4Y8AA

Crystal structure of the n-terminal domain of ceacam6
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
AKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Carcinoembryonic antigen-related cell adhesion molecule 6
publication title Diverse oligomeric states of CEACAM IgV domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y8aA00
1JWUA 3VFVB 2GK0A 5D7SL 1QQDB 1RHHA 4X9IA 4QNPE 2WINA 3L6FA 5C0AE 1WQVT 3BKCH 5DR5L 4JDVB 3L5HA 2GUOB 1IAOB 4WUUE 1QP1A 4XNYH 3RI5F 2IJ0C 1J05B 3I9GH 3OF6D 1TZIB 3LIZH 4J23A 4EVNA 2BZDA 4IRSC 3Q6GH 1TMCB 2FIKB 3CZFA 4R8WH 4JRXD 4HFWB 1DN0A 2LVEA 4OSUH 5JDJA 4N0CD 3IF1B 3O6FC 1OM3H 4XCFH 3LS4H 5EH1A 1MFDH 4P4KA 3CSYA 3MRCB 2HJKA 3STLA 1YNKL 4AT6B 1ZWIA 3F7PC 1D5BA 4YHKH 5E9DB 5HXMA 5JORA 4XP5H 1JZ3A 4X5XB 3X12B 5EB9A 4W81A 1OP3H 5ICZA 3EHBD 4RMQA 1CFBA 4LPYA 3NMEA 3OKOB 4LMQE 4QHLB 1PY9A 5D7SH 2D7PA 4XHQA 35C8L 3DX9A 3KPNB 5DR5H 5C0AB 3IYLW 2LU4A 1HKFA 3TA3C 1ZK9A 2GIYA 4WUUB 2NTFA 3REWA 3N85L 2ED7A 3MRGA 5DK2A 5LWYL 3OAYK 4HLJA 4Y5VB 5F7KC 5IKCA 2W0FB 3QUMA 4TSAL 3QG7L 4Y88A 4NIKB 1SJXA 5D1QB 3I75A 4XZUA 2NNAB 1S3KL 5ILTL 2C7UA 1I4FA 3E1F1 2XIDA 1I3GL 5E8EA 3ROOA 3TCLA 5D5MA 2Q6WA 5CJ5A 4HIEA 4L8DA 4YBQD 2GFBA 4QXTB 1YNKH 3HZYB 2CR3A 4X7FC 1WTLA 4APQA 3P11L 3OKDB 5J12C 4WWID 4BQCA 1AKJB 1XZ0B 1NMCB 3G08A 1I7UA 2IALA 4R6UA 4WU5B 2Y6SC 4NKDA 2YKLL 2ZUQC 3T0XA 2OL3B 4WI8A 35C8H 2VITB 4KKCD 4IJ3C 1YQVL 4UOJA 1N2RA 1R5WA 2NR6D 5GIRB 1W0WA 3KPPA 3ZKNC 1CGYA 3FRUB 3O6KL 4NPYA 5I8CB 5DI8A 4P5KB 3N85H 1L6XA 5LWYH 1R0AL 1PDKA 2FEDD 3BEVA 4R0LC 1OAUL 5DFWH 4JM2B 5JW4N 4YK4C 2HFFB 4JGMA 4TSAH 3QG7H 1EV2E 1KV3A 3CX5J 4U3HA 1I1FA 1U8QA 5CEYA 1BAFL 2Q86A 3WJJC 3I3BA 4QOKE 2VYRE 5ILTH 1S3KH 4ODTL 3MREB 1JN6B 4LU5L 4FMKA 1OTTD 1I3GH 4R2GC 4Y8DC 3LQAC 4NN5B 5T1LA 1LQSR 4LF3A 5D7IA 2RFXA 3P11H 1LP9F 1WZLA 5EUKB 5B38A 1FIGL 1QR4A 4S11A 1XGYL 2YKLH 3H9SD 4X7DC 1BOGA 5D1XA 4U33A 2DQIL 1YQVH 3GHEL 3ZE0F 2WQRA 3CAFA 3C60A 1QSVA 1YNTA 5IJKA 1EVUA 1R5IA 3WLWD 1C5DA 1LK2B 2IC2A 2V2WA 4ELKB 2VLKE 2LAAA 3O6KH 2P49B 3GSWA 4J8RB 4OZFH 1H3XA 5DJ8B 3VI4F 1R0AH 4TUOA 3V52L 1OAUH 5C0BA 1EERB 1INQA 3RNQA 3T0AA 3MJ7B 3ZT5A 3KS0H 1MOEA 1BAFH 3QNYB 4QRTA 4ODTH 1QBBA 3KJ4C 5FFLA 4UUJA 4LU5H 4IS6B 1JHTA 1MUJB 2Z93A 4WJ5B 2VZUA 4JJ5B 4OGAD 1DQML 4I18A 4CNIA 5HHMB 1EXUB 4N90E 1EEUA 4HK0A 1QLFA 4JREB 1T04A 4QF1A 1I9IL 3UTZA 1FIGH 3MUHL 2VQUA 3TO2A 2CIIB 5KVMC 1XGYH 1OSPL 5J1AB 5DMGD 3QIBA 3PGDA 4Z7QF 2DQIH 3GHEH 3QPQC 3DI3B 1MCLA 3C8KA 1P1ZA 3QDJE 1CI5A 1E4WL 1YMMD 3FQWA 3GMRB 3V6FA 3QUXB 5KG9A 5F7FA 1QKZL 2VLKB 3OAYH 4W6YB 4UT7L 1KG0B 4AEFA 3V52H 4P46C 4XCNA 2E5EA 3DOSA 2PTVA 5IFJB 2OTUA 5DK0B 3HR5A 1KCLA 1LP9E 3H9YA 4B5EA 3SDXB 3ARBA 3RBSA 5HYSB 4XX1G 4D9QD 4TVPE 4X4ZA 4MLSA 1WBXB 5C0GA 1DQMH 3VXUE 3MJGX 1LE5A 1YA5A 4IBLT 3ZE0E 1S7WA 4ZTPL 5I17A 3ULUL 3NCJL 5GGRY 1I9IH 1DUZA 1QBAA 2D9QB 4X9FA 4ZYKA 2RAMA 1AIFB 1RJZA 1YPZA 1T7XA 3FONA 3QXWA 3VI4E 5FGRA 1OSPH 1NAMA 4ZSOE 3MLRL 3QCUL 4UTAL 1XF4B 1QHOA 2D0GA 5C0CE 3FO0L 1DQQB 1E4WH 2R2EA 4HXAL 3QDJB 3FT3B 4X4ME 3VU2A 4XNXL 4GKNB 3IDJA 1QKZH 5F7HA 2NYYC 1G9EA 3G5VA 4UT7H 1EJ6A 3NCYP 4I0PD 2CUIA 1ZAGA 2PNDA 3G9VA 1LP9B 4PJCF 4A2MA 3OQ3B 5C6TL 2NY1C 1L0XA 1EEQA 2VXUL 4P2YA 5E2VL 4NNYA 4Z7QE 3GNML 1QYGL 4ZTPH 3SO3C 3DBXA 3ULUH 1RUAL 3NCJH 3FHAA 3BZ4A 3B8YA 1EIBA 3SDCC 3T4AB 3VE0A 1EVTC 1QG3A 2R15A 1BJ1H 3P2TA 3QCTL 5TQ2L 4YHYB 4G9DA 1KIRA 1UEMA 3MLRH 1IAMA 3QCUH 4OV5B 4ZSOB 2BNUA 4UTAH 4Y5XB 1HXYA 5FM5O 3VH8B 3FO0H 3MNWB 1IGFL 1HH9A 5BZDA 2YWZA 2Y25A 1PKOA 4HXAH 4XNXH 3O41B 3O2DL 3B9KD 4OIBA 5EZJA 4QGTA 3MC0A 1T21B 3F65A 2QTEA 2ZCHL 2D0HA 5F9AC 5DD5L 3KYMA 4IRJC 5C6TH 4DN3L 4G8IA 4FQLL 4HLZG 4NQED 5IBTL 4A6YB 2XN9D 3P9WB 1U92B 2VXUH 5E2VH 3DMMB 1JYNA 4U6YA 3GNMH 2XFXA 1QYGH 4H25A 1MCWM 5GSVB 4HUVA 4U0QB 3TYFB 1U3HB 2XRAL 3WN5C 1RUAH 4HFUL 2PR4L 4I2XE 1QTYT 5ETUA 2XWBB 3LVEA 4U1GB 3ZLQC 1Y6NR 1BFTA 3UPRB 3RPKA 4DEPC 3QCTH 3ILPA 5TQ2H 1U6AL 3KPLA 2PXYC 3UYOD 3UTTD 1A22B 4FQIL 4TSBL 2WSKA 5I9QC 4PJCE 4JFFD 4XWOC 3CFEB 1IGFH 5HDLA 2DKSA 3GRWL 3WSQL 2W65B 5E4IA 1R3HB 1S5IL 3O2DH 3SO5A 2Q20A 2R2HA 4YPJA 3QO0A 1EEZB 4ODUB 3MRJA 2Y72A 4U1JB 1B2WL 1N8ZA 2ZCHH 5DRWA 4KPHL 2WIMA 4JFOA 5DD5H 1JF1B 3ILQD 1HWHB 1H5BB 4OD2B 4DN3H 4KJYB 4FQLH 1KN4L 2I9LB 4KVNL 5IBTH 1FL3B 4L3EE 2UYLA 5JXEC 3VXRA 3WIHA 1WT5C 2X1XR 2Y9RT 2P7TA 3EJJX 2VDPL 3BN9D 3SDAB 2ZSVA 4CVZB 2WBJD 4PV9A 5IB1B 3D69B 5KSBF 2XRAH 3U83A 2H3NA 2GITA 3HS0A 4HFUH 1T20B 1OW0C 2PR4H 1QSFE 4U1MA 5A2FA 1P9MA 3RP1A 1TZGL 1VA9A 3ULVL 5C07A 1U6AH 3DTXA 1WJ3A 1UM5L 3GMMB 3NFPA 3OXRA 3KS0J 3HRZA 4TSBH 4FQIH 1LMKA 4POYA 4P3DA 4U3XA 1WF5A 1IKNA 3WSQH 1A6ZA 3GRWH 1R5VB 3R8BB 4JZNB 5FGBA 1S5IH 5SX4H 3WHE0 4N8VB 3HI5L 2VE6B 5GS1C 2YC1B 3IFOB 3BP5B 1B2WH 4L9LB 3OBAA 4LSUL 4CL7A 3MO1B 4IOIA 4Z77A 4KPHH 3S96A 4FTVD 1CXHA 3RWJA 3VXNB 3TESA 5C0EB 2BHZA 2OQJB 4JZOA 3S88L 1KN4H 4KVNH 3PGCB 3RRQA 4WHTA 4LHUG 2I07B 4HS3B 3QFDA 4OUOA 5CS7A 2VDPH 5JQHC 3QH3A 4DKDC 3U0PB 5FYKL 4LVNC 1P7QB 5FO9B 3MLSL 5E4EC 3JTTB 2QV2A 1QSFB 1TZGH 1NUNB 2QL1A 3C5SA 4PGBB 5BCAA 3ULVH 5C9JA 2HTKC 5C9KA 1UM5H 3J7HA 2AQ3A 1GYAA 2H2PC 3SCMB 1AI1L 5IHZB 3O9WC 1BJMA 1A7QL 3IFPB 3BKYL 4M7KL 3UTPD 4S1DD 2CK0L 3HI5H 2EYSA 2WLYA 1TNNA 3BFOA 4NO2B 3H3KA 3GMQB 5DZLA 5KSBE 4PLKD 2VNCA 4YH6A 3EDKA 4AL8L 2M8XA 3TO4D 3S88H 3VFNB 4JQXA 3D0VB 1VDGA 1MF2L 1WIUA 3ABZA 1WAAF 5SWZE 4ODXB 1VB9A 1QA9A 1YEIL 1NFDB 1P5UA 3ESVF 1MLBA 5FYKH 1MHCA 1I8LA 2NY0C 3MLSH 4M1CC 1Y18B 4N5UA 5D7KD 5AG9A 1TQBB 1WICA 2V5RA 4CAGA 1MI5E 2DBLL 3TIEA 4ZNEE 1OAKL 5GZNC 1J9CT 1F3JB 1AI1H 1A7QH 3AS3A 4LPTA 3BKYH 3LEVL 4M7KH 5EU6A 3BPNB 1LO4L 4X5WA 2CK0H 5C09A 5ICXA 5A2LH 5DRXB 3FOMB 3NN8B 4QXUL 4DZ8A 1EK3A 1IQDA 1K8IB 4AL8H 3L3KA 1WZ1L 3EOBA 1MQKL 1JWMB 4U1KB 1TJIL 1U9KA 4XNZB 3CU7A 2OZ4A 3MUJA 5L8LB 4JFPB 1MF2H 4MHHG 3CVIL 1CDJA 1YEIH 4ZFOL 5SWZB 3MV7D 1R3KA 1UB5B 1WWAX 3GSNL 1WZMA 1M05A 3X11B 4M7LT 1AQKL 4TULL 4ZAKD 5HVGB 4U7MA 5F6IC 2NW2A 4XC3L 1E28A 3W81A 5DRNA 1T0MA 2DBLH 4E0RB 3IDNA 3MNVB 1MI5B 4P9HC 3SKUD 4MJIA 4BH8A 1OAKH 4JFED 3QDME 2UWEE 1PD6A 4JDZB 4B50A 4OKDA 3IKCA 1J0IA 1JPFB 4LCWA 4P48A 1NGXA 3WFCL 4M6NL 3LEVH 3C2AL 4Y16B 3TA3D 1LO4H 4KUZL 4HCRL 1RVFL 5D2LA 3JTSB 4RAUA 1WAAE 5C71A 3CPLB 1G84A 3QZWG 2YA1A 4QXUH 1U8HA 4LKCB 5JMOC 1IGCL 3AY4A 1WZ1H 1MQKH 4C83B 3CXHJ 4ZFZB 1TJIH 2AKRA 2CXKA 2BOCB 4F3FB 1KTRL 1A1OA 5CZXD 4GOSA 1MPAL 1DBKL 3BGMA 3CVIH 3OTTA 3LRGA 3QUKB 3HZKA 3GSNH 2BY0A 4R3SB 1AQKH 3HZVA 3KWWA 4TULH 3S6CA 1KT2B 4E5XB 1I75A 1C12B 4KGLA 3PWJB 4XC3H 5DJAB 5INDB 1MHEB 4N0FA 4PJIF 5ESAA 4MDJB 2IBZX 2E8YA 4BFGA 1QPXA 4MNQD 1ETZA 3QUYB 3WNPA 3BEWA 4P99A 3QDMB 3BSZL 4HUNB 4JFXA 1U8MB 2UWEB 3F5WB 3WFCH 4M6NH 5IM7A 3C2AH 4G9FA 4E42B 4KUZH 4HCRH 3ZKND 1RVFH 3B5TA 4U6XA 1CQYA 3GSRA 4TQEL 4C56A 3QA3A 4MAYB 5JHDA 1AGCA 1A4JA 5E24E 5DVNA 4NN6C 1JBJA 1KTLA 1CICC 5JNYA 1IGCH 3U2SB 1F90L 4F2MA 3HB3C 3NIFF 1MPAH 1DBKH 1NCNA 2AV7B 3VFTA 5F1IA 4PJ9D 3WFHB 1WBZB 3O45B 3ZZ1A 2FJHB 4PRAA 1MVUA 3PWVB 4LRNL 1T83C 1FLRL 1I3RA 4W70A 1M6OA 3DUUB 1KGCD 2KPNA 3FCTB 1WWWX 2IAMA 2BHUA 3RY4A 4GKZB 2ZG2A 5FCSH 3IXAB 4P2QE 5D6CA 1MCNA 1ORSA 4LSDA 3LKPB 3BSZH 1YQ2A 2EDQA 5ID0B 4HDIB 3IU4L 5DD0L 3G5YB 4EI6B 2AXGA 5DJYB 4IMLA 1F02I 3A6CL 5L6YL 1OWRM 2OL3L 4PRDB 4TQEH 1HEZB 4ZPVB 4GAFB 3ESUF 2ADIA 3DECA 5IV2B 4OGZA 3VFPA 1F90H 4XRCA 2DWDB 5ADOL 3V0AC 2IANE 1QNZL 1Q9WB 5L2KA 2H6PB 3VFOA 1JTOA 4PJIE 4WTZG 5CWSB 2YPVL 1UA6L 1FYTE 5JXAL 4LLWB 1GIGL 3LKQB 3L3JA 1P5VA 3P4NB 4KI5C 1I7RA 4W4NA 2GJ6D 4M43L 2CLVB 3I02B 1H8OA 4LRNH 1FLRH 2Q1EA 4HIJA 4HIHA 2AK4D 5IVXA 5HHNA 1G0YR 1V7NL 4LSVL 4YHPA 3V5KB 4MX7A 5I2IB 5I73C 1A4KA 2WW8A 2BVPA 4KV5F 5EZLB 1BJ8A 4P2QB 3QPQD 1N3NA 1T7ZA 4G8FB 4KKAD 3EYFB 43CAB 3IU4H 5DD0H 3ARFB 1B9ZA 3IFNL 3NIFE 5FYLD 2AEIT 2H9GA 2NXYC 3A6CH 5L6YH 2OL3H 1T22A 5IMKA 3VFRA 4OFKA 4OGYL 2VLJE 1QFOA 1T6VN 4P46D 2D2OA 3BQUC 3BP4A 4ZUWA 3SDDC 4F7CA 1HHJB 3WDIA 1CE6B 4OAWB 4E41A 2X6MA 2W91A 2XOTA 4JKMA 5ADOH 2BVOB 2LU7A 4CBPA 4IOFC 1QNZH 1FG9C 4L4TA 4HIXL 3IDYC 2IANB 2YPVH 4LHUD 3VFMB 3VXTA 1UA6H 2AJ3A 1U8KB 5JXAH 3ZYIA 3L95B 3SGKA 1AGEB 1FYTB 1PZUB 4IMKA 1GIGH 4GW1B 5EO1B 2GSIB 4M43H 4U1IA 1JUFA 1ZT4A 4KMQA 1IZKA 4ONHA 3NFNB 1FZJB 1G7PB 1R3LA 4QRQA 4JKKA 3TFKC 1V7NH 2W9DL 3GB7B 2R2BB 4LSVH 4HUMB 3ZKQD 2FX9L 3EYVB 1TQCB 3GJFK 5F89B 4ZG1A 1MLCB 1UQSA 5KSAA 2PW1A 4PJXF 2I5YL 8FABB 5IVXF 2C4FT 3IFNH 4QHMA 4FRWA 3FMGL 4XNQA 5F7EL 2F9BT 4BH7B 2NYYD 4KK5D 4OGYH 1UYWL 1FORL 1J0HA 1FC2D 4F58L 2VLJB 4X9BA 1JPGB 4ZOCA 4NN7C 4XH2B 3LEXB 3LB6C 1IAOA 1J0JA 2JB6A 2R0WL 4J3WA 4F37K 4F9PA 4HJJL 3WS6C 4NQCA 4QRPE 3GBML 3VGDA 2NY2B 5SX4I 4HIXH 4PLNC 2NY1D 5F7LB 4H0HB 2ERJC 2FO4B 4EQ3A 1OGAB 1LGVA 3J8F7 4HFWA 1QPPA 4DUXA 2P5ED 3VXSE 4YGVB 3IF1A 1JPTL 1BMGA 5JA8B 5FK9B 4YHIA 1CGSL 3MRCA 2W9DH 4HG4J 1FNAA 5D96B 4M4PA 2X1PA 2FX9H 2CUHA 3FT2A 3I6LD 3S36X 4DK6A 3L7EB 4M03A 4JRYE 4X5XA 3WFZA 3X12A 4N0RA 4KJPC 2CO6B 2I5YH 3RVTC 3TZVA 1M7DA 1BD2E 2E9BA 3FMGH 5F7EH 1HN1A 1XCQA 2EEDA 5C92A 1UYWH 1FORH 4F58H 3VWKC 5SV4A 2R0WH 3PWUB 4J1UB 4HJJH 1DQJA 1KYOK 4PTTA 3GBMH 4IRJD 5J6GB 5I1AA 4H5SA 1QFWM 4K3GA 4QRPB 3VDCA 3L7FA 5DO2D 3QUZB 4XPGL 1H9VA 1TLKA 4KK8C 2Z4QB 2GY7B 1TVHB 2NQCA 4OIAA 4X4XB 3OXSB 1H3VA 4PJXE 3VXSB 3RWFB 2QLVB 4TVPL 1JPTH 2HLFC 4NQVB 1OTSC 1WLHA 4GG6E 2E3VA 5FYJU 1FVDA 1ADQL 1CGSH 1T5WA 4HUWA 5LGJA 4R4FL 5TDNA 3T1WA 1GH7A 5GS2H 5DDHB 2PXYD 4IRSB 5HBBA 4K3JL 3WUWB 3ARUA 4XWOD 1IEAA 2YMXL 4JRYB 1XZ0A 1Q1JL 4HKXB 4U2ZA 2D9CA 1BD2B 4K3EL 1HXMB 4YZFF 1UWXH 4P2OB 4Y19D 2QJDA 2IMNA 1IC7L 5TH2A 4M62L 4Y4HC 2X4RA 4UINL 3RKDC 3DURA 4PGDA 5H35A 4JAMB 5I76B 1GVIA 4P2CG 2VXVL 5I8CA 4JFZL 4P5KA 2D7OA 3LN4B 5JXED 4XPGH 3LN5B 5IW6B 1FG2A 3HPJA 5J11B 4PGEA 3U0TB 4DAGL 4QYOB 3D3VE 1I7ZA 3OG4B 1IEBB 3O3DA 4RGNC 4X6EB 4TVPH 2E7MA 4AMKL 4PJXB 4X99A 2VDOL 1KJ3L 5F9DC 1FNHA 3VCLA 1NCUA 3DO7A 2H8PA 3CUPB 1ADQH 1T1ZA 4GG6B 4R4FH 2C3VB 2Q76B 4P23D 1EHXA 5HJ3B 4K3JH 4NM4L 2YMXH 5DURD 5IMLA 1Q1JH 5E1AA 2YD9A 2E6QA 4K3EH 5CKAA 2XZCL 2Z31B 4N0YL 4GSDL 4LCYB 1IC7H 4Z76B 3FFCD 2E6PA 4M62H 1WUNT 4UINH 2W0LA 2WBWB 4X4YB 3EJYC 1EZVX 4PJ8D 3GUTB 1VCAA 5CHNB 2VXVH 1CD0A 4JFZH 2JJTC 3RY6C 3O4LA 3SKOA 5K33A 5IK3A 2GJJA 4I3SL 2WWKO 5KAQG 1MRCL 2DF3A 1KCRL 1YEDA 4DAGH 1PQZA 2X7LA 3GSXB 3MFGB 1HCFX 3RGVA 4AMKH 3D3VB 2VDOH 1KJ3H 4ISVA 3THML 3W9DA 3NCYS 3S37X 2PYED 5CEZD 4MGXA 4LK4A 3T3PF 2OXHA 5EBLA 5C08D 1M71B 2L0DA 2CR6A 2XPGA 4NM4H 4HD9A 2H2PD 3RWHB 4ZXBD 1P84K 5EC2A 2Q3AA 3O9WD 5HHQA 4FQQA 4MSWA 1D6EA 3D85D 2XZCH 2N7BA 4N0YH 5J1AA 4GSDH 4S0TD 3LS5L 4Y4FA 1KIUA 4YBHA 1IM9B 2YPKB 4C57C 4I9WD 3U7AA 1UWEL 2X44D 1AGBA 3H8NA 4MWFB 4I3SH 3NPSC 3HE7D 5JZ7D 5B3JF 2XY1A 3ORJA 5IG7B 5IFJA 1MRCH 1KFAL 1KCRH 4JKPL 3DROA 1WVZA 3SDXA 1ES0B 2JIXD 3VXOA 2JKXA 1T03L 1CDBA 2NY0D 5D1XC 4M1CD 5F9WB 5ELIA 3KLHC 4JO3L 3THMH 5ECJE 3EGSA 5IJKC 2DN7A 5IQ9A 2PO6C 2HT4D 3QULA 1CXFA 4HH8A 3UPCA 4OM1L 1IC1A 4QTHB 1A9BB 1MSPA 5E0QA 3SBWC 2FLBT 2W59A 5GZND 3KLAB 1BZ7B 4RIRA 2NY6C 4PJGA 2EDHA 2VXSL 1B6DA 5DLML 5I16B 3MBEC 4GKOA 4WRLA 4J3SA 4J3VA 4M7ZB 2C4XA 3RTQA 1RD6A 3KJ4B 3LS5H 1FNEA 2OXGA 3IDGA 1YN7B 4DWHA 1DEDA 1DQQA 3RZCB 5D1ZA 5F3HB 2BVEA 3GIVA 4GKSA 3T3PE 3HE6A 3MRDA 4PRHD 4WWKC 1KFAH 3U9UA 1NGWA 1F45A 1MY7A 4JKPH 3T08A 4L4VE 5B8CC 1HNFA 1ONQA 4P5MA 1T03H 2ZUSA 3ARYA 5IWLA 5IJVB 3CDYA 2FO1A 1MCWW 5BRZD 2IH1B 4JO3H 1JZ4A 4JKLA 4ZPTB 2VLRA 4POZC 4OM1H 4AQOA 5CZKA 4Y8AA 3GMPB 3RWDB 3ALPA 5CMAB 5ISZE 3GJFA 4F33A 1FZOA 4LPVA 3QHZL 4BSVB 2HJLA 2F15A 2VXSH 3TBVA 1AR1C 5DLMH 2JELL 5B3JE 3H7BA 1GOFA 3HAEA 3IETA 4U6VL 4OV5A 2ZJSL 4Y5XA 4YHNB 2W92A 2YPLD 4YC2C 4OFPA 5GPRA 1C7SA 3VDAA 5I8OL 1D9KD 3O41A 1K4DA 4QXGL 5BQ7B 4YDLB 4LMQI 4TTGA 5E2JA 3N9GL 5EIIA 5JW4M 3PQYA 5AD0B 3WHXA 1X5XA 4PD4K 4BK5A 3QRFM 3TGXA 4ORZC 4L4VB 3E2HB 1N7ML 1IAII 1G7QB 4XAKD 3KPQA 5CGYC 3C8HA 4A6YA 1NMBL 3LD8B 1KLUB 1XGPB 2C1PA 3BZDA 3UCRA 5KANI 3DMMA 4PLOB 2FR4B 1JI1A 4X7TB 4GW5B 1ZS8B 4DFIA 2OJZL 3UDWC 1U0QA 2VISB 5ISZB 3QHZH 4YNYA 3RVUC 5KN5B 2WIIB 4QRRD 1AD0B 1KPRB 2NXZD 5BJTB 2JELH 2EDKA 1CFSB 3OF6A 4U6VH 3MNZA 3I85A 2ZJSH 1IGYA 3HNTL 4IHOA 4R7NB 3AB0B 5DFTA 5F9OL 5I8OH 4YEEA 1CICD 3OGCA 3C5JB 4QXGH 2WWMD 3N9GH 3B9VA 4NBXB 3PXJA 3KPSD 3SDCB 2P24B 2Q7YA 4WI7A 5LKNA 1EEYB 1QUNA 1JGDB 3OKKB 1I1YB 3SE3A 1H5BA 1BFOA 1N7MH 4KJYA 2I9LA 3MLXH 4P9ML 1RIUL 1FL3A 1NMBH 2YK1L 2A2QT 2HVJB 3LEYL 1SEQL 4V2BA 3KXFD 5CP3H 4POUB 5E6IA 1CXIA 2P8MB 2XKNA 1HKLL 5IB1A 3FB5B 3IAQA 3D69A 3AS2A 4CGTA 2OJZH 4MQ7A 1T20A 3SE9L 5IEKA 2P1YA 1ZT7B 3CFIC 3JSSA 3C5ZD 2DQGL 1UG9A 5KSVB 5I19L 1BWMA 2X4OA 3HNTH 4R96B 4M48L 1Z5LA 2FECL 2RJMA 5F9OH 1I7TB 3MLPA 1OGTB 3U6RA 1EFXD 4Y1AD 4YFLI 2R1YA 4U1SB 3V6OA 1AGDA 4M6OL 5AYUL 3ZKXB 5B38G 3ARZA 4UV4L 5C0FB 4L9LA 3HI1A 4LSTL 5DJCB 5EUOB 1PBYA 4AIOA 5LAXA 1J10A 4YGAB 1X7QA 4XHJD 4X8JB 4P9MH 1N6UA 1RIUH 3QIWC 2YK1H 3LEYH 5I9QB 1SEQH 1T5XA 4FNLL 1BQSA 2CK2A 1BZ9A 1HKLH 5LVEA 5HHVL 2YWYA 4Z7UF 5FO9A 3SE9H 4NQDE 5FYKU 5IQ7L 2A73A 2DQGH 3T77A 4PGBA 3NCBB 2F5BL 5I19H 4K9EL 1PLGL 1B6UA 2NXYD 4LEOA 1CDUA 4C4KT 3AXLB 2YD5A 3B5GA 3BP6A 3BQUD 3QHFL 2ED8A 4M48H 3SDDD 4ZDHA 2VDNL 1VEOA 3QDGA 4NFDA 4YE4L 4JFDE 2C9AA 1P6AB 4M5YL 4AYFA 1TNMA 2H32A 4ODVL 3L5JA 4IOFD 4EJ1C 4M6OH 2LAGB 5AYUH 3CVHL 3BZEA 4NO2A 1OD9A 4UV4H 3GMQA 5HYFA 3P3YA 1LO0H 5C0DB 3HI6L 4LSTH 1GC1C 4Z7VF 4RMRA 3PE9A 4WTWA 1P69B 2YR3A 3LKSB 1J8HD 2AEPL 3D0VA 3PDGA 1K5NB 1IKNC 4FNLH 3T2PA 3UC0L 3TFKD 3TVMB 1NFDA 1KB5B 2DTSA 5IHBA 1PYWB 5FDWA 3V5HB 3MLZL 3OKYA 1J0ZA 5HHVH 1VHPA 3GMNB 5A1AA 5IQ7H 5DC9B 1XF2B 3ZDZF 3V2AR 2F5BH 2AQ2A 4K9EH 1PLGH 1X5YA 1E4XL 4J4PC 3LRSA 3QAZC 4JG0L 1KJVB 4JRXE 4NZRL 2V2XA 3QHFH 5AZEL 2VDNH 3LB6D 3HPLA 1MNUL 5KBNC 4YE4H 4M8QB 4M5YH 4JZJB 4ODVH 4JFDB 2BSSB 3MXWL 3CVHH 4YPGA 3ULUC 1YJDL 2HRLA 3FHQA 3HI6H 1O5DT 3NN8A 3MRMB 3VWJC 1ZGLB 3VJ6B 4U1KA 3BXNA 2IPTL 2AEPH 4BKLB 1A7OL 5T1KA 3RWCB 2EIBA 1U3JA 2EYRB 3UC0H 5F71A 1YYML 5BO1L 1UB5A 1S9VB 3MLZH 3T1FB 4PRID 1CWVA 3UBXB 1E6OL 2AERT 5CSBA 3C8DA 4N9GB 2DLFL 2FZ3A 3QBTB 1XGRA 1E4XH 3C6LC 4JG0H 4JQVA 4PY8J 1PG7L 4Z7VE 4K94L 4NZRH 1KPUA 3VWKD 4OJFL 4JDZA 5AZEH 2YD1A 1VPOL 1JPFA 1I1AC 2E7CA 1HHHB 1MNUH 2ZZUT 2E7LA 1I8LC 3VW3L 3DUSA 4OF0A 3FQRB 2P8LB 3MXWH 1YJDH 2V17L 2ZNWA 5CSGA 1RZIB 4RMSA 3KYKL 2H26B 1C08A 1U8IA 1E0OB 1WC7B 3D25A 1BGXL 4KUCD 3ZDZE 3AREC 2IPTH 3MCLL 3MR9B 1A7OH 2HLFD 2X05A 1BBJA 1IE5A 1YYMH 4AENA 1T66D 5BO1H 4OZGF 4R3SA 1D5MA 3UZVB 3X3FL 1C12A 5FA4A 2E7HA 2P4AB 1E6OH 3B6SA 2B2XL 2CLRB 2DLFH 1V3JA 1GGUA 3TBWA 1A7BA 3H42L 1PG7H 4K94H 3QUYA 4LLVA 3VGHA 4IDJL 4Y4HD 4Z7VB 2JJSC 4OJFH 5FF6B 4I0PA 1FC1A 4CU8A 1P7KB 1VPOH 5C1MB 4OI8A 3VW3H 3NCMA 3BD5A 4XNMA 3UJIL 1GGTA 4MJ4A 2V17H 5F6IB 5EU4B 1A0QL 4LLYB 3KYKH 1P7HL 1JGVL 2NMSA 4E9LA 4PGCB 1BGXH 3MCLH 4G6ML 4RGND 3MMEB 4KTEL 3T8XA 2HVKA 2BVYA 3MACL 2X10A 3PHSA 2IPKA 3VRJA 2YUWA 5B39A 5F72S 3R8QA 1FL6B 4WU7B 3PWVA 3X3FH 5HYQB 3LKRA 2B2XH 1SYVA 3FCTA 3AY4C 4Y5YC 4OZHA 3B2VL 2ADGB 5AG8A 2AI0L 3B9KA 3T65B 3H42H 5E95B 1KXVC 1ERNA 4IDJH 3LKPA 1RPQA 3AM8A 3T2OA 5FUCC 1S9YB 5C8JA 5FECB 4OCWL 2X4UB 5IEHA 4KHTL 4EI6A 2PF6A 1KUMA 3UJIH 4APQD 1OTUC 4BKLA 2MSPA 3DRQB 1BLNA 3O8XB 3HHRB 1AGFB 4OZGE 3RY5A 1A0QH 4JPWL 1JGVH 5GZOC 4Z7WF 5ANME 3T0EC 4PJHA 1QVOA 2DWDA 3B3IA 3DV6B 4G6MH 3FQTB 4PJ7F 4KTEH 2CO7B 1JZ5A 5CWSA 3MACH 1NEZB 1ZSDB 5FO7B 4RSVA 4KFZC 4PY8I 1KCKA 4HQQL 4Q74A 2VABB 2OTWB 3KLSA 2P8PB 1KIPA 3MV01 4P2RE 4FP8L 4YR6B 1S7TA 2HN7B 3B9EA 2VWEC 4JFFA 5MI0C 3E6FB 2D7NA 5H37G 3VFGL 3HCVB 4PRNA 1C8PA 3B2VH 3ZTJH 2AI0H 3SKJL 4PD4J 4MXWL 1UADC 5K9KA 3OKNA 1YEGL 5EZLA 2NW3B 4G8FA 2CPCA 5HI5D 3AVEA 4OCWH 4D9QE 4KHTH 1QFHA 3KPRD 2NX5E 2IQAB 5F9JA 4EI5A 1I8KB 1EO8L 3VMOA 2A83B 4JPWH 1P2CB 1VFAA 1HHJA 4OZGB 4OAWA 1KJMB 2UVEA 5HGHA 5INCA 4MA3B 5GGQL 5D1XD 3QFJE 3W9EA 1MEXL 5F8QC 1NDMB 3KLHD 1U8KA 4S1RL 5DQ9A 1YY8B 4WFHD 2PO6D 3KPOB 1FYTA 5ALCL 4RRPA 1UEYA 4WGWB 3P0GB 3BPOC 4HQQH 4PJHF 5EU7E 2A6JB 3JWDC 5C0IB 4FP8H 3DXAA 3ES6B 3PABA 4LFHG 3CC5B 1FZJA 1LDPL 4P2RB 1V8HA 5L0QC 1YC8A 3VFGH 4FQXC 4Y2DA 2O93L 2R2BA 3PNWA 2VIRB 2YEZA 4NBYB 3SKJH 4MXWH 4Z7WE 1YEGH 3CCHA 4U0RC 5F89A 2NPLX 4R4NC 1YUHA 4AH2A 4PJ7E 8FABA 3SY0B 4GRLC 4P4RB 3KDMB 1EO8H 2NX5B 4WI3A 5GGRB 2PETA 1H3PL 7CGTA 4M3JA 5DEGB 3TN0B 3N1GC 4WWKD 3M1BB 4XH2A 5BOPA 3K3QA 5EOTB 5HGGS 3STZB 1Q8MA 4QWWC 5DK3A 3BJ91 5GGQH 4OZ4B 1RMFL 2CH8A 2E7BA 3DSNA 3QIBD 1JL8A 3QG6B 1MEXH 1TTFA 2QADB 4EXPX 3QFJB 4EQ2A 2VLLB 4S1RH 3MGAA 1OGAA 3S9DB 3UEZA 2DI9A 5ALCH 3BP7A 5JIKA 1Q38A 4I0KA 1S8DB 2OLDA 2VXTL 3BGFB 5ACLA 1PJ9A 3FRPA 4KKLC 4ORGA 4C59B 1LDPH 1GGBL 3ZSSA 5MEOA 2EC8A 4WHYH 2VKWA 3ARBD 2AJZB 3FB6B 1QZ1A 1ITCA 2JK5B 3QIUC 3MROA 1GL4B 4XCCL 5HYEA 4P5TC 4Z7WB 1QEWB 4X5LA 5TE6L 5JDSA 4PJ7B 4PJAF 1Q72L 1VADA 4NQEE 4P57B 2XN9E 5EO0B 3S98A 2EKSB 3BIKB 1H3PH 1X5HA 4KH2A 2FECI 3LHPL 3PWUA 3MOAL 3MV11 3DPBA 5CBEA 3NGBC 5CGTA 4NWTL 1RMFH 4K7PY 2QKIB 1CZ8L 4XXDA 1RU9L 1G6RA 4HKZB 3QUZA 3D5OF 4FFYL 2LTQB 1S9XA 1D3CA 3SGJC 3VFWB 2VXTH 3RWFA 4G6FD 3RL2B 2F54A 2XQBL 1GGBH 4NN7B 1M7IA 3L9RB 3HNSL 1R3IL 5DDHA 4KRLB 1BOYA 1T4KB 4XCCH 3RX7A 4IRSA 5FYJD 5ITFA 1CG9A 5TE6H 2G9HB 4IIQB 1Q72H 2QQKL 5MENE 1J7VR 1CFTB 3O6FA 3FTGB 2VR9A 5T3ZD 3S3PA 2CKBB 3MJ9L 4PJ5B 2CXGA 3LHPH 3HFML 3B4NA 3MOAH 5I76A 1RJYA 3MV7A 4DFHA 4NWTH 4BUHA 3K8MA 1CZ8H 1WWCA 1INEL 1RU9H 5IB2B 4FZEL 2EDJA 3LN5A 4MNGA 4FFYH 3L3OA 5IB5B 3U0TA 1IVLA 4EUPA 4QYOA 1QR1A 3EOAB 3C87A 1IEBA 3JV4A 4JN2B 4PJAE 4HAFA 2BC4A 2XQBH 4NJAL 3DRTA 3MODL 1PY4A 3BD3A 4GG6A 1FZKB 1UC6A 2VDLL 2C3VA 3HNSH 1TIUA 3EZJB 1R3IH 2A6DB 4Y5VC 4OF7A 3G9AB 4FTVE 3EJZD 4JHAL 3OB0K 5GSRA 5JR1L 2QQKH 4LDEB 5D1QC 3KYAA 2L7JA 5MENB 1Q9KA 4R4BB 3ZE1E 4NQSA 1DBBL 4YFEA 4BYHA 2BFVL 1BX2A 1YMHB 3MJ9H 1RURL 4ELMF 3VGFA 5DUML 2WBJB 3HFMH 4MYWB 3VG9B 2R1XB 2UUDK 2BMKB 1PKQE 4Q6IB 5EN2B 1FN4A 5TDPB 3MLTB 2KL6A 3CDGB 1INEH 4KRMB 4FZEH 4MCZB 1NMCC 4RGMB 4CJ1A 1G1YA 2DQDL 3UTQA 1KTDB 4JO2L 5CIPA 2QHLA 4L3CB 4YDKL 5HPMB 4X0KA 4B53A 5GRVL 3NA4A 4PJAB 3OG6B 4NKQB 4NJAH 4ZUTA 4TNWK 3QEHB 3MODH 2OMBA 4KK6D 1TFHA 2DJSA 2HYMA 2VDLH 3GGWA 3ARVA 3VA2C 4NZTL 1LEIB 2IADB 3VXRD 4JM2C 4K3DL 1SMOA 3RAJL 1S5HB 4JHAH 3RWHA 3RWGB 5BV7L 5JR1H 4FTVB 2EEAA 4YO0B 4JR9L 2G2RB 3HZMA 1EHNA 4Z5RB 4YXLL 3WJJA 3PF2A 1DBBH 3PXHA 2BFVH 1DR9A 1RURH 4DJMA 5DUMH 4OBRA 1RK1B 1IM9A 3QXTA 4PG2C 3QI9B 4NN5C 5AAMA 2ARJA 2VDML 1GZPB 4JB9L 3RNKA 5GGTA 1UH4A 1PKQB 2XZQL 2BERA 3OKEB 2XZAL 5I75B 4G43A 2DQDH 3MYJA 2LVCA 3BUTA 1CLYL 2AK1L 4JO2H 3L5WA 2FATL 4PR5B 5DQJA 4YDKH 4Y7MA 3FB8B 2NY3D 1JCKA 4QRUB 3TLRA 1XGTB 1NGYA 3U7YL 3DX8B 1W72B 3O11B 4ELME 4NZTH 1TXKA 3QQ3B 5IR1A 4K3DH 5A16B 3RAJH 4EXKA 1FPTL 4O2EA 5BV7H 3V5DB 5HYJA 4NRXB 4JR9H 4GXVL 4XX1E 4LPUA 4YXLH 5DD3L 2CIKB 4NKOB 3BESR 3VGEA 1ZHLB 1TCRA 3NTCL 5BXFA 4DCQB 3P4OB 3B8SA 4ODHL 3WNKA 2VDMH 3RZCA 5M95B 4JB9H 4D8PB 4LL9A 2R4SL 4JREC 5F3HA 2GJ6A 4GAJL 4MXVF 5D4QA 2XZQH 1SEBB 1NUFA 2VDQL 4DKEL 2XZAH 4G6JL 3TP4A 4JPIB 2AK4A 1CLYH 1P4BL 2AK1H 4JFEE 5GGSB 2FATH 4M00A 3UO1L 3R0NA 5H94B 4NRZB 2NY4B 1RFDL 3G6JA 4HW6A 1A6VL 4WW1A 2IH1A 4XVJL 5ENWB 3U7YH 4ZPTA 1KB5L 1A6TA 4KZDL 5F7DB 3QUXC 1SHMA 3C6LD 3RWDA 5CMAA 4YAQB 4ELMB 1FPTH 4D9LL 4Z6AT 3PP3H 2Y06L 5EG6C 4GXVH 3N50A 1NMAL 2ARWA 1NANH 5DD3H 4XI5C 3UAJC 5D2NB 3RX5A 2VZOA 2PN5A 1UXWA 3QEQA 3NTCH 1A9EA 4ODHH 4EN3B 1JPSL 3ARED 4ZAKB 2HA1A 4GUPB 3TNNB 2R4SH 4HH9B 5BQ7A 4GAJH 4PJBA 2DI7A 4R90L 2AGJL 4YWGL 2VDQH 4DKEH 1BVKB 3K8KA 4G6JH 2ICWJ 2EXYC 5EFIA 5EU6D 1P4BH 4NP4L 1E4JA 4MNQE 1Z9LA 1JNHA 2EH7L 4JFEB 2JJWA 2VZVA 4OLVL 5C09D 3UO1H 5HTSA 5KSUB 5GQBA 3GSQA 1RFDH 1A6VH 4XVJH 1KB5H 2F8VA 4KZDH 1S7UB 4K7FA 4GW5A 5IF0A 5FIEA 3D18A 2XZZA 4D9LH 3F12B 3BAEL 2G75A 3NA9L 4MXVE 1K85A 2Y06H 2J6EA 1FFPB 2SEBB 1NMAH 1BIHA 3TEUA 5IWLC 3IU3A 3DSFL 1GAFL 5JW5B 3BISA 4WEBL 2AXFB 5BVJA 1FL5A 1JPSH 2YD7A 5T3XE 4MJID 2G5BB 2YN3A 2X1QA 5I1CL 1KGCE 4R90H 2AGJH 4YWGH 5DUBB 4LCWD 3JWOL 2IH3A 3SDCA 5J4MA 4NP4H 1W0VA 2WLZA 4XBGA 4YHYC 2EH7H 4NSKA 4OLVH 3EO0B 2GTZB 4Y5XC 4PJBF 1MCQA 1OT1A 1D5XB 5M94B 2HVJA 1FGVL 1BP3B 4ZFGL 4MA8L 2P8MA 4X6DA 3LV3B 5FO8B 3IJHA 5CEXB 3OMZA 3MRKB 4HC1L 3DX7A 4WW2B 3TT3L 5FOJA 1G0XA 2WK2A 3BAEH 2HT2C 3NA9H 4OZIB 3ZT7A 2D3VA 3SJVE 4W68A 3DSFH 1GAFH 1OTUD 5C0RL 3V0VB 4WEBH 4G8GB 4PJ9B 3MLVL 3DMMC 5C0ND 2VUYA 1I7TA 4OCXL 5GZOD 2OR9L 3MUGA 1U3HC 5MEPB 4G6KL 2KUTA 5A2JH 5I1CH 5IVZA 3WN5A 4U1GC 5C6PB 2ED9A 4MZ3A 1NBYB 3RQ3A 4GW4B 4GLRI 3PIQB 3JWOH 4G9FD 1UB6A 5DJ0B 3RWEB 4Q2ZB 1CL7L 5EUOA 3SQOL 4BFIB 5I18L 1OVZA 1UJ3B 2VSCA 5JHDD 4X8XA 2PXYA 4QGYA 4MD5A 1FGVH 5FYLE 3KNBB 4ZFGH 1FRGL 4MA8H 3U4BL 5EZOL 1FV1B 4KI1A 3RDTB 4LNRA 2X4SA 4R7DA 4ZQKB 3H0TB 4HC1H 1UVQB 3U30B 3TT3H 3ZKMD 4NYLB 1U8JA 3EO1B 5F70A 1H5BC 4X6DF 4FA8A 2ICWI 1C5BL 3SJVB 5IB4B 4U1HA 3AXLA 3CD4A 1QACA 4GXUN 1U8PB 5C0RH 2JF1A 4GMSL 2Q8AL 3MLVH 5JXEA 2IAMD 1GCFA 4OCXH 3SDAC 1OAXL 2OR9H 3WUZA 1ZE3C 1DDHB 4G6KH 5T1MA 1AHWB 2YRPA 4PJDF 1EGJL 1OW0A 4LGRB 1FZMA 3HUJA 4AJ0A 3GKZA 1ZOXA 2XNAB 4BA8A 1QSEE 3OL2A 1CL7H 3SQOH 1XCTB 1KELL 5I18H 4LLDB 2V7NA 2P47B 4X7SL 6FABL 3S4SA 3VRIB 2FYYA 1KULA 3AC0A 1FRGH 3GSOB 4PREB 4UQ2B 3U4BH 1NBZB 5EZOH 2I9TA 5DEFB 3RWIA 3PHQB 3RVXC 4L9LC 4WO4B 5GS1A 1HQ4A 3OR7B 1T7YA 1KJ2A 4ERSL 4NRYB 4XT1C 4HPYL 4MA7L 3W11C 1SJEA 3IVKB 2J8UF 4KK9C 5DF0A 5IGXL 1C5BH 2XKUA 3FL7A 1V05A 3S5LB 4LHUB 5C2UB 4G5ZL 3QIWB 2X1OA 4GMSH 4ZUSB 2Q8AH 4I8DA 2ZUTA 2P5EE 5CD3B 2D7MA 4ALAL 3U9PL 1OAXH 4X98A 1GZQA 1K8DB 5GRXG 2X4TA 2DQJL 4JZJA 1NGPL 1ZA6A 1XMWA 4X6BB 1HI6A 1EGJH 2QR0A 4ZUVA 1I8MB 1AE6L 5F1NA 3DVIA 3FQXA 2I25N 4F7PB 4GAGL 3QWOA 1MHPL 1KELH 3I6LE 2Y07L 5C08A 5CSZA 3K0WA 1QSEB 1Q94A 3CLFL 4PGZA 5GGUB 4X7SH 4KKLD 6FABH 3SCMC 1EBPA 1CQKA 3RWCA 4LLMA 4E41D 3HUJF 3X14A 4MNHB 2DD8L 1AXSB 3O9WA 3VRLF 4XP1L 4H1LA 2EDDA 1JV5B 4RAVA 5AUMB 3QIUD 4L4TD 32C2B 5DHYB 2IG2L 4ERSH 5HHOA 3EFFB 4PJDE 4HPYH 4MA7H 4OF6A 4PJFA 4LPWA 3HMXA 2X4PB 4YXKL 5H2BB 1HILB 3PL6B 5IGXH 2AVGA 3PWLB 4G5ZH 4ZFFA 1AO7A 1IQWL 4ALAH 1AP2B 4H26A 1WK0A 1L9NA 3U9PH 2P5EB 4XVUC 3ARGB 5IB3B 5K9OB 1BM3L 4NNPL 1FH5L 2DQJH 1L0YA 1NGPH 4HXBL 4MQSB 1XF1A 5I66B 5C0JA 1AE6H 1S7SB 1TQBC 4LGPB 3MJ8A 1JTPA 5DJ6A 1SYSA 3I3EA 3G04A 4GAGH 4XTRD 3DX6A 1MY5A 3WL9B 4FFWC 1MHPH 1IZJA 2Y07H 1WC7A 3LKNA 3HAEG 3CLFH 3TBYB 4J6RL 4M61B 2HMID 3BZFA 1CFQA 2J8UE 4PJEF 4OF8A 1X6NA 4HWZA 2DD8H 3CDCA 4XP1H 4Y19E 3VXQA 4NQCD 4ZO7A 1T2QL 5D8JL 1EX0A 2VQ1A 3R06B 2IG2H 5E8NB 1DE4B 2RIKA 3E8UL 3HG1A 1H3WM 4WFED 5EU5B 3TBSA 4WFFE 3W5MA 4MDIA 4YXKH 1Y0LB 2LFGA 3DI2B 4PS4L 1AD9B 2N1KA 1HOCA 3NVQA 3EFDL 4U1LB 4XNZC 3RA7L 1N6QL 2J12B 4OKVB 4NUJB 1IQWH 4L1HA 4PRHA 1SBBA 1SY6L 4NO3A 1BM3H 2R4RL 4NNPH 1FH5H 2JB5L 2XTJB 4HXBH 3VRLE 4CRPA 4URTB 3T09A 5LQBL 3TZVD 4JFHE 1CDHA 3QXAA 4J6RH 4S1QL 5F1SA 2R0KL 4NOBA 1E27B 3GSVB 2VN7A 4JHWL 4RNRA 2HG5B 1Q9OB 2J8UB 1OP9A 4Y16C 1U8OA 4YDVB 3L3IB 4NO5A 1IC4L 1PW3A 1YN6A 5DMKA 1F4YL 3DNKA 3FFCE 4Y19B 1T2QH 4Z0XB 5D8JH 3FT4A 2R29L 3QZWB 2CRIA 3E8UH 2YPLA 3WIFB 2P5WA 3QEUB 1GGYA 4UBDD 4QKXB 4PS4H 5TE4L 5D1QD 3RA7H 3EFDH 3MRHB 1N6QH 4ODSL 3B2UD 1K2DA 1U36A 3KJ6L 3CX5K 1MELA 1LEGA 3DETD 5ABDE 3UYRH 4RQQB 4LCCB 5IMOA 1SY6H 4O2FB 3UTSE 2R4RH 3BWUC 1IJ9A 2X4UA 2YUZA 2WM0A 4PJEE 2JB5H 3ROLB 4MCYB 5HY9A 4QT5A 1DQDL 3DRQA 2PYEE 5CBAB 2AAVA 5CEZE 1AGFA 5LQBH 3QYCA 1A21A 15C8L 3CMOL 4P23B 5JOPD 2Z8RA 5DC0A 3FFDB 3NFSL 4S1QH 3QUYC 2R0KH 2R23A 3DV6A 5DURB 4FXKB 4JHWH 1ZSDA 5FO7A 1KXTB 1IC4H 1NDGB 1VGKA 1F4YH 5D7LA 1U58B 1UZ6F 1DBAL 3FFCB 3MV8E 4MAYC 2R29H 4LP5A 5IOPB 4JLRB 3PV7A 4ACPA 4LAJH 4JM2D 1P4LA 4PJ8B 2APXA 4QCIB 2HN7A 4I9WE 3BHBA 2FJGB 4Q58C 5TE4H 1LO5A 4ODSH 3BDXA 5KOMC 4M6AA 3KJ6H 2NW3A 2EXWC 2GSGA 3AS1A 2VL5B 1LNUA 2ZKHL 3KPSA 3PDOA 5HDBF 4MS8D 2BHYA 5GRWA 2ESVB 4ETQB 3UTSB 4PJEB 1DQDH 4BSJA 4JY4B 4YHML 4WGVB 2A83A 3BMWA 3RL1B 1T83A 2PYEB 4OM0L 5J57B 4LBEB 15C8H 1P2CA 3KXFA 5IIEA 3CMOH 4K9EC 3NFSH 4PYGA 3WLBA 1MCIA 3FZUC 4ZXBB 3AM8C 1FVEB 1HCVA 3REVB 5J6HB 1JWSA 1T0NB 3PHOB 2ITDA 4N0UE 5KS9A 1HSBA 2XWTB 3QWRA 4UILL 4NWUL 1DBAH 4Q6YA 4LSQL 1G7JB 2A6JA 3MV8B 3CDFA 5JPNB 3L3GB 5I1LA 3PWPE 1NQBA 2CUMA 3M17A 1A8JH 5E2UL 3KVQA 4BQ9A 3RGVD 3HE7B 1TDQA 4O02L 3CFBA 5E1HB 2BXYA 2VZSA 2H2SC 3MUY1 4FOMA 4NNXA 5TJWK 4GG8B 2ZKHH 1G7LA 5JOFA 3BOVA 5DJZA 5HHMD 1GRWA 4MD0B 5EORL 2UVFA 4HF5L 3WE6A 5BRZE 1NC2B 5MERB 3WV0A 4G7VL 3BKJL 3F7QA 3MUZ1 4YHMH 1WFTA 1FFNA 4OM0H 2NY5L 2NZIA 1UZ6E 1I3VA 1M4KA 4H20L 5J89A 3IS0X 5ESVB 3V7AG 4F15B 5I1DB 2Y7QA 4ZUUB 3D9AL 4NDMA 4OZ4A 1ULVA 4EDXA 3KPTA 5CCKL 3SE8L 4X9HA 1U42A 2VLLA 4JGUA 3ARFC 2FJFA 3ZMRA 3QUXD 5KZCD 1A3RL 4UILH 4MZ2A 4N0UB 4NWUH 2VLKD 4B41A 2QQLL 4LSQH 2OJEB 1S8DA 5HDBE 3EYOB 3LKOA 4XCEB 5JW4R 4LOUD 3T4YA 1YJDC 3BQUA 1EAPB 4JPVL 3A0OA 1W72L 3BH9A 3MZGB 3PWPB 3D39B 1A6PA 5KS9F 2O5ZL 4DQOL 5E2UH 5EBWB 4XI5D 4Y0GA 3UAJD 1IC5L 4O02H 3MLWL 1S7QA 1FDLL 1QEWA 2PW2B 4JY6A 3KYNB 2XXMB 5EORH 2CLZA 4HF5H 5DFVD 1XF5B 4XAKE 4L29A 4P57A 1OP3K 4G7VH 3BKJH 5BRZB 1A1MA 2DJ4A 3BIKA 5GS2D 1OOAA 4DKFL 4OQTL 2EDTA 2NY5H 2EXYD 1T0PB 1U8LB 1Z2KA 4FQXB 4H20H 2FH6A 5DTFB 1VGEL 3D9AH 4RZCA 1FCCA 2D4DA 4QRRE 1WWBX 1TQCC 5CCKH 3SE8H 1RULL 1OT2A 4F7TB 4HKZA 4Y4KC 1RZGB 3MGOB 2ATKA 1A3RH 1ED3A 2FEEI 1Z9SA 2HT3D 1ZHNA 3VFWA 2QQLH 2VO5A 1VACA 4LNVA 1OF2B 4Z9KB 3RVVC 4PV8B 4JPVH 1W72H 1D9KB 3L9RA 5J0BA 2O5ZH 1F4HA 4DQOH 2NY2C 3SGEI 3WS6A 1BVLA 1IC5H 2OI9B 3BPCA 3QJHA 2QQQA 3ARDB 1ZVSB 3MLWH 4TVPD 1ZTXL 1FDLH 3C9NA 3GFUA 4HIIB 4K8RL 5GS0D 3JUYA 3SQBA 3FO9A 3QJFA 4D0DB 2VLRD 4FFVC 2IGFL 3MRNB 4KJQC 4PTUA 3U46A 3FQUA 3WHE1 3VFUA 1MCCA 5A3IC 1CFTA 1OARL 1J18A 4DKFH 2MKLC 4OQTH 1RUQL 1TCMA 2CKBA 4BSWA 4PJ5A 1J87A 1JK8B 2XA8L 1XGUB 5JTWA 1VGEH 5D96C 2K9UA 4MVBC 3DVGA 1MJ7L 3CFDA 5DVKA 1RULH 3OJVC 2NXZB 4PRIA 5IW1A 3CH1B 2X1WL 4XB8A 1MFNA 1J0YA 1FHGA 3FO1B 4WHDA 4JN2A 4HJ0D 1XR9A 2BNQA 3PQYD 2XG5A 3VWKA 4Y1AE 2HT2D 4NHCL 1AQDB 1WFNA 1VKXB 1ZTXH 4K8RH 1DEEA 1DLHB 1MHHA 1MIEL 4N68A 3DMMD 2BOBB 1KXQE 1JPST 5B39G 3WNOA 2IGFH 2FWOA 1D5ZA 1U3HD 2JJUA 1OARH 3ZYOA 5FEBA 4V1DE 4PRPA 3U82B 5ACZB 1RUQH 2APWA 3HRPA 5AAWA 1UFUA 4O2CB 2DIJA 3O3EA 3G6DL 2XA8H 5E94B 2Y5EA 2BMKA 4L8BA 5EN2A 1MJ7H 1WBYA 2J3SA 4ZO9A 3P4MB 4R26L 3ALXA 3VI3F 4MCZA 4WV1B 1NFIA 4FXGB 2D31B 1T1YA 4JM4L 5E2WL 3I2CL 3NIDE 3S97C 5T5NG 4P2OC 2Z8VC 3MBXL 1IEHA 1LHZA 5HPMA 3MFFB 2F19L 4Y4HA 2A38A 5DEZA 4NHCH 4WUKL 1EFXB 3W2DL 4Y1AB 4HUXA 1S7RA 1F3DH 4OI7A 1MIEH 5E6ID 3OSKA 5J11C 3S3JA 1EH9A 4C4KO 1J8HE 3BH8B 1QRNA 1MJJB 3IB4A 5E8PB 4F7MA 3FB7B 2JCCA 1G7HB 1F58L 4V1DB 1A1NA 4JANB 2V2TB 3G6DH 3K4ZA 5T3XL 4F7EB 1HHIB 4KUCF 1TJGL 4RFOL 3ULSB 4R26H 4YFLF 3OKEA 5TPWL 4JKWA 4JM4H 5E2WH 3I2CH 4LDOB 3V6ZA 3QNZB 3TNMA 2Z31C 3MBXH 4ZOAA 4KZEL 2HP4A 3RVXD 1PGRB 2F19H 4MJ6B 5HHXL 3RU8L 3SKMA 1OY3B 3QQNA 3G5XA 4WUKH 5MEQB 3W2DH 4FQ2L 2ZSWB 3QXDB 3BVNB 4HWBA 4KK9D 2X4QB 4OLZL 4RMTA 2JJTA 3RY6A 3VA6A 3LQZB 1CK0L 2F74B 5A16A 1VEMA 3OKMB 1BHGA 4B7IA 2W0KA 2C5DC 1OB1A 4RRPG 4HLZH 1J8HB 1P7QD 2BSRA 4NKOA 1U8NB 1F58H 3P4OA 5F7NC 5EBGA 5T3XH 1Q0XL 5FB8A 2V5YA 3MRQA 1LDSA 2OCFD 4JE4B 1C5CL 4LLUA 1JNLL 4PBXA 1TJGH 4RFOH 2BSTA 5JO5A 3SCMD 5TPWH 3QDGD 1ZT1B 5GGSA 5E08L 4KZEH 4GQ9L 1FLTX 2WZPD 2A6KA 5CKGA 4BM7A 3SPVB 3RU8H 5HHXH 2F53A 5ENWA 5FYLL 5SWSA 3W0WA 2IBGA 4FQ2H 2ZCLL 2IFFL 3KPRA 2HTLD 4WDIB 3OX8A 4OLZH 1RZ8A 3CIQA 4WNQA 1CK0H 3K46A 4UDUB 4YAQA 4KU1A 4NO0B 1LEKB 2AV1A 2C3GA 3K8LA 3RHWF 4K7PX 4QHNB 3QXVA 4UQ3B 5D5MF 4XVUD 4S2SB 5GRZA 1DTUA 2FBJL 3BN3B 4CMMB 3CNKA 2R9HC 3FRPG 1UCTA 2FL5A 5F9WC 2VKXA 1M7XA 3BWAA 3HLAA 2GCYB 2HAZA 3Q0HA 5D2NA 2X4NA 4DTGL 4HKBB 4ZS7L 3RVWC 2PO6A 1TZHB 4FFWD 2R69L 4EN3A 1OAQL 1Q0XH 2O26U 1C5CH 4IOSD 1JNLH 1U93A 1X5GA 3SBWA 2AJSL 5FOBA 2ZOLB 2EIZA 1MWAB 4LCUB 3DVNB 1A6UL 1BREA 2IEPA 3AMKA 3MBEA 1KIQB 4M7ZC 5E08H 3DGGB 2ICES 4M3KB 4GQ9H 4QOKB 4YIQB 1NC4A 1J1OL 3MRBB 2VAJA 5FYLH 1LK3L 3OR6B 3F6LA 1XEDA 3RZCC 2ZCLH 4AIXA 2IFFH 2E27L 2OSLB 1IGML 1KN2L 5I8EA 5T1KD 3F12A 3GDBA 4UDTA 2ICCA 4WWKA 1JWUB 1ZXQA 5SWZD 2Y36L 3CJJA 3Q48A 3LPWA 3CXHK 2SEBA 1X5LA 1RHHB 4NC0B 1PZ5A 2FBJH 2WINB 3L6FB 5B8CA 4W6WB 2ID5A 5D7IF 4LAQL 2R1WA 4DTGH 5I0DA 4HWEL 5HI3D 5DRZB 5T1DL 3HC3L 3GM8A 4ZS7H 3C6SA 3BUYB 2R69H 4P0DA 1OAQH 2H45A 4MJ5A 4EVNB 1DVFB 1MI5D 2OX5A 2GTWA 4PP1C 2FD6L 2AJSH 1DN0B 5DUBA 1T1XA 2W07A 1A6UH 4D9RE 3Q6FA 4GAYA 1MCJA 4GO6B 2DLGA 1YDPB 3EO0A 1F97A 4P4KB 1HH6A 5D5ME 3JWNC 1G9ML 3CSYB 4ONOA 1J1OH 4HJGA 1D5XA 5ICYB 5JQ6L 1LK3H 2HJKB 3STLB 4QO1A 1CTOA 1IAKA 1ZWIB 3GM0A 5EC1A 1D5BB 2EDEA 4YDLC 3LV3A 2E27H 3OJDA 5CEXA 5FO8A 5JORB 4ONGL 1IGMH 1KN2H 5IBUG 1ZA3A 5ICZB 1B0RA 1I85C 5FHBL 2Y36H 1I3UA 4IDLA 4EUPG 4OZIA 4K71B 3DX9B 3E2HC 4CN4A 2R56L 4LAQH 3LD8C 4G8GA 4RMWA 2XACC 5E8OA 3ZTNL 4HWEH 5T1DH 3HC3H 2NTFB 4WFGE 3MRGB 5DK2B 1A6AB 3QUYD 2FD6H 3UDWA 3BJLA 3QUMB 5EOCL 5DJXA 3RJQB 1NBYA 4FQHA 3PIQA 3I75B 4XZUB 1F3DJ 2C7UB 4UB0L 1I4FB 5DHVH 1ZLUK 4LHQB 1TPXB 1UJ3A 1G9MH 3ROOB 3TCLB 1IILE 4RX4A 3AB0C 3OHXA 2MMXA 2Q6WB 5JQ6H 4L8DB 2GFBB 5D7IE 2DWEA 2NTSP 3RIAF 3F62A 2PYFB 4YDJA 3VXUB 4APQB 1DANT 1I8IA 4ONGH 3O3BA 3G08B 2IALB 5HGDB 2EXWD 1RZJL 2P46B 3BGAA 5FHBH 1OLZA 3EO1A 1RK0A 3IS1X 2HLAA 3MCKA 4CW1B 1JMXA 2R56H 5TF1L 1N2RB 1R5WB 5IB4A 4WFHE 1JNJA 1W0WB 3KPPB 3AGVA 5HI4D 3ZTNH 3NAAL 1QFUL 5C0CB 1YPZF 4NPYB 5DI8B 2B4CL 2XTLA 5J7CC 4KJWC 5C0BE 3BEVB 3FZUD 1H8SA 5EOCH 4OZFA 3SE4C 1I1FB 1U8QB 5CEYB 2Q86B 3QDAA 3UJTL 2VDRL 4FQPA 5I71B 5TGBB 1RUML 4HMDA 1XCTA 4UB0H 3D0LA 4LLDA 2F8XC 5JPMA 1MCOL 2GJZA 3VRIA 2YD8A 4UQ2A 5T1LB 3BYTA 4LF3B 5D7IB 2RFXB 5DEFA 2AXHA 4HUUA 4PRBB 1F4AA 5B38B 4YHOL 3ZKXC 4PBWD 4X6CA 2PKDA 1RZJH 3N1PC 2H2SD 4N1EA 3VXPB 1JGEA 1ND0A 4AK1A 2XWJA 5CJBA 3IVKA 4NJ9L 5I0ZA 4Q9CA 5TF1H 3S5LA 3LN9A 3C60B 1YNTB 1R5IB 3W39A 5E6YA 3QIWA 3HTLX 4ZUSA 2V2WB 1NCTA 1QFUH 3NAAH 5CD3A 2B4CH 1JP5A 2V5TA 5JIHA 4TUOB 2CDEB 3QB7C 4QTIL 5C0BB 1INQB 2ATPA 5IHLB 5CEZL 2YD2A 4P2QD 4NGHL 2W9LA 3ARFD 5FCUL 4Z0BL 2VDRH 3UJTH 1RUMH 3UXFA 4EI5D 1JHTB 1Z0NA 2HKFL 2Z93B 1QLRA 4YUEL 3N1MC 2D0FA 1MCOH 4XC1L 4I18B 4CNIB 3MRIA 3HC0A 4U49A 3CZJA 4MNHA 3CSGA 4JGJA 1HYSD 4HK0B 1IGTB 1QLFB 4I5BA 2ITCB 1T04B 2PTTA 4HS6A 1YPZE 4YHOH 3LCYA 1V3LA 2VTFA 1NCWL 5IVOA 3TO2B 2XQYG 32C2A 5DHYA 4I2XB 1YY9C 1FYTD 4OQ1A 5K9QG 4OCMC 2X4PA 3LDBB 3QIBB 1LE9B 4NJ9H 1HILA 3PL6A 4XCYB 4XPFL 3EDFA 3DXAD 2DIAA 1P1ZB 3ARPA 3C8KB 5E5MA 3FQWB 3V6FB 5A40E 5KG9B 4PJCB 3TVMC 1AP2A 4Y2DD 3ARGA 1NGQL 1UZ8A 5K9OA 4XCNB 4QTIH 2OTUB 3HR5B 5CEZH 3GSUA 1S7SA 3P77A 4NGHH 3P0VL 5DA0B 4HG4K 3ARBB 5FCUH 4Z0BH 1ZLUH 4EOWL 2UV3A 2HKFH 2QSVA 3EKCA 5FYJE 1G9NL 4DGVL 5E00A 4J4PA 4YUEH 2VLJD 4XC1H 5C0GB 4MB3A 1LE5B 4L3EB 4CVXA 1S7WB 3TPUA 2BNRA 5I17B 2OR8A 1KCSL 4JZJC 3S3SA 3AU1A 5T3ZE 5CJXC 3WKNA 3DVFA 5I15L 1DUZB 4ZYKB 1NCWH 1RJZB 1YPZB 3JV6B 4OCYL 4PB9L 2A0LD 3FONB 1WCBB 5J13B 3RUGA 2E9IA 1OGAD 1NAMB 4FFVD 4KJQD 3VXMA 1KCVL 3VWJA 2X89D 5A3ID 1T3FB 4U1LA 4XPFH 3B9AA 1WISA 2R2EB 4HHAB 1QO3A 1CF8L 2Y5TB 1K3IA 3IDJB 5CGMA 2J5LB 1DUYB 2DYPB 1NGQH 2W38A 3G5VB 2Z92A 1MREL 3MQIA 4MVBD 3T04D 2HKHL 2A1WL 3NZ8A 1OAZL 1B4RA 1F6AB 3PJSB 1K4CA 3P0VH 4LVOB 4QHUA 3X13A 4EOWH 4NHUA 5EPMA 1G9NH 3SGDI 4DGVH 4ZOEA 3C6LA 5EBMA 2QSCL 5IP4A 1CN4A 2Z35A 4NNYB 4Q9QL 4XVSL 4OIIL 1L7TL 5T33L 1I1AA 2ENYA 4KRPB 1KCSH 2DLHA 3BZ4B 5I15H 4W4OC 3BKML 5B4MD 1BIIA 4OCYH 4PB9H 3VE0B 1ZGLM 1MJ8L 1C16A 1UH3A 3QUZD 2EYTB 1ORQA 1CCZA 4HEME 3JWOC 1KIRB 3LY6A 4G7YL 4GBXB 1KCVH 1VERA 2BNUB 1HXYB 3VXSD 1MAKA 3AREA 4AM0A 2BRRL 3QQ4A 2F54D 3Q3GB 1HH9B 4GXUM 5BZDB 1A7PL 1CF8H 1SMAA 5FA3A 3QEGL 3RUGF 1F11A 3EHBC 2EE2A 5EZJB 4O2FA 4ENEC 1H15A 1MREH 4RFEA 4D0BA 3TF7C 4MCYA 2HKHH 3O2DA 2A1WH 4IRSD 1S78C 1OAZH 2F58L 1CLZL 3LAFA 5CBAA 3H3BC 4NUGL 4JRYD 5D7JB 1Z9OA 5KSBB 3S34L 1MFCL 2P42B 3KYMB 1UXSA 4G8IB 1MCEA 1UCBL 3LH2L 3VXRE 3O6FD 1EO7A 4PY7A 2QSCH 3UROR 4Q9QH 4XVSH 5BVPL 4FXKA 1L7TH 4OIIH 4U6YB 3V6BR 2JJSA 2XFXB 3IGAA 5T33H 4H25B 4HUVB 3IDMB 4OV6F 1QLEL 5ETUB 1U58A 3BKMH 4OFDA 5IOPA 4R9HA 1MJ8H 1BQLL 5C07E 5E03A 4YBQC 2BRQA 3ILPB 1XF3A 3KPLB 4G7YH 3NABL 5EOCJ 5JIPA 2BRRH 3L5XL 3CU1A 5BS0A 1CDCA 1A7PH 4NCC2 3QEGH 2YHGA 3U36A 2VL5A 2R2HB 3GRWA 3V4VL 2ESVA 3MRJB 4KKCC 2F58H 1N8ZB 1CLZH 4S0SD 2OK0L 4I4WA 5DRWB 2RB8A 4NUGH 4QRSB 4JFOB 3S34H 1MFCH 3KYOA 4Y5YA 1KEML 3KPMA 1UCBH 1CU4L 2DM2A 3LH2H 5D71L 3OV6A 2UYLB 1FVEA 5BVPH 3P73A 1BQHB 3IXTB 4GT7A 4PV9B 3PHOA 5HGBA 2H3NB 2GITB 2XWTA 1QLEH 4U1MB 1KLGA 3DYMA 1OTTC 4CN6A 3O8XC 4FXLA 3QCVL 5F7YC 1BQLH 5CP7A 3P9MA 5C07B 5IMMB 3DTXB 3NABH 1HDMA 2Y6SD 3VD3A 2XV6B 3OXRB 3GIZL 3HRZB 2ZUWA 4P3DB 1KB9J 2FB4L 3T0EA 3K81A 1OSZB 4O9HL 3S4SG 1G0DA 3L5XH 1A6ZB 2DLIA 1A3QA 1AXIB 2DKUA 5MHSD 4GG8A 3RI5K 1Q9LA 4FQCL 2A6IA 3V4VH 1NC2A 3WJLC 2NY3B 4HX1A 3MYZA 1W8NA 3MV9E 1IGIL 2OK0H 4IOIB 4Z77B 3S96B 3WLWC 3RWJB 3GO1L 4K55A 4X83A 4JZOB 5D9SA 1KEMH 1BF8A 1CU4H 5ESVA 5D71H 5D2LF 4WHTB 5I1DA 3ISWA 1U2CA 1N59A 3DWTA 3BW9B 1U41A 1IM9D 4R2GD 3DYPA 3MRPB 2GY5A 4UU9B 1FFRA 3QCVH 4OGAC 2FSEA 3C5SB 5C9JB 2EECA 1SJVA 3CFKA 5LJYH 4RCAA 1X6LA 3PWPA 3D39A 3FN0L 3GIZH 2LABA 2FB4H 2R9HD 4O9HH 5EU6E 3QPXL 5C09E 4H1LG 3QNXA 1VFUA 4MAUL 2EYSB 4FQCH 1WTGT 5DMGC 3WO4B 2YRZA 4MHHI 1IGIH 3RIFF 1PG7W 1VESA 1CDYA 3CVHB 3MV9B 5HYJD 3GO1H 1MCBA 3T0VA 5DTFA 4FQXA 3H7LA 4ZD3L 3QO1A 1AH1A 1IAIL 1CS6A 3CFJA 3D2UA 4ODWA 1QA9B 3C08L 2DQFA 5HHPB 1MLBB 3ZDYF 4YBLB 1FAIL 1MHCB 3E6HA 1RZGA 3EW3B 3RZCD 5DJDA 2BK8A 4GRLA 1S7XA 4I3RL 4HS8L 2VJXA 4F9LC 3TN0C 1G7IA 3TIEB 2YBRB 4MJIE 2EIDA 3FN0H 4KXZH 1ODAA 4LCWE 1KACB 1QFWL 4GMTL 5DYOA 2CDGA 2QADC 1DQLL 1ZHKA 3JXAA 1ZVSA 1YEFL 3QPXH 4HIIA 5D2LE 5EU6B 1YNLL 4X5WB 4MAUH 3FKUS 5C09B 1REIA 4Z78A 3MRRB 2FHFA 4PP1D 5CZVL 3BGFC 5ICXB 5B22A 5EU7C 1UWXK 4DZ8B 2PCPB 4UMGA 3BI9X 1U91A 4YHZL 3TBTA 2EDFA 2X70A 1UENA 4ZD3H 4UT9L 4C55A 1IAIH 3G5ZA 3QIUA 1OL0A 4CU6A 3ELAT 4GRMA 3QEQD 3C08H 1IL1A 4P5TA 1NGZA 4PJIB 1MWAL 5L7XL 3Q5YA 1FAIH 1XGQA 4D0CA 2A74A 4PFEA 1M05B 3KG5A 4DZBA 4ZFOA 1H3GA 1NKRA 4I3RH 3DLQR 4BK4A 4HS8H 4JDTL 3RX8A 3UP1A 3GSNA 5TDOB 4XXCC 4ONFL 2FRGP 3FO1A 1E28B 3FQNA 3IDNB 4BH8B 5C86A 1UKTA 4GMTH 1QFWH 3IKCB 1DQLH 4G9FE 1NGXB 1YEFH 4LVHB 2Q7NA 1DLHA 1YNLH 2LTQC 2BOBA 4Y4KB 5D2LB 4DVBA 4C56E 5JHDE 1O7SA 5ID1B 3ZDYE 5CZVH 3ARWA 4HCRA 3VFVA 3SGJA 1VFBB 5TF0A 1QQDA 1YZZA 2J2ZA 5ISZD 4HK3N 4JDVA 3F7VB 4O2CA 2GUOA 4YHZH 2AKRB 3VMNA 3RJDA 3WYRA 4O51B 4UT9H 1J05A 1A1OB 1TZIA 3BGMB 2D03L 4MB4A 1KCUL 2FIKA 1MWAH 3WFEL 5L7XH 4WV1A 2X42A 5DMYA 2J8HA 4KV5E 4IIQC 3KWWB 2EDOA 4JDTH 2GAZB 2MQ3A 4ONFH 2E9JA 4OF5A 4WCYL 5ESAB 3SDCD 1MRDL 4Q7DA 4L1DA 1H8NA 3BEWB 4AT6A 4HKJB 5E9DA 2B20A 5IM7B 5BOZG 4G9FB 3BT2L 4U6XB 1UGNA 1V3KA 4C56B 4XMLL 3OKOA 2ZCKL 4KJWD 5JHDB 2EEBA 1MJJA 2E8ZA 4QHLA 4OFIA 2YXMA 1A4JB 3KPNA 1KTLB 4PYHA 5JNYB 5C0AA 2BDNL 2V2TA 2L4OA 5L2KE 3ALWA 4F2MB 1BWWA 3D48R 1B3JA 4F7EA 4WUUA 2XYCA 3BRGC 2FHCA 3QUML 5IROA 4TN9A 3VFTB 2D03H 5F1IB 1KCUH 1BQUA 1PFCA 4Y5VA 3WFEH 2W0FA 2DICA 1MVUB 2EO9A 3MCG1 5F1KC 5D1QA 2NNAA 4UTBL 1CIDA 5IVXE 1AXTL 1M6OB 2IAMB 4MJ6A 4RGOL 4WCYH 2DM4A 2WBJC 1MRDH 3VG9C 1N4XL 4YLQT 5HVHC 4TNVF 2ZSWA 1H3TA 4QXTA 1B90A 5D6CB 3TH2T 1ORSB 3HZYA 4Q6IC 1X4YA 4TTDC 4NQTA 3WNMA 3O4OB 3OKDA 2UY6A 1AKJA 4RGMC 4TVSa 3BDBA 1EPFA 2AXGB 3BT2H 3C09B 4IMLB 3SOBL 4JN1L 4WU5A 4XMLH 1EBAA 2ZCKH 2XI9A 1Z9MA 2EIEA 2ADIB 2EDLA 2X41A 4E41E 2OL3A 2VITA 2MWCA 5K93A 1R6VA 2BDNH 3Q1SL 5GIRA 5FM4A 1SQ2N 4JFQB 4L4TE 5L2KB 3FRUA 1KPVB 3VFOB 3QUMH 2P44B 4N1HB 3K1KC 4JM2A 3RIAK 2HFFA 3L3JB 2B1HL 5I8KL 1I7RB 2H41A 1ZT1A 4J12A 4UTBH 4HIJB 4HIHB 1V7ML 3MREA 5F88B 1JN6A 1AXTH 3HKFA 4P59L 3SPVA 3MLYL 5IVXB 5HHNB 4RGOH 1YY9D 4YHPB 2NY5C 1N4XH 2DMBA 4MX7B 4AIZB 3QI9C 1A4KB 2BVPB 4PG2A 3WO3B 8CGTA 5E8DL 4XNUL 3VGAB 1E6JL 5EUKA 5I75C 1IARB 2H9GB 3TVMD 3SOBH 5F96L 4JN1H 5IMKB 3VFRB 3DHMA 4CDGC 4CMMA 3BP4B 4ZUWB 2GCYA 4E41B 4LLQB 4HKBA 3Q1SH 4NQCE 2KQNA 1MQ8A 4YHLL 1TZHA 1LK2A 4O5LL 4ELKA 4LKXB 3F7YB 4L4TB 3V4UL 4BQ6A 3VXTB 4J8RA 2AJ3B 4PLKC 4WFEE 5DJ8A 4UAOB 2C4FU 4HK3J 4XPBL 1GXEA 4PB0L 2MQ0A 2B1HH 3MJ7A 5I8KH 2DOCA 3DVNA 3WD5L 4U1IB 1JUFB 3QNYA 5LG1A 4JFDD 2ZOKB 2GT9B 4ONHB 3DGGA 1V7MH 4QOKA 2IWGA 4QRQB 4P59H 4IS6A 3MLYH 1MUJA 4WJ5A 3MRBA 4YZFE 4JM2F 4JJ5A 4IRZL 3M45A 3EBAA 4XBEL 4OLEA 2HTKD 1EXUA 2MNUA 5GGVY 2VC2L 5KSAB 5E8DH 2PW1B 1ITBB 4IM8A 1E6JH 4XNUH 3FOLB 4QHMB 5I30L 2HFEB 1IT9L 4XNQB 3GK8L 2CIIA 2DQUL 5F96H 4WHCA 3EUUA 1UH2A 4J3TA 4I3GA 2NY4C 3ZYJA 1UKSA 2JB6B 5HHOD 3I50L 5D72L 1JGLL 4LDLB 5DRZA 1ZHBB 4YHLH 4NQCB 3BUYA 4O5LH 3GMRA 3K2UL 3QUXA 4RMUA 1DVFA 1SJHB 3V4UH 2VLKA 1KG0A 1AO7D 4XPBH 4UV7L 4LSSL 4RISL 4PB0H 5DK0A 1RI8A 4K8RC 1IGJB 4H0IA 1NCDL 3WD5H 3N06B 3BIBX 5HYSA 1YDPA 5D2NC 5B21A 4HGKC 4FABL 4YHIB 2ADFL 1CGXA 5ICYA 5F1OB 1K6QL 4IRZH 1WBXA 4EN3C 4XBEH 3LPFA 4K7PL 4FG6C 3FT2B 4ZAKC 2GQHA 2ICWB 2VC2H 3B83A 4HBCL 1VENA 3TZVB 1M7DB 4MJ2A 5I30H 1IT9H 1NAML 5DWUL 5JOPE 1AIFA 2VR5A 3PGFL 3GK8H 2DQUH 1IM3B 1XCQB 2WP3T 4ENED 5DJ2B 5J1TC 4RFNB 5FDYA 1S78D 2DJUA 1XF4A 3HG1D 2KH2B 3I50H 5D72H 1JGLH 1DQJB 2WMPA 4PTTB 3QDJA 3K2UH 3FT3A 5I1AB 4H5SB 1OLLA 5EA0L 4GKNA 3L7FB 3E3QE 5DUPL 1A6AA 1A6WL 4UV7H 4LSSH 4RISH 1JF5A 2DLEA 2DQCL 4X6FB 4KROB 1NCDH 5KVEL 1LP9A 5FYJL 4LVEA 5CZXC 4FABH 1FVDB 2ADFH 1T5WB 4HUWB 1UM4L 5LGJB 1K6QH 5TDNB 1YEEL 3T2QA 4J7RA 4K7PH 2PYFA 1ADQA 2UZYB 2B0SL 2N4IA 3VXUA 3SDXF 5T3ZL 2DLTA 1FGNL 1L0QA 4HBCH 1S9KC 1IEAB 2A9ML 1CFNB 1NAMH 5DWUH 5HGDA 1BZQK 3PGFH 3T4AA 5LGKA 4MA1B 5TH2B 4CW1A 2X4RB 3DURB 4KXZI 3QQ9C 4PGDB 3P9LB 4ZSOA 2B7DT 5H35B 5ALBL 2P5WD 4TOYL 3VH8A 3H9ZA 3MNWA 5C0CA 3O4LE 1F2QA 4P3WA 4PJGF 4DVRL 3P30L 5EA0H 1DSFL 1ZANL 5DUPH 2B5IB 4X4MA 1A6WH 4MQTB 1FNGB 2EE3A 1FG2B 3HPJB 4WW2C 2DQCH 1T21A 4PGEB 4V2CB 2QQNL 2DI8A 1I7ZB 3O3DB 1NJ9B 1ZLWK 5TGBA 5KVEH 5FYJH 2DTML 4X99B 4HGWB 3VCLB 5CLTA 3MLXL 3O8XD 4UOW0 2H8PB 3DO7B 4PJ9C 1T1ZB 5HHME 1UM4H 1U92A 1YEEH 4QXWA 5EDXA 2BP3A 1JNNL 2B0SH 3MTRA 5GSVA 5T3ZH 1FGNH 3TYFA 1U3HA 4PRBA 5IMLB 2A9MH 2XWBA 2Z91B 3MOQA 4CU7A 5E1AB 3UPRA 3VXPA 4XWGL 4M9OA 3K4DA 1XIWB 1R24B 1QHPA 3HC4L 5D7LD 2HRPL 1UJ3C 4LQ1A 1QFWI 5ALBH 4TOYH 3CFEA 3U7WL 4HZAA 2W65A 4DVRH 3P30H 4HAGA 1R3HA 3O4LB 3SKOB 1DSFH 1ZANH 5IK3B 3RDTC 4OCSL 1MCDA 1WEJL 2CDEA 1HSAB 3HB3D 1EEZA 4ODUA 3U30C 4J3OC 1HHGB 4Z8FL 4U1JA 2QQNH 3SDXE 1YEDB 4LCIL 2DRUA 1PQZB 2X7LB 4F37F 5L2JB 3RGVB 3P4LA 5J9PB 3RGHA 2DTMH 4CVWA 1JF1A 3WIHL 4ISVB 4OD2A 1D5IL 1J86A 4MMXC 3W9DB 3S8WA 5EBLB 2LQRA 2IPUK 1JNNH 3SDAA 4CVZA 1IGTA 2ITCA 2XG4A 1AHWC 3A6BL 5CJ8A 2XPGB 3IDUA 4PJGE 5EC2B 2BJML 1FO0B 3HN3A 1GC1L 5HHQB 4FQQB 4I2XA 4MSWB 1D6EB 1MIML 3U4EB 3VD5A 4XWGH 1T89C 4I13B 5BV7B 1BVZA 2MPAL 4JVUA 3HC4H 3QWRD 2HRPH 1LE9A 4KRNA 2P48B 3GMMA 4Y4FB 4KKAC 1CGWA 1HWGB 4XCYA 5HDOA 4P2RD 3HMWL 3U7WH 2BXZA 2VAAB 5KZCB 4W6XB 4PJCA 1R5VA 2QBWA 3GHBL 4JZNA 3DO3A 1AGBB 4OCSH 1WEJH 5E7BA 4N8VA 2I24N 2VE6A 3DIFB 2O5XL 4WO4C 2YC1A 3IFOA 4Z8FH 3BP5A 4U6HB 1LO0L 3DROB 4LCIH 3MO1A 3VXOB 3KGRA 2MOVA 3VXNA 2WNGA 3WIHH 5C0EA 4KI5D 1N0LA 1FSKB 2NX5D 2OQJA 1D5IH 3EGSB 3PGCA 2VLRE 5IQ9B 1TTGA 3QULB 3QDHA 2I07A 4HS3A 3TN0D 3AMLA 4L3EA 3BD4A 4L4JA 1T1WB 1EHLL 5HGAB 3U0PA 5D93B 2VOTA 3A6BH 1CVRA 1P7QA 4RIRB 2APFA 2BJMH 2QADD 3QFJD 3JV6A 1GC1H 4PJGB 3JTTA 4M1GL 1QSFA 1WCBA 1MIMH 3DJ9A 2MPAH 3RTQB 1F6LL 3VD7A 2E9WA 3FO2B 1FNEB 2FHBA 1X5ZA 1MFEL 3IDGB 3PP4L 1FQ9C 1T3FA 3ZHLA 4G42B 4HHAA 4KQ3L 3SCMA 1T2XA 3HMWH 2Y5TA 4QHKJ 5IHZA 3VMPA 3IFPA 3GHBH 5D1ZB 1DUYA 2DYPA 4KK5C 3GIVB 4GKSB 3PQYE 3HE6B 3MRDB 4OGXL 2O5XH 3U9UB 5H37H 1NGWB 1F6AA 1CD1B 3PJSA 3NZHL 1ZLWH 1ONQB 4P5MB 1CE1L 3PL6C 2HJFB 5JHLL 4DUVA 2ENSA 3VFNA 3WFBL 2VLRB 5K9JL 12E8L 1SBSL 3ARGC 4ODXA 4LPCA 2O5YL 1EHLH 3GJFB 1RHFA 1FZOB 4F33B 2COQA 1CLCA 1Y18A 2HJLB 4M1GH 3IAGC 3TBVB 4NQDB 2EYTA 3H7BB 3UMTA 4G80B 4OFVA 3HAEB 3IETB 4GBXA 3L3HB 1MFEH 2AJYL 3PP4H 3RIFK 2XY2A 3QR2A 2RGSA 1F3JA 1G9MC 3Q3GA 4ZO8A 4KQ3H 4BQ8A 3MX0A 1K4DB 1KTKE 5EIIB 3PQYB 1X5AA 4OGXH 3IDIB 1CD8A 3WHXB 2BVUA 1JF6A 3NZHH 5D7JA 5DRXA 3FOMA 5LGHL 5KSBA 1MRFL 4Z7UE 1K8IA 2OZ4L 1CE1H 4NC1E 5FXCH 4M5ZL 1JWMA 3KPQB 3QSKB 5E56A 5JHLH 3RZWA 2C1PB 5DO2C 3I6KB 3WFBH 4JFPA 4PJ5D 5K9JH 1J1PL 12E8H 1SBSH 5CP3A 5SWZA 2O5YH 2RBLA 3IDMA 1BFSA 2XTJC 2ZUUA 4D94A 3GMOB 3X11A 4YNYB 4L8CB 3KHOA 5BMFL 4KJPD 2CRZA 3RVTD 5DQDL 4MB5A 1NFDF 4E0RA 2VH5L 3MNZB 1XAUA 2AJYH 3MNVA 4IHOB 1IGYB 1MI5A 3JBG7 4ZNEA 3TPKA 2BNQD 1J0KA 1KNOB 4JRXB 4BFEA 3MJ6A 3OGCB 3V6OE 4Y16A 1MCRA 2ADJB 4M1DL 2EZ0C 3JTSA 1L4IA 3CPLA 4WI9A 1QBLL 4QRSA 2Q7YB 3X3GL 2XT1B 5LGHH 1RZJC 4KK8D 1MRFH 2OZ4H 1GJIA 3TC9A 4LKCA 1BFOB 4Z7UB 4LRIC 4M5ZH 5MEND 4C83A 4EEEA 1JTTA 4ZFZA 4YDIL 2BOCA 4F3FA 4PRPD 5E6IB 3MOBL 1OTSD 1X9QA 1BQHA 3IXTA 1J1PH 4UIMB 4LCCC 2XKNB 3B9DA 3QUKA 4MQ7B 3CXDL 2B4CC 5IEKB 4QHKI 4TTDD 4OZFG 1KT2A 4E5XA