1S7UB

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 13
structure length 99
sequence length 99
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7uB00
4OCRL 3O0RH 2JK5A 4KRNA 4P57A 5B4MD 2J8HA 1RI8A 1ZV5A 4CVZB 3NFPB 3MLWL 1G9NC 2ESVE 4I18B 3QA3B 3AS0A 4WW2C 2GW5A 1Q0YH 1NGYB 3VFNB 3DRTB 1LO4L 5D6DA 1FBIH 3VFRB 4HJJH 5HVWA 5GHWL 4WFGD 5CP3H 1QFHA 4X4XB 4HUVB 1A22B 1S7UA 2A1WL 3ARSA 3H3PH 1KOAA 1ORSA 4PGDA 2VE6A 4WI2A 4FMFA 3DHMA 1GGUA 4PGJA 4ZXBB 2AK4A 1XF1A 3C6SA 1RU9L 4GOSA 3VWKC 5IMKA 4X99A 3QJHB 3QCTL 5GGTL 1JV5B 4BFEA 3GNMH 1Y18B 4NYLB 4KKCD 4B50A 3NBNA 4CU8A 3EOYG 2DI7A 2H3NB 2H9GB 5E8NB 3PJSB 1XH3B 1MRCL 3PDDA 2PR4L 2BSRA 3OJDA 1XR8B 4KJWD 5TDPA 1I8MB 1CD1A 4XVTL 1V3JA 4NN6B 4NQUA 2CRIA 1Z3GH 4D3CL 4PRNA 1CZ8L 3BQUD 2VQTA 3V4PH 5I75B 1GGIH 4PJBA 1MHEA 5IP4A 2AXGA 4A6YL 3MJ9H 3GJFA 3O9WA 4OBRA 2FX9H 2V5SA 4OJFL 5A2JH 3V4VH 5GJSH 5IHUH 4S1SL 1G6RL 2X4TB 1CFNA 5JQHC 5JORB 5AYQA 5H37G 2VZ1A 5D9SA 4KRPD 3FT3B 5SWZE 5FF6A 3ULUL 1R0AL 2I60L 1I4FB 4R2GC 3NOIA 3LKOB 1A0QH 5EU5A 1CE6A 2D03L 5L88H 1S7VA 5GZOD 2VDOH 2CDFB 1A3QA 2B0SH 4OGAC 4KUZL 1WEJH 2GT9B 2Y9RT 2ZOLA 4PJXA 4QRRE 3VCLA 5ADPL 3U30C 4JZOA 2CLRA 3CIQA 4JHAL 3LQAH 5I1LA 4YO0B 3QH3A 5EIQA 4W4OC 3BRDA 1OTSD 3TV3L 1NCTA 2K3TA 4UUJB 2OZ4A 4M3JA 5FECA 5D72H 4P99A 2R1XB 1KIRA 2B20A 3TNNB 4Z6AT 2GSGA 2IH1A 4RIRB 1Q1JH 5DK2B 3QJFA 3I75B 5B8CC 2DWEA 1FL3B 2VC2H 5ANMA 4TQEH 3ULUD 2NR6D 1NBYB 2RIKA 2DS4A 2JE8A 1NL0H 1Q72L 3G6JB 3SCMA 5JUEH 4G5ZL 4P0DA 5ANME 2VXUL 4IRSB 1U8JA 5DSCB 1J9CT 3Q0HA 2XWTA 4OF0A 2V6HA 4YNYA 1UZ6F 2PTTA 1ORQB 5GIRB 3INUL 4KI1A 4PJXE 4ZXBC 4AYFA 2XZCL 3HPJB 3QQ4A 1FYTE 4M93B 1OM3L 5EOQH 1X5YA 2J3SA 3BH8B 2DQIL 1EERB 5DUPL 3S36L 2P5WA 4WI5A 3U0WH 3E2HB 4LVOC 3TH2T 2HLFC 1K2DB 1I1RA 3RP1A 3ARZA 3ZKXC 4HWBH 3B9KA 4X9BA 3CC5A 2P47B 4P5MB 4UT7H 1MY5A 1J8HD 5I8CA 3SGJC 4Z95L 1M4KA 3VXRD 4PIRF 3WFCL 5E8OA 4MA3B 2VDNH 3NFNB 3T0VA 5IFHH 1DLHB 5E8DL 2VL4A 1LO4H 3FQNB 2AJ3B 1M71A 4GS7B 3H9HB 3P4NB 4XCCL 3MRQA 1U95A 4UU9A 1NEZA 4GKZA 3LIZH 5HYSA 5GS1C 4OGZA 3T65B 2GSIA 1R5IB 4MNGE 2C1OA 5DI8A 4PLNC 4LK4A 3DNKA 3DX6B 4QYOB 4YQXH 3ZDZF 3T77B 4LCUB 4CMMB 3GSQB 4M6ML 1MAKA 2HMID 1DANT 2QSTA 2OTUB 3C6LA 5FCSH 5EIIA 4WFEE 3SDCC 4KJQD 1GYAA 3UPCA 1BJMA 4UNVA 4J3UA 2ENYA 5KVMC 5SWZB 4WY7L 1U0QA 3EJYC 5EIVA 4WWKC 5F70A 2YPVH 2J6EA 2DBLL 3PGFL 4JE4B 4GJTB 3W39B 3VFSA 2FX8L 3R8BB 4Y2DD 2NW2A 5C71A 2VLJB 4HK3N 4XNZB 3NACL 2O93L 3P77A 1BVZA 2WBJB 2F54E 1XR9B 3RUGB 3GBNH 2W07A 1WZLA 3IJSB 3TCLB 4AMKL 4JFXA 4XX1G 3ZSSA 1SMAA 4MZ3A 3BWAA 3VW3H 1I3GH 3CDYA 1B6UA 3B4NA 4XMKH 1DQQA 3EDKA 2DL2A 1J0YA 3SDAA 1HH9B 1S7SB 4J4PA 1NUFA 2EKJA 2APXA 2ITCB 4Y88A 3U0PA 1OGTB 4JRYD 4WTZG 5LGHH 2BVPA 3O8XC 3K3QA 4MNQD 1MPAH 4LMQE 1Q9KA 1B2WH 4GRLB 3OAYH 2R1WB 5JIHA 1SJEA 1FNSH 4KK8C 1D5IH 3LDBB 4O2FA 1JHTB 4X7FC 3OBAA 1OT2A 4UT9L 1DQJB 4YK4C 4MD4B 1RVFH 1DL7L 3QUKA 3ZTJG 3UAJD 1U93B 4HPYL 2AAVA 3BT2H 1AR1D 3WLWC 3CDGB 4LBEA 2DQJH 3BPOB 1DN2A 3R06B 3BIBX 2JB5H 2PO6A 2VC2L 5JNYA 4HFUL 5E2VL 3OKOA 1V5JA 3JTTB 1HH6B 3L9RA 3EDJA 1J05A 1CFTB 1QHOA 4MSWB 3Q6GL 3V52L 4E0RA 3G5XB 4MB4A 5HPMB 2RBLA 3HC4H 2ED9A 1WWCA 1KXQE 1DBMH 4R0LA 4HUKB 2EDEA 4OAWB 4JFDD 4PD4J 2AGJH 3DVNB 4TSCL 1Q0YL 1XF2B 3UZQA 1KN4H 1S5HB 4XX1E 3U0WL 3ARDD 5ICZA 1I7TB 4GW5B 4N0UB 4PJ8B 5C08E 3IF1A 5ESAA 5LGJA 1L6XA 5KSBB 4HJGB 5TE7H 5KTEL 3QWQB 3FT2A 5I2IA 4YHLL 1A6AA 1DBBL 2YZ1A 3ZYZA 2XACC 4JCMA 5J1TC 3UJJL 3QG6B 3L5JA 4OF5A 1EJ6A 4LLMB 4MQXD 5DMKB 1CLZL 4MDIA 4F7CA 3MV7E 1TQCC 3JV4A 1Q9LA 1MCSA 4NJAL 2E9IA 1WICA 4JRWA 3RL2A 1T21A 3FCTB 4IDLA 5SWQA 5IW1B 5IB3B 1FO0L 5D1XA 3VJ6A 3Q5OA 4U1NA 4ZPTA 1CZ8H 1K4DB 2ED8A 4GH7B 1D5MA 4ZFGL 3MROA 3DIFA 3BKJL 1JP5A 5AWNH 4X4ZA 4DEPB 4ETYA 2EDKA 1ZGLM 5BRZB 4J12A 2VLJE 4Y5YB 5AWNL 1CWVA 4K3JL 2EZ0C 3PHOA 4FQLL 2FJFA 2I07B 4JPIA 4GRWH 5D1ZA 4U1IA 4XVJH 4PJ8C 2X6MA 1A6VL 2VH5L 3E1F1 4N8VA 4TVPH 1KPVA 4K9EL 4PJ5E 5F89A 2NY4C 1N3NB 5IVXA 2FX8H 2D7TL 2OR9L 2IANB 2QR0A 4KJYB 3SE8H 5JA8B 2IADA 4M93C 2EC9U 4DKAA 1GOHA 4WWKA 2NXYB 5FUZL 2PUQT 2YD4A 1G7IB 1I3GL 3KYMB 1SM3H 2APVA 1WFUA 4OV6F 4UNTA 3EGSB 4BSJA 4PG9B 1RAMA 1G7QA 1PLGH 2DQIH 4KTDL 1VGKA 1F4WH 4NDMA 3GHBH 4MS8D 5IM7B 2EEDA 5FYLL 4F7MB 1IC7H 4NZTL 3AFLA 4H88H 2MHAB 2N56A 2APBA 3FN3A 4OD2A 1MREH 4D8PA 1PDKA 5DO2C 1HOCB 1WAAF 4XT1C 2P8MA 5KSAC 3KAAA 1ZTXH 5T1MB 4R4ND 1YNLH 3IDUA 2DKUA 4EJ1C 3TO4C 5EU6B 3TJHD 1MCHA 2NMSA 2FB4L 3RKDC 2Z93B 4JO4L 1BVKA 4PY7B 4H5SB 3WSQH 1ZWIB 2NXYC 2V2XA 3UX9B 3QUXB 4X6DF 2EIEA 1AJ7H 1TZHB 2NNAA 4HZAA 3VXSB 3G6DL 4JKPL 5FKAA 4XCNA 1UB6A 3BZFB 4ZFOA 1V7MH 3DUHA 3QAZC 4Y2DB 5B39B 4O00A 4WI6A 5C07E 2VLRE 1H3TA 2VDNL 4C83A 1CDCA 1K8DB 3QQ9D 4CVXA 1OY3B 5ADOH 3Q1SL 3BJLA 5I30L 2R1YB 1CYGA 3SQOH 2D0HA 4OF8A 1HHGB 3OR6B 2RR3A 3R8QA 4NGHL 1NDMA 1N0LA 3KPSA 4WEBH 1LK2B 4MAYB 2DI8A 1YYLH 3PWVB 2BK8A 3BZEA 1TZGL 4AL8H 1PQZA 1WUNT 5C09D 1RURL 3TZVC 4G9DA 1FYTA 3HZKB 1RURH 2JK5B 4P57B 4QRPB 1II4E 5IBUG 2VLKA 4DVBA 4HIIB 4JZNB 5TQ0L 3RRQA 4HUUB 3T4YA 5I1IL 5TQ0H 3SPVA 4LCWB 3OKYA 2EDJA 4LARL 4UIKL 1ZMYA 2ARWA 2UZYB 4R7DA 1C7TA 1T2QL 3DI3B 1HZHH 3TBYB 5BMFL 2ESVD 4CRPA 2IQAA 2VE6B 2BNQE 2IFGA 2XFXB 4YEEA 3TVMB 4RGND 1BECA 3RFZC 1AH1A 4O4YL 4UT6L 1P7QD 2IPTL 1GVIA 3QDAA 3VH8B 3HI6H 3V8CA 3KWWA 3LS5H 4UILL 2QV2A 3CU1A 2E9WA 2CDEB 3OKEB 5JHDD 4G8IA 5SX4H 1KCRL 2JELL 4KAQL 3OG6B 5CJQH 5IKCA 1VCAA 1TQBB 4MCZB 3DPBA 4K9EC 3ARXA 5IFAL 1ADQA 4NQTA 3FMGH 4HKZA 4WVRA 4X80L 1OW0A 1UH3A 4OCYL 3TO2B 4XVSL 2R23B 4WFHE 3RZCB 4PBWD 3LKRB 3FQWA 1XZ0B 2V7NA 4QKXB 3VMPA 5B8CB 1GOFA 3FT3A 3WE6A 4WENB 2FGWH 1EHAA 1T2XA 4U05A 1F4YH 4OB5L 5B39G 1JYVA 2WLZA 3ECBB 2P49B 4X6EB 4DUVA 1UKSA 3U36B 2BVQB 3LAFA 4RMRA 5ITFA 3JWOL 1FL6B 1NBZA 4L29B 1U8HA 1FZJA 2QQKL 4X7TA 2LTQC 1L0XA 4MCYB 1J0KA 5DEFA 3BHBB 3M45A 5AUMA 4ONGH 1FLRH 1KB5L 5CIPH 3WO3B 1FO0H 5LCVL 4E41D 3U7WH 2EXWD 3VXSD 1KN4L 3SDDC 1G6RH 2A6KA 3QDJB 4GXVH 5FHBH 3TA3B 5FOBB 3BVNB 1KIRB 4Q9RL 1MSPA 2AABH 4PJCB 1IC4L 1HDMA 4RIRA 4XNUL 4P5TC 1HSAB 2AKRA 3IU3B 4K7FB 2AABL 5FYKD 4I4WA 1LEKB 3UPAA 5EC1B 5C3TA 5ANMB 3V79C 3QXVA 4HAGA 3FO0L 4KFZC 1NBYA 2ZUQB 4OZIA 5IJKA 4NKIL 2F5AH 3I3DA 2IBZX 4M4RA 2XQBL 4XMPL 4M7KH 2ED7A 2NXYD 4U6TA 5DVLA 3WHXB 4Y4HD 4KY1L 4NO2B 3LN9A 3I9GH 4HV8A 3H0TA 1QA9A 3MCG1 3ULVC 2FIKA 3ZYIA 3MGTB 4X5WA 4XPTL 4S1QL 4HKJA 4P5KB 4Z0BL 5IMLB 2FL5B 1LDPH 3DVGA 1OGAB 3DTXA 5TJWK 3QNZA 2YA1A 1FNGB 1ZLWK 1BOYA 2X1WL 4HPOH 5TH2A 5CD3A 3P9WB 1QP1A 3MODH 1BBJB 3OHXB 2BNQB 5TE6H 5EU3B 4R97C 4XC3H 2ZG1A 4K7PX 2HG5B 5CGTA 1TLKA 5DJ6B 1HXYB 3BSZL 4KQ3L 2OR9H 5EU6D 5FK9B 1SEQL 4PJBE 3AREA 4LLQA 1FGVL 4QHKJ 3QFDA 7CGTA 3I3EA 3QWRA 4XPHH 4BZ1L 4EXPX 3E8UL 4LVOB 3HTLX 5C92A 5DJXA 1A14L 1TVBA 2GSIB 3U2SA 5HHOD 3ZT7A 2DYPB 3QIBB 1BZ7B 3TP4A 5IVZA 1YEEL 4XHJC 2VABA 5FO8A 3ARGA 3SKMA 4KHTL 5DS8B 4F7TA 1FVEA 4F37K 4ZTPL 3M17A 4PR5A 3N9GH 4OCRH 2PKDA 4UINL 2JCCB 4Z8FL 1EGJH 4LNRA 4X6FA 2ADIB 3MLXL 5DUMH 2B39A 1DQDL 5F3HA 1NFDB 4MD5A 4NUJB 1CTOA 3PDOA 4LLYB 4RBPH 2EC8A 4B41A 4LDOB 4PYHA 2Y36H 4NHUA 5C0AD 1D5XA 4MJ6B 4NC1E 3QDMD 1GGTA 5KAQG 1G84A 2B7DT 3QWOB 3D0LA 1MHPL 2F8OA 4GAJH 1J88A 4OCMC 3UJIH 2OJZH 1VADA 1ZHNB 4J1UB 3F7QA 3QIWB 3G5YA 3NA4A 2LVEA 3BGMB 2BVPB 1JRHH 1T1WA 3HR5B 1IVLA 4IMKC 3RIFF 5CAYB 4NRZB 3UZVB 1L9NA 3RTQA 3B9AA 2AGJL 5E8PB 2YOCA 3BPCB 4QGTA 5IVXE 5JQ6H 4XRCB 4LVNB 4EIGB 5E5UB 3HUJB 4U1LA 2WV3A 3RUGE 3MOBH 3BN9C 3E6HA 2ARJA 4MD4A 1KTDA 5FO9A 3QEGH 4BQCA 1DP0A 2D9CA 1T2QH 2FJGB 1G0YR 1YMHB 3BYTA 1OQXA 2BOCA 3BUYB 3G04B 4FXLA 3MX0A 2YEZB 3DX7A 4LFHG 3VGAB 4LASL 1OW0C 32C2B 4FQXD 5TDOB 2MFNA 2CRMA 4Y5XB 3U48A 5HPMA 2NR6C 5BS0D 3GMPA 1XF3B 2A9NH 4HG4K 1LO5A 2P8LA 1JFQH 1RMFH 2NYYC 2ICWB 2VDMH 3NGBC 5IG7A 4KK6C 4R4FH 2A74B 4YDVB 4TVPE 4R0LB 1I8LA 3JSSA 5DHVB 4R4FL 4BK5A 3MRPA 1NGQL 5CINL 4WO4D 5DHYB 3AS2A 3MRJB 2CO6B 2P5WD 3S37L 5GHWH 4BELD 4S1DC 4FQLH 1YEHH 3IF1B 4P2OA 1C5CL 4RRPA 3GRWA 1GOGA 1X5KA 2BY0A 1DBJL 1A9EB 3LY6A 1EIBA 1U8LA 5DK3A 4QRRD 3MRBB 3HZMB 3EAKA 3GEWB 1MI5D 3PNWA 5CCKL 2HJFB 3CFJB 4IIQC 4X6DE 3CFDA 1NSNL 4PGCA 4BZ2H 1RQ5A 2AQ1A 5EDXA 4P23C 4RMWA 5HGHA 4GBXA 4L9LA 2JCCE 5GRZA 4BZ1H 4ZOEA 3TNMA 5SWZD 3H3PL 4IS6A 3FOMB 1P53A 3MR9B 4CN6A 4PJFF 3CZFB 5GZOC 1INDH 1IFHL 5HHVL 4XP5L 4O5LH 1S7WB 1C1EH 1WBXB 5DUPH 1E0OB 3WEXB 1JNNL 1NLBH 3A6OA 1TZIB 1HQRA 2BSSA 1HWGB 2XICA 4Z18A 2IPUG 2IC2A 4LIQH 4Y19B 4N68A 3VXUD 4PRPB 1J5OH 1QLFB 2BSED 3PL6B 4J3XA 4YUEL 3G6DH 2X4TA 3D18B 4TPRH 1KB9K 5FO7A 4D2NA 4L9DA 5F71A 3DLQR 2XKNB 1AI1H 1DN0B 2P42B 1UGNA 4Q6YA 4RZCB 3RIAK 5JZ7D 3I6GB 5DHVH 5ICYA 2ITDA 4M9PA 4LFHD 1QSEB 1X6NA 3DXAE 4AJ0A 3QDHA 5I75C 3UTTD 3RDTA 3DVIA 2JJVA 3V5DB 2R29L 1MFCH 2AEPL 4PLJC 4CMHB 5EUOF 4PJXB 5LGKA 1NGPH 5E5RB 1WWBX 1N2RB 4GRLD 1F3JA 5I8KH 1WVZA 2Q86B 5EUOA 2QADC 4PJ5B 2CKNA 1D6VL 3RTQD 5HDOA 4F8TA 3EIFA 2R0KL 4MGXA 3M8OH 1OCWH 4HWEH 3GMMB 4Z7VA 4WO4A 4LHUG 5J57B 5IB5B 3ILPA 5C2BH 2EH8H 3I85A 1OQOA 5D4QA 2VN4A 1FNAA 4X8XA 4HS8H 3TIDA 2XYCA 4PUBL 1A4JB 3ISWA 3FO9B 5CGYD 4WTXA 2QHRH 2XT1B 3ORJA 5GRUH 2DIBA 4O2EA 3VW3L 2V2XB 5DSCA 3CFKA 1CGTA 1CGXA 2PYFA 3EDEA 1BOGB 3I3BA 4OCWH 4H88L 4ODXA 2GTZB 5KN5B 4FZ8H 3K8MA 3HI6L 4JDZA 3BP4B 3LCYA 3EOTL 4U1KA 1W0WB 3CDFA 3UMTA 2P5WB 3H7BB 4R9HA 1D5ZB 1K2DA 4LCYA 3GM8A 1I7UA 2GY7B 1K8IA 4EVNA 3KPQA 4KVNH 3U0TB 1YNLL 4KK9D 3DURB 4XMLH 5IESH 1X5JA 4JM2F 4NWUL 4C58B 5C07D 2AJUL 4OBSA 4OI9A 1BJ1J 1MVFA 4NBZB 4QY8B 2ADGB 3BRGC 3NN8B 4X6DA 5GZNC 1DCLA 1T5XA 3N1PC 4LRNL 4G9DB 2AJ3A 2FR4A 1WFNA 2R39A 5FUCE 1LO0L 5IUSA 5SV3A 5HHQA 1OAYH 3IDIA 4BQ6A 1CU4H 2Q7NA 1KJ2B 2Z35A 5HYSB 1I8KB 1UCTA 4NQCA 2Z91A 2C1OB 5EZJB 1NC2A 4BZ2L 4PJXF 4QYOA 4HUUA 5GS0D 3O41B 3S5LA 1DBML 4PS4L 1LNUA 3IB4A 4LSQL 4JHWL 5BVJB 4HHAB 1E6OH 3NCJL 2EDLA 4CVUA 4FHBD 4YBLB 5LCVH 1NGYA 3VFNA 4M6NH 5EC2B 4JZJB 5J89A 4HX1A 3WFHA 5IB4B 4M6MH 3QT2A 4NHCH 3LQZB 4RNRA 4XCEB 1BJ1H 1RIVL 1CDGA 1IC4H 1XGQB 3V6OE 3VFVA 5CEZL 3OKEA 1MAJA 2ATPA 2YPVL 4BFBD 4PJGA 1FZOB 4JM4L 1GGCL 4LCWE 5DGQA 3C09B 2W60A 3KXFD 3BWAB 1CN4A 4XVUC 2J6EL 4RFNC 3BESR 2RAMA 2G2RA 3L7FA 4JY5L 1MELA 3ARDA 2FSEB 4WWKD 3WO4B 4M1DH 1XR8A 3TO2A 3ZHKA 3PL6C 3EJZC 3ARGC 4MQSB 4GAGL 1I1AB 5GSRA 7FABH 4NSKB 5C9KA 2BVTA 2Y7QB 4WGWB 2G5BA 1A7OH 3WNNA 2R56L 4QHMB 5L2JA 5K9OB 5HHMD 5CBAB 4RMVA 5DHXB 2HVKB 3PWUB 3O6FA 3ECBA 2R56H 4GBXD 4HGKC 4FQXC 1OLZA 3NA9L 4KXZI 4I48A 1O5DT 4PRIB 5BV7H 2BVQA 3IDXL 4K71C 3C08H 3O6LL 5CILL 1NBZB 5ID0B 4NQVB 5HJ3B 2E27L 5LBSL 1KF9B 3AUVA 4L8CA 3X17A 1T20A 2M2DA 2CLRB 4JM2D 3FRUA 4JG1L 4X4MA 4LAQL 3HMXA 1WT5C 3S36H 1AHWA 4LLDB 3LV3B 4HPOL 3JWNC 4FQQA 4XTRC 1A14H 3VFWB 3VXUB 1RUQH 4R97B 1KC5L 4AEHL 1NJ9B 1F11B 5CUSL 1XF2A 3KPRE 5GGSA 1YQVL 1EGJA 2H8PB 3KPOA 5DC0A 3SE4C 2J88L 2DWEB 1P4IH 1FL3A 2Q6WB 2V2WB 3WHXA 1EUUA 3TC9A 1KCVH 2V5MA 2Y06H 2DLHA 2P4AB 1QO3B 5F1IA 1PBYA 3RGVC 4ERSH 2MKWA 3OTTA 1QUNA 5J1SC 2VITA 3BPNB 2Y06L 1VACA 3JV4B 5K9KA 5T5FL 2BNUB 1FFRA 4E5XB 3MJ9A 3P0VL 4ZS7H 3NABH 1G7PA 5H2BA 4N90D 4XNUH 1JYXA 4AK1A 3WSQL 1MHHA 3TZVD 1QFWM 4PRDB 1T04B 4KV5F 5TH2B 5C0IA 1AD9A 1HHHA 2YN5A 3L1OH 4KK6D 5KJRH 5AD0B 2R4SH 4ODVH 1BBJA 5KG9B 5EA0L 3WD5H 4LHQB 4IOIA 4E42A 5KJRL 2UUDH 4JKPH 5EN2A 1D6VH 3KJ4B 1J5OL 3U1SL 2CUMA 2G9HB 2NY1B 1NAMB 3FFCB 3AS3A 3QNXA 3GBML 5GPRA 5B3JE 5DJDA 3SDDB 2WUBL 3W2DL 4KKNA 3W11D 1GJIA 3GBMH 1S9WA 1IGJA 2HLAB 3LEVH 1OGAE 4HXBH 1SBSL 4JRYA 4QRSB 4U2ZA 1CXLA 5DQDL 3RHWF 2FLRT 1MJ7H 4O58H 1P7QA 5AAMA 4ZUVB 1SJHB 5CZVL 4M5ZH 5IVZB 4C56A 4L3ED 2VNCA 2VABB 1CDBA 3D3VD 3QULB 1GPOL 5CZVH 1TCRA 1R5IA 1NANI 1KEML 4NQSA 1RY7B 2AJZB 3DMMD 4LSTL 3SDDD 4WWKB 4EN3B 5D1QA 4XNQA 1PZ5A 3TO4D 5IVNA 1KLUA 4RGMC 4O2CB 2VL5A 1I3RB 2HT3C 3QAZB 4X9FA 5DVMA 4WHTA 1ONQA 1NFDA 5F3BA 1LP9E 5E6ID 2DTML 4X5XB 5JW4Q 3NCYS 3DRQA 4PRIE 1RVFL 3FAWA 4PD4K 2AV1B 1L7IL 1NKRA 4HPYH 3RWCA 3U46B 2AQ2A 2VLJA 4NRXB 4Y4KD 5CLWA 5D71H 3QI9C 1T83A 1A2YB 1VDGA 5F7DB 5JHLL 3GJFK 1L7TH 3DETC 5IW6B 4KRMB 3HI5L 4XWGH 4ZDHA 5DMGC 3VRJA 3BGMA 1B0WA 3GGWB 5E08H 5FM8A 1JK8A 3P73A 3GO1H 2P48B 1GH7A 4KUCF 4NOBA 4FQ1H 1BQSA 3QUZA 3U0PB 1DUZB 1OGTA 5I74B 3MUY1 2E27H 4N5ED 5L7XH 1G1YA 4ALAH 3L7EA 5D93C 4Z76B 1TIUA 4KK5C 2HKFH 5MHSE 4X7SL 4OQTL 3EYUH 3JWDH 4XCNB 3ALXA 4O2FB 4G9FD 3DSFL 4AIOA 5KVEH 3MRCA 2HFFB 2DN7A 3MRFB 1IGYA 3BKMH 2G60H 1RZFL 3HC0A 4R2GB 1U93A 4XP6L 1KPRB 2VLKD 5E99L 5EUOE 1LO0H 3MNVA 2PR4H 4P2QB 5TDOA 3VG0H 3R06A 1NDMB 1RK0B 4P3CH 1CT8A 5D2NE 2Z4QA 1QSFB 3JBG7 4HIHB 1NCUA 4K3GA 3Q1SH 3FZUD 4P3CL 1NMBH 4UMGA 1PQZB 4YXKL 3TVMD 1FYTB 2MQ0A 5IWLA 1AIFB 5JLZB 2J6EH 1X5XA 1P7KB 2CIKA 3JTSB 5GJSL 4ZUTA 5DZLA 4Z78A 3CNKA 1FJ1B 3PABB 2VLKB 4U6YA 3MLSL 3PHSA 3GMQA 2Z92B 3T1FB 4MA1B 3GI9L 4PJEA 1N8ZA 3NVQA 1A0QL 4MXVE 3EO0B 4K8RC 2MPAL 3R4DA 4UBDD 4I18A 5HYSG 4LVNC 2DQHH 4G8EA 1RMFL 3MRMA 5AZEL 2DQHL 3HCVB 4M03A 4L4TD 5C7XL 5EO9A 4U1HA 4MDIB 3S34L 1DLFL 4EI5B 4I3RH 2M26A 1QR1A 3ZZ1A 3S97C 4DQOH 2XKSA 2M1KA 1MFCL 2X4OB 5DJYB 5FAAA 5C2BL 3F58H 4Y1AD 4Y16D 1FO0B 4JM2B 4P23B 1T83C 5CKGA 1NLDH 4Q9BA 4OIIH 4I5BB 4GXUM 3KYNA 1K4DA 5TQ2L 4LCIL 3VMNA 4JFDA 3QDMB 4XHJD 4UV4L 1U8KB 3BP7B 4XPFL 1KACB 1V3MA 4GLRH 5SX5K 5C0FB 4Y5YA 4G3YL 1MOEA 2LABA 5MP6L 1AP2A 1U8IA 3O3DB 1YQVH 4YBHA 5I1KH 5DUBA 3TA3D 1R3KA 3KLAA 1ND0A 2APWA 2EZ0D 3CJJA 4U1JB 1UEYA 4PJIE 3OKDA 2XNAB 3UTSB 3IDMA 5INCB 1IGTB 1HHJA 2HT2D 5F1OB 4XPHL 1JZ6A 5KZCB 4I3SH 3RHWK 4QRQB 4MJ5B 2PTVA 1B4JH 3QUML 4WW1A 4Y19E 3A6BH 4Y8AA 5T1KB 2Q86A 3TEUA 5TE7L 1MCPH 4WCYH 3EGSA 1CICC 2E7HA 2O5ZL 1DBBH 1O7SA 1K5NA 3GO1L 1V7ML 3HE7A 3B9KD 1INQA 2OZ4L 3CUPB 5DYOA 5I1LB 1A7PH 1OSZB 4E9LA 3QH3B 3RNKB 5GGVY 3LRGA 5FOJA 4NQXB 1HSAA 2AKRB 3DXAB 3IU3A 3HR6A 5BS0B 4M43L 2R1XA 4RSVA 1TJGL 1J8HB 5I19H 1EEZA 4H1LG 4NN5B 1TJGH 2DTSA 3IDYB 3LQAC 4U7SA 3ZYOA 3DHJA 1FNFA 1MFAH 2L4OA 2G60L 2J5LC 5IV2A 1YUHA 3V95A 2KL6A 1QSFD 4HIJB 4O2EB 2OQJB 4N5EC 4U6VH 1QTYT 3RVTD 5I8KL 1VPOH 1U6AH 1CXFA 2H32B 2X4NB 3CU7A 4K3JH 3QZWG 4RCAA 1MUJA 2F58H 4H5SA 4Y4FD 4AIZB 2RCSH 4R6UA 2P44B 1ZWIA 1UYWH 4NFBA 3BH9B 1UEMA 4ODUB 3U4EA 2PTTB 5CIPA 3U7AA 1WGOA 5F6HJ 1X6LA 3VXSA 4ZD3L 4N8CH 3QCVH 4XPTH 1F42A 4K55A 1WLHA 3SDCB 4BFGA 1N7ML 4XTRD 2C4XA 4X4YB 4C83B 1CXKA 3QCVL 1N59A 4JFHD 3GSOB 3IXAB 1SEQH 3D2UB 5D1QC 4P5MA 5ISZB 4WWID 4UT6H 4IRSC 1GZQB 3ARRA 4HIXH 5I8CB 3QIUD 1BD2B 4QRUA 3MV7B 3NFNA 2WIIB 2VXTH 3BZEB 2QSQA 1NFKA 5B4MC 5D7IB 1KJ2A 3LH2L 2Z35B 1G9MH 1JPSH 1TVBB 2VOTA 4JVUA 3KYAA 2BMKA 4OQ1A 3LQAL 3MUZ1 2H32H 2JJWA 2D0GA 2AK1H 1T89A 2YUZA 1AO7B 3ZE2E 2DLEA 1N6QH 2DM2A 4JZNA 3REVB 4M00A 1UCBL 1S9XB 1J7VR 4OF7A 5CP7A 3O3AA 1FVCB 4FP8L 5HD8D 2FIRT 5I1HL 5IGXH 4W6WB 2XN9A 1HEZB 1OB1A 4OLYL 2YMXL 4R7DB 4MXWH 5EIIB 2BJMH 1ZLVK 4LKXA 5DA4A 4TUJA 3WL9B 3CX2A 3PWLB 3IFNH 5EFIA 3O2VL 4UINH 1P5UA 3PIQA 4HW6A 3TVMA 1EGJL 4LAJH 1NCWL 4XCYB 4DKDC 3NCEB 1HK6A 3D0LB 5AEAA 1MJ8L 1HWHB 3GSWB 2ZOKA 4PJBF 1KIQA 1DTUA 5C70A 2Q8BL 5I1JL 2GCYB 3MOAH 2VDLH 2VLME 3NGBB 1FRGH 3GFUA 3L7FB 1E4XI 5F21B 5MERA 2XZQH 3TCLA 1OM3H 4JFXB 3BEWA 3ULSB 4WHDA 1HSBB 1JUFA 2R2EA 3P0YL 2EO9A 2XZZA 2F8VA 1F58L 3EOAA 1FP5A 3MJ9L 1F13A 5GGRB 2DYPD 5BS0E 5TDNB 1HN1A 1IFHH 5HHVH 3TBWB 4GMSL 4OLZL 3KPMA 3BD5A 4FFYL 4NM8L 1XZ0A 2V7NB 3WLBA 2ATKB 2VKWA 1GCFA 3MRRA 3O2DA 4PTTB 2HVKA 2R1WA 4G6AD 2NY0D 5I18L 4OI8A 4F33A 5BVPH 2F5AL 2FJGA 5EUKB 5D8JL 3N50A 3MOBL 1JFQL 5CWSA 4X6EA 5D5MB 4L4VB 3W0WE 4UNUA 1U3HD 3O6KL 4AQ1B 2GTWB 4ETQB 4F7PB 5JHDA 4EUPG 3VFUB 1T1ZB 1A1NA 4LCCC 4Q0XL 3G5ZB 2HJLA 4GKSA 3FFDB 1HIML 3BN9D 5DT1L 3RU8H 4MDJB 4M7LL 4MSWA 4E0RB 1MQ8A 3VXUA 5ETUB 4QRTB 4MMXC 2ID5A 1AKJA 4GUPA 4LCIH 3EZ8A 4JANA 2QQQA 4PRBA 3S35L 3F5WB 2IGFH 1N64H 3UROR 5T5NF 1MLCB 3NCCB 3LKQB 5BJTB 2CK2A 3RUGF 2UZIH 4HQQL 1N64L 1CVRA 2O61B 1CF8L 4ZFFA 4MB5A 1RZJH 3RZCC 2XOTA 3EYOA 3EUUA 5JUEL 4G5ZH 3TIEB 5ICZB 4MAUL 4HF5H 4GW5A 3HZMA 5HD8C 2L7JA 1OP9A 3H9SA 5KSBA 5LQBL 2DTMH 3CFJA 4OFIA 2QSCH 3TH3T 2W9DH 4ZMAT 2JIXA 2FEDC 3VXUE 2KUTA 4H1LB 1VFAA 1G7PB 5DD0L 1I9IH 1X7QA 4XPBH 1J12A 1MHHB 4KHTH 4QRPE 3VWKD 1RZ8A 4RAUA 4IRJD 4NZRH 4F8QA 3FTGB 4PJ9A 1YNTA 3WIHA 5EN2B 4N90E 1DUYB 4MNHA 5FYLH 2AK1L 1DQDH 4G6FB 2G9HA 1S8DB 1WBXA 5H35A 1IAKB 4TNVK 1VEPA 2COQA 2VISB 1U8MA 4NKMB 2PW2B 1TTUA 1XMWA 3EBAA 3PP4H 1IGJB 3O3BB 4P46D 5DJ6A 3ULUC 4JRYB 4PJ5D 3MJ8B 4YHKL 2XN9E 2CKBB 5GSVB 5D7LB 4DZ8B 3BJ91 1RIUH 4YAQB 4HC1A 3OAZK 3KDMB 1DN0A 5J3HD 2V9TA 4KRPC 4Y7MA 5DJXB 1N4XL 3I6GA 4XI5D 1VEOA 3RNQA 5ACZB 2ITDB 1T1XB 1CCZA 4N0UE 1I1FB 4XPGL 4QHLB 3FL7A 4MXVF 3V5DA 1D9KB 4QEGA 2JCCF 3EHBD 1KLUB 1FVEB 3O2WH 3SGEI 3RVVC 5KSUA 3MUJA 8FABA 2Y5TB 4PJFE 4NKOA 3B9VA 4DZBA 3QXTA 1A6PA 1NCBL 3LRSB 3AGVA 3MJGX 4YH6A 3PGDA 1YYLL 5GS3A 5MI0B 3SEPA 5B22A 4MD5B 2BHUA 4NUJA 1RZFH 1CGYA 4FA8A 1SQ2N 2X4QB 3P9MA 4JPWH 4YDLC 2IG2L 4O51A 5F97E 5IB5A 4RWYH 4OSUL 2NLJB 3F7YA 3TA3C 9CGTA 5I18H 1QQDB 3O6FD 4FQJL 4OTXH 3NCMA 3L5WA 5C8JB 3MV9B 2X9YA 4Q58C 3QHFL 3SE9L 5A16B 4EBQL 1NANH 5J8OA 4JLRB 3K2UL 5JW4M 3NZ8A 4OFDA 3WYRA 1JF5A 1MPAL 3ARVA 5E03A 4PGBB 2F19L 1WC7A 3ZT5A 2XPGB 4RQQA 4TRPL 1JGVH 5HYEA 3QG7H 2EDHA 5I9QC 1HIMH 4CNIA 1ROWA 3QR2A 2XTJD 1DL7H 2DIJA 4LF3B 1ADQH 2EDXA 4OCNC 1J1PL 4CW1B 1YPZE 1I7UB 4AG4L 4DVRL 1CXEA 3HC0B 3TM6A 1KUMA 1TJIH 2WK2A 4Y2DA 1PYWA 4HUWB 4BH8B 2O26U 1K6QL 5HGBB 2J8OA 2ESVB 1JTPA 5ADPH 3VXMD 2IFFL 1HHGA 1T5XB 2VLKE 1JNJA 1BZ9A 4EZMA 3MGOB 1XIWD 3VWKB 1TNMA 1MHCA 2CQVA 4ZUTB 4H8WH 4J3OC 5E2UH 3O45A 1INDL 1I8KA 4G8GA 5DD1H 4KRLB 1FGNH 3KR3L 3LEXB 4P5TA 4G43B 3BD4A 3H6JA 3H7LA 1FFOB 2X1XR 4U1MB 1P1ZB 3MYJB 3RZCD 3L6FB 4FQ2L 3EO0A 1F02I 5F7YC 4G8GE 1CBVH 4LIQL 5FYKH 3GKWH 5I9QB 1XGYH 4IEFB 4P9HL 5DQ9A 5KOMC 4G8EB 4HMDA 1FORL 1U91B 3EJZD 3EO9H 4EUPH 1M6OB 3HPLA 4ODSH 4XP9L 5IB4A 3WFHB 5EO9B 5IROA 5JDJA 1JZ2A 3D85B 4X7DC 1KCVL 4DCQB 1T2JA 4JFZH 4PJIA 4QHNA 5CSZB 3V0AC 3I6KA 1XF4B 4JO2L 1FO0A 4JY5H 1EMTH 1MCCA 1B4JL 3O3EA 2FRGP 3ARBC 4GBXB 4L9LB 4ZOBA 3G9AB 4WJ5A 5CLTA 4U33A 2I9LA 1U8KA 2WWMC 2VXQH 4IOSD 3ARQA 4JR9H 4G8IB 2JJSC 2NY3C 2NX5A 3LN4A 4ELKB 4ZFZB 5EA0H 4G6AC 4QRRB 3FB5B 2BHYA 1A6VH 4JFYA 5KVDH 3VDCA 5HBBA 2D7NA 4ONFH 3R0MA 2C4FT 2JIXD 3KYKL 3MV8A 2G5BB 1FV1B 5KVDL 1T7WA 1JI1A 1DDHA 1HHKB 1ZS8A 2AJXL 4NM4L 5HYQB 2CGRL 4H25A 1OD9A 2PCPA 2XNAA 2X10A 3O6FB 2A0LD 3O2DH 35C8H 3Q48A 3ZE2F 3MV9D 4OIIL 2VO5A 4ZAKA 1U6AL 2XY1A 1LE9A 3RWGA 1B88A 3HAEA 3IFLL 2QKIB 1IQDA 1Q9OA 4LAQH 2AXJA 3BGAA 1IKFH 1LE5A 3A67H 2WAHA 3CSYB 2XRAH 5CBEB 4JFOA 2DBJA 1EO8H 1CGWA 2GJ6A 1T80A 4HXAL 1S7RA 3BSZH 1MFDL 3RY5A 3BHBA 4GKOA 2AI0L 2KQMA 1KIUA 4PJ5A 3UYRH 5FYKE 2KBGA 1YQ2A 3VFWA 2HH0L 5TPWH 1MCOH 2W59A 5GGSB 3HRZB 3TJHC 5FCUH 2EE3A 4I4WB 2J12B 5T1DL 5I16A 2DAVA 4G42B 3FO9A 1EHLL 2EKSB 2CSPA 5ESVA 1B2WL 4JFEB 4HFUH 5J1AB 3MNWA 1WCQA 1FYHB 1A7RH 5DC9B 3I2CL 4PRID 5BZWB 1H3UA 1URLA 3WFBL 2PYFB 3JVGA 2PW1A 4M48L 1OARH 4X5WB 2VDPL 4XPAH 5IJKC 2ICEB 1NC4D 1OARL 4FP8H 1OGAA 3X12A 1D7FA 3UTQB 5H94B 4L4TB 2QHLA 1P4LA 4BFIA 2PYEE 5ABDE 3SOBH 4C56D 1LP9B 4HD9A 5CD3B 3DSFH 1GZQA 5IOPA 2DOCA 1CK0L 5DJDB 1R5VB 3SDDA 1MJ7L 1UJ3C 2DF3A 2FH8A 4UV7H 1FC2D 3MV7A 4QY8A 5F6IB 5LAXB 5DJ8A 3NN8A 4X6DB 5CEZH 3MBXH 3H8NA 1HXYA 5I8EB 3UJJH 3MV8D 3OQ3B 5CP3A 2IMMA 4JPKL 4QXTB 2NY6C 2R0WL 3HNTL 4QT5B 2BERA 3HNVL 2HP4A 4C56B 3C5JA 1NCCH 3VGEA 3DX9A 1AO7A 4NQCB 1FHGA 4N8PA 4F15C 4XAKE 2AJZA 5ISZE 2DB8A 3BKCL 4O58L 4F9LA 3ARTA 3ARGB 1KT2B 4NO5A 5DS8A 3BKCH 4K23H 4KV5E 4F7TB 4O2CA 2GJ6E 3DO7B 4LKXB 5ESQA 1IILE 4CU7A 1ORSB 4J3TA 2WWKT 1KJ3H 5CKAA 2ARJQ 2DKMA 1R24B 5B3JF 4TUKL 3VXMB 1KJ3L 3SGDI 3PDOB 3GB7B 4FQHB 1ED3B 4PRHA 1GZPA 1FN4A 4BYHA 3CFCH 4QXGH 2DMKA 4OZIE 4DN4L 3CMGA 1V7NL 1YEJH 2X2YA 3O6KH 5DO2D 2CMRH 1FZOA 2GK2A 1ZT1B 1JZ4A 4HKBA 4BKLA 5AG9A 5LVEA 3EOAB 4N9GB 1EH9A 1S78D 1RIHH 4PJBB 3G5YB 3TBWA 1YMMA 1U36A 2VIRB 3LKPB 1IRAY 5DJ2A 1FL5B 2MQCA 4CU6A 4OLWL 4FG6C 4WUUA 4P3WA 1I8IA 3GNML 3HE6D 2A0LC 3WIHL 2AI0H 5FYKL 5I6XC 3RKPA 3HUJA 4U1LB 1LP9F 1HHIA 5K9OA 1MI5A 4I9WE 3SCMD 4LQFH 3FN0H 3B2VH 3BEVB 1INEH 3A0OA 5L8JB 3LEYL 4JFEE 3IVKA 2ADJB 4ODBD 3BAEH 4K3EH 3OKNB 2EXWC 5KVEL 3MRKB 5I17A 1H15B 2HJLB 3U30B 3QI9B 4KK5D 1ETZB 1G7LA 4MXQD 4UZGA 2YRLA 3LHPH 1J86A 5IEHA 4AM0A 3BXNB 3LHPL 1U8OA 2NY6B 3GSVB 2DQTH 4W81A 1OWWA 4MJ2A 4EI5D 1UVQA 4NHCL 5ERWA 1FSKC 1LK3H 3T3PF 3ELAT 4LLDA 3VG0L 3I2CH 2P5WE 3HC3L 4KTEH 4U6YB 5DK2A 1BFVH 3MRPB 1FZMA 4G6ML 4MQ7B 1EAPA 2EDWA 5KS9A 1BEYL 5JMOC 3GHEH 4RFOH 3X14B 2FLBT 1EK3A 3LEVL 3SJVD 2PNDA 1I9JL 3DV6A 5I66B 1X5FA 4NIKB 1Z2KA 4DQOL 3OGCA 4ISVB 1CFSA 1BX2A 5E24E 5D7SL 4WEBL 2A6JB 4YFLI 2IAMC 3RDTD 4PJCF 4YDIL 2HTLC 5DRNA 3DROA 3HNSH 3KLSA 3IETA 2WM0A 1PY4A 1FG9C 2ZSWB 4B0MM 4JPKH 1UH2A 5H2BB 1Q1JL 1YPZF 4JM2A 3UO1L 3SKJL 4P23A 4F9PA 5HGHB 2UZIL 5ADOL 4K7PH 4XC3L 5K9QG 1CF8H 3BN3B 4LLWB 4KKLD 1LO3L 2R2BB 1QACA 3PGFH 5D7LE 2PW2A 4DWHA 3CMOH 1S78C 1UXSB 5EOCJ 3MXVL 3ZTJH 3KYOB 1KCKA 1TZIA 1HQRB 3OPZL 2XWJA 4L8DB 3KLAB 4G6JL 1U95B 4GSDL 4OLUH 1IEAA 4Q9QL 1ND0B 3VA6A 3E2HC 1REIA 1A1OA 1KYOJ 4U1JA 4ZODA 4ZAKC 5DI8B 5CHNA 5DA0B 2GHWB 1EZVY 4DOHE 1RJZA 3UTTE 5E08L 3THMH 3UTSA 3AXLB 5INCA 3EKCA 3QULA 4UIKH 2YD7A 2OTUA 5ICYB 1I1YB 3C9NA 2IPUK 3BIAX 3VFTA 2P24A 5INDA 4XC1H 4F57H 1OTUD 1MWAH 1A3LH 1WIUA 1I3RA 4YHKH 1K5NB 3PGDB 4R8WH 3W39A 3WXWH 2OLDA 4G6KH 5C0ND 3S5LG 3SKOB 4EUPB 1EXUA 3LIZL 1OD7A 1ZEAH 3H9YA 4O51B 4NQXA 4M6OL 2O5ZH 2LAGB 4XHQA 4QF1A 2YD5A 3PWJB 4HK0B 3RZWA 1JPST 5CSGA 1BD2E 2EDOA 1S7SA 4PJIF 1RD6A 3MLYL 4PJFB 2A6DA 3WKNA 4ZO9A 1RV6X 1I7RA 3BAEL 4XPAL 3ROOB 1OAKL 2D4FA 1UWGL 3DMMA 4I8DA 4PJGF 3ZKSD 4AIZA 3GJFH 4ONGL 4APQD 1FAKT 1U42A 2AK4E 1E6OL 3JV6B 1UJTA 3NCJH 4U6VL 3IRZA 3OSKA 4LMQI 1DQJA 1Q94B 2FBJH 5C6TL 3D39A 3FQRB 4IDJL 4CW1A 3WN5C 1PKOA 5SX4I 4R26L 3PP3H 5EO0B 4MJIE 3C8KA 1X5GA 2KZWA 3VWJA 2A6IA 2GUOA 2HJKA 1SY6H 4XAWL 2OTWA 4EVNB 3X11A 2R69H 1AI1L 3KHOA 3OKOB 2QEJA 4X6BB 3VRLE 4PY8J 4JRXA 1F3RB 4M6AA 1WZKA 3U7WL 3GI8L 2EE2A 2MCPH 3H9SD 1OF2B 3HUJF 1HYSC 1QSFA 2ADGA 4ZG1A 4HIHA 5D7IA 3RWEB 2W0FA 2AEPH 3K81A 2CGRH 4G8GB 2W92A 3TBSA 2C4FU 1WQVT 5I15H 1UWEH 4XXDA 3HNSL 5EZOH 1FFOA 5FGSA 2YXMA 1N26A 3VFOA 1YEGH 3GMQB 5EZJA 2VLMD 4XH2B 4X6CA 4YZFE 5IT2H 1CFVL 3RWDA 1DSFL 3O3AB 4L3EA 1MNUL 2F53D 3O6LH 5JW4N 4PJ7A 3TT3L 1LNUB 4DGVH 1M6OA 3VFRA 2OI9B 2E9JA 4U0RB 3ZKMD 3BQUB 3MFFB 4MX7B 4L1DA 4GW4A 5D2NA 4EQ2A 3OB0H 4ZPVB 1A7QH 4N1CA 4TNWF 5E1AB 4NNPL 5EC2A 5E7FA 4HX1B 5C0NC 3I6KB 1ZANH 2O5XH 4U1HB 2UZXB 2XZAL 3O3EB 1C7SA 1DQLH 1E27A 3HLAB 4NYLA 2W9DL 4DGYH 2DQDH 5E6IA 2HVJB 5DMJB 4XB7A 1D6EB 3QIUB 3VFVB 4QXUH 3C6LD 4LKCB 4NBYB 5GGQH 1QBLH 2ATPB 4PJGB 1X9QA 3MRLB 4NFCA 4RDQF 2ZUYA 3WBDA 3S88L 2OYPA 3FB5A 3BP7A 1IM9B 1T0PB 2EO1A 4FZEL 4U1IB 2HH0H 2EECA 4PJAA 1MRCH 4PJHE 1J18A 1B0GA 4I0KA 4PV8A 5JOFA 1ODAA 4ONHB 3L3GA 3QDJE 5DUBB 5BO1H 2Y7QA 4PTTA 5D9SB 4JVPA 1UM5L 1KULA 1CTNA 2IADB 4WUKH 3OKKA 5IJVA 4YQXL 1I4FA 4MD0B 1RFDH 25C8H 2Y6SD 4P23D 1Q9OB 2PXYD 3PWUA 3T4AB 4LEOB 1CR9H 4PP1D 3GSRB 3GBLA 3N9GL 5D1ZD 5D5MA 4I48B 4MQTB 2YD1A 4I77H 2P5EA 3RWIB 1M7IA 1W0VA 1CXHA 4HEME 3B9EA 4I77L 3F62A 4CADA 1JIBA 4ZNCD 1ZLUH 1JGEA 3O11B 4MDJA 1I3UA 4FS0A 3NPSB 3T8XA 3IKCB 3BWUC 5C7XH 5CJOL 2C3WA 2G75A 1AGFA 1L9MA 3T09A 3UYOD 3UYPA 5JOEA 4DUWA 4PRBB 2VWEC 3B9KC 4OZIF 2CKBL 1QKZL 2VZTA 3UJIL 3LB6D 3UTSD 4P49A 3STZA 1KB5B 3KG5A 1KTKE 4ZOAA 3I84A 2ENSA 4P59H 5K9JH 4O9HL 2H8PA 2DL9A 4P2QE 4W6YB 4GSDH 4Q9QH 2AV7A 2QQLL 3ARBD 3VH8G 3H9SB 5DFVD 1M7XA 4XPBL 2IAMA 1U8JB 1JYNA 1I9EA 3MA9H 5F1IB 1T5WB 5L0QC 5FB8B 3CH8A 3PE9A 2Q3ZA 2NY3B 3HPJA 3QQ4B 4M02A 1NL0L 2PYEB 2ICEA 1MCFA 4KJPD 3QO0A 1NCNA 1RZ8B 5K9KB 1A02N 1XGRA 2Q8AL 5HYIA 3L5HA 3BH8A 5BQ7B 3H3BC 2BDNL 4L4TA 4BFIB 4OT1H 4PJ8D 4J3SA 2R1YA 3SDCA 4OFYA 4RGOL 5AD0A 5GRVL 5HHPB 1N59B 2D31A 2ZWLT 3WN5A 4MA3A 3MRDB 2PYED 2X70B 3JV5A 2XA8L 3QIBC 1DLHA 3DBXB 1ES0B 1RSFA 3QCTH 4M6OH 3O3BA 5GGTH 4C56E 3K74B 1YEDB 5C3LD 1KB9J 2OK0H 3THML 4Y16C 2O5YL 4I2XA 3BKYH 5F93C 3P4NA 3T3PE 3QDGB 4R4BA 2ZUTA 1MCKA 1VENA 2UV3A 2X4RA 1UM6H 1G7MB 2LAAA 4NZDA 1IGCL 3KPRA 2D7OA 4QHLA 5ITBL 1IEHA 4LLAA 1TCRB 3BKML 2NW3A 1J11A 1IM9D 3KVQA 1E4WH 3V6ZA 3VXME 4WEUD 1OB1B 4TOYH 5ACMA 1CLZH 2Z9TA 5FGCB 1S7UB 4NNYB 4D9RD 3VH8A 4LRIC 3VFSB 1YPZB 1GC1H 4ELMB 2BVEA 1XIWA 1B3JA 5ECJE 4ZNEA 5A40E 3ILQD 2XTJE 5JPNA 3GSNA 1QSED 4PV9B 1OL0A 2AQ3A 3N1FC 1DVFA 1BLNB 2JJTA 3MV9A 1OLLA 4E41A 3W5NA 3DI2B 4N9GA 1FDLH 1T6WA 5IW6A 4JKKA 1FVDB 2BSRB 3ULSA 1YMMB 4AENB 4TN9A 4Q9RH 2GAZA 2DJUA 1A21A 4FQJH 3DOSA 4YR6A 1RJCA 4X6CE 4HH8A 2NQCA 4YUEH 3KGRA 4F15B 4G9FE 3GJFB 3O9WB 4GBXC 4L9LC 1WEJL 4JDTH 2VLLA 1A4KA 2EEAA 1BFTA 2BCKA 2CDGB 3N0PB 1NH6A 4PP1C 1NCDH 1KXTB 2FATH 2IFFH 4MZ2A 4LOUC 5ITFB 1QKZH 5F9OL 3MUGB 2QSCL 1VFBB 1UB5A 3MRKA 1E28A 4XCFL 2O5XL 3NIDE 5AUMB 4JFED 1LDPL 3B3IB 3JTTA 3GMLB 5J12B 1T3FB 5I1HH 1T7XA 4F2MA 1F6AB 1IEBA 3ROLB 2DQGH 3BXNA 3ZDXF 3HMXL 1NCAL 1KELL 3RJQB 3VD3A 3MGOA 1UKQA 5EU4A 4GKSB 4S1DD 4K7PL 1LVEA 2N7BA 1ZKAA 3KLDA 5I1KL 3TH4T 2RGSA 3O4OC 3CX5J 3DVNA 3V5HA 3RL1A 1J0HA 4G3YH 2IPKA 5LXGH 3MRNB 3OB8A 4LVEA 1P1ZA 2B1HH 2W65A 4UTBH 2GSGB 3ME0A 2YN3A 2C3HA 1T7ZA 3D3VB 3LKQA 4XP9H 4HLZH 5BJTA 4RDQG 4N0UA 2EICA 3ARED 4PJ8A 5E8DH 5IIEA 4KDTA 2E7LC 5EORH 2RHEA 1TETL 4ELMF 1RZGA 5JHLH 5FCUL 3MGTA 1IAIM 1N4XH 2DI9A 5KSAB 1LDSA 1Q9LB 4JO3L 5GRYA 5E56A 1J0IA 5KTEH 4H1LA 1Z0MA 2OZ4H 1WFOA 3FCTA 1T21B 1IAMA 5JPMA 5E00A 3MQIA 4HAFA 2LV4A 3MYZA 4LEXH 5IFHL 1OAYL 1CE1L 4M62H 1BPVA 2JLLA 5L6YL 1XGPB 3P4OB 4ALAL 5EU3A 5C0RH 3GK8L 2WUCL 2OL3H 2DBLH 3VRLF 4H0GA 5E0QA 1UXSA 1WBZB 3OAZH 4ZUWA 3V6BR 1E4WL 3LPWA 3KYOA 5DD5L 4IJ3C 5IW3A 3BRFA 5JZ7C 2H45A 4L8DA 2ZG2A 1IEAB 3BIKB 4M6NL 1A1OB 1A47A 2C3VB 3BP6B 3FQNA 4WUUE 43CAB 3PXHA 3FB6A 3HZVB 5D7LA 1ZS8B 4DZ8A 2FBOJ 5DJAA 5GS0L 4YAQA 1PGRB 1R3KB 3MLYH 1YMME 2DQEH 3ARWA 4LSTH 4IRJB 4KK9C 5MENE 1S9VA 4Y0GA 5IVOA 2NY3D 1ITCA 1WFTA 1RJYB 1UA6H 2E7BA 1QPXA 2VXVH 3HE6B 1LE5B 3KYMA 3GSUB 2W9EL 1G9MC 4ZSOB 2VTFA 4MJ5A 3QCUL 2A9MH 5FV2A 1DFBH 4NKQB 5SWZA 3ZKND 3EYVB 3LRSA 4K23L 2I60H 2I27N 3MRHA 3C60A 4WI9A 2MHAA 4Z77B 1YZZA 15C8H 5IMMA 5GS0C 5DEZA 4P46A 2E5EA 1MCQA 1HKFA 4XAKD 3QDME 1ZHNA 4J1UA 3QDGD 4EQ3A 5BS0A 1QQDA 4IHOA 5E95B 4XC1L 1HH9A 2Z93A 1J1XH 1BVKB 4AY0A 3NZ8B 3VXRE 5E8PA 2ITCA 1N6QL 3LQMA 4QTHB 1U3HB 5C09B 2XPGA 1U58A 4OZGA 5GRWA 4RQQB 1MUJB 3D39B 3FQRA 3IAGC 3B8SA 5T3XH 4JAMB 2BJML 1KGCE 3RWFB 1XCQA 3RWHA 2A6IB 4PBVC 3QUKB 4HJ0C 4NNXA 4WEMB 2VDPH 1AE6L 3OZ9L 4N0CC 1YY8A 1ZSDA 1MQKH 3QFJA 2R15A 2ESVA 3DETD 1A1MB 4BSWA 5D8JH 5DJ8B 3DUUA 1IZJA 4JG1H 3PWVA 5ISZA 5IG7B 5E9DD 3G5XA 3K4AA 5DHVA 3FO1B 2YC1B 5C1MB 2SEBB 1MHCB 4XXDB 3S98A 4MJIB 1B6DA 3C5JB 3DX9B 3F8UB 4JEGB 1JNNH 1UQSB 4P2OB 1BAFL 2VUYA 1R0AH 4V1DA 3KHQA 1NBVH 3AROA 5IK3A 4CVZA 1JGLL 3L6FA 1U8LB 3OMZA 3REVA 1ZHBA 2VH5H 4EBQH 3TJEL 5I1GL 2X40A 4TPRL 5KS9F 4OFYD 3EYSL 3GSNH 4C57C 2C26A 1HXMB 2XN9B 3EYSH 2XFXA 4FFZL 2FATL 4LLMA 5DMKA 4X4XA 4HUVA 5DURB 2LTQB 4F7CB 2F74A 3T0EE 3VXMA 4HCRA 3P40A 4P2OD 1B90A 1HQ4A 1MAML 3MLRH 3FQTA 1SBSH 3ARFD 4F80A 2VQ1A 5EZOL 1UJ3B 1WSST 3PIQB 5DQDH 3B8YA 5GRJH 3CZFA 5MI0C 1AGDB 4M7LH 5D1XB 3VJ6B 2E7LA 5DD0H 4ZPTB 1BFSA 1MWAB 5C07B 4BKLB 2H3NA 2H9GA 5F1SA 1NDGA 4P2RE 1CL7L 2WANA 1M1SA 2VSCA 5MERB 3SDXE 4YHZH 2GFBA 2GI7A 5I76B 2R23A 3RZCA 1I8MA 2FYYA 1CD1B 4MAUH 1VEMA 4TTGA 1XF5A 4HQQH 1LQSR 3HFML 1FGVH 3QCUH 5GGRA 1RZJL 3B2VL 2ZUWA 5DRXB 4JFYB 2AXGB 2BP3A 5FO7B 1U92A 4N8VB 1R6VA 1SM3L 4XVSH 1NAMH 4WI7A 1IAOB 1QSVA 4M7JL 2VRAA 1YEEH 2ERJB 5L9DL 4JO4H 3HMXH 4O5LL 3U36A 1IC7L 3PV6B 2B5IC 3P11H 5HY9A 3LKOA 4FQ2H 4YHIB 1SBBA 1IQDB 4DTGH 2I9TA 5E4IA 2HTKD 5F1KC 2EDYA 1FCGA 2VLJD 4DTGL 3IYLW 3SDYH 3F7RA 3VCLB 1G7QB 1IJ9A 3MUHL 5EOCH 1QBMH 1UCBH 2J7LA 3MV7D 4TSBL 3EYQD 4G6FD 2GY5A 3H42L 4NWUH 1T0MA 4M61A 3QUZC 4X9GA 1KEGL 4K7FA 5FGBA 1WISA 3L3DB 5GJTL 4GUPB 5T3ZD 3PWPA 4MA8H 4JANB 4MYWB 5KS9B 4NGHH 3BGFC 3RVTC 5L2KB 1A4JA 1MLCA 4I0PD 5D7SH 3TYFB 2B1AL 4OZ4B 4R96A 5EZIH 5HI5D 4U6XA 4P3DA 3O2WL 1R3LA 3WUWG 1ACYL 1CFSB 1MQKL 1UFUA 3H0TB 4OTXL 3E3QC 4IMLA 4KDVA 2VDLL 3MOAL 1MCLA 3QXUA 3UEZA 2IF7A 4GAFB 43C9A 4WFFE 4D0BA 2NY4D 3VXTA 1EEUA 2P5EE 5DJZA 3K4DA 1LO3H 1LEIB 3RVWD 1MCBA 2OR8A 4NM4H 5FKAB 4ZFOB 5EU7E 2HFGH 1MF2H 4Q6IB 1N0XH 4Y2DC 5H94A 1MF2L 2UWEF 1MCNA 4IDJH 3NIDF 4K8RH 4MNHB 3ZSTA 2HG5A 1NUGA 3JWDC 4O4YH 4OSUH 3A67L 1E6JL 2XQYK 4Y4KA 3UZEA 2JB6B 3ZDXE 4YXLL 3MFGB 1ZLVH 4NKMA 5E8OB 3AREC 4LLQB 2NY1C 4YXLH 4JM4H 2ADFH 3N85L 4Z7OE 1NMCB 3LMJL 4XZUA 4KHXH 2AK4D 2CMRL 1UA6L 2Z91B 3UYRL 5DR5L 4P2RB 3MLVL 4H20H 1YN7B 4QT5A 3O41A 1BZ7A 3MLVH 1NEZB 4GKZB 2Q20A 5DD3H 4PJCE 4G6JH 1IARB 3RTQC 3T65A 5CEZE 4NT6B 5GRJL 5IMOA 1JBJA 3CVHA 2AJUH 5I8OL 1I1FA 5I0ZA 4ELME 4C4KT 3L3OA 3IXTA 1RUPL 1W8NA 4JZJA 2HTKC 4DKEL 1TJIL 3GMNB 1UWXK 1YN6B 3BKYL 5D7IF 1UG9A 4OB5H 2ZUUA 1F2QA 1CU4L 1XGQA 2EDTA 5IFAH 3RVXC 1U9KA 2VZOA 1HE7A 2R2HB 2BNRE 3MLXH 4GO6B 5DUML 3ZHDA 4XCFH 2CXGA 5F8QC 4UDUA 3WNOA 4R0LC 4ODTL 2V9QA 4E41B 1GC1C 1ZA6B 4M7JH 3VFPA 4DGIL 1N5AA 5E2TL 2GK0B 1RK1A 4KI5E 4LP4A 3L95B 5C8JA 4GAJL 2YRZA 5KVGL 1A8JH 2RJMA 5FGCE 5A16A 3GKWL 2QLVB 5GSRB 1C08A 1PSKL 3RTQB 4JLRA 5J6HA 5T33H 2PO6C 4GRWB 5FUOL 3BPCA 4UV7L 3IAQA 4AT6B 5C9JB 3LDBC 4FTVA 1WF5A 1ZVSB 5L2KE 1FL5A 1NC2D 5L2JB 4U3XA 3WFCH 4RX4A 1WZMA 4PG2C 3GUTB 1SJEB 3ALWA 5FO9B 1FLRL 1KB5H 2A83B 4NKIH 3ARFA 4AEEA 4PRIA 3B2UD 4ONFL 5BXFB 5GISL 2YPLA 1MCDA 4KY1H 1WBYA 4M7ZC 1DANU 1QFUL 5I71C 2ADJA 3DX7B 4JB9H 4HUWA 4BH8A 4Y4FB 4JR9L 4GKNB 1AJ7L 3QIWC 4MCYA 3QI9A 2C3GA 1OF2A 2Y4SA 1AHWB 3TGXA 3DO3A 3LV3A 1QOKA 5FYJU 1HH6A 3VXPA 1AC0A 3RWEA 2P7TB 1X3DA 4MWFB 3IFOB 2AVGA 4RMTA 1I9RL 4LPXA 1F11A 4R4NC 3Q3GB 4PJGE 5FHAH 5IQ9B 1DSFH 5D6CA 4M43H 2E6QA 2OMNA 4X83A 3MRNA 1MCWW 1P4BL 4APQA 1HNGA 1DLFH 4LVHC 2EIZA 1JPTH 3IDXH 3D2UD 4L8SA 4W6XB 1N5YH 3SE8L 5IQ7L 2P45B 4P5TB 1H8NA 2R0ZH 4C4KO 4UOW1 2AJXH 3SDCD 4G80A 3D48R 1EFXA 4NN5C 3MOQA 1MJUL 4BM7A 4V1DE 4G9FA 4XPFH 3UBXI 1XFPA 4ZPVA 4N0CD 4AZ8A 3CFDB 1BJ8A 1JGDB 4J2XA 2VZVA 4HKJB 2YD8A 1EEYB 1R3JA 1R3HB 5FEBA 3TNMB 1NAKL 1WAAA 3HUJE 4NQCE 1S7TA 2A77L 4PJIB 4QHNB 5CSZA 4IOIB 1A7RL 1XF4A 4LKCA 4W70A 3UTSE 4U6HB 5IB3A 4WW2F 1MIEL 3UTZA 3V7AG 5F9WC 3KPTA 3ZL4L 2ICWI 2BDNH 2R9HC 4LSPL 4OM0H 5IROC 4ZUWB 1A6TA 1AY1H 4XMKL 3SDAC 3RQ3A 2I9LB 5T1DH 2Y36L 4GG8A 4JO1L 5CSBA 2BSSB 4GRLC 4YZFF 1HILA 3TZVA 1W72B 2OSLB 3EO1B 4E41E 3CSPA 2V5YA 2QJDA 3D18A 4ZUVA 2XWJB 5DVKA 3RKDD 5SV4A 4V2CB 6FABH 4RZCA 4ZXBD 4YWGL 1BVLB 4JN2B 4ZSOE 1ACYH 2WBWB 4WUUD 5J4MA 3PQYD 3FMGL 5JW4R 2PCPB 3T4AA 3FONA 4G6MH 4KJYA 5FO8B 1AC6A 4IRSD 1MJJB 2YXFA 5C0BA 1TJHH 1MCWM 4X7EC 2NY7L 3SKNA 1C5DA 1BM3L 1SYSB 1KJ2H 1TTGA 3STBA 3HE6C 1BF2A 1MCRA 2MNUA 1I85A 3TYGL 3SOBL 2R29H 4AEFA 3KPSE 3C60B 3ARBA 4R26H 3T8XB 1CG9A 3B5TA 1IE5A 1S9YA 4KKAD 4LSSH 3TO4A 4PJHF 1D9KD 4FQIH 4F7MA 3TPUA 5F7DA 4YHOL 2VXSL 5HHOE 4JJ5B 3ILPB 4HZLB 1D5BB 3MBXL 5ID1A 3VXRB 1C16A 2V2TA 1LEGA 3MNZB 4WW2A 3PWJA 4M7ZB 3UDWA 4HK0A 4D8PB 2CD0A 3HAEG 5C0GB 1JK8B 1U8NA 4TNWK 1W0YT 3SDXF 1VADB 3HNVH 5T1MA 1F58H 2W38A 3QDGE 4EN3D 4PY8I 1F3DJ 3HR5A 1SHMA 4K2UH 3QNYB 5ILTL 4NRZA 3L7EB 1NGQH 3DMMB 1BOGA 2PYEA 1C5BH 3CXDH 1MFNA 4XRCA 5DDHB 3QO0B 2QHRL 2IQ9L 3BP4A 4Q2ZA 1XCQB 3RWHB 1AR1C 1W0WA 5IT2L 1ZVYA 2LQRA 3JV6A 4K8RL 4YHYB 5D71L 5D1QD 2ARJB 4HIEB 1K8IB 4OCXL 1EJOL 3WNMA 4FXGB 3KYKH 1AO7E 4TVSa 5E5MA 1KGCD 1EJOH 3MACH 3DYPA 3WN5B 3OKMB 3T0WA 3BKJH 1F6FB 4JZJC 5C09E 5JW5B 4KVNL 1CGUA 3P30L 1QRKA 1RIHL 1JI2A 2XTJB 4Y5XA 1KG0A 4H26B 3BO8B 3IFLH 3QRFM 4D9RE 1P7KA 2CIKB 1HCVA 2LU3A 2Y07H 3GJEB 1GHFH 1CL7H 1I9IL 2AEIT 5L9DH 1UQSA 5CZXD 3P4MB 3VGDA 3NZHH 3MRJA 4HSQA 4XBEH 3UBXB 1U3HC 4HIIA 4WO4C 5BVJA 4X6CB 4MMZC 3SDXA 2OBGA 4HF5L 4JQXA 1NGWA 3TN0B 1SEBB 3RVXD 5FUZH 2IEPA 4OM1L 2DLFL 1AQDB 5D96C 5DJ0B 5TGBA 3PDGA 1OWRM 3VA2C 5EOTA 4PJHA 5FFLA 3FHAA 1F4WL 2X42A 2E8ZA 2YKLH 4KH2A 4PGCB 1YY9C 3WKML 4L4TE 1BFOB 2N7AA 3F12B 2ZP0T 2EYRA 3RPIA 5J9PB 3U6RA 1PSKH 4L5FH 3QIUA 1Z9SA 4NO3A 2NY0B 2FSEA 2HMIC 4FN0A 1ZT1A 4P5TD 4L4VE 4UIMB 1X44A 4O02H 5C0BD 3ES6B 4JDTL 3W0WB 3ZHLA 3WUZA 5FHAL 3S8WA 3B6SB 1X5IA 2EH7L 1KLFA 1I1AA 4HKZB 4LSVH 3O3DA 3T0EC 1EFXD 3T0EB 4NSKA 5HHOB 5F8RC 4TTDD 4Y5VA 3WHE0 5F7HA 1U92B 4Z7OF 4Y19A 3LN5A 5I19L 4HS3B 2VLLB 3VGFA 3RI5K 4ONHA 3CMOL 4MQXC 3L3GB 5B8CA 2MKLC 3WFDL 1J1OL 3VD9A 4P2YA 1ZLSL 1JTOA 4K7PY 5JTWA 4N1HB 3AU1A 4JPWL 3UO1H 1JVKA 4MD0A 5GRUL 3NMEA 2F54A 4KMTH 4KROC 4D9LL 2FNBA 5CJXC 3BEVA 1QSEA 3I02B 3HB3C 2OP4L 3C8HA 1FPTL 3MJ6A 3MMEA 5C0EB 4L4JA 4U49A 2B8OT 3RGVD 1SYVA 3HKFA 2IALB 3ROLA 3K2UH 3VMOA 4QTIH 3MZTA 4CADB 1H15A 5EU4B 1ETZA 3QEGL 1ZA3B 1PD6A 4FQQB 4U2YA 1OPGH 1T0MB 4Z0XB 2C1PB 3UP1A 4FFWC 3RL1B 1U8OB 3UC0L 4X6CF 4LSPH 4OM0L 3CVHL 5DMYA 1KELH 1NCAH 3AY4A 4PJCA 5MEND 2R8SH 3MLUH 1HDMB 4DN3H 1FZKB 1WTLA 3RGVB 4LHUB 4OD3L 4WI4A 2JKXA 1YUHB 2AEWA 2IMNA 4KI5F 1T0NB 3TIDB 2Z0BA 4J7RA 1I85C 1K6QH 1QO3A 1H8OA 3S88H 2JJTC 3X14A 1UZ8B 3GMRA 1MWAL 1A3LL 1H3PL 1O0VA 3VXTB 2FEEI 4HV8B 1BX2B 2HFTA 2DJSA 4HBCL 2WBJC 5E00B 4BJLA 1OT1A 5KN5A 3OX8A 1IAIH 2FL5A 4PRDA 3BDYL 1VKXB 3VFMB 1ZEAL 1XGPA 5BQ7A 3V9FA 1FIEA 3KS0H 1DBJH 5D7LD 3TBVA 4A6YA 1FNGA 1RULH 2DLGA 4LIQE 3CFEA 4WIQA 5EPMB 2C9AA 1G6RA 1KCRH 2JELH 5HHPA 1WBZA 5EWIH 3K1DA 4HG4J 2XXMB 1YDPA 1QZ1A 6FABL 2X70A 2RCSL 1P7HL 1JZ7A 1S9WB 4KVCH 5F7KC 5TF1H 3FB7A 3GRWH 3CH1B 1VSCA 4WY7H 2ZCLL 2JTDA 1BWMA 4I2XB 3AREB 4GG6A 4NN7B 2FH6A 3JZ7A 3RY6C 1CICD 3KJ6H 1T03L 5KANI 1EZVX 1EMTL 4K07A 4N8VG 1G7MA 1NLBL 1RJYA 4GXVL 3KPRB 5CGMA 3OJVC 1PZ5B 3C87A 4NCC1 5D2LE 4PLKC 2OXGA 3S6CA 2HT4C 2P24B 5INDB 1NGXA 1Z9OA 1KN2L 1MRDH 2YUXA 3B5GA 2MQ3A 5IBLC 3CZJA 4S0SD 1AGCB 2VDML 1JWUA 2PXYC 4HGWA 5EBWA 4M5YL 3JUYA 5F7EL 2MOVA 4WU7A 4EDWL 2NY0C 1A2YA 1CGSH 3QPXL 4NC0B 1H8SA 2K1MA 4NBXB 4R2GD 1Y0LA 5DT1H 3L95A 2NY2B 1YEIH 2CRZA 4JQVA 4WNQA 3T3MF 4MXWL 3UJTH 3O81A 1PKQB 3SJVB 4JGJA 2DD8H 2YUWA 1CXIA 2KQNA 1TQCB 2YPKB 1A6WL 1B0RB 5FA4B 5A2LH 3QFJD 4Z76A 3VXQB 3I9GL 1PY9A 4TULH 1XCTA 4JKMA 4BSVA 5J11C 3GUTA 3UTTB 4WDIB 1CLYL 2HN7B 4JAMA 3DYMA 5FYLE 3BI9X 4JDVB 1OAQL 35C8L 3HZYA 2FHCA 1RHFA 1JL8A 4ODTH 3VU2A 2CDGA 5L2KD 3K4ZA 3WS6C 3QHZH 1KTDB 1MJUH 2ZKHH 4NP4L 2OJEA 4IMKA 4TSCH 3IDJA 3K80A 5GGQL 2R8SL 3MUGA 1FH5H 4J8RA 3VWJB 3QFJB 3OL2A 4Y4FA 5T5FH 5ID0A 1BBDL 2DQDL 3H9SE 4M7LT 1E28B 2Z8RA 3CLFL 4IRZH 4DUXA 1A1NB 3GMOA 2YEZA 4LU5H 2C7UB 4CAGA 3ULVL 4XP6H 5I1CH 1JMZA 5DTFB 4MWFA 2V7HB 3KPNA 4OGXL 3FO1A 4D0CA 2P8LB 5JLZA 1AKJB 1FLTX 1HYSD 3D5OF 5AZ2L 4Z78B 4YDVA 3G08A 3FFCD 1KTRL 2EIZB 2WUCH 3V5HB 5HTSA 4LNVA 1N8ZB 4V1DB 2WUBH 3W2DH 3R0NA 1MI5E 4XH2A 5D7KE 5IIEB 4F58H 4KQ4H 4NQDD 2F8XC 1VPOL 2ZNXA 25C8L 4L3EB 1A9EA 4NRYA 4NPYA 1VFAB 5FGBC 3HCVA 5C0DA 5T1LA 2CLVA 1ZLSH 1GIGL 3T0DA 5KAQF 1GPOH 3WCYA 2F5BL 1S7TB 3FTGA 1TCMA 1ZGLP 4K9EH 1BM3H 3CVIH 3QZWB 3WIIL 4U1GB 4KK8D 2LE9A 1CICA 3KYNB 4I5BA 5E6IB 3FOMA 1L0YA 3FJTA 1A6TB 2A2QT 4LSUH 4MA1C 1KNOA 1TVHB 4QHUB 1BQUA 4NQDA 3L3KB 1ZLUK 3CVHH 4I18C 1J1OH 3WFDH 1JRHL 2X1PA 3LS4H 1QFWL 1AP2B 2Q3AA 2DQGL 4LPTA 5TQ2H 3AAZB 1KLGB 2AS5M 4WFFD 2MJWA 2R69L 5KS9E 1NFIB 2EYSB 2W0LA 5DFVC 2VLRA 43CAA 3QHFH 3SE9H 2CRYA 2OCFD 4M5YH 2CO7B 3FONB 1KV3A 1KCUH 1HHJB 1QNZL 2XKNA 4ZO8A 3V6FB 4UB0L 1MJJA 4FNLH 5DRZA 1JWSB 2X41A 3VG9B 5KSUB 4M9OA 2I9TB 5TE4H 3GSRA 5BMFH 5HI5C 4IOFD 1DQML 3MCLH 2P5EB 4ZSOA 1I75A 1UENA 3EFFB 3HS0A 1DQMH 5GGSY 3HI5H 4XWGL 1CG9B 1BQHG 1VFUA 4CJ1A 2D9QB 1N2RA 4AG4H 2EC9T 5E6ZA 1TXKA 2PF6A 2X4QA 4YE4L 1JGEB 3O11A 3V0WL 2UY7A 3DRQB 4HULB 1UM4L 1MEXH 5CEYB 3L3IB 4H1LH 4JHZA 3H2WA 2EDNA 1EDQA 4P46B 3PWPB 4WO4B 3VXOA 5CEZD 5L2KA 3BPLC 1IAII 5F7WC 2GITB 4Y4KC 2YPLD 4X80H 4HDIB 3EYUL 3JWDL 3QEQA 5F7FA 3MCKB 3ZE0E 5M94B 1R3LB 1LILA 3BMWA 1SJXA 3C5ZA 2IH3A 3P73B 3JUZA 4WHYH 3MBEA 1DUZA 5GGUA 3D6GA 1P5VA 1T5WA 4OGXH 1Y6NR 4NFDA 2ORBH 3BZ4B 2GTZA 3P9LA 4ZS6C 5E9DA 1QBAA 2Q76A 1WIOA 4GMTH 3TWCH 4POYA 1BFVL 3MRFA 4LCYB 3W9DB 4KUZH 4XNMB 4JPVH 1DBKH 1VERA 3F65A 4D9QD 5ICXB 1EX0A 5I1IH 1IQWH 3D25B 2EYTA 1KG0B 4H26A 1Z6JT 1RK0A 4KGJA 3IJYA 4YXHL 1JPGB 3VWKA 3KJ6L 2WIIA 3CFIC 1CDUA 1EVTC 4M8QB 4K3HA 4JN1L 4S0TD 3LEXA 2BXYA 3MV01 1YN7A 5I8OH 3JTSA 4MNQB 4Z7WA 3NFPA 3I6LD 1GL4B 3T08A 1R3IH 1DQTA 5SWSB 2EH7H 4M1CD 3SQBA 4EOWH 1U91A 2DWDB 1DBAL 5FDWB 1HEZA 3HPLB 1G0XA 3VE0B 4FQXA 1K4CA 4G8GD 3GMNA 4HHAA 1GGBL 4PGDB 2UWEE 1YN6A 4EDWH 1HXMA 3G6AB 4Y8DC 3DVFA 4L8BB 2OL3A 5FKPB 2IJ0C 3QJHA 1KEMH 2R2HA 4ODWB 4NZJA 3KXFE 2YRPA 4I0CC 4XCEA 2FECL 4ELMA 3FQTB 2AW2A 2WW8A 1XIWB 3IFPB 1UJ3A 3M8OL 5AAWA 2FHFA 2X4OA 4WJ5B 3FQXB 4HJ0D 5F96L 5HI3C 4F7EB 2DJ4A 2B1HL 1BLNA 4UTBL 1OAXH 3RVUD 2WP3O 3HG1E 3VI4F 1MWAA 5C07A 1JUFB 4JGMA 4S1RH 3EO9L 3B6SA 1NDGB 4JFDB 2MMXA 3QQ9C 2BC4A 4XXCC 4ZFOL 4PUBH 1T22B 4W68A 1A9BB 5TDNA 4V1DD 2MTPA 1EEQA 5C0FA 4F3FB 3LRHA 5C9JA 1XF5B 5J6GB 2BVOB 3QUMH 1DDHB 1HHKA 5FM4A 5DRXA 2ZUSA 1MLBA 5L0QB 2XV6B 1RHHB 3IDNA 4F58L 3ARFB 4NQCD 5D7IE 1Y6MR 2WINA 1KFAL 1CR9L 3RWGB 1T66C 4J6RL 2EIDA 2YPLB 1QLEH 3HAEB 3IS0X 1R5WB 1FG2A 3UPRA 3IDMB 1BMGA 5CWSB 4P4RB 4L4VA 3CSYA 2Z31B 5D2LF 4EI5C 4PRAA 1HINH 1HNFA 2ZOLB 5JR1L 3WS6A 4J4PD 1I9RH 4WW1B 5HJ3A 3G5ZA 3RVVD 1QLRA 2APFA 2AJVH 3IDYC 4ZUSB 1NGZB 4UUJA 3SGJA 1EUTA 1KENH 2YK1L 4Y16A 4Y1AA 3T0AA 3D39E 4FFZH 5DD6A 1RU9H 3G9VA 2VDRH 5DMGD 1F4YL 4Z0BH 3TNNA 2VDRL 1AD0B 4TOYL 4KJWC 3QJFB 1QRNE 4DAGH 1XAUA 4XNZC 1U2HA 4WU5B 3EYOB 3QXDA 3GZKA 3TIEA 1FPTH 1OAZL 1JPTL 1N6UA 2K7PA 4JHWH 2OQJA 4G9FB 4YPGA 2DM3A 1ZGLA 1OTTC 1RZGB 2H32A 2X4NA 2EEBA 2FX9L 4IMLB 3GBNL 2PW1B 3S3JA 4MVBC 5CFHA 4S1SH 4LCCB 3U83A 1J1XL 4OF3A 4Y4FC 1ADQL 1FFQA 1TNNA 3X12B 2K7QA 4TSAL 3UTQA 4UQ2B 4PJ9B 4C54A 1WT5A 1AGBA 4A6YB 5IFJA 3M1BB 3C6LC 3VXNB 3C8DA 4GT7A 4GW1A 4CKVX 5DRWB 1I3VA 5IHZB 4N0YH 3RGHA 3UAJC 1TPXC 3WJJC 3D2UA 1DJSA 5I1DB 5LAXA 5F7EH 1QYGL 3EJJX 3CFCL 4QXGL 3CH1A 4Z7UA 3QNXB 4IBLT 2LVCA 4QRUB 3AM8A 3FKUS 3D69A 3WFBH 2OSLA 4F57L 2J8UF 5CILH 5GSVA 3H9HA 5T3ZL 3EYFA 1WZ1L 2BSTA 1BHGA 3QEHA 1OAQH 2HLAA 2BX5A 1JF6A 4UU9B 1FBIL 2YMXH 5DD1L 3V5KB 2XZQL 1YNKH 3R1GH 4Z7UE 3QPQC 4P2RA 2IBBA 3RNQB 3BQUC 2X4UA 3T77A 3ZTNL 3T1WA 4LCUA 5E2VH 5DC4B 1D9KA 1CLOL 3AS1A 4NO5B 1MNUH 5A2KH 5IB2B 4FFWD 3B5HA 3HE6A 3HMWL 3IXTB 1DEEB 4G8FA 3W9EA 4GQPH 1AGCA 2K9UA 1RZKH 2R0WH 4MJ4A 4NJAH 2OM5A 4M1GH 1GZPB 5GXBB 3EYVA 3GSNL 4XCYA 3QQNA 1XR9A 2AV1A 4KMLB 4BA8A 3RUGA 1QEWB 1NEUA 4LLVA 2PXYB 3S3SA 4YHYC 1WWWX 3CLFH 4IRZL 5C6TH 1KFAH 2GCYA 2ZUQC 2VB5A 1P2CA 4JFFB 4NKDB 2F54D 5FXCH 2IBGA 1HI6B 2BOBB 4LEXL 3DECA 1N5AB 1PKQA 5MEOB 2NTFA 5C0CA 4PLOB 4YFLF 2YPKA 1GGYA 2YA2A 5FYJH 3MA7A 4WUUB 5H8DA 1P9MA 2I5YL 1ZT7B 1ZT4A 3WNKA 3TWCL 2FX7H 3WDJA 4JQXC 2HN7A 1BQLH 4FTVB 1H5BB 4KJPC 4JRYE 1X4XA 5C09A 3BMVA 3TLRA 3QFJE 2BVYA 3VD7A 3MRRB 3MLRL 4I3RL 2A73A 2EE6A 3WXVL 4U1SB 4N0FB 1MFBH 4NCDA 2BZDA 1NUNB 2CKBH 4KZEL 5FYLD 4RFEA 5MENA 1YEIL 5BXFA 2AP2A 1W8OA 4J4PC 2QTEA 1KPUB 2WNGA 2NX5E 5CD5C 1YEHL 2DQEL 4HFWA 1IT9L 1J05B 1CFTA 2Y07L 4XXCA 5DLML 1IL1A 4KMTL 4D9LH 2GTWA 2V7HA 4ETQA 3RVWC 4OLWH 3KPNB 4XP4L 5JHDB 2NXZB 1T1ZA 4PRHD 4PFEA 3DUUB 3FFDA 1I8LC 3C5ZD 5KW9L 3OXSB 3LKNB 3W81A 4QO1A 5ETUA 1TFHA 3IFOA 1X5AA 5FUCC 5KW9H 3PGCA 1JF1B 1AIFA 3P0GB 4DFHA 1BWWA 2SEBA 1INEL 3MTRA 5D6CB 1FE8L 4JG0L 1X5ZA 1S5HA 3PABA 3NCFB 1FNEA 4G7VH 5HSFA 3LS4L 1BIIA 4L8SB 4OT1L 1OP5K 4MB3A 1NGWB 1NEZG 3ZE0F 4WV1C 3TN0A 4ZFFB 1FGNL 1FAIL 5IK3B 5C0BE 4ISVA 1MCIA 3REWA 4YHNB 3DRTA 3ULVH 3QUMA 3LH2H 3MA9L 5HVHB 4OD3H 4OLXH 2ZJSH 5J12C 4PJHB 4NQDE 4WHCA 2CR3A 4OIAA 4DCQA 3IETB 3CLEL 4HCRL 2V17H 2OR7A 4DKFH 1HCFX 4R3SB 4FFVC 2Q87A 1JV5A 1X7QB 1T4KB 4K71B 3QI9D 3ARYA 4OZFB 5CMAB 1HQ4B 1R3HA 1NBQA 5C0RL 4PJAF 2VQ1B 4I13B 4ORZC 4P2RD 5DJYA 3PJSA 1XH3A 3HI1A 1RFDL 5CS7A 5FIEA 1CFQB 1KEGH 3UTZB 3QQ3A 2NY2C 1IAKA 1QBBA 2GKIA 3FAXA 4WRLA 4HKXB 4M1CC 4KGLA 1MHEB 1XGTB 1JE6A 5I76A 5EB9A 3QB7C 2X4PA 3OKLB 2VMFA 5GGRY 4IM8A 2F9BT 2GJZA 5HYQA 1PG7W 4H25B 1AFVH 1RJZB 4CJ0A 1RZKL 4QRPD 4QXWA 4UAOC 4Y4HB 4Y5XC 2XA3A 3WIIH 2NXZC 2ZZUT 1OAKH 1IAOA 3OG4B 4JN2A 4GAYB 3OKDB 3JXAA 4K2UL 5IQ7H 1IGTA 1G7IA 2FWOB 1IQWL 4ENED 3OJMB 3KPLB 2IG2H 3PV6A 4JFOB 3MMEB 5C0EA 4PG9A 1SYVB 1RUKH 4GRWE 2AEQH 8FABB 3FZUC 5T1KA 4HIXL 3SKOA 4HS6A 3RVUC 2AXFA 5FM5O 15C8L 5F7UA 1K3ZA 3CPLA 4DAGL 4K94L 5GQBA 4RAHA 2MPAH 5CEYA 4Z7QE 2ZCHH 4OCWL 1CVSC 3MACL 3ARPA 4UB0H 2IH1B 1J10A 1QYGH 1A7BA 1T1YA 5FA3A 1C16B 1Z0NA 2UUDK 2A6DB 3WXVH 3VI4E 1KCSL 3MCKA 3SO5A 4NWTL 1YEFL 3U9UA 4WV1A 1NGPL 3TN0C 3V0VB 3G6JA 4I0PC 4H0HB 5E7BA 3PHQB 4UQ3A 3TYFA 3GMRB 1A3RH 5DFWH 5JIIA 1YEFH 1IAIL 4P3DB 1AKJD 4IRSA 2KPNA 3HN3A 3LS5L 4KKLC 3N1MC 4RAVB 5HHXL 1OP3K