4Y8AA

Crystal structure of the n-terminal domain of ceacam6
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
AKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carcinoembryonic antigen-related cell adhesion molecule 6
publication title Diverse oligomeric states of CEACAM IgV domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 26
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y8aA00
4KK8D 5C0CA 2EEAA 3RP1A 2WP3O 4LEOA 1O7SA 3O0RL 4W6YB 5KJRL 1A7BA 4P5MB 1IEBA 1HHHA 1LK2A 4P23A 4HK3J 4XCYB 4BUHA 3A0OA 1T80A 4NN6B 1UYWL 2FYYA 5BRZA 4NJ9H 1ZMYA 5IVXF 3EGSA 4JQVA 4WU7B 1UB6A 3O2WL 3T8XB 3U7YH 1I8KA 2CPCA 4OF8A 5CJQL 2IALA 3W9DB 4EZMA 5D2NA 3B9KA 4NQUA 2HTKC 2VOTA 3E0GA 3VRLE 1IAIM 2W9EH 1A2YA 4LDOB 5DZLA 5DTFB 1LEGA 3VXMB 4FXKA 5SV4A 4G7YH 1J1PH 4KGJA 4AMKH 4KZDH 4ALAL 1ONQA 2C5DC 2R0LH 3RI5F 3T3ME 3IJSB 3GSWA 2W07A 4UINH 4YDKL 4E0RA 1S9KC 3GJFA 1ZAGA 4JM2D 1ZEAH 3GUTB 1A9BB 1EK3A 2GK0B 1GGTA 3QO1A 1RVFH 1I1YB 2IJ0C 2BY0A 3EDEA 4G3YL 3NA9L 5SX4H 4MB5A 2FIKA 3F7YA 1WIPA 5LBSL 3UTQB 3FQRA 2OR8A 4LAJH 1YPZE 3HI1A 5KZCD 2UZYB 4Z0BL 1XEDA 1I1FA 1KN2H 2ICEA 1QA9A 4K3EL 2R0WL 4KMLB 4R7DB 4XC1H 4G8GB 1MIMH 1Z0NA 4OFDA 5DJYA 3VXTB 4HULB 2P8PB 2J8UF 2P24A 1V05A 1B2WL 4R8WL 2WZPD 5ANMB 1Z2KA 2KDGA 4WV1A 3QAZB 4ZUUA 3SDXB 5ADPL 4GAJL 1J18A 1I75A 4XP4L 1KFAH 1UWGH 3C87A 1KB9K 4AG4H 2RHEA 2VZ1A 4UV4H 3DMMB 2J1KA 1F4XL 3TWCH 3HZYA 5CEXA 1X9QA 4JDTH 3KR3L 4K7PL 4CUCA 3X11B 4P48A 4J23A 1X5IA 1TNNA 3GB7B 3LQAC 1PSKL 4FMKA 2WUBL 4YZFE 1PYWA 2BNRB 1NCBH 3V0WL 2BSED 2AJVH 2XYCA 4LASH 4QHUB 4HCRL 3RGVA 5FO7A 1CFNB 3ZL4H 2DM4A 5DD1H 1LP9F 2ITDA 2ZSWB 5E6ZA 3DROB 4JRYE 2V5TA 5D7KD 1CZ8H 4M7KL 4RA3A 1G6RB 1LNUA 2X4OB 5IBUB 1VPOH 3LZFH 2KQMA 4FTVB 1KPRA 3QNXA 2R0KL 4NWTL 4HX1A 1H8OA 1NAMB 1SM3H 3QUYA 5H35A 1FPTL 3HLAA 1ZWIA 4J8RB 1Y6KR 4JRXA 4YDLB 4U33A 1TJHL 3VFWB 5IVXB 1JZ7A 1CWVA 4DUXA 1N59B 1YEDB 4OLXL 2MJWA 1HDMB 3IXTA 1N6UA 4NC2B 1MCSA 3D87B 4LNRB 1ZHBA 1FYTB 3RTQB 4Y5VA 5LGKA 1NBVL 2VTFA 3QUZB 5J12C 1YNLH 4JANB 2NZ9D 3D18B 3KYOB 1I9JH 1MJ7H 2XACC 3BN3B 3BPLC 3FQWB 2KKQA 3MRDA 3L3GA 4RNRB 3LN9A 1FDLH 1IZKA 4OGZA 4DTGH 1OSZB 3WDJA 4KZEL 1CDYA 1IAIH 3O9WD 2X89D 3MOAH 4O2EA 4HUVA 5DLML 3D85A 3EOYG 3F7PC 2PR4L 4RGND 5DJZA 4TNVK 1N0XH 4UQ2B 3HAEA 5L7XL 1YY9C 2XKNB 3F5WA 1L0XA 5I8KH 3PWPB 3N1GC 4YHKL 4WEMB 1QSFB 1L7IL 2PW1B 4Z7OF 1FVDB 1IAMA 3AAZA 3DXAB 3GSQB 2J8UB 4HWBL 4QRQA 2D03H 4UQ3B 3MV8D 2APWA 2VLKB 4LP4A 1MCPL 1FO0B 1KJVA 4G9DA 1YEFL 3MRRB 2VWEE 4QXUL 1G7JA 4Z7VE 1NKOA 2A6IA 2YPLD 3H9SA 1KJ2H 4UBDC 4JKPH 3GIZH 5F9JB 4UIMB 5ALCL 3I6LE 3BIAX 5I74B 4X5XA 3SJVA 4PJ9C 4WY7L 2AGJH 5C0NC 5BMFH 3BGFC 1J8KA 1K2DB 1QFUL 5HGBA 3UYPA 3AREA 1RQ5A 2YKLL 4OZIA 3P2TA 5CJBA 5D6DA 1FHGA 1U93B 3VXNB 3V4UH 3U4BH 2Z8WC 4OGAC 4NJAL 1LP9B 2XQBH 5FYKL 5F7KC 2PO6B 4G6KH 4DKDC 2DN7A 4HUUB 2OI9C 2F53D 3MODL 4J3XA 4B53A 1F4HA 1UADC 4KKAC 4P5KB 1T1WB 2JJUA 5GRJL 5IEHA 5F3BB 1TJIH 4J3SA 3MRIA 4WI5A 2Y5EA 1CFBA 4X5WA 4JO2H 5FA3B 5MP6H 4A6YH 2C26A 2GTZB 2E8ZA 5TQ2L 4QCIB 4LLWA 7FABH 2VLJA 2FBJL 4WVRA 4HDIB 5DDHA 3P4LA 3V0VB 4L9LA 1UXWA 3EOAB 1INQB 5E94A 4NDMB 4P46B 1UM5H 1S3KL 2P5EB 3O2VL 4MJIE 5KS9B 4KHTL 3QXDA 3R4DA 2Z31B 1P7QB 2VDOH 4DKEL 2VC2L 3TBTA 3SGDH 4JN2B 2NY5H 4XBEL 2DKUA 4WCYL 3LAFA 5JA9A 1KCUH 1P4BL 1JUFA 4HEPG 2R56L 1GSMA 3MYJA 2FWOA 1FZOB 5BXFB 5BCAA 1CG9A 4RGNE 1XFPA 4J3UA 1T1XA 4FFYH 1QSED 4X6CE 4IMLB 4MCYB 5I1DA 1VFBA 4P2QA 1FORH 1JWMA 3LH2H 2JELL 2VIRB 3OG4B 4AEFA 2X1OA 1RMFL 4QF1A 1XGRB 4JREB 1C12B 4Y19D 4EUPG 1NDGB 3GSNH 2VDQH 5JLZB 2YPLE 4MAUH 4GG6B 4OCWH 1RUKL 3DETD 3QUXB 2L7JA 5BOZG 4JFYA 2IPTH 1HI6A 5T5NF 4NZRL 4I0PB 1CD1A 2GCYA 2VR9A 4CNIB 5J3HD 2QKIB 3T77A 4AY0A 4XVJH 3X13B 5C3LD 5F1KC 4DCQA 4Y4KB 2WWKT 1EGJH 4QT5A 1OSPH 1A3LL 3F7VA 3TC9A 4G6JH 1QO3B 1HHGB 3KWWB 2G5BB 2R2HB 2F53E 1U91B 2BVTA 2XTJB 3ULSB 3B6SA 3F65A 3MLWL 2D0HA 5BW7C 4DFIA 4RAUA 4G7VL 2Q20A 4X98B 4UNVA 4CDGC 3T1FB 1MCNA 1IAKB 4ZAKD 4JZNA 5I73C 1T2JA 4XNQA 1YN7A 1MI5D 4U6VH 5TF1H 2W0LA 4HBCL 3BE1H 1SJEA 1MF2H 2W9DL 4K9EL 4TN9A 4NCC2 4ERSL 3RAJH 5C0GB 5IJVB 1FRGH 2MPAH 4CVUA 4HMDA 3VG0H 1NSNL 4IRSA 1FFPA 5EOCL 4WHYG 3I85A 4PLOB 5JZ7D 3RWHA 1JHTA 3CD4A 1NCTA 1MAMH 5TGBB 2JB6A 4LSVL 2ZWLT 3GJEA 4NQEA 4E5XA 4U3HA 4F9LC 4PD4K 3ULVH 4NQDE 5GXBB 1WFTA 3IS1X 1DQMH 1EO8H 1YEKH 1OT2A 2VXTH 3MRNA 3PGDA 5DUML 3VI3F 3DRQB 3EYVB 1T6WA 1CLOH 2QQKH 4GJTB 1NMBH 2AV1A 5F8QC 3MRFB 2R4RH 1BJ8A 4F57H 1LD9A 5CGYD 1QSEE 1CGXA 3MLTA 4LSPH 4ZDHB 1JHLH 1BPVA 3EUUA 5TQ0H 4KI1A 1BFOB 3DX9A 1NCDL 4XCNB 3JV4B 4PGJA 4JCMA 1ZSDB 4JFQA 4S2SA 1DE4B 1NC2D 4XRCA 2VITA 2WBJD 3SKJH 2DQIH 4MNQA 3RL1B 4GMTL 4X6BB 3TBSB 3O3AA 5D7LD 4FABL 3OB0H 4WWKA 4Z5RA 2D31A 3QIWA 3U9PL 3SDCC 2A6DA 1EO5A 2A38A 1H3UA 4B50A 2EDHA 3N9GH 3SDDB 5DMIL 3LEXB 4OCSL 1XGTB 2VL5A 3OJMB 1I9RL 3MLSL 4YAQA 1T03H 2O5ZL 3DTXA 1SBSH 5GQBA 4MXWL 5MHSD 1U8HA 1NGPH 3S35L 4YNYA 1RHFA 5CSBA 1CGTA 1K9TA 1VGKB 1NLDH 2APBA 1EA9C 3QQ9D 4L3EB 43CAA 4ELMF 4MA1B 5JQHC 1NANI 1RUMH 2VH5L 2AXJA 5T3XE 2EC9T 1MFAL 5I1KL 1AQDB 1FSKC 3DIFA 4QWWD 1E4XI 4L4VB 2VSCA 1WQVT 3ARFA 2EDQA 2HRPL 2N4IA 4XMLL 1Z3GL 1U8LA 4TRPH 1MI5E 4N0FB 3IU4H 3MJ9L 2EXWD 2ARJQ 3A6BH 1DQLH 4HHAB 4CW1B 4OUOA 5IMMA 3IVKA 2EO9A 2EIZB 3W39A 4MMXC 5EH1A 4YGVB 3PIQB 1M7XA 3X12B 1UA6L 1N5AB 1PW3A 2CLVA 1FFNB 2DM2A 1RURL 3SE8L 2UWEF 1LDSA 2KH2B 4KTDL 1QNZH 3O11B 4EI5D 4LOUD 5C0FB 2VDML 5BZWB 4P2OB 1M1SA 4TOYL 3B5HA 4KJQC 4Y5XB 3S36H 4ZOAA 3SKNB 4CMMB 3NACL 4GRLA 5C0BB 3TGXA 3WNOA 4QNPE 4OI9A 1FV1B 1U2CA 1KACB 3MR9A 1NFIB 4H5SB 4MDIA 4Z18A 1WZMA 4IRJC 3QIUC 3EYSH 3BIKB 1F3DJ 1LO5B 5I1JH 1KELH 2H2PC 5IEKA 4MWFA 1AGFA 5IBUG 4Y1AA 2B4CC 1YMMB 1QRNA 1IM3B 2WWMC 3A67H 3VXRA 3WFDH 2G60L 4MJ6A 1RZKC 2P44B 5KSUB 1DUYB 2Z93B 4OM0L 1JJUA 3RDTA 4TVPD 4ZO8A 1NPUA 1WLHA 1A6AA 1U3YA 4U1GB 4QRRE 5HGAB 3QG6B 4BKLA 4IBLT 4MZ2A 5MHSE 4L29B 1RK0A 4RMQA 4U1NB 3WO4B 3MCKA 3CFBB 5BOPA 3MLUH 1QZ1A 5AYQA 2EE6A 1R24B 4BH7A 4LRNL 3BAEL 3MLRH 3ZE1F 1H3PH 3ETBF 4OF3A 2CDFA 4AM0B 5GISL 2WQ8A 4PG9A 1TZGH 4JPWL 2QSVA 3D25A 4IOIA 4U1HA 1T7ZA 3RNQA 2ICWA 1T7XA 3VMOA 2B8OT 2MMXA 3CPLB 3O3DB 4CRPA 4D0CA 1AI1H 1BAFH 1FAKT 1GOFA 4UU9B 4PJFE 1JPST 3UJIH 2GY7B 1GH7A 1KENL 5GGSB 5C0AA 1JK8A 1EEUA 4MA7H 4YX2L 3QDJD 4U6YB 3WD5H 5FYJL 2J6EA 2UWEB 2EDFA 1OPGL 3BPCA 1MWAA 3TN0A 4X4YA 1BZ9A 1S5IH 1SY6L 2Q1EA 1JZ2A 5I8EB 1IEAA 2BRRL 4EQ2A 3WSQH 4TSCH 1EVUA 5F89A 1N6QH 3L3OB 4W68A 1V7MH 3NPZB 4M8QB 3NCBB 1J12A 2A9MH 4IDLA 1OF2A 5DZOA 4YC2C 3TNMA 2ADIA 1DQTA 5E03A 3A6CL 3FO1B 1IAOA 3LKRA 3LY6A 1KLUA 2OL3L 4GBXC 2X4QB 3CFDA 3CFKA 3NA4A 5HPMB 2C3GA 4HLZG 4TUJA 5DFTA 4LDEB 1KJMB 4PJXE 3RL2B 2N56A 1OWWA 4PTUB 1G9ML 1UYWH 1TPXC 5KVGL 2JLLA 2EC9U 3OXRA 4O2CA 3U9UB 3BHBA 5J9PA 1T0MA 1U8KA 3O2WH 4K8RL 4O9HH 5CJQH 3V5DA 4TVPE 1TITA 3E8UL 3VXUD 4CN4A 3L7FB 1BM3H 4O02L 5DMJB 4PG2C 1K5NA 5C09E 4PJ7F 4RGOL 3UO1L 3BQUD 4WEUD 2Q8AL 4KKLD 3QXAA 5MEPB 3RVXC 3ZHKA 5HHMB 4YDKH 1MCHA 3GEWB 1UM6L 3MRPA 2ICWJ 2EDWA 2C7UA 4GQ9L 5BJTA 2XQYG 1I3UA 3UAJC 4OV5B 4LCCC 4EEEA 1EJOH 3WE6A 2VQ1A 3EDDA 1CFTA 4M6NL 1CD9B 5DD5H 1QPPA 1QVOA 3MQIA 3KLHC 4Q6IC 5I15H 1OLLA 3R06B 4JKWA 3NAAH 4Z7WB 1YEEL 2DD8L 4K3EH 2R0WH 4ELKB 1Z9LA 5FO9A 4OJFL 4ZUWB 3P30L 1B0GA 5SWSA 2HTLD 3E2HB 3T0ED 3LQAL 1J8HB 4XC3H 3K3QA 5LQBH 1T83A 1B2WH 4R8WH 1NFDF 3WV0A 3GSVA 5ADPH 4W4NA 4XX1G 4KI5D 4ZS7L 4XP4H 1IKFH 3MRKB 5L6YL 1KTLB 5IHZA 5K9QG 4KXZI 1F4XH 4PLKC 2HP4A 3IFLL 4K7PH 4K3GA 4Y7MA 4YFEA 3FB8A 1R3JB 4U1IB 1Z5LA 4M7LL 4D9RD 1W0VB 2E9BA 2I60L 4PJCE 5FK9A 2XN9D 1PSKH 3WIHA 2WUBH 4H26A 2H6PA 4LHQB 5F9WB 5I1CL 1OGAD 1WBYA 3HC4H 5FYJE 4P23C 4JO3L 5K9KA 5LGJB 1ZOXA 2EDJA 3FL7A 4HCRH 4JQVC 3PHQB 1ORSA 1LMKA 3VWJA 4X4XB 4DAGH 3NIDF 3T3PF 4YQXL 5D2NC 1KG0B 3B9KC 5GS0D 5BVPL 1IKNA 3UTTA 1B0RB 2X70B 4OAWB 1T3FB 2YN5A 4X0KA 3JTSA 5FXCH 4MB4A 5H2BB 2DBLH 2R0KH 4NWTH 5EUKA 1HHIA 4APQB 3SDAD 4S1RL 3C6SB 2ZCLL 4MCZB 4H0GA 4M1CC 4PRHD 1YNTB 4L8SA 4PB9L 1F3JB 4K94H 4OLXH 4KGLA 4QTIL 4CBPA 2G75B 3VXUE 2C3VA 3T09A 3V8OA 1U8NB 1FVEB 4CADA 1JHKL 3VJ6A 1S7TA 2V7NB 1NBVH 3WMSA 3RU8L 3OR7B 1OARL 2OSLB 2PYED 5F7WC 1NCWL 2EDBA 2YUWA 3F8UB 4Y16D 3RWDA 1RULL 1MHCB 3MBED 5E6IC 5FUOL 2QQQA 4LL9A 1FLRH 3IETA 4ZFFB 5E95B 5MEQA 4KZEH 4J3WA 2BVUA 2DQGL 5DLMH 3ULUF 5IT2H 2PR4H 2WSKA 4Q58C 2M1KA 3TO4D 1MH5A 4P3WA 2PTUA 1WC7B 3D39D 2DMCA 5DC9B 5J1TC 4QOKD 5F1IA 4LARL 4PJDB 3CFEA 1L7IH 3CDFA 3JV0A 1S7QA 2PTTB 3KXFA 1BBJB 1NFDB 1YEFH 4XWGL 4OLUH 2LVEA 4KI5E 4PYHA 3RQ3A 4QXUH 1WFUA 3RGVC 3FN0L 3PWJB 4JFPA 4BFIA 1FGVL 4JLRA 1KJ2A 3UTPD 3DUUB 4HUWA 2Y7QB 1JWUA 5T5NG 1MJ8H 4Y2DD 1BIIA 2NR6D 5JW4N 5CIPH 2XT1B 1OGAE 3GMMA 3H2WA 3MV9B 3QUYC 4HWZB 4NQVA 3ME0A 2YKLH 3UTOA 5C07A 4FA8A 3ARDD 2DLIA 2AAVA 1IMHC 2B0SL 1JNNH 2NY6D 4Z77A 2L7UA 4Z7UE 1P1ZA 2QQNH 4Q0XL 1IM9B 4XCEA 2PYFA 4U1MA 1A0QH 1KB5B 3MODH 1S7RB 3QWRD 5HYJD 2AP2A 4Y5VC 1KEML 5GRJH 2HG5B 3HCVA 1AO7E 3C8DA 5EZJA 3IDIB 4OGXL 5IFAH 1A4KB 1A1OA 3C2AH 4N5ED 1UQSA 4L4TA 1KIQB 3JWDC 2GJ6B 3MJ8A 4BH8A 1WSST 4A6YA 3DPBA 1T7YA 3T2OA 1EV2E 3VFTA 5ESQB 3LQZB 2JF1A 2IBBA 3PJSA 4HUMB 3WL9A 1HXMA 3JV5A 1C5CH 3ZYJA 4PJ9B 3ZYIA 3O2VH 2PYEE 3ZT6A 4KHTH 2ATPB 3GIVA 3T2NL 1RFDL 4I48A 5DD0L 5T5FL 4G9FB 2VC2H 5F7LB 5H37H 1CYGA 3MV01 5FCUL 3DO7B 3KDMB 2DQUH 2VXVH 5GJSL 5FM5M 4DN4L 3HZVB 1Z0MA 5L2JB 2R1YB 5HDBF 1T21B 2IF7A 5HJ3B 4PJEF 2C4FT 2JELH 1GPOL 4ZO7A 3LS4L 4XAKD 3DWTA 1V3MA 3OMZA 4UDTB 4X6DA 1MRFL 3QDMD 3DUHA 3AREC 5LAXB 4ZOEA 3VRJA 5D6DC 4Y8AA 1Q9KB 1S9XB 1HEZA 1T66C 1MRCH 1JGUL 2DICA 3VXQA 3MLVL 3GSNA 4KJYA 1A7NH 3MV7A 3S34L 1WCQA 5D5MA 1S8DA 2NW3A 1CE6A 2J2ZA 1I7RA 5T3XH 3R1GH 2NW2A 2O61A 4UTBL 1TENA 5I1HL 2CK0L 2F5BL 4KH2A 4GKOA 5E8EA 2GJZA 5FA4B 3LRSA 1DLHA 1A3LH 4JZOB 4Y5YA 3QDGA 3WKML 1EAJA 4KKBD 2NY2D 1EGJA 5ICXA 4LFHD 4F8TA 1AGDB 1R3HA 5AAMA 5DT1L 5JXAL 4P2RD 4CKVX 1GJIA 2GTWB 3P73B 4L9LC 3V7AG 2IG2L 5D7JA 3FO2A 2PNDA 4D2NA 5KSAA 4V1DB 1G7HA 4G7VH 2XWTA 1TIUA 2HT4D 3L6FB 4G8IA 1AC0A 5IB1A 3BRFA 2CUIA 1D5XA 1AE6H 4ZUVB 4AEHH 2Y72A 3MXWH 2BVPA 4NNXA 1B90A 4M43H 1O0VA 1RJYB 1G1YA 4FFVC 3N1QC 5EOCH 4M00A 5F9AC 3MACH 5DRZA 4HIIA 1D5IH 5AZ2L 2CLZA 4MD4A 4NQXB 2QLVB 1MHPL 1OTUD 3D2UB 3KPMB 4XGZB 3LKPA 5DR5H 2GSGA 4XCFL 2UZIH 4KMQA 1MLBB 3D48R 3QG7L 4HFWB 4M6ML 5DUMH 2HJFA 3K8KA 4JDZB 4C56A 4Q9BA 3BDYH 4OCNC 4QHNB 2OP4H 3OQ3B 4EN3B 4UTAL 4GRWF 5B38B 4JG0L 1JZ4A 3K2MC 4YDJA 5EOQH 3PABA 2YPVL 2GFBA 4NC1E 2HVKB 3WIIH 3OKEA 1I1RA 1I9IL 3HZMB 2PKDA 5I73B 5J4MA 2R23B 1NCDH 4G8GD 2A9NL 3IF1B 1XGUB 1EBAA 3FB5B 3O6FB 1TVDA 2ICWI 1Q0YL 4X4MA 4PJ5E 5TPWH 1P2CB 4NUJB 4HK3N 1RIUL 1Q94A 4OLZL 1XIWB 2YC1B 1IQDB 3QCVL 2K7PA 2XI9A 4H0IA 3U9PH 3WKNA 3SPVB 1FC1A 4ORGB 2OZ4L 3QIBC 1INDL 5IK3A 2NXYB 3VXPB 1FNEB 3MGOA 1JGEA 3NN8B 2BDNL 3VW3H 1I9RH 1NMCC 3FFCA 4GO6B 1HE7A 5KBNC 2BNRD 5BS0A 2O5ZH 3BESR 2X4RB 3ES6B 1CGUA 4OT1L 5CZXD 4OLYL 4R26L 1BEYL 4LEXH 4JB9L 4FFWC 4P59L 1F13A 1U8JA 5HGHA 1NUNB 4BK4A 6CGTA 5C7XL 4HLJA 3JV6A 3N1MC 2VH5H 1D6VL 5ITFA 1MFAH 3AB0C 4P4KB 1EZVX 1MFEL 3LKOB 2Q7YA 4HKBA 5I1KH 2NY7L 1GVIA 5GIRA 1BJMA 1TXKA 4FTVD 1U92B 3K4DA 4MJ2A 5HHOA 5C0EB 4OCMC 2EDEA 3TVMB 2HRPH 4XMLH 5C6WH 3CFCH 4NKQB 5D9SB 3KYNA 2IADB 4DK6A 4RBPK 3TFKC 3IDJA 1YEJH 3AS0A 5MENA 2NXZC 2A0LD 3ILPA 2IH3B 4LLYB 1D5MA 2KUTA 1FYTD 3RTQD 1IGMH 4F9PA 4XPHL 2NYYC 4NO3B 3VXME 4G43A 3QUZD 5JHDA 2F54B 1K85A 1UA6H 4JDVA 4C83B 3QP3A 5FB8B 1HXYB 5C08A 5DSCB 5L8LB 1GHFL 4R3SA 1EVTC 2MQ3A 3VFSA 2ED8A 4IDJH 9CGTA 5FGBA 3PWUB 4WFFE 2DL9A 2BNQA 5F72S 5HGDB 1FL6B 4HH8A 5ALBL 1RJZA 4XPGL 1BQSA 2AJYH 5I76B 4OQTH 1BX2B 2UUDK 3RPIB 3NACH 4PLJD 1RIVL 3RFZC 5SX5K 3VXSE 1XH3A 3Q6FA 4WWKC 3ZE2F 1KCRL 3QIWC 5T3ZL 4ZUSA 2F15A 1RZKL 1UZ8B 1MNUL 2N7BA 3ZDZF 3PWPD 4JO1L 3VFNB 3PHOA 1QSFD 4G8GE 1RJCA 5D8JL 3DXAD 3NH7L 5GHWL 2VLKD 1JE6A 3MGAA 3BD5A 4KK6D 3BEVA 5ANME 3WLBB 3SDXE 5BV7H 1FNHA 3BZDA 3LN4B 2O93L 1DEEA 3CXDL 2JIXB 2ADJB 4MXVF 1FJ1B 2QJDA 3TJEH 2P46B 3FOLB 5J89A 1OP9A 1WFNA 4M7ZB 2X7LB 2A73B 1UVQA 3IRPX 2X4SA 4OM0H 1JL8A 5J6HB 3MFFA 1AGBA 1W0WA 2WNGA 4X6FB 4Z7NF 4JCLA 4WU5A 3V4VH 4BZYA 1DLFL 2BNRE 4F3FA 3MUZ1 4L1HA 3ARFC 3LB6D 1K4DA 5CP3H 1QLRB 5IBTH 5IJKA 3L5XL 4TQEL 3AMLA 4MX7B 3KVQA 2I25N 3UX9B 4ZFOA 3GZKA 4J7RA 4NP4L 3G5YB 1YJDC 1NBQA 2PO6D 2FD6L 5L88L 3ZDYE 1YPZA 2ERJC 4KDVA 3RJDA 4IRJB 4D3CH 3BWAB 2HT3C 2VSDA 2VNCA 4JPWH 4FTVE 3AC0A 5F9OH 1M7DA 3U6RB 3QR2A 3FHAA 1DVFA 4AK1A 1NGZA 5F88B 5IVXE 5FECB 1I7ZB 2ARJA 5IV2B 1RK1A 4ONHA 5ID0B 5J1AB 2R9HC 4PP2B 5IBLC 3RUGB 5IESL 3QPQD 1FYTE 8CGTA 1Q0XL 2R69L 4QRPE 1PKQB 5IVZB 3VD3A 4WFEE 5EFIA 3QQ3A 1JBJA 2P5ED 4GRLC 3DRTB 1HZHL 5AEAA 4LBEA 3KLSA 5FYJH 1HINH 3KJ4C 4DZ8B 2Z31D 1A6VH 1P7QD 4EBQH 3DV6B 5DRWA 4F58L 3OSKA 4PPTA 5F8RC 2EYTB 4C58B 1GGYA 4XBPA 2Y06L 3GSRB 4IRZH 4OKVB 4K3JL 1N64L 2HLFC 4MYWB 1A14L 2H26A 4JRYA 1SJXA 3H3PL 1DR9A 5L9DL 3STLB 5ICYA 3QBTB 3A6CH 3D0VA 3WS6A 5B8CB 4U1KB 3PWPE 2BSSB 4LSQH 3G6AB 1QSFE 4DOHE 2OL3H 5KANG 1LILA 5F7EL 3RDTC 3DXAE 3TBYB 3MSPA 3HA0A 2J8UE 4XH2B 5D1ZB 5IFHH 4HH9A 4BQBA 4KJWD 1EPFA 2ENSA 4U7SA 3TZVA 2ESVB 3W5MA 5T3ZE 5KVEH 2PXYB 4LMQE 1G9MH 2PCPB 4AQ1B 5KSBA 2B2XL 2CLRB 4XMKL 5EO1A 3GBML 5FF6A 3DVFA 3QUXD 1KPUB 4K8RH 1HHJA 2MNUA 1ZVSA 4XWOC 4NRYA 4I0PD 5DA0B 4HIJA 4O02H 3RWCA 5J11C 4RGOH 1UACL 5BQ7B 1AFVL 4R4ND 4Y4KD 2VDRH 2Q8AH 1MCWM 5HI5C 3NTCL 3OR6B 1UJ3A 4LHUG 1LP9E 1ZS8B 4YC2B 2J8OA 1RY7B 5MEOA 3QJFA 1YY8B 1UM6H 4YR6B 1TJGL 5I1LB 5EU3A 4F7EB 2W0PA 3BGMA 1F90L 4GQ9H 2XTJD 3E6FB 2VN7A 1QYGL 2FEEL 5EU7E 2EICA 4DVBB 4HS6A 4NHUB 1HQ4B 3OKMB 1FFOA 4RFEB 4UI2A 3TN0C 3U79A 2X44D 4GG8B 2BFVL 3V5KA 1YYLL 2FEDD 2VDPL 3NFNB 1TPXB 2IGFH 2K9UA 4Z7VA 3P30H 1DQDH 3QRFM 1K4CA 2DIBA 3QUMB 1BQHG 4OD1H 1CFQA 3IU3B 3KPPB 2P5EE 5CUSL 3C9NB 2XWJB 4NZTH 1EEZA 4Q97A 3VD4A 5EO9B 1X5ZA 1TVHA 4LPCA 5IB2A 3H9YA 5EUOF 2PUQT 4OKDA 5D72L 3WUWB 2Y5TA 1C7SA 3MLYL 4YWGH 4RFOL 1PFCA 1IQWL 4NCC1 5DI8B 5GS0H 3EYOB 4RMWA 3R0NA 2DQCH 3QCUL 4I5BB 4M7LH 3O45A 4IHOB 3VFOA 3KPSB 4R96A 4NBYB 4RWYL 3QULB 5I1CH 1CBVL 4WDIA 4LCCB 2VKWA 2BMKB 3F7RA 4IJ3B 5I18H 3TBWB 4HAFA 4JPVH 1FH5H 5DJDA 4YQXH 4Z7OE 2DDQL 1J05B 5BVPH 2NY1D 1U3HA 4K07A 4PRDA 1Y6NR 1SMOA 3CJJA 3WFBL 5CMAB 4LIQL 2EDDA 1C8PA 1L7TH 2Q8BL 4R4FL 1X6LA 4NFDA 3R8QA 4XX1E 3P9MB 4KRLB 4MDJB 5IIEB 1MHEA 4K71C 2X4TB 4GW5A 4YEFA 1W8NA 3BGAA 4S1RH 2ZCLH 3U0TB 3SDDD 3S3SA 2JCCF 4PB9H 4MJIA 5FGSA 1VACB 2KZWA 2Y9RT 4R4BA 5EIIA 1WCBA 5EZLA 3MRCB 4K23H 2V2WB 1JHKH 3VCLA 3KPRA 1U8IB 4XI5D 4KV5F 3RU8H 3ARXA 5F6IC 1BBDL 1OARH 3O9WA 4LEOB 3OKOA 3P9LA 3FONB 1IEBB 4XPFL 4L3ED 5FO8A 1HHHB 1LK2B 4P23B 3H8NA 5FUOH 2FYYB 3P4MA 3W11D 5BRZB 5DXWA 3EGSB 4X6CA 1UB6B 3K0WA 1I8KB 4L4VD 2IALB 3T2QA 5D2NB 1U95A 1H3XA 1T83C 5DO2D 2DQGH 5GSRA 3BEWB 1P4LB 3VGAC 1Q72L 1ONQB 4JGMA 4KWUA 3S4SB 5JPNB 2QV2A 3H0TA 2R8SL 1G7QA 2EXYC 4XPTH 2YPLA 4HXBL 1BQLL 4E0RB 2G2RB 3GJFB 1DFBH 2HFFA 1OB1A 4X80L 1C5DA 3UZVB 1CK0L 3TM6A 1Y6MR 3QO1B 1NAKH 4N8VA 1XR9A 2XG4A 4IIQA 5FKAA 4U2YA 4N8CL 2FIKB 4HKJA 5EUOB 3U82B 3F7YB 3VWJC 3NZHL 1HH9B 4P2OD 1IKNC 1PG7L 3FQRB 1QSZA 3B8SA 3HI1B 3IKCA 4PGCA 2OK0H 5CEZD 1I1FB 1IGYA 1B0WA 3RVTC 2ICEB 1QA9B 4OCXL 1BLNB 1NGQL 5DJYB 4FP8H 2F53A 5C0BD 4EUPH 1I8IA 4XNMB 4TUKL 2P24B 3CMGA 1R3KA 4QHLA 3JWDL 5D7SL 4WV1B 4YE4L 4L8SC 1ND0B 3PQYB 3DGGB 4Q0XH 3RWGB 4NPYA 4JN1L 4AIXA 5E6YA 2Z91B 3FT2A 4M7JH 3L3IA 5CEXB 4XAWH 1YC7A 3GSOA 1J88A 5DJAB 3DYMA 2YUZA 2H3NA 1KEMH 1YMMD 4KHXL 2H9GB 4OGXH 4XMPL 2J88L 2AEIT 4JY5L 5ISZE 2RAMA 2JCCB 4YBHA 1B4RA 1NMAH 1YUHB 1T0PB 1A3RH 5DEFB 5EZOL 3RGVB 2CRIA 1LK3L 3EOTL 3SKUD 5FO7B 4PGEA 4LCWE 4NQDA 1T22A 2CGRL 5EU5A 1AKJB 2KBGA 1I85A 2VZUA 1WBXB 1DN0A 4MA3A 4NNYA 3CZJA 2AKRB 2VXUL 3T2NH 1RFDH 3QUYB 1ZTXL 5H35B 5CGTA 3HNTL 1JGDA 4JRXB 5AUMA 3IJYB 4DGVL 1QSEA 5B4MD 1F4AA 5FCUH 3AS1A 3IXTB 1DP0A 1R3IL 4RAHA 4WHYH 3BN9D 1RU9H 4YHIA 5GJSH 4OZHF 2VZVA 3GJFK 1SEBB 4DN4H 4W81A 2HVJA 4PJIF 4XXCA 1NH6A 4PJAF 2ZJSL 5EBMA 3S97C 3O81A 4JJ5A 2BC4B 3C5JA 1FNAA 1ZXQA 4QHMA 1RZ8A 4L3AA 4QY8B 5CLWA 4JM2F 4L8CA 1M7IA 2XA8L 3L3GB 3MRDB 3FRPA 3LS4H 3MTRA 4RWHA 3NFPB 4YHNB 2BSRA 5EOTA 3FFDA 5E8OB 1C08B 1ZA3A 3QXVA 3BKCL 3D85B 1VGEH 1CN4A 4F7CB 4TULL 1R5IA 1X4ZA 3MLVH 3S34H 5CLTA 5HVHC 1J7VR 3VI3E 3HAEB 1CT8A 3F5WB 4F8QA 5FIEA 3WLWC 4DKFH 5CEZE 2DBJA 2I24N 1EMTL 5E9DE 4ZPVA 4UTBH 2CJUL 2JK5B 2ITCB 5I1HH 2ZUQB 4S1SL 2CK0H 2F5BH 1KJVB 3MRQA 1A9EA 1OAZL 4G9DB 2BY2A 1KIUA 1F58L 3BKYH 2QQLL 2E9IA 4ZAKA 1G7JB 4AEIL 4BSWB 5C2BL 1DBAH 5IOPA 1MI5A 2A6IB 2AK4B 3KLDA 3BP4A 1DQJA 3WNNA 5JXAH 5T33H 4NO2A 3SJVB 1YMME 5I71C 3EYFB 5AD0A 4MS8C 2QHLA 2V17L 3FQNA 2GQHA 2A2QT 4ZNEE 5FKPA 1QD0A 4PV8B 1D9KA 1HOCA 4N5UA 1JRHL 4XP1L 4M61A 2QBWA 3P4NA 5LJYH 1UH3A 1FVCB 2NY5C 3S88L 4HMEA 4LKXA 1H5BB 5AZ2H 1OAQL 2SEBB 3UP1A 1OTTD 2F58L 4LDLB 3WFCL 5IEHB 5ELIA 3MRIB 5I1GH 4ELME 3KGRA 4U0RC 1IGTB 1MHPH 1E27A 1HIML 3V7AE 1DQQB 2NZIA 5IWLA 2VLJB 5DC0A 2JE8A 3C08H 4Y4FA 1NEUA 3RVUD 5DDHB 4UTAH 4LPXA 3TT1L 1NC2A 2YPVH 1UKSA 3RZCA 4PJIB 3EJYD 1T1ZB 1I9IH 4EIZC 5KSVA 1CDUA 3MROA 2QADC 3FQXA 2A9NH 4P9ML 1F4WH 3ZTNH 3I02A 4JM2B 1PJ9A 4JZJB 1QBAA 5DVLA 2HTKD 5E99L 3EFDL 4NKDA 1WBZB 5DJ8A 2P5WE 1RIUH 2UWEE 2I5YL 4AT6A 3MYJB 2FWOB 3QCVH 1H8SA 2WUCH 4H0HB 1E28A 4Y5YC 1A1MA 4QRRA 1T1XB 2VQTA 1ZT7A 2NMSA 3GDBA 3C8KA 3GKWL 4U1JA 4F15C 5I1DB 1VFBB 2HWZL 5D7JC 1X7QA 1JWMB 1G6RH 1HILB 3T04D 5KSAC 4WEBL 1BOGB 1T04B 1GZPA 2FHFA 1RZFL 1EAPA 4JHWH 5E7BA 1HSAA 4QF1B 1CGSH 3MUGB 1NAMH 5E08H 4R26H 1IC7L 1BEYH 1CTOA 4P59H 2H32H 2A74A 2O5YL 5EORH 15C8H 1IARB 3D1MC 1D6VH 2BCKA 3WFHB 5E0QA 4NSKB 2NY7H 3LSOB 4OZGA 4JFYB 3EOBA 4PJHF 1HI6B 3UBXA 4O5LH 4PJFA 4APQD 3C6LA 4QYOB 1MCCA 1OQOA 5INCA 1HHKB 4UNTA 4DCQB 4NRXA 4JFZL 3ULVC 3F7VB 4KVCH 4EI5A 4XPHH 5EOCJ 2C3XA 5JDSB 3QFJB 1A7RL 3BPNC 4F7TA 3B6SB 5ABDE 4RAUB 5HHME 4B0MM 4DK3A 4UAOC 4HUNB 4XNQB 1V3LA 4NM8H 3ZE1E 3Q5OA 3HI5H 1SJEB 4QRUA 5ALBH 2OTUA 4NKOA 4UV7L 4RX4D 1CXFA 1URLA 3L9RA 4H88H 4JPIA 1W2KT 4IRSB 4OQTA 1FFPB 3MLXH 2XZQH 1VFUA 5T3ZH 3RWHB 4PJXA 5L0QB 5ACMA 3NCCB 1MNUH 1PZ5A 3PWNA 4WTZA 4NQEB 3GJEB 2E9WA 4E5XB 5F3HA 5EU6E 1LEIB 4FQQB 3G04A 5D8JH 1J8HE 3RWIB 1NEZA 2NXZB 3QEUA 3PDGA 4ISVA 3VGBA 4UILL 4ZXBC 3O6ML 2AV1B 2YWZA 2NY4C 2E7BA 3ABZA 3T0AA 3CXDH 3FT3A 1LD9B 5C09A 1CGVA 1YJDL 1MFNA 2BHZA 3MLTB 5JO5A 4HLZH 4ODXA 1CL7H 1KC5H 2H2SD 1FCCA 5DK0A 3DX9B 4CVWA 2X4PA 3RWJB 4S2SB 5GS2D 2ORBH 1XZ0A 3MV9D 2VITB 1KF9B 5JR1H 4TQEH 4R0LA 3O3AB 2A83B 5CP3A 5B3JF 1TQBC 4FQXB 4G42A 5MERA 1IM9D 5GRYA 3JVGC 1LWRA 4WJ5A 5HYQA 3TLRA 4F9PC 1ZGLB 1NDMA 5H94B 4HD9A 4MSWA 2VL5B 2IQAA 4YAQB 4JQIH 3G08A 3HE7B 3DTXB 2E27L 4MAYA 4ODSL 5IF0B 2X05A 3U83A 5FGBC 1A3QA 3VGFA 3K4AA 1U8HB 3B5GA 3K1DA 5LXGH 3IDYC 1MOEA 5IESH 2JJTC 3JTTA 1AR1C 43CAB 4L1DA 3VU2A 2ZG3A 4UBDD 3SOBL 4CGTA 4PJ7E 1CDJA 4KRPC 3DIFB 3VFGH 4PJ9D 5C0RH 5C0ND 1HZHH 4NQSA 3C5ZA 4PJCA 3V6ZA 4WENB 3CH8A 3ARFB 3OWEA 4NBZB 3DECA 4G9FD 2F74B 1CF8L 5K93A 3T4YA 1U8LB 3SGJA 2Y06H 1NCAL 2BVYA 3EYQC 3ZZ1A 1P4IL 4YHYC 1UCBL 1A14H 3FKUS 1G0YR 3IVKB 3H3PH 2ERJB 3BSZL 3MREB 4JHZA 2HFTA 1AD0B 4M48L 4RRPG 5L9DH 4KMTH 3CCHB 3J8F7 3I6KA 2DQDH 5HSFA 5F7EH 5FHBH 4JO4L 4G80A 1EIBA 1MPAL 2OL3A 4KRMB 3B2VH 3OJVC 3BJLA 1XCQB 2NPLX 1NFDE 5F6HJ 3VXUA 5CD5C 3UJTH 5CILH 5IJKC 1DEDA 1BZ7B 2ADFL 2OCFD 3WHXA 4ZOBA 2EZ0D 4PJGA 3ZT5A 3BRDA 2B2XH 4XMKH 2OR9H 1U58A 3GBMH 3SCMB 1I8MA 2YD3A 3ARBB 2O5XL 3KJ4B 3SKMA 3MR9B 4MDIB 1XGPA 1H3VA 2DQJH 5JIKA 5I1IL 2E7LC 5K59F 1P5VA 4LLDA 3U48A 3MV9E 1UACH 2J6EL 2BHYA 1AFVH 1EDQA 5IEKB 4F7PA 1NLBH 1DVFC 4MWFB 3VFRB 1AGFB 1MWAL 3EHBC 4EI6B 4Y1AB 2FLRT 1QRNB 4ZFZB 3CC5A 2F9BT 4PTTB 3NIDE 3AU1A 3T3PE 4MA8L 1CGYA 2MWCA 4MJ6B 2CDEA 5IFJA 1TJGH 3O4LE 2DWEA 2BVQA 1I7UA 4H1LB 1F90H 2CMRL 1DSFL 2PW2A 2FHCA 5C6PB 1QYGH 5HHVH 1MJUH 2R4SH 4OSUH 4V1DD 1MFDL 3S5LG 5GRUH 5IG7A 1MUJA 3LKSA 4NM4L 1QR4A 1IC4L 4P99A 3G5ZB 2GJ6E 5CBAB 4BKLB 5JMOC 4YK4C 2HFEB 1HWHB 4PBWD 5E2JA 5EU4B 1ZHKA 2VDPH 5M94B 4KROC 1VEMA 4XPBH 1A5FL 2ZSVA 5DFWH 1E6JH 2D0GA 5CUSH 2CDFB 2XY2A 1MVFA 4PG9B 5I19L 3WS6C 5J11B 4L3CB 2ZUTA 3RNQB 2ICWB 3G5XB 4G9FE 5IHUH 2AABH 3D2UD 5IKCB 4BJLA 4NJ9L 4GAGL 1OP3H 1IQWH 1EHAA 2WMPA 3N1PC 3CZFA 3QCUH 3HPJB 3QA3A 4Z7UA 1GZQA 2IFFH 5KVDH 3N50A 4RWYH 3ULUE 3KPNB 3HNVH 5C0AB 3TZVC 4G7YL 1J1PL 5C3TA 1M05B 4P4RB 1S7UB 1CBVH 4AMKL 1ETZB 1QSVA 2YOCA 5B39A 1AO7A 5CCKH 2MCPH 2L0DA 1JF1A 1X5KA 3BPCB 2DDQH 1MWAB 3TN0B 2WANA 3Q0HA 4X4YB 1BZ9B 2J4WH 3WFBH 3O6FD 1ZEAL 1IEAB 2FJGA 2Q8BH 4R4FH 1OW0A 2CK2A 5F89B 2EEBA 1XIWD 1VKXA 1MVUA 1OF2B 1UJ3C 3TNMB 2IWGA 1JPFB 4DEPC 3MBXL 2PYEA 3HRZA 2NXYD 1T1YA 3MBEA 3S96A 5HI4D 1MIML 5CBEA 1NGYA 4GS7C 3CFDB 2I07B 4WW2A 3BPOB 5JOPD 4TUJB 3WNMA 4TPRH 5TDOA 4PV9A 1IFHH 4FS0A 4R7NA 2D9CA 4OCYL 4UUJA 1X44A 1UWGL 2VWEC 4MNGE 1KNOA 4AG4L 4UV4L 1FCGA 3VH8B 4D0BA 4N0YL 1U8KB 4JDTL 3WIHL 3FT4A 3IYLW 3ZE0F 5TJWK 2DQFA 3TVMD 4J2XA 4TVSa 1NCBL 3UCRA 1K5NB 2VLRB 4G8FB 4LASL 1OAXL 3ZMRA 1U42A 2ADGA 3QXAB 3SDCD 3VWKA 4JFDE 3ZL4L 5L8KB 3DUSA 2DYPB 3K80A 5DD1L 1FZMA 1BQLH 3T1WA 1LDPL 3QI9A 1P69B 1CZ8L 3V6FB 3GM0A 1G7IA 2F54D 3NGBC 2VDKH 3DX8B 1LE9A 1IILE 1EHNA 5BJTB 3LZFL 5TFSH 4ODVL 1FN4A 4Y2DA 4N8CH 2VQ1B 2GYSA 1P6FA 2RIKA 1JMXA 4QTHA 2FL5A 5F6IB 4NHCH 1QVOB 1JPGB 5D6CA 2IFGA 4RCAA 3QNYA 4IOFC 1PG7H 1U3HC 3ARDA 3BD3A 3EJJX 3H7BA 3U0PA 4I2XE 4YXLH 2RR3A 4OCXH 3IFOB 2JB5L 1TQCC 2H1PL 4YHLL 1HYSC 4XNYH 3QWRA 4TUKH 3GHEH 1KYOK 5D7SH 1T5XA 4NWUL 4OZ4B 4EUPA 4W4OA 2I27N 3BISA 4YE4H 5HDBE 2NZ9C 3L7EB 3MO1B 1MJ7L 1T20A 5GZOD 4PJEE 3HC0B 2GHWB 4DQOH 4JN1H 5IHZB 1FDLL 4K94C 4LVEA 4YO0B 1IAIL 4HGWA 2RB8A 3MOAL 4KHXH 3O9WC 5FK9B 1BWWA 4Z76A 5HVGB 4XMPH 4WI7A 3ZHDA 4MD0A 1FIGH 2J88H 4RGNC 3V52L 5K9KB 1N0XL 1NFKA 1CLYL 4NO0B 2OXGA 4YLQT 4ORZC 3PUCA 3RHWF 5I8KL 5EZOH 1LK3H 3EOTH 4YPJA 2OQJA 2YBRA 2CGRH 2Y1VA 3VWJB 3D3VB 5F7YC 3RX8A 3UC0L 3UTTB 4KJQD 5JOPE 3GMQA 2D03L 1GOHA 4YIQA 4H25A 2RGSA 3RRQA 5DEGA 2P1YA 2Q6WB 1MJJA 5CJOH 1ZT1A 1HHIB 1NGWA 1PQZA 2DI9A 4N68A 1AP2B 1MELA 2E9JA 4L8SB 4IRJD 3QIUD 1OLZA 4LCIH 2ZUWA 3K74B 4OIAA 4EDWL 4CADB 1KLFA 2BOCA 4IIQC 3VJ6B 2H2PD 1VHPA 2NTSP 4BQCA 2A77H 3QSKB 4PJ5A 4MLSA 3DURA 2C3WA 4ONOA 2ZJSH 3V4UL 5KG9B 1S7VB 5A2JH 5A2LH 5CJ8A 2HJKA 1MCRA 4G6KL 4WI4A 1W72L 4WHTA 3S6CA 2KPNA 2P45B 2YPKA 3IETB 4ZD3H 5MEQB 1KUMA 3WS3A 4JM4H 3NCMA 5MP6L 2P49B 4A6YL 2XIDA 5BZDA 2P7TA 3L95A 3OV6A 3FHQA 5DWUH 5DK3A 4GRWE 1M6OB 3OAUH 4KKCD 4IEFB 5CGMA 1FYHB 1ERNA 1VDGA 2R2CA 3D69B 4P5MA 2XTLA 4C4KT 1F58H 1EFXA 3HMXH 4HPYL 4AEIH 4ZOCA 3FTGA 2VDOL 5IW6A 4GFTB 5EC2A 5D1ZD 3T8XA 2X40A 3W9DA 2NY5L 4HKXA 4JFPB 1I85C 4BFIB 3ZO0A 4RIRA 3U36B 1CR9H 1KJ2B 1JWUB 4X7SH 5DTFA 3VXMA 1WVZA 3HR5A 2V17H 4I0CC 4ONGH 3L3HA 4FFYL 2DQTH 3BW9B 3GK8L 5C07B 4I77L 2NLJA 2V9QA 3LH2L 5EN2A 1P1ZB 4XP6H 3STZB 5AYUH 4XNZC 3EIFA 3S88H 2PYFB 2Z8RA 1HCFX 3CXHJ 4U1MB 5F1NB 3GUTA 1VADB 4LK4A 4N0CC 4ZG1A 1I1YA 2Y6SC 4YHML 1MREH 2F58H 3HCVB 4XXCC 2XWBB 3K8LA 3WFCH 3FCTB 3H9HA 4ZFGH 5IB4B 5EZJB 2GSIB 3VXSA 4KPHL 2VDQL 4UDUA 1UQSB 4L4TB 2VR4A 1HIMH 2YWYA 3EO0A 4MAUL 1C16B 2VZSA 4HV8A 4BH8B 4OFVA 2IPTL 3INUL 3DETC 4NN7B 3VFTB 4ODHL 3VXTA 3TT1H 2P8PA 2F19H 3F7QA 1HXMB 1PVHA 3O6KL 4XVJL 3ZKNC 1DCLA 5KN5A 3BQUB 5ANMA 4RSVA 3SDXA 1EGJL 5I9QC 1DBKH 1OSPL 4RQQB 1U9KA 1OD9A 4G6JL 2CKBL 4Y89A 3DMMA 5E24E 4EQ3A 1PKQE 3ARGA 4YDVA 5FUZH 3ALPA 4JFEA 4ZAKC 4QHUA 5I17A 5TF1L 1MF2L 2XFXA 1QRKA 3GKWH 4HIXH 4U0RB 3KPTA 4YPGA 4ZO9A 1V8HA 4WEBH 3T0EB 4BQ8A 3VG0L 3PWVB 3UAJD 1G6RA 3SEPA 3ZE2E 1OTSC 3VG9B 2IANA 4LVOB 4FTVA 4P9HC 5DF0A 4JJHA 1F6FB 3ZDZE 3F62A 1MY5A 1D9KC 1NAMA 3VRJB 4OF7A 3ULVL 4J8RA 3KLHD 4HQQL 1HEZB 5TE7L 5IVXA 2H32A 3GSNB 2DJ4A 4KJYB 1EO8L 3LKQB 3MV7B 5JOFB 2VXTL 1U6AL 4HUKB 1S8DB 4H1LG 1HDMA 2NW3B 1CE6B 1G9NH 3UJJH 1CLOL 1I7RB 1BD2E 2QQKL 3MLPA 3QEHA 1NMBL 4Z7QF 4LNRA 2NW2B 2ESVE 3MJ7B 3QZWB 2R4RL 4F57L 3VGGA 1KLGB 4QRPA 3M07A 4MXVE 2ENYA 3GMPA 1NCCL 1N4XL 5GGRY 5E8EB 3GO1L 4JFZH 2GJZB 2P8LB 4PR5B 2RCSH 5IWLC 3KYOA 3PP3H 1T89A 3QDGB 4PJBA 4Y4FC 3PXHA 1TCRA 2VERN 3M17B 4Z7NE 4PLKD 5ICXB 3C60A 5DYOB 3FOMA 1R3HB 1Y18B 1B3JA 5CP7B 5GRVL 1OSZA 4F15B 2BOBA 5C0CD 3MOBH 2DQIL 5D7JB 1A7RH 2B5IB 2FX8H 1MCIA 3RZCC 4KUZL 3X14B 1KIRA 4P23D 3IB4A 2XWTB 3HNSH 4N8PA 5BRZD 1SJVA 4G8IB 5DQJA 4CMHB 5IB1B 2VISA 1D5XB 2GT9A 3PWPA 5C9JB 3P77A 1KTRL 1QSFA 1B6UA 1QQDA 3QFDA 1FVDA 4OLWL 2BVPB 3DXAA 5TE4L 4KY1L 1T03L 3W2DL 5D96B 1SBSL 1FC2D 4HIIB 3DX6B 3CH1B 4NT6A 1XCTA 1QFWL 1NLDL 3VFPA 4MD4B 3GI8H 3HRPA 4M1CD 5LGHH 1RUML 3GMRB 2GSGB 4M3JA 3NBNA 5F9JA 2HJFB 4WO4B 4GLRI 3UPRB 1WK0A 3OKLA 4MQ7B 5EBWA 3O6MH 1TZHB 3CFIC 4YDJB 1IL1A 4BQ6A 4S1QH 3PABB 4C55A 5D70L 4JFFE 3BPNB 2GFBB 3T4AB 2CXGA 3IU4L 1L0YA 5IROA 1A1NB 1U36A 2Y36L 3A6BL 4XB8A 4QHKJ 4KFZC 1UEMA 1DQLL 2E7CA 4YGAB 1GIGL 1LP9A 2HH0L 1KB5H 4ZO6A 3KPSE 3W0WB 2HYMA 2NY3C 2PO6A 3O3BA 1RIHH 3S3PA 1S9YB 3QXTA 1AD9A 1HQRB 2J5LC 2VXQH 3S35X 3C6LC 2Z92A 2CIKA 1KT2B 3BZFA 1BVKA 3DNKA 3PQYD 5E2WL 4EI5C 4QCIA 4LOUC 3SKOB 2BSTA 3VH8G 5IK3B 1JYVA 3BKJL 3MGOB 4HDIA 3NPSC 5CSGA 4AIZB 3PV7A 5I8CB 3QEQA 4P46A 1AGCB 5BS0B 2FHBA 3NMEA 3N85H 4ODSH 2P5EA 2V9TA 4U7MA 4YHZH 1PZUB 2WINA 2NY4B 3Q3GA 4NQCB 3KYKL 3RGVD 4U6TA 4JG1H 1U8JB 4QXWA 3EYSL 4NNPH 5HGHB 1QBLL 1ACZA 3SOBH 2AJZA 1NCUA 4JN2A 2YZ1A 1AHWB 5ITFB 5GGSY 1KELL 5I1JL 2Q7YB 3ULUH 2R2BA 3BDXA 5GIRB 4Z6AT 5F21B 1FZOA 5BXFA 1JPSL 1EHXA 3A67L 3QUYD 4ZQKA 2XY1A 4JQXA 4JRXD 1EEYB 3E1F1 3QHFH 2QEJA 3L5IA 1PGRB 4IMLA 4MCYA 1TQBB 3EO9H 3IDJB 1KPVA 4MQXC 1UCBH 3KLAB 4O4YL 5CINH 1D5MB 5E5UB 3BSZH 5CKAA 2E6JA 5JHDB 1XGRA 5BV7C 4JDVB 4ODWA 4E41B 1F42A 5HDOA 3MLUL 5DRXB 5JLZA 4JO4H 4TNWK 1G7PA 4HS8H 1ZT4A 4LU5H 1JI2A 4YBLC 2PETA 2V9RA 1RJZB 5GGTH 4I0PA 4BSVA 3LQMA 2BVEA 3T0XA 4CNIA 3D85D 5EUOE 4R0LC 2QKIA 4RZCA 4KRPB 5I66A 4PY7A 3X13A 4ZMAT 5CEYB 4HC1L 3VXOB 4ZUSB 2O5XH 4R2GC 4NOBA 1YECL 5E1AB 1BAFL 1J0HA 5GRVK 2BK8A 1MRDH 1HHGA 3M8OH 2G5BA 1U91A 2YA1A 5DURB 1T2XA 1OAYH 4AIOA 3QDMB 3MRHA 5CZKA 4YHYB 4MAYC 1P7KB 4HT1H 3WD5L 5DQ9A 3MNVB 1IAKA 1DEEB 5K9OA 3PQYE 5KSBF 2AK4D 3LDBC 1F6AA 2CUMA 4HPOL 3OKDA 1DSFH 1UVQB 2X4SB 1NEZG 3WSQL 3TIDB 1N6QL 5C0GA 1AGBB 3SJVD 1MFDH 4BK5A 5IJVA 5HHQA 1V7ML 4WU5B 2H41A 3C5ZC 1INEL 3NCFB 1K4DB 2JCCE 1KXQE 4RDQF 3SGJC 2V2TA 4ZFOB 5FGCB 1ZLUH 4KV5E 3IGAA 1MIEH 2V5RA 3K8MA 3P0YL 2EDLA 5I19H 1MQKH 1RZGB 1M7DB 4Z8FH 2AQ1A 2R2EB 1IGJB 1DVFB 1YEGL 4GAGH 3RIFK 4CJ0A 2ARJB 2VLJD 1RK1B 3LEVL 4O9HL 1BFOA 2HT2C 1LQSR 3HTLX 5KVFH 3JV4A 2W1NA 1BM3L 4QRSB 4ENEC 3RL1A 1MCQA 1UEYA 3QQ3B 3GMOB 3TBSA 4JFXB 4EOWH 1L0QA 3M1BA 4LBEB 2IPKB 4P5TA 1G9MC 4Q9QL 2M26A 5DRWB 4YK4B 3B9AA 5ISZA 4K8RC 3RX7A 5L2KE 1N5YL 4UT9L 3EJZC 1BECA 5DD6A 3HR6A 4LCWA 3L1OH 1A6ZA 2DL2A 1XGTA 3FO9B 4KROB 5HPOA 1MCOH 1EJOL 3NFSH 2EH8H 4JRYB 4FHBD 5DA4A 1DDHA 4DW2L 5DD5L 3VFMB 3OBAA 1CICA 4GAFB 3MBXH 5ICYB 3D0VB 5I15L 4RFNB 3HE6B 5E6IA 3NAAL 3O4OC 1VGKA 2YD6A 4GMSH 4P2QD 1UH2A 1XT5A 1QR1B 5IP4A 4XC3L 4JFHD 43C9A 5LQBL 4HH9B 3UXFA 4XNUH 4OCYH 3TZVB 1IKFL 4KI5C 1JGLL 5GGRA 5KSBB 5F7NC 2AK4E 4N0FA 3VD7A 3MPCA 4N0YH 5FF6B 2CRZA 3WIHH 1HHJB 4HHAA 2B20A 4R9HA 4NRYB 3SJVE 2VLLB 2EIZA 4N9GA 4YGVA 3PIQA 2Y25A 1JNJA 4GSDL 3HC4L 1N5AA 1Y0LA 4WW1A 1OAXH 3LD8C 3QCTH 1FNGB 2NY0B 4DAGL 5I16B 5C0FA 2FX7L 4P3CL 5MEOB 4DEPB 2XNAB 1LDPH 5GS0C 3FB6A 5BZWA 3W5NA 4P2OA 5EU3B 4U7KA 3BGMB 4Y5XA 4GRWH 2AXGB 4MXQC 3HUJF 3QFJD 3SGKA 1X4YA 4GS7B 4ODVH 2DBLL 1QTYT 5E9DA 2BNUB 3HB3C 4U1SB 1YEIL 3SGEI 2AJXH 1FFOB 2QR0B 2NX5A 1HNFA 2CDGB 5FOJA 4PUBL 1NFIA 4H5SA 4K94L 3KYMA 1ED3A 3BIKA 3VRIA 4V2BA 1OW0C 2JB5H 4KJPC 1ORQA 1T5WA 4OZHE 1LO5A 2H1PH 3QEGH 4YHLH 4IRSD 4PYGA 1CFQB 4PJIE 4PJAE 4NWUH 4DKAA 3GM8A 1YMMA 5KS9F 1IM3A 4NQED 1KTDA 3CSYB 4OD3L 2LTQC 5D1XB 1P5UA 5IB3A 3VMNA 4ZNEA 2Y5TB 3MBEC 3L3JA 35C8L 3TFKD 4X99B 5KSUA 1OCWL 5JORA 1I3RA 1FLRL 2NXZD 4WW2C 1T0NA 2P8MA 1AXSB 2Z93A 4YXKH 1QFOA 3O45B 1FP5A 2DMBA 5HYEA 4R96B 5IT2L 3QZWG 4CVXB 2DM7A 1FNFA 5HGAA 5JA8B 4PP1D 2LABA 3V52H 1J0IA 4L29A 4WDIB 4U1NA 1CLYH 4L5FH 3CFBA 1ITBB 4OF6A 4ELMA 4HF5H 5DJDB 5GRZA 3UC0H 5BO1L 4M03A 1U3HB 3IAPA 3SO5A 1GL4B 4LPVA 3CSGA 4JFHE 4OFYA 4N0RA 1NL0L 2X2YA 4OLUL 1BQUA 3G9VA 4FQXD 5B39G 3QH3A 3VWKC 4F7MB 1FAIL 2G5RA 4GG6F 3O3DA 4X6EA 3QI9C 2X9WA 4GXUM 4UU9A 4R4BB 5EIIB 4EDWH 1MJ8L 1WCBB 5EZLB 5CJXA 5GGSA 3VCLB 3KPRB 4Y2DC 4J3OC 3HE7D 2DKMA 2Q3AA 4QXGL 3IDNA 1U41A 2P5WA 1QLFA 2UWEA 3OKOB 4PGDA 4HW6A 3ARDC 3T0WA 1JNNL 5FO8B 3PL6A 1A64A 2QQNL 3ILQC 5D7KE 3P4MB 2H8PA 1A0QL 5I8EA 4UT6H 1W72H 5HHNB 3UEZA 2NTFB 4HG4J 3HUJB 3ESUF 3QFJE 4TSAH 4XVTL 5ETUB 3VI4F 1SJHA 1RUAH 2AERT 4M8QA 2ZCKH 2B7DT 4Y0GA 3OAYH 4W4OC 5IFAL 4LAQH 3ARFD 5EA0H 3QPXL 3C2AL 4NFBA 3RBGA 3FO1A 4M6OH 1GGIL 1TMCB 1KSRA 3ZKMC 3H0TB 4ETQB 4LLQA 3K81A 4OCRH 4EDXB 2HFFB 1RZJL 5MI0C 1C5DB 1C5CL 5DJCA 3WDHA 3RL2A 4N8VB 3W82A 4IIQB 4DUWA 1D6EB 1LEKA 4MVBC 4HPYH 1G7MA 5CD3A 5C0JB 4HKJB 3WXWH 3HMXA 5GGQH 2R9HD 4LQ1A 5DJXB 4PGCB 2YEZA 1LO0L 3IKCB 5E8PB 2AK1H 3X3GH 2CR3A 5GS1A 5L8JB 4FQPA 5D93C 1IE5A 1GGBH 2DQUL 2VXVL 4ZSOE 3GK8H 3SCMD 5C1MB 5CIPB 1CI5A 1A7PL 3ARBD 4QHLB 4NC1C 4JKKA 1LE5A 2F5AH 5MEPA 1N7ML 4I77H 4X4ZA 5EC1A 4JKMA 3QXWA 5FHAH 1WZKA 3FT2B 2VLMD 3L3IB 2HLFD 3MV8E 3MNZB 3OTTA 4YHMH 1N2RA 4JR9H 4Y1AD 3M45A 1H3TA 1QRND 4LLVA 5HYSB 3NIFF 4MJ5A 1QFWM 4KPHH 1P9MA 1MRCL 1A7NL 5T1KA 5HI3C 4GW1A 3LV3A 3INUH 4J1UB 3B9DA 4KKNA 3QUMH 4PJHE 5T3XL 3R1GL 4NQDB 1T22B 1ES0A 5EU6A 1F11A 4ODHH 5DS8A 4ZUWA 4LVHC 5E8NB 3CLFH 1II4E 4JHAL 1J8HA 1Q8MA 1F2QA 4P57A 5IR1B 2VUYA 2CH8A 3O6KH 5ERWA 1DN0B 2BVOA 2P42B 4DWHA 3AS3A 2YXMA 4NNYB 1FZKB 1TZIA 3D5OF 3MRKA 3VFVA 2CKBH 4IM8A 1P84J 4XTRD 1JGDB 2NY2C 3QIBA 3UTZB 1I3GL 4XHJD 4HBQA 4XWOD 4U1IA 1VFAB 4XNZB 4BYHA 4P9HL 3CMOL 2E3VA 5LGJA 4OTXH 2HT4C 4J4PA 1D3CA 2HVJB 2RQ8A 3CDYA 5IM7B 1AE6L 4AEHL 5EBMB 3PHQA 1MCWW 3MXWL 2EDNA 5HDQH 3C5JB 3OX8B 4QHMB 4M43L 4L8CB 1M7IB 1NANH 3IDXL 5C0AD 5A2FA 5C6TL 2X70A 1TTUA 4P2CG 1JFQH 1T3FA 4KVNL 2DQEH 4X7EC 5HXMA 5EOTB 3MACL 5H2BA 1D5IL 3FFDB 1G7LA 4APQA 1ZA3B 2GUOA 3TN0D 4HQQH 2WM0A 5TE7H 3X3FH 2D7TH 5DR5L 3OJDA 1OTUC 2UZIL 4J12A 1U6AH 1ZLVH 1CT8B 3BDYL 2K3TA 2OP4L 1U8NA 1FVEA 1WEJL 5E4EB 3HFMH 4CVZA 4J3VA 5EOQL 4PJ7A 5DMYA 3OR7A 4PREA 1NCCH 1N4XH 2C1PA 5FYLD 5TDNA 3WIIL 3GO1H 4DN3L 1UM4L 3MRQB 2X42A 3TIEA 2DWDA 2FRGP 2ZPKL 4X7TA 2NY1B 4LFHG 5IOPB 3EKCA 3HPLA 1DQJB 3U0WL 4Y4HB 4ZFFA 2VLME 4BZ2H 4EJ1C 5TPWL 2QSTA 4OZGF 3I6GA 4OD2A 4NO2B 4KUZH 4Y19E 5B3JE 5FCSH 2D7OA 4RX4A 5AD0B 3FQNB 3AM8A 4D0DA 1FGNL 3IDMA 3ZKSD 4WFGD 1WC7A 5FKPB 3DMMC 3BFOA 1D9KB 3UDWA 3ARGC 4M61B 4OLWH 1FL3A 4N1EA 3VW3L 4PGBA 5TE4H 4KY1H 1I1AA 3O6LH 2PTTA 3CUPB 2VLRD 2A6KB 3W2DH 1U8PB 4M9OA 1JZ3A 1NFDA 4NYLB 4CU8A 5CZXC 4WHCA 4LEXL 5DJ0B 1QFWH 2DYPD 1Z9SA 3AVEA 5I2IB 3B9EA 3PWJA 1E27B 3MRMA 2YMXL 5FGRA 2EKSB 1TTFA 4NIKB 5I6XB 4Y4FB 2FEEI 3S37H 4BZ1L 5F1OB 3DUUA 4MNHA 3FQTB 5KOVC 2EH7H 5C0DA 1SVCP 3MV9A 2EO1A 3CFCL 5D70H 2CRMA 2VAAA 2OTWA 4YDLC 3RZCB 5C86A 2Y36H 1YEJL 2AEQL 5KSVB 3RVVD 1J11A 1GIGH 2HH0H 2IAMB 3BVNB 1R5WB 1IGML 1WZLA 2FB4L 2EDTA 3I02B 3O4LA 1KB5A 3WBDA 1S7RA 2VJXA 1YQVL 3MGTB 3QUZC 4JY6A 4LQFH 4NKDB 2HG5A 1EBPA 4ZS6D 4M1GH 3L5WB 1A4KA 4IDJL 1J5OL 4QRTA 1NJ9A 2NQCA 1KIQA 1T89C 4QRRB 5E2WH 2HRLA 2GJ6A 3C60C 2VRAA 1N8ZB 1ZT7B 3VA6A 5I1AB 1FL5A 2R15A 3C8KB 4M3KB 3BKJH 5ESQA 1H15B 5T1LA 4BQ9A 1JTTA 2AJYL 4OQTL 3RIAK 1WICA 1S7XB 3OKNB 2EIBA 1HSAB 1KBGH 5FYLE 4NO0D 4HKZA 3KYKH 4RDQG 4IS6B 4LHUA 3VWJD 1JNHB 3RA7H 2DQHL 3D3VD 4G9FA 4PS4L 3D6GA 1QBLH 2A74B 3OGCB 5K59E 3UTTD 2W38A 4TVPL 2BCKB 1WFOA 3EDKA 4U3XA 2DM3A 4OZGB 2NY3B 5DVKA 5BV7L 3OPZL 5D7LE 1JPSH 3AXLA 2K7QA 3OZ9L 3HZVA 4XZUA 3TJEL 3CVIL 3MA7A 5L2JA 1L6XA 5INCB 2ZOLB 5F1SA 5HJ3A 3U4AA 1RZIA 3FAXA 4O4YH 3V4VL 4JGUA 1BQHA 1YYML 3WHE1 2VLRE 4O2FB 3ROLB 2CUHA 5IBTL 2D0FA 3JXAA 5IROC 4Z0XA 5SWZB 2XZCL 3ZT7A 1MCJA 3BWUC 3OAZK 3FMGH 3GHBH 2PO6C 5EIQA 3EFFB 2XKUA 4D3CL 3BZ4B 2OTUB 3D0LA 2DI8A 5F9OL 4FQJH 1JN6B 5EU7C 5GGTA 3L9RB 4HXAH 3MOQA 4OUUB 4HC1H 4ZYKB 1AC6A 3TJHC 1YECH 4M1DH 4Z7WF 5DJ6B 2X09A 3HZKB 4HIEA 1AGDA 4MNGA 4S1DC 4HWEH 4ONFH 1L4IA 4HGMA 3QPQC 2FGWH 3QRGH 5GGVL 3P73A 1H3GA 4Z95L 3AMKA 4P46C 2CR6A 5EULV 5JUEH 3QEUB 4ISVB 1HINL 5A2KH 4PJGF 1A6VL 2MCG1 5C09B 4EBQL 2VZ3A 2OR7A 4RA0C 3WJLA 1G0XA 4ZUVA 4HPOH 1NUGA 1X5JA 2DLHA 5JO5B 4IRZL 2B39A 4F33A 4JFDA 4QGYA 5DK0B 4YHPA 4KC3B 3O8XA 2X4PB 1INEH 3DBXB 1WTGT 1XZ0B 3V5HA 2DLTA 4LVNC 4JQXC 5C07D 3BP7B 5A2IH 4R0LB 4LSQL 1UJTA 3KNBA 4TTDC 3ZLQC 3D3VE 4KQ4H 3KPMA 3V4PL 3BYTA 2COQA 4R2GB 1A47A 4HFWA 4WJ5B 5HYQB 1I4FB 1NDMB 5IFHL 4I2XA 1VA9A 3P0YH 4EN3A 3HI6L 5ACZB 3RJQB 3ZDXF 2IQAB 5KVEL 1NBZA 3G08B 4L4TD 1S7WB 1YEGH 4MAYB 5IUSA 1HN1A 5E00A 3LEVH 3X17A 3GGWA 5M7QA 2D7QA 4OB5H 3B2UC 3IF1A 4PJEA 5CWSA 3ZE0E 4P3DA 5I0ZA 4I0PC 2HN7B 5JIHA 3FB5A 3IJHA 3O6FA 5D1QB 5DUPL 2FR4B 1J1OL 5DMKB 4WWID 2VDRL 4QKXB 4R4NC 4MS8D 1XIWA 2YC1A 3C5ZB 1IQDA 4PJCB 4Q9QH 1XF3B 2W91A 3T4YB 2W65A 1U8MB 4ORGA 1ZGLM 5DC4B 4WNQA 4F80A 1N5YH 1FNEA 4UT9H 4HIHB 1QOKA 1TETH 4DW2H 2X4RA 3V0AC 1AJ7L 1CVSC 4PJDF 2FEDC 2IGFL 3ARWA 3P11H 4HAGA 1DQDL 4G80B 4P4KA 2OL3B 4OD1L 5C0IA 3QDJE 4GKNA 4NZTL 3IKKA 4LGSB 4HWNA 3WHXB 1V3JA 5AAWA 4X8XA 4PJGB 1JGLH 5F9DC 5HYSG 5D9SA 4FZEH 5F97E 4YWGL 3MV7D 1GGCH 5CSZA 1U58B 2LV4A 1I8MB 5GS0L 3SKMB 4WUUB 2IH3A 2DQCL 3KS0H 4LLYA 3WNKA 1XGPB 2Z8SA 3I75A 4PRBA 4GSDH 1I7TB 4C83A 5FB8A 3TNNB 1HXYA 5DEZA 2ZZUT 5I18L 1MAJA 3DX7B 4JPVL 3QDGD 1FH5L 4MJ4A 1R6VA 2VE6A 5J6GB 2FX7H 2YSSA 3AU1B 3PWUA 4P3CH 2FECL 2DWEB 3CIQA 1QG3A 1KULA 1IZJA 1L7TL 5D7JD 2PW2B 1PY4A 5KSAD 5I76A 3NCEB 4Q6YA 5INDB 1ULVA 1AXTH 1MUJB 1S5HB 3LKSB 1YEIH 4P5TC 3STBA 4FMFA 2IBZY 3T0VA 1JRHI 1UZ8A 2BZDA 1CLZH 4PUBH 2Z4QB 4YBQC 2IMMA 2G9HA 1G9EA 5TE6L 4K23L 2XG5A 1TVBA 1CXIA 2ZSVB 4OGYL 5J57B 4E42B 4JRWA 1A6UH 1N26A 3WLBA 1CICC 2V2XA 4PFEA 5ADOL 4OD3H 2JIXA 3DVNA 3GNMH 3T65B 3RKDD 5LG1A 1GRWA 3MMEB 3LD8B 35C8H 5E5RB 5J13C 1OCWH 3ULVD 3NCYP 2X7LA 2A73A 1XF1A 4I3RL 4WO4D 2HLAB 4K3DH 2IBZX 2Q7NA 3CZFB 3OG6B 4X6FA 3TYGH 3QA3B 3U4EA 1GZQB 3H6JA 1BFVL 5IMOA 5I1EH 2VO5A 5H8DA 3PWLB 5D2LF 1QLRA 1D5ZB 4ACPA 4MX7A 3BUYA 3MRJB 3S37X 4Q74A 1AO7B 3W0WD 1KV3A 3VDBA 1IRAY 4XPTL 5BO1H 4PGZA 1DFBL 4N0UB 3T0EE 4D9QD 1FNSL 4TSBH 3FRUA 3HS0B 2FJGB 3QWOB 3RVWC 1NAKL 1GGUA 1NL0H 3PDDA 2D7MA 3ARVA 4PY8J 3U6RA 1RPQA 2AVGA 5J12B 1VKXB 4NGHL 1RUPH 1PDKA 3GMNB 1ODAA 5IV2A 1FAIH 2XPGA 5J1AA 2IBGA 2LTQB 4P2OC 2OK0L 1T1YB 4Y5XC 3BPLB 4XNXH 3AY4A 4D9RE 1ZLSH 5FDWB 1ZHLB 2XN9E 3SGKC 5CBEB 4RMRA 4FP8L 5BS0D 4WW2B 2W60B 2A6JA 4C4KO 3CDGA 3VFUB 4QXGH 4FRWA 3LMJL 1ZLWH 4PV9B 1J0JA 2NY4D 4NQCD 2HMIC 2AI0L 1FFRA 4DZ8A 4UUJB 1X6NA 2WIIA 4I13B 1ADQL 4FXLA 3TH3T 2EYTA 3BDBA 3SY0A 3JWOC 5C70A 3W81A 4M7JL 4XAWL 3OF6D 4XVTH 3FT4B 1W72A 4PRAA 1QFHA 1RUQH 1ZA6B 2DQFB 5DHYA 4WUKL 3QPXH 2OJEA 3MV11 3STLA 5JW4R 5B8CA 4PRHE 5IQ9A 4GKZB 1NMAL 4U1KA 2ADGB 2BSSA 1BVLA 1A3RL 1GGIH 4LP5A 4F2MA 3VWKB 3DUSB 3MFGB 1FZMB 3TBYA 5DHVH 3NIGF 5D1ZA 3QI9B 5J8OA 5HHPB 1YMHB 4POZC 1G7IB 2AEPH 3EAKA 4PB0H 1RZJH 5JHDD 1CCZA 1BD2A 4E41D 3I9GL 3ARRA 3BGFB 4XXDA 5FAAA 2ESVA 1FN4B 4LCUA 2PXYA 4NKMA 4KK9C 2DLGA 4QTHB 2CLRA 2FL5B 3EO1A 4RAVA 3QNYB 5KW9L 2GKIA 3ARQA 1LO0H 3H7BB 1AR1D 3U0PB 5B4MC 4PRPB 2GJJA 1I8LA 5J06A 2OI9B 1OD7A 1RU9L 4KRPD 3BN9C 4S0TD 5BQ7A 5D2LB 1D7FA 2R0ZH 3D39E 1A7PH 3SO3C 5JXEA 2FX9L 4EUPB 4QOKE 3OR6A 2R1WA 1N7MH 4NRZB 5GGUB 1EHLL 3BH8B 5DVNA 3W0WE 4H1LH 1YY8A 5D71H 2EE3A 1UWEH 5I1LA 4U6HA 5CJXC 4F7EA 3BO8A 5DURD 3EYQD 5CZVL 3E6FA 4X4ME 3UTSB 3B5TA 4HGWB 3O3EB 1X5YA 3RWFB 3F12B 1Q9LA 4DVBA 1I3VA 4Z76B 1VGEL 2YK1H 1HQ4A 4NHUA 5MI0B 4LSTH 4RFEA 4G8EA 3PL6C 4DKFL 5DFVD 3BXNA 3EZJB 3UTPE 3C8HA 4Z7QE 3MRLB 2OQJB 2YBRB 4KDWA 2OLDA 5FUCE 4JHAH 4D9LH 3QUMA 5E70A 2YD4A 3TESA 4NKIH 3KPPA 5CD5D 4FQIH 3GMQB 3C9NA 1A6TA 4H25B 4NQCE 5D93B 1KEGL 5EO9A 1FLTX 3BKYL 3TH4T 1MJJB 1C5BH 4FG6C 4JFFA 1PQZB 1DBAL 1EUUA 1I3GH 5AG9A 5DI8A 2CKBA 4I4WA 1UZ6F 3BX7C 5HYJE 3LN5A 4I5BA 5DRNA 3KPSA 5T33L 32C2A 4P9HH 3CMOH 3QULA 3SE3A 2BOCB 1DVFD 1C7TA 2BMKA 3DURB 4KTEL 3TBWA 4GT7A 3QDHA 5GS1C 4HJ0C 2HJKB 3IDXH 5C6TH 3WXVH 4IOSD 4EXPX 1WAAA 3HG1B 1MHHB 4WHTB 4KVNH 4E41E 3MUY1 3P9MA 1SYSB 5IIEA 2X4TA 5I1GL 1QKZH 1RJLA 2ATKA 4HZLA 2XXCB 1JV5B 3U0TA 4KAQL 1LO2L 2Z9TA 5BZDB 3C08L 2P7TB 3L95B 4Q7DA 4YXHH 4KROD 1PG7W 1WEJH 3RVUC 2V2WA 4JRYD 5JNYA 5DD3H 1ZV5A 4TUOA 4N1CA 1P9MC 4DN3H 3FONA 1UM4H 3HE6D 3U30C 2EECA 3EJYC 5A16B 1EFXB 2ZPKH 5EBLA 2IMNA 5JOEA 2WK2A 1F8TL 1F4WL 3FTGB 2VKXA 4OZFB 3ZTNL 5IW6B 1VENA 5EC2B 3U0WH 4XAKE 4LGPB 3E2HC 1RHHB 4HKXB 3QDME 3UPAA 5F7DA 4RIRB 4K7FB 1RV6X 5F70A 3TZVD 3BEWA 4AJ0A 1EZVY 3HR5B 1P4LA 2WUCL 5EWIL 3K2UL 3TCLA 1FGNH 3L3HB 4ODUA 4M6AA 1C1EH 3MUJA 3S4SA 3OKYA 4LKCB 5JPNA 4PJBF 2NLJB 3PNWA 3RNKB 3CXHK 2G2RA 1G6RL 1GC1H 4LLUA 5EN2B 2HAZA 2VYRE 4JHWL 5F9WC 1CGSL 1NAML 5F44A 4ZXBA 3L3DA 5E08L 3OKKA 1QBMH 2WBWB 2B1AL 4J4PC 4GQPH 5ITBH 3H9HB 2NY0D 5EUOA 4JFOA 1KJ3H 1R5VA 3VXSB 1HH9A 4UDUB 5EORL 15C8L 5FGCE 3EO0B 4P2RE 2AQ2A 2YMXH 1CLCA 3PDOA 4M9PA 3DVIA 4HV8B 4BZ1H 2FATL 1XGQA 4X7DC 1BLNA 1HCVA 4O5LL 3G6JF 4RRPA 4XNMA 4APQC 1EO7A 3TA3A 4FZ8L 4JAMB 5KN5B 3IFPA 4NQTA 5E2UH 2AEQH 3KPQA 4NOFA 1UB5B 1A6PA 1M71B 1ND0A 3PQYA 4KVCL 3JVGA 3RUGF 3SDCB 4CN6A 3DGGA 3RWGA 2FB4H 2Z91A 3T0BA 4OF0A 1AQKL 1QFPA 1G9NC 1MCBA 3CLEL 1YQVH 3ARGB 1ZANH 5DJAA 3I6LD 4YDVB 2WW8A 2YUVA 2H9GA 3CVHH 2GIYA 4I0KA 5D1XD 1J5OH 2C4FU 4WGWB 5IMLA 4JFEB 3E3QE 1DL7L 1OM3H 2JCCA 4NM8L 2DLFH 4WTWA 5DZNA 4EIGB 5I17B 5JW3L 3HI5L 1YUHA 5DEFA 2JJTA 2XFXB 3NCJH 3QNZA 1CE1H 4C59B 1AKJA 1CQKA 4YPGB 1FO0L 4C54A 2FJHB 1FSKB 1WBXA 4H88L 2ZKHL 3MLXL 2XZQL 5D7IF 3AM8C 1X5XA 4OIIH 1WUNT 2AKRA 2IANB 3QXUA 1JF6A 2EE2A 3MCLH 3QUKA 3UDWC 5E8DL 5IW1B 2DQHH 4PS4H 3IJYA 2AV7B 4IOFD 1U3HD 5IB5B 1OP5K 2H32B 4TVPH 3IDGB 1ZHNB 1I1AC 4URTB 4Q9RL 1H0DB 2Q86A 4PJ8A 3S5LA 3QEHB 5SX4I 3OPZH 2AJSH 1HYSD 1OT1A 1S9WA 2FZ3A 4DGIL 3C2SA 1NQBA 1SEBA 4QRPB 3OZ9H 5KSBE 1GAFH 3JUYA 3GMPB 3CVIH 4MJID 4XPAH 5IGXH 1CL7L 3MRGB 1KC5L 2BC4A 4PJBB 5ACLA 1TCRB 4FN0A 4QY8A 2H2SC 3C60B 4XBGB 3FOMB 3KPRD 5L2KA 3NFPA 1YYMH 2ORBL 4YHNA 3N1FC 3ZYZA 2BOBB 1UWXH 2HKFL 5JR1L 1X5LA 5E8OA 3EZ8A 1C08A 3NABL 3DARA 1NC4B 2X4NA 4PY8I 4F7CA 1XF2A 2XZCH 1KIRB 4HK0A 2GAZA 2AXFB 3ALXA 1MFBH 4Z9KB 3TPUB 5DQJB 2C9AA 2VISB 4HJJH 2GT9B 4HMCA 3QIUB 2J8HA 3P77B 2AJ3A 4DOHB 1QQDB 2E7LA 2MQCA 3QFDB 4RMSA 1T7VA 4UOJA 5I30H 2JK5A 3G6JB 2ITCA 4JQIL 3FB7B 3B3IA 3HN3A 3I3DA 2W0FA 2R1XB 4LSDA 5J7CC 2VABA 3AGVA 1X4XA 1G6VK 5LXGL 4NT6B 1XCTB 4HC1A 2LU4A 3VFPB 4BSWA 2AK4A 5GGVH 3ZTJG 5C8JA 4Z95H 1BFSA 3OHXA 3VFGL 5C0RL 1U8QA 3OKLB 2APTA 3EYFA 4FQHB 5EBWB 4EVNA 3D9AL 4N90D 1IL1B 4XT1C 4PV8A 1YQ2A 2L4OA 2E7MA 4ZTPH 4PRIB 1FVCA 3O3BB 4XP9H 3ULUC 1AD9B 4D94A 4LSRL 3KPOB 1OAUL 4KMTL 1H5BA 5D7IB 2Z92B 2SEBA 2CIKB 1NGXA 3BZFB 1BVKB 5IMKA 1IGTA 3WEXB 2DQDL 3V4PH 5FHBL 1DQQA 1JWSB 2BSTB 2LU3A 2UVEA 3B2VL 1E4WH 1IAII 2VLKE 5FYKD 3VA2C 1B4JH 4M5ZH 3RI5K 3UJTL 5CILL 3HI6H 3A6OA 4Q9CA 1CDHA 4OZHA 3SDYH 3QEQB 4QEGA 1K6QL 5DK2B 3TPKA 2CRYA 2EZ0C 4PJIA 1T1ZA 4NO5A 2OR9L 5ESAB 4PJAA 2BXZA 2WINB 1MEXH 3Q3GB 3JBG7 4NQDD 4CJ1A 4JM2A 2DQJL 1SYVA 3KPRE 4JZJA 2X41A 1F97A 2AJZB 4NCDA 5JQ6H 5DUPH 4OI7A 1J1OH 3V8CA 1WZ1H 3TV3H 3DSNA 1WBZA 2R2BB 1NLBL 4FQLH 5DUBA 1PX3A 2UY6A 3U7WL 3L3KB 4HSQA 4LVNB 4ZQKB 3Q6GH 1A7QH 3P0VL 3LHPL 4C57C 3HUJE 1FQ9C 1EXUB 1DBMH 4GBXB 1S7SB 1KPVB 5HHVL 1MJUL 2R4SL 2Z35B 4OSUL 1HILA 5GRUL 1BOGA 1T04A 4N0CD 4S0SD 2Y6SD 3MUGA 3B4NA 3R8BB 4ODWB 1CXKA 2HJLA 3WJLC 1K3IA 1AJ7H 1SEQL 3TF7C 3V6OE 1S9VB 2IPUK 4XPBL 3WFHA 1G7PB 1DUZA 4NSKA 1I9EA 1ZT4B 3LSOA 3O8XC 1E6JL 5KS9E 1UFUA 4LCYB 4BSVB 1UC6A 4CDHA 4QYOA 3ZKND 4N90E 4RZCB 5I66B 2AABL 5IHUL 4PY7B 3QO0A 2BY3A 1K3ZA 1HHKA 2XRAL 5GZND 3QHZL 2DTSA 3C09C 5KVDL 2IFFL 3MRBB 4DZBB 2FO4B 4EN3C 5JPMA 5T3XD 3HNVL 1L6ZA 3QQ4B 5JDSA 3QFJA 3MRHB 3PGFL 3CSBA 4EXKA 1AH1A 2APFA 4V2CB 5DQ9B 4GRMB 5CCKL 1KOAA 4YHOL 5EO0A 2MCPL 3WNLA 2YHGA 1F4YL 3SGDI 4Q6IB 5K9OB 3BP6B 2W92A 5FM4A 5SWQB 1NBYA 1F6AB 2J4WL 4Y4HD 5FYKE 2XICA 3OKDB 4W6WB 3O6FC 2VUOA 5HHQB 1CFVH 1XIWC 1OTSD 3NZ8B 5ENWA 4GG6E 1D5BA 1D9KD 2XQYK 3BMWA 1AIFB 2V2TB 2NXYC 4YFDB 1LEIA 4FQQA 3BZEA 5TE6H 3IT8D 5HI4C 5IQ7L 3RWIA 1EUTA 4OGYH 3IGAB 5C0CB 4TPRL 3REWA 1IFHL 5AWNH 2X89A 4H8WH 4XVUC 1IGCL 1TDQA 5ADOH 3F58L 3ARZA 4ZSOA 1WV7T 3GBLA 2YA2A 3PV6A 4QXTA 4ZPTA 4ZTOL 1OHQA 4I3RH 4P4KC 4Y4FD 4FFZH 2XTJE 3B9KB 4IMKA 1A7OL 3VI4E 1HSBA 1BFVH 1WGOA 1A2YB 3RWJA 5B38G 1LEGB 3MZTA 5I75C 4FXKB 3TVMC 4MQSB 2WQRA 3MV8A 3RZCD 3G6DL 3M1BB 2A83A 4GAYA 4P5TB 4FQXA 3DO3A 4HUXA 3GSWB 2IAMD 5CEZL 4OZFG 5ISZB 1S78C 1ZGLA 5H94A 1FNSH 2ICCA 2VDKL 1LO3L 2DI7A 5DD6B 4PJHA 4LCWB 1A6ZB 5TFSL 1F2XK 4FQ2H 3HE7A 1DDHB 2R29L 1CDIA 1MFCL 4NGHH 4QRRD 5IF0A 4NHCL 1CICB 3KS0J 4WTXA 3JWOL 3I2CH 2CQVA 5E6IB 4YXLL 3LRGA 1U8OA 1KIPA 4KUCF 5J13B 1A6WH