4Y8AA

Crystal structure of the n-terminal domain of ceacam6
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
AKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carcinoembryonic antigen-related cell adhesion molecule 6
publication title Diverse oligomeric states of CEACAM IgV domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 26
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y8aA00
2Q7NA 1J0KA 1RUKL 3JTTB 1TIUA 4U1MA 4G8FA 4MB5A 4L5FH 2XRAL 2VDRL 4N1EA 3TPUB 1VADA 2DKSA 4WUUD 2VWEC 2MCPL 3GMQB 5HDOA 4LIQH 4KJPD 1KB5L 2BZDA 1UEMA 1WBXA 3E6FB 4PFEA 4MAYC 4YHOH 1P7HL 3X12B 2YZ1A 5C07A 2V5RA 1H3PH 1OB1B 4XAKD 32C2B 4ODSL 5EZLA 1R5WA 3LKOB 2BMKA 3TFKC 4PD4J 4HCRH 4UUJB 1SJHA 3KPLB 3MCKA 3G9AB 1Q9KA 1KEGH 4QHMA 3TV3L 5IMMA 3P4OB 4LDOB 4JY4A 5DMIL 2VSDA 5DD0H 1C7SA 3BVNA 3CFEB 4PUBL 5EC1B 4MMZC 4UIKL 3OJVC 4K3GA 1Q9LA 1A22B 3X3FL 2WBJB 5TQ0L 4PJGB 5C0AA 3IFNL 2WQ8A 5FUZL 1X4YA 3N85L 3DYPA 2R0KL 4HZAA 1E0OB 4DFHA 4AZ8A 4PRBA 3U7WL 2ILLA 4X5WA 1NGQH 4PJFF 4Q2ZB 1UKTA 1RSFA 3VGHA 3D39E 4ZPTB 4KMTL 4OZFH 4PBWD 3C5ZC 1E28A 2PO6B 5FCUL 1RUPH 3U82B 3BAEH 2R2BB 1TETH 3S36X 5EIIA 5A2LH 4HG4K 3NABL 3O6ML 1RK1B 4CGTA 3DV6B 5MHSD 4NN5C 4OM0H 1DEEB 4MCYA 2GI7A 1HKFA 3SDAC 5DZOA 4WHCA 3KPPB 2BC4A 2VLJE 2EXYC 4JM2B 5FA4B 1QFUH 2AAVA 5IFJA 4HIJA 4ODTL 3MGAA 3Q48A 4HJGB 1RFDL 5C92A 5C08B 4KDTA 4GW5B 3QI9A 1I8IA 3FZUC 4RDQF 5MEOB 2WP3T 4DJMA 4PRAB 3QIUD 2UY7A 3X14B 3VXRE 3SY0A 4WFHE 1AGDA 1EHAA 1CXLA 5C0CE 1UZ8A 2Y06L 4JG0L 3M17B 1ZLWK 3OL2A 1JRHH 3WO4B 2EC8A 5T5NF 4AYFA 5IW6B 3GUTB 2BNRB 5DRWA 3IJHB 3O8XD 1IFHL 1QSED 3KXFA 4YDIL 4ZUTB 5EU6B 4OZHB 1C5CL 3BPOC 5D4QA 1QO3B 4D8PB 4XMKL 1HCVA 5K93A 2VN4A 4KZEL 5KSAB 4NDMB 3EYFB 4M7LL 4ZUWA 4M43H 5D1ZB 2UY6A 1MCSA 1XCTB 1U8MA 5E24E 1UXSA 3RWJA 4WHDA 3CLEL 1G9NL 4WCYH 5EZJB 3C5SA 1ZHKB 3QUXD 3GI9H 2FBJL 4YDVA 1WJ3A 4HS3B 2YUVA 4ISVB 5GISH 5IFHH 4ODWA 2VLMD 2B2XL 1BQLL 5J7CC 5KSUB 2OYPA 2IMMA 4J8RB 4G7YL 1FIGH 5DO2D 3VXTA 4B50A 3C60D 1UACH 3KWWA 2V17L 5SWZE 3EFFB 3G9VA 2BVOB 4BKLA 4ODUB 3MODL 1CG9A 1YEHL 4XC3H 2MMXA 4MJ6A 1VSCA 1KCLA 1UJ3B 2IG2L 1JGVL 5D2NA 4I2XE 4OCWL 4A6YL 1MUJB 4JN2B 5D7JB 4IMLB 2OSLA 2XICA 5ACZB 5K9KA 4KI1A 4UNVA 2VYRE 2XKNA 3LKQB 5E8DH 1I75A 4DGIL 3VG9B 3HNTH 3ARBC 1GOGA 1YEJL 3RPKA 2ESVD 1RQ5A 2HRPH 3K1DA 1G7IA 1OPGH 4DW2H 3WYRA 4YFLF 3BEVB 3LN4A 4WNQB 4JB9H 4F7EB 1DQML 1TJIL 5DT1H 5EOTA 4I0PC 3DXAE 4KROD 3C8DA 2J3SA 3I85A 3MYZA 5CUSL 5D70L 4Z0BH 5F9OH 2NW2B 3GBMH 1FGNH 5CBEA 3ZL4H 4NZUL 3VWKC 1RZ7L 3T0AA 3TZVD 3ARQA 4P9ML 2UUDH 1K2DB 3JUZA 4KDVA 2X44D 2OMBA 3W82A 1MNUH 1DLFL 2G60L 3I6KB 4IIQB 4XNUL 4X6BA 5KSVA 2HT3C 3MREA 4K9EL 4L3ED 3VJ6A 5JZ7D 1CDGA 2UV3A 4PJBE 3PGDA 3SKMA 2VDKH 4OZIB 2WWMD 3C5JB 3DYMA 1MCWW 4MD0B 3ES6B 1U8KA 4NIKB 4LFHG 3ZE0F 1D6EA 3LKNB 2XTJB 3LS4L 3KPSB 4HWBA 4BJLA 4XCNB 5I8KL 3FFCB 5JDSA 2OJZL 2XZCH 1KTDA 4RNRA 5D96C 2KKQA 3WEXA 4FZEH 3FB8A 4ZFFA 1AXTH 1D5ZA 3IFOA 2FO4B 4XP9H 1A6WL 2JE8A 2PTTA 4NKIL 3ARRA 3UP1A 3WIHH 1MF2H 3U46A 3MCLH 4I4WB 1S5IH 3D25B 4UU9B 1FNLA 3F7YB 3BESR 5FYKL 2GJJA 3IDGA 4JHAL 4ELME 4HD9A 4M8QB 1NBVH 1BJ8A 1EAJA 4WDIA 5IBLD 2JCCF 4OQTH 4NN7B 5DK0B 1SY6H 3EJYC 1EXUA 1J5OH 3QH3B 3MV11 1IM9D 1FE8H 2ZCKL 4Y0GA 3LEYH 1QSFA 1YEKH 5HGHB 3DSFH 3D87B 5DHXB 1S9VB 3T0EE 2KQNA 2YK1H 4XNMA 5D71H 4PYHA 2I26N 2A6DA 1WBZB 1BFTA 4WI2A 3P4MB 4PLOB 3ZDYF 4DKFH 3V6ZA 1F3DH 3HE7D 5I8OL 1G7QA 5ACLA 4FP8H 4OSUL 4NQXA 4O58H 3U4EA 1H3TA 4XVJH 1BPVA 1P7QB 5DVNA 1J11A 4LARL 4L8BA 4F9LC 1D5XB 3NCJH 4YZFF 1RJYA 2FGWL 2NY3C 3O3BB 4UB0H 4DEPC 2DRUA 3V6OE 3WFHA 4PJ9B 5DD3L 3B3IB 2X7LA 3O6FC 5DJ6A 5DVOA 5T3XD 1CFTA 3ZYJA 3MJ9A 1UKSA 1QR1A 3OZ9L 1NUGA 3UZEA 1BECA 4DTGL 3WKNA 4FQXB 2W9DL 1Z3GL 2YEZB 2X4SB 2J5LB 1HKLH 1YNTA 1O7VA 1ROWA 2X4RB 2X9WA 4I18A 4M5YL 5IKCB 3NPSC 3OKOA 4GS7B 2IGFH 4JREC 3PXHA 4PYGA 3BKJH 4U1LB 1ADQA 4X4ZA 4TRPL 3HPLB 3V7AE 2EYTB 3CK0H 3RWEA 1MCOL 5DZLA 1BIHA 2WBJD 5KVFL 5K59F 2W0FB 3QG6B 2ED8A 1FC2D 3SE4C 3LHPH 3RKDC 3HE6B 1GC1L 1GZQA 2R2EB 3HCVB 5BRZA 3RI5K 2D3VA 4WEUD 2PO6D 4QRPE 3GMOA 4PGBA 3QDMA 3MXVL 3AU1A 2VKWA 4M6ML 4G8IA 1NGPH 1Z6JT 1T03L 4NO5A 2IPTL 3K8MA 5DMKB 1AO7A 3JWNC 1UB6B 3L3JB 4P23C 4H88L 5CFHA 3G08A 2AK1H 3BZ4B 4GRWB 3VFOB 2V5YA 4PRPB 4JM2D 4CRPA 4JPWH 1GGBL 1CD1B 1I1AC 3BIKB 3ALPA 3WLBA 5C08D 1GYAA 2Y5EA 1AIFB 3QXAB 2R0LL 1SEBA 5F6HJ 3X11B 2X4OB 4KTYA 4LCIL 5IJVB 2WUCH 2E7MA 2XQYK 3QFJB 4QTHB 4HBCL 2OR9L 3MMEB 4JRYA 4IJ3C 4IDJL 2YSSB 5TDOA 2AABL 2XQBH 4U1KB 2NZ9D 4RMSA 2BNRD 4J12A 2IWGA 1KLUB 3GSNB 4WFGD 1QP1A 4KUZH 4YR6A 3VGFA 3V4UL 2JCCA 5EU6D 3O6LL 1CLYH 4TULL 1U8OA 4KK5D 3RWFA 5K9OA 4OLYL 3DETC 4AIZA 5HGDA 3LB6C 4OQ1A 5I0ZA 1HH9B 3OKKA 3BHBB 1XGPA 5KSAD 2F53B 2CIKA 3A6BH 5D93B 1SMOA 5D1ZD 3WE6A 4HH8A 5E70A 1MJ8L 1X5AA 4PRIE 2FECI 3IDXL 3VRJA 1EUTA 1F45A 3F12B 4OKVA 1S9XB 1K6QH 5A2JH 1U92B 4I9WE 2AK4E 5IW3A 4UIMB 3B2VL 4GKOA 4PJHE 3W0WB 2MPAH 4HIEA 5KG9A 3B9AA 3MLRL 1MVUA 2GY7B 3L3IB 3MRFB 1B4JL 2UZIL 3SDXE 4ORGA 2JELL 3ZLQC 3P9MA 4FQCH 1IQDA 4XPTL 3EO0A 4G42A 2CLVA 4R4NC 1DBKL 3GI8H 1CDUA 4I3SL 1PVHA 3KPMB 2J88H 3VFRB 4K94C 3CSYA 2A6JB 2D7OA 1CE1L 1MHPH 3H9HB 4FTVB 1LO2H 4XWGL 4JDVA 3MRRA 3LN9A 2GJZB 5D7JD 1RZFL 3LPGA 2X6MA 4ODXA 3M1BA 2HLFD 3RGVD 1CLZL 4JO1H 1B6DA 4JQIL 1FO0L 4EZMA 4WWKC 1QLFB 1YC8A 2VRAA 2X89A 1XR8B 3WUWB 1M7XA 4XHJD 3DUUA 5EUOB 3D85A 1DQQB 4Z8FH 4J2XA 3WN5A 1FC1A 1QSZA 4YHLL 3U1SH 4GAJL 4GBXC 5IW1B 1Z5LB 3TN0A 3GSRB 4PGDB 5E08L 2ADGB 3T2OA 1A7NH 3I2CH 1P2CB 4DCQA 3GKZA 5HYSA 5D2LF 2F8VA 4BFIB 3F62A 3NGBB 3LRHA 3WFDL 1E4XL 5J9PB 3BKMH 4JQVA 4HW6A 3ARUA 5SV4A 2SEBB 1FFPB 1R5IB 3EO9H 4L4TA 3UTTE 4HJJL 1K4CB 5L0QB 5ESAB 5FYJE 1DE4A 4MS8C 4LLYB 2LABA 4MQXC 5E6IA 1ETZA 5JHLH 1T66C 1XGYL 3QG7H 5C8JB 3ARDA 1A3RH 2A0LC 3MACL 2XTJD 3B8YA 3KPSD 3AREA 2GSGB 3RIAK 4NT6B 3FFCD 3DO7A 4DKDC 5FFLA 1A7RL 2AGJH 4HK0A 1TJGL 3MUGA 2X4UA 3LS5L 3HG1D 3QNZB 1BQSA 2FD6L 1MEXH 1UM6L 3NACH 2YPKA 1HINL 4OLUH 4JR9L 4OCSL 3RVWC 5FDWA 1VFBB 1CL7H 4K3DH 4L9LA 4KJWC 1ZLUH 5GS1A 1CDYA 1X7QB 3A67H 2ICWI 2HH0L 5LKNA 1CCZA 4Z7UB 1EHLH 3E2HB 2V5TA 3BPNC 5JW3L 5HYQA 5GRJH 3X13A 4CVWA 2WBWB 4L8SB 5I1JH 1LEKB 4LCWB 4S1RL 5EN2B 1YMME 4YGVA 5AWNL 1LEGB 4JKWA 1VACB 2VXSH 3BH8B 4BSJA 2BCKB 3D39A 1AGBA 1LO5B 3O2WH 1FFOB 2OTWB 2R1YA 3B2UD 3IF1B 3PL6A 3P0GB 2CUHA 4MA7L 3UMTA 5GGRA 3PWUA 1J10A 4LEXL 1UWGH 1KB9K 4WFFE 5CIPA 5CEZE 1LMKA 3SCMC 3EYOB 1XIWA 4HWBH 1UM4H 4Y4HC 1XAUA 3WJJC 2VLJA 1P7QD 1U42A 4X7TB 2I60L 1T1WB 5DMGD 3U0WH 3W81A 4MQ7A 4PJ9D 2NY6B 3IDJB 43C9B 4MA3B 4PJBF 5IQ7L 1OTTD 1R3HB 1OAKL 2N7AA 1UCBH 1MHHA 3RPIA 5ECJE 1E27A 4RWYH 3RA7L 2B1HL 2DTML 4MMXC 1CN4A 3BGFB 5IVNA 2ZKHL 4D0CB 1J0YA 1BD2B 2UYLA 1A7QH 4TQEH 3V4VL 4D2NA 3MUZ1 2JF1A 2GHWB 3IGAA 4Q6YA 3STZB 3BWUC 1NGXA 3QHFL 4C57C 1LK2A 3GDBA 1M4KA 3JWDC 3ULVD 4LGPB 2JJVA 1JIBA 4G6KH 1U3JA 3ZHLA 1NCDL 5I73C 3HRPA 4Z18A 1PLGH 1A6UL 1UA6L 4GG6E 1ZGLA 2YD7A 3LMJL 5A43C 1N7ML 2VITA 4BH7A 2OM5A 3K8LA 5J1TC 2MHAA 4GMSL 4CVUA 2VJXA 4LLDA 3FFDB 4TVPD 4ZTPL 1T2QL 4KV5E 4QHNA 4XCCL 5JHDB 1D9KA 4PGCA 5JXEC 2CKBA 1AR1D 1RAMA 1WAAE 3O3EA 2VR4A 4PJ8C 2HJFB 1YPZE 4YE4H 3HFML 3BXNA 1NFDF 4IOFD 4GJTB 1LVEA 4MVBC 3PP4L 5GPRA 3S5LA 3TM6A 3EOAB 1R3JB 1KEMH 5ILTL 2XKSA 4K7PY 3WDJA 1NCCH 3KDMB 3MJ9H 5E4EB 5SWZA 4F80A 1KIRA 3MRQA 3PQYB 5T33H 1B2WL 5DRNB 1F58L 3L1OL 2H32A 3LOWA 2QSVA 2QKIA 2YA1A 4WW1A 3ZE2F 5C9JB 3A6CL 4I2XA 3VFUA 1JHTB 5C0BE 4AT6B 2I25N 2ITDA 3RZCB 4QY8A 3QIBC 4DZBA 1ADQH 3JV5A 4WHYG 3BP7B 2V7HB 2AKRB 2X4NB 3ETBF 1JWUA 4NCC1 4QRSB 4RGOH 4F7PB 1BM3L 1CF8L 3GSXA 3NN8A 4NC2B 3RDTB 1HHGB 4AENA 1L9MA 1N5YL 2DJ4A 4LCCC 4QRRB 5FKAB 5A3ID 1J05A 3D48R 3H0TA 4R96A 4UDTB 2JK5A 2PCPA 5JNYA 3DXAA 4N9GB 4UAOB 3DWTA 5CJOH 3VFMA 1PG7L 1KTLA 4WGWB 2GK2A 2H45A 2R29L 1J8HD 3TT1L 5HHOE 1JGEB 1MCNA 4X4YB 1OTSC 4S1QL 2YD9A 1S7TB 4XBPA 2C1OB 2W9EH 4G8GA 2C3HA 2AJZB 2CMRH 1U3HB 3UTQB 4U1NB 5I1IH 2F5BH 3QSKB 5FM4A 1DUYA 1JFQH 5D9SB 4QXTA 4TPRL 4FQ2H 5CJBA 3OKMB 4RFOL 2BNQE 4PJBA 4JFFB 1K3ZA 1D6VH 1RMFL 4CADB 3MGTA 3HR6A 1KN4L 5T1KB 4FTVD 1A9BA 4OZFB 5J6HA 1GZPB 1KJ2L 4ZNCD 3ZSSA 1ZKAA 4JFQB 1BBJB 5IQ9A 3U0PB 5TDPA 2FJGA 1I3GH 1R0AH 4WV1B 5FGBC 2ARJB 1JZ2A 5C0JB 1W0VA 1IC4L 1I7TB 3QEGH 5GZOD 1MAML 4ZS7H 5FYLH 5JOEA 4KJPC 3S4SA 4XP6H 1HXMB 2XFXA 4RGND 4ELMA 5FO8A 2XPGB 1B0WA 4ZUVA 5HDBF 4U1HB 3DV4B 2ICWB 3E6HB 2EDTA 4XMPL 2R1WA 3QNYA 5JQ6H 3CX5K 3QXVA 3T0EA 4X0KB 4OKDA 3S37H 2CKNA 2DQFA 3BYYA 1N6VA 1JF5A 3JSSA 4UDUA 2V5MA 1K3IA 5BQ7A 5C0IA 2ZSVA 1HSAB 2MTPA 5DRZB 4GAYB 4NYLA 1E4KA 4GKNB 5H37H 4JPKL 3VGBA 4PJ5E 3SJVB 3VXMB 2BNUA 1FYTE 5FGCE 4Z7NE 3SDXF 2JB6B 4WU7A 3ZDXF 3HB3D 2PXYB 3QR2A 4PBVC 4LHUG 3SGJA 1F3RB 3V6OA 3CVHL 1L7IH 3VXQA 3P0YL 1W72A 4K94L 3ZT6A 1P4IH 5H2BB 1DQJA 1A6ZA 4WI9A 5I1LA 1FVDB 2AJXH 1MRDL 5T1LB 3IVKA 2DQGL 4YHKH 3K81A 3QPQD 3U6RB 3FQTA 3GHEH 3KNBA 1A47A 3MR9B 1GGTA 2W65B 3FQUA 5DVMA 4Y4FB 4NNYB 5KW9L 4X98B 1ZVSA 4YPGA 1LP9E 4Z7OE 2NY2D 5IG7A 1M6OB 2DLTA 4D9RE 4KXZH 3DX9B 1V8HA 5HVHC 1HYSD 3QIUC 4ZAKB 2IQAB 4PG9A 1U91B 2A1WH 3HR5A 3FOMB 1S8DA 3WV0A 4R97B 2VXQL 5F96L 2X1XR 5HTSA 4PJEB 4FFVD 5ICXA 4XWOD 4QRPA 3PWLB 5JOPE 1FYHB 1RPQA 5F21B 3B83A 5ADOH 1CVRA 3JWOH 4YHMH 3V0VB 4HPYH 1U8QA 3JTSB 4MNQB 1H5BC 5B38G 1OSZB 5BZWA 1DUZA 3FCTB 4KU1A 4X6CE 1JWSA 3AM8A 3Q6FA 5ERWB 5FAAA 4NPYA 4GAFB 4BQ6A 2DL9A 2QSCL 4YBLB 3GMNA 2Y7QA 1BBDH 4LKCB 1NDGB 4W81A 4AL8L 4XPAH 2VDPL 3SGKC 1OAYH 3M8OH 1BD2D 2IF7A 4QRUB 5DO2C 4JFYA 3UC0H 3O4LD 1NC4A 4D94A 3SN6N 4EDXB 2WINB 1X5YA 3H2WA 2JB5L 3LVEA 2NY4B 5DLMH 3EO1B 4L4VD 4I3GA 1EHXA 3BP5A 3ZYIA 4OFYA 5FYKE 4XNXH 1UYWL 2FSEB 4X6EA 4Z5RB 1MWAH 5MENB 4WTZG 4FXKA 3WNPA 2WIIB 5CIPH 2APVA 3BZDA 1EZVX 2VLRB 4K55A 2DQEH 2F54D 4HEPG 1TNNA 3S34L 3W2DH 2AK4A 2X42A 3WHXA 5IMLB 1X9QA 4C4KO 5JHDD 2DLIA 1A4JA 1F4XL 3DMMB 1D5IL 2HFGL 1YMHA 4HWZA 4JFDE 3SDXA 4BZ1H 2FEDD 3CSPA 4DVRH 1S7QB 5CZVL 2GK0B 4ZUSB 3VCLA 1P4LA 3VFVB 3RWCB 2ADJB 5B22A 4D9LH 3GZKA 1T1YA 4PS4L 3K0WA 3HS0B 4KVCL 4B5EA 3C6LB 4G3YL 5DJYB 5KZCB 3PQYD 3TZVC 3B8SA 3GJFH 2EECA 3MA7A 5CD3B 1AY1H 3BW9B 5D6DA 3VXUB 4YJZL 2FX7L 3RZCD 2CK2A 5B21A 1J1PH 1EVTC 1BJ1H 4LNRB 5DMJB 3FN3A 4JRXB 1JPFB 3C9NA 4RIRB 3FQWB 2WZPD 2CO6B 4JKMA 3RDTD 5DDHB 3P3YA 2A9MH 2V2TA 1NBZB 2AJ3A 15C8L 2WWMC 1QBMH 3IDYB 1NMBL 4P5TC 1AGEA 2XWBB 1DBAH 1I85A 3GSUB 4AEEA 1BFOA 1XF4A 1MI5D 4KQ4H 2E9JA 4JLRB 1QNZL 2EZ0D 5CMAB 3ULUD 3KJ4B 4I48B 1VFOA 4HIXH 4XP5L 1S9KC 2B4CL 2CKBH 1IKNA 4BQCA 2W60B 5M7QA 4LEOA 1I7UB 4TNWF 5HD8D 1W0WB 1ULVA 1T5WA 1CL7I 4GG6F 4ESKA 1WFOA 2WAHA 3KPNA 5TPWL 4PJ7B 1MELA 2D2OA 2PR4L 4KRMB 4M3KB 1EEYB 3K2UH 4YO0A 1BP3B 5KS9E 5IBLC 3UTTA 2H32H 4GRLC 3SQBA 1XF3B 1SJVA 1YEEH 2NQCA 5IEHA 3CMOL 2Z35B 4XC1H 3AS3A 5EO0A 1ZS8A 1U36A 1WAAF 5T1KD 3BYTA 4U1MB 1EERB 4KGJA 4G8FB 1WTLA 5EORL 5FM5O 1VADB 2HTLD 3D9AH 3ZTNH 5F7KC 5F1NA 1HQRB 2VWEE 2CR3A 3HE7C 3R8BB 4Y4KC 3HZKB 5C07B 3GGWB 1PG7X 3RVXD 3BN3B 1PZ5A 3T8XA 1UC6A 3MLTA 1NAKL 1DBML 1SBSL 1MCPL 4P3CL 4EN3A 3IS1X 4QHMB 4JHWL 3UDWA 1X6LA 2CJUL 2DYPA 1DBBL 2LFGA 1H15A 4JO4L 4NJAH 1P1ZA 1RIUL 4O2EB 4TVSa 3ZTJH 4S0TD 4K07A 5C9KA 1WLHA 4NQEE 5IV2A 2X5PA 5GIRB 3LSOA 3QWRA 4PY7A 5HDQL 1A64A 3MRDA 1Q9LB 1YMMA 2WBKA 4L1DA 3WNMA 2A6IA 2P5WD 3NA4A 2R1XB 3ECBB 1XZ0A 4PRBB 1I3VA 4FMFA 4X5WB 2HA1A 3KYMA 1DLHA 4O5LL 2HT4D 2A74A 1E28B 2B1AL 1TNMA 2NTFB 3SJVD 3T08A 2R69H 3PUCA 3VXMD 5DUPH 4EUPG 1UWXH 4KKNA 4LLAA 4U6VL 5JXAH 4MCYB 2XOTA 2PXYD 1E4WH 2Q8AL 3OX8A 3FT2B 4H5SB 4RX4D 5IFJB 5A1AA 1GGUA 5B4MD 2H9GB 1LO3H 2NNAA 1D5BA 3VFTB 1I8IB 5T1LD 4H26A 4JM2C 4P0DA 2HTKC 3SY0B 2Z93A 4WI7A 1OGAA 2ARJQ 1DR9A 3QUMH 4X6DF 3T65A 1K9TA 5DRWB 1SBBA 3KXFB 4POUB 5IK3B 2W38A 2YOCA 3F7QA 4FFWD 1JNHA 4ONFL 5ANME 4DK3A 6FABL 4GG6A 4L8DA 3BP6A 3HMXL 5IR1A 3QBTB 4PRNA 3RVVD 1B3JA 3NTCL 4JY5H 1D3CA 1BIIA 3VH8B 1TQCB 2R23B 1LO4H 5E56A 4QT5A 4KK5C 4UILH 5CJQH 2BVUA 5AYUH 1UXSB 4KK6D 1F6AA 1WAAA 4XXDB 2Q6WA 1OLLA 2P8PA 3C5SB 4QRTA 4MNQD 2OJEB 5D1ZC 1QFPA 2EDHA 1W72H 2FATH 2R2HA 2Y07H 3MLVH 4HUKB 4YDVB 5E99H 1F6LL 3QHTC 4ODWB 2R0ZL 5C1MB 1CFVH 3SQOL 2R9HD 1N4XL 4P3WA 1R24B 3WBDA 1F4WH 3VXTB 3VFNB 4X6FA 4RZCA 3KWWB 4OD3L 1Q1JH 1WEJL 1IGTA 4K7FA 3CJJA 4BKLB 3LIZL 1MHCB 2EDKA 4NCDA 1FZOA 4MJ6B 4FXLA 1NCUA 2H1PH 2APTA 2XN9B 4G9DA 4MNGE 1FL3B 4C56E 3NCCB 5K9KB 3KYKH 4KPHL 5IVXE 3ORJA 5I1GH 5GRUL 2NY4D 2XKNB 5IBUG 3QUZA 5L8LB 3V5DA 4TOYH 1LHZA 1CICA 1VDGA 3ZHDA 2VH5L 3VDAA 1UJ3C 3GHBH 3Q5YA 3DOSA 2JIXA 3AXLA 5D7JC 5HHXH 1SEQL 2YKLL 4GXVL 5LCVH 4CVZA 1G7IB 1WFTA 3QWOB 4Z7OF 1F8TL 2JJUA 4NZJA 3RGVC 5IEKB 1U41A 1TITA 2HJKA 1DFBL 1HHJA 1UZ6F 5ICYA 3IU3B 3ARSA 1WUNT 1AHWA 5HHOA 3QCTL 1LE5A 1HHKB 3KYNA 2CGRL 3UBXI 2NZIA 4XHJC 3DMMD 5I66B 5CBEB 3FB7A 3AB0B 3ZYZA 1YYLH 1BF8A 4TUJA 3LRGA 5C0DA 3HAEG 1CGSL 2P5ED 1CGYA 1NGZA 2OZ4L 5AEAA 3UZVB 2VUYA 4X5XB 2OS7A 1YZZA 4CDHA 4GW4A 2E8YA 5KSVB 1MIEL 3C6LD 1JGDA 1YYMH 5E7FA 3VJ6B 4EI6A 5KZCD 4NBZB 1JV5B 1P84K 4RRPG 4UTBH 1UH3A 1MFBL 3PGDB 3VXUD 4OCYH 1NL0H 1N59A 1PKQE 3QHZL 2FX8H 4WEBL 5GS0H 4M5ZL 3O6KH 2HFTA 2DWEB 4H8WL 2RJMA 3E8UH 4FFZL 4JDZA 4OD1L 1KGCE 1D6EB 4FFYH 1JPTH 2P47B 5CCKL 3SDCC 1BREA 3PG2A 1KTDB 5E03A 1A6AB 4RNRB 1LDSA 3WEXB 4ZFFB 1QYGH 1XGQB 2XTJC 3N9GH 1D5ZB 3IFOB 2XZZA 4RAUB 3L3OA 2PTTB 2ZCLL 5C7XL 4MJIE 5J57B 3UJJL 3CDGA 3U46B 1CD0A 2L7JA 3T1FA 4M4PA 1BQHB 1IGMH 5BS0E 2G75A 3G5XA 3SDYH 4QCIB 3D3VD 4WDIB 2LAAA 4OGYL 1EXUB 1JYXA 4QGTA 1JGLH 5AZEL 4X9GA 5B39A 4KXZI 3GRWL 5A2KH 5L6YH 2Y5TB 4N5EC 3B9EA 1QSFB 5FV1L 1SYVA 1ZE3C 1AXSB 2NX5E 1T4KB 2HKFL 5D7IE 1NMCB 4XNMB 4KMLB 3QO1A 4XXCC 1JPSL 4B7IA 4F8TA 1J9CT 2O5YL 5DJ2B 1ACYL 2WIMA 1FYTA 3AROA 3V5HA 1CLOH 4UINL 4UQ3A 5H35A 5EU4A 3MLYL 3IT8D 1RZJH 2D03L 1JYWA 2H2SD 3GMMA 3FHAA 4HXAH 4NQXB 1MQKL 3U4EB 1KPUA 4CW1B 5F3BB 2NY0B 5EIQA 3WD5H 4L8BB 1LE9A 3QFDA 3RJDA 5AG9A 3WFHB 4JKLA 4EXPX 5DEGA 3BT2L 4PV9A 1MH5B 3EJZD 2BY3A 5C0GA 1DJSA 2AI0H 2X7LB 1UADC 5C07D 3W39A 1KSRA 5DJ6B 1RK0A 4RMQA 2XNAA 4MQTB 2R4RH 1QR1B 3LEXA 5CAYB 4MD5A 4F15B 4NUJA 1LP9A 3FQNA 1FNHA 3UYRL 3I6LD 4HIIA 5IVZA 1FZKA 1H3XA 1UQSA 4XPFH 4OZGE 5IB2A 1YNTB 3W9DA 8CGTA 3CFDB 3OKOB 1EFXA 1SJEA 4P2OA 7FABL 4PB0L 5HYEA 3ZHKA 3RWEB 4PJDF 2ZG3A 2DI8A 2BVPA 5C0AD 2A9NH 4PTTA 3WO3B 4XPGL 5FYJH 3OPZL 2K7QA 3CFKB 2YPLE 3SKNA 3ULVC 2CLRA 4MX7A 5BO1L 5J13B 4YHZL 3VXSA 2HLAA 3QDMB 3L5WA 2EEDA 3AU1B 3CZJA 2VDLH 4AIXA 1RZKC 1RZ8B 2ZOLB 1YJDH 3LQZB 4NO5B 4NOFA 1R3IH 4YC2C 1NUFA 1AO7B 2ED7A 4RMRA 4X6CA 4JPVL 3G08B 3DI3B 3R06B 4OGZA 5MP6H 4MCZB 3ARZA 3L6FA 5CKGA 4N0YH 4QHLA 4YEEA 3WLBB 1QPXA 2LTQC 2BDNH 5I71C 1AR1C 3QI9D 1SEBB 4IOFC 4DUWA 4CVXA 3EKCA 4G6FB 5A2IH 1PEWA 2Z31A 3MX0A 2YR3A 4WWID 5J0BA 3J8F7 1ZEAH 1FL6A 1ZHBB 4Q0XL 3VRLE 4QEGA 3V0WL 2FB4L 4HWUA 2GCYA 3KXFD 35C8L 3PWPB 3H9SE 4KAQH 4MQSB 5DQDH 5DYOB 3KLHC 1K85A 1V3LA 1NUDA 1Q0YL 2JCCB 4WW2F 2AEIT 4FRWA 5LG1A 4LPXA 1U8OB 3GBNH 2Y6SD 3BSZL 5HGDB 3QIWA 1HOCA 4ZPVA 3OKKB 1XGPB 2GAZA 3SGEH 3O9WB 4G7VH 2OL3B 3WE6B 1T7VA 5T3XL 3V5KA 5C6TL 2AQ1A 4NO3A 4Q9QH 5E2VH 1NCTA 1QLEH 2XACC 1NAML 4NP4H 4HT1H 2J4WL 5LWYH 2NY7H 1MRFH 1DZBA 3VRJB 1L4IA 1LWRA 2VQTA 4LU5H 5A3IC 3UBXB 2NMSA 3UTPD 4F37F 3VFPB 5HGAB 4WY7L 1UWXK 1I9JL 3GKWH 1UH2A 3OJMB 2QQNH 4GW1B 1MVUB 4O02H 3WIFB 3VGAB 1GGCL 3VWJB 4Y5XC 3P9MB 1MQ8A 1IQDB 1J87A 2V2WA 4HQQL 1TTFA 4G42B 1WISA 2PW1A 4JHZA 3CSYB 2UWEE 4BUHA 3TJHD 3CGTA 3TYGL 1IQWH 3LRSA 3L3GA 4XPBL 4PJGF 1IZKA 4JDVB 4FQIH 3P9LA 4KK8D 4OTXL 4MXWL 4PGJA 3QAZC 3OSKA 1JBJA 3O45A 3VMNA 3EHBD 4Q6IC 2O5XL 4IMKC 3M1BB 4QWWD 1NUNB 1KJVB 1BVZA 3NCBB 2VZ1A 1MAJA 5HHVL 1ZK9A 5E2UH 4WO4B 5GGVL 3UTSE 3MRPA 1BFVH 4RAHA 3DUUB 3D85B 1KNOA 3MLZH 3GMPB 3EZ8A 1MIMH 5GZOC 1G7MA 3EGSB 4NQVB 4L3CB 5ALBL 3TN0B 3BH9A 4PTUA 2YD2A 4P4RA 2Q76A 5TJWK 4DCQB 5HYSB 4RGNC 2XXCB 1S9WA 2BY2A 1JNLH 5D7LE 1I7RA 4R7NA 4LF3B 3SE8H 3TWCH 4L4TB 1XF5A 2C5DC 3G6DL 4U6XB 3RWGA 5F7WC 4PB9H 3X3GL 3FTGB 3MLUH 5BVJA 5E2WH 5IESL 1ETZB 4LGSB 2E7CA 2VN7A 4L29A 4MWFA 5SWQA 4BQBA 3QNXA 4ZSOA 2W0KA 4OFKA 1ACZA 2WLZA 3AREB 4U0QB 4RFNB 5DJAB 2W1NA 4XCFL 5TDNA 1JGUH 1HH6A 4MAYA 5F6IB 5FM8A 1KG0A 3QJHA 4YXKH 4R90L 5FECB 4HK0B 5CGTA 1YEDA 3MUGB 2X4UB 4WW2A 4NWUH 4H20L 4PRHE 3HB3C 3MV8E 4JFHE 4QHKJ 2YPKB 3P30L 1QZ1A 4M7ZC 3TPUA 3VG0L 4RBPK 2N56A 4KMTH 3E6FA 4J3VA 1FRGH 5A16B 2EKJA 2VLKE 3O6MH 4L9LB 4HC1L 1NGYB 4NQEA 4JN1H 1QFWL 1AP2B 4ZTOL 5GS1B 3QPQC 4OI7A 3S35X 32C2A 3TIDB 1U95A 2FR4A 4ZDHA 1KENH 5HYQB 2A2QT 1X5FA 2PW2B 4R2GC 2NY2C 1QSFD 4YGVB 3PDGA 3D39B 1AGBB 3BKYH 1A6TB 1II4E 5DD5L 3PL6B 1MWAB 3BO8A 5GGRB 5ABDE 1G1YA 1IAIM 3PWUB 5F7LB 5CIPB 4R26H 3CDYA 1XIWB 3JXAA 3QDAA 4H0HB 2AJVL 4PJGA 4XWOC 2VLJB 1FNFA 3SDAA 5ID0A 1D5MA 2DM7A 3BIBX 5FO9A 4V2CB 1KTKE 3MA9H 5DFWH 4Q2ZA 1U6AL 1CD8A 5E8EB 4Y7MA 3ESVF 5J89A 1YEFL 4XMKH 2GYSA 3Q2CA 4FQJL 4KZEH 1RK1A 5IB1A 2XA8H 4KDWA 3VXRB 4DN4L 2IQ9H 1E27B 1DEEA 1S7SB 1XF1A 3MROB 3BPCB 3GNML 4LASL 1T0NB 4GAGL 4OGXH 1B88A 2ZCHL 5IGXL 2UYLB 3D2UA 5FA4A 3GJFB 4RQQB 1UM5L 4QXGL 4NZRL 4N8VG 4OCXL 5MI0C 4Q9RL 4W6WB 3IGAB 1ZLSH 5JMRA 1I8KA 1NGXB 2CDEA 1LK2B 3C2AH 5EA0L 4PJCE 1MRCL 2B2XH 3F58H 3OAZH 3GK8L 4HIHB 1BEYL 4OZIF 1CK0H 1H8SA 4N0UE 4ZO7A 1T89C 5J12B 2FH6A 4BH7B 4Z0XB 5ID1A 2V17H 3GUTA 2ZJSH 5BRZD 2WUBH 5IWLA 5DEZA 4LLDB 1YEHH 3FO1A 2ORBL 4ZUTA 4QHNB 1MREL 1JGVH 1QO3A 4U33A 4PGCB 2AQ2A 3Q1SH 1AO7D 2VR9A 5FOBA 2CKBB 3UPCA 3ARXA 2R39A 3I3EA 4ONHB 1QSVA 4M6OH 4AG4H 4KKCD 4TUOA 2XI9A 3S5LB 1X5IA 2I24N 2LAGB 1XCTA 3QDJD 1CTNA 3TO2A 2C3VA 5SWZB 3OAYK 5J4MA 1KIRB 2AP2A 3MRQB 4YQXH 5EZJA 2H32B 4PLJD 4WW1B 3KGRA 4MNGA 4G6FD 3VFSB 2HVJA 4I2XB 3VFUB 1C16A 4C56A 4HS3A 5IVXA 1OD9A 4NC0B 3D69B 4QY8B 4DZBB 4JRYD 5KSUA 4ZOCA 1KCVL 4E5XB 2DQHL 4J8RA 2IAMA 1X4ZA 3DVFA 4OCMC 1EJ6A 3NN8B 3PDOA 4OM1H 3U7YL 3KJ6L 1WVZA 1L6ZA 4POZC 1UWEH 1DLFH 3H42L 4LVOC 1JL8A 4R96B 3FO0H 3T0DA 4XNUH 2PCPB 3U4BL 1ODAA 4IMLA 5I1EH 4K9EH 3DXAB 5ACZA 5I1AA 3MLWL 1KTLB 2B5IB 5FYLD 1BZ9A 3O41B 3CXHK 1G0YR 5DR5H 3GIZL 1TZHB 2WLYA 1VCAA 5HXMA 2FHBA 1U3ZA 1RUQL 2EZ0C 4XBPB 2D7QA 4UI2A 3ULUC 3ZKMD 2UVFA 1HILB 5IJKA 1BLNA 5D1QA 5KTEL 5FGRA 5I1HH 2OJZH 3ULVL 5HD8C 5L7XL 4QXTB 1YN6A 1C1EH 3GJEA 1OF2A 2PYFA 4PJBB 5HHMD 2DM2A 3MGTB 1L7TL 4Q97A 1VENA 1EV2E 1A9BB 2FZ3B 4D9QE 1GSMA 5J6HB 2HRLA 5AZ2H 1TCRA 3BFOA 4TVPL 3L5XL 5IQ9B 5TDPB 2VXUH 2FJGB 4OFVA 4OF8A 4IIQA 5JIIA 3ARVA 2B0SH 1Q72L 2HVKA 3HI1A 5JLZB 1OCWL 3TT3L 1RJLB 4AEHH 5L8KB 5F9AC 2HTLC 1L0XA 4MJIA 4OZIA 2X89D 2APFA 5ALCL 3C5JA 4GRWF 1YEGH 4WUUE 4ZD3H 3BMVA 1EJOH 1RZIB 2GTWA 3D85D 3ES6A 3VRLF 2XFXB 5T5FH 3LKNA 4ELMB 2IADA 4J3XA 5FO8B 4XCNA 2YS4A 3QA3A 1R5VB 1EGJL 3RVXC 5I8OH 3TN0D 3OAUH 4LCYA 2IALB 4XAKE 3H3PH 3T3MF 1FAIH 2R1WB 4OJFL 3QNYB 3QUMB 2YRZA 2PYEE 1RURH 2FO4A 4J6RH 3H7BA 1P4BH 5D7IA 3T0EB 3UPAA 2EE9A 1J12A 3MRKB 2DQFB 3G5ZA 3NZ8A 4NO0A 3UX9B 4I4WA 1T83A 3D25A 4UU9A 3QULB 4WVRA 5C0IB 5BQ7B 2BHYA 2ZSVB 1AI1H 4M8QA 5GSRB 4NYLB 4L4TD 1FCCA 5CBAB 2DM4A 5DK0A 5DWUH 2CLZA 1UCTA 3IRZA 1E6JL 5D7SH 2BNUB 2GSIA 2W9DH 5E6ID 1SJXA 2AJSL 1F4HA 3SGDI 1G1CA 1OM3H 4I3RH 4LVHB 4TNWK 1RVFH 1AKJB 3ARDD 3WS6C 3ARED 3CAFA 3VXQB 1FBIH 3P4MA 1HWGB 2E27H 1LD9B 4KTDH 1HEZA 5F70A 3O6FA 5MHSE 4Y8DC 2JTDA 1A6ZB 3RTQA 4FABL 1F00I 2DLFL 3HI6L 4GXUM 1AXIB 3V2AR 5C86A 3FQTB 1T1ZA 3KNBB 5DQ9A 1IL1A 4HWNA 2VXTL 1ZVSB 3K1KC 3G5VA 2VDNL 3EDEA 3TVMD 4FS0A 2IEPA 5H94A 3WXVH 4LHUA 4EOWH 1RU9L 2ITCA 2E7HA 9CGTA 4PG9B 4FOMA 1CU4L 2WP3O 3HR5B 3C2SA 1G6RB 1S8DB 4FQXA 2YPLA 5BMFL 4DQOL 3D39D 3SE4A 1N5AA 2X1OA 3C09C 4QRPB 4N0RA 3PL6D 4OI9A 5IKCA 4Y5YC 4PJXE 5E8OA 4FFWC 2YD5A 5TFSL 4X80L 2P48B 1F02I 4MB4A 3HPLA 5I76B 1FG2B 3RVVC 2DQTL 4BQ8A 1XIWD 4UV7H 4U1IA 3QPXL 4P23A 1U8QB 4HBCH 2E7LC 2VLJD 5F7EL 1P7KB 2AJYL 4M93C 3AMKA 5BZWB 3QG6A 4KC3B 5EUOF 1JP5A 4NUGH 3HE6A 1JWSB 1I1AA 3Q6FB 4BFEA 4KK6C 3HCVA 4NPYB 1DDHB 3O6LH 3S9DB 2FHFA 3MZGB 5D5ME 5DUMH 4URTB 5F3HB 4AEIL 1A7PL 3UPRB 1JN6A 3GMNB 2Y7QB 4WFHD 2P49B 1FPTL 3PJSA 3BZ4A 2R9HC 1NPUA 3PNWB 2VLME 3NIGE 3OXSA 1T5XB 2F9BT 4PRPA 4MSWB 5TF1H 3ARFB 5BZDA 4LAQH 3BIKA 3RX8A 4KK9D 1H0DB 4FNLL 2BOCB 4MGXA 1AIFA 5B38A 5EWIL 3OF6A 2H2PD 3FHQA 1AQKH 2NYYD 3BP5B 4HH9A 1FDLH 4P49A 5GJTH 3X11A 2JELH 4X7DC 5CINH 5HYFA 1T21A 5IJVA 1NEZB 3KPQB 3QFJA 4QTHA 4FXKB 1IC5L 3DX7A 4PRIB 2VL4A 2YSSA 4U7KA 3IXAA 3W9EA 5JR1H 3GSNA 5IROA 2A77H 2AK4B 3TBSB 3WHXB 3JV6A 3ZKXC 1BWMA 4HKBA 4PJHB 3UAJC 3DARA 2QADB 1D9KD 1A4JB 4HWZB 1YMHB 1RZFH 3SDXB 1HH9A 2YPVL 3BHBA 2F53A 1BVKA 3RWDA 3VCLB 1P4LB 1FG9C 4HGMA 5GHWL 4YXHH 4XVSH 5IT2H 1I9IL 4JQIH 3BIAX 5SWZD 4OB5H 3DMMC 2OBGA 1S9XA 4WTZA 5C09E 1U92A 3EYSH 4RFEA 2YRPA 3R4DA 3IFLL 4F57L 3U4AA 3I50L 5EZIH 5INCA 3MA7B 1NCBL 3W0WA 1AJ7L 5ESVB 1VPOL 3L3IA 5F8QC 1QEWA 4YHLH 5GQBA 2D4DA 5EOQL 4UT9H 4LVNB 1VFAB 4L3AA 5F6HI 1V7MH 2QQKL 4V2BA 3V9FA 3C9NB 4L3EE 5TE6H 4TNVF 2DQJH 3UTSA 1A1OA 2AJ3B 3H9HA 1E4XH 2P7TA 4P2RE 3MBXH 5FYJU 2BFVH 2AEWA 3DYOA 1VB9A 1F4YH 1VGEL 2GJZA 4NQSB 3DXAD 4LLMA 4PV8A 1NC2A 3HUJE 4W6YB 2NY5C 3IDYC 1DCLA 1BZQK 2CDFA 1CIUA 4LEOB 4P5MA 5D1XD 3QCUL 5LXGH 1RJCA 3DVGB 5FHAL 1S7VA 4NHUA 1QLFA 4XAWH 4G8GD 1N6QL 4GSDL 3WUWA 3IDIA 3KPNB 4ENED 5E00A 2R56H 4YO0B 1PSKH 1TJGH 2GFBA 5IB5A 4JGUA 1N3NA 3UTTB 5KVGH 3CD4A 1OSPH 3U9PH 1JPGA 2KL6A 4JJHA 4PGDA 5IEHB 2ADGA 4CU6A 4W4OA 1ZS8B 1F13A 1FQ9C 4Q74A 4JFZH 4MXQD 2FECL 4S1SH 4BFIA 3RVUD 5J9PA 1NCWH 2VOTA 5DJXB 5F1NB 4HUMB 4PBXA 2SEBA 1R5IA 2DQUL 4U1SA 1GPOL 1K4CA 4OLWL 2H2SC 2O93L 5ESAA 1CGTA 4N8PA 2IPUG 3LD8C 4E9LA 1PZ5B 4W6XB 5GRYA 5I15L 4QNPF 3I84A 3VXOA 3MLTB 4P59L 2QHRH 1OQOA 3GB7B 4MA1B 1P69B 3ZDZE 4MA7H 4EN3B 2VLKA 4NZTL 4NKOA 3EJZC 2L4OA 4LEXH 4H1LG 2GSGA 1OARH 1IGYA 4WHYH 1YNLL 2DYPB 1FFQA 3QNZA 4X5LA 5IUSA 5IV2B 4PY7B 3LQAH 1YMMB 3VD7A 4NBYB 2F8OA 4DK6A 4L5FL 2A6IB 3T0ED 2HWZH 4LIQL 3TYFB 1KACB 1VFBA 2VC2H 2DS4A 3KYMB 1P9MA 4YHOL 1JHKL 3MRCB 2A74B 1X7QA 1ZANH 1H3PL 1T0PB 2ZKHH 3ULUL 1JCKA 3LKSA 4U2ZA 4Y4HA 1XF2B 4LCWA 4HCRL 5EN2A 4G5ZH 2Q7YB 3OX8B 1GXEA 5LGHH 3BH8A 2CK0H 1CR9H 1KEGL 3RNQB 2VQUA 3IF1A 4GKSA 2NR6D 5DD0L 1X5GA 3GSQA 4P46C 2BY1A 4ZFOA 4F7CB 1X44A 1V7NH 5L2KE 2NNAB 4UNTA 1D5BB 3EYOA 4NKQB 1FORH 2VKXA 1G7LA 4PJIE 3O2VH 1WV7T 2Z93B 2ZUSA 4HWEL 1NGQL 1GIGH 4D0DB 4PLNC 1N26A 3Q6GH 1T2QH 3QI9C 4IRJC 3IDJA 1DL7H 5CSBA 3T65B 3VW3H 4YH6A 1RUPL 1DN0A 3BAEL 1HZHH 1PQZA 1R3HA 1TETL 3DNKA 5IOPA 4KHTH 3WNKA 2BVEA 3HFMH 4MDIB 1JNHB 4GG6B 3BP6B 4G8EA 4OM0L 1OT2A 4PP2A 1T20B 2IFFH 4J3TA 4WTWA 5C3TA 5IR1B 4PRNB 2NXYB 4S10A 5IFAL 3HKFA 1QFUL 4QRPD 1BIIB 1RY7B 4WFGE 4ZNEA 5F44A 4X4ME 3RHWF 4AQOA 3S88H 5L2JA 2P8PB 1HQ4A 5JXEA 1YPZB 1LILA 2R2HB 5I74C 4DKAA 3QDHA 3N1FC 3SO3B 4NNPH 1JRHL 1RIVH 4IOSD 4JG1H 2ZPKL 3MBEC 1TJHL 1MAKA 4X6FB 4RZCB 5B8CC 1IGTB 2VAJA 4K7FB 5C0BB 4Z7WE 2G9HA 4NFCA 3CUPA 3O3UN 3N06B 5F9WB 2HJFA 1PG7H 4G9DB 5DI8B 1L0YA 2P8LA 4M43L 4DZ8A 5IMOB 1NC4D 2OI9C 1G7JA 5GS0D 2DQDH 3TJHC 3K2MC 1GHFH 1MOEA 4M6AA 3MOQA 1XGRA 2MNUA 4OFYD 1U8PA 4WCYL 4LCCA 5D2NC 2EDWA 4KK8C 2JIXB 3AXLB 4HKXA 3RP1A 4JCLA 5GISL 3EHBC 1QD0A 5IFHL 3NIDE 4QWWC 2M8XA 2LVCA 3BP7A 4XNQB 2HJKB 1RUAH 4I9WD 1FIGL 2ZUQC 2AK4D 3I6GB 4KY1H 4F7PA 1AHWB 2X05A 5HHOB 1UACL 3LQMA 2QADD 5F8RC 1FH5H 4YXLH 4QRRA 4XC3L 3FB7B 4UDTA 3X17A 5C0FA 4TUJB 5C0DB 3BI9X 4OT1H 4FQ1H 2NXZB 1NGZB 4YHIA 3P4NA 4YIQA 3BRFA 3ZYOA 3MLPA 3F7PC 2BNQB 3I9GH 2YA2A 5E8DL 4GW4B 4U6HA 4NM8H 5CP7B 3MRGB 4EI6B 2AV1B 1T22A 1S7TA 2C1OA 5B3JE 1ZLVK 3CC5A 3SPVA 1OPGL 4JFEE 4AJ0A 3KLSA 1MFDL 1U3HA 3UTQA 4PJEF 4JB9L 3RY4A 4JDZB 3MRMA 2XWTA 4F37K 4KHXH 5DT1L 2CD0A 5D5MF 4NJ9H 1DVFB 2DJUA 4JFFA 1KCSH 4Z0BL 3DROA 5F9OL 3ZKQD 1OVZA 3GBML 1FGNL 3ZL4L 3F8UB 3KPRE 4QRQA 1JNJA 1GZPA 3U83A 3L3OB 2XTJE 1HIMH 2NPLX 1MNUL 4WV1A 1Y6NR 2ARJA 4JPKH 4ZUUB 3T1FB 1X5XA 5C0JA 1EEUA 3HG1E 3G5XB 2PYEA 2ZUXA 4S2SA 3T3PE 4F7TB 4HUUB 2Y72A 5C0ND 5B39B 2VDKL 1V3MA 1TVBA 1HXMA 4TTDD 4K94H 1SYVB 1A9EA 3UTTD 2A73A 3OGCB 1G6VK 5F1IA 1HWHB 3VGGA 4RWHA 4PJ5B 3C08H 5EBLA 5FYJD 2LU3A 3B43A 5EPMA 4ALAH 3DV4A 2ICWA 1FYTB 2X10A 2EH7H 4LPVA 5FGCB 3OG6B 4KZDH 4FZEL 5EU4B 1KBGH 3DIFB 1AXTL 1G9NC 3SE3A 3GMMB 5IP4A 1NMAH 2VERN 3WIHL 1MF2L 1P6FA 4FQHA 3MCLL 1S5IL 1HSAA 2VTFA 4A6YB 4YDLB 3QFDB 4GAYA 5DEGB 2C7UA 1NBVL 2XT1B 4GKNA 4OQTL 1WWBX 1U8HB 3EOTH 2QR0A 4NSKB 1SY6L 4X8XA 4ZXBC 3OKLA 2VXQH 1AD9B 1J5OL 1RK0B 3U36A 3QRGH 1FE8L 2XNAB 3SKJH 1OAZH 3LEXB 4MD5B 4TUKH 1YEKL 3DSFL 1LP9B 4EN3D 3RY6A 4HIIB 4XHQA 5IVZB 2YK1L 1FZKB 1NCAH 2DLGA 4GKZB 4LLWB 2DYPD 3NA9H 4XBGA 5I30H 4DKFL 5H2BA 1EFXB 3TPKA 4NKDA 1FVDA 4P2OB 3QWRD 4LSVH 12E8H 4MA8H 1YMMD 1Q9WB 2DQCH 4FP8L 1IAKB 2BVPB 4O58L 3U6RA 3DO3A 4PTTB 3FRUA 3MR9A 5I1DB 2W65A 4M9PA 4I18C 4NNYA 2CUMA 1K8DA 3NCJL 4UB0L 5DFTA 4QOKE 1M6OA 2FIKB 4WFFD 3SKNB 2OMNA 2FL5A 2MQ0A 3SO5A 4MX7B 4LSTH 2AV7B 3DX9A 4NQTA 1NSNH 1U8IB 2W0LA 3ULVE 4ZAKA 2HLAB 2IQAA 2VDPH 3L5WB 3RRQA 4DOHE 3IKCB 5KSBE 4XH2A 1U91A 2QQLH 5I8CB 2OTUA 1MJ7H 1MCHA 3FOMA 3SBWC 4X6CB 4C58B 5J13C 1N64H 4QKXB 1HKLL 4CAGA 3BKCL 3PWLA 4OV6F 3L6FB 1I8MA 2BP3A 5D5MA 3SDDA 5HYIA 1KOAA 4Z77A 2IGFL 2YN3A 4HK3J 3BKJL 3RL2A 4DVBA 4LBEA 3CK0L 3RNKB 3BGMA 4KKCC 3SGKA 4RISL 4PJ7F 3HNVH 2Z31B 5FUOH 2E6JA 1OGAD 3LHPL 1U0QA 3CVIL 1X3DA 4ZODA 5ERWA 4LPWA 3FN0L 3T0VA 1CVSC 2ZUVA 5CZXD 4IOIA 2GCYB 4NQDE 4PLJC 1I3UA 2HFGH 1NGPL 2DIJA 1NDGA 5FK9A 1U58B 2Q3ZA 3UJIH 4YFEA 3L7EB 3BJ91 2AK1L 3DECA 1HOCB 4ZPVB 2NXYD 1K4DB 1P5VA 4PS4H 1MCCA 4JPWL 3D0LB 1MSPA 1E4XI 3V5KB 4NO3B 1PAMA 3FOLA 2N7BA 4C55A 5M94B 4K7PH 2HMID 1H9VA 1CDJA 5J11B 4JFDB 4HGWA 5C2BH 5MENA 2WUCL 4N68A 1B0GA 2EH8H 2NY1B 2VLRA 5FV2A 1JYNA 2BX5A 2XQBL 5DMYA 3OJDA 5C09A 3RAJH 4KUZL 4M3JA 1J8HE 4E0RA 2PW1B 1C08A 3TZVA 1CLYL 3WKMH 5T3ZL 3L3GB 3RX5A 5J1SC 4NGHH 3A6BL 3JWDH 4BZ2H 4ONGH 1EFQA 1NGWA 1T7YA 5HYJE 4PREB 3QUZD 3HS0A 1XH3A 1HHIA 1CICD 2XY1A 1K6QL 4P2RA 5DJYA 3TA3C 4HJ0C 2PR4H 2JIXD 1TPXC 4P5TA 2ZOKA 4ELKB 3ILPA 3JZ7A 3PABA 5BCAA 2MPAL 2VZSA 4O4YH 3B9VA 3MRPB 5E4IA 3EOYG 3HUJA 1IJ9A 3S3PA 1KNOB 4GQ9H 3C8HA 3DBXA 1KULA 4JRXA 3NCFB 5IHUL 2VXVH 5LGJB 3O4OB 3GI8L 4YX2H 5HHOD 1S7UA 2MWCA 2J88L 3BH9B 4PTUB 4P4RB 1NBZA 5EORH 2EE2A 1ZT1A 1KJMB 2PUQT 3TIEA 1MHPL 2ZZUT 3HZMB 3RGHA 3A6OA 4JZJA 3WJLA 5KAQG 3WN5C 4N90D 2BSRA 3DJ9A 2NXZD 4RGNE 1CGXA 4A2MA 3TN0C 4LLQB 3BQUB 4GRLA 4R7NB 2KZWA 2CDGB 5JO5A 3FT4A 3H8NA 1CFSB 1XF5B 5BW7A 3RWGB 3HC0A 1JZ5A 1A0QH 1ZGLP 1CBVH 2MQ3A 4JO1L 3GO1L 5CGMA 5CLTA 2EYRB 4X8JB 5BVJB 1A5FH 4JQVC 4PJ7A 2ARWA 4MWFB 4XVUD 5HHPA 1CXIA 3QNXB 4Z8FL 2FLRT 4OIIL 3U1SL 2YD4A 4AQ1B 1HH6B 4MAYB 1FNGA 1KG0B 1KYOK 3QJHB 4Y4KA 5E6IC 4M7KH 1A7NL 3T0BA 1YEDB 3I2CL 1YUHB 5F7UA 3JWOC 3ARDC 5HHQA 1HXYA 4NFBA 3V52H 3BKML 3T77A 4ZO9A 1HQRA 2B1AH 3IJSB 3B5TA 3EO9L 1CQKA 4NQEB 3HZKA 2RIKA 3GGWA 4Y2DC 4KKBC 1U95B 1U8LB 4LFHD 4ZDHB 2FR4B 4X7FC 5JHLL 1CFNA 5JUEH 3QG7L 4YPJA 5IHBA 3TVMC 1A3RL 3TNNA 4OD2A 1ZHNB 4M7JH 2RFXA 3BO8B 3DRTB 1EEZB 1WC7A 2AGJL 3C5ZB 2J8HA 3T4AA 1FYTD 3GSWB 3QT2A 4O2EA 1MFEL 3CLFH 4ODVH 5GIRA 1FN4B 2I5YL 4NN5B 3KLDA 3NACL 1OAXH 2P46B 3NFNB 1QUNA 2D0HA 5EIVA 5J8OA 4OLUL 4Z95H 5AUMA 3O81A 1UG9A 3SDAB 4Q9CA 2R1XA 3ECBA 3I02A 5ID0B 1D5MB 5FO9B 3HAEH 4XBEH 3S6CA 1CL7L 4K3DL 1F42A 1X5HA 5L2KA 3VI3F 1HDMA 1XIWC 4ONFH 3U2SA 2NTFA 3A67L 4NRYA 1JZ7A 5HI5D 3V8OA 5E5RB 1EHLL 2VDQH 5IB1B 4GT7A 4Y1AE 2CO7B 2CXKA 2HFFA 5GRJL 1I8LA 5I1JL 4Y19E 4XNYL 2VXSL 3FT2A 4H5SA 1LQSR 5CHNA 2OTPA 1BHGA 1KB9J 3O2WL 4AM0B 3D2UB 1PX3A 3WFCH 2KQMA 2H9GA 3DURB 5F71A 1UWGL 1I8KB 3BMWA 2CDEB 5ANMB 2PKDA 1I4FA 1EFXD 1C5DA 5CLWA 3VFTA 4P2OD 2DAVA 5DGQA 3BPOB 1YNKL 4HWBL 1UM4L 5I16A 5HGGS 4IHOA 1BD2E 3INUH 4KK9C 3G04A 3O4LE 2Q8BH 4X4MA 3U0WL 5ID1B 2H2PC 4L4VE 3L5HA 5HI3D 3VXSD 1EIBA 3FO1B 3U9UB 5IK3A 3F7VA 2E3VA 3DHMA 3KS0H 1QLRA 2B39A 1TFHA 1GRWA 3FT3B 4RWYL 5FOBB 4N8VA 1OP3K 3RVTD 2OK0H 3MV9E 2X70B 1A7QL 2F54E 3P73B 4K3JH 4TQEL 4TUOB 3VH8A 4HUVA 3ARGC 2R23A 4QF1A 2LQRA 3TO2B 1D9KC 2C3VB 3QCVH 4Z7WA 2DWDA 1FVEA 1EAPA 4XXDA 1S7RB 4G6KL 3I75A 4NO2A 2OJEA 4XT1C 3ULSA 4P4KA 4MNGB 5E9DE 2HVJB 1PLGL 1UGNA 1C16B 4C56B 2Z31D 3JBG7 5IVXB 5MERB 1J0IA 1F3DJ 1TCMA 3DRQA 5DJ8B 1CLCA 1R24A 4I77H 2V2XA 2IAMB 1I1YA 1SYSA 3VFNA 3PDOB 3BRDA 3IAQA 1NKOA 3ARBB 5T1MA 1MHCA 2D31A 3CU7A 3L7FB 4ZFZA 3VRIA 3QIWD 5I1CH 4LRIA 2XN9A 4DUXA 4YE4L 4OCLC 3STLA 1FL3A 3BDYH 1Q9OB 3ARPA 4FZ8H 3VXNB 1NCCL 2J12B 5I1AB 4I0PB 4NQCD 3MJ9L 4CUCA 1BZ9B 1GOHA 4EEEA 4HF5H 4AMKL 3MOBH 3OTTA 2O61B 2F58H 4Z7VE 3VWKB 2Y25A 4RDQG 4FQLH 1MI5E 3VFWA 3QWOA 1BLNB 2NY1D 1HSBA 5D6CB 5D1QB 3ULUE 1ADQL 4JAMB 1PG7W 5IEKA 5D1XC 4GLRH 4XTRD 5T1DH 3IU3A 4S1DC 1YN6B 5T5NG 3THMH 4RGOL 3GJEB 1OF2B 3GSOA 1HHKA 2BY0A 2PYFB 4KI5E 3S8WA 4OBRA 4GXUN 5EO9A 1FNSH 3OMZA 1PKQB 2D7MA 4JFEA 5I66A 5GRWA 3K74B 4X4XA 4UTAH 1A6VH 5CILH 1TCRB 5CJOL 4APQC 5ITBH 4X5XA 2AS5M 3IDMA 5AYQA 3UJTL 4G6AD 4N8CH 3SDCA 3OKNA 5AZEH 2HVKB 3HI1B 1JV5A 3KPRA 4MXQC 5F88A 3GMRB 5D96B 2R0WH 2HYMA 2W9EL 4MJIB 3ZMRA 2CMRL 2DWEA 5CP3A 2GTWB 2IPUK 2ICCA 5I1IL 5BS0B 1JFQL 2IADB 5HI4D 4F7MA 4FQ2L 1G9MC 3QA3B 2HN7A 2GKIA 3ARTA 4LCYB 1A6AA 1D6VL 1Q94A 1Y0LA 3EDDA 1MQKH 3T2NH 3H3BC 3FRPA 4LSPL 1XGQA 4RAUA 3H7BB 4TNVK 5D7IB 3SE9H 1QA9A 3G5ZB 3NZ8B 4NO0B 1I3GL 1R0AL 3NCEB 2W9LA 1BQHA 4RGMC 4DN3H 1EX0A 4QCIA 4KQ3H 3QEGL 1IC7H 2CLZB 2OP4L 4YDJA 5TGBB 2GSIB 2BSTA 4ZS7L 1EUUA 2P5WE 3NFPA 5FYLL 2HG5A 1QBAA 2Y5TA 2YD3A 3QXTA 3GFUA 1Z0NA 1AXSA 1EZVY 1T4KA 3T1WA 2GTZB 1J0HA 2NY3B 4UOJA 3CX5J 5DJ2A 4MAYD 3CH8A 2IANE 1HEZB 4WU5A 3O6FB 4RAVA 3RTQB 5JQ6L 3SGJC 2GY5A 4P9HH 4JFPB 2HKHH 5EZOH 1IAOA 2X1PA 1T1ZB 1WCQA 2NR6C 2BRQA 3S37L 4CW1A 5F3BA 4OZGB 5DQ9B 1IL1B 4YHZH 4UQ2A 3LEVH 3G5VB 3NPSB 1MH5A 2AXJA 4NQED 5E94B 4X7SH 1NLDL 4JREB 1A7OH 5DD1L 3VD3A 5H94B 1PJ9A 5DHVA 4LHUB 2L0DA 4JPVH 2ITCB 2DF3A 4JO2H 4M02A 5DHYA 3WNOA 5EU3A 3DX6A 1QRNE 1K8IB 2YPLB 2ATKA 4QOKA 1WTGT 4D0BB 1KLFA 1L7IL 3VXPA 5C70A 1N5AB 1BAFL 3EYUH 3CFDA 5E8OB 4DGYL 1P4IL 3VDBA 2DJSA 4DGVH 1T2JA 2AJXL 4U1IB 2DMKA 1H3UA 2EDBA 3Q5OA 4YHKL 4P23B 3GHEL 3SDAD 2D7NA 3CFKA 35C8H 5I2IA 5SX5K 1I1AB 2WV3A 4PJAE 1WIOA 5IB3A 3CFIC 4P48A 1JN6B 5E5UB 3LQZA 1RZ8A 2ZOLA 1MCLA 2VISA 2A1WL 3F6LA 3RUGE 3PJSB 3PHQB 2DMCA 1SHMA 3R06A 3OXSB 1IEHA 3GIVA 3D2UD 5BZDB 4MCZA 5HY9A 4IJ3B 4NQDA 3H9SB 5C0EA 3QDGE 5ADOL 4HHAA 3B6SA 4WY7H 1IILE 4N1HB 5B38B 3JWOL 2DDQH 4HH9B 4YHML 4HPYL 5I18H 1C7TA 1T21B 4IRZH 5ISZE 4NN6C 4BK5A 5GS0C 3B5GA 3DX7B 4OGAD 5MEQA 1ZHBA 4J4PA 2Z92A 3IXAB 3W9EB 4M1DH 3PWPA 2B8OT 5DYOA 3VFGH 3TO4C 3JV6B 3R1GL 4YWGH 4HKBB 5LAXA 1BBDL 3LZFH 3J7HA 3WLWC 3QQ4B 4XPAL 4U1GB 4MXWH 1W0YT 5ADPH 4U05A 3M8OL 3MRBA 2AEPH 2X4PA 2O5XH 4Y5XA 3MRHB 2X4TA 3O9WA 5H37G 3UC0L 2OL3A 3HRZA 1BVKB 4YHPA 2P42B 5D8JH 3RWDB 3CU1A 1JZ3A 1OGTA 2QADC 5D72H 5DLML 1FL5B 2UWEB 3HLAA 3UBXA 4RFEB 2Q3AA 3VE0A 1BGXH 4XNXL 3VFPA 4LSRH 5HGAA 5KANG 5INCB 4OZ4A 3REVB 3KLAA 4GW1A 4F33A 2P5EE 3RHWK 4CJ0A 4C56D 5BV7H 3WIFA 1QEWB 2H6PB 5DF0A 3VWJA 4O00A 1A7BA 5HYJA 2DQEL 5GRXG 4Q6IA 1AC6A 3W2DL 4GMTH 1OAUH 4IMKA 2IAMD 3PP3H 2VDMH 5D6DC 3P11H 1A1OB 3UTSB 4M1CC 4WWKB 2P7TB 4BZ1L 4K3EH 5FF6A 4P5KA 4DVRL 2A83A 2EXWD 4LLMB 4PV8B 2UVEA 4W4NA 1NC2B 3X3GH 4D9LL 4GBXB 5DA4A 4KGLA 4ERSH 4LQFH 1WBYA 3PGCB 2CDFB 5IESH 1KJVA 4HBQA 4P5MB 3PGFL 1I85C 1S7VB 1AY1L 4NHUB 4R6UA 4WO4A 3IDUA 4BH8B 2DM3A 1WQVT 1VEMA 3IDIB 4QGYA 5JORA 3HPJA 5D7LB 5D1QD 1J1PL 4NC1C 4XNZB 1IKNC 5E00B 3GMPA 3L5IA 1VEOA 2GFBB 5IB5B 3P77B 1N3NB 1U93A 2EDRA 5FB8A 3EGSA 4NQVA 4L3CA 1JPGB 3D3VE 3T09A 2A9ML 3KHOA 1DEDA 1QBML 3S3SA 3MC0A 5HPMA 4NQUA 1WWWX 4NWTH 2HAZA 1MCEA 2FO1A 5JTWA 5K9QG 4KQ4L 2VE6B 3I3DA 2Y9RT 4CL7A 4Z7QE 1B6UA 4HIXL 1IGIL 1MFAL 4LPTA 5FHBL 2CKBL 1ES0B 4LF3A 4U1SB 3NAAH 4PRHB 4U6XA 3IU4H 3MV8B 4KVNH 4XPHH 2VR5A 4JZNB 3NCYP 1U8JB 3FTGA 3VXOB 4MJID 1BZ7B 2OCFD 3K2UL 4Y2OA 4NHCH 3U30C 2VLKB 4NKOB 3DTXA 5DJAA 4MJ5B 1ONQB 1IGYB 2VZTA 1IAIH 2KUTA 3WSQH 4HMDA 4XC1L 5FECA 1X5LA 3EJYD 2VABA 2N4IA 3E0GA 1FJ1A 4JO3H 4FA8A 1PDKA 5TE7H 3I6LE 2DBLH 1CXEA 2Z91B 5DA0B 1N6UA 3G6JE 4NO0D 2D9QB 3D9AL 4JKPH 3ZTNL 5IM7B 2FJHA 5A16A 3W11D 1NGYA 1C12B 1AP2A 1O0VA 4M48H 3TIDA 2M26A 3UXFA 5F89B 3PHOB 2DBJA 5C0AE 4H1LA 2G5BA 3LKSB 4Y4HB 2YRLA 2PW2A 1BOGA 2KZ1B 2QBWA 2Y4SA 4Q9RH 2UUDK 3MLSH 4R3SA 3IKKA 5T3ZE 3BPLB 5B3NA 3D18B 1A6TA 2NY3D 1QVOA 4GKSB 4KI5F 3N1MC 1MWAA 3ILQC 1CDBA 3GSQB 5K33A 4NJAL 4ZFOB 1K5NA 3GK8H 4IDLA 1TMCB 4Y1AA 3O6FD 5CP3H 1EO8H 3MUHL 5I8EB 4Y19A 3RTQD 3VGDA 1G7LB 5CSZB 4OFPA 3PXJA 5E8EA 1S3KH 4E42B 3CFCH 3Q0HA 4QHKI 4EUPB 1DN0B 1PQZB 2R69L 4L4JA 4LHUD 4PJCB 5I6XC 5DUPL 5IOPB 2YMXH 4LSQL 2LU7A 3OB0H 3VXRA 5ENWA 4N0UB 1S7SA 5I73B 4G8EB 3MROA 5C0CA 2W59A 4PP2B 3BPCA 1E4WL 3QEQE 1T0NA 4FQXD 2YPLD 5DQJB 2P4AB 5IBTH 1KPVA 4UNUA 5SV3A 5CZXC 1TQBC 3GJFA 3BISA 2C3XA 4RQQA 1G9ML 3S5LG 1MJUH 3L9RB 1I1FA 3OXRB 1LO3L 3MFGB 3OKYA 5DD6A 2B4CC 1OAQH 4X83A 1IC1A 2ADFH 2X41A 2NXYC 5DK2A 1AFVH 1QKZH 3S98A 1YEIH 5L2JB 3GMLB 1HQ4B 3BEWA 4X9HA 2DQIH 5GJSH 4P23D 4HIHA 3MV9A 4PJ8B 5KVEL 1KIPA 3WFBH 4ELMF 4Z0XA 3HE6D 1I1AD 3U7YH 3WS3B 3S37X 4YGAB 4YFDB 4WFEE 5E9DA 3MPCA 1BJMA 4XI5D 4UOW0 3LAFA 4GLRI 2G9HB 3SO3C 2V6HA 3CUPB 1M1SA 4ONHA 2J2ZA 1FSKB 4O2FA 4Y16C 4QO1A 4PRPD 5FO7A 4M4RA 2P8LB 5DHVH 4DZ8B 1F3JA 2OXHA 1ORSA 2K1MA 4WI3A 3RL1A 1G7JB 1JZ8A 4LSUH 1LO4L 4EBQH 1QFHA 3OF6D 5AYUL 1RUQH 2FBOJ 1PGRB 1XGRB 1WIUA 4KJYB 1RHHB 1GL4B 1U8PB 4LCCB 3VFSA 3LB6D 1GAFH 2DIAA 1W72L 2FATL 4HKXB 5D2NE 3QFJD 3C6SA 2Y07L 3JVGA 4MJ2A 4K23H 5L7XH 3MLVL 2CIIB 5E99L 4U2YA 3D69A 3ZTJG 3QUZC 3RWIA 1CFVL 1CICC 4E5XA 5J1AA 1RZKH 4LSSL 1F4WL 1GGYA 2EICA 3OV6A 2HT2D 1Q1JL 2KH2B 4Z7VA 4POYA 3C8KA 5F1SA 3AFLA 4BK4A 5HBBA 3CFJB 3V0AC 2H1PL 5C0FB 2F53D 5IBUB 1DBJH 4UOW1 2ENSA 4PJFE 1AHWC 1QG3A 4YHIB 3P4NB 3KYKL 2D7TH 4YIQB 5I1GL 3SKUD 1TZGH 4R4ND 5I0DA 3O41A 5F7MC 1TZHA 4U6HB 3HI5H 1JNNH 5EDXA 1JHLH 3FO9A 1T22B 2NXZC 5HHXL 3W0WD 4JDTL 1G0XA 3OR7B 4OF5A 3CC5B 3SPVB 5LCVL 3W5NA 1HILA 5E6YA 2J6EA 4HLJA 3S4SG 4MNHA 4PJAF 3MRMB 2XWTB 1KF9B 5EULV 5LQBH 1DQDH 2PTVA 3DROB 3HAEB 3UTSD 4BA8A 3RUGF 4XVUC 4JKKA 2MCG1 4WUUB 3MJ8A 2FZ3A 1YYLL 4QRQB 2AXFB 2Z9TA 4XMLH 5DS8A 1UB5B 2V7NB 4AH2A 1P84J 3NBNA 1Z2KA 4K2UH 7CGTA 1FIEA 3T0WA 1TVHB 3S3JA 2EDJA 2GW5A 5CJXA 4B53A 3L5JA 5JLZA 2O5ZH 1YA5A 1TZIA 4LSDA 2PYEB 1IRAY 1RJLA 2XKUA 4UTBL 2IPKB 4S2SB 2CSPA 2OL3H 3N1PC 4OCYL 1NL0L 4QXUH 5GS0L 4PRDA 1F90H 1ZLWH 3O6KL 2GIYA 1RZIA 3MOAH 1TVBB 3E8UL 1KN2H 1A9EB 2A73B 1JPTL 1R5VA 4FFYL 2YXFA 4HXBH 5F1IB 3UO1H 5EBLB 2IALA 5EPMB 4C59B 4P2CG 5BVPH 3QUMA 3WIIH 1QYGL 1T66D 3N9GL 1RUMH 5EO1A 1A1MA 2XTLA 2Z8VC 5DJ0A 1YQVL 3MRKA 3QEUB 4RA0C 3WS6A 2FEEL 4FQHB 2VMFA 3QULA 2IANA 5GSRA 4S0SD 2C7UB 3SDYL 5CBAA 4PJHF 4R4FH 2DN7A 2QR0B 1QQDB 5CGYD 3OKLB 5I75C 1JGLL 3OB8A 5L9DH 3U36B 5L6YL 2Q86A 4YDLC 3PF2A 4EI5A 1AKJA 2VLKD 2C3GA 1A3QA 1OWWA 4X80H 5I9QC 4GRMA 4Y5VA 4XBGB 1LD9A 5HVHB 4KTEH 3OHXA 3QIUB 1QRNA 3IDNB 2WSKA 4NKDB 3WFEH 1BJ1J 2BHZA 4F58H 3FRUB 5EBWA 2IH3B 4R7DA 3WD5L 4LVEA 1K8DB 1R3LA 4PJXB 3O0RL 1A7PH 3B9DA 2FL5B 4P2OC 5ELIA 4LNVA 2AI0L 3V4PH 4EKXA 3MFFB 4XH2B 4LMQE 4XZUB 2OTUB 3FQRA 4Y4HD 2R4RL 4U7SA 5IIEB 4LCWD 1G6RA 5JDJA 4YEFA 4FNLH 3O8XC 4YDKL 4PJAA 4I8DA 1Q0XL 2JJTA 1MVFA 4XPFL 5BRZE 1I8MB 5D5MB 3SDDB 1VEPA 4HFWB 4ZG1A 3NFSH 5INDA 4Z77B 4ONOA 5I76A 5DJDB 1FG2A 3RL2B 4BSVA 1E6OL 3RUGA 4LBEB 4OLXH 4DVBB 1AO7E 3RVTC 3BGMB 3EFDH 1P7KA 5FYJL 3WNLA 4AIOA 2VLLA 1XCQB 3HNSH 3QDGA 3QDJE 4OFDA 1AC0A 1CFBA 4H8WC 5TE4L 1DDHA 2NY6D 4IOIB 4HLZG 3QUXC 5F3HA 3UPRA 4EVNA 4X7CC 2Z31C 1YJDL 5ISZA 1R3IL 5FK9B 1BX2A 1J0ZA 3RU8H 5GHWH 3PNWA 3TH4T 3WL9A 1T5XA 4MSWA 3ARFA 4JRYE 4PIRF 4JM4H 2DI9A 5MP6L 3C60C 3PWJA 2LU4A 4N0YL 1H0DA 4H1LH 4F57H 2BOCA 1EBPA 4J1UB 3FOLB 3I50H 2A6KA 2BDNL 1ZLUK 4R0LA 2L7UA 3QIWC 1VPOH 2JJSC 3NZHH 5JXED 3BWAA 3WNNA 4HGWB 1NEZA 1ERNA 1KXQE 3KPQA 3TC9A 1B0GB 5I19L 1AD0B 4V1DE 2F19H 4PRIA 1UXWA 5FYLE 3OJDB 4FXGB 5C09B 3ZDYE 3TBSA 5DQDL 4KAQL 4E0RB 4PJHA 1C08B 1NQBA 3TZVB 5E6ZA 3K8KA 3GBNL 3CNKA 4Z78A 4XTRC 2P45B 4KROC 4G7VL 3ISWA 4XRCA 4L3EB 2EDLA 4Q9QL 3QQNA 1QLEL 4NP4L 4HT1L 1NGWB 5LWYL 2NY7L 1MRFL 5HHME 1XH3B 1NJ9A 1HHIB 4LU5L 4P2RB 1A1NA 1QFWI 5HHNA 3LDBC 3BUYA 3FO2A 4P5TB 2R4SH 2ZOKB 1ZVYA 3GKWL 3ILPB 3MLXL 3PABB 5ESVA 3QUYA 2QQNL 2FX9L 5EOCH 4O02L 3BN9D 3HUJB 2QTEA 3V7MA 3LKPB 3PWNB 1VFAA 1MCIA 1I9RL 3DBXB 5JZ7C 1OY3B 1AGFB 1S7UB 2PNDA 1ZWIA 5JIKA 5EBGA 1ZT1B 1IQWL 3TIEB 4QRRD 1KCUH 4JZJB 4L8CA 5K59E 1IAII 4FQIL 5HI4C 4LDEB 3L95A 1BFSA 2BSRB 4NQSA 1GPOH 5J3HD 3D3VA 3BP4B 2Z0BA 4GRLB 4TSAH 4HFUH 5I15H 5JO5B 3FT4B 4U31A 5GGSY 5KN5B 3HC0B 2DD8H 4D9QD 3DVGA 1N0XH 1T6VN 3MSPA 1BFVL 1WT5A 1U3HD 1X5ZA 5HHPB 4M6NH 4MHHG 2BRRL 2M1KA 5E8PA 4KV5F 3HE7B 5JPNB 4JFFD 1FNGB 1JI2A 4Y4KB 4EXKA 4PG2A 1ZAGA 4IRSA 4LDLB 1YPZF 5L88H 2EIZA 5HHQB 1ITBB 1UJTA 2BHUA 1HXYB 1JHKH 1JNLL 4NOBA 4KMQA 1NANI 4G9FE 3T77B 4U6TA 5DJXA 2ZUTA 1IGFH 5KJRH 4WW2C 2Y1VA 4MZ2A 3SE8L 3TWCL 3ULUH 1INQA 1P6AB 1NAMB 4PB9L 2PYED 1RJZA 5DJCA 3AY4A 2ATPA 3MLUL 5E2WL 3AVEA 3G6JA 3GB7A 1CFNB 3QYCA 4NCC2 4DKEH 2QQQA 4HDIA 3TNNB 4NM4H 3HMWH 4OD2B 1OP5H 1JGUL 2RFXB 1FP5A 4YXKL 1RIHH 1WC7B 4RA3A 3T4AB 1M7IB 3L3DA 2J6EH 4NWUL 4HS8H 1UVQA 5FXCH 1EHNA 1LO0H 1OTUD 4HWEH 1G84A 2W91A 1RULH 2AJUL 1T1XB 5AUMB 4I5BB 4GUPA 3I02B 4Q7DA 3TYFA 4EDWL 1FRGL 3IETB 5L2KB 4L1HA 4EIGB 3LN5A 1HDMB 3MRCA 4JN1L 4P46A 1ZT7B 2WBJC 3U2SB 3MNWA 4NRYB 3MV7E 3KR3H 4ZQKA 1IBGL 2ICEB 3U79A 4PJIB 2D0GA 1IGCH 3N0PB 4TSBH 4NRZB 1KENL 5IFAH 3H7LA 2HFFB 1XF2A 1JE6A 4PGEB 2Q7YA 3R8QA 1SM3H 5CHNB 2AXHA 5DC9B 2PO6C 3RNQA 3BKYL 1EMTH 4ACPA 5TF0A 4IRJA 1URLA 2FJFA 5BV7B 2NLJA 4F7CA 4R26L 1EPFA 1I4FB 1C5DB 3HC3H 3QEQA 1KCRH 5JA9A 5I16B 4IHOB 2MOVA 4Y4FD 3G04B 43CAB 3MA9L 2ZPKH 4D0DA 1TJHH 4YUEH 1M7DB 5FDYA 3AS0A 1ORQA 4ZAKD 3BZEA 5CEYA 1KT2B 2VIRB 2XZAH 2XA8L 3F7VB 3ZKSD 4MDIA 5D2LE 1QLRB 2IQ9L 4RMWA 4FQQB 1T20A 4N8VB 4OGAC 3WO4C 3H9YA 4OGXL 4MLSA 2NZ9C 3EJJX 5IWLC 4QYOA 1FFNA 2J1KA 4O9HH 4HUVB 4WHTA 1WZ1H 4QF1B 3SDDD 3GBLA 1BVLB 1ZLSL 2HFEA 1KJ3H 2VQ1B 3G5YA 3MBEA 4Z7WB 1HN1A 3C2AL 2DWDB 5B8CA 1FVEB 1EAPB 5KSAC 4CJ1A 3I75B 1YPZA 3F58L 3OBAA 4NO2B 1A6PA 3ULSB 1CK0L 4P4KB 5CWSA 4PP1D 3AAZB 1F97A 4OCRH 3B9KA 4Z76A 2E7BA 5IHZA 3DRQB 2IC2A 2ZJSL 2WUBL 5TQ2H 1KB5A 2V2XB 5F7DA 1I1YB 1SYSB 5KVDH 4Z7NF 1TTGA 2WNGA 5C0BA 3Q1SL 5T1MB 2D31B 4HS6A 2XYCA 4ZFZB 3VRIB 1PY9A 1KELL 3EZJB 4M6OL 4AG4L 4LRNL 5DI8A 2IAMC 5IMOA 4HUNB 3STLB 5JW4R 2EKSA 3RGVB 4CNIA 5GGVY 2FCBA 3KG5A 5EG6C 3LKRB 4HPOL 1G6RH 4XCEA 4YQXL 4MAUH 1MFDH 5FKPA 2R2CA 2EXWC 5MEND 4UT6H 1IT9H 4PJFA 1XMWA 3VFWB 1LP9F 5DVLA 4HUWB 4U7MA 1HSBB 2VLRD 3QQ9D 2HLFC 2IBGA 1XGUA 2P8MA 1QRKA 2F5AH 4XNQA 4X9FA 4U6YA 5C09D 3VG9C 3K4DA 3I6GA 3H6JA 4R4BA 4JQXA 3GSOB 5JW4Q 3DUHA 4OM1L 4DAGH 4PLKD 5EO9B 5IJKC 3TBYB 2Y36H 4JFEB 5D1QC 4G8GE 4X4XB 1UWEL 3S36H 1J86A 3LQAC 2BSSA 1YY9D 3FO0L 3TJEH 3CXHJ 4BM7A 5I1EL 3JV4A 4FN0A 3MRLB 4XCYA 5JW4M 2BNQA 3S35L 3IDMB 4P3DB 4OLVH 3SDCB 5CP7A 3MRGA 3OKNB 5DR5L 4FG6D 4Q9BA 4P2RD 3T2PA 1R3KB 3KPRB 5F88B 1GGIH 2AV1A 1NLBH 4N5UA 4P5TD 4M00A 4X6CF 1J1OL 5B39G 2WQRA 4IIQC 1PW3A 4JFXA 2D0FA 5I1HL 5E1AA 1XGTA 4JRXD 4G6JH 4F7MB 1FLRH 1DVFA 3HG1B 1C1EL 1X5KA 2HN7B 2YZ8A 5F72S 2UZYB 5JA8B 2FH8A 1Q94B 1Y0LB 4KKAD 5E1HB 2XXMB 5I1KH 1QOKA 4BFGA 1H8NA 4OCNC 5AZ2L 1FHGA 4QXWA 4E41E 1QA9B 2VXUL 4ZS6D 4ZUUA 3HC4H 4GRLD 4G6ML 1OD7A 4R8WH 2B0SL 5GGTL 3FMGL 4WI8A 5C0RH 1CXKA 1DQLH 4AEHL 4F7TA 4HUUA 4YDJB 2BSTB 3O2DL 1T83C 4XVTH 2Z8WC 3NFPB 1NFDE 1YEGL 2HG5B 2DKUA 4ZD3L 1EJOL 1LK3H 3W11C 3TBTA 1ZSDA 5T5FL 3FKUS 5AG8A 3OGCA 3P0VH 4NN7C 5LBSH 1HHHA 4PJ5A 3OAUL 3SOBH 4Y4KD 3H3PL 3NMEA 4ZXBA 3ZE2E 3GEWB 3GJFK 1FAIL 4WU5B 1MJJA 1MLBA 2WMPA 4RAVB 3DIFA 4LQ1A 2NY5H 1CWVA 1RURL 4J6RL 4JANB 2X1QA 1P4BL 2C4FT 1IAOB 3B2UC 1WFUA 4M1GH 1QBLH 4KUCD 4UQ2B 4A6YA 2GITB 1AI1L 2ZNWA 3RTQC 1AE6H 1ZTXL 2AW2A 1U8HA 4NSKA 5DWUL 5DHVB 3MRNB 5HJ3B 4WTXA 1AD9A 2XA3A 5D7SL 5DHYB 5EU3B 3DX6B 4YLQT 5DMGC 3BKCH 3VI4E 1OM3L 4I3RL 1RVFL 2ATKB 4PJ9C 3FONA 4QOKB 3BD5A 3VXPB 1OTTC 4GKZA 3G6AB 4LLWA 1FBIL 5DEFA 4DOHB 5KSBB 1AH1A 2E27L 1S9YA 4HKJA 4KTDL 4RISH 3MRIA 3FJTA 2DL2A 3CSGA 2UZXB 4FQXC 3L3HB 1Q9WA 2ICES 2J5LC 4YC2B 1IAKA 1CFQB 3SBWA 3CVIH 1LNUB 1J1XL 3FN0H 5I1DA 4W68A 3OKDA 4GS7C 1F4AA 1MFNA 2GUOA 4RCAA 4BSWB 5I2IB 2FIKA 3RY5A 1B0RA 3WXWH 5L2KD 4OLEA 2AV7A 3SGDH 2LTQB 1U8IA 5IB3B 3WXVL 5I71B 4EOWL 3IKCA 2D9CA 4D3CL 4XP1H 5I8CA 2CXGA 4HUXB 2VISB 3IJYA 2HTKD 1MCFA 5KS9F 3HE6C 5C71A 3QDJA 1CZ8H 3GIVB 5HGBA 5HY9B 4NQDB 2ADIB 5C0EB 5M95B 4XI5C 5E2TH 3AGVA 4HHAB 8FABA 3B6SB 4LLVB 4Y88A 1ND0B 2X1WL 3RNKA 4UV7L 3OJ2C 4XB7A 2EE6A 2AXGA 25C8H 1A3LH 1BWWA 4CN6A 4N0CD 4OLZH 5FM5M 4K8RH 3BD4A 3LH2H 4NUGL 1OP5K 5MEQB 5HDBE 6CGTA 2Z92B 4Z9KB 5T3ZH 1INEH 2ZG1A 5DUML 3VA2C 3QZWG 3MCG1 3MXWH 1NFIA 2EDYA 2GQHA 5LAXB 3MYJB 1ITCA 3QXDA 1U58A 1VGKB 4ZFGH 2VB5A 3L7EA 2DKMA 4V1DA 4CMMA 5JW5A 5CEZH 5H8DA 1RD6A 3MRBB 1K4DA 2X4PB 5TF1L 1A14H 2R8SH 4Y5XB 5IROC