1S7UB

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 13
structure length 99
sequence length 99
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7uB00
4LLWA 2IH1B 2X40A 3B2UD 3CSGA 4OD3H 3ULUF 1MUJB 2YHGA 4G8IB 3WIFB 5KS9A 4K94H 5BV7B 2A1WL 5EUOE 3O6FD 4WCYH 3HKFA 3T3PE 2O5XH 2R2HB 4KRPD 5TQ2L 5KAQG 2DWEA 4G5ZH 1I7ZA 1YMHA 1GZPB 5FHAL 4FZ8H 5T3ZL 1BWWA 1N7MH 4JFED 4YK4B 5A3IC 3ZTNL 1MCSA 5DJAB 3E3QE 3F7PC 2XIDA 4J8RB 3WNPA 5GGRB 3BO8B 1MCWM 2I9TA 1F3JB 1Z3GL 4E9LA 4TUKH 3RZCB 1FSKC 2AJZB 1FNSH 2IPTH 1BZ7B 3BKML 3TBSB 2IAMB 5DA4A 5HHMD 1E6OL 1YMME 4I48A 4KVCH 4G8GB 4N8VG 1QQDA 3MQIA 5DJYA 1VERA 2CXGA 5I1IL 1HH9A 2DB8A 3CUPB 12E8L 4PJXE 4KJQC 3LCYA 2EDYA 5I19H 3L5WA 3IXAA 5L2KA 4EBQL 4OBSA 1WZMA 1NC4B 2RCSL 1MCQA 3R1GL 5C7XL 2R29L 1FYHB 1LEGB 1T04B 2OZ4H 3SJVB 1IGYA 3B9EA 3BH8A 3U36A 3UC0L 1A14H 1Q9WB 3EO0A 1U58B 4PD4K 4EI5C 4UV7L 2V7NB 4Y5XC 1D3CA 3K3QA 2QJDA 4GAJH 1B0WA 3FFDB 1MWAL 4LRNH 3VGBA 4HK0B 3O2VL 3GMMA 5FOBA 3RAJL 5MENB 2G60H 3F12A 1MPAL 3IDNA 4Z7WE 2Y06H 3QIUB 5DC0A 3P3YA 4KKNA 1GH7A 1NAKH 2GW5A 3UDWC 4X6FA 2VR5A 5DFVC 1WK0A 2LU4A 4IRSA 5INDB 1KLUA 5HGDB 4MNHB 32C2A 3H9SD 3WJJC 3VA2C 5JORB 4PJHA 2VZSA 5HVFB 1FZMB 4TOYH 3GSUB 3PF2A 4HFWA 3QFDB 4PRDB 2ICWB 1J8KA 5IBUG 1JN6B 1T1XB 3MTRA 1MRCH 5IQ7H 1A6UH 4IMLA 4IMKA 2GIYA 2CRZA 3ZE0F 4GG6F 3MLWL 3BDYH 2WIIB 5IHBA 2HFFA 3TO4A 5GS0D 2M2DA 5D1XB 3SDCA 4NKQB 3PHOA 3VWKD 3OF6D 1KT2B 5TE4H 2NY1C 4GAYA 4KVNH 1JF5A 4HIIA 1YPZB 4L8SC 1EHNA 1Q8MA 5E6ZA 5F93C 2G5BA 4D9QE 5I1EL 4HUUA 1K8DA 1RZJH 2IADB 5CZVL 2B39A 2DMKA 4FQPA 2UWEA 4FQXA 4NQXB 4LDOB 3WN5A 3FRPA 4E42B 3SPVB 2AVGA 3UJJH 4PJIB 1E4JA 2JIXA 5MI0B 2BNRB 4LBEA 3ZTJH 3O8XD 5E99L 2D4DA 2O5ZH 3DNKA 2BJMH 5IMOB 3C60D 4E5XA 1NGXB 3CDGA 2GITA 4OB5L 5E8OA 3PL6D 4QT5B 3TZVC 2NLJA 3HAEH 4WTWA 1RV6X 4JZOA 4XCCH 5F9WC 3QG6B 2AABH 3QIBA 1DBBH 2CDFA 4CNIB 4MCYA 4CU7A 3VFMB 3VXRD 1S9KC 4QHNB 2JJSA 1M1SA 4JG1L 5EUOA 4IOSD 1WIUA 5DHVH 1WGOA 3FB6A 5D7KE 2JJWA 5GGTA 3WJLA 1AC6A 5DMGC 4RBPH 4XNUL 3L7EB 1E4XH 3JWOL 2KKQA 4ISVB 3RVUC 1ZSDB 4D9RD 1YN6B 1KB9J 2R4SH 2UZXB 5IM7A 2ADIA 3TJHC 2XZQH 5IVXF 2VO5A 5D6CB 5IBTL 3T04D 3U4EA 1NFDE 1VGKA 4GMTH 3QUYD 5J6GA 5LAXA 1BOGB 1EJOL 4HV8A 4DCQA 4QRPB 1EV2E 1U8PB 3C9NA 5GGRY 1MCPL 1S5IL 4NN5B 3BE1L 5BS0E 3T3MF 4NRXA 4U1GB 5FHBH 1YMMA 1NUGA 5HSFA 4MMXC 3V4UL 3HR5A 3PJSB 1FFPB 2P5WA 5DGRA 1R6VA 2GTZB 5IB2A 1KENH 3CVHA 3FMGH 4MNGB 4YH6A 1MFEL 5GGSY 3EYQC 3RDTA 4YHYB 2HYMA 1FLRL 2ZSWB 3Q5OA 4HIEA 1PLGH 2ZCKL 3SDXA 4JFHD 2XI9A 4N0CD 1AQKL 2HTLC 4U33A 2WAHA 4FOMA 4ZFOA 4YPGA 2CO7B 4HT1L 3GMPA 2YR3A 1RK0B 4XNZB 4PGDB 2ZJSH 2CMRH 3IFNH 5DJ8A 2XZCH 1A7QL 4PGEB 1D5XA 2H6PB 5HI3D 2F19H 5IQ9B 2WUCL 1EZVY 5D70L 2AK4A 1JZ3A 3VWJD 3GRWA 3VXOB 4X9HA 2AXHA 2H3NB 3D39B 1UXWA 4PTUB 3NFSL 4Y5XB 4JM2F 1IAOA 2JF1A 3U0TA 2WWKT 3OAUL 2FYYA 5HD8D 3ZDZE 1FL5B 1WVZA 3ZHLA 1MCLA 5JW4N 4NBXB 1MFBL 5E7FA 3L3DB 1V7NH 1MAKA 4QF1A 3ZE1E 1HHHB 5KOVC 5ESAA 4ZFFA 5D7SL 2A1WH 5EFIB 5HHOD 2R0KL 3JWOC 5TQ2H 2W0LA 3B9VA 4OF6A 4M7LT 4WU5B 5FHAH 5T3ZH 3DWTA 1EEZB 4DW2H 4R90H 3ZTNH 4TNVF 1VCAA 1RMFL 4JR9L 3WL9B 2V5SA 4JZJA 4PJAE 4YDJB 3V6OC 1HI6A 3SO3C 1SYSB 1Z3GH 4WFEE 1BGXH 2FIRT 4YR6A 3MA7B 3QO1A 4F9LA 3DOSA 5B39G 3BKMH 2XWBA 1RY7B 1B4JL 2XTJE 3LKRA 4LCWD 2QQQA 1KYOJ 5IB4B 5IJVB 1E6OH 2X2YA 5F7EL 3TNNA 3DV6A 3V6BR 3U2SA 1P84K 2B1AL 3E6HB 3U4BL 5I1IH 4PV9A 5C3LD 4U31A 3VCLA 3RTQB 12E8H 3H42H 2V9TA 2YN5A 2Y7QA 4PP1D 1DBAL 5IWLC 4J12A 2JTDA 5DJDB 4EBQH 1UJ3C 3BP4A 4DZ8A 4QTHA 1NCTA 2PTTA 4YFEA 1F02I 3OGCB 5CGMA 4NQSA 4OIIL 2RCSH 2H1PH 4Y1AD 3R1GH 1PY9A 2R29H 4WDIB 3ARDD 2F53D 3UC0H 1JHLL 5F7LB 4JPIA 1VEOA 3QCVH 4WHYG 5JHDE 4UV7H 3SGKC 1W0WB 5KG9A 1C5BL 4YUEL 4I77H 1MHPL 2LV4A 2A9NL 1MWAH 3RAJH 2Q7NA 1MPAH 2ZCLL 5GRXG 5AYUL 4P4KA 5ECJE 4N0UB 3VXUB 3BEWB 3W5NA 3FO9B 3ME0A 5IESH 5H94B 4Z0BL 1YN7B 4NZDA 2FWOB 2XFXB 2A73A 2E9IA 5KANI 1U8OB 4N8VB 1VACB 4OGAC 5T33H 5L2JA 4MNQB 2BSRA 4M5ZL 4OZIA 1EX0A 1T7VA 3K46A 1LEIB 4XPAL 1NGYB 1PQZB 4LSSL 5E5UB 4LHUD 5EO9B 2EDHA 1NCCH 4Y19D 1AP2B 4H1LG 1V7ML 2BVUA 1H5BC 5DJ6B 5BRZE 3BZDA 4NPYA 3QWRA 2EDLA 3KYNB 3HZVB 1U8LB 3ZE2E 5DD3H 4RQQB 2X10A 4MJ5A 5FFLA 4LQ1A 3OB0K 1L0QA 1L7TL 3KLSA 3TCXA 1CVSC 2E27L 3MRCA 5CZVH 3VGHA 2SEBB 1PBYA 4LCYA 1QBAA 4MD5A 5EU7C 3HG1D 5F1IB 5I75C 3L7FB 5IBUB 3GSRB 1HIMH 1SBBA 4WUUD 2FJHA 5FKPA 5TFSL 3BOVA 4Z7OE 3OAZH 5C6WH 3ZKXC 5KSAA 1U8QB 2VWEC 4PJFF 3FB8B 5DRZA 3HI5L 2NY3D 5E0QA 5C0NC 2WWKO 4JG1H 1AGEA 1XIWD 2NX5A 4JFXB 3VFTA 4F33A 1DEDA 1FVDA 4RWHA 4XNUH 2HT3D 5T3ZE 2EDJA 2W1NA 3OXSA 5EU6B 2NW2B 3KAAA 5C0CB 1HHGA 4LMQE 4PJGB 4RX4A 2W59A 5ISZD 2HG5A 5IBTH 1XR8B 2P5EB 4NKDA 5C6TL 4G9DB 2GTWB 5IMLB 1EJOH 4M8VA 5TF0A 4H0IA 5HHXL 1MCPH 3DJ9A 3BE1H 3U7YL 1E6JL 3HAEA 1I1AA 3V7AG 2OI9B 3GBLA 2ZOLB 3T0ED 4PJDB 3DLQR 3FFCB 4PB9H 4Z77B 2XG4A 2EXWD 1JUFA 5E00B 3ZYIA 2D03L 5HYEA 1Y0LB 1XGPB 2CIKB 2GUOA 1MFEH 3BSZL 4MZ3A 5C9JA 4KHXL 4WI2A 1CLZL 4BSVB 1FLRH 3W81A 2ZCKH 5HBBA 2RBLA 1AQKH 4EN3D 1J1XL 4G80A 4D0CA 4L8DB 3BESR 4AH2A 2WANA 4ZAKA 4HKJB 4PJEE 2HTKC 1HDMB 1UJ3B 3JVGC 1NGQL 2BVOA 4R0LB 2IG2H 1SJVA 1A7QH 3QG7H 1HZHH 4GAFB 2VLRB 2WUCH 5D70H 1AQDA 1YNTA 2R0ZH 1I1FB 2V9RA 3EYOB 2YRZA 2I26N 4LVOC 4XNQA 1QACA 5AWNL 1YEFL 1RZGA 1HK6A 2Z93B 3MRGB 2VDRL 3S35H 3OAUH 3LQAC 5IFAL 1I1RA 2VDQL 5B3JE 1MFBH 4XP4L 1NGWA 1I7TA 5FUZL 5CGYC 2E9BA 3ZKND 3RWDB 1FDLH 4LQFL 1OY3B 3CVIH 4U4BA 3Q6FA 1EH9A 1IM9D 5HGAB 2R0KH 1KF9B 1FFOB 5J11B 4PJXF 2BMKA 1TJHL 1FVEA 1FYTE 1NANH 2BVPA 5K33A 3GJEB 4IRJB 3AC0A 3ARBC 4G6FD 1RMFH 4JR9H 3CFDB 1F3DH 1CDBA 5FIEA 3WIHH 4DFIA 1H5BB 3HZMA 3ZKSD 1VADA 5DUBA 2A74B 1JWMA 5ANMB 2BVTA 5I1HL 2VXQL 1JPGB 3WJJA 4GT7A 5T1LB 2P8PB 1B4JH 2HT2C 5B21A 4E0RA 3TIDA 4XNMB 4HH9B 2RIKA 5F7EH 3T0BA 3ULVC 3MLYL 1MRFH 2A2QT 3DX9A 4AM0A 4Z7WF 5D7IE 3U4BH 2E5EA 5C09D 3ILQD 5F1SA 4YIQB 3HNTH 1I3RB 1WV7T 2GYSA 1S7QA 1HH6A 3WFCL 3GFUA 1DBAH 4LLQA 1E28A 1KNOB 2BOBB 2H32H 4NFCA 5LJYH 2UZIL 3KPRE 1ED3B 3UP1A 2DS4A 3D18A 1U92A 3L3IA 3EUUA 1F6AA 4PRPE 5AAMA 4JDVB 4L8SA 1JHLH 3EFFB 2X5PA 3FHQA 4HJ0D 4RGND 2YSSA 3MMEA 3H9ZA 5D6DC 5EOTA 3HCVB 3SDDA 4RIRB 5BO1L 1BPVA 1N2RA 3EDDA 2VLKD 1EA9C 4YUEH 3TIEA 2WNGA 3OTTA 2EH7L 2A9NH 1CDYA 2ZCLH 1NBVH 3EJZC 5B39B 2Z4QB 4S1QH 1JNHA 2X4UA 4RA3A 1BVLB 4Z0BH 3BGAA 3MRBA 5D1QC 2Q86B 4N90D 4PR5B 4HHAB 5FGBC 3P0GB 4ZFGH 1YUHA 2ZWLT 4NN7C 3TVMB 4YAQA 3C6SB 3MOQA 4LU5H 4PRID 3P9MA 4GBXD 4XAKE 4M5ZH 4RISL 3S4SG 1U41A 4Q0XL 3RL1A 4LKCA 4GLRI 4XPAH 4X6CB 4LSSH 4FXKB 3KVQA 4XHJD 2DQIL 4NQEB 1NKOA 4ZG1A 1ACZA 4MLSA 1V7MH 2D7PA 4CDGC 3DIFB 4JFQB 3QQ3A 4PBWD 4I2XE 1XZ0A 5JQ6L 2X9YA 4NSKA 1G7IA 4FS0A 5J7CC 2ZG2A 4KUZH 4HUVB 5E1AA 2J8HA 4F3FB 1IKNC 3SGEH 3MSPA 1MWAA 1QBLL 3CFEA 4HJJH 3SCMA 4MDJB 5JOFA 5DFWH 1L7TH 3FOMB 5DJ2A 3IFLL 4Z7NF 2E27H 1ZLUK 1LP9E 3EHBC 4F80A 4PRNA 1GAFH 1I8IB 4PJ5D 1KPUB 4EIZC 5C0FA 5IG7A 5H35B 3JUYA 1YEJH 4Y89A 4QLRA 4PJ8B 2ADGB 1IEAB 4KI5C 1NFDF 1UM4L 4X4XB 4XP9L 3GMNB 4XBGB 2BHYA 4OGXL 1HNGA 3MYJA 3ILPA 4Z78A 3CFKB 1X5JA 4H1LB 3QRGL 3MJ9L 4U2YA 3IDMA 3M45A 1UH2A 3PE9A 3M07A 5MHSD 4UIMA 5KVDL 2VLJE 4N0YL 1XGQB 3UZQA 4TVSa 3KGRA 4XVJH 3WFEL 4U1LA 1KPVB 2HN7A 4PJ7A 5A40E 1U3HC 3X17A 1WBXB 4BQCA 1XH3A 4LAQL 3PWVB 1AH1A 4OLXL 5IMKB 2ERJC 5EBLB 1X5HA 3E6FB 1TENA 5C6TH 3RVXC 1AD0A 1K85A 5DA0B 1YNKL 1UKSA 4WWKC 3IDGB 1P7QA 3KPNB 3U7YH 4OCWL 3ARBB 1E6JH 4O2FB 2NZ9C 4MJID 1EXUA 2BX5A 1A1OA 1FV1A 3MV9B 1NLBL 2HVKA 3H3BC 2YEZA 4ODXB 2IANA 3TBWA 1CDIA 2A6JB 2Q20A 2D03H 5JA9A 4WW2F 1MJJB 1VENA 3KPRA 2PYEA 2YD4A 3BSZH 1MEXL 4KHXH 1GGCL 4KKBD 1CLZH 3LS5L 4RDQF 4UU9B 4HIXL 2X1PA 2IQAB 1OQOA 5HYJE 2R1YA 2FIKA 1Y18B 1C8PA 4YHKL 2CLZB 3B2UC 3V6OA 4WFFD 2DDQL 1NGQH 4PJ9D 1XEDA 4BQ9A 4WI6A 2DBLL 2FX8L 3BW9A 1U6AL 4P5TD 1X5YA 4NQCA 3W9DB 5DHXB 5JW4R 4K7PX 2J5LC 4QCIB 1QEWB 2APBA 3BVNB 3O6FC 3D3VE 5AWNH 1YEFH 1MIEL 4M02A 2HRLA 2VDRH 5E2JA 4PJAF 3WKML 4H26A 5IFAH 2E9JA 1R5VA 2VDQH 1J0ZA 1NDMA 4XP4H 4OV5B 3LHPH 1WFNA 4QXGL 5FUZH 5KJRL 1P2CA 1U3YA 2CKBL 4YZFE 2L0DA 5ICXB 5IWLA 4LQFH 5D1QB 1JGUL 3IJYB 3MJ6A 5FXCH 5SWZA 4R9HA 3S5LG 3SKOB 3TJEL 5IOPA 4QHMB 4I2XA 4Q9CA 3VGFA 3IFOA 5D7LE 3JTSA 5GJSL 1SVCP 1TJGL 4PTTA 1N3NB 4IBLT 2P24B 4P2CG 3OKEB 3BYTA 2YMXL 4S10A 1NLDL 4HQQL 1BWMA 1GXEA 4S1RL 1ZLVH 1OTSC 1TJHH 3ISWA 2QQLH 1TVBB 4UQ3A 3U6RA 4NC1E 1CI5A 3O3EA 1JVKA 1LP9A 3HE7A 5IMMA 4ODHH 4QRRB 1MELA 1CXFA 2DICA 2FZ3B 3BRGC 1W72B 3KLAB 5I1HH 2VXQH 5I1KL 3FQNA 4J3OC 2GSGA 1I8MB 4N8CL 4L5FL 4W4OC 5BZDA 5ESVA 3EDJA 3MLYH 4OM1L 4YJZL 4X5XB 3PWLB 3ARSA 3ORJA 1D5BA 3P9LB 4L3EE 5KN5A 3WFCH 1ZA3A 4UUJA 3RP1A 2UZIH 3L5JA 1ZEAL 3U30C 5JLZB 2CJUL 4S0TD 3O9WB 4OZGF 1S78D 1S8DA 3L9RB 3WKNA 3M1BB 2G2RA 4MX7A 5KVEL 1ZHNA 5BO1H 3W5MA 1MCKA 2BSED 3L1OL 3ARFC 2HAZA 3TF7C 2EH7H 3THMH 4PRBB 3QUZA 3VRLE 4YLQT 4R3SB 5GS0C 2F58L 2W0KA 3ZE2F 3HS0A 4HGKC 4YDVA 4WFGE 4WFHD 3V6ZB 3VWKC 5T5FL 3AUVA 3RWHA 1PAMA 1SJHA 1U3HB 4FFZL 3TT1L 2MQCA 1F8TH 4KY1L 4RMRA 1FNGB 4KKAD 3REVB 3TFKC 2ERJB 5I9QB 3DHJA 3EDKA 3Q2CA 3DX6A 4MHHI 1DSFL 2E6PA 2ZUVA 4RISH 1CE1L 2H32A 3NA9L 2L7JA 3DTXA 5EIQA 2DQIH 2EO9A 4GW1B 1BQHA 1DQML 3VXQB 5BCAA 1DZBA 1JPSL 4UMGA 1TVHB 3L3GB 5JQ6H 3C60C 5HYJA 2WBKA 3EBAA 2ITDB 4X5WB 4X4ZA 4YBQD 4Z7OF 1MF2L 1A1MA 3GHEL 1FRGL 1QBLH 1HXMA 1G7LA 1L0XA 1K2DA 1PZ5B 2E6JA 2P47B 3QDMA 1CCZA 2J88L 4X6BA 2ICEA 5IR1B 3W9EB 4MXWL 3C8KB 3RNKA 2R2BB 3GBML 5MEOB 3DRTA 3UTZA 2BVQA 4JE4B 5EA0L 1JRHI 1A9BA 1BREA 3OB0H 5FOJA 1KJMA 1NPUA 5FYJU 1QSED 1CTNA 5EC1A 4ODBD 1IQWL 1JP5A 3QWOB 3S4SB 4IS6A 5FM5O 1UM4H 4ZO6A 4XP9H 4LSTH 3O6FB 4M3KB 4OGXH 2I07B 1T1ZB 4KRPB 3H7BB 1OCWH 4G9FB 1XF2A 1BD2D 3QRGH 5E8EB 1M7IA 3MJ7A 3B2VL 3KDMB 1AO7D 3MJ9H 4GO6B 3JV4B 4JFEB 5E5MA 4M93C 2ED9A 2OX5A 2YUWA 3MV8A 5KVDH 1GGTA 1CFNA 4GRMA 2EIDA 4HGMA 3OR6B 1RULL 4N0YH 4XWGL 5IVOA 3WFEH 3QNZA 3QPXL 2VUOA 2Q6WB 1HWGB 2E8ZA 1B4RA 4OLXH 3QDGA 3DXAD 2PCPA 3KR3L 5EZOH 2PTVA 4PG9B 5HHMB 4LCCC 2PYFB 3IB4A 5DQJB 1YNKH 3MUY1 4ESKA 4OF8A 4N0CC 4XH2B 4YGVA 4GUPB 4OCWH 1J1OL 4PJEF 3KPLB 3OKOB 5D7JC 1R3JA 4LHUG 1NLBH 1D5ZB 1FGVL 4CAGA 3STBA 2IPUG 5F1NA 1IGJB 3LQZA 5K9OB 3D6GA 4NO3A 5HI3C 4WI4A 2GKIA 3VD5A 3VWJC 4BK5A 1MEXH 2QQKL 2V2WA 3F7VA 1GGCH 1DQLL 3C5ZD 1NC2D 3LS5H 4QOKD 5E9DE 4HIXH 3CX5K 2NY5C 5B3JF 1UM6L 3H0TA 3QZWG 3RHWK 4I18B 4MSWB 3K4DA 5HD8C 1KBGL 2NY0D 4JHZA 1S7WB 1ZS8A 4KGJA 1Q72L 3O45A 4YHKH 2X4NA 1RZIB 2DDQH 4FQJL 3QDJE 1U6AH 2Z92A 3H9SB 4LPVA 4ZUUA 1DLHA 3PDOA 3FT3A 3K4AA 2MHAB 5F9JB 1E4WL 4L29A 4XMPH 1KCKA 1MIEH 2VIRA 4BZ1H 1KC5L 1OWWA 2E7BA 5DS8B 5KSBB 3SDAC 3VFPB 2D31A 4G6KL 4P23D 5IW3A 3WKMH 2V17L 2IEPA 4F7PA 4HIJA 3OL2A 3RNQB 2WK2A 3W0WB 5C08E 1N8ZB 1E4KC 3CH1B 1MNUL 2AJUH 2X4TA 4S2SB 3HNSL 5EH1A 4QXGH 4LCUB 1LILA 5KJRH 3QEHA 3G6JA 2VB5A 3CPLB 1JGUH 3HUJE 2HT4D 4OIBA 4OLUL 3TJEH 4CVUA 4PYHA 4NNXA 2HKHH 3IETA 1UZ8B 3AREA 4UBDC 5AUMA 1TJGH 5D7IF 4OQTL 1NLDH 4K9EH 4HQQH 2VITA 4LP5A 1AIFB 5CINL 2HKFL 3ABZA 1C5DA 4KMTL 1BQSA 3RWEB 2YOCA 2MCPL 1X44A 5I18L 2OQJB 3O8XB 1UWXK 1RPQA 2EEBA 5IW6A 4K7FB 4PP1C 3QQ4A 2ZUXA 1C12B 3JUZA 5T1MA 3OKLB 2L7UA 3V5HA 3PL6B 2D0GA 4LLVB 5I1KH 3WO4C 5LGJB 3BH9B 5FGBA 4L4VA 3ARDC 3V2AR 3EOAB 3BZEA 4Y8DC 4N8CH 3DV4A 4L5FH 3W39B 4M5YL 1NJ9A 4BKLA 3VXRB 2VUYA 1WIOA 4OM1H 4CMHC 3ULSB 4NT6A 5H37G 3QNXA 5EUKB 3MGOB 2CK0L 3S5LB 2XA8L 3UTPD 5FF6B 5FM4A 4BFIB 4F7TB 3C2SA 4OFDA 5GGVH 5TPWL 3VFRB 3GSVA 2XN9E 2DLFL 1ZEAH 4POYA 1B3JA 4I4WB 2CJUH 3KXFB 2FH8A 1QKZL 5KVEH 1IKNA 2Z8WC 4MXQD 4J6RL 3D87B 4BH8A 3SQOL 3VD4A 3QUYB 3OKYA 3VXPA 1RJCA 4K7PY 3L1OH 3BGMA 4ZD3H 2DTML 1BJMA 4JFDD 2YD9A 4M93B 5KTEL 2XYCA 1A22B 5JXED 3EDEA 5I8KL 4P46A 4P2QD 3HPJA 1K4CB 1KGCE 1TZHB 2YD7A 4CL7A 5D5MB 1RIVL 1P53A 5T5FH 5I1GL 2V2TA 4FFZH 4C58B 4W6XB 1OSZA 5E24E 1FZOA 4JPWL 4NJAL 5FGSA 2W0PA 1WAAA 5DR5L 1BFOB 1NSNL 5IEKA 4ZO7A 4JRYD 1NKRA 2GT9B 1DSFH 4LCCB 2Y5TB 3QH3A 3SKNA 1JV5B 3EJYD 5AAWA 1S7SB 3NA9H 1JWUB 3GK8L 5DDHB 1TQCC 4HUXA 3ARGD 2Q7YA 2IF7A 3FN9A 4W6YB 4IHOB 5E9DA 4P2RA 1QFOA 4EOWL 4KPHL 3BX7C 1Q9KB 2EC9T 2G75A 1DQMH 1JPSH 4AENA 3RIAK 2Q1EA 2VL5B 3NFNB 4JY4A 1IC7L 3LMJL 3BHBB 3RUGB 2VABA 3PV6A 4KQ3L 4GKSA 1IAIL 1MF2H 1U3JA 2NY6D 1FRGH 3GHEH 3RVVC 3FQRB 3ZDXE 4APQA 4HBCL 1RU9L 4G8GE 3QDJA 2R9HD 1KTLA 4MXWH 1TNMA 2FHBA 3KJ4C 1X7QB 2NY3C 4IOIB 4PREB 5ICZB 3GBMH 1KTDA 3FTGA 3UEZA 1HXYA 4FQHA 1XIWC 5CMAB 5DC9B 2QKIA 1CS6A 5EA0H 4G6ML 1OGAD 3SJVE 4C56D 4LNRA 3ECBA 3DO3A 3FN3A 1BIIA 2HVJA 4XXCC 1U8KB 4Q2ZA 4PGBB 2AXGB 3CFCL 3LKNA 2BNUB 3HUJA 3S97C 1V8HA 5HHOB 2W9DL 2OLDA 5MENE 4G42B 1NFKA 1EJ6A 3I6KB 1MH5B 4JFYB 3QAZB 3DI3B 1RULH 5I1JL 3T0EC 1TJIL 3QPXH 4JG0H 5FYJE 2GI7A 1M7DB 4FTVD 2EXWC 2OSLB 2Z9TA 4B0MM 2MKLC 5FYKU 2Y36H 3VJ6A 1CLYL 2IPKB 4PJBB 4CDHA 4JJ5B 4LCWB 3KR3H 4QHLA 3PP3K 3F5WA 4U1IB 3OV6A 5BZWA 2W65A 5IHUL 4LIQE 2C4FU 3MGTA 1GOFA 4QTIL 1INDL 4EN3C 1T0MA 3FQXB 3OKKB 4RGOH 3ZDYE 5C0GA 4LLUB 1YPZE 1G9ML 4XGZA 4GRWB 3WFDH 4U1MB 4AQOA 1FGVH 4ZUSB 3EIFA 3P0VH 1E4XI 4F7MA 3MJ9A 4NKMA 3SN6N 1DTUA 1MLCA 3QISA 3ARDB 1LE5B 2QQKH 1S9YB 1DQLH 1MCBA 5F7NC 1FIGL 4PJIE 4XX1E 2BNRE 4CMHB 4D0BA 4E41D 3NAAL 1UM6H 1N59A 3BMVA 3MFGB 1NMAL 2A83B 4MJ6B 1UM5L 4YZFF 1KBGH 1B90A 2YWYA 1G0XA 1Q72H 4QRSA 1HYSD 4WV1A 1AD9A 4MQSB 3B8SA 4FQJH 3ZKNC 4KUCD 1NEZG 4NO2B 4WWID 5DMJB 3EGSB 1MUJA 4OD1L 1ZHLA 2H8PA 2YPLD 2RQ8A 2PW1B 4Y7MA 4BYHA 4ZMAT 1YECL 1BBJB 1E4WH 3DECA 1IM3B 1TVDA 1RHFA 1YDPA 4ODSH 2R2HA 1MCWW 4K2UL 4WHTA 1KC5H 5DJ0B 2FEEL 4LHUB 3HPLB 4RAVA 2V17H 4HWUA 3LV3B 2BNQB 1JGEB 5DK2B 3NN8B 1MNUH 1ZAGA 4LOUD 1NDGB 5DJAA 3SE4C 3NFPA 1Q0YL 4U1JA 4J8RA 2X1WL 4PJFB 2EDFA 3DGCR 1AE6L 1CXLA 4OLUH 5GSVA 5JO5A 5CSZB 1RK1B 4HFUL 3V8CA 2VZ3A 3G5VB 3BN9D 3QZWB 3BD4A 4QRPE 4XPHL 5DVMA 5TH2B 4RDQG 5DZLA 1UZ6E 3SDYH 4OQTH 4GG8A 3DX8B 5CINH 4LLMA 1N4XL 3CZFB 1MRDL 4KMTH 2ILLA 5KS9F 3ARFA 4HWBL 5GGSA 3GIVA 2MCPH 3CFIC 5I18H 1GOGA 2X44D 3IAGC 4FFWD 5L2KD 3BUYA 1KEGL 1UG9A 1T21A 3HG1B 5J13B 3O4OB 2GAZA 3VU2A 4MNGE 4V1DD 1BFSA 3VWKA 3TN0C 3DROA 4FQQB 3MRIB 1JGLL 5IHLB 4NDMB 4RGNC 5FGRA 1AY1L 2XKNA 3DMMC 3PIQB 4M5YH 2CKBA 3VRLF 3BPCB 2NY3B 2AQ2A 4R8WL 5SWSA 3UTQB 2IC2A 1XIWB 2N7AA 2CK0H 4X5LA 3BDXA 4OJFL 1VFAA 1M4KA 5SX5K 2G9HB 2DLFH 4MAUL 2Y9RT 2C1OA 3C60A 5DVOA 3UX9B 3D39E 1DANT 4JRXA 2JKXA 4LMQI 5IB5B 1QKZH 4POZC 1PKQB 2XXCB 4J6RH 1MHCA 4NUGL 1KG0A 1QO3B 3JTTA 3SQOH 4LSUH 2PR4L 4GBXC 1JN6A 2DTMH 3L3HA 4UDUB 4CN1A 1T1WB 5BOZG 1MJUH 3TO4D 5KTEH 1CGWA 4XHJC 1W8OA 3SDCD 4UT9L 3FN0L 4LPUA 5I74C 5I8KH 3LIZL 3LEYL 1GGYA 4F9PC 3VDBA 1RIVH 5I1GH 1KT2A 5GRVK 3U0PB 1XT5A 3N1MC 4JPWH 4NJAH 3OJDB 2V2XA 5DR5H 3L5IA 1T3FB 3BZFB 4LL9A 5C71A 5KSUA 3MLSH 4XRCA 5HY9B 3LEXB 1FL3B 2IADA 3TC9A 4U1KB 3GK8H 2A0LD 1X3DA 4XVTL 1S9XB 2JIXD 4ONHB 4PJIA 1YEDB 4EOWH 4XNYL 2LAAA 1I8LC 2D9CA 1ZT7B 4OF7A 1WWAX 1ES0A 3EYFA 3FO2A 1ZVSB 1WWBX 3LMJH 5ETUB 3MRDB 4KQ3H 2VRAA 3HI6H 1IAIH 3L3OA 4LRIA 2E7MA 3QIBD 4HBCH 1AI1L 4PD4J 4J3XA 2AJXL 4O2CB 3NOIA 4YQXH 2R2EB 1P4LB 4QHNA 2R8SL 1W0VB 2AJSL 1QA9A 3PGCA 4NHUB 1KJVB 4J1UA 5FK9B 5D2NB 4F2MB 1NL0L 1YEHH 2FATL 3QI9A 4HLZH 2WQRA 3QUXC 4G6MH 4PGJA 1BHGA 1OP9A 1CZ8L 5D7JA 2AS5M 1ZSDA 3MUGB 1YN6A 1SYVB 5IGXL 4XAWH 2R4RH 4I3SH 4HG4K 1IM9B 4X4ME 1HSAA 2V7HB 1RZ8A 2LABA 1YJDH 2NW3A 4AIOA 3LKOB 3CXDL 3LRSB 2NNAB 1EHLH 1U36A 4N0UE 4PP2A 4PRAB 1FG9C 1YMMD 3Q6GL 1CXKA 4G6FB 4JLRB 5CEZL 1CDJA 3MRLB 5ACZA 5I1JH 2F5AL 2P5WD 3IDIA 4F8QA 4MNQE 2GTZA 3VGDA 1BLNA 1CLYH 3RDTD 3MJ8B 3K2MC 3O41A 1OQXA 1LDPL 2HJKB 3OR7B 4KKBC 1JIBA 4HWNA 1S7RA 5IHUH 5CEYB 2H9GA 4UZGA 3SDAA 4QTIH 5C09B 1INDH 4JN1L 1QRNA 4NRYA 4EKXA 1UENA 3TLRA 3BDBA 4P2OA 2F8VA 1E4KA 1RK0A 3LN5A 4PGDA 1G9MH 2UYLA 5I8EB 1IEBB 4LGPB 4PJ9C 2AK4D 4P9HH 4RFEA 4P5TC 1N6UA 1LO4L 3RU8H 3DGGB 3D0LA 3QNYA 5FYKE 1G7JA 1FIGH 3E8UL 3K74B 2ZOKA 4PTUA 5J9PB 2EDDA 2VLKB 3NAAH 5IIEB 5HVHB 1NMAH 2J8UB 3O6KL 1UM5H 8FABA 4OCRL 1FL5A 4ELMF 5T3XL 4LVHB 2OL3B 3QEQA 2BY0A 3JWDC 1KJ2A 3FRUB 3B5GA 5E56A 1U2HA 4OD1H 3I2CL 4MYWB 4EXKA 2QSQA 4YHIB 1YECH 5IW1B 5IV2A 1NAMB 4W81A 3HZYB 4ZUVB 2F53A 4GBXB 4K2UH 1IL1B 2XY1A 4HF5L 4FXGB 3L3JB 4D9QD 1ZLSL 3CC5B 3GJFB 4OLWL 1Q9OB 5EU6E 5C0CE 5DUML 4FP8L 4PJGE 4AL8L 1KOAA 1GHFL 2F15A 1AE6H 1XF5A 3MA7A 4CU6A 1G0DA 5FCUL 2P5EE 5ID1B 5JOEA 4HFUH 3OAYK 1JWSB 3PABA 3PDGA 3TBYB 3MRRB 4LGRB 5EU4B 2APWA 3I3EA 4XPHH 3C09B 2OBGA 1IAKA 2O61B 1ZA6A 1NMCB 1NBZA 3NABL 4OQ1A 4HWBH 1NEZB 4PJDE 1CDCA 3P40A 1J8HA 3RTQA 5GS2H 3FFCE 4Y19A 4JM4L 3FB5A 3VRIB 3IGAB 1B9ZA 5DJDA 3ULUL 1LNUA 3GSXA 2E7CA 1HOCA 1IGCH 2K7QA 2YPKB 1S78C 4TNVK 1JGLH 5DJZB 1QFPA 1B0GA 3EOTL 1AY1H 1CQKA 4XC1L 4MQXD 4XNXL 1N5AB 2ATKB 1S9VA 2VZOA 3KPMA 1A7NH 1Q94B 4KH2A 4U6TA 5HGHA 2Z91B 4R8WH 4YBHA 3EDFA 4D0DB 4LCIL 4P4KD 4OJFH 2AKRA 2VLRE 4N0UA 3BEWA 4HWZB 4OQTA 5EORL 3HMWL 4MAUH 3RY5A 4L4TA 3DYOA 1DUYB 4ZUWA 4XZUA 4P2YA 3I75A 4GKZA 4XCNB 5J1AB 4KKAC 2VZUA 4LLDA 4NUGH 4WUUA 5C3TA 5FA3B 1WLHA 1NQBA 1EGJH 5IFJB 1PZUB 1PQZA 3WE6A 4QXTA 1U8MB 4LHQB 3GGWB 1K6QL 3ZO0A 5M95B 4UT9H 5F7YC 3QUKB 3FN0H 2R1XB 2MOVA 2PXYC 1A02N 1AGDB 3LIZH 4RNRA 4KKCD 3LEYH 2EKSA 1T20A 1CFTB 3CCHB 1MIML 2FBOJ 5DJ6A 4JQIL 1DLFL 3ZDXF 4RMTA 1SJXA 1U8LA 3OXRA 5AZ2L 4J2XA 1JGVH 2D2OA 1DDHB 1XCQB 1XCTB 5GS1A 1P84J 2Z35A 3QRFM 3K7UA 1VFUA 1JCKA 5L88L 1RIUL 3VRJA 2KZ1B 5DURD 1CGSL 5ITFB 4OZIF 5ANME 1Z0NA 3PDDA 4GRLA 1OLZA 4JQXC 4PJ9B 1FLTX 4P5TB 1I3GL 2CIIB 4HDIA 5HJ3B 1AI1H 5KSAD 4MB5A 3FQUB 2R8SH 1A8JH 2AJSH 2UY7A 2GK0B 2NX5D 2HFEA 1NL0H 3NCJL 2EIBA 1NMBL 2FATH 3MUHL 3M17B 1L7IL 4EN3A 1X5XA 4UDTB 4YFDB 5I71C 3U9UB 1CZ8H 5D8JL 5EU6A 4BQ8A 3U7WL 1M6OB 4RX4D 3DVNA 4EDXB 2WBJD 1T4KB 4K8RL 4X9GA 1BZ9B 1H3GA 3QA3B 4AEEA 4WHCA 3RWJB 4WY7L 1Q0XH 5FUOL 4ZUTA 2EKJA 3WNLA 4B53A 4FQIL 1YY8B 2IALB 5I2IA 2YN3A 4K3EL 4YHLL 3ZMRA 3K2UH 3CXDH 1C08B 2CGRL 3LRGA 3ZDYF 3P4OA 4OZGB 2IPUK 1YPZF 4D8PB 2JELL 3Q6GH 1K4DB 5CEZH 4NUJB 2CR3A 2MQ3A 2F5AH 3QPQD 4PJDA 1I7UA 3QFJB 1KSRA 4WHDA 4HZLA 3DVIA 5CJXA 3Q1SL 5D96B 2BOCA 1F2XK 2VZTA 4AEHL 3BKYL 1CTOA 4RFNC 3QJHB 1OVZA 4X6CE 4A6YB 3NZHH 1W0YT 1LDPH 2FDBP 1RJZA 1O7SA 4NQEE 1IGTB 2ARJB 4XB8A 3CSYB 4BSWB 4JN1H 3MR9B 5DRXB 1FFQA 4LF3B 4HK3J 4GFTB 3UZVB 2WLZA 2DQCL 4ZAKD 1KTKE 3PP3H 4F7EB 1WSST 1YEGL 3UBXA 2QHLA 4L9LB 4JREC 1FJ1A 2R0LL 3PWPB 3MFFB 4HLJA 4HIHA 1JYVA 2P48B 1NFIB 4HKXA 3E8UH 5B8CB 1U8IA 4JGUA 3HC4L 1I1YB 3O6KH 3WS3B 3QIWB 1T5XB 3FL7A 4P23C 5INCB 4OCRH 5E70A 1K8IB 5T3XH 1JZ8A 3RWIB 4N9GB 1WC7A 5GSRB 4XWOD 1B0RA 3DETD 3L6FA 4J7RA 1A3LH 1EIBA 1RUAH 2HT4C 5KZCD 5BRZD 1UZ6F 4TVPL 1FH5H 3NA4A 4AG4L 3TN0A 5HPOA 3SBWC 5HGAA 3D25B 3UMTA 1FFOA 3DMMA 4XP5L 1A47A 5JDSA 4JAMA 4ZDHB 5A2IH 3PNWA 4LSVL 4D9LL 1H8OA 3KYOB 4OLWH 5ESQB 1DEEA 1P1ZA 3GJEA 4ENED 3MNZB 4YHNB 1OOAA 5SWQB 3NZ8B 1S7UA 4Z76A 3JV6B 4N8PA 5DUMH 3FT2B 5LBSH 1I4FB 4FP8H 4U1NA 4AL8H 2C7UB 1GHFH 4X8JA 1ZT1A 1CT8B 5FCUH 2APXA 4Y2OA 5JPNB 5DGQA 3LN9A 1S5HA 4JVPA 1PG7X 1JPGA 2LVCA 2XWTB 5HDLA 1IGIL 1AHWB 3VI3F 2YUVA 5MEPA 4A2LA 4N1HB 2Y07L 3GEWB 3LKPB 1TXKA 4JZNA 3NABH 1GZQB 4KI1A 3MV9E 5D93B 2CDEA 3HMXL 2HRPH 4JM4H 1IZKA 4IJ3C 3ULUH 5JIKA 3ZHKA 5T3ZD 2OS7A 4OZHF 4ZTOL 4WNQB 3GSWB 1RJYA 1JJUA 1CL7L 2KH2B 3SDDD 1F2QA 4XC1H 3HCVA 3MBEB 4MXQC 4XNXH 5C0JA 1X5ZA 4RMQA 5J6HB 4UQ2B 1QYGL 1BD2B 4P3DA 1RJLA 3KWWB 2WP3T 1AO7B 4CVZA 3RVWC 3O3AB 3Q0HA 4LCIH 4X98A 3TBVB 4X9IA 2QADC 4PJ5A 5JXEC 1U93B 5EZJA 4KAQL 4QXUH 5EORH 3HMWH 5E2UL 5CEZE 3QXUA 5CD5D 5HHNA 3V7AE 4HWBA 2NXYD 4TSAL 2E7LC 3FONA 1NBQA 1FZKB 5SX5H 2GJZA 4NRZB 4OLYL 2CLVB 3EJYC 3U0WL 5DI8A 1RURL 3G6AA 4NKIH 4W6WB 1K6QH 1ZWIA 4NQEA 1MVFA 3ARGC 2N56A 2N7BA 4JFQA 2B0SL 3O2DH 3QUXA 1DLFH 4JQIH 4JGJA 5EO0B 3KYKL 4JKPH 4HUVA 3TO2B 3D85D 4WGVB 3TJHD 5EU5A 3SCMD 2P46B 4K7PH 2NY6C 4ODWB 1KIUA 2D7TL 1H0DA 3MOBL 5K9QI 5JPMB 5J1SC 3C5ZB 2R9HC 1NC2B 3FOMA 5BVPH 4QOKB 4N0FB 5F3HB 2YXFA 2ZPKL 1LO2H 4LVNB 4G6JL 4QRRE 5KAQF 1RI8A 3PQYA 3D2UA 4ELKB 2Y5EA 1I8IA 4Y16B 2NY0B 4NO5B 3R06B 1CGSH 5DO2D 1DQJB 3C87A 5H35A 3DBXB 4GMSL 4JM2C 3EFDL 4Z0XA 5T3XE 3CDFA 2HJFB 3EOBA 4PJ8A 1IEAA 1SEBA 1I3GH 3L3KB 1K9TA 1CR9L 1KUMA 2NPLX 2X1QA 2F54A 5DFTA 5FO7B 1EMTL 3VGAB 5E8DL 1QLEL 1XGUA 3VG0L 1CQYA 5DD6A 5MEQA 3NCJH 1NMBH 4NFBA 4G6AD 3HLAA 3BP7A 1L7IH 1KPRB 4HX1A 3V9FA 3VW3L 1MFCL 2YA2A 2WSKA 2J6EL 4M1DL 1KPVA 1RZ7L 3MO1A 5AZEL 4K8RH 4WUKH 3TWCL 4YHPA 4WY7H 4JDTL 1V5JA 2VQTA 3BPLC 3E6FA 4TTDD 2GJ6B 4FQIH 3QHZL 1P7QD 4JY6B 4K3EH 5GZND 2VXVL 3IDGA 2CGRH 3GM0A 4ZNEE 5JA8B 4I9WE 3HC3L 3P4MB 2X70A 1ONQB 1A7PL 3MROB 1DR9A 4ZSOB 2R69L 3ARPA 4AT6A 4MHHG 1M05B 5TGBB 4ODXA 1A6ZA 1RSFA 3OJMB 1VFBB 4KV5F 5SX4H 2R39A 3KPRD 4AEHH 3BKYH 1GIGL 4UTAL 3AAZB 3ULUE 1KULA 1I9RL 1JYNA 1AGCB 5HGBB 1PDKA 3X14B 4UU9A 1X5KA 5D2LB 1MHEB 5JR1L 3QO0B 1QSFB 4M6ML 3EO1B 1Y18A 3FRPG 1HYSC 1YEGH 1RD6A 4LSQL 5F72S 4NQCD 3ZL4H 1TTUA 3WIIL 1L9MA 3MV7B 3W9DA 2BSTA 2R0LH 4M62H 1JL8A 1YQVL 3QUMB 1D5MB 5TE7L 3AXLB 2WP3O 4Z7UB 1X4XA 2FL5A 3VXTA 3H9HB 1T0PB 4JFDB 3UPCA 4XAKD 1UA6L 3O0RL 3T77A 4PJGF 4NGHH 3BIKB 2UY6A 3OKMB 4LOUC 1G9NL 4K3DL 1JPFA 4S1DD 5SWZD 1VEMA 1BAFH 3I85A 1BVKB 2FJGA 3MRNA 4MCZB 4TVPH 1LWRA 4AG4H 4G9FE 1FNEA 1DN0B 3BN9C 4JRYB 5EULV 5M94B 3V4PL 3CU1A 5C0AA 4JFEE 5D71H 5GRWA 3JSSA 1EAPA 3EYVB 4L9DA 1QUNA 4LSVH 4D9LH 3OKDA 5ICYA 3S37L 3ARGB 3LKSA 2OK0L 3HE7D 1RHHB 5HHQB 2X09A 4U1SA 3U46A 3P73A 4FFWC 3GKWL 2FD6L 3ARQA 2C1PA 5B4MD 1LD9B 1R5IB 3DVFA 2GY5A 2FO4B 3VFWA 5HHME 5D72L 3FQTB 4NNPL 4QYOA 2Y07H 3T0VA 4HGWB 2APFA 3OAYH 3DVGA 3HMXH 5C07B 4HKBA 2IFFL 1BJ1H 2W0FA 4QRTA 2PXYA 1DQQB 4ERSH 1OGAB 2HP4A 5LCVL 5IB3A 4C56B 2VLJD 4J3WA 4RAUA 3O9WA 3SY0B 1NGZB 4ZTOH 3QDHA 3L9RA 3IVKA 43CAB 5JW3L 1CL7H 5F6HI 3TBTB 2PF6A 2JCCB 4Z7VA 1JHTA 1QYGH 4AMKL 3TA3A 3RI5K 3VFOA 3V6FA 3QUZD 2DD8L 4NHCL 5HYSG 2UV3A 3TO4C 5I1LA 5CKAA 3SDCC 4R3SA 3H9SE 4XBEL 4NQDA 1R24B 4KAQH 4ZNEA 4YNYB 2YD8A 3B9DA 4PRHA 3S3PA 1WICA 3OHXA 1XR9A 2EE6A 4JQXA 1QSEA 5E2UH 3EYUH 4FTVB 5EBMA 1G7PB 3C6LB 5GRJL 4ZTPL 2X7LB 4R97B 5KSBE 1T5WB 1G9NC 4OUUB 4BZ2L 3KLHD 4TSAH 4O02L 2JK5B 3QP3A 3CJJA 1KB5B 3W0WE 1JBJA 4OLYH 3G5ZB 1Z6JT 3U0WH 1QFWL 4YGAB 1RURH 2A0LC 5IF0B 4FFVD 4JN2B 4C54A 1N5YL 3RA7L 5CEXB 1F4WL 5HYJD 2B0SH 4I0PD 4ZFZB 1OAKL 2GFBB 3HZKA 3KYKH 3HR6A 2ITDA 5CZXD 5DTFA 1LEKB 1INQB 4PJCB 3QDMD 3RHWF 1HHIA 2I25N 4QHKJ 1TCRB 3QIBC 2D7TH 2Y25A 4UNTA 5FKAB 3MOBH 4M00A 3IAQA 2H2PD 5I66A 2ZPKH 4BELD 4G6JH 3UTTA 3WJLC 1T03L 5I73C 4I5BA 4LLWB 1D6VH 4W4NA 4OZFH 4NO0B 1JF6A 3EFDH 4PS4L 3E3QC 1F6LL 3QWOA 4U1HA 2IMMA 5KS9B 3QDAA 4GW5A 3VXRE 1CR9H 3LN4A 1OF2A 4UTBL 4YBLC 2W38A 2DWEB 1I7ZB 1EMTH 1DL7L 2IFGA 3H7BA 3IDYB 4G9FA 5E8DH 3UROR 2Z0BA 3WDJA 4OFYD 3KDMA 3T4AA 1QLEH 3VG0H 4OBRA 1LK2A 1B2WL 2O5YL 3MV8D 3TT3L 4BSJA 4D9RE 3KXFE 2I9TB 1V3LA 1LO0L 3WHE0 1MFCH 1PG7W 4L8BA 2J6EH 4M1DH 4DGIL 1GYAA 1RZ7H 4X6CF 4AIZA 1FCCA 5AZEH 3ALWA 3QDGD 1IE5A 3TPKA 3TWCH 1ORSB 4R2GD 2A6IA 4JDTH 5F7KC 3TH2T 4WI9A 1G84A 4PG9A 2O5XL 3QHZH 3HI1A 1QQDB 5DJYB 5J89A 1HH9B 2VXVH 2ZUQC 4ZPVA 3ZSTA 4FZ8L 4HC1L 1N7ML 1S7VA 3HC3H 3MCG1 5D5ME 3B6SB 1A7PH 2XXMB 3KPLA 3BPNB 2R69H 4I3RL 3L5WB 3IXAB 1MI5A 5A2FA 1OW0A 1FNHA 1EO8L 2XZZA 1IGJA 3T1WA 4GG6A 3MV01 1IGYB 4OFIA 3U36B 5HYIA 1GIGH 3F6LA 3X12A 5K9KA 1I9RH 4KDWA 1L6XA 1G7HA 3E1F1 3G5XA 1I85A 2PNDA 4J3SA 4OF3A 4P3CL 1HHJA 1LQSR 4JFFB 1AFVL 2F74A 5JR1H 2E7HA 5FOBB 3GMMB 3LD8C 1PEWA 3IDNB 4Y4HA 5BQ7A 6CGTA 4M6MH 1S7WA 2X4PA 4H8WC 5DQ9A 3RUGE 4X6FB 2VR4A 4IRSB 2UZYB 1KLUB 3MBXH 5I19L 32C2B 3WIIH 3QJFA 4PJHB 1KB9K 3VG9C 1A9EA 2XA3A 3T65B 2NTFA 3IFPA 1YQVH 1AGFB 2OZ4L 4HFWB 3SKJL 5J57B 3GKZA 1Z5LB 5F9OL 5TE7H 4GS7C 4M6OH 5DEGB 5L8LB 7FABH 2HFFB 1X6NA 3TO4B 3O0RH 4LRNL 3W0WA 5JQHC 3SDCB 4FN0A 3PHOB 1G9NH 1TPXB 4LAJH 3S96A 4K3DH 2XNAA 4LSDA 3I50H 5I1CL 3R8QA 3CPLA 4HIIB 4NN6C 4HEPG 5CJ8A 5HHOE 3ARED 2G5BB 4CMMB 1EVTC 4HUUB 4TOYL 1T1YA 2UWEB 1X6LA 4FQXB 3WN5B 1ZT4A 1CD1A 1G1YA 2JIXB 3IJHB 3RX7A 4LBEB 1X5IA 5BMFL 4R4ND 2BSSA 4K94C 5IVXA 1PEZA 1U91A 4E5XB 2GITB 4P0DA 3ULVF 3MRMA 2FD6H 4M7LH 5E8OB 4KTEH 3HAEG 4PJBE 2AJ3A 1FN4A 4LCWE 1I9JH 3MGAA 1FP5A 2BP3A 4JZOB 2FLRT 4L4VD 4YWGL 3W39A 4NNPH 5E2TL 1RZJL 2FJFB 3ULSA 3QBTB 1EFXB 3OJVC 2QSTA 3FB6B 4YXLL 2KL6A 3GDBA 5EUKA 4FABL 4GRWE 2EYSA 5H37H 2FR4A 4NP4H 2E9WA 3GI8L 5FF6A 5E4EB 3IDJA 4ZS6D 2IFFH 4P4KC 4KWUA 2BVEA 3BIAX 5IM7B 2ADIB 3KXFA 1ZGLM 1DUZA 4YC2B 4MWFA 5JW3H 3O4LA 5F97E 4YBLB 3U4EB 4LFHG 1VGKB 2AABL 5J6GB 5LAXB 1YEKL 2DL2A 2X89D 4HV8B 4XCEA 5IVZA 4AMKH 1VEPA 4DCQB 1FGNL 1D5IH 3C9NB 5FV2A 5EOQL 1ERNA 4P46D 1PD6A 2YBRA 1OT1A 4XBEH 4TPRL 4KKCC 4LSPH 3HR5B 2F5BL 3FB7A 2P5WB 4JM2A 1LE9A 1X5GA 4NZUL 3MLUH 5IB2B 2QQNL 4BUHA 3CVHB 5GRJH 3VXSA 4AK1A 1FZJB 4ELMB 4ZTPH 3RDTB 3HMXA 4BZ2H 4O02H 4XHQA 4HIEB 2X4SA 2BNQE 1KYOK 5D1ZB 5EU3A 3SDXB 3TEUA 2I60L 1S7SA 1QFWH 4OKVA 3GMQB 5E9DD 4P2RD 5C6PB 4WW2C 4PJFE 1DBJL 1SJEA 3GMPB 1JNNL 1N5YH 3RA7H 2PW2A 1F4WH 1JTTA 3TCLA 5DJ8B 2VL5A 1OP3H 4HXBL 4U05A 3L95B 3MZGB 1OAKH 4FQLL 2W07A 4KTYA 1FORL 3BHBA 1D9KC 4MQ7A 2AK4B 2DYPD 4QHKI 4APQD 3BWUC 3QDJD 4MAYC 1CVRA 4NQVB 2VH5L 4HPYH 1UXWB 2DWDA 3HRZA 3UAJD 1HYRC 1IAOB 4IOIA 4P9ML 2AV7B 4WI5A 4KI5F 1TFHA 3HG1E 5C0BA 1T03H 3V0WL 4X0KA 1KCRH 2EDOA 4QF1B 4RMWA 2EDXA 1RZJC 4PS4H 3VG9B 2XZCL 1GGUA 2RHEA 5ESAB 5E6IC 2HMID 2F19L 4ZFFB 2WBJC 4PGBA 4UTBH 5K9JL 5J06A 1CN4A 1MCNA 4KTDL 4NYLA 3B9KD 1CIUA 2XTJC 1N0XL 3MACL 2GCYA 1B2WH 4M6AA 4E41A 2O5YH 3TT3H 2DI8A 3I6KA 1MH5A 4JFYA 3VMNA 4JZJB 3ETBF 1HI6B 5I1DB 4RMSA 4ZS7L 4HUWA 5F96L 1V7NL 1LO0H 1IGML 4JHAL 4YR6B 3QO1B 4NN6B 4XVUD 4Q9QL 1PKQE 3QPQC 4O4YL 4DGIH 2IBBA 4FZEL 4Y5VA 2XWBB 3IAPA 3LKRB 4UT7L 2YPLA 2CLRA 1JE6A 4JJ5A 4R7NA 1TNNA 4R7DA 4K23L 3TNNB 1IAII 3DV6B 3GSOA 5KW9L 3U2SB 4OZFA 2VLMD 2WW8A 4X7TA 3O2WL 2I5YH 4PV9B 4XP6L 4X6DF 3VCLB 5CJBA 4HC1H 4ZPTA 4DW2L 3G08A 3F62A 4R90L 4JANB 2F8XC 3OKKA 2Y7QB 4I3RH 2PO6A 4P5MA 4ZAKC 1UB6A 4LLUA 3RBSA 1EO8H 3BP4B 3EAKA 4DZ8B 2PTTB 3PHQA 4NQSB 1BGXL 3BISA 2FH6A 4ZUSA 1D6EA 5CCKL 4F57L 5HYQB 2CH8A 4JPIB 3QXWA 1JNLL 1S9YA 1NCBL 3WCYA 4WEMB 3PGFH 5CP7B 3MPCA 4P3CH 2R2CA 3JBG7 4PGCA 5KG9B 3KPSA 2B8OT 3FO1A 1NCAH 1OTSD 3T0WA 1AFVH 1AXSA 35C8L 2J6EA 2DQEL 2V6HA 4KHTH 3UBXI 4P4KB 3BD5A 3H42L 4G43B 4N1CA 1NBYA 1I8KA 4XWOC 3DETC 1PSKH 5A43C 2A73B 4HD9A 2A9ML 4V1DA 4OI8A 4JJHA 2H1PL 4Q6IC 4DUVA 2J1KA 3P9WB 3SKJH 5L2JB 5HPMA 3SO5A 5F9OH 4NWTH 5D2NE 2BSRB 1JPST 4OZIB 5E94A 3QCVL 1WZKA 1ETZA 5EPMA 4EQ3A 3B5HA 4XC3L 4I77L 5F88A 1A7BA 3MLRL 1WZ1L 5DD0L 4Y4KB 2BNQA 1ZANH 3GSQA 4ENEC 3G6DL 1HCVA 1L6ZA 4NPYB 4R26L 4DZBA 5I1CH 4PJFA 2EDEA 4OT1L 5IESL 5FO8A 4LKXA 5I8CA 1A4KA 3KHOA 3WUZA 3MRQB 2IAMD 2YRPA 3QZWA 5TDPA 3I9GH 3O3BA 1J86A 5T33L 3MRCB 3DX8A 1Q1JL 3ARFD 5EBWA 2WUBL 3VDAA 2UVFA 5BMFH 1NCCL 4LCYB 4MD5B 4M7KH 3TESA 4M4RA 1R3IH 3VE0A 3WDIA 2P45B 3SJVD 5DD3L 1KIQA 1DFBL 4CRPA 3OGOE 2FJHB 5FKPB 4YWGH 4QRQA 5FDWA 3TFKD 3P77B 5KSAB 25C8L 3SDDC 1I7RA 5DRZB 5C09E 5E2TH 1T89A 1A6AA 1AGEB 5SWSD 2ZP0T 4CN6A 2NX5B 3MNWA 4YXLH 4FABH 3VFTB 4Y0GA 3KYMA 4F33B 4KJWD 3GI8H 3QIUD 1FVDB 4KK5D 1MREL 3DUSB 5DRNA 4M43L 2FEEI 3OXSB 4KRLB 2VN7A 1IAMA 4OZ4A 3VFNB 1HHGB 4JRXD 3SE9H 4F7CA 4FHBD 4YDIH 5KSBF 3HB3D 5CD5C 4I1NB 4Y5YA 2HG5B 1H3PL 1HIML 2R23A 2VLKE 1G7QB 5DEFB 4NKDB 2NXYC 2J8UE 5DD1L 5BXFA 3ARXA 3MREA 3T0AA 1YEKH 3FCTA 3G04B 3ROLA 1FGNH 1BF2A 5EOQH 4AEIL 4NC2B 3HAEB 1I1AB 4NCC1 4Z7NE 4DVBA 2X1OA 5TDOA 1QRKA 1CICC 4L1DA 4HUMB 4L4JA 3SKUD 3T4YA 4TPRH 4N90E 3VFGH 5F7WC 2F5BH 3WNOA 1JUFB 4OAWB 4NZUH 3U0PA 5BW7C 3CLEL 4YFLF 2QQNH 3RIFK 3P0YL 4MA1C 2FBJL 2YPVL 2GUOB 1X9QA 3SCMC 5C9JB 3BZFA 3MRFA 1FNFA 3N1QC 2VR9A 2I60H 4HAFA 4U6YA 1OARL 4RGMC 1S9XA 4AH2B 3HE6C 1DBJH 2EIZA 3B3IA 4DGVL 1R3LB 1JNNH 4JKLA 5JXAL 1WTGT 4GQPH 5DZOA 2BHUA 5DO2C 4HXBH 2FB4L 1ZGLP 1GVIA 5DMKA 4FQLH 1FORH 4PJXA 4PB9L 1FSKB 1AQDB 4MB3A 1B6DA 4PY7A 2VH5H 4W70A 4BH7A 1CG9A 1MQKL 4XB7A 2EDRA 2R2EA 1KIPB 1P4LA 3FOLA 3KPPA 2WZPD 5F6IC 1KJVA 4P9MH 5MERA 5FK9A 2VKWA 5D2NA 4F2MA 3QI9D 1RZKL 4G6AC 3V0WH 1I7TB 3T8XA 1ZVHA 2GEEA 5D7JD 2AJYH 4RZCA 3MRHA 3MUGA 4HPOL 2IG2L 4Z7WA 4HKZA 3QG7L 3Q6FB 5KZCB 1HZHL 4ZXBC 1BJ8A 2D7OA 2EDBA 5K9JH 3T2OA 2R0ZL 3Q3GA 3H3PH 4KTDH 4TTDC 4AY0A 4EI5B 2BMKB 1FVEB 5D5MF 3TNMA 4N9OB 2BVPB 1P7KA 1WBYA 6FABL 5GZNC 1N0XH 3MACH 4OZHB 4P59H 3CXHJ 3S35L 3QUML 2APVA 4HS8L 3TM6A 4JLRA 3HZMB 4ZS7H 4L3CA 4EZMA 5L7XL 5F96H 1IGMH 4JHAH 5DUBB 4Q9QH 4LLYA 4O4YH 1FDLL 1JWMB 4DKDC 4FZEH 3QHFL 3CVIL 4LEOA 2DJUA 4UT7H 4E0RB 4K23H 1A6TA 3DX9B 5KW9H 4AM0B 3O2WH 3SDAD 4XP6H 3O3DA 1J5OL 2ZSVA 1X4YA 1QRND 3RUGF 3BN3B 4P3WA 5TE6H 1S7QB 1OT2A 5C0EB 1EBAA 4P2OD 1QPPA 3BJ91 1SBSL 4LLQB 1E28B 3SE8L 4P5KA 4HULB 1GSMA 3WIHL 3D18B 1U92B 5IJKA 3L3IB 2NY1B 1F6AB 4J3VA 5CCKH 1BQHG 4F57H 5GGVY 4L8SB 2DRUA 3O11A 1YEIH 2YD6A 2YSSB 4R6UA 4UBDD 5EOTB 4UAOC 1JNLH 3SDDB 1NCBH 1N2RB 2MSPA 2VE6B 1KN4L 1MRFL 1UB5B 35C8H 2DQEH 5I30H 2BRRL 5ACLA 1XF3A 3QEQD 4QNPE 5LGHL 3HNTL 3HNVH 1JNHB 2X4UB 2ADJA 3BGFC 3VFUB 3MRBB 4S1DC 1JFQH 3IJSA 1TZGL 3AGVA 4L8CA 2A9MH 1YUHB 1MHHA 3TZVB 2VDNL 1HILA 4H88L 4HC1A 4YAQB 5F21B 4CN4A 5F9WB 1KACB 5DK0A 1G6RL 4ZUVA 3RL1B 8CGTA 4FXGA 4HUNB 3I3DA 1FFRA 4IEFB 1ORQA 4XC3H 1F97A 3MLRH 1WZ1H 5DD0H 1NFDA 2NR6C 2BRQA 3HE7C 3G6DH 4MD0B 4PJBF 1FHGA 1RVFL 3QQ3B 1XZ0B 1NBVL 4NSKB 4S1QL 1G7IB 1MJ7L 4R26H 3VMPA 4OT1H 5E1AB 5BS0A 4YO0A 2ATPA 5EC2A 3QULA 5B4MC 5GGUA 4MA1B 1MWAB 3CFEB 3SCMB 4YEEA 3TBYA 5CIPH 2B4CL 3MRRA 4ZFGL 5JOFB 1MJ8H 5DJ2B 4M9PA 4OZGE 4P4RA 4LU5L 3SHSA 3FQWB 1OM3L 5C8JA 1T0NA 4GRWF 1Q1JH 4LK4A 3UTSB 1TIUA 2WUBH 4WIQA 4X99A 1J8HD 3RTQD 2NCMA 3QFJE 1CD8A 5C0FB 5IG7B 2OZ4A 3IS0X 1KELL 2MFNA 3WLWD 3ZT5A 4KUZL 2VISA 1TTFA 3WNKA 1DFBH 2W60A 4QY8B 1G1CA 2CD0A 3MYJB 4DWHA 25C8H 4HJJL 4OD2A 3ILPB 4Z78B 5FB8A 5L6YH 3WHXB 1IAIM 1FNLA 1VESA 2CUIA 5F6IB 1Q94A 3ET9F 3IDMB 3TYGL 1KCLA 1N26A 3QUZC 4D0DA 2A77L 1GAFL 3GNMH 1MREH 4WW2A 4M43H 4MZ2A 2ESVB 5C0DA 2R1WA 3CDYA 3PWPE 4L4TD 4WW1A 4U1LB 2HN7B 1YEJL 4PJ7B 2YWZA 2XV6B 3IS1X 5ENWB 1XH3B 1MCHA 2A6DA 1D9KA 4XCNA 3RVVD 1H3PH 2YC1B 4PBXA 4MAYA 4D2NA 5DD1H 5C86A 4H0GA 3KLHC 2QBWA 5CSGA 1F00I 3IT8D 1P7QB 4CW1A 1AKJA 5F8RC 1NCNA 4AEIH 3H9YA 1EXUB 1MQ8A 4FFVC 1A1OB 1FV1B 1UACH 2C9AA 1Y6NR 4KK8D 2DQHL 3TBWB 2HVKB 2YEZB 4Z95L 2IANB 3CCHA 4I0PC 4XVJL 1A3QA 4Q9RL 5CZXC 3CLEH 4PJAA 3P0YH 1HCFX 1BJ1J 2FBJH 2YPVH 2PYEB 1IQDB 5E6IA 2X4QB 2WBJA 3C5SA 3BP5A 1LO5A 1QR1B 3TV3L 3MCKA 1U8JA 1GPOH 2H2PC 1OARH 2AK1L 1F45A 4WTZA 3RGHA 1EEYA 2R1YB 1HQ4B 2CDGA 2FIKB 2B4CC 2X6MA 4FQ1H 4DGVH 5I15H 1R3KA 4GRLD 5JXAH 3AB0C 3SO3B 1FQ9C 2FB4H 2YD2A 2P44B 2W9LA 2EYTB 3BW9B 4NQCB 3UPAA 4ZQKB 2YA0A 4C83B 4HUKB 1SQ2N 3GMLA 5DHVA 4X4YA 1BM3L 1FC1A 1MQKH 5I16A 3AS3A 1UEYA 4KXZI 3CLFL 4H26B 1KN2L 4G3YL 2X4OA 1RZKH 2VAAB 3WLBA 2FLBT 5JHDA 2XZAL 5CHNB 4OCLC 4NC1C 5EU6D 5SWZB 5BVJA 1AR1D 5IOPB 4HPOH 4FMKA 4KQ4L 3ZSSA 5E2WL 4TUJA 3ARZA 3JTSB 1BD2E 3OX8B 4PTTB 2P5ED 3RWJA 1AO7E 2HJLA 4R2GC 3AVEA 5ADOL 1MCCA 5T1KB 6FABH 3U6RB 1MCOL 2M26A 1KIRA 3O3EB 2FEDD 2WQ8A 4OLZL 1CF8L 4D8PA 3QUMH 1LP9B 3HE7B 5IMMB 1FG2A 4R4BA 4HS8H 1JZ5A 2PETA 2K1MA 4NUJA 1IT9H 1WBZA 4IDJL 3LHPL 5L7XH 1UEMA 3QFJA 1NCUA 2IMNA 3QHFH 3TYFA 3FQNB 3KS0H 2GSGB 1DE4A 1A6VL 5BZDB 5BRZA 4Q6IA 5ESVB 4JO1H 1KCUL 3VXME 5C0IA 1CIDA 5B3NA 4MDIB 5DJXA 2Z31A 4URTB 1D5BB 2VNCA 1J5OH 2QQLL 3MZTA 2OTUA 1F4XH 4KDVA 4G8EB 4LF3A 5KN5B 2H41A 1P9MA 1SBSH 5KSVA 4UUJB 3SE8H 4ODHL 3DO7A 1A4JA 1S8DB 4L9LA 1CFQA 2DM4A 5I76A 4HEME 2G2RB 1A6WL 4MX7B 4QOKE 1ZHNB 4NM8L 4PLJD 1FO0B 1HKLL 4HS3A 5B8CA 3F7RA 1A2YA 2AEPL 3BPOC 1KN4H 5ERWB 1GJIA 5F9DC 2BRRH 4WENB 5LGHH 2ICES 3HS0B 4YDVB 4EXPX 5FUCE 3RWHB 1YNLL 5ITBH 1J05A 1SJHB 2FSEA 3NCYS 1TZGH 2GHWB 3BP6A 5I75B 4O51A 3TN0D 2VDNH 4H88H 2EDKA 5DJCB 3AREC 3DX6B 5EO1A 3ZKQD 4LDEB 1G6RH 4UOJA 3DMMD 3ZKXB 5EN2A 2EC9U 3H6JA 2DIBA 2H32B 1IFHH 3G5YA 3SOBH 3DTXB 3EJJX 4IRJD 2EEAA 3LSOA 3THML 4RA0C 3LS4H 4ACPA 1IBGH 3MNZA 1BQHB 4YHNA 3RL2B 4R4NC 1RVFH 4NCC2 1JK8A 1MJ7H 1I4FA 1QLRA 3P11L 4AQ1B 4OF5A 2P8LA 1A1MB 4MA8L 5TDNA 3U4AA 2GJ6E 4GJTB 1HXMB 3QDMB 3IXTA 1K2DB 4RBPK 1F8TL 1OAUL 2B4CH 4POZD 3MRKA 1DVFC 3LDBC 2ICEB 3CH8A 2NY7L 3GB7A 1JMXA 3CIQA 5JW5A 1OM3H 1P5VA 5H2BB 3RNKB 4ZSOE 3LKPA 2VDPH 3DRQA 3A67L 2VAJA 3UTZB 3CVHL 2BVQB 4DN3H 1R5WB 1DBML 4GKNA 1S7XA 4AZ8A 4KJPC 1KJMB 4ZS6C 1KB5H 1CICA 2LFGA 3LPWA 1KELH 5EC1B 5FM8A 1Z9MA 4IS6B 3LKQA 1QFUH 4S11A 5ID0A 2J8UF 2NY4D 1LDSA 4HS6A 5BW7A 5LWYL 1IC4H 3D85A 4PJEA 3D69A 5D2LE 1A21A 3RZWA 4X6EA 3HC0A 3V5KA 3P4LA 1XF2B 2CUHA 1FE8L 1QSFE 1M7IB 3MJ7B 3UTPE 3ELAT 4EDWH 4GXUM 3TYGH 3NVQA 5E5MB 4GKOA 2A77H 3MV8B 1WITA 3TBVA 3HE6A 1CFNB 4GRMB 4P46C 5CIPA 3MV7E 3T1FA 1GC1H 1QVOB 2B5IC 3QNZB 1EK3A 4UNUA 2HLAB 1MVUA 3QDGB 5GS2D 1H9VA 2PCPB 3N0PB 4EQ2A 4Z7UE 4U3XA 4R2GB 4YHOL 4LSTL 4LVOB 1TCMA 3KPOA 1OCWL 1O5DT 2RJMA 4YGVB 4NQED 4KJYA 3VXMA 5CBEA 2ZUTA 3MLXL 1R3JB 1FYTA 3QUXD 2DQHH 2XG5A 4JDZA 4Z95H 2AV1A 1BP3B 1T2XA 3CDCA 4JRYE 3ROOA 4NO3B 4Q9RH 4CVXA 3TO2A 1REIA 1U9KA 5GS3A 4APQC 1J87A 2V2WB 3F7VB 4ODWA 4ZXBA 4NNYA 3S36L 4HSQA 4YXKL 5EZOL 3TV3H 3UAJC 1HEZA 4RMUA 3CFBA 3H0TB 1CL7I 2AK1H 3MCLL 3PQYD 3D2UD 2ZG1A 5DK3A 4LPCA 1ZS8B 2ADFH 3O45B 3SKMA 1HQRA 5BV7L 2X4NB 1DQJA 3K8MA 5D7IA 4AEFA 4YEFA 4PJ8D 4AYFA 1OAYL 3CMOL 4ZUUB 1DLHB 3PDOB 3FT3B 4F15C 1HKFA 4L29B 5CILH 3WUWA 2F54D 2HMIC 1J10A 1BM3H 2VIRB 1QD0A 5FO7A 2AI0H 2Z8SA 2D31B 5C07E 4PRPA 5DVLA 4ZOEA 3B9KC 3CLFH 3RKDD 1KN2H 4G3YH 4F7PB 1OWRM 1OGAE 1BBDH 1BQLH 4C56E 2X4TB 5CWSA 5EZLA 2XZAH 3ZHDA 3QEHB 2IH3B 3G6JB 3DUUA 3I6LD 2DQUL 4UINL 4XVUC 2VLLB 3UJTH 4KQ4H 3IETB 2D9QB 2VC2H 3PGDA 5E2WH 2JCCE 5AUMB 3BRDA 3S34L 4MMZC 4U6VL 4XMPL 2VITB 4ZNCD 4TNWK 5C0RL 2GJ6A 4NZTL 5ADOH 1A1NA 5JDJA 5IB1A 4BZ1L 1PY4A 1MCOH 1OTUD 3V0VA 2FHFA 2DM7A 4OLZH 1CF8H 1ONQA 4KFZC 4HAGA 3SEPA 4ZSOA 5IW6B 1QG3A 4IDJH 1CXHA 2AJUL 4FTVE 3QQ4B 5FAAA 4HJGA 1EBPA 5T1MB 3V5HB 1OB1B 3UJIL 4U2ZA 1G9EA 3DURA 2WV3A 4L4VB 3BZEB 1A6VH 2HKHL 3LDBB 4NN7B 1IKFH 1V3KA 3C08L 1NJ9B 4BKLB 1KCUH 4K9EL 4NT6B 4F58L 5DUPL 4QNPF 3QNXB 4Y4FA 4ORZC 1U8HB 3QXAA 1DANU 2DMBA 2QL1A 2YRLA 2UUDK 4WV1C 2XQBL 3STLA 5FYJL 3LOWA 4PJCE 1ROWA 4DFHA 2XTLA 3GSVB 2OTWB 2RFXA 1YEEH 3MV7A 4YHZL 3T0XA 1ZHBA 3RI5F 3I02B 2B7DT 5L9DL 1A6WH 2BDNH 2MWCA 5BV7C 5CEZD 2LU7A 4LIQL 4BH8B 1JZ4A 4NM8H 3TP4A 5E03A 3VXPB 3BGMB 15C8L 1G7MA 1HKLH 4DK6A 2AEPH 4BQ6A 2KZWA 2X9XA 4WJ5A 2WINA 4LASL 3EZ8A 3NCBB 1VFMA 5IK3B 4P46B 1JF1A 1T6WA 3JWNC 1NCWL 3HPJB 3A6BL 2CR6A 5KS9E 4XBPA 2B5IB 5GGVL 2V2TB 1YNLH 4FQCL 3Q5YA 3MNVA 1OSZB 3IF1A 3STZA 1FZOB 5GGTH 5DZNA 1MCIA 5IHZA 2VLJA 1MSPA 2P8MA 1ZMYA 2IAMC 1ADQL 5I6XC 1PYWB 5C0AD 5JHLH 2MQ0A 5J8OA 4NKOA 1CGXA 3QH3B 3SKNB 1TZIA 3GUTA 3WIHA 4HUXB 2V9QA 5GZOD 2Q7YB 4ZD3L 4M61A 4P2RB 2G75B 4OFVA 4QRRD 4AENB 1RHHA 1S7TA 4QHUA 1EZVX 4PG2C 5DSCB 1EUTA 5FA4A 3P11H 4H5SB 2VABB 2YA1A 3PV6B 4GKSB 3BZ4A 4XMKH 4MA8H 2FO4A 1CE6A 4APQB 5T3XD 1UADC 1OAUH 2Y6SD 2X05A 1KTLB 2NY7H 3OG4B 4JPKL 5TQ0H 3WXWL 4XXDA 1I3UA 1VGEL 5EOCL 5F7HA 1KTDB 3FTGB 1XF4A 1HXYB 4WWKB 5FO9A 1BEYL 3A67H 3CVHH 2QKIB 4P49A 4X83A 1DBMH 2VZVA 2XWJA 3NPSC 3QXDA 4KJWC 5C07A 2PXYD 3QIUC 4KK5C 1CDUA 1G6RA 5B38A 1DQQA 2EXYD 1ZTXH 4K9EC 5JUEH 4X7SL 4LNRB 3O9WD 3AU1A 4I0PA 1BIIB 4F15B 2HVJB 4X6DB 1T22A 4Q2ZB 5KVGL 3LKNB 3VXNA 5LWYH 3OKNA 3AM8C 3HB3C 1QOKA 5CD3A 4JFFE 3VFVB 1FNAA 1SM3L 1FE8H 3TA3D 3OJ2C 4U6XA 2Q87A 1GGBL 2VDML 3RVTD 3D3VA 4LDLB 2XQYG 5JNYA 4NQDD 4PJHE 4I9WD 1F58L 4PRHD 3RWFA 2P42B 3DX7A 4YNYA 1ND0A 5IROA 1H15A 4OCYL 1A3RL 2WLYA 1DQDL 1CFSA 1V3JA 3C6LA 3VJ6B 1MLBA 1U0QA 2J5LB 1X4ZA 5BOPA 4EI6A 3F5WB 2X4RB 1NGPH 4YHOH 5BZWB 1KTRL 2JK5A 2W65B 3ULUD 2C3HA 4MJ4A 2CRMA 3MGTB 5D7LA 5I17A 2A38A 1T0MB 2OP4L 4U6HA 4OFYA 5CS7A 4Y8AA 3MLXH 5C0GB 4XPTH 4XGZB 1FFNA 4XP1L 4P99A 2OJEA 4OFKA 5DMIL 3T2QA 4HH8A 4F7MB 4NKMB 5LKNA 4JG0L 5F3BA 1MLCB 4LRIC 3V8OA 1E27A 2UWEE 2Y36L 3VFSA 3S36H 4KRMB 4YXKH 1UCBL 2WBWB 2ZUUA 4GW4B 1FPTL 4D0BB 4S1SH 1N59B 3MCLH 3UTTD 1M71A 4DKEL 4DN4H 3N85H 4JRWA 1QLFA 5J56B 4QRSB 2JJTA 4WV1B 5BV7H 3QI9C 1A5FL 1AD9B 4RGOL 3KYAA 3QYCA 2A6KA 3UYRL 1HHKA 5KVFL 4UOW1 3MOAH 3T2NL 4PGZA 3BYYA 4NO0A 2Q3ZA 1OAYH 1ZHLB 2H8PB 3CMOH 3HRPA 4L3EA 2C3VA 3WFDL 3P0VL 4ODUA 3REWA 1R3HA 1UYWL 4POUB 1YDPB 4WHTB 4G9FD 5GJTL 3PHSA 5DHYA 2VERN 4RAVB 4BQBA 4H25A 4N5UA 4NN5C 2ZCHL 1T7WA 3BQUA 2I27N 3TPUB 4U1GC 3NFPB 3D1MC 3GIZH 4U7KA 3MV11 4U1JB 4MLIA 1MY5A 1QFWI 3PWJA 2DQUH 4JFOA 1V3MA 4H20L 5GSVB 4UINH 4KZEL 5C2UB 5JO5B 2VXUL 4WTXA 3U30B 2IGFL 3N1PC 1ZLWK 5IFHH 5I6XB 5IKCA 4TRPL 5DQDH 2BVYA 3GMRA 1ORSA 1YZZA 3S34H 4LPXA 1UH4A 2KQNA 4GG8B 4U6VH 4YHYC 4LLMB 5C0RH 4NZTH 4NC0B 4ODSL 3WFBL 2AXFA 3ARFB 2DQDH 3GO1H 5GGSB 1OD7A 3RGVA 3GIVB 4JVUA 3B6SA 3FO0H 2P5WE 1MI5D 5C1MB 4CADA 3BUYB 5HHPA 4P2OC 1LVEA 2MMXA 1T21B 3B4NA 4XNZC 4WRLA 2GAZB 4ELME 4ODTH 2ARJQ 3VWKB 2EDWA 4Z5RA 3UJIH 1U8NB 3DROB 2DLIA 4V2BA 2QR0A 3E0GA 3O6LL 3SDXE 3QEGL 1GGIL 2XKNB 4WU7A 2ITCA 3C08H 1JMZA 3QQ9D 2CKBB 2I24N 4IIQA 3SDYL 5TJWK 3RX8A 4F58H 5DUPH 5SWSB 1Q9LA 4JFFA 4Y4HD 1F11A 4DQOL 4K8RD 4RRPA 3NPSB 1U2CA 1VFAB 5A16B 1EEUA 4UI2A 2XQBH 3IU3A 1UJTA 2DLGA 2AK4E 5FYJH 4IOFD 1CLCA 3C60B 2C1OB 4LSRL 4TQEL 4JO3L 4JRXB 3PG2A 4Y2DA 5AG9A 4YHZH 3T65A 5L9DH 4DKAA 1AGFA 1MHCB 4LIQH 1KG0B 3JTTB 1Z5LA 4JCMA 1DVFA 1ZHKA 5IBLD 15C8H 1TETL 3L3HB 2C3WA 5E8PB 5DEGA 4LASH 1R0AH 3W0WD 2DIAA 2FCBA 1NCWH 5D9SA 3A6BH 3UPRB 4JFPA 3IKCB 4FQCH 5FYKL 1XAUA 2V2XB 4JO4L 2PUQT 1XGYH 1ADQH 4CMMA 5KSUB 1C7SA 4P57B 2VQUA 4XRCB 2BK8A 3QCTL 4EVNA 1B6UA 3LRHA 2BC4A 1FAIL 4LSUL 2X89A 3IJHA 3RVWD 1MJUL 3MODL 4QRUA 3RTQC 3KPQA 3NIDE 4X9BA 2QADD 1TTGA 1YYLL 5DVKA 1ES0B 3EYFB 3FO2B 2E3VA 4IRZL 2FGWL 3WEXA 1VPOL 3WLWC 4AIXA 5D2LF 4L1HA 4MVBD 3UO1L 3L3OB 3WHE1 4KZDL 1UWEL 2OR8A 4KC3B 9CGTA 5B22A 1U95A 3AMLA 1P5UA 3MLSL 3GBNL 1QA9B 3MYZA 3PGCB 4JPKH 3WXWH 2FJFA 1VGEH 4J1UB 5EOCH 1C1EL 1EFXA 2ORBL 3ES6A 1BEYH 4HWEH 4LP4A 4TVPD 1OSPL 4HLZG 4DVRL 1CFVL 3QI9B 3WD5L 3S88L 2R15A 1C16A 4DTGL 3D5OF 5CKGA 3KG5A 5D7JB 5EIIA 1P6AB 3F7YA 1Z9SA 4X7SH 5KVMC 5GHWL 1FAKT 3KXFD 2OR9H 4Z7UF 2LTQC 2H26B 3O4LD 5KVGH 3BWAA 3HI6L 1NH6A 4KROD 1CWVA 1HSAB 2DYPA 3UTOA 4O9HL 1RZ8B 3VWJB 2JJUA 3UBXG 1SM3H 4M4PA 2NW3B 1L9NA 2MJWA 2JB6B 4YQXL 3CFJA 3PWUB 4PP2B 4CGTA 4NOBA 1GGBH 2EDQA 2VDMH 4BM7A 1ODAA 1YEHL 5GISH 5F7DB 5ACZB 1F58H 4JM2D 4KK8C 3IDIB 4OCYH 5A2LH 2B1HL 1A3RH 3S7GA 2B20A 5C08A 1ZLUH 1DQDH 3VXSD 5J0BA 4OZIE 1RUKL 1VKXA 2IJ0C 1BLNB 1FZJA 3O41B 4ELMA 1W8NA 3D0VA 3JZ7A 4G7VL 3DSNA 4XAWL 5L0QC 1FVCA 2R4RL 4I3SL 5HVGB 5AD0A 5GS1C 3BEVA 1PX3A 1BQUA 2QSVA 2VN4A 3MRPA 3O6MH 1S7RB 5D1ZA 2H9GB 1YJDL 3NIFE 3MLTA 3SDAB 5J3HD 2GSIA 1QRNB 2OP4H 4NRYB 3B9KA 2NYYC 3GMQA 1EHLL 1WISA 4QO1A 4P2OB 1WQVT 3LN5B 2XPGA 2I9LA 4WO4A 4LPWA 2UYLB 4HK3N 4GRLC 4XP1H 5GIRB 1XF1A 3GM8A 1HSBA 3L95A 5DMIH 4RFEB 4OLVL 4MJ2A 3X11A 3V5DA 5FECA 4XPGL 1T7YA 1X5AA 4NQVA 3D0LB 3QNYB 2IBZX 5HYSA 1G7JB 4G7YL 2ZOKB 1UCBH 5E95B 3KLDA 4G8FA 1FPTH 1MFNA 5E2VL 5JZ7D 4NZJA 3VH8A 3CX2A 1ZGLA 1OGTB 4DKEH 5C0BD 8FABB 2AV7A 4HZAA 2DI7A 2BCKA 2VMFA 3QEQB 4Q9BA 1KJ2B 1A5FH 3UYRH 5KVFH 4J3UA 2EYRB 3T2NH 4DJMA 1ZLVK 2JCCF 1AR1C 4NWUL 2P7TA 1Z9LA 4P9HL 2BY1A 3OMZA 4Y1AB 5IV2B 1UYWH 3WO4B 4F37K 2NX5E 2F53B 3RU8L 2AXJA 2CRYA 2XN9A 5GJTH 2Z8RA 2YD5A 5FYLL 1KLGA 3G9AB 4PB0L 5DYOA 5E8NA 43C9A 2ZCHH 2MPAL 1QZ1A 1UVQA 1VA9A 4O00A 4O58L 2FEDC 2OI9C 5I1DA 1FO0L 1XGTA 3X13B 1WCBA 5DVNA 2IH1A 1XF5B 2JLLA 4H20H 4KZEH 2VXUH 5CJXC 4LLAA 4BFBD 2IGFH 3JXAA 3PABB 4KMQA 3IDXL 4G8IA 2XY2A 3WIFA 4TRPH 4OIAA 1IAKB 4LPYA 1ZA6B 3V4VL 1NBZB 3WFBH 3NCMA 1GZPA 1J8HB 4PJCF 3RWCB 2PO6D 4JANA 2RB8A 2LVEA 4Y19B 3FB5B 4PUBL 3O3UN 3VD7A 2Q8AL 4J4PA 1LNUB 1YJDC 3GSXB 4R0LC 3BO8A 5GGRA 1HOCB 1F3JA 2F9BT 5C7XH 1UGNA 3FHAA 3GSNB 3RY6A 3RZCA 2AJZA 3O6LH 5HYQA 1B0GB 1BZ7A 3QEGH 1GGIH 3TBSA 2IAMA 1S9VB 3KPMB 5CP7A 3KPSD 4PLJC 4ZOAA 5HGHB 5JOPE 2DMCA 3IYLW 4KUCF 4G8GA 1TQCB 4TUOB 3O2VH 4DQOH 2NQCA 2AKRB 3CUPA 2VSDA 4G43A 2VQ1B 4XTRD 3DSFL 1MAML 3BXNB 4PG2A 4MQTB 4L4TB 3PUCA 4LSRH 4TQEH 4JO3H 5BJTB 2LTQB 4ZUWB 4XZUB 5I0ZA 3I75B 4GKZB 5JIHA 1NC4A 1IGCL 3U48A 1IZJA 4PLOB 4FFYL 1LEGA 1T04A 3SJVA 2UUDH 3QEUB 4LLDB 4WUUB 3ZT7A 5ADPL 2D7QA 1Q9WA 3N1GC 1CFBA 1U58A 1G9MC 5J11C 1L4IA 1LK3L 1TETH 3KJ4B 3WE6B 1A7NL 4QXTB 3KS0J 2V7NA 4C59B 3LB6D 3MLWH 3VI3E 1T6VN 2BNQD 3BT2L 4P9HC 1X5FA 4IRJC 4Y4KA 3FFDA 3RIFF 4HK0A 4RNRB 5MENA 1XMWA 2EKSB 1T20B 5HHVL 4C4KT 3QIUA 1PKOA 3OXRB 4OCMC 5INDA 5HGDA 4BFGA 5FYKH 4MNHA 4JO4H 3MRQA 5JORA 1F3DJ 3PWNB 1H3WM 1AGBB 5L0QB 5I1EH 5GS1B 5ISZB 1FZMA 1I9IL 3AM8A 5LXGL 2Z35B 3GSUA 3QCTH 4OZHE 3QFDA 4PRDA 2ICWA 1FAIH 1J1PL 1SY6L 1T1XA 1EGJL 3VRJB 1C5CL 3MODH 4XPBL 4Z7QE 5E99H 2WIIA