 4JQXC 3C5ZB 2O26U 4ERSH 4IRJA 3SQOH 4KK5D 1S7XA 2JE8A 4XVJL 4X4YA 3S4SB 1LO4L 1EXUB 4TTGA 4OCSL 1G1CA 1MJJA 3NCCB 4CL7A 1YEKH 4X4XB 3RWEA 4JFHE 4Q9QH 5GRYA 3SO5A 1BJMA 2NZIA 1IT9H 4HFUH 4HS3B 5FHBL 3QQ4B 4HWEL 4KKBC 5ANME 4FNLH 3T1FB 4CVZB 3H9SA 1IRAY 2VLKD 2XWTB 4XB7A 2QHLA 4EI5D 2EE6A 5FA3B 5TDNB 1VENA 1DBBL 3GBNL 4N0YL 5C0RL 4NKIL 3WIHL 4CMMA 1NAKH 1P4LB 3O45A 4H1LH 2AV1B 1FVDA 3MOBL 1KELL 1QLRB 1VEOA 1IKNC 2XN9D 2GJ6D 3FFDB 5DHVA 2ICWJ 4R97C 3OAYK 1U8PB 4JANA 3TBWB 4NKQB 4HXBH 3W0WA 3LMJH 4ZFZB 1QSVA 4K9EH 3ILQC 1WFUA 5FF6B 5IKCB 5EOCJ 4WY7L 3IAPA 1WFNA 1HH9B 4P4RA 1JGLH 4Z7UA 4Y1AA 2EICA 5IHLB 4PBXA 1BREA 2DIAA 1GPOL 4POZC 3IKCB 4DCQB 4OLYH 4FRWA 5SWZB 5JXEA 4DKFH 1VCAA 2X42A 1OARH 2DQEL 2VC2H 3FQXA 2Q6WB 1QFOA 5E8PA 4DAGH 4YBLC 3ILPB 4OM0H 3VFVA 1HWGB 4K9EC 2I60L 3ESUF 2NXZD 3O3UN 1TVHA 3QH3B 4LPTA 2QSCH 1MLCB 3TZVA 4JO4L 5C09B 4PJ9A 43CAB 4L3EE 1F8TL 1JFQL 1H3TA 3T4AB 1HHGA 3C9NA 1P84K 3FQWA 3QG6A 3CX2A 4LCYB 1MCQA 5BOZG 1AC6A 3AAZA 3Q3GB 1MCEA 5J9PB 4FP8L 3FQNB 5BJTB 4UOW1 2AI0L 5HHPB 3QHTC 3TJEH 1URLA 3MXVL 2Z31C 3PDDA 5L2KE 3PHSA 2YXMA 1JUFB 2AEQL 2GCYB 3U0PB 4UI2A 4OM1H 1B0GB 3HI1B 1II4E 5EUOA 5FKAA 2R2EB 5I75B 3IDXL 1IAOB 1GCFA 5EG6C 4S1SL 3SCMC 4HHAA 5CCKH 4Y5YA 5AEAA 1AXTL 3GSOB 1DTUA 3BMWA 1UJ3C 1I1AB 4LAQH 4WV1C 3HI5L 4GMSH 2GITB 2X4OB 3ZT6A 1IAIM 4NC2B 3O6KH 4OT1L 1FFOA 2VLRB 4QRQA 3ROLA 3GBML 3FT2B 4Y4KC 4GAYB 4QRUA 3RRQA 3TH2T 1N4XL 3VU2A 2R1WA 4OCYH 5GS1A 4UNVA 2AP2A 3RX5A 4J12A 4H8WL 4LPXA 5HHVH 1IC7H 5DD0H 2B5IC 3WFBH 5GISH 4JO3H 4R3SA 1W8OA 3C2SA 4M03A 5MEPA 3U36A 4YE4L 3RWCA 4NWUL 4OKVB 4RMTA 4OCWL 4HS6B 4PJAB 4N90E 4DGIL 1BGXH 1I8LA 3BKJH 4LQ1A 3SQBA 2A77H 3RJQB 3O3AA 3LEVL 4PRIE 1MHHA 1TPXB 2PCPA 1X6NA 2GY7B 3R1GL 1MIEH 3FHAA 4HJ0C 4RNRB 5GGRY 3RTQB 3I85A 3BHBA 1I9EA 2ZG2A 4HMDA 4X4ME 4KRPD 3DV6B 3MRRA 4PUBL 4FS0A 3VXSE 5HDQL 1OCWL 5C07A 3VFNA 1FC1A 3LZFL 3TWCL 1HZHH 5F1IA 5J7CC 3T2NH 4PREB 2Z4QB 1G7LB 5JLZB 3PDGA 1YEGL 4X6DA 5EPMA 1D7FA 5EU7C 4U6VH 3CDCA 5GZOC 3T0WA 3C6LA 3VFGH 4X5WB 3LQAH 2NY0D 4CW1A 2IQAB 3NN8B 1FH5H 1JNNH 4GXVH 3MGTB 4UT7L 1RZIA 3BPCA 2EXWD 2JJSC 3NABL 4LLDA 3MJ8B 4W6YB 1ACYH 3NAAL 5J1AA 4QOKD 1Q0YH 2ARJB 4ONFH 1CU4L 4NN6B 2ZSVB 1FL6B 1U8HB 4PGBA 4M61A 5I8EB 4YHPB 2ATKA 3DX9B 1J8HD 3PWLB 3WFCL 5C6PB 3GHBL 3VG0H 4JKPL 4YFLI 4Y19D 2VITA 5F9DC 3UDWC 3LQAC 5DXWA 1KULA 2ADFL 2JIXD 1U8MB 2XKUA 3DUHA 5H2BA 5JZ7D 3TT1L 2KL6A 4YC2C 2AXFB 1X5AA 1RZJH 5GGRA 1T22B 3V6ZA 4ALAL 2DN7A 2WIMA 2HJLB 5IBUG 3UPCA 3LPFA 5D2LB 4MAYB 4RCAA 2CMRL 4PRHD 3M8OL 4TULL 5TQ0H 1A4KB 2A0LC 1JTOA 2VLJA 2VDRH 5D7IA 1RIUL 7CGTA 4MAUL 5I1JH 3PNWB 3RGVB 5A2IH 1PY4A 1OP9A 3L7EB 2L7JA 4LOUC 2Q76A 1N5AB 4KKAD 3UJJH 5SWZE 3PL6A 1Q38A 1U3HD 1RZJC 4UOJA 1GL4B 5HHMB 5DWUL 2WBJD 1XF5B 3GMPA 4D9QE 3VGHA 5DMJB 4GW5A 4HV8B 1GGCL 3DTXA 4G6KH 3U9PH 3GIVB 1AFVH 2BXZA 3DV4A 5CUSH 1NBVL 1OM3H 5H37H 5GS0D 1Q9LA 4J23A 5CP3A 2CK0L 4LSQL 2PTTA 3P4OA 1KLUA 3TN0D 4MQ7B 5C09E 5DDHB 1T4KB 1YEJL 3WLBB 1IKFL 3L7FB 5GJTH 1NGXB 3TLRA 1B4JL 1U8KA 4HJGA 2FX7H 1ZVYA 5D1XA 4EEEA 4RRPG 1UWGH 3MTRA 1RJCA 1X5FA 3MUGA 3RA7H 1CT8B 1H9VA 2MPAH 2KZ1B 2VDLH 3O2VL 4X8JB 4XXDB 1ZS8B 2W9DH 5IW6A 3VW3H 3C08L 5E70A 5C0AB 3EDFA 1A4JA 3RY6A 1YN6A 1OAKL 5I71B 4JREB 4KDWA 5F8QC 5JPNB 3C6SB 3OWEA 1BIIA 2BFVL 3VFRB 3OXRA 1YEFH 4HD9A 3O3EB 5GGUB 1FL3A 1ND0B 3OQ3B 4Q6IC 4OI8A 4L4VA 1XFPA 4OCLC 2VLRE 3BH9B 3LKSB 1SBSL 1MF2H 2GKIA 1MJ7H 2QR0B 4OLXH 1G7MB 4M7LL 2R23B 5EC2B 1ZVSA 3HCVA 5ALBL 4Y5XA 2ZUXA 2FWOB 3FB6B 5F96H 3ZL4L 1CE6A 4NQVA 1OQOA 3C2AL 2VZVA 1QQDA 4G5ZL 4HCRA 3OG6B 4LHJB 2JB6A 3G6JB 5HTSA 2XKNB 1F4AA 5K9KB 3Q1SL 3PGCA 1MVUB 3BGMB 5I0DA 1J1OH 5D5MB 3MV9D 1RU9H 2X1QA 2GSGA 2C1OA 3EYUL 4JRXA 1WICA 2EO1A 1XGPB 4JDVB 4PJAE 3FRUA 4UINH 4ZUSA 5BVJB 4FTVD 2HLAB 3VFUB 3FAWA 2B4CH 1B6DA 4PJ7B 5BMFH 4L29A 2M26A 1CGSH 4U1JA 3ES6B 1UH3A 4YDKH 5C8JB 1RD6A 1KBGL 5JDJA 5BS0D 2XA8L 5DRZB 1CQYA 3WNPA 2H8PA 1WZKA 5IT2L 1QSZA 5J1SC 2CLZB 1NCDH 4ZOEA 1NLBL 2XPGA 1KB9J 4NBXB 5DUBB 1C7SA 2WUCH 4Z7VB 3STZB 5I17B 4LVNB 4YHML 4PG2A 3IT8D 2H2SC 1IC4L 4U6HB 1ZHLB 2F5BL 1J5OH 4XVSH 2B4CC 2QQKL 1FZMA 2PW1B 3X12A 2ADJB 5LBSL 4RDQF 4R4NC 1NC2B 3RPIA 2W1NA 4C54A 2EDNA 5C08D 1VHPA 2H32H 4UTBL 3UTPD 4AYFA 3IFOA 2V9TA 5D2LF 4LEXH 4OCXL 3LEYL 4KKLC 4I3SH 5FYJU 4FFYH 5GRZA 2BY2A 1UM6L 4HPYL 5ICYB 1MCPH 4JG0H 2BRRH 3GKWL 2X1PA 2PR4H 1S3KL 3QDMA 3ZE2F 1VERA 1NGWB 5KSUB 3P77A 3O6LL 3WE6A 3MLWH 4XXCA 4FA8A 4D2NA 5IEKA 4PB9L 1QNZH 4ETYA 3VH8B 3U6RB 3D85A 2IPUG 4MSWA 4JZOA 5KSAD 5BZDB 4WFGD 3P40A 3U1SH 4PJIB 4X7SL 5IEHA 3Q5YA 4P4KB 5BXFA 4F58L 3UJTL 4NQDB 5DJCB 3SE3A 1JPFA 1QLEL 4XI5D 3UTTB 1P69B 5SX5K 2H3NA 2YOCA 5D2LE 3FZUD 4XMKH 5IG7B 4A2LA 2Y7QA 1MFBH 2CKBL 2HH0H 1NBZA 3MMEA 3BN9D 4RIRB 4UU9A 4FQHB 3WHE0 2GYSA 1VFAB 1EERB 3IFPA 1TIUA 2ITDB 1IGCH 3GSRA 4JFHD 1FYTA 4Y8DC 1J1PH 3ZE2E 2AJYL 4RGNC 3TVMB 1NL0L 2J6EH 1FORL 5SWSA 3O6FB 5HHME 4TSCL 2VISB 1XF2B 4X99B 5IHZA 3RIAK 3TT3H 1SYVA 3BO8A 2F53A 1PVHA 1I8IB 4ZNCD 4HIXL 3C60A 4QKXB 1RZFH 3G08B 4S1DD 1OW0A 1D9KA 1MRFL 2W91A 3GSVB 5DC0A 3D0VB 5EOQL 1XF1A 2DDQH 3OKDA 3CDYA 1A2YA 1CGXA 4CN4A 4FZEL 4LKCB 5HVGB 1R3HB 3S97C 3GSWB 1FFRA 4AEEA 3GMRB 4Q58C 1WK0A 4NBZB 3HI6H 5AZEL 2ATPA 3G6JF 2HWZH 4KK8C 4OJFH 2BZDA 1Q9OA 5CMAB 1MHCB 3G9VA 1LDPH 4X6CF 4PJ8A 3P9MA 3WN5A 5D5MF 3UTSA 1WFOA 3U0TB 3H8NA 43C9A 1KJ2L 5C0AE 2OI9C 2H41A 4IRJB 2VR9A 2RR3A 1S7XB 5SX4H 1CDYA 4X4YB 2YUVA 3WXVH 3U4BH 2AJUH 5H8DA 1MJJB 4F7CA 1FGNH 1KCUL 3RWEB 4NN7C 2X89A 5JPMA 3S88L 4U1KA 1DR9A 2DM4A 3NVQA 2EC9U 4FQCH 1H3XA 2R69H 3QQNA 4I1NB 1ZT7A 4ODHH 3GB7A 3H9SB 4L3ED 3RWIA 3CFIC 1BZ9A 1MRCH 1QBMH 2AABL 3G6JE 3HG1A 2J12B 4CMMB 2OJZL 4OIIL 5BW7C 3WFEH 1JI2A 4MVBD 1T7WA 3GI8L 3O45B 5D5ME 1FVDB 4CUCA 2FLBT 2JCCA 3V7AG 2VRAA 1WBZA 4JJ5A 5DHVB 5F93C 1UADC 5L2KD 5D1ZD 2DLFL 2XXCB 2B39A 2FEEL 4JANB 3OKOA 1MUJA 4YO0A 5T33L 1ULVA 2X4UA 3U7AA 3W0WB 4PJ7E 1KEGH 1NLDL 4LLWA 4IBLT 4UILL 4XWOD 1N64L 3IDUA 4P4RB 5CJOL 4DGVL 2D4FA 3JXAA 2BK8A 4Y1AB 4Z7UB 1E4XH 2YPLA 3BPLB 4P99A 1BIHA 4PGCA 1T66C 2IEPA 5EBGA 3EYFA 4CDGC 4LIQE 4O4YH 5DD1L 1A9BA 3ULVH 4Z7VE 4MA7H 1OGAA 1DEDA 3PWNA 2EH7L 1A5FH 4J6RH 4XNUL 1J7VR 3FQXB 4LQFH 5E8PB 1IQWL 1UFUA 3VFOA 3VFVB 1LHZA 5C7XH 1NQBA 4Y7MA 1G1YA 4YK4C 1AHWC 1I1RA 4L3AA 1TVHB 5HGDA 3RGHA 3OX8A 4UQ2A 4Z77A 3TZVB 5FIEA 2X4RA 4U3XA 4M6MH 4N90D 2YD4A 3IETA 4PJ9B 3DBXA 2DM2A 4P9HL 4W4OA 4AIXA 4AK1A 4WUKH 4C83A 3B3IA 1HHGB 2VDOL 3C9NB 4JY5L 2GI7A 3FQWB 4PRID 4BH8A 3GIZL 3QG6B 4DVRH 4YDLB 3MLYH 1T1WA 3AAZB 4IRSC 2IBZX 4KMQA 1MCKA 2XI9A 4L3CA 3BW9A 4IDJL 4A6YH 1N26A 3QP3A 1K3IA 3T0XA 4HG4J 3OAZH 3VXSD 4ZNEE 1P4BH 5F7FA 2HJFA 1OL0A 4H1LG 5IJKA 2X6MA 5EUOB 5FKAB 1AD0A 3A6CL 5DJ2A 1G7IA 3RU8L 2QBWA 4HHAB 4Y5YB 1CDIA 1U6AL 4PJIE 5F7YC 5GHWH 1QBLH 3KWWA 2DLTA 2ZG1A 1WC7A 2NW2A 4S1QL 4UAOB 4NQDE 1BFTA 3ULUL 2WLYA 3KPMA 1FFOB 4QRQB 3ROLB 5I9QB 1LMKA 2RGSA 4K2UL 3C5ZD 2C3XA 2JTDA 1YYLL 4QRUB 3RZCA 2R1WB 4IRZL 4XNYL 2V5YA 5GS1B 1E4WL 4U0RC 3VA6A 2LTQC 3EFDL 5JUEL 3QDGA 2Y06H 3C8KA 4R3SB 5MEPB 3RWCB 4X4ZA 1F3JA 3ZDXF 5J4MA 1F3DH 5JXAL 4ZS7H 3O3AB 1MHHB 5DURB 1OT2A 2PCPB 4E5XA 3VD9A 1VFBA 2H1PH 2BJMH 3IRPX 5C9KA 1JYWA 4KAQL 4NQCA 3BHBB 4DOHB 5CEXA 1X5JA 1EUUA 3MLTA 3LHPL 5CIPH 3MRRB 1CXLA 4JN1H 5C07B 3MCLH 3SDYL 3ARUA 2FLRT 1T6VN 5F1IB 1N59B 5JIKA 1ZA3A 4X6DB 1T2XA 2XTJC 4YNYA 5EPMB 1G9MH 3X14A 3P30H 5KTEH 2V5RA 4JHWH 2YD8A 3C6LB 4Z0BH 1H0DA 1PD6A 1OSZA 5SWZD 3ZDXE 4CW1B 1UG9A 5L8KB 1DQDH 1ZV5A 9CGTA 4D9QD 1RZIB 4TSBH 3BPCB 3BP5A 4J3TA 1MLBA 1CN4A 4XPAH 4BYHA 4LLDB 3WNKA 5J1AB 4MX7A 1I8KA 4O02H 4E41A 4TPRH 4ODVH 1N0XH 1F3DJ 4M62L 1AGBA 1U41A 2X4PA 4YH6A 4HWBH 4PGBB 4M61B 2QQLL 1G9MC 3LS5L 2ATKB 1A6TA 1ODAA 4LSPH 1CXHA 5C09D 4TUJA 3H9SE 3V4UH 2VITB 2YN3A 4XNXH 3TEUA 1BJ8A 2ZZUT 5H2BB 5D72H 2CO6B 2R29H 2VDPL 2VR5A 5FO9A 4X80L 2XQYK 3PV6A 5GGRB 3IS0X 4I77L 4KZDL 2PO6C 4GQPH 2E27H 1MCDA 3GSNH 1R6VA 1LK3H 3W0WE 1FG9C 3LV3A 3R0NA 3L3GA 3TV3H 2VLJB 1A7NL 4N1HB 1DVFC 1I1AD 3MLRH 5D7IB 5CEZL 5L8JB 4CVWA 4U49A 4Z7UE 4Y1AE 3GHEL 1C12A 4TTDD 3CFDA 2VLRD 2BSSA 4OUOA 1FIGL 5GJSH 1E6OH 5IVZA 1KB5H 3OBAA 3PL6B 5DZLA 2GQHA 1YEKL 4YAQA 2MNUA 3L5JA 5EUOF 5E08H 3GMPB 4I18C 1NKRA 4G80A 3QIWA 4LLAA 4GW5B 3RVXD 3C8DA 2NY3D 4LDEB 2FZ3A 4TUKH 1IE5A 5A2KH 3DV4B 3S36X 2EDKA 4S1RH 3IU3A 3UCRA 2PTTB 5I8KH 3P4OB 1KLUB 4WI8A 3V5DA 1NAKL 3MLVH 4I48A 4GRMA 4GS7B 2YUWA 1ZOXA 3K8KA 4DTGH 4LHUG 2G2RA 1KT2A 1U8KB 4HJGB 4F15C 4LVOB 5D1XB 2BVQA 1QUNA 1T6WA 4D94A 2VN7A 3MUGB 5F21B 3RTQD 4KRMB 4YUEL 3HFMH 1ZT1A 1KIUA 1MI5A 4K9EL 5JHLH 5IW6B 2E7LC 5A3ID 5CZKA 1S5IH 1UJTA 1A4JB 5L7XH 1YN6B 1JGLL 5EUOE 4KJYA 1N6QH 2D0GA 1JPST 4WI6A 3K7UA 5JIHA 4Q9BA 3K74B 1BIIB 3L5XH 3OXRB 2XFXA 3MJ9L 3GMNA 3AS2A 3T09A 1FL3B 3BT2L 1EGJL 1LEGA 1N0LA 3H7BA 1JZ8A 2ZNXA 1R5VA 4AIOA 5FYLH 3KLHD 3QXTA 5F7LB 1BFOA 3LIZH 4DAGL 1ZVSB 4OM0L 2A83A 3HCVB 5F7HA 5BV7B 3RZWA 4Y5XB 2GHWB 5KOMC 4QTIH 1CE6B 4NQVB 1QQDB 2H2PD 4X6DF 1NCTA 5CZXC 2JB6B 5FYKH 4CADA 4POUB 2XZAH 5CAYB 3PGCB 1KTKE 5DTFA 3IJSA 4KRPC 2GSGB 2C1OB 3BPOB 4JRXB 5DMYA 3QNZA 3LH2L 2HKFH 3FRUB 4ZUSB 4MHHI 2E5EA 5H37G 3RBSA 3WO4C 4FFVD 4I13B 3MODL 3B5TA 2HLFD 3DARA 1UT9A 4L29B 3ZKSD 3KS0H 4PGZA 1P53A 4U1JB 5KVGL 4DZ8A 4JRYA 4OM1L 4Y4FB 1EO8L 4QXUH 1F2QA 4DOHE 5HPOA 5CCKL 2R4RH 2NY0C 4LPYA 2H8PB 5C07E 1AKJA 4LAQL 3MC0A 4MAYD 4GMSL 5DJ8A 2XPGB 1KN4H 1WSST 3B5HA 4JKWA 4X6DE 4WEMB 1LD9A 2NY1B 1KGCE 4MB5A 4RMWA 1AR1D 3WL9A 3V8OA 3QEQA 3RGVD 4OCYL 3X12B 2V17L 3RPIB 2WW8A 4WCYH 1OGTA 4D0CA 1G7HA 5I1DA 5T1DH 3CXDH 1TCMA 4POYA 5KVEH 3IFOB 2HFTA 3WFBL 3DX8A 5HHMD 4JO3L 5MP6H 2HT4C 3WIHA 3G9AB 3DROA 4YXKH 2AXGA 5D7IF 5I6XB 3NH7L 5IBTH 4LRIA 2V2WA 1S7WA 1BGXL 3HMXA 5KSVA 5ELIA 3BKJL 4Y16C 2A77L 3UBXG 5JOEA 4Z18A 4HK3N 3QDMB 1IFHH 1FNFA 4M9PA 5ACZA 1WGOA 3P77B 3WE6B 4YHZL 5IEKB 4M6OH 1MQKH 4I3RH 3D85B 5E7FA 5E99H 4MSWB 4JZOB 3HPLA 5DGRA 4NM4H 1HZHL 5IEHB 5E6IC 3T2NL 5BXFB 5A40E 3MJ7A 1JGUH 4OGAD 5JTWA 3STLA 4NJ9L 4UQ3A 1JPFB 3MRGA 3MRDA 1U3HC 1VACA 2H3NB 4HZLA 5C0AD 4J4PD 2BVTA 1FQ9C 4LCUA 2Y7QB 3QWQB 5FCSH 5MHSE 4NJAH 1NBZB 4E9LA 3MMEB 2VLJE 3IDIA 1G6RH 3V6FA 2A6IA 5D7IE 2L7UA 3LQAL 4QHUA 3EUUA 2F5AL 4NNYA 4PJDF 4UU9B 2CR3A 1O5DT 3IFPB 4AMKH 5CGYD 2DL2A 2MQ0A 4KHTL 3QCUL 5M95B 2X5PA 3GSRB 1FYTB 4ETQA 3X3GL 5F89A 4WEBL 4JHAL 1H8NA 5SWSB 4Y5VC 5CINH 2PW2A 1IL1A 1GOGA 5IHZB 4P46A 5D96B 3CLFH 1SYVB 4ZUWA 3BO8B 2F53B 3ZKNC 5K9OA 5KAQG 3X3FH 3C60B 2BNQA 4XTRC 4RX4A 2FX8L 1D9KB 2B1HH 1L9MA 3UP1A 5EBMA 1FPTH 1E6JL 3WMSA 3OKDB 1A2YB 3OJ2C 3GBLA 3KPRA 3SDCA 4YLQT 4LCWA 1QFWI 3SDAC 2ATPB 3RY4A 1AQKH 5B3JF 2OQJA 1Q9OB 1IGIH 4PJ8B 5A16A 2FJHA 5FGCB 3P9MB 2ZKHL 3WN5B 3UTSB 4P3DA 43C9B 4DFIA 3FQTA 3FN0H 1DN2A 3CFCL 2VDQL 1LWRA 2IADA 2X4TA 5HVFB 3HAEG 5EU5A 1CK0H 2VERN 1NGZA 3D18A 3UJJL 4F7CB 4WTXA 1QFUH 1NC2D 5A2LH 1ACZA 5JPMB 4U1KB 3I3DA 4MLIA 1CE1H 3U9PL 5JIIA 1ZT7B 3GJFH 3GB7B 4RZCA 3RWIB 1BZ9B 2D03L 3HG1B 3BKMH 4TRPL 3QUXA 3VXUE 5B3JE 4FQXA 1FZKA 1I9JL 2JCCB 4U1IA 1UA6H 3AB0C 4JRXE 1WBZB 5JO5A 4JJ5B 1NC4A 4C4KT 4ZAKA 4YHLL 5F8RC 3OKOB 1MUJB 4F57L 3RA7L 4YO0B 3EZ8A 1U9KA 2X4UB 2VDLL 1ZEAL 4XWGH 4LLWB 4EBQH 5IB2A 3VW3L 3ZDZE 1BHGA 2C26A 4Z8FL 3EDDA 3MRFA 4P4KD 1IM3A 2YPLB 3E8UH 4PGCB 4OLZH 4NQDD 3EYFB 3UTTD 2Q8BH 1KV3A 2KH2B 3HS0A 4KTDL 2V2TA 4OF8A 5IK3A 1A9BB 3T0VA 2FECI 2NXYB 1OGAB 3PWNB 2DI9A 3S98A 2R8SH 1MF2L 1MJ7L 4DK3A 3V0WL 3ZHKA 3VFOB 4ENED 1Q0XH 1HINH 3L3KA 4XP4H 1IARB 5AUMA 5F96L 2R1YA 5HGDB 3TVMD 3OX8B 4UQ2B 3I02A 4Z77B 2X4RB 3O6FD 3V4PL 5T1MA 5FM4A 4U7KA 3IETB 1FRGH 3DBXB 4HC1H 3VWKC 2EXYC 4GBXA 4C83B 4OF3A 3B3IB 3RJDA 4LMQE 4WW2A 4BH8B 5FFLA 1UWEH 8FABA 5HPMA 1WV7T 1B6UA 4DEPC 4G8GA 1T1WB 5C92A 1AI1H 4L3CB 3BW9B 4XI5C 3MRQA 3T77A 3V5KA 3QDME 1UEMA 5BMFL 3OF6D 1MAML 3QIUA 5IMKA 2HJFB 1QD0A 3HPJA 1AD0B 2X05A 2W0LA 3BN9C 5DJ2B 1G7IB 1C5BH 1E4JA 2IPKA 4FMKA 2DMKA 1YDPA 2ZUQC 3EDKA 3TFKC 3KWWB 3CC5A 1WC7B 2NW2B 2JB5H 5E5MA 1YYML 1HSBA 5DJYA 3KPMB 2ZUUA 5HBBA 3LOWA 2VDNL 5J3HD 2IG2H 4IRJD 2HFEA 2G5RA 1TZGH 3RZCB 1QTYT 1U42A 4PJXF 4KXZI 5IESH 3KAAA 3KPQA 3HRZA 3IAQA 3QDGB 3KLDA 5E2WL 1MJ8H 4LEXL 4EQ2A 4P23A 1EEZA 3C8KB 4MA3A 5FCUH 1JNLH 1FYTE 3A6BH 3O4OC 1ZTXH 3PWPA 4L9DA 3QNXA 4F8TA 3AY4C 4FFYL 2C4FU 1GIGH 4PJGA 5SWSE 1KCVH 5L9DL 2LU7A 1PEZA 1F3JB 3H9SD 4G8IA 2EDFA 2F53E 1KCRH 4E5XB 4QNPF 1VFBB 3MLWL 1UWXK 4KRLB 1D6VL 4F9LC 2LQRA 1QNZL 2N4IA 4NQCB 1DSFL 2HG5A 5CEXB 3MRJA 3MLTB 2XOTA 3D5OF 3TNMA 1EEUA 2VIRA 4PJXE 3W0WD 2DLGA 2DQDL 3FQUA 1ZA3B 3IKKA 1OAQL 1IJ9A 1J86A 1UCTA 4YNYB 5JMRA 3X14B 4Y1AD 1KPRA 5FGCE 3UTSE 1Y18A 2W9EL 4U31A 3PWUA 1C8PA 1OAYL 5C1MB 5D7JB 3RVWC 1CGWA 4M1DH 5HY9A 2ZCLL 1H0DB 2NZ9C 1OSZB 3KLSA 5JXED 4KFZC 4RAVA 5DJ6A 1F58H 3BP5B 1MLBB 1MWAH 5E6YA 4QNPE 4MX7B 1I8KB 4E41B 1AGBB 2X4PB 5LQBL 2OM5A 5D1ZC 4JB9L 4G7YH 2YPKA 4JY4A 2DI7A 1A6TB 4G6AC 4PTTA 4PJ9D 3ARFA 4TUJB 4JJHA 1RZFL 3BGFB 2QHRH 5BCAA 3HG1E 2IPUK 3MV8D 1KXVC 5E1HB 4DJMA 5FO9B 2JCCE 4PJHA 1CZ8H 3PV6B 4M1CD 1WWWX 4K7FA 2HWZL 1N6VA 1SM3H 3MFGB 4D0BA 1LDPL 3LV3B 1H5BA 5CWSA 1A7RL 3L3GB 4XBGA 4RBPK 4KVNL 3FMGL 1KYOJ 3SDXF 2YPLE 1C12B 1CD0A 4KHXL 5DFVD 3CFDB 1UENA 3LSOA 1KLGA 2BSSB 1T7YA 4YZFE 1ZLVH 3WXVL 4HW6A 5IVZB 3U4BL 4O5LH 1GGIH 1FNGA 3WIIH 1FGNL 4YAQB 1OGAE 1DDHA 3IB4A 4GT7A 1ZGLA 1T89C 4X6FA 2IPTL 5IVOA 4G80B 3CFKA 3QIWB 3GNML 1T1YA 2R69L 2FZ3B 2PF6A 1WJ3A 1A1NA 5DO2D 1A6VH 4ODHL 4QRPA 5GGQH 2W92A 3IU3B 4HBCH 3V5DB 1MRCL 5JMOC 4W70A 4C59B 4UDUA 2PN5A 4I48B 4GRMB 1UXWA 4OUUA 3Q5TA 1NMCB 1NUGA 2D7PA 2G2RB 4UT9H 2C4XA 1KT2B 4PRPA 5DURD 2BVQB 2UY6A 3ARGC 1KIQA 2YD9A 1ZK9A 4YDJA 3UYOD 1KEGL 1ZT1B 1MI5B 3FB7A 1NMBL 2M2DA 4JFQA 5C07D 1ZMYA 2CKBA 4J2XA 2VAJA 4KJYB 4OKDA 4WGWB 2XQBH 2XFXB 4RFNC 3GMNB 3MYZA 4JZJC 1LEGB 4QEGA 1NGPH 3WD5H 3U83A 3H7BB 2OK0H 4R4FH 4MA7L 1R5VB 1FBIH 8CGTA 1A5FL 1AJ7H 4J6RL 3C6LD 1BFOB 3P4MA 5FGBC 4PRAA 3IXTA 2A83B 5C7XL 4EIZC 2A38A 2EZ0C 4NHCL 3N1QC 4B50A 5FUOH 5A2JH 1HH6A 3QDGE 4RRPA 2D0HA 3PP4H 5JDSA 1PBYA 1Q9KA 4M6ML 4CADB 1JWUA 2WP3T 2YA1A 3RWFA 1M7XA 5DTFB 3IJSB 5FUCE 5MEOA 5GRUL 5IROC 4DVRL 3EYQC 3QNZB 3F7RA 3D3VA 5IB3A 3OB0H 1ZA6A 4XP6H 1OTUD 2PXYA 2Z8VC 2DBLH 5HYQA 3BWUC 1B0RA 3IU4H 2P45B 2IQ9L 4FG6D 4NQTA 1LQSR 3LPGA 5B4MD 4UT6L 3QBTB 1P4BL 4JRYB 3CMGA 1PG7L 4NQCE 4RGMB 3KHQA 3DMMC 3DSFH 1KJ3H 2APWA 3FOLA 4MQXC 4ZO7A 1KJ2A 5EU6A 5GRJH 2CDGA 3SOBL 4XPFH 4NFBA 5EZOL 1EO5A 1AKJB 3HNVL 1BFVH 1QBLL 1T0MA 4D3CH 5MHSD 2F19H 5DJ8B 4XX1E 3DNKA 1A6UL 2VLJD 3HZMA 4NZRL 1B90A 1LD9B 3RUGA 3MO1A 3QPQD 3WL9B 1MY7A 3QEQB 4ZXBA 2BX5A 1Z2KA 4P2OC 4XVUD 3HNSL 1X5GA 4D0CB 2XACC 1G7HB 5I1DB 5KANI 1V3LA 4MJ5A 5HI3C 4IS6A 3I6LE 5DI8A 3PL6D 2EDHA 3PGFH 1MRDH 1XF3A 25C8H 1KG0A 4YXLH 5HGHA 3LS4H 2HN7A 1S9YA 2Q3AA 2ZG3A 3DX8B 5IW3A 1F6AA 4F7MA 1W0VA 3SGDI 4KTEH 3BRGC 2KUTA 5DMGC 1BBDL 3DROB 4M93B 3CSPA 2AXGB 4E41E 5KSBA 4UOW0 2V2WB 1S7WB 3B2VH 4R90L 2ZWLT 4Q9RH 4KRNA 1CGYA 1JWSA 3MOAL 2DM3A 2EIZA 1JZ4A 3OAUH 4M1GH 5ACZB 3QDHA 2H1PL 2BJML 2HT3D 4LK4A 4IJ3B 5D1XD 1SY6L 3HPLB 5EN2A 2PTUA 3JTTA 4DUXA 2FX9L 3MJ7B 1EFXA 1NUDA 3B9VA 4PTUA 3STLB 3P3YA 4ZUVA 5I18L 4UQ3B 3MRGB 3MSPA 2LAGB 3E6HA 3MRDB 4RQQA 4YPGA 1VACB 3AREC 5B38A 1E4KA 4HZLB 4LIQL 1G9ML 4LCUB 1CTNA 3AVEA 5CJXA 5KTEL 2Y6SC 2P5EA 2C4FT 3HC3H 4JHWL 3TNNA 2NY3C 2WWMD 3IDIB 3V6FB 2A6IB 4Z0BL 4QHUB 3PABA 4NNYB 4L4VD 1RHFA 4YQXH 3ZTJH 4Q74A 3W39A 1DQDL 1RMFH 3T65A 3UJIH 4ETQB 1GGBL 1YECL 4XPAL 5F89B 2R56H 4LASH 1JWMA 2KQMA 3SGDH 4O02L 1N0XL 4HIHA 2PW2B 3QEHA 1IL1B 2AEPL 5CBEA 2Q7NA 4P46B 4JDZA 4ZUWB 3NPSB 4LSPL 3KYKL 5K9OB 1FO0A 4U05A 4HLJA 2F8XC 3V4UL 2BNQB 5E9DB 4PB0H 2WIIA 5A3IC 4JRXD 4G42A 4HT1L 5EBMB 5F6HI 5K93A 1ZLUH 3ARDA 5D72L 3KPRB 3SDCB 4LCWB 1NAML 5E4EC 4NWTL 4HIIA 12E8H 1XZ0A 3L6FA 5L0QB 3QSKB 2H6PA 2E27L 2AW2A 4P2YA 2OQJB 5DJDA 1LK3L 4GXUM 3KLHC 4K23H 1MI5E 5A16B 2FJHB 4JQIH 5D1QA 4TQEH 4P3DB 2MCG1 1U8QA 3FQTB 4HK3J 4K8RC 2IADB 2X4TB 4EDXA 5EU5B 4GAGH 4ZS6C 4BQBA 2NY1D 3L3IA 1E6OL 2UUDK 3FO0H 3D18B 1KB5L 4MA1C 2ED9A 3QNYA 4NO3A 2FH8A 2VL5A 2NY4C 4NM8H 3QG7H 4M48H 3UMTA 3RNKA 4KDTA 1C1EL 3AM8C 1WZMA 2W65A 1F90L 4TUKL 3S6CA 1S7VA 1HEZA 1P6FA 4RZCB 4LKXA 1QYGH 3QUXB 2C1PA 3V6OC 3P0VH 3GFUA 3QPXH 3MLVL 4FQXB 5T3ZE 3OKMA 2M8XA 1FZKB 5DEGA 2L0DA 3BYTA 4U1IB 3MBEA 2IH1A 3VGBA 5JO5B 1QACA 3QDMD 4OLWH 1NC4B 2VLLA 4ZAKB 1RHHA 3MFFA 1ETZA 4NHUA 3DVIA 1OPGH 3OR7A 3HFML 3B9KA 3NIDF 5EO0A 3D2UA 3S36H 3FT4A 2WZPD 1A3QA 5IB2B 3UTOA 1KC5H 4OLUH 1S5IL 3PWVA 4JRYE 5E2TH 3MRFB 4FQIH 1IM3B 1K2DA 1K6QL 3S34L 1IC1A 2R9HD 1DBJH 3QZWG 2VWEE 2AK1L 1AXSA 3HS0B 3HE6C 2V2TB 1CLZH 3D6GA 5IK3B 2NTSP 5EOTA 3EO9H 5KJRH 2J8OA 4KPHL 3UTQA 5FYLL 2IAMC 2D3VA 3ZT7A 3LEXA 1K9TA 5JNYA 5FHAH 4U7MA 1YEHL 3QEQE 4Y2DC 3L3KB 5D6DA 3WJJC 1H3PH 3ABZA 5AUMB 1VGEL 2VXSH 4M00A 1QG3A 1FYTD 4CJ1A 2R1YB 4JO2L 4IHOA 3I02B 1MIML 3GM0A 5SWSD 5FYKL 5T1MB 3NCBB 4JQXA 2NW3A 5LGHH 4GBXB 4HAGA 2V9RA 4WW2B 5GGVH 5GZND 8FABB 5HPMB 4NGHH 2F53D 4G8GB 4YGAB 5GRVL 3T0AA 3C60D 4OGAC 2O5YL 5KVMC 1D9KD 3MRQB 3T77B 3V5KB 4LLMA 3N85H 5FK9A 3QIUB 4QHMA 5IMKB 4G6FB 1EBPA 3SDDC 1DQQA 4Q0XH 4QXUL 3HPJB 5BO1L 5ADOH 1WZ1H 2R4RL 2R4SH 2IPKB 1UKTA 3EO1A 1YDPB 4XVTH 3ALXA 1JL8A 1NFDA 2KDGA 3CC5B 4PJ8D 5E5MB 1KN4L 1HSBB 5DJYB 1IKNA 4P0DA 4ZD3H 2HFEB 3MBXH 1FAIH 4NO2A 3FFCA 3TM6A 3Q48A 4M02A 3KPQB 1UB6A 3HRZB 4KJQD 2E9BA 4NC1E 1MCLA 4WI9A 5KVEL 4P23B 3H42L 1EEZB 4MA3B 3BJLA 3M45A 2X89D 4XPHH 1JF6A 2JELL 3PWPB 2XT1B 1D6EA 3QNXB 4YBHA 5EB9A 5LCVL 2BNUA 4M43L 4YXKL 4PJGB 5FGSA 4LCCA 4QO1A 1RSFA 3AUVA 1KJMA 3QUYC 2LVCA 3TIDA 4G8IB 5C2BH 1GZPA 5T5FH 3ZYZA 2BNQE 5E9DE 4M6OL 1MQKL 1FDLH 3IVKA 3GZKA 4LSTH 3V6BR 2HG5B 3SE8H 1S7SA 1XGYH 3MRJB 5IMLA 3N06B 2J7LA 3TNMB 4LCWE 3GK8H 3U30B 2VIRB 2HTKD 1C5DA 3MJ9A 1JGUL 3ZDYF 5ALCH 3FQUB 1EGJA 3L3HA 4FFWC 5F9OL 1BVZA 5HDLA 2DQGH 4DQOH 1KPRB 1T5WA 2YPLD 1UCBH 1S9WA 4ODSH 4NJAL 2NY2B 1YEIL 1Y18B 3UROR 3PWUB 3IFNH 2Z31A 5HY9B 1WLHA 4FXGA 2NXYD 3CFEA 5EH1A 1OGAD 2CGRH 4RAVB 1BVLA 2P42B 5JIPA 5DJ6B 3SCMA 1UJ3A 4XPGL 4WV1A 1RJLA 3DGCR 5CINL 5IFAH 2DKMA 3JWDH 2BDNH 2YPKB 1XMWA 4ZPVA 4JY4B 5IHUH 4PTTB 3ARFB 3LKNA 3X3FL 5TFSH 4D0DA 3F58L 4GKSA 5KN5A 5H35A 2FL5A 4N68A 2XTLA 2NY7H 4PJHB 3ZYOA 2YD1A 4V2BA 4KGJA 3QQ9D 2B0SL 5LJYH 4K7FB 1AQKL 5FYJD 2BCKA 2SEBA 1FLRH 4OZHA 1IGIL 4D0BB 2D7TL 1YEEH 3JWDC 1H5BB 4M3JA 4W6WB 5CWSB 4XBGB 3VI4F 4GAFB 4WW2F 3LKOA 4U3CA 5ECJE 1BFSA 5I1AA 1P7KA 2EDJA 2FHFA 4JFXA 4OFPA 3LSOB 1KLGB 3D87B 3K3QA 3L5HA 4JPKL 4M6NL 3RVUD 1FNGB 3VFTA 1DBAH 3RZCD 2Z93A 1DDHB 3QIBC 4Y8AA 1ZGLB 1NSNL 3TESA 2MOVA 4X6FB 2OMNA 4CVUA 3CFKB 2R2HA 3WS6C 3C8HA 3QI9C 3EJZD 3QDGD 1T1YB 1IMHC 1JNJA 2Z92A 3DUSA 2NX5A 4QRPB 3DVFA 3D39A 4ORZC 1A9EA 4YX2L