4Y8AA

Crystal structure of the n-terminal domain of ceacam6
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
b'AKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carcinoembryonic antigen-related cell adhesion molecule 6
publication title Diverse oligomeric states of CEACAM IgV domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 26
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y8aA00
4PJXA 3EHBD 2HMID 4UQ2A 3T77A 5LJYH 1DN0B 3VFPA 5E6YA 4A6YA 5D5MB 5L8LB 2YR3A 4PP2A 3RHWF 4NM8H 4HQQH 2A1WL 2I5YH 5F7KC 4PY8J 2K3TA 4KI5E 1S7UA 2C4XA 4LEOB 4MDJB 4PJEB 2ZUUA 2BFVL 3A6CL 4EXKA 4RWYL 1OW0C 2OQJA 4XNXH 4NGHH 3HR5A 2AK4B 2GSGA 2BRRH 3QULB 1GGUA 5JW3L 4P5TC 1JPSH 4PJDE 4MXVE 4ODBD 4GAJH 2NY4B 5D96C 2X09A 3RP1A 1SMOA 2AXHA 2PUQT 1UA6L 1PZ5A 5JNYA 4L4TE 1WEJL 2APWA 1R3JA 4B41A 2WBJA 4HUMB 3H0TA 4L9LA 3DROB 1P4LA 5BW7A 1Q9KB 5FOBA 2P49B 4X7SL 3EYVA 2APTA 2VE6B 5FKPB 1V7ML 3HR6A 1F4XL 2EH7L 4RZCA 2CK0H 4PGJA 4R8WL 4NQSA 4QRPD 8CGTA 1JPTL 2EYRB 2WBKA 4O2FB 3AXLB 4U4BA 5AUMA 3VFWA 1MLCB 1RUMH 3NIDE 4LRNL 5GGTL 4ELMF 3S5LA 5BCAA 1TFHA 3MRGA 3RJDA 3TCXA 3UJTL 4F33A 1PLGH 2W91A 4XP4H 2BHUA 3CFCL 1Y0LA 4UINL 4P57A 3TJHC 4ZXBA 2C3HA 3P4NA 3MREB 6CGTA 2J8HA 3L95A 4HUXA 5SWSB 1OQXA 1BQHB 4MJIA 2BSSB 1M7XA 5F8QC 3KLSA 5C07A 1EEYB 4UAOB 4YHIB 5C0RL 1DDHB 4ELMA 1KUMA 2W07A 1IC1A 5HYSA 4HT1H 4N5ED 2X4SA 1JGUH 1MCOL 4MXWH 5LXGL 1UXSA 1BVZA 1U3HB 3OKMA 1LGVA 2JCCB 2ZUXA 3U0TB 5ID1B 2C26A 4KKNA 5CD3A 2D9QB 1GGBL 1RIHL 4P2RD 4OGYH 4K71C 1OD9A 1TNNA 1FJ1A 1QBML 1PY4A 1ZHBB 2UWEF 2UVFA 4W68A 5TQ2L 3V5HA 5ADOL 4CMHC 2BVOB 5BRZA 2ZUQB 2F8OA 3CD4A 1XCQB 3QIWB 4JO3L 2Y72A 4ONOA 2B0SL 2DMBA 4LCCA 5H37G 3BZ4B 2R8SH 5CEZH 4N5UA 3BD4A 1T04B 2XRAH 1IC4L 3HI6H 2W9EH 4JM4H 1SY6A 3HE7A 4MJ6A 3O6ML 4GRMB 1QSZA 1CTNA 2WBJC 3T4AA 5DQJA 3FQRA 5T1LB 4XXDA 4L9LC 5BW7C 2UWEA 4PJHA 1Q72H 5ISZA 4PJBF 2FD6L 2NYYC 1PBYA 1PJ9A 5FB8B 2DOCA 4PJAF 4XGZA 4Y16A 3ZTNH 3KJ4C 2DLHA 1FN4A 2CJUL 3LQAL 3QPXL 4GRLD 3MOBH 2NW3B 1FBIH 5CINL 1F4YH 4PP1D 1BD2E 4P9HH 2GKIA 4BYHA 2F53E 3QUZB 3V6ZB 3OWEA 4ZXBC 5KSUB 3R0NA 4PJBA 3VH8A 4W70A 2WQRA 2XY2A 1RK0A 2K7PA 5I1KL 2F15A 4PJAA 1IMHC 4WHTA 3UPCA 2CDFB 4MNQB 5F7UA 1CZ8L 4WW1A 2COQA 4QKXB 2VUOA 2Q6WB 5E7FA 3LKSB 4I18B 1N0XH 4FFWD 3EDDA 5EU4B 3BP7A 4U0RC 2HTKC 5GRVL 3U4BL 1N4XH 1MCIA 2NQCA 3OGCB 3OSKA 3L3KB 4EDWH 4ZFFB 1U93A 5EBGA 1S5IL 3THMH 4M62H 5I1IL 3NCJL 3L3JB 3DX9B 3GIZH 3T08A 3Q3GA 3X17A 4HXBL 1MELA 4DJMA 1Z5LA 1B4JH 5HDQH 2FZ3A 1DR9A 1YC7A 3QUKA 4FP8L 4LNRA 3IDYB 4M7LH 5EULV 2HVKB 4IMLB 1KJVB 4S1DC 5CSZB 5HD8C 4LCCC 4NWTH 3BIKB 5D9SB 5FM4A 5D7LB 1J18A 4FXGB 1T7WA 3HE7C 4JFEE 1ZWIB 2BNRE 3X11A 3FB7A 4XMPH 1HI6A 3ARBA 2AABL 1C8PA 1DBBH 4U6HB 2DAVA 3JV6B 3BDBA 5IFHH 3EGSB 3D85B 2YZ8A 1A4KB 2AP2A 1JK8A 1OPGH 4LSQL 3DGGB 2IWGA 4OI7A 4Y16C 5EU6E 2X4RB 1FFPB 1FVEA 3IYLW 5GS1B 2HLAB 4NJ9H 2YK1H 5KW9L 1W0VA 1RMFL 1MJJB 1RHFA 2R39A 4OLZL 4OZGE 5D7KE 1UM6H 4WJ5A 2VLRE 4NQEB 1CD9B 3LN5B 3MMEB 2IFFH 4MNGE 3DYMA 3SCMD 3UYRH 3FB5B 5LVEA 3S4SG 1AHWA 4OCWH 2GJ6A 1MFBH 1X6LA 1PAMA 2AQ3A 4NZRL 3QNXB 4K7PH 4C56D 2Q86B 1VENA 2FEEL 1OAXL 3OQ3B 5DRWA 1LO4L 1S7XB 3HNTH 3CX5K 3TNNB 5B3JE 3WFBH 2JJVA 4I4WB 2J7LA 4MS8D 1NSNL 4JG0H 3UZVB 3OF6D 4LKCA 1GC1C 2OJEB 1K9TA 1U8NA 4Z0BH 3O3EA 4XNQA 4CJ0A 3O8XD 2FHBA 5F3BB 5DJ8B 1MFAH 3ORJA 1FVCA 1U0QA 4NRXB 3GSXA 2QJDA 4R4NC 3LEYL 2IEPA 3TT3H 4FQHB 5I76A 5FEBA 2NY1D 3HS0B 4UNTA 1FG2A 1XGQB 5JHDE 3FCTA 1LD9A 3KYNA 3WJJA 4K8RC 2BNRD 3EYOB 5CZXC 3BKMH 5EFIA 1M7IB 4P4RA 4NYLB 3QZWB 1RULL 2DN7A 3IDXH 3U0WL 5IOPA 1M05B 2QQKL 2P8LA 5I30L 3VD5A 3ARBC 1CIDA 3BUTA 5CKGA 3CZJA 4JRYA 5D72L 4O00A 1W0WB 5FGCE 5DQ9B 2XTJE 4JFDB 3IDJB 5I16B 1PEZA 1UM4L 3LVEA 3IU3A 3MUJA 5AEAA 4OZ4B 2Q3AA 3CFIC 2OZ4H 3HI6L 4LP5A 2FBJH 2W9EL 1SJVA 4JM4L 1JGEB 4MQXD 1AR2A 2AEPH 2VABB 3ZYOA 3X14A 2QEJA 4X6CF 3M07A 1QO3A 3HMWH 1CD1B 3IU4H 1VFOA 1FORL 1GHFL 4LASH 1FL5B 1HHIB 4S2SB 5D70L 1TQCC 2R2EA 1D9KA 4Y5YA 1CU4H 3RA7L 4QLRA 1KYOK 4PD4J 1QR1A 4UILH 3ZTNL 3QPQD 3S88H 3QUXA 4KK5D 2PO6A 4DGIH 3IVKB 2Q3ZA 1NL0L 1AHWC 3IDNA 4BM7A 3T3MF 2ZPKL 2PW1A 1S9VB 3WKMH 1S7SB 3PQYB 1EA9C 1F4YL 5D2LF 3QRGH 1U8QA 5HHNB 5D2NA 5B38G 4MHHG 2H9GA 4NHUB 1D6VL 1OP3H 1UZ6F 1NAMH 3PP3H 3VMPA 4OCLC 2V17H 3WFDL 1U8IA 3D69A 3ZL4H 5T3ZH 3QNZB 4POZC 5T3XE 5L2JB 4PLKD 1E28A 5JLZA 4OAWA 1SEBA 3KXFE 3VRIA 1YNKH 5JHDD 3ZDYF 4QGYA 5J89A 6FABH 5DURD 3Q6GH 1E6JL 4GW4B 5DT1H 3O3BB 3WJJC 1P53A 1F5WA 3MFFB 4Y2DC 5E9DA 1K2DA 1N5AB 2F58L 1AR1C 4FOMA 2IC2A 5EZOL 4PJDB 3N9GL 3NH7L 4P2RB 1KN4H 2X4TA 3QFDB 2R2HB 4M1GL 1J0YA 4NBXB 5GRVK 3A67H 4QRRA 4NO3B 4AEHL 5JW4Q 3LPWA 3WN5A 3TA3B 1T66D 3OTTA 5GS0H 4L4TB 2Z93A 4M7LL 4TQEL 1ZK9A 3LEVL 1RJLB 2X4QA 4NWTL 4H1LH 5MEQB 3BP5B 5JIKA 1XGTB 3BP4A 2YC1A 5A16A 2XWBA 5MEOB 1IJ9A 4JZJB 3RPKA 1AGCA 1BX2B 3DHJA 2D9CA 4E0RB 4UT9L 4NKMA 4XCYA 3JVGA 5IFHL 1P4BH 1OTSD 1D9KC 4Y5YC 1GZPB 4I13B 2CKBB 5I1CH 3KPSD 3U1SH 1U41A 1B2WH 3GBNL 3CZFB 2PO6C 4GRLB 1F8TL 4L8SB 3TFKC 1UJ3A 4NJ9L 2PYFA 3K7UA 4Z7UB 4UUJB 4G8IB 4POUB 2D0FA 3L3IB 3BRGC 5D2NC 1EMTL 3MV9E 1UM6L 5HY9B 3D87B 5E8EB 5EPMB 4P49A 3VFUB 3MRCB 3BD3A 4OGAD 4WHYG 4B0MM 2A0LD 5TF0A 2JB5L 1QLEL 3GSWB 2D4FA 3GHEL 3MCG1 2FEDD 1P1ZB 3GJEA 2CDGA 5F70A 1FL3B 2EDYA 2ERJC 3FB8A 2F5BL 1A9EB 2EDFA 4H5SB 3KLAB 5JW5B 1N3NB 5EU5B 1D5XB 1NDGA 2CUHA 2YD7A 1Y18A 2VXVL 1WC7A 1H3PH 4OKVA 3WNMA 1NUGA 3STZA 3MV8E 5DRZA 3TBSA 1LEKA 3RFZC 2Z31D 3MLUL 4Z0BL 5I1AB 4IRSA 3KPLB 3SDCB 4AT6B 1BZ7A 1TJIH 4GKZA 4N0UA 3WN5C 5J1SC 2LU3A 1CF8L 4GKSA 1YPZF 1OTUD 4ZQKB 5HHMD 4P5KA 3O9WD 7CGTA 1KTRL 3CFBA 1IGFL 1KF9B 2IG2H 1T1XB 2LTQC 2XWJB 4M3JA 1LP9E 2ARJQ 3FMGL 3IDXL 2V2XB 3I75A 1ACYL 1DBMH 2F9BT 5FUOL 4NQXB 4OLVH 2VDML 3JVGC 2EH8L 3TYFB 2RHEA 5D1ZD 3KYOA 3BN9D 3TYGL 1I3GL 3SKOB 2CSPA 3EO9L 4HIXL 3LY6A 4OM0H 1BD2B 3V6FA 1IGCH 2F53B 1UJ3C 3HG1D 1AJ7H 3MV9D 5BVPH 4MLIA 1EH9A 1LO0H 2D7TL 4ELKA 1FIGH 2VC2H 1NFDA 4FFYH 1C5BL 3KLHC 4LLQB 4G3YL 3L5HA 3DURB 2JB6B 4IOIA 4WWKD 1UVQA 4UILL 3GMNA 2AJ3A 4RX4A 5DVKA 4PRBA 5K33A 2ADGA 1X4ZA 4C56B 4KROD 4PV9B 4MJ5A 1NBQA 2WLZA 4GMTH 1LMKA 4DK6A 3H3BC 1X44A 4LLWA 3CUPA 3U83A 3EDFA 3P9LA 1NMCB 1D6EA 1B90A 4OZHE 5LBSL 5KN5A 2NX5E 5C0ND 4KXZH 4L8DA 4PJ9B 4NJAL 3MLVL 4E5XB 4TVPD 1WFUA 4ORZC 4EVNA 2Q8BL 3G5XA 3O8XB 4IRSC 5A2IH 1NMAL 4LHJB 3QH3B 4FFVC 4NSKB 2B4CC 4R7NA 3TBVB 5E5MA 4QOKE 2ARJB 6FABL 3CDGA 3Q6GL 5DTFA 4HWUA 5DT1L 3SO3C 4JFEB 1DCLA 2BNRB 5K59E 1D5BA 4HH8A 4KJPD 4MAYB 1DBAH 1A14H 4LMQI 7FABL 3C8DA 2J6EH 4HKJB 5DUBB 2W92A 4YO0B 5BVJB 1Q38A 3CVHH 2B7DT 3C8KA 1REIA 3VFNA 1IGIL 2JELL 2CQVA 5FFLA 5EU6B 2XFXA 2NTFA 3PWNA 4LIQE 1L0YA 5LG1A 2WUBH 4DVRH 4B7IA 4CNIB 4PRID 3QI9C 4XAWH 3O6FB 5CAYB 2YSSA 3ZSTA 4ENED 5LGKA 2FIKB 5E8NA 1YY9D 4OZGB 3B9EA 4JHAH 5FDWA 5AYUL 3DSFL 4MNGB 2YEZB 4ODWA 2B39A 4DN3H 2Q8AL 1R24B 1QEWA 2DM4A 5I1CL 3MLRH 2A9ML 1S78C 2DWDB 3LDBB 3OR6B 3VFGH 3U9UB 4NWUH 3HNVH 4KRLB 2ARWA 3L9RB 5EBWA 4MWFA 4JAMB 4LPCA 4JFHE 1RZKH 3KYKL 2VNCA 2NY3D 2FECI 5FM5M 2GSIA 1WCBA 1MFNA 5JHDB 2XOTA 3SGDH 5DURB 5EC2B 3K46A 4S1QL 4Q6YA 4NCC2 4F58L 1HINH 3IGAA 2X9YA 3ABZA 4L1DA 4NC2B 3DUSB 2V9TA 1C16B 5F3HB 4L9DA 5TE7L 4HK0B 1RZFH 5EZIL 1KT2B 5I6XB 3FFDB 3K74B 5D1XD 5FGCB 3ARGA 5DI8A 3QQ9D 3NCMA 4LAJH 1TJIL 1FP5A 4G7VL 4JY5L 1S3KL 5HYJD 1M7DA 1S7QA 4DKAA 1EO8H 3DARA 4M4RA 4NFBA 1XEDA 2YN5A 4TOYL 3RTQD 4PLJD 1FDLH 3MNWA 3MO1B 4QCIB 1Z0MA 4DGYL 3H8NA 4Z7WA 1YJDC 2HKFL 4HBQA 1JHKH 3MLTB 4D8PB 1ZGLA 3KPSB 5E2WH 3OXRB 4M03A 4KAQL 1SYSB 4OM0L 2H2PC 2DQEL 1DANT 4N8CH 2ZCHL 3TNMA 4OQ1A 4BZYA 3TV3H 3HA0A 1VERA 1U8MB 4OLXH 1CFSB 1NAKL 1AJ7L 5BVPL 3MCKB 2DQUH 3IFLL 3GSOA 5HI4C 4M5ZL 4FFYL 2E8ZA 1LEIB 3R0MA 2XZAH 2F5AL 1HNFA 1RY7B 1MOEA 4MX7B 3FFCE 2X42A 5C1MB 2ZCLL 3D6GA 4HGKC 4MA3B 3KXFB 4PGCB 4KTDH 3VE0A 1E27A 1G6RL 4J12A 1NDMB 1I7UB 1S9YB 5DHVB 5HHQA 2LQRA 4YHKH 3FQXB 1FRGH 5LCVH 1EHLH 2HLFD 1ORQB 3CX2A 3WHXA 1FO0A 2A9NL 3PNWA 3T0BA 5CJQH 1FNAA 3MRDB 2XZZA 3F7QA 1RPQA 3ALWA 4U1SA 1YY8B 4NKIH 2HFEB 1J0JA 1KPUA 3S4SB 3ZTJH 4HJGA 3ULUD 5TE6H 4P5MA 3LHPL 3G9VA 1MQ8A 4NO2A 4P2OA 1N7ML 2CMRH 4OD3L 4OBSA 1V7NH 1VGEH 2Z31B 3EOAA 2ORBH 3FHAA 4ZAKA 4U6YB 4X4ZA 1P7QD 3ARGC 3VXUA 2DICA 2EZ0C 4XP6H 2E6QA 3S5LG 1Z0NA 5F7EH 5JPMB 4R90H 1T20B 1MCKA 4Z78B 4FXKB 4HEPG 4IS6B 2BNUB 4X4XA 4QY8B 2KZWA 4JFXB 1T7XA 1IAKA 5ERWB 1J0KA 5GGQH 43C9A 2FX7H 4Y4FD 3U36B 4IRJA 3BT2L 4KXZI 2B5IB 4X0KB 3VWJA 3MRRA 4U6TA 1RJZB 4BH7B 5HYSG 3W9DA 3RRQA 4D0DA 4LOUC 5D1ZB 4RMTA 3WL9A 4YJZL 4HUKB 2EYSA 3CFJB 4OJFL 5DK0A 3QIUD 4GRWF 4LARH 1JL8A 4I9WE 1JN6A 2PYEE 4V2BA 5DLML 3BUYA 4H8WC 5IMKB 3MV9B 1ZGLM 3VRJA 5LQBL 2FGZA 2P7TB 3G5VA 1XAUA 3TH4T 4IHOA 5F72S 2CGRL 4AG4H 4XMKH 4WWKB 4PJXE 3MLRL 2R56H 3CLEL 4YDVA 3BOVA 1Q1JL 4NN6C 1MAKA 1K8IA 3LIZH 2X1QA 3WLWD 4EUPA 4KROB 4M43L 2BMKB 1RHHA 3RWDB 5CHNA 3BH8A 2HJKA 4IDJH 3EO0A 4JFYB 3CXDL 5C0CD 5ID0B 1I8MB 4BZ2H 5LWYL 2APBA 5CJ8A 4JQIL 2MQ0A 4CUCA 1EERB 3MV8B 1KIUA 3MLWH 3O41B 1G7LA 4P2OC 2XXCB 3RWGB 5E5RB 4BH8B 3HB3D 2UV3A 5B38B 4TUKL 3HNSH 4ZAKC 4F7MA 3TIEB 4RGOL 4GAYA 2VAAA 1KLGA 4MCZB 1FH5L 2ZNXA 1BOGA 1E6OH 3MRNA 4MJ2A 2AJYH 2VITA 5H35A 4JY4B 4KDVA 3F7VA 2WWMD 3GB7B 1LP9B 4KDTA 5FO8B 1YMHA 3MLSL 3U46B 4FS0A 3BWAB 5MP6H 5IB4A 1HDMA 1KGCE 2BHZA 2YA2A 3WIHA 5B39A 2W38A 1AKJD 4IRJC 1JNHB 3VWJC 5K9OA 3IAQA 2W9DH 1FAIH 5C2UB 2V2WA 4JPKL 4Z7VF 1EO8L 3MNZB 3G08B 3RNQA 2J8UF 4UU9A 3SGDI 1PQZB 3JTSA 4XCNA 1JIBA 3BGMB 3ARYA 4R97C 3BEWA 3HPLA 4RIRA 3E3QC 3J7HA 5AZEL 3GMOA 1KV3A 4JPWL 4HBCH 4LGSB 2YRPA 1NCBL 4HV8B 4PTTA 3DJ9A 1R5IA 5E8PA 1GIGL 2FR4A 1I9RH 5E2WL 3JWDC 3R1GL 4MJIE 3GIVB 1H9VA 4GFTB 3BYTA 4NC0B 5FHBL 1G7QA 5FA4A 5C07E 5FYLL 4YBQC 4OCSH 1M4KA 3T3PF 4BJLA 3RAJL 4YHML 1ND0B 4OZHB 4U1JA 2ICWB 3L3GA 5DJXA 3AMLA 1ZVYA 2J1KA 3VXRA 1V3JA 2XZAL 1EEUA 1MREH 4QWWD 1PFCA 1ZEAH 4X6BB 4XRCB 2NY3B 4JM2D 1ACZA 2MHAA 1I8KB 2H8PA 4V1DD 2O61B 1I1YB 4DKDC 1CDYA 5D6CB 1Z9OA 4OFPA 3O3UN 3RUGE 4QOKB 1ONQB 1SY6H 4YR6A 4JDVB 1CXHA 4LDLB 5FCUH 3MGOA 3ZKND 3PJSA 4HLZG 5JIPA 1SYVB 4U1KA 2HH0L 3RVXC 1CGWA 5BRZE 4L4JA 5EIVA 4MA8H 3LPFA 3T0EA 4KDTC 2HT3C 4L8BB 4M02A 1KGCD 4DN4L 4Z0XA 3F7YB 1LWRA 4Z7QF 5DS8B 3QHFL 5D1XB 5FCSH 2P1YA 3RWIA 3SHSA 5IFAL 2J3SA 4OV5B 2FX8H 4XC1L 1C12B 3KHQA 3FONA 4FZ8L 5AZ2H 1G7IB 5JORA 2YPLA 4OD1H 5AWNH 5KTEL 4HLJA 4KJYB 2X4UB 4LNVA 1XF2A 3NPSB 3OAZH 1ADQL 1EUUA 4TVSa 4CGTA 5BOZG 5C3LD 1Z3GH 3U4EB 4M8QB 3M45A 5IM7A 4AEEA 4ZO8A 4O2EB 3S96A 3MXWH 4I0PA 1G0XA 4IDLA 1ZT4B 4XPGH 4OLUH 1EJ6A 5J11C 2G9HA 5FECB 1WBYB 5ESVB 3K1KC 4HKZB 3C9NA 4ZG1A 1C5DB 3LV3B 4NZUL 5I8CB 1KJMA 3UBXB 1GC1H 1QZ1A 1G9ML 5B22A 1ADQA 4IOSD 3HE6D 3G5ZB 1JZ4A 1OAQH 1N59A 1AY1L 3B9VA 1QQDB 4KK6D 2VLME 4MVBD 3MRFA 5EZJA 3MJ9A 4PG2A 4K8RH 3MRLB 3LD8B 2CIKB 1NFIA 3NGBC 1ZA6B 3I2CH 2UUDH 1WFNA 1P69B 4IDJL 4YXKH 3B9KB 2NY6D 1S7VA 2P42B 3NVQA 3T0EC 4F7TA 3U7YH 1OGAD 2E6JA 1U8HA 2VZ3A 1JRHH 1U8OB 5FGRA 3RZCB 1JF5A 3MJ6A 4QNPF 3BPLB 1CGUA 3JWOC 5FYJD 2VDRH 4HX1B 3Q5TA 4X4ME 4FQJL 3OR7B 1JNJA 1E6OL 4F37F 1Q94B 2AJYL 3GMMA 1FQ9C 1J88A 3FL7A 4O58H 1YMME 5C0EB 5ANMA 1UFUA 2R0WL 5C0GA 3UTTA 4ZODA 3CFEA 1GYAA 4Y4FB 2EDNA 1MCWW 3HZMA 3BPOC 3N1QC 4UB0L 3UC0H 3RIAF 3F5WA 4I0PC 4EI6B 2CRIA 3LKQA 4LCWA 4E41D 4G5ZH 1FAIL 5H2BA 4P2QA 4AL8H 1UACH 3E6FA 5GRYA 1I75A 1GRWA 4NFCA 3ET9F 1CDUA 5FA3A 5IK3A 3UJJL 4OI9A 1MWAL 2WINB 3GRWL 2GJ6E 5T1MB 3ARFD 2C1PB 4JVWA 3F62A 3TO4D 1T0MA 4MCYA 4QXTA 2QHRL 3AM8A 4NFDA 4CJ1A 4JKKA 4HBCL 3QEQA 4YGAB 4W6WB 3G5YB 3QCUH 1PGRB 4X4YB 4MAUH 4ZYKB 4U1NB 3GJFA 3C2AL 5CWSA 4PG2C 3FT4B 3UMTA 3MBXL 1GVIA 1BEYL 2EDRA 4LQFH 2DQFB 5DVOA 4EI5D 5GXBB 4L3EE 2LU4A 3C5SB 4OZFH 1KCRL 2J5LB 1CDCA 4IOFC 5IMOA 5C0CB 4WTZG 3VG0H 5FKAA 3RWFB 3BQUB 3NPZB 1IFHH 3NTCL 4BSJA 2NXYC 3LKRA 2EECA 3S37L 5HGGS 1BZ9A 3QFJE 2B1AH 3WFZA 4F15B 4NUJA 1KCKA 4HK3N 3RX7A 2DJSA 1JWSA 1I4FB 2I26N 4ZFZA 3Q6FB 2DM2A 3QXTA 4K7FA 4HULB 1YMMD 2PR4H 2VOTA 1WWCA 1SQ2N 2QSCH 4GAGH 3ULSB 2HJFA 4ZFOB 2F54D 4WCYL 2H1PH 4OSUH 3KG5A 5HHOD 1KOAA 2P5WA 3K81A 2XZCH 3P77A 4CVZB 4PJ7B 1AKJB 1OTTD 1NCDH 3FO0H 4U6VH 5AG9A 4I2XE 3HPJA 5BQ7B 2DI7A 3PWVA 3B8YA 5DD3L 4JHWH 4DUXA 1PYWB 1FVDB 4EIGB 1MCPH 1YEKH 4Y4HD 2JK5A 5ALCH 2A6KA 1I3VA 3MACH 4AZ8A 3KPNA 3PWJA 4X6EB 1YQ2A 3L5XL 1A3RL 5D7JD 1CQYA 1KCVH 4Y5XB 3BGFB 5F1IB 4MXQC 3TPKA 3AM8C 3FQNB 3MXWL 5C2BH 1ZT7A 4PJXB 4FQ1H 3QHTC 4G43A 3SOBL 4UQ2B 4L3ED 4K3JL 4NP4L 4WUKL 4OCXL 3RNKB 3VMNA 1CXKA 4K3HA 1FFOB 4P4KD 5CJOH 3RJQB 4NZTH 4C57C 4PREB 4AH2A 3BMWA 5BJTA 2GAZB 2FRGP 1BVLB 3QCVH 3RKDD 3MNVA 3O2VH 4G80B 3QFJD 3VXME 5IG7B 1BQLH 4Z76B 1MHPH 2ZUTA 1BREA 3MUGA 1J1XH 3NN8A 2W60B 1NUNB 3I2CL 3OJDA 4JCLA 4NC1E 5IHUL 4YXKL 1SM3H 4LDOB 3T04D 2VDQH 1H3XA 4M9OA 3LRHA 1UZ8B 4E9LA 4WI7A 4WV1A 1S7WA 4WVRA 5KANG 4AJ0A 4YZFF 2APVA 4PS4L 1KJ2L 4NNPL 1L7IL 5FOBB 4PYGA 3BRFA 3BJLA 2JJTA 5TQ0H 3EYVB 1FNEA 4YHZH 3CNKA 1KNOA 5F9JA 2BY3A 4TSAH 2VWEC 4KZDL 4UOW0 3QWRA 1I3RA 1TETH 3TLRA 4DZ8B 2NLJB 2NY5C 3P40A 4F3FB 4JLRA 1T2QH 3S5LB 4CRPA 3VD4A 2FB4L 4R2GC 2YPVH 1HILB 2R0LL 2EIZB 1BFVH 1GPOL 3GMLB 3LN9A 3DETC 4LSUH 3GNMH 4KZEH 1KJ2A 3ULVL 4LLYA 4HJJL 4B7LA 2VDOL 3NBNA 3M17B 1JRHI 1XGPB 4G5ZL 4TPRH 4PJ5E 5KAQF 5HGHA 5IBUG 3S34H 4OFDA 5KVFL 1AD9B 4WTXA 4NQVB 1VCAA 1BGXH 3TCLB 3ZKXC 3G6DH 4R6UA 3HE6B 4LQ1A 2C3XA 3GJFK 1G0YR 4M7KH 2CK2A 2ZSVA 2B4CH 1T03L 3NCFB 3GMRB 1X9QA 2OBGA 3RUGB 1YNLH 4LCIL 3CPLB 1XIWA 2IMMA 1JF1A 2E9IA 4QRQB 5IQ7L 2NY2C 1FYTA 5J6GB 2A74B 2ESVE 3L7EA 4O5LH 4WI4A 1A6TA 4KQ3H 1JCKA 3VJ6A 4Z7NF 2YPKA 3F6IA 1AQDB 1IFHL 2YD9A 3OPZL 2NY6B 4YGVA 3IXAA 1OGTA 4G8EB 2Y36H 1N6VA 3QUMH 2MPAH 4P99A 4WV1C 2XKNA 3C60B 3O2DL 3O6KH 2Z8RA 1KYOJ 3N1MC 2NXZC 3VRLF 4Y0GA 5DK3A 1CFTB 2JJTC 1D5MA 3U2SB 1LE9B 5IEKA 1XGYH 1AXSB 5BV7C 4UDTB 3JUYA 1RK1B 1OWWA 3F58L 4NQDD 3FTGB 2PR4L 2OJZH 4KKCD 1K4CA 4GAGL 1IILE 1NBYB 1UB6B 3KPQB 3U30B 2IANE 5JDSA 2BVQB 4OM1H 1E4XH 5F7WC 3A6BH 2P43B 3I6KB 1WLHA 1AXTL 2E9BA 2EXWD 3UPAA 4FQXA 1HNGA 2ZCKH 4GMSL 4PJ5D 3MYJB 4YDIL 1JPFB 4I3RH 3UYOD 1NFDE 5MERB 1MHHB 1DJSA 1NKOA 2VLLB 3GSNA 5ACLA 2WMPA 1ZS8B 4ETYA 3V52L 2EO9A 1HN1A 4JO1H 3L1OL 1P4IH 3BE1L 4C58B 3ARFB 1MEXL 3TO4B 2M1KA 1CT8B 3F6LA 4N0CD 4PRHA 4G6KH 3JV0A 2R4RH 2AXFB 4XVTL 4G9FD 4FQ1L 4MQ7A 5CGMA 4KMTL 5IB3A 4CADA 2M2DA 1OAUH 4MMZC 2ESVD 4AEIL 5L9DH 1XIWC 4EI5B 5HDOA 3S36L 2GTWA 1X5KA 1UKSA 5DEGA 3LMJH 2DJUA 3UTSD 4O4YL 4UV7H 1NLBH 4OTXL 5DJ0A 4WI8A 2Z4QA 3R06A 5EOCH 5GGSA 4DTGH 4M61B 1QOKA 1A22B 1OB1A 3ILPB 4BZ1H 4LSRH 2ADIA 5GQBA 2GJJA 4PRNB 2AJZB 2IAMA 1QSEA 5INCA 3BD5A 1FCGA 3CCHB 3T0AA 4YX2L 2VXQH 2HJLA 4G8FB 4QF1B 3OB0H 1J1XL 2BERA 1NCCH 3RPIB 4UOW1 2M8XA 5C86A 2MCPH 2R1WA 3P4MA 4QXUH 4YHPA 1J0IA 1KB5A 3DUUB 1YMMB 1MJ7H 5GRUH 4LPWA 2IAND 1OOAA 4F2MB 2OR9H 1YJDH 3RY4A 2F54B 1OCWL 3SGEH 4LSSH 1DN0A 1T6WA 2X89A 4XCEB 2AW2A 4FQXC 1JHTB 3CAFA 5CUSH 5D5MA 5KJRH 1J9CT 3FZUC 1IGYB 4P2CG 1IEHA 1T1YB 4YHZL 5JR1L 2EICA 3MRPB 4YHYC 2GJ6B 4LEOA 4MDJA 4PJEA 2PTTB 4WFED 5DXWA 1JZ3A 1GH7A 2J88H 2CRZA 3MRMB 2AK4A 5D7IE 4QYOB 5KSVB 3QULA 3UZEA 1EO5A 3UO1L 2I07B 3JV4B 4KZEL 4MA1C 4JCMA 4HG4K 4L3EB 3VFTB 2FWOB 5IW1B 1J87A 4XHJC 4P4KB 1NEZA 1FPTH 2FJHB 2J4WL 3SY0B 3DROA 1CGTA 5HVHC 1Q9KA 4G8GD 4ZUTB 5FKPA 2VE6A 3QFJB 3OKKB 5T1DL 2G2RB 4R7DB 2EYRA 2IAMC 1BP3B 4U3HA 1S9WB 4ODTH 4O2FA 3AXLA 5F89B 4HCRA 1MLCA 4ZDHB 2EIBA 1K85A 5D7SH 3B5TA 5CKAA 3MOAH 4BQ8A 1ZANH 2JCCF 5BS0D 5K9QI 3MREA 3IU3B 1EO7A 1KPVB 1PKQA 5SWSA 2NY7H 1U6AL 2VISB 1BQHA 3UTOA 3P11H 5D71L 2BSSA 5B3NA 1EEYA 2D03H 3DO7B 1KCLA 4G6MH 4JO2H 1DDHA 4PTUB 4I2XB 2A73B 4F57L 1MCDA 2Z92B 1TTUA 4H8WH 4EUPG 1U3HA 1XGYL 4ONFL 2JCCA 3U0TA 2OXGA 5ID1A 1OWRM 4Z7WE 3MJ7B 2R0KL 3QUXB 1MH5B 4G7YL 4W4NA 5GS0D 2QR0B 1Q8MA 1RUPH 3WHE0 3QRFM 2ATPB 1BM3H 4G6FB 3RI5K 1RUAL 5KBNC 1A7PH 1ZHBA 4D9LH 3OMZA 2BVOA 1JP5A 2YXFA 4I3RL 1XCQA 3QIWA 2NY4C 2VDLH 3WJLA 5IV2B 5DDHB 3BZ4A 2N1KA 2OLDA 1PSKL 1EJOL 4XZUA 1E28B 1T04A 5FAAA 3MV11 4AENB 2NCMA 4GRMA 3RDTB 1P4IL 1QFWM 1NGZB 3ZHLA 1EGJA 4HSQA 5IGXH 1KACB 5T1LA 4PGZA 1CE1H 3I02B 4NUGH 4KI1A 3VXMB 4PJIF 3BVNB 1E4XI 5IMMA 3MR9B 2VXTH 5EWIH 5FB8A 5DFVC 2EE6A 3MYZA 5DK2B 1TPXB 2X4TB 3ARSA 3RZWA 5L9DL 2NW3A 1A7BA 3TH2T 3D9AL 2XQBH 3LMJL 4LLDB 1TVDA 3BJ91 4UV7L 4HF5H 2VZSA 3QUZA 3VXUE 3V6ZA 1OAYL 4PB0L 5KSUA 2X4QB 1J8HE 3J8F7 4AYFA 4M6ML 2DWEB 4PYHA 5T1KB 4LSRL 3VFRB 4MLSA 3IJYB 4UAOC 2CDFA 4MNQA 5IT2L 2VXQL 2Q6WA 2JE8A 3LKSA 4I18A 5EU4A 5CEYB 3NIFE 3WIFB 4JPVH 4KQ4H 1U3HC 4HEME 2WAHA 1UH2A 2HTLD 4HWBA 5HHPB 1MJ7L 5GRUL 3RL2B 3OGCA 1A0QL 3L3KA 4ZFFA 1A1NB 3P30L 3EDKA 3H9SD 3L3JA 2X70B 4QRTB 3DX9A 3JWDH 4GO6B 4HAFA 2YZ1A 3DVGB 4GRWH 4L1HA 5GIRB 5ILTH 5KJRL 4PJ5B 2Y7QB 3LRSB 1RVFH 4TSCL 3KNBB 2ZUQC 5TPWL 3ZYZA 3QIWC 3WJLC 5I15L 2H2SD 2HVKA 4IMLA 1KJVA 3BEVB 3OJ2C 5CSZA 2ED7A 3ZKSD 3BIKA 5J13B 5D9SA 2VR5A 3DOSA 4KGJA 5D7LA 4FXGA 1AGEB 5HGBB 3C6LD 4JB9L 4P46D 1ZWIA 1MCJA 5D1QD 5HHVH 2FIRT 4H88L 4U6HA 4XHQA 1YYMH 1T2XA 2IBBA 3JV6A 3SGEI 3EGSA 1CICD 2HWZH 4GW1B 1PD6A 3D85A 1JWMB 2X4OB 4RRPA 1A4KA 4G9FB 2AJVL 4DKEL 1GZQB 1MFDH 3DGGA 4YWGH 3MXVH 4OZIE 1IBGL 4HFWB 1Z9SA 2X4RA 2ESVB 1O7VA 1I9JH 1NBVL 4Z6AT 1FFPA 5GS1A 3GO1L 1XF3B 2HLAA 3GKWL 3UTSB 1EHNA 1NGQH 3WIHH 1FC1A 1FLTX 4LPTA 3QUZC 2EXYD 1KLUA 4WO4D 4PGEB 1F13A 1UB5B 4NQEA 5I0ZA 3LN5A 3MMEA 3IRPX 4K3EH 1IQWH 1F58H 4QHKJ 3BAEL 5DRNB 1FHGA 1N6UA 5JXED 1R5VB 3FB5A 3HUJE 4I18C 3QNXA 2Q86A 3BKJH 5K9JH 2E7BA 2VH5H 2OTWB 4TNWK 2EDOA 3TBWB 3TNNA 1S5HB 3VD9A 2IANB 1B88A 2Z8WC 4I4WA 2O5XL 2NY0B 3RBSA 3BIAX 3ZE2E 3DVNB 1I3UA 1WZMA 4ELKB 4JQXA 5L88H 5F3BA 1SJEB 5DJ8A 4NRXA 4PGDB 4KJWD 4FQHA 3HS0A 3IDYC 3EYQD 1XGQA 2BSTB 1IC5H 2UYLB 5GSVB 5CILH 1TJHH 3EYOA 4XPTL 4PRBB 4Z5RB 1M7IA 5DMIH 4NYLA 1YEFL 3QZWA 1M05A 1JGVL 1RU9H 5C6PB 3CUPB 2CXKA 4D9LL 3ILQD 5BXFB 1W0WA 5DQ9A 4F7PB 4JFDA 3IDJA 5I16A 4OZ4A 3KJ6L 3GBLA 3QDJD 1P5UA 1JGEA 5GS1C 4OFKA 2VABA 4PJGB 1CD1A 4NUGL 3DRTA 1FL5A 4S2SA 5FYLE 4WFFE 2VXTL 5EWIL 1GGIL 1KTKE 2HT2C 4S1SL 2P5EE 4GG6E 3BSZH 3IVKA 2BOBB 2E9JA 1EDQA 3AGVA 5EUOE 1S9VA 1DBKH 1S7SA 3PQYA 2XQBL 4BUHA 4KI5F 1AI1H 5HHNA 5BS0B 1YEHH 1NH6A 1MRCL 1RIUH 2EE9A 5HTSA 4NHUA 1KIRB 4OT1L 4N9OB 3T2NL 4RMWA 4KK9D 3T0VA 3EHBC 4GAFB 2HMIC 2G60L 3QNZA 1XFPA 2DYPD 4PJDF 5GGSY 4MXVF 1I9IL 5L2JA 1EFXD 2AV7B 4JQXC 1BBJB 3QJFB 4WU5B 3BP6B 1IGJB 3MV7E 3NACL 3LOWA 2Y5EA 3JXAA 4GW4A 1QRNE 1KENH 4RMQA 3O3BA 4LL9A 2XY1A 3MFFA 5D7IB 1TCRB 1N5AA 1RZJC 3PGCA 3ROOB 5F7YC 3MJ9H 3HZVB 4PJDA 4ZOAA 4P2RA 3QFDA 4MWFB 1PVHA 2R2HA 1SMAA 3HMXL 4ETQB 4KGLA 4NO3A 4WW2B 3HFML 5GSRB 3TA3A 1R0AH 4ISVB 1PY9A 3NIDF 1F4WH 1RJLA 5MEQA 2RCSH 1NGPL 2VQUA 3BP5A 1XGTA 4RGND 3H9YA 5MEOA 1JWUB 1QKZH 1BX2A 5FYLD 5HHVL 5JUEL 4G42B 4E0RA 2V7NB 1DSFH 2CIIB 4JN2B 3IGAB 4KRNA 2BY1A 4UTBH 4XT1C 1IEBB 3B6SA 2HWZL 1Q9WB 1GZPA 2CKBA 5J0BA 5D4QA 3N1PC 4YWGL 4HIEB 3LZFH 3CZFA 4K55A 2NNAB 4C83B 5AG8A 5H94B 1NCAH 4GRLA 4DZBB 4L8SA 4BELD 4Z7UA 4UUJA 4G8IA 1NGQL 3L3IA 1II4E 4K3DH 5HY9A 5E8EA 5EPMA 3VFUA 3S9DB 1DQDL 5I9QB 3MBED 3MRCA 3CMOL 1IAIL 2VSCA 1IM3B 2PTUA 4HKBB 3VDAA 1J7VR 3GSWA 4GLRH 3IKCB 5BMFH 1P2CB 2E3VA 1P1ZA 5HVGB 1WVZA 2R29H 2DTMH 3MV7D 4JRXE 4N5EC 4LCUB 5DUPH 4WEBH 4Q9CA 4Z7WB 4M48H 1FL3A 1QRND 4XP9H 4JFFE 1AIFB 1A9EA 2VH5L 4H5SA 4AK1A 2PW2B 4LCWE 3HCVB 3KLAA 5JW5A 1N3NA 5EU5A 5GISL 1D5XA 3EYSH 5KVGH 4PV8B 2GI7A 2MKLC 4YUEL 3VFVB 1YZZA 1FNSL 5DFTA 3FHQA 4XBEH 4MA7L 4K2UH 1ZLUK 5I1AA 5A2KH 3STLB 5L0QB 2W0KA 3KPLA 4AT6A 4OLEA 3V0VB 1TITA 3CK0H 3EW3B 1D5ZB 2Z91B 4WUUE 3TA3C 1WTGT 2VLKD 3EUUA 3BKCL 3RWHB 2P24B 3RL1B 3ZE1E 4ZQKA 4FABL 3TJHD 5F7FA 5I75B 1JTTA 1TJHL 2EDXA 2L4OA 1A6UL 1H8NA 1T1XA 3RVWC 2XWJA 2RQ8A 4JZJC 3O3AB 2V2XA 5D1QB 5FUZH 5HVWA 4ZUUB 1BVKB 1F2QA 1UM5L 4ZUVB 5E00B 3RWCB 4NQXA 5ITBL 2VDKL 1KPUB 3VW3H 4LSVL 3TYFA 3IAPA 1JF6A 4P5MB 5CGTA 2ZNWA 1INQB 3SKOA 1RJCA 4UT6L 4WI2A 1BD2A 2F53A 4GRLC 5IB5B 3VXNB 5IB1B 1G6RB 4L8SC 1BJ1H 4PP1C 4XCCL 1J8HB 4S0TD 1EBAA 2YWYA 4WO4B 2HFGL 5SX5K 4KUZH 4LLQA 1J0ZA 1JGDB 3S6CA 5I1EH 3DURA 4GJTB 2JB6A 2ADJB 4DAGH 1J1PL 4JRXD 2NY5H 4OFVA 2ICEB 5E03A 1EEZB 4XC3L 2AI0L 3FO1B 3PXHA 4FFWC 1YC8A 1OARH 4PV9A 5DEZA 5F7DB 3EBAA 4C56A 5EBMB 1BBDH 2BJMH 3U9PH 2VMFA 4P3CH 5DO2D 1KPRB 3EOTL 1RIUL 1A3LL 1JBJA 4PJ9A 2RFXB 1FL6B 4E5XA 12E8L 2AGJH 3MRKB 3ALXA 3O8XA 2A38A 3SDCC 5HHXH 4M1CD 3QH3A 4NSKA 3TBVA 3OZ9H 1T21A 4HPYH 5JW4M 1ETZB 2ARJA 5K9KB 5IMLB 2DQTL 4PRAB 1CFBA 5F1SA 4JFEA 3P0YL 2BNRA 4MAYA 1O7SA 2H41A 5ALBL 1WTLA 4HKJA 4EUPB 5C6TL 5DUBA 3T8XB 1HYSD 4YO0A 5BVJA 2YD6A 1T83A 4OZGF 1KC5H 5JQ6L 1SEQL 3MLXL 3SKJH 1UH4A 4JEGB 3INUL 4OZIB 1ES0B 3I85A 2QQNH 5KS9E 1CK0H 5EU6A 3QUYD 5IKCB 1MRFH 1Q0XH 4WFGD 1JPST 1F4WL 3O6LH 5F6HI 3O6FA 4ONGL 5C0JB 1QSFD 1LO2H 2IADB 4GOSA 4WIQA 3QDJB 1K5NB 3UJIH 2FIKA 2VZUA 5DC9B 1MIEL 4OZGA 1QKZL 5B21A 2WLYA 5ICXB 2Q7NA 5C0AD 2IFGA 3W5MA 4MNGA 5DJ2B 5A40E 3JBG7 4X6DF 5BV7H 2GK0B 2WWKT 3HUJB 3SKUD 1AGDB 1R24A 5GGRY 5I8OH 1LQSR 4TTDD 3MODH 2DQCH 2DWDA 3OR6A 4S1DD 5HD8D 3U9UA 4YDKH 1NCAL 4LKXB 2MMXA 4HK3J 4Z8FH 3L9RA 4UQ3B 3REVB 4ZNEE 2WANA 4JKMA 4JAMA 1X5XA 1NMCC 4PRDB 1EAPB 5I73B 1LK3L 3BXNB 4MS8C 5B4MD 2E27H 5ISZD 4PJ9C 4HXAH 2BSED 1H3GA 2VDNH 3QEHA 4NN7B 5BMFL 4Y4KB 1TNMA 2X7LB 2DTML 3O8XC 4P9ML 5DUPL 4WEBL 2OL3H 9CGTA 5JHDA 3TM6A 1J5OH 5E8PB 5EC2A 4X5LA 1FLRH 4KJQD 3SJVE 4DKFL 1TTGA 2HKHH 1F3DH 3EYSL 4MAYC 3DUSA 3SN6N 5KVGL 5CD5C 4HMEA 1C16A 5F3HA 1CGSH 5JOPE 2CLVB 2G5BB 4JFZL 5J1TC 4HK0A 1T83C 2MTPA 1KT2A 3FFDA 3FJTA 3K8KA 3L3GB 4K2UL 5DD0H 1T0NB 3FQUB 3GK8H 2XA8L 3BMVA 4GLRI 2BOCB 3CK0L 1L6ZA 1XZ0B 1BJMA 2EYTB 1K3IA 4WFHE 4RISL 3ULVE 1CLZH 3O6FC 4RGNB 5IW6B 4FZEL 3B2UC 1DUZB 1YEDB 4MQXC 3JTTB 3VCLB 3QDHA 3MO1A 1FYTE 2Z8SA 3WNNA 1CLCA 4QCIA 2FX9L 3FRPG 4YQXH 4GG6B 3C8HA 2P5EB 4IRZH 2NR6D 4PRPE 2O5ZH 3DO3A 4D8PA 3KPSA 4GQ9H 4X7DC 4R4ND 5J57B 5EUOB 3OXRA 2RAMA 1HZHH 1C08B 1SYSA 3LDBC 3O45B 1T7ZA 1U8MA 2WWKO 3ARDD 1CFSA 2BSRB 5J56B 2LVEA 1CGVA 4DOHE 4RMSA 3MCKA 2Q7YB 4D2NA 4X9GA 1LEIA 5TJWK 1JGLH 5FYKL 3ARBD 1FV1B 5LGJB 3MBEB 2FATH 4MX7A 4X5XB 4ACPA 4MA3A 3KXFA 4PGCA 3GSNH 1NDMA 1I7UA 1S9YA 4PLKC 5DHVA 3RVUD 1B9ZA 3MV7B 1G7JB 3FQXA 1NEZG 2QQQA 2E9WA 1ORQA 1QRNB 5HI3D 3IRZA 3U9PL 3MRDA 4H0HB 4MD0B 1FZMB 5IFJB 4GQPH 2BZDA 1YY8A 3S4SA 2HFEA 4O51A 1RUQH 4AM0B 3TN0D 5A43C 1PEWA 3GSUB 3HZYB 1OM3L 4NKDB 2AGJL 2Z31A 4XPAH 5I6XC 4U6YA 1EIBA 1G1CA 2B2XH 1WGOA 4OLWL 5GGVL 4EOWH 3OZ9L 2CD0A 2F19L 1WZ1H 1U3JA 4WFHD 5JPMA 1T20A 3LQMA 4NO0D 1AD0B 4Z78A 4FXKA 25C8L 4IS6A 4A2LA 2BNUA 1LK2B 1TZGH 5AAMA 5IEHB 4QY8A 3NOIA 3ARXA 4JFXA 4JVPA 1JHLH 5ERWA 4M7LT 5KSBF 4WU7B 5I1DB 1MRDL 1KSRA 4ZD3L 4YLQT 3U36A 4X0KA 4O9HH 4FRWA 4POZD 1RJZA 4BH7A 1EVTC 3OV6A 1OTSC 2IPTL 5D1ZA 1Q0XL 1KB5H 3PP4H 1GOFA 4WI9A 4WY7H 2L0DA 3CFJA 3NCYS 3VWKD 3ZKQD 1W72L 4TNVF 1A6WL 1IKNA 3BH9B 3UJIL 5IMKA 3S97C 3MV9A 4Y2DD 1AR1D 4ODVH 5DJDB 1UZ6E 2P7TA 3V4UH 5EZLB 5CS7A 2VR9A 4OGAC 4WWKA 3CLFH 2A0LC 4RFOH 3SE9L 5HBBA 5E99L 3KGRA 4JRXB 5I8OL 5BO1H 3ZE0E 2ICES 3MODL 1NC4D 4J3UA 5LGHL 2FEDC 3ALPA 4LLAA 4JFFB 2BMKA 3LKQB 3B3IB 3RWDA 5D5ME 4JFYA 4UDUB 4ZPTB 5ID0A 1I8MA 4DFHA 3WV0A 4X80H 1WWBX 3R8QA 2ITCB 3C5ZD 4HKXB 4I77L 1LP9F 1QFWH 3MV8A 1E4WH 5DGRA 3SQOL 2QQLL 3O41A 2X9WA 3BZFB 3RWGA 4HC1H 1KEMH 2VDNL 5IBTL 4BH8A 4Q9QH 4HS8L 5B38A 5I1HH 2Z31C 4F80A 4WUUB 4YNYB 3TIEA 2PO6D 4MCZA 2W0FB 3VXOB 4CMMB 1QR4A 1NKRA 1OTUC 2BY0A 4JY4A 1QBLL 1JTPA 1K8DB 5CBEB 3GB7A 1AQKH 1LP9A 2H32B 4XTRD 3STBA 4F37K 5AD0B 5FO8A 5DQDL 3U46A 1MHEB 3SDYL 3BWAA 4MZ3A 4YE4H 5CZVL 1MWAB 1F02I 4HCRH 2B5IC 2MFNA 4XNUH 1JNHA 1HQRB 2D0HA 3WLBB 4NBYB 3QUYB 4LSTH 5D1ZC 3BN9C 3MNZA 3DWTA 3G08A 5IESH 1CLZL 1QSFB 5DD6B 1BJ1J 5DR5H 1PQZA 5GHWH 2X4NB 1IKNC 1T1WB 5E9DD 4OZHF 3IDGB 5C0AB 3V8CA 3OXSA 3AU1A 4HV8A 1Y6MR 1Z6JT 1PKQE 3D25B 4WWKC 1JZ2A 4IJ3B 2VDPH 3GIVA 1BFSA 5J9PB 5HYQB 1HZHL 3MJGX 1DL7L 5IVXA 5EA0H 4LP4A 3IT8D 2X1OA 4KROC 5I0DA 1ND0A 4OZHA 1X5HA 3QEGL 4R9HA 5EN2B 3TBYB 3I6LE 1DQJB 5K59F 2ICWA 2WNGA 5TE4L 1JGLL 2JK5B 4TSBL 5FGSA 3PWJB 3E0GA 4X6BA 4XRCA 1I8KA 2O61A 1I1YA 1PG7W 5IJVB 3Q0HA 5D6CA 1ITBB 4GKOA 3FOLB 4QTIH 4QOKA 1ONQA 4JDVA 4Y1AE 1ZT7B 1YPZE 2C9AA 1EGJH 4N8VG 2ZUVA 1SYVA 1MAMH 3H9ZA 2ZJSH 3K4ZA 1QRKA 4PJFF 1RUQL 4KJPC 4L8BA 5FGBA 5FO9B 3KLHD 3QDGD 3F7YA 4I1NB 4LU5H 2YBRB 4Q0XH 3NFSL 3P0VH 3T4YA 3DECA 5KS9B 5KVEH 3FN0H 1SVZA 5DS8A 1DEDA 5D1XA 2W65B 2QSQA 1JMZA 4LAQH 3OAYK 4OV5A 1C12A 5ADPL 4YPGB 5HYJA 1OSZB 1G7IA 5GRJH 3L3OB 3HC4L 1MFEL 5MHSE 4X99B 1FIEA 4KJYA 3S98A 1TZGL 3SE4A 4ENEC 5IUSA 1YY9C 1Z9MA 4J4PD 3U4EA 4M8QA 3DXAD 1X5JA 2GQHA 4O2EA 3ZKMD 2DDQL 1RURH 1MI5E 3ZYIA 1ZT4A 1N64L 1MQKL 5SX4H 5FECA 4HWBH 1WBYA 3PP4L 4J6RH 5ESVA 1ZLVK 4NPYB 3CMGA 1VDGA 4JJ5B 4HKZA 5GJSL 1C5DA 3LV3A 4YAQB 3QXUA 3I6LD 1CYGA 5CEXB 3ARDB 1TLKA 1UYWH 1BMGA 2HN7B 3UBXA 3NA9H 3G5ZA 5DFWH 5DMGC 1QQDA 5KVDH 2CRYA 1OAKL 5HYFA 3V4VL 2NY3C 3PWPE 4RFOL 4NO5B 5C0IB 5I1GH 4LHUG 2DQDH 1WSST 2V9RA 3MRLA 1KJ2B 2CIKA 4OGXL 3QI9D 4ERSH 5IHLB 1ZA6A 3MTRA 3OX8B 3CSYB 3SJVB 4U7SA 4DWHA 1A7QH 5F96H 3B9KA 4GXVH 4MNHB 1WZKA 1ZSDB 5FO7B 4X7EC 5FGBC 3TN0B 3NFNB 1IKFL 3B2VL 3I3BA 1F00I 4J8RB 4HC1L 1U8OA 3VA6A 3RZCA 2KZ1B 5D1XC 1CLOH 3DMMD 1Q0YH 2UVEA 1XGRA 2XIDA 3QQ9C 4HX1A 5GJTL 1D5IL 3L5IA 3OR7A 1WIUA 1YQVH 3TJEL 4NO0B 1Q94A 1L0XA 3VXSD 5C71A 1AQKL 3K80A 5C0EA 3NPSC 3SE4C 4W4OA 4PLJC 1MI5D 5I19H 3O3DB 3C2SA 4Y4FA 1QFWI 4PRPB 1AC6A 2VZ1A 4PY8I 3BZEB 4N0YL 2B8OT 4XPHH 4EI6A 3QG7H 5FM8A 2A6JB 4FQCH 2AK1H 2OP4H 3EZJB 3CVIH 4JN1H 4Z95H 1KULA 3WDHA 2Y1VA 3VWKB 5J3HD 1X5IA 4DOHB 3F7RA 3DPBA 5DR5L 2AEQH 5GHWL 4YXLH 5TFSH 2WINA 5T1MA 3IKKA 2FGWH 1G84A 5EUKB 3PWPD 3L3DB 3TC9A 1EHXA 2R1XB 4X4YA 1JZ7A 4YH6A 4U1NA 4ZYKA 1A2YB 1HIMH 3FT4A 1MVUB 2VDPL 1NC4B 2YXMA 2DQFA 4XMLH 4NHCH 1L7TL 1MUJB 3LD8C 4UT7L 1LDPH 3C5SA 3IDMB 2HLFC 5GS2D 5C0CA 2XG4A 3VU2A 5E1HB 3RWFA 3BQUA 2XKUA 3B9KC 3IFOB 3PIQB 5EU7E 3C5ZB 2VRAA 1RIVL 4HWZB 3ULUC 4ALAL 4G9DB 2B20A 2WSKA 2Z35B 3RZCC 3BPLC 1I4FA 2VXSL 5FV2A 3ZT5A 1XF5B 3Q6FA 2H2PD 4QRUB 5SWZD 2O93L 1NBZB 1G9NC 3HI5H 2ZJSL 4X6CB 2Y06H 5JPNB 3CXHK 1PX3A 5SWQA 4PJCE 3ULSA 1QYGH 4ZFOA 5L6YH 3PABB 3OKLB 1ZTXL 4Q0XL 3FN9A 4W4OC 1TZHB 4WGWB 3P0VL 5I74B 4CVZA 4PJ7A 3SKNB 5KVEL 3T0DA 1AKJA 4BUGA 4Y4FC 1FGVH 4MD4B 2DQJL 2OK0H 4Z7OE 5BQ7A 4YHLL 1FNHA 4PJXF 2ZOLB 1FVDA 2VN4A 1CLYL 2HJLB 4JQVA 4QRPE 1O5DT 4X6EA 2V6HA 4XPFH 1NCTA 4Y5XA 2AS5M 5F1IA 1BQSA 3P9MB 1GGCL 4U6XA 1QA9B 1FGNL 2R1YB 3FQNA 3UPRB 4KUCD 15C8H 4NN5B 3N85H 2EZ0D 5EIQA 5JQHC 3RNKA 4FXLA 5I8KL 4ZS7H 35C8L 1VSCA 2MWCA 2VN7A 1FFOA 5E8DL 5BZDB 2AJSL 3WLWC 4R26L 3NAAH 1T2JA 4PREA 2J5LC 5GS3A 3OG4B 4ZTPH 2GAZA 4KU1A 3GEWB 3BQUC 1BVLA 2XN9D 4XVJH 4XCFH 2R15A 4U3XA 4I48A 1LO3H 3M8OL 2DKSA 4GUPB 4G80A 1G0DA 2WIIB 5IG7A 1A5FH 4Z76A 2JIXD 5I1GL 3HB3C 4F15C 2W60A 5SX4I 4U1GB 2DI8A 5J7CC 5IVOA 4P2RE 1RFDH 5E6ZA 2YD8A 3TPUA 1T6VN 4TUOA 4LHUD 1A7QL 4I3SL 3MA9H 1RSFA 2WWMC 1UZ8A 5KZCB 4JR9L 3G04B 4JGUA 1NEZB 4KKAD 3QDGB 5L2KE 4DGVH 5DF0A 1H3TA 2A83B 3D48R 1F2XK 1QNZL 2UZXB 1QVOB 2H3NB 5DMKB 1KJ3H 2BVPB 4DK3A 1CXLA 1YQVL 1NLDL 1T3FB 1YYLH 2DB8A 5KSAB 4KC3B 4DZ8A 5FUCC 1UQSA 3DYOA 2NLJA 1HHGB 1IQDB 4Q2ZB 4F3FA 1UXWB 4AMKL 4JQVC 4OFYD 3HC3H 4PBXA 5FYKU 1HILA 5CCKL 2EIZA 4Y5XC 3DXAB 3GMLA 1YNTB 3BGFC 4P2OD 5DD1L 4GT7A 3OBAA 1PKQB 1INDH 4Z7UE 3RGVD 3M17A 4XP1H 4FQCL 1XGPA 5ETUB 4XVSH 1KLFA 2I9TB 1VB9A 2E8YA 3WO3B 1AD9A 5C08D 4NQVA 2FO4B 5DD5L 3V4PH 3BDYH 3TCLA 3BHBB 5CJXA 4RQQB 2P47B 3LS4H 5GGTA 5TFSL 2C1OB 2L7UA 1ZLSL 3HE6A 1P9MA 3ES6B 2IPKB 2FGWL 4ZTOL 5E8OB 4UZGA 4IRJD 3GMRA 5FHAH 4PB9H 3WFHB 4JG1L 2CUIA 4QWWC 3RUGA 1MIML 3WD5L 3CPLA 3GI8L 4Y1AB 3D0LB 5FYJL 4HUNB 1YPZB 4QRQA 3DI2B 5EG6C 4O02L 4H25B 4NHCL 4PJHF 5J6GA 2A74A 1AGFB 3O2WL 2DD8L 1JNNH 1Q9LB 4KPHL 3WSQL 2C7UB 1AQDA 1VFUA 2KKQA 3MV01 1OAZL 3FQWB 5DC4B 5T5FH 3I6GB 4XZUB 5L2KD 1A64A 4G8EA 5EO0B 5KOMC 1OGAA 1JFQL 1PG7H 1UEYA 3C60A 3VMOA 5A2FA 3LS5H 2QTEA 1CR9L 3IAGC 4Q9RH 5D8JL 3DMMB 3ROLB 1CFTA 3MGAA 4WI3A 3U2SA 5IMMB 1LE9A 1AXSA 4UDTA 4YHOL 1RK1A 4YBQD 1MJ8L 1CXIA 1YEGH 3FTGA 3OB8A 4M7JH 2CR3A 4NNXB 3UZQA 3VXSB 5IWLA 1KEGL 1QYGL 1UB6A 1NBYA 3KPQA 3WFEL 2OI9B 4YC2B 4XP5H 2BVQA 1OSPL 1MI5B 3I6KA 5ICYB 2YUXA 3CIQA 4YFLF 1FGVL 2HT4C 3CFDB 4UIKL 3MYJA 3TBTB 4KVNL 1JPFA 2OK0L 4QHMB 4ZFGL 3MOQA 4ZOBA 5MERA 1MHHA 4LF3A 5AYQA 2VLLA 1BF8A 1ZS8A 1U2HA 2EDTA 1W2KT 3E8UH 4M5YH 5JOFB 2HT3D 3ARFA 3ELAT 3H7LA 5L7XL 1CQKA 3HE6C 3TO4A 1P9MC 2Y9RT 1CT8A 2X9XA 4C56E 3EO1B 4FMFA 3PWPB 5HGDB 3WXVH 4KK6C 4DVBB 2R69L 2AXFA 1EX0A 4MVBC 4N0RA 4X7CC 4WNQB 4XB7A 5C3TA 2BY2A 4EI5A 1S9XB 4UNUA 1KTLB 1KCSH 4NM8L 4HQQL 1YECH 4R3SB 2I5YL 1CE6B 4ZTPL 2ZKHH 1B0GB 3HHRB 4F7CB 2NY6C 2R4SH 4M61A 4XCFL 2Q20A 3NCCB 3ILPA 5CP7B 4RDQG 4Z7QE 4PRNA 2Y07H 2AJZA 2ITDB 2PCPB 1FFRA 3LEXB 5DVMA 4APQD 4DUWA 3C60C 3CCHA 4XNXL 4NGHL 3O4LD 4X4MA 4QF1A 4G8FA 2BRRL 2HP4A 4XWOD 5GGRB 3TO2B 2FO1A 1HCFX 5JA9A 1XMWA 3RPIA 1JPSL 1F97A 4GAJL 1EZVX 4Y5VB 5H37H 3SPVB 3DUUA 1YMMA 4LVEA 4F2MA 3QBTB 5A2LH 2DF3A 2F54A 3LKNB 2EDKA 5IWLC 4FG6D 3U30C 1P5VA 3VXRD 4N8VB 4Y8AA 4MB3A 1HSBB 4HPOH 5F7MC 3C08H 3RQ3A 4XCEA 3SO5A 1CDBA 4ORGB 1JHTA 1KLUB 5E6ID 1IGYA 1SJXA 1T1YA 3WEXB 3WFCH 4EBQH 3QDME 3MQIA 4YEEA 2CK0L 4I3GA 1RZGB 3MRPA 3PF2A 1P7KB 3EJYD 5ECJE 3ZSSA 4KTYA 5IIEB 1RUML 1VPOH 5DJ6A 5FDYA 1BAFH 2PTTA 3DIFB 2W1NA 5EOQH 5CFHA 1PLGL 3LQAC 3PV6B 4LCYB 3ARFC 4XP4L 4D3CH 3MRMA 4QYOA 3TO4C 5KSVA 4EQ2A 2XV6B 2I07A 1J11A 3JV4A 3ARRA 2AJUH 1KCUH 4XP1L 2DQHH 3FB6B 4L3EA 3VFTA 3ZZ1A 1RUKH 5E2UH 2FWOA 3NIGE 1TVBA 5IW1A 5AAWA 4QT5B 3O4OB 3BDYL 4JGMA 4EI5C 2A6IB 2B1HH 4P4KA 2YPLD 4HT1L 2FJHA 1JGUL 3RWJA 5E08H 4MXWL 3SY0A 3LS4L 3P73B 4Y8DC 4NQUA 2V7HB 4YDLB 2XN9B 4ZUTA 3CC5B 4LVOB 5F88B 2QKIB 3WO4B 3QFJA 3OKKA 5FHAL 4PB9L 4EKXA 1Y6NR 2EDWA 2G2RA 4R7DA 2YD3A 2Z0BA 2QBWA 1S9WA 4OGYL 2YMXH 5F89A 4ZDHA 1DFBH 1UJTA 2CUMA 4KHXH 5F44A 1QBAA 4PJCB 5EC1B 3KDMB 1NEUA 4LHUB 2E7LA 1WFOA 3EOBB 4OBRA 2R8SL 1KPVA 5T5FL 5CEZL 1J1OH 2VISA 2XRAL 4XI5D 3T0WA 1FYHB 3G6AB 5C70A 3MZTA 3DO7A 2E7MA 3FQTB 4I2XA 4PTUA 2A73A 3QDMD 1OTTC 3DRTB 1Q72L 2Z92A 4X83A 3ARED 1N8ZA 3MRBA 5J1AB 3S35H 1UWXK 4ODSH 1A7OH 4QRPB 1DVFD 4IOFD 2HRLA 3MJ7A 4C4KT 1MH5A 4HS3B 2CLZB 2QR0A 4HIJB 1HQ4B 3DVIA 3KPSE 5KG9B 3MOBL 5T3XH 1FBIL 1DP0A 4XP5L 1JYVA 2ATPA 5DJYB 3VDBA 4HDIB 4P9HL 3DBXA 1C5CH 1R3IH 3AC0A 4OQTH 5DHVH 3G6JE 5FF6B 3RGVB 3PDOB 1LO5B 4C54A 4LBEB 1FNLA 4LDEB 8FABB 5IV2A 2C3WA 4LHQB 5DDHA 4QHLB 5C08B 3DSNA 3C87A 1QPPA 4P4KC 1CDGA 1N0XL 3DHMA 4AENA 3RDTA 1NGZA 4BA8A 1DN2A 1SBSH 3I02A 1N4XL 3VXMA 3UTTD 4EDWL 2V9QA 3BVNA 1YEJH 3THML 4M62L 3MR9A 2PF6A 3PGCB 3GIZL 5DK2A 1CBVH 2QSVA 4P2QD 2VKXA 1UCBH 5TDOB 4LEXH 1HXYB 1B4JL 1R3LB 4LLDA 5HDQL 4R4BB 4JREB 1YECL 1UWEH 3KAAA 1A6PA 2E7LC 4K9EH 5L2KB 1EFQA 4MXQD 2DWEA 5T1KA 3OAUH 5EBLB 1A7RH 5HHME 3VFRA 2V5MA 5HI5C 3QEQD 4WTZA 3IJYA 4XMPL 1BPVA 2FSEB 1DBBL 4JZOB 5CEYA 3B6SB 3WIFA 3N1FC 5TDNB 4BK5A 3AB0B 3TZVD 3TT1H 1OPGL 5JW4R 1PW3A 5HHPA 1IGTB 1F6FB 3RL2A 1IGMH 1A1NA 3QUXC 2BHYA 5C09D 1B0RA 2X70A 4QRTA 5E2TH 3FOMB 1MF2H 3GHBH 2YK1L 1URLA 3DVGA 5DJZB 5GIRA 4C4KO 5JMRA 4PJ5A 3HG1E 2Y7QA 4HIIB 3LRSA 3KNBA 5T5NG 1EVUA 2IFFL 5BZWB 3VXQB 3UYRL 2DIBA 3BEVA 4GG8A 4OCWL 1MFBL 2WUCH 4JGJA 1AGEA 4L4VE 5HGBA 5DWUH 1U95B 4K7PL 1BAFL 1ZT1B 3RU8H 4PY7A 3RDTC 4EDXB 3MRJB 1MCFA 4XWGH 3HNTL 3H2WA 3PV7A 5EDXA 3WFBL 3ESVF 1G7MB 4GW1A 1JWMA 2X4OA 1CTOA 1OP5H 4G9FA 2DQHL 4JG0L 1IZKA 5FYKD 1GZQA 5T33H 4JDZB 3RBGA 4W81A 4HFWA 2BRQA 1RUKL 3WIIH 1JJUA 4P59H 2ESVA 1TPXC 4TVPE 4FQ2H 3H7BB 1XF3A 4NC1C 4F8QA 5IR1B 1MFAL 4OUOA 3IS1X 3UTSA 1U8JB 3HTLX 3TT3L 1WF5A 1P6AB 4R2GD 4N8PA 3VFOB 4PGEA 1UB5A 1KBGH 3I50H 3OKYA 4YZFE 3SE8H 3BKML 4EIZC 1BIIB 1JYWA 5DRNA 4J3WA 4APQB 1R5VA 4WHCA 3VFMB 3O4LB 2DQGH 2CO7B 4Z7VB 3QAZB 1NFDF 1DFBL 2ZG2A 3AS2A 2HRPH 3ECBB 2P4AB 3UBXG 2OTWA 3TBWA 1S5HA 2IANA 4KKCC 1HK6A 2OZ4L 3OHXB 4LVNB 2FBJL 4PRIE 2V5RA 4K94H 2AEPL 2EEAA 3DVNA 5GZNC 2DLEA 2EXWC 3KPPA 3QT2A 1L9NA 3HMWL 3IU4L 5E6IB 1IEAB 4LASL 1SJEA 1YEEH 3DX6B 2YRLA 4PGDA 1NMBH 5E94B 1CU4L 3SCMB 5MENE 4L4VD 2BSTA 4WEUD 2DMKA 4L8CB 3S88L 2UYLA 5GSVA 5J13C 4DGIL 2HYMA 1WWWX 2VZVA 4CAGA 3NCYP 2AKRB 4Z5RA 5T3XL 1JI1A 3WKML 3V6BR 3PGDB 3QRGL 1MLBB 1S7TB 5IVXE 4G6JH 4OQTL 4N0CC 4WHYH 5BXFA 5FV1L 4F7PA 1NAML 1LHZA 2V17L 2DBLH 3ZL4L 5T3ZL 3MPCA 3Q2CA 1OHQA 1YNKL 4PJGA 1T21B 2NY1B 4LIQH 5DHYB 2FHFA 2A77H 1JE6A 1QHOA 2EIDA 1VFAB 4YK4B 1RZIA 2FL5A 4K23H 4XNMB 4K7PX 3VRLE 3WE6B 1IAOB 2VQTA 3PL6D 1A8JH 1KN4L 2RJMA 3IS0X 2BOBA 1DEEB 1UCBL 3A67L 4LPVA 3W2DH 3FT2B 3MLYH 5JHLH 5GS0L 3PXJA 2GYSA 4ZO7A 5BS0A 4LSDA 3NA4A 5IB2B 4B50A 1CXFA 2D7PA 3OKEB 3QHZH 5HYJE 1KIRA 2ZUWA 4OB5H 2NY0C 1FFQA 4YIQB 1A7RL 5D7IF 1MFCH 4IIQB 4N90E 4CDGC 4EJ1C 3BDXA 2R0ZH 4TUJB 2AV7A 3QDMB 1BBJA 3AREB 3QJFA 2FECL 4WU5A 3LH2H 1P4BL 5MEND 3BP6A 1IGJA 1DVFB 4L3CB 4HS6B 1HEZB 3U1SL 4HMCA 3ZDZE 3QCTH 1B2WL 1RJYB 2ED8A 2IGFH 5D7IA 1TCRA 4RAHA 3ROOA 3HZVA 5DUMH 4AIXA 3P4LA 4L5FH 4ETQA 4QEGA 2GW5A 4WW2A 5FYJU 5GSRA 1AO7E 1GAFH 4ISVA 4OF6A 1A7NH 2H45A 2IQAB 3QEHB 2WQ8A 2Y5TB 3HN3A 2WUCL 2O5YH 1JWUA 1L4IA 3S35X 1I7RB 4GS7B 2IMNA 3KYMB 4G42A 4XWGL 2D4DA 3ARUA 2V7NA 1N2RB 2CIIA 4JN2A 1HOCB 1IEBA 1Q9WA 1G9NH 3FZUD 1TJGH 3MCLH 2NZIA 1ZV5A 2ZG3A 1H3PL 1N5YH 3ULUE 4HIEA 4U49A 4P59L 5C7XH 2UZIH 2NNAA 4C83A 5H94A 4DZBA 3GZKA 3PDDA 3C09B 4Z7WF 3U4AA 3RIFK 3LB6D 3BRDA 2SEBB 4GW5B 4TN9A 2YHGA 1QP1A 4J7RA 4N90D 1KBGL 1VACB 5I1JH 2IG2L 4Y19E 2DLFH 1IM3A 3I9GH 4HKBA 3IKCA 1P2CA 4JO4H 3SDXA 1DBML 4OLVL 1KB9J 4LCUA 4URTB 1U92B 2CDEB 3UAJD 4XHJD 4RGMB 1MY5A 1AIFA 3TZVB 5H8DA 1KN2H 4CVXB 2PW2A 3V0WH 3HCVA 4ODHH 4RSVA 1ZVHA 2LV4A 4PV8A 1JPGA 1IGCL 5E2VH 3VFVA 4K94L 2AJXH 3G6JB 1LO0L 4R4FH 1FIGL 2VC2L 1QSED 1RZ7H 3STLA 1AO7D 5EORH 1YEEL 3V0VA 4GBXD 1HH6B 4WW2C 1D5ZA 2XI9A 2Z91A 1MJUH 3QB7C 2ENSA 4H20H 3RWHA 2P24A 3RL1A 2DQIH 4FMKA 1CCZA 4RA3A 4CKVX 1YUHB 3C6LA 3NABH 3H42H 3O3AA 4GMTL 5D1QA 4ZUUA 1BVKA 2I60H 3Q5OA 4ZUVA 4KMQA 5E00A 3RWCA 3VXPB 1I9EA 5C0CE 1MCWM 2X89D 4O51B 1CICA 3EYUH 3BWUC 4KVCH 4X7TB 1INQA 1X5ZA 3NIFF 1JZ8A 2L7JA 5IB1A 5IB5A 3VXNA 3DI3B 1G6RA 4KV5F 1J8HA 1OP3K 4X9IA 3B5HA 4LIQL 4WO4A 4BKLB 5HHMB 3PP3K 4Y19D 3O9WB 1JGDA 5I9QC 1DBAL 4BSVA 1A14L 2ADJA 2J6EL 3GBMH 4XX1G 2VQ1B 5ACZB 4Q6IB 5JXEA 4EN3D 3CVHL 2ICEA 3K2UH 1EEZA 5JZ7D 3FO1A 5F7DA 4PJ7E 2NTSP 5E4EB 4YXHH 5EBMA 1WAAE 5ELIA 3MLYL 4N68A 1J0HA 2HTLC 2WUBL 4DVRL 1KPRA 3BKYH 1U42A 1ZMYA 1HXMB 4XAWL 1KTDB 2VL5B 3HAEG 5FUCE 2RFXA 1FL6A 4X98B 2BDNH 1DQLH 3HG1B 4MQSB 5DFVD 4A6YH 3MRKA 2R0ZL 2CH8A 4JHAL 4OIIH 5F97E 3NZHH 4OLYH 5L0QC 4GKNB 3LH2L 1ITCA 4HJ0C 2YD2A 4HZLB 2AXGB 2AERT 1ETZA 4BK4A 4DN3L 5K9KA 5IMLA 1P6FA 2H2SC 4L4VB 1GGTA 4PRAA 3VFGL 5I75C 2HG5B 2IGFL 5GGUB 3UTZB 2BXYA 2OM5A 2X4PB 4WHDA 4LK4A 1UWGH 4J3OC 3T8XA 4NWUL 3HNVL 3QJHA 1W72B 1J10A 4OIAA 4UI2A 5D1QC 4EXPX 4X6FB 5C0FB 2VKWA 1VEPA 1ZA3B 1NPUA 2XG5A 4OZIA 1ES0A 1RZKL 3QXVA 5FM5O 5IKCA 1T80A 1XR9B 1A7NL 1EHAA 2A1WH 2XXMB 4U2YA 5C0JA 2IADA 4V1DE 3UXFA 1FG9C 3QDJA 1K5NA 2JJSA 5DRXB 2XTLA 2NW2B 3JSSA 2BFVH 3A6CH 3VGDA 5ICXA 5LKNA 2EXYC 4WO4C 4OCMC 5DJ2A 1HINL 2BK8A 5JW3H 2GK0A 3ZE2F 3HUJA 3MFGB 1AGDA 5DYOB 3PL6B 5JXEC 1H0DB 1YN6B 1RZFL 5C7XL 2UZIL 4MDIB 1B3JA 4LKXA 2EEBA 2CPCA 4MZ2A 1WEJH 4UQ3A 3REVA 4E42B 2J12B 1OT1A 1U3YA 3QIBD 4PRIB 4PRDA 1EAPA 2RR3A 5T1LD 3BXNA 1GGYA 4X7SH 2HFFB 4K7PY 4UNVA 4O2CB 3WNOA 1V7MH 3W11C 3I9GL 1F4XH 3RX5A 1FDLL 2EKJA 3U48A 4R8WH 4Y4KA 1JPTH 2X7LA 4NBZB 3WBDA 3VGEA 2ICWJ 3OXSB 5MENB 1ULVA 3AU1B 4LRNH 5GGTH 4YBLB 4KRPD 1H5BB 1JHKL 3UJTH 4QGTA 3MLZH 3EYQC 3CFCH 4UINH 4U7KA 4M4PA 4XX1E 1FC2D 5F7NC 2OX5A 4WEMB 4Y88A 4N8CL 5IVXB 3VI3E 3TV3L 1JV5B 4OLXL 2XWTB 4RFNB 2CLVA 2G5BA 2AJXL 2XPGB 3IF1B 2DQUL 2AQ2A 5C0RH 4XBGB 1AH1A 1T0NA 3FQUA 4MNQD 4ODXB 4GG6F 3ILQC 5KVMC 2KL6A 2BOCA 4Z77B 1MCOH 3HRPA 5LXGH 1MJUL 1XZ0A 2YUVA 3ME0A 2CRMA 2EYTA 1N26A 5EUOF 4KTDL 2DBJA 2OXHA 2QHLA 2PN5A 5IW6A 3CXHJ 3H3KA 4YHKL 5LCVL 1FRGL 5CIPB 1DUZA 1CD8A 3NABL 1GGBH 1QFPA 1YEDA 3JTTA 2JJSC 3VCLA 3ARWA 3VI4E 2I60L 4BSWB 5CJQL 2OYPA 3B9AA 3OJMB 4NKIL 4GG6A 2P5EA 1QBMH 1Y6KR 5TE6L 5ADOH 3ISWA 1M1SA 2BNQE 3T4YB 2CMRL 2ZSWB 1WISA 1DQMH 4JO3H 5EUOA 1V7NL 1VGEL 3BPNB 1C08A 2ORBL 1OGAE 3O45A 2G75B 4XP6L 2AEWA 1ZHKB 2MKWA 1IC4H 3A0OA 2BSRA 5J6HB 5F7EL 5HYJB 4R90L 3O6MH 5FYJE 5TGBB 1QFHA 1CFNB 2Q7YA 2P45B 5DSCB 3HLAB 1FV1A 1YA5A 3MBEA 5LGJA 3GUTB 5I73C 4X5XA 4XAKD 3RTQB 5GGQL 2FD6H 3D85D 3GKZA 5DJCB 2X05A 4NN7C 2FX7L 4Y4KC 3MV7A 4JRWA 1G7JA 2CJUH 3ARTA 2MNUA 3QPXH 4M3KB 4EEEA 1QRNA 4D0BB 5CINH 1ZVSB 4E41E 4MD0A 1FZMA 5IFJA 3GI9H 4AM0A 3BYYA 3L5WB 4LARL 5L8JB 3GSUA 3HZYA 4U05A 4NKDA 5I1KH 4HUVB 3QO1B 4A6YL 2VJXA 1AO7B 1X5LA 5IP4A 1CZ8H 1NQBA 1DZBA 4JVUA 5A3ID 3K8LA 2P44B 4GBXB 2N56A 2DKMA 4AG4L 3IFPB 4XMKL 2ADFH 1AD0A 2R56L 3U4BH 1LK2A 4M1DH 5IEHA 3LIZL 4RGNC 4UBDD 1XH3B 3U79A 1S5IH 4WU7A 1UWGL 1XGUB 5C9KA 5I1DA 1KIQB 5I1IH 4J1UB 3NCJH 1X4XA 4BZ2L 4PLOB 3LN4B 2XQYK 2ATKB 2BNQD 1QACA 3MLWL 4HXBH 1NCWH 5J12B 4NCDA 2BC4B 4FP8H 3HNSL 1WBZB 1P7QB 2ZUYA 4OGZA 3BH9A 1XGRB 43CAB 4HLZH 3KPTA 4JKPH 1T4KB 3HZKB 1XCTB 5DJDA 5JO5B 4Y19B 4D94A 2AABH 5EZLA 1V8HA 3MBEC 3H9HB 1T7VA 1V3KA 1B6UA 2F54E 4JRXA 5MP6L 4JFDD 4LSQH 4EN3B 5HHOE 2EO1A 3NCBB 3TEUA 4JFFA 3KLDA 1EK3A 2VL4A 2DI9A 2W9DL 3B3IA 5MEPB 5BOPA 4ZPTA 4UDUA 3F12B 3ZE1F 4QO1A 5HVFB 5KW9H 3V5DB 2FHCA 1RMFH 2ITCA 4OF5A 1A6VH 4HKXA 3QIUB 4RAUB 4OLZH 3BZFA 4ESKA 3FO9B 3BI9X 3LQZB 4MD5B 1R3HB 4ZMAT 4JKWA 4WUUA 4YNYA 1LDSA 3K1DA 4MSWB 2VIRB 2EEDA 2W0FA 5GPRA 3VXOA 3QXAB 4NZRH 4CMMA 1XT5A 1I9RL 3PQYD 3MLZL 1OAXH 1LO4H 1K8DA 5CBEA 2H32A 5AD0A 3UYPA 2LAAA 4JDTH 1AFVH 1NSNH 1MHEA 2QL1A 3B9DA 4OCSL 1MWAA 3P4OB 3GRWA 2KQNA 4LLVB 2VZTA 1G9MC 1HQRA 3TWCH 3WLBA 1MREL 3QUYA 3T1FB 1ZEAL 3D1MC 1QD0A 4LGRB 3PG2A 4D0CB 4KI5D 3LEYH 5IW3A 5LAXB 1XF4B 5E0QA 5IHBA 1QSFA 5DD6A 1OT2A 1SY6L 2X4NA 5FCUL 5DEFB 4JFOB 3B43A 1T1WA 1RULH 1MHCB 3U0WH 1WICA 3IDGA 1CVRA 5C0AA 1I7TB 2QQKH 4ZS6C 5I30H 4MA8L 5SWQB 4QTHB 5D72H 1M71B 4N9GB 1S7RB 4BFEA 3D25A 4F8TA 3TA3D 1DQML 3VXTB 1QG3A 4RCAA 4L4TD 5J9PA 5HYQA 1UM4H 3KPRE 2DLIA 4N0FB 5HDBF 2FX8L 3RVWD 5EN2A 5AZ2L 2EC9T 3TBYA 1DQJA 4U3CA 4UOJA 3WCYA 3QIBB 4OD1L 3QNYB 5AWNL 5DO2C 4NQCE 1FORH 1GHFH 4XPBH 4PJ8D 5D70H 3MX0A 1CL7H 1Z3GL 3RA7H 5IJVA 3QYCA 5KS9F 4U6XB 3FOLA 5CEZE 2PXYD 3K4DA 1U91B 2C4FT 1NL0H 4M1CC 4OD2A 4XPGL 4OLUL 1JTOA 3GMQB 2PTVA 2ZPKH 4KRPB 4A2MA 2GUOB 5E1AB 3S3PA 2D7MA 4U1IB 3GI9L 2C3VB 4PJIB 2EDHA 3RVVC 5FO9A 1D6VH 2CLRB 2YBRA 5IVNA 1HYSC 4H26A 1GC1L 2QADD 4WGVB 2H26B 5KS9A 1OAQL 3WFDH 2W65A 3OKOB 2ENYA 4I48B 4H0GA 4KKLD 3WUWG 1BLNB 2E7HA 3QUYC 4YPGA 1OSZA 4JM2B 2X2YA 3L3OA 5CZKA 5MI0B 4V1DB 2ADFL 2R2BB 4X99A 4K8RL 3OKDB 3KPOA 4M1DL 1E6JH 1F3JB 5GZOD 1BZQK 4YFLI 1A6ZB 3TPUB 2D31B 2F58H 4TUOB 5EZOH 3MJ8B 3N9GH 3NH7H 4PPTA 5I66B 1F6AB 3CH1B 1NJ9B 5D6DA 4M1GH 2I9LB 3U7YL 3SDCD 4AEHH 3EZ8A 1NCWL 3KPRD 1KFAH 4NPYA 1JRHL 4IJ3C 4JJ5A 4TTDC 1HHHB 4U1HB 1TVHB 4TQEH 1A6AB 3FKUS 1UKTA 4YAQA 1A1OB 2OTUB 3LEVH 4ZNEA 2VDRL 5CEXA 3ARDA 3SQBA 2HN7A 2GTZB 4JKPL 3EAKA 4NQCD 3RHWK 3MROB 4JE4B 1UQSB 1GL4B 3CX5J 4R96B 4NQDE 4UT9H 4O58L 1B0WA 4JFPB 5B4MC 4M93B 5CEZD 5DGQA 4NO5A 5C0IA 3HKFA 3UC0L 3QA3B 1CG9B 3GBNH 1BD2D 3OX8A 3CSYA 3SJVA 2F53D 4AL8L 1F8TH 4KRMB 3ULVF 1UACL 4MNHA 4KJQC 1A6VL 1FZKB 1ZSDA 5FO7A 1EMTH 1K3ZA 4PR5B 3TN0A 2Y4SA 3NFNA 4P3DB 3RVTC 4J8RA 1JUFB 1FSKB 2JB5H 3LSOB 1QLEH 3GHEH 4UMGA 3D3VE 3HAEB 1LE5B 5I8EB 3QCUL 4MAUL 2GY5A 4NO0A 4ZPVB 1IZJA 4G9FE 3RY6A 2ZP0T 2F5BH 3PWUB 4LQFL 3WS3B 2DM3A 4JDTL 1AFVL 4PLNC 2VXVH 4PJ9D 4DCQB 3O3DA 3VG0L 2E6PA 3BZEA 4PRPA 4R0LB 3IJHB 4X6DE 3UTSE 4RMRA 3MLUH 4M7ZB 2BNQB 3TWCL 3WDIA 4LRIA 2A6JA 2NR6C 3O11B 4PG9B 5D6DC 5E24E 5C9JB 3TH3T 1OGAB 4WDIB 1A1MB 2B1AL 1CF8H 3VWKA 5IQ9B 4HWNA 5F8RC 2A6DB 5CMAB 2FEEI 4JFED 3TVMD 3W9EB 1IGFH 4L3AA 4H1LG 3ARDC 4MAYD 4Y2DA 5CD5D 4CW1B 3BPCB 1MCBA 4OZFA 3RI5F 3FMGH 1ACYH 3HC0B 5EUKA 5FUOH 2QSCL 3L3DA 1DUYB 4P0DA 2DTSA 3JZ7A 4HH9B 2R1XA 2H1PL 2VDMH 4OSUL 1RZ8B 1NGYB 2EH8H 1NUDA 3MA7B 4IEFB 1A2YA 2XZCL 5EU6D 1MVUA 5F1NB 1NC4A 4CU6A 3TYGH 1I3GH 1NCDL 3FO0L 4U6VL 3RVUC 1MUJA 3EO9H 3O2DA 4HIXH 3X12B 3IDMA 3O6FD 4E41B 3B2UD 3BW9B 3O81A 3EKCA 5HI3C 4HMDA 3P0GB 4JHWL 4LF3B 5J8OA 4RFEB 5D7KD 3IFOA 3PIQA 3AAZB 1MCPL 2VLRD 2D7TH 1S8DB 1YEKL 3C5ZA 4KDWA 4HWZA 5ALCL 3MACL 4XPBL 1C5BH 4G9DA 1D7FA 4U33A 3TN0C 4YEFA 2Z35A 4G3YH 1CL7L 1KCVL 3OKNB 3D3VD 4WFEE 5C0BE 3QXWA 1XF5A 2VLJE 5C2BL 5E7BA 4QRUA 1NBZA 3ULVC 3OAZK 4X6CA 5JPNA 1U9KA 3RY6C 1U58B 1XF1A 1BFOB 4OI8A 3DX8B 3PABA 3OKLA 5CJOL 4X5WA 4KKBC 5LBSH 4NZTL 1TZHA 4NJAH 3MLVH 1FFNB 3SKNA 3I3DA 4FTVE 4PJGE 4PGBA 3QCVL 3REWB 3MUY1 1CL7I 4MD4A 2Q8BH 3ZMRA 3P2TA 3O2VL 4G8GE 3AUVA 2OR8A 3BFOA 4LRIC 1NMAH 2ZOLA 3HRZB 3ZE0F 2IALB 1BQLL 5D2LA 2P48B 1OLZA 1MHPL 4LMQE 2OTPA 4ZO9A 3WNLA 5D93B 5F1KC 1NC2D