1NWOA

Crystallographic study of azurin from pseudomonas putida
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
AECKVTVDSTDQMSFNTKDIAIDKSCKTFTVELTHSGSLPKNVMGHNLVISKEADMQPIATDGLSAGIDKQYLKDGDARVIAHTKVIGAGEKDSVTFDVSKLAAGEKYGFFCSFPGHISMMKGTVTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Crystallographic study of azurin from Pseudomonas putida.
pubmed doi rcsb
molecule tags Electron transport
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nwoA00
4HIPA 1PZCA 2YAOA 1OF0A 5TK4A 1OCRB 2XV2A 3S8GB 4A67A 4KOCA 1FA4A 2HLEB 1AS8A 4KNTA 3UAAA 2DYSB 1SHWA 2XU9A 1ASQA 1M57B 1WAEA 1A65A 1AS7A 2FQFA 3NT0A 1N68A 1X9UA 4G7RB 1GY2A 1SF5A 3PAVA 5AFAA 4DPCX 2IWEA 4CSZA 4A68A 4AKQA 4HCGA 5EHFA 1WA2X 1ADWA 1ILSA 2YAMA 4W1TA 1NPNA 1RZPA 1SFHA 2FQGA 3NSCA 4Q89A 5FC9A 1MZZA 4UAHA 4E9RA 2FT7A 1IUZA 1SHXA 3T9WA 5B1AB 2EINB 2YAEA 1J5CA 4G72B 1JZGA 4YVNA 4F7KA 3FSAA 2I85A 1I53A 5I28A 4G71B 1A3ZA 2J56A 2RACA 1L9PA 2XLLA 4BDVB 3X2QB 1RZQA 1OCZB 1JXFA 2WSDA 4E9XA 3GXUB 1ET7A 3SBRA 1JZIA 3NSYA 1M9WA 1NWPA 1E5ZA 2VSMB 3S3CB 1IBZA 4M3HA 1XB8A 2XV3A 3WIAA 4DPAX 2J5WA 4HHWA 2PPCA 5I6NA 2PCFA 4P5SA 3CDZB 2R7EB 3NP3A 4BWWA 2W8CA 5F7AA 2AZUA 2PLTA 3FPXA 1AZNA 2GI0A 2I7SA 3FSZA 4EF3A 1KBVA 4YSSA 5B1JA 1FFTB 1JXDA 1ID2A 4G7QB 3OD3A 3IBOA 4UANA 2BW4A 1MG3C 1J5DA 3OMAB 4DP7X 5B1BB 3NJJA 1SDDB 3FQYA 3FSWA 3FYIB 4MFHA 5I26A 5B7FA 1JXGA 2VM3A 3NJKA 3TASA 1JZHA 1SJMA 1NWOA 4AKOA 3N2JA 1AACA 3H4FA 1SNRA 5B3SB 1KDJA 4JHVA 3QJSB 1N70A 4KNSA 3UAEA 3V9EA 3DKHA 4KO7A 3EH4B 4RH4A 3T6VA 1W6LA 4DP9X 3WG7B 1E65A 5AKRA 2YAQA 2YQBA 2OV0A 2Q9OA 1BXUA 2VW6A 4KO9A 3S3DB 3UGEA 3X1GA 1WS8A 4X4KA 4N8UA 4DP2X 3SBQA 2OJ1A 1FWXA 1PMYA 1A8ZA 1TKWA 1IC0A 3IE9A 2LLNA 2HX8A 1QNIA 3C75A 3T6ZA 2A3TA 1XMEB 3UADA 4FA7B 1X9RA 4YSQA 1L9TA 4BXVA 4PAZA 1NDTA 1OE3A 1GS7A 5AZUA 1NIDA 2HRGA 3ZDWA 5I6KA 4DP5X 2FT8A 2XV0A 3H56A 4WTQA 4YVUA 1AZRA 2GHZA 3OMNB 3IEAA 3OQRA 1XB3A 2EIJB 2VW4A 5I5MA 4KO6A 3FQ1A 4FAAB 3AY2A 3L45A 4GP8B 1JZFA 4M4RB 1JOIA 1ZDQA 2FQEA 2X87A 3QJVB 4GYBA 5B7EA 2ZXWB 1GYCA 3CVDA 1L9OA 1A4AA 1CC3A 4JHUA 2XX1A 1PF3A 3ZIYA 3CVBA 2B08A 2TSAA 2EILB 2XWZA 4BDVA 1AAJA 4CSPA 5PAZA 2WO2B 3SBPA 1PY0A 2EIKB 2H5UA 1BYPA 3NJGA 4GY4A 5I6LA 2JKWA 2AANA 1RCYA 2X88A 2R7EA 1V54B 4NB7A 2IDFA 1MDAA 2N0MA 2JFCA 2I7OA 1SFDA 5D4JA 2BHFA 2FQDA 4A2FA 4E9WA 1TEFA 2DY2A 2BP8B 3G5WA 3GDCA 2IDTA 1JERA 1MZYA 1ZIBA 1CURA 4UF7C 4KNUA 2W88A 1AG0A 2H47C 2QT6A 5B1KA 3PPSA 1L9SA 1J9SA 3FT0A 3FU7B 3QQXA 4YSTA 1PNCA 4WKXA 1WA1X 3PAUA 4BWTA 1PNDA 3DIVA 5E9NA 4YSAA 3QJQB 2ZWNA 4K9JA 1ET8A 2GIMA 1OCOB 1NPJA 2BWDA 2ZONA 4DP4X 4W9ZA 2YAFA 4YSRA 5B7MA 2DWSA 2E86A 4HZ1A 1ZV2A 2PP7A 4GP4B 1JZJA 2FWLB 3CZUB 2MRYA 4HCFA 2HRHA 1UATA 3X1FA 1GSKA 4A2GA 5D4IA 2FT6A 2DV6A 2XX0A 2IDSA 1XB6A 4A2DA 4A66A 1NIFA 3ZX1A 3WKQA 4E9YA 1BXVA 3D12B 2WO3B 1WS7A 3FS9A 3MX0B 1PCSA 3TU6A 1NTDA 2TSBA 1AANA 1AQ8A 3ABLB 3FQ2A 1AZBA 4QLWA 3TBCA 3CVCA 1EZLA 4A2EA 1L9RA 3ABGA 1KV7A 4YL4A 1NICA 1SF3A 2YARA 4QKTA 4E9VA 1AOZA 2FJSA 3NSFA 1AIZA 3ABKB 3NP4A 4G7SB 2BWIA 3JTBA 1RKRA 2CBPA 2VSKB 5IY5B 2BZ7A 1QHQA 2GB2A 3AG2B 3NYKA 4F2FA 3PAZA 3OM3B 1A4CA 1GW0A 4F2EA 3HB3B 4GP5B 8PAZA 5A7EA 3AG4B 2VN3A 1GY1A 2CUAA 3U25A 2QPEB 1TU2A 3AG1B 1OE1A 3ERXA 4DP6X 1BEXA 1J9QA 2QPDB 3NJNA 3QPKA 1BQ5A 1WA0X 4E9QA 3T6WA 2Y69B 1NIEA 3X1BA 4A2HA 2PP8A 2PPDA 2EIMB 2IDUA 2BP0B 3NJFA 1KCBA 3OMIB 3ABMB 4YSUA 5B1JC 3WNJA 3X1EA 1IKOP 3QJTB 3PCYA 1PLBA 1GS8A 4BXSV 1KDIA 1V10A 3ASOB 7PCYA 2BO0A 4HCIA 2UX7A 1OV8A 1CUOA 2YXWA 4JKNA 5LDUA 1KBWA 2BP8A 2YXVA 5TK2A 1ILUA 1PZBA 1E30A 3ASNB 2PP9A 4TXVB 3EHBB 4KOBA 2XVBA 2MTAA 1GR7A 3IN0A 1R1CA 2UX6A 4ZK8A 7PAZA 1J9RA 2B3IA 1ETJA 3FU7A 3FPYA 3RYMA 1A4BA 3GYRA 2VW7A 3CDZA 1IBYA 3NSDA 3HEIB 1AS6A 2CALA 1ZDSA 4DP1X 1OE2A 3TBBA 3WI9A 1MG2C 1W6WA 2ZOOA 1CYWA 2XUWA 3SQRA 4AZUA 2H3XC 2QDWA 5I5JA 4YSOA 1ZIAA 4E9SA 2YAPA 1B3IA 3KW7A 2GBAA 3BQVA 2IH9A 3QJUB 4DP0X 3PLYA 1NINA 3AW5A 3UABA 1SDDA 1ZPUA 2BZCA 2J57A 2XYBA 2Y1AA 1PAZA 2YAHA 1NIBA 3AG3B 3H4HA 1PLAA 1VLXA 2UXVA 3MBWB 3EH3B 3FSVA 2UXTA 1ASOA 3WKPA 1GS6X 2IDQA 2PCYA 5I6PA 2PPAA 1JZEA 5I5IA 1T5KA 6PCYA 1BQRA 1ASPA 1E67A 4NERA 3T6XA 2QDVA 3X1NA 4DPBX 3V9CA 1QLEB 2CCWA 1DYZA 1DZ0A 1KYAA 1CYXA 1KGYE 3IN2A 2GC7C 4HAKA 1AG6A 1URIA 1PLCA 1ET5A 1OCCB 2OCCB 2GC4C 2HX9A 1NIAA 3NJLA 1V55B 4L0PB 3EF4A 3JT2A 1NZRA 1KCWA 3BVDB 4N4YB 5ANHA 2XXGA 5I6MA 5I6OA 4HHGA 1JVLA 2CAKA 4HALA 5PCYA 9PCYA 2AFNA 5F7BA 3T71A 1F56A 2PPFA 1HFUA 3KW8A 4Q8BA 3FU8A 6PAZA 2NRDA 1BYOA 1AZCA 3FYEB 2UXGA 4NAJA 1EHKB 2IWFA 3WNIA 2DWTA 3UACA 2XXFA 4E9TA 4YSEA 4P5RA 2PPEA 2BW5A 3NJIA 4ENZA 2BP0A 1OOWA 3N55A 2FNWA 1J9TA 2CJ3A 2VMJA 4AX3A 3ZBMA 1BQKA 2IAAC 4YSPA 1M56B 1BXAA 2P80D 3QJRB 1BAWA 3DTUB 4BK5C 2IWKA 4PCYA 1AR1B 2HX7A 1HAUA 4BWUA 1E5YA 3NJMA 2DYRB 3S3BB 2IH8A 4GXFA 4AI7A 1PZAA 2HXAA 2GSMB 4YSDA 1TEGA 4KO5A 3EH5B 2FTAA 3PXLA 4DP8X 2AVFA 2HZHA 2AZAA 2UXFA 1YLBB 3CG8A 1L9QA 1HAWA 2Q5BA 3AZUA 4AKPA 1AZUA 3FU9A 1JVOA 1W8EA 2J55A 5D4HA 3NJHA 4G70B 4YSCA 3S8FB 2VM4A 3TA4D 2JXMA 2P80A
chains in the Genus database with same CATH superfamily
5AW9B 1N0LB 2FX7L 3D6GA 2YAOA 2OTWB 5B39G 4KOCA 2CWRA 2YZ8A 3EO0A 1YECL 3WTTA 1XGPB 1OAUH 4HIIA 1N19A 2GUOB 3VXUA 2AI0H 1OALA 1A65A 1E3XA 1PG7W 1H3UA 3BXNA 2ZXCA 3K1DA 1AQHA 2QHRH 2E8ZA 1N68A 1P4BH 4FXGA 3V4LA 4QTHB 1MNNA 4D0BA 3VXNB 3K2KA 3LH2H 3D1MC 2JLPA 5TDPA 3TWCL 2VO5A 1E9QA 2B1AH 4HUVA 2IWEA 3T65A 1KB5A 3R0MA 3WHXB 2DQTH 1HHGB 3MGTB 5I71C 3UH8A 1NGWB 2F15A 1M1XA 5D1ZB 3DO3A 4PRPB 5IJKC 2EC9U 4MLSA 4HKXB 4AG4L 5DHVA 3MUGB 1W72H 1O9VA 2X89D 3QIWB 1F6LL 4UAHA 1DBJL 5FW8A 1GAFH 4M61A 5CLZA 2FT7A 3ZW3A 5DTFB 4ZD3H 4UDUA 1QHOA 1JGUH 4PSPA 3ESOA 1SXSA 4Z7UB 2E27H 4OZ4A 3HMWH 1TQWA 3HPJA 2QHLA 3PWUA 1LO4L 5LBSL 1D9KB 1S2EA 3RP1A 2VH5H 3QIUB 1J48A 2PXYA 2QADD 3QEHB 4OZGB 3L3GA 3RUGE 3P9LA 1VGKA 4JL2A 4OKDA 3CMOH 1KFAL 4LLMB 4ODHL 1QUNA 2ZUTA 2ZP8A 4E9XA 1ET7A 2DIBA 1JZIA 3A6BL 1FNSH 1UTDA 4CC4A 3W0WD 1RMFL 3PFQA 4WO0A 4DVBA 5HXMA 5C0FB 3P4OB 5BZDA 3EADA 3KL3A 4RMBA 2NQCA 1G9ML 1CD0A 1S5HB 5C07B 4HK3J 3RVXC 4H5SA 3CFNA 3LVTA 1RUML 4WSKA 1AIFB 4MD0A 3IMVA 3B2PA 3W39B 5J12B 2A9DA 1YEEL 4M93B 3UYPA 4YPJA 4TVPH 3V0WL 5B1JA 4ZOBA 4LARH 3ABZA 1Q1JL 5C08E 4JFHD 2GT9B 1JBJA 4UILH 5DCCA 4M8QA 1OEZW 4ODTL 2D03L 3AB0C 3GSNA 4X5XB 2BOBA 4QXUL 4YPGA 4H2CA 5G2NA 1C1EH 2JWYA 3T08A 4WHTA 1LP9F 1IU1A 1XXDC 3DYPA 3T2NH 4BQCA 4NM4H 3GMOB 4LLWB 5B8CA 2CMRH 1TT6A 4RIRB 5FYKL 1NC4D 2G3MA 2K78A 4KNSA 1NUNB 2DL9A 3MLVH 4L5FH 3KCPB 4CBPA 2AK4D 5E2WL 1XAKA 5IHUL 1JGIA 2VDNH 5EN3A 4FYRA 3UG3A 3EW3B 5ESAB 1YEDB 5EOQL 4NNPH 3V4UL 4MWFA 1M7IA 2FX9L 1ORSA 2GFBA 4JVWA 4NRYA 1NANI 4YL9A 3RIFK 4LEXH 1IRAY 4FNRA 4B0MB 4HQQH 1DVXA 1E3FA 3NESA 3AACA 4J4PA 3KPSE 3SDCA 1BFVL 2A3TA 4G6JH 4P57B 5CN1A 4FA7B 4YSQA 1UM4H 5AZUA 4IOSA 3LNIA 1KIPA 3GLZA 2DRUA 3SZKC 3PWJB 2OSLB 1DJHA 2NTSP 3DX6B 2NNRA 4W9GC 1UT9A 4FG0A 4WO4B 5AAWA 2WSPA 4U1MA 5HYJE 1M7DB 1INDH 5AD0A 1GGBL 3SO3B 3ARWA 1P1VA 3TIEA 4BA8A 2JIXA 2KL6A 3JWNG 4UNUA 4X5PA 4GUPA 5IQ7H 3SBWA 5FM8A 2X3BA 4K15A 1RZKL 1AGFA 2ALAA 4CVXA 5F9OH 1FNHA 3VRIA 4ZQKB 1INQA 4Z7VA 1YN6B 3OAYK 1TMCB 3OKKA 3DLQR 1C5BH 3DX3A 5J1SC 1CIUA 1UUSA 3CVDA 4HGMA 1QR1A 2XX1A 4OCLC 2M83A 4XVUC 4PB0H 4XHJC 2X2JA 4I3GA 1JGEB 2CO6B 2OMTB 1AAJA 4F5CE 2H2SC 1IGIH 4Y2DB 4PJEB 3WFCH 5D7HA 1LEIA 1X5MA 2X4TA 3RIFF 1HEHC 4TNGA 5I8OL 4GRLB 1LTXA 2JKWA 3RAJL 4BUHA 2B5IB 3CPLA 3CZFB 2EDEA 4BGDA 1NGZB 5CKGA 2Z35A 1GPOL 1GMIA 5LXVA 2D3JA 4LP8A 3FB7B 3T0AA 4S0HA 5DXWA 4HMEA 3MDJA 3VFMA 5KN5A 1N6QH 3JZYA 1L7IH 3FB8A 2GY7B 5E6ID 2UY6A 5FUZL 4MNQE 4OTXH 1LEKB 4JB9H 1GZQB 5BO1H 3K8LA 3MJ9L 4MD4A 3QBTB 1BD2A 3GBML 2NY4D 3CXHJ 4YZWA 2BP8B 4XNMB 2DH3A 1S7VB 2E5EA 2YHGA 4IOIB 2JV6A 4APQB 4IHOA 1B2WL 4POUB 1S3KH 2ITDA 2EDBA 3RWIA 1NFDF 3UERA 3VGEA 1DVSA 3RDJA 5TE7L 3HN3A 4WKXA 5IV2B 3IDIB 4A7SA 5I66B 5IMLB 1W0WA 3IGLA 4P2QA 3UOAB 1XZ0B 3RJQB 3CC5B 5HHNA 5JOPD 1AY1L 4P2AA 4KC3B 5EZOH 2EDRA 5D7LA 2XIIA 3QPXL 2G2NA 4X6DE 4A55A 3FUNA 1QPPA 5E8EB 1RK1A 5TDOA 1J1PL 3WEBA 1L5GA 2APSA 3NGBB 3VQ2C 4PW3A 4XP9H 3BSGA 4K3DH 3U46A 5INCB 2R59A 5LBVA 1SXZA 4EEEA 2CM5A 2HRHA 4O2CA 3ZY7A 3RTQD 4HWEH 1T1YB 4OZHE 1WZMA 1HXMB 1SEQL 3LMJH 2VWEE 5DDHB 3ZTDC 4KU1A 2ADIA 4XI5D 5EUKB 3S37H 4E9YA 1QBBA 1WS7A 2WO3B 3JTTB 5AALA 5C0BD 4NNXB 4A7GA 5B21A 2HCZX 1CICB 1HXYB 2O26U 2CZNA 5IESL 1XSKA 4NHCH 5C09A 4R6UA 2WXNA 1L9MA 4A2EA 4C59B 3ABGA 4ONHB 3FO0H 4DT2A 1QR4A 5E95B 5FM5M 3D2TA 3UTTE 3K4ZA 2OMVB 1NPUA 2BDNL 4NC2B 2WIMA 3G5ZA 4PGDB 2GCYA 5C2UB 5D2LF 5DD3L 4U1NB 3WIHL 1SXNA 5FF6B 5IJKA 4YHLL 5DQDH 3IF1A 3T4YA 1SVCP 2ERJB 4ONGH 4HJJH 5A6IA 1RIHH 1NLBL 1P6WA 1ZT1B 4DH2A 1U8QB 1JYNA 1SPDA 1A3RH 4AEHL 1J9QA 4RFEB 1A4KA 4XPBL 1A14L 3H1ZA 1WA0X 1D7BA 1IM9D 1WYJA 1ORQA 2LLLA 5FA3A 2HFFA 2QELA 4DN3L 1AHMA 3QFJA 4W9EC 2HTLC 5C6WH 4AL8L 2Z3FA 4DESA 1TJMA 4G9DA 3RZCC 2J4WL 5D6DC 1GGIH 2ZKMX 3ETSA 3ZT5A 5FEBA 4GRWE 4AQAB 3QJTB 3TVMD 1LEGB 2F1AA 1OLZA 5C97A 2PO6D 5KS9A 4P5TC 3HC0A 4NQED 4E0RB 2PTTA 4K94C 3D2UA 1MLCB 1S7QB 3F7KA 2IQ9H 3MMEB 4Z7OF 3RVTD 4N8CL 3Q6FA 3DX8A 1UA6L 3EJZC 2AMUA 2MSPA 2V2WB 4J2XA 3QXDA 2VLKE 1WCBA 2OR9L 4LHUA 3NCCB 3IKKA 1B2YA 4HD9A 4PI0A 4ZDHA 4G8GD 2FSEA 3HEIB 2AW2A 3T3PB 4U0QB 4R5VA 1DQLL 3WAJA 1K8IA 5EZIH 3DI3B 4AZUA 1EEZA 3VD3A 3ARGD 2Z9TA 3SGKC 3PUCA 3ZHKA 4ZMPA 2YXMA 4AYBA 1ZSDA 4XMPL 2VLLB 5AVVB 5F44A 1KBGL 3PLYA 4YX2H 3PDOB 4FQHA 3VJ6B 1QFHA 1SDDA 1ZPUA 2B1HL 3T09A 5T3ZL 3D69A 3RTLA 5EOTB 4MAYD 1AC0A 4WTZG 5CILL 4KY1L 1K3ZA 1EVUA 2VMCA 3H53A 4J3VA 1XIWB 2YQ3A 1R6VA 2VDMH 3RZWA 2CK0H 5EZJA 2P52A 2HT4C 4OF8A 1QLEL 2OMYB 2Z64C 3TBTB 2WGXA 2XDHA 3C08L 2FVNA 5DHYA 2BS71 3L6FB 3G7TA 3BMWA 1DN0B 4JDZA 3VX1A 4BBWA 2R69A 4G7VH 2CCLA 3V5KA 4L3AA 4FCHA 4XVSL 5ENWB 3RFZC 4P23C 5E8DL 3GD1C 5T1LB 1BZ9A 5ITFB 3HMXH 3O45B 4DJMA 5L4JA 4BUGA 1JZ3A 4G8EB 3FTGA 4FULA 2LHAA 5I1GL 4ES8A 1FC1A 4LCWD 1R4XA 5G4MA 2VZ3A 4QHNA 3C87A 1MJ8H 3VXTB 3Q8FA 1TQCC 4JDEB 1SOXA 4NQVA 1MRCH 4QHPA 4NP9A 3S98A 43C9B 1C5DA 3TOPA 3HZMB 4NKOB 4GT0A 3FQWB 2BINA 3US9A 2MH4A 2NXZB 4NSKB 2WXKA 3R7QA 3UACA 4Q6KA 3F7YB 3MNWA 3IDYC 3RBSA 3MR9B 4WW2F 2NNAA 5ICYA 5E23A 5JLZA 5L7XH 5DC0A 2BP0A 3W9DA 1WD8A 3G9VA 3ESNA 4JFFA 3KBEA 4WEBH 2XN9B 5TD4A 4FFZL 4ORZC 1GKEA 1QQDB 4P9MH 1J1OL 2VN5A 4AX3A 3HNSH 2Y36L 3VXRE 4V11A 2IMMA 3OKOB 4JDVA 2HKAA 4XNUH 4KI5C 3QDGB 4DN4L 5J1AB 2PWEA 3O8XC 3RGVB 2WLIB 3FH5A 4TTGA 2X9WA 4EPSA 1JGLL 3D51A 5JHLH 1S7WB 1W0YT 4URTB 2N7BA 2A0LD 4JFXB 2CIKB 1UOKA 4UQ2B 4BWUA 3NRQA 3SYAA 3QNXB 3S34H 3ZZLA 5SWSE 5I1KL 3S3BB 3QJXA 2NY7L 5FOBB 3EFFA 2HKHH 2G9KA 2JVUA 4HZAA 4DP8X 1SEBB 3QC5X 5T1MB 1MNUL 1S9WB 3ARRA 1CU4L 2WKOF 3OB0H 4UB0L 2P5WE 4KKZA 3TA3C 4FTDA 2QV2A 3BKYL 3H9SA 4OFVA 5KVGE 4L8CB 4WTWA 1NOAA 5CZVH 4LLVA 3WXWH 5J6GB 3Q3GA 4MMZB 3SD2A 3BZDA 4NN5B 1O7VA 3M7FB 5AKTA 2DYSB 1IEHA 1JI2A 2BNRB 4TVSa 2KZWA 4OZGF 5DQ9B 2ZUUA 1OWRM 3IJ9A 4WSJA 3VE0A 3BPNB 3VTAA 4LCCB 5DFVD 2ZOKA 5F88B 4ALAL 1Z6JT 3GMMA 1T0NB 4DW2L 4BZ1H 1T0MB 1MI5D 1ZLEA 2W0PA 2ICWA 4LVHC 3WGUB 4FQJH 3IMUA 2BC4A 4LZKA 4R97B 5INDA 2WANA 1BLNA 3MLYL 2E75C 3FFCA 4DGVL 1YYLL 4N24A 1JNHB 3VM7A 3X11B 4Q89A 5DURD 3KYKH 1EV2E 1FHNA 2OL3A 2ZKXA 1H9DA 4JPVL 2R23A 3B1UA 3WYRA 1KGJA 1NLDH 5K9KB 5HVHB 3EDEA 2XPGB 1FNAA 2Y1YA 5E9DA 2XY1A 3SDDD 1U2HA 1B6UA 3GSOA 3B7RL 3P73A 4HH9B 3RIAK 3RWCB 1PZ2A 4OLYH 3SJVB 2QV4A 3VFRB 4B41A 3CXHK 4JPWH 4X5WA 1RZQA 1OCZB 3QUYC 1JXFA 5DO2D 3UFIA 5EULV 2JTYA 2EUZA 3GMQB 4N8VG 5CSGA 3U7WH 1LO0L 4OV5B 1PDKA 5AOLA 4UZSA 4LDCA 4KTYA 4M3HA 2XWCA 3MSPA 1EZSA 1S78D 3KPNB 3LRHA 5EO1B 1RUQL 2UZXB 1JGVL 3CHSA 1P5VA 3D39B 1K2DB 2WVUA 3H54A 2DI8A 1O7SA 1OZTG 3ZDZF 2GY5A 3ZSTA 2H9GA 2EDJA 3TZVC 5MHSD 3SQOL 3RZCA 3IMTA 1CF8L 2B59A 5D6DA 1L0YA 2Q87A 2WW8A 2A2QT 2XTJB 1Q94B 2F8OA 3P3YA 3VXQB 1M05B 3PGDB 4HIXL 4R8WH 1BZ7A 1Q0XL 3HHMA 4GAYA 4P5TA 1FORH 2HFEA 3HI5H 1DQVA 2X4SB 1JL8A 3MTXA 3NIDF 2WUBL 4GAJL 2DZEA 4UQCA 3ZDYB 2DQCH 3U30B 3OGOE 3RIAF 2QR0A 2YEZB 1TJIH 1U8LB 3GMLA 5DR5L 3HG0A 5A2IH 5AOJA 5DJ2A 2I07A 4QGTA 4FCAA 5FR3A 3W38A 1KDJA 2CDEB 1IC5L 2WNWA 3UAEA 4DUXA 2R69L 2B77A 4PRPD 2XQ0A 1C12A 4WZ9A 3V7AE 3OLGA 3GO1H 3A22A 5JR1H 4OAWB 5A7BA 2BSSB 3TV3H 1MW0A 2VW6A 5A40E 2ZX5A 3QIWD 3X1GA 1SY6L 3DYOA 3BZEB 2DQDH 1OD9A 3J2PA 3BHBB 3SBQA 3RHWK 3WNMA 2D7NA 3L48A 3SGKA 4EN3C 5KVDE 2LLNA 5DZPA 3HS8A 2KERA 5BVPH 1UXSB 2MNUA 1D9KD 3L3JB 3T6ZA 3TYFA 4AQ1B 1MLBA 2YJLA 4PJEF 3RWDA 5MENB 1Z0NA 1QKZL 6FABL 3NFPA 3K8MA 3UJJH 3ZDWA 1F1GA 1RAMA 4N3TA 2J8UF 3L7EA 4O5LH 2KPNA 2NXYB 4WK0B 4ZMYA 2MCMA 5C07D 3VFGH 4JJ5B 5DGRA 1JZ5A 1H3XA 5ADPH 3SE9H 4D7BA 4H0HB 4KO6A 1U58A 1A7RH 2W1NA 3GIZL 3AY2A 1U3YA 2ZF9A 1ZWIA 4KRMB 4MXQC 1EJ6A 5I1CH 3BH8A 3VFOA 4FRWA 3RFZA 2B4CC 4DF9A 4GW4A 1SHMA 4P23A 1FG2B 3A6OA 4JRYB 5F7EL 1KCRL 3WTVA 4JN2A 3KJ4C 4AT6B 4M29A 1BPVA 1TLMA 3NCYP 3ARFC 1IGCH 4QHMA 2Q7YA 3RHWF 4U6YA 2QQNH 3QEGH 4GY4A 3C8KB 3WNLA 3NFNB 3X14B 4CU6A 1FNFA 3EG9A 1JP5A 2ENYA 3LYRA 2VL4A 4X9YA 4KTDL 2VISA 3S5LG 3MLZL 2DLHA 4FL4B 3T1FB 3G5YB 2C4XA 3O4LE 1NMBL 1DVFB 3KEDA 3P77A 3Q2VA 1XCXA 4OI9A 1A9EB 4OLXH 5IBTH 5ABZA 3IDMA 1DO5A 3DDGA 1UVQB 2BY1A 2XIBA 4HS6A 2IH3B 1RD6A 3RWJB 1LQSR 3RWHB 2Y7LA 1ROCA 4Z0XA 1TEFA 3VD1A 3BT2H 3RVUC 3EFDL 4YFLF 2BNUB 4IRJC 1KJ2L 2H6UA 1BFSA 1PTZA 2QT6A 4QF1B 4Z7QE 2FJGB 3HE7D 4BUQA 3O8XA 4F15B 3U0TB 4BKTC 2Q1EA 3HPLB 4F7CB 4HETA 4EOWH 5SWZE 1WA1X 2ED7A 4BWTA 1UC6A 2DQGH 1SBSH 4N87A 3VB8A 4QHKI 5EDXA 4GG6B 3J07A 1QWUA 4WO4D 4ZOCA 2D3VA 4B3VA 2K4WA 4OF0A 1IC7H 4U1KB 1ZT7A 4FEMA 4O2FA 2K7QA 5I16B 1BJMA 3F7RA 2X4QB 5T33H 4JKLA 1B0GB 3QDHA 4YIQB 3CSTA 2ZG2A 4KHXH 2X28A 5T1DH 1KWGA 4GB9A 1K8DA 3FUHA 3F65A 1DFBH 2PNDA 4WKZA 4Y8AA 3TA3A 5T3XE 2V8LA 5CLYA 4HCFA 2Y2WA 3D18B 1AYRA 1E4KC 2PETA 5D4IA 1J18A 3SKJL 4CNIB 2GTZA 2V4LA 4I2XA 3GMNA 3ISWA 3WIFA 5SX4I 1Z32X 3WKQA 4I3RH 3U4AA 2VXUH 4J5VA 3FT1A 2FZ3B 2ITCA 1AZBA 4Y2DD 1Q9KB 5C0NC 5LJYH 3U7YL 2N59A 3FB6A 2LTQC 1IAIL 4GRLD 1IBGH 1BJ1J 4Y1AB 5LB1A 1FE8H 4LU5L 5DJDB 1MHCA 2QKIC 3EO9L 3O2DL 2R29H 5I1AB 3ABKB 3SKNA 3TIDB 1CN4A 1A7QL 2BWIA 2CBPA 3KXFE 3RWEA 3QDJE 1OTTD 3CFEA 2OI9C 3IETB 3JUZA 2R2BB 3IXTA 1ND0B 3T5WA 4HPYH 5D9SA 4G5ZL 5AVZB 2C9SA 4ODXB 3MO1B 5IVXB 1H5BB 1IAMA 4AE1A 4EQ2A 3JTSB 4HP5A 2HRPH 4OCWL 3VA6A 6CGTA 1LE9B 1YPZE 4JKPL 4M6AA 4OF6A 3ILQD 3N91A 3O6KL 1VGEL 2DJMA 5FUOH 3QUYA 1JCVA 1PYWA 2EDHA 3MRRB 3OMIB 4CADA 1BBDH 2YMTA 1X5FA 2VAJA 3DGDA 1II4E 3G08A 1K85A 3FRPG 1IZJA 1U8MA 3O6FC 4W4OC 4NZJA 5DEFB 3P3TA 1UZ6F 4G43A 3UXFA 3QNYB 1IARB 3O9WB 3E6HA 3M86A 4X4XB 2UWEF 3QNFA 4YHZL 2ODHA 4J3BA 4UTAA 2BO0A 2CGRH 3MRFA 1OAQL 3ARDB 2YXVA 3RBGA 1NJ9B 2XKNB 2ZWZA 4UIKL 1PKQB 4N1HB 5IROD 4ODSL 3IE4A 1T03H 1PJWA 2AF2A 2WAHA 2LQRA 2MTAA 4PEEA 2XQYK 4YH6A 5MI0B 3TZVA 7PAZA 1QSVA 1YEIH 2L0DA 5E4OA 3ZK0A 5KJ7E 2R1YA 1VENA 2XRAH 3RWFB 2HH0H 3WHE1 2CU9A 2WWMD 2Y9RT 3Q6GL 4HA1A 2IPUG 4R4ND 3RPBA 3H7BA 4EIUA 5EUOB 1CICD 4OJFH 2ZX7A 2EKSA 2KMWA 2R56H 5I23A 4BKLA 3CVIH 1HZHL 2H6PA 4PRAB 2W95A 2BJMH 5DRWB 2AEQH 3BN9C 3BJLA 4PJ7E 2VN6A 3MRQB 3U6RB 3TO4B 3QPQD 1EGJA 3FQUA 3QQ4A 4F93B 4IRSB 3VXMA 5F3BA 5GSRA 1V8HA 4EKXA 4IMKC 1IC4H 3QWOA 2YLKA 4HUUA 5AVWB 3JWOC 3ATDA 3AS0A 3E0GA 1I4FB 5F21B 2BVQA 4ABVA 1VLXA 3QORC 5IB5B 2CHWA 1N0XL 4MQTB 3PWPE 5FECA 1N2RB 4EN3A 2A1WH 1E67A 3RL2A 1B3JA 1SDYA 2RD0A 1B4RA 4EZMA 1PIGA 1RZ8A 1QSEE 1HHIA 2PYFB 4PGJA 5CEZH 4N6QA 4M6MH 3QRGH 4HPOH 4ORGA 2XHNA 4EDWH 1OCCB 1T0OA 2ICWI 3LPFA 4YDIL 3SDXA 4NQSB 4HOXA 4X4YA 1TQBC 4HJGA 4GKZA 2CLZA 5DZVA 3RNQA 5HHQA 3HNVH 1UKTA 5GJSL 4NUGL 4N4YB 5EN2B 3CFIC 1UOWA 5ANME 1G43A 2CR0A 3BIAX 3L5JA 1BIHA 3FO9B 5HD8C 4R4FH 4RGMB 4NZUH 2BY3A 4FFWC 5DGQA 6PAZA 3L7FB 4QYOB 4NHUB 1JRHH 3WXVL 1MWAA 2DH2A 3P9MB 3EIFA 2VXSH 3IRPX 1F58H 3BYTA 1G1OA 4B53A 3V0VA 5A6MA 2PW2A 2VR9A 2AJVL 4U1IB 1SLWA 3ARFA 2EUWA 2BIIA 1QPKA 3IAQA 4Y4FD 5AVTB 3JSSA 2C1OA 5ESVA 1A21A 1E3ZA 1U8NB 3IKCB 2C9RA 5GSVA 1I8MA 1JTTA 1EAPA 2O4EA 4X98A 3LCYA 4Q6IB 1FRGH 2VABB 2J6EL 2CDFA 3JV5A 3KVQA 3UL4A 1BEYH 1F6AB 1I1AC 1MFAL 5FUCE 1TEYA 3VI4F 4HIEA 2TAAA 1MJUH 1OZUA 3EZJB 3IGAB 4TSAH 4EVNA 3S97C 2PR4L 3SDYL 5IB1B 4P9HC 5KEZA 4M6NL 1YYCA 1JV5B 2DYRB 3CK0L 3GSUA 1E8YA 1LQBC 3GUFA 3T77A 2HXAA 3SCMB 5GHWL 3FN0L 1XIWD 4YMPA 5JA9A 3TURA 5C3IA 2R4SH 3DSNA 1U6AL 2DYPB 1KOAA 4YHML 4FN0A 4PREA 4JPKH 3CFJA 5LG6A 5E08L 4FQ1H 4JQIA 2A7BA 4FMFA 1LWRA 1NCHA 2W9DH 2EADA 3OSKA 1B4JH 1FVEA 2F54E 3RVWD 5A6LA 5L2KA 1QSFB 2EYTA 3BGMA 4GRWB 5H35B 1CYGA 3X13A 4AQEA 2NZ9D 3VFNB 3SYPA 2D31A 5DHXB 5IGXH 5T1LD 5IVNA 4GBXC 4O4YL 1HKLH 5I18H 2AERT 3UAAA 3TJEH 3ZKXC 1HJCA 1AZZC 1CZ8H 4I5BA 4PMFA 3V6FA 2HN7B 4F33B 4RZCA 2VITA 3H2PA 4HUMB 5EIIG 1WAPA 2XG4A 3VG9C 1K5NB 3MCKA 3HKZA 2H0EA 2X44D 3ZRFC 1FGNH 4YDVB 2ESVE 4K8RL 3JWNC 3V7MA 3WKNA 4C56E 1DCLA 3DWTA 4K5PA 4ONFH 3BUYA 3PAVA 4J8QA 1E4KA 1LO5A 1ZGLA 2P7TA 5BUPA 5IMMB 5A2BA 2W60B 3F7VA 4OGQC 4ZPTB 2WQUA 4UTBA 1HSBB 4L5FE 3UJTL 1OGAE 1JPSH 3T1WA 1XSOA 2XN9D 5FHBL 2CBOA 2I27N 3BE1L 3EYSL 4WWKC 1CDBA 1DEDA 3T9WA 3OC5A 4ZMVA 1AR2A 2QKIA 4MDJA 3IWVA 1ZS2A 3RGVD 1F11A 2J56A 1CGWA 1DANU 5DJ6B 2XLLA 2BY2A 1KPVB 3CVHL 4GSUA 2Q8BH 4HIHB 5EU6A 4RCAA 3C2AL 3RFRA 3U4BH 2V7HA 4HCRA 1C7TA 3H85A 3SGEI 4JANA 1M9WA 1LL1A 1KLFB 4DKFL 1MIEL 1MHHB 5E5MA 1IBZA 1DSWA 1G7HA 4UT6H 2XV3A 5F7WC 4DPAX 4B7LA 4LRNL 2PCFA 4P5SA 5AOZA 4ZAKB 1J8RA 1EEQA 4NC1C 4BWWA 5ID1A 1NCBL 5LQBH 1DFXA 1OP4A 2RIKA 1RVFH 2N1KA 1CR9L 3ULUC 1H3PL 3CN3A 3VFPB 5HSFA 1NCJA 3O3EB 1EGJL 5BOZG 5C0IB 1HIML 3KYAA 2EH7H 5SWSA 3EYUL 4BZYA 1JXDA 3CH1B 3O6FA 4JY4A 4W4OA 1IE4A 2GJ6E 4OFQA 2EVIA 4OGXH 4HISA 2XWDA 5HVFB 3T8MA 1PGRB 1MREH 2NY3C 2PYEA 4RMQA 3TT1H 1ADQH 2WTRA 2BNRD 3MRJB 4EI5B 5EA0L 1X5GA 1KLUA 4ETQB 4WLCA 5IJVB 5AW3B 1C08B 1TYRA 1NWOA 1V7NH 1F3DH 4FFYA 4KRPB 4L8DB 3AT9A 1GIGL 1ZHKA 4IU2B 2OXGA 3QXTA 3LKPB 1JJUA 5JOFA 2X4PB 1KGIA 2LVCA 1FZMB 2Z31B 1PSKH 4KK6C 1P4IH 1ZA6B 3NA9L 4N90D 3WS3B 5A2AA 4N0CD 3MRNA 1CFQB 4X50A 1CGXA 3V4VB 3ZE0F 3KPOB 5B39A 3UEZA 2EO1A 2VLJB 3GNMH 2E9GA 1PMYA 1KC5L 4U6HB 1B9ZA 1AKJB 2HX8A 2L8AA 1YCSA 3R1GH 4FYTA 4HZLA 3IAGC 4PY8I 3SJVD 3WUZA 4FP8H 4IMKA 5DZ9A 2A6JB 5DI8A 2X4OB 5JDSA 2CG9X 2HRGA 1Q72L 2ZUWA 2A73A 1ZEAL 3PRZA 1M2OA 3Q7JA 3WFBH 2ZOWA 4W9DC 5I6KA 5IB2B 1TR7A 3QORA 4XP4H 1YYMH 4M62L 3MRHB 1QA9A 1AD0A 1TQVA 2NR6D 4I1NB 2BWQA 4N9GB 3U36A 3CSYB 3RWGB 4CW1B 1AZRA 2GHZA 4HIJA 4U31A 5IBLC 3MLUH 3CUPB 2DM4A 3D39D 4X7EC 3OL2A 1GSMA 3FF8A 3LRSA 3WKMH 1IFHL 1I7ZA 4GYBA 5AOIA 1KIRB 1CC3A 1PS3A 5BRZA 4UYPA 5FB8A 2EVHA 3MACH 3F2LA 1ACZA 2XTJD 2FHFA 5F70A 4JGNA 2QBWA 1FFOA 2MTPA 3D0VA 3IJEA 4AGQA 4XNDA 2BOLA 1FJ1A 3BQUC 5D72L 4KZEL 1KPRB 3P9WB 1XF4B 3LKNA 4PRDB 4KTGA 4H25B 3ESUF 1CD1B 2Y7QA 4IK6A 4M43H 5ERWB 3FMGL 4AYMC 4X6FB 2Z92A 1AFVL 2NY1C 2YBRA 1S7TA 4K71B 4FG6D 4OZIE 3TBVB 4TLKA 2P3YA 3B8SA 3OHMB 5F1KC 4IS6B 4LPCA 1U92A 3I84A 1HI6B 4MYPA 4HWNA 3DK2A 3SE3C 1TITA 4FZEH 4JRXE 4A2MA 5F1NB 2H2PD 3TH2T 1AR1D 1EJ8A 2OFQA 1MZYA 3C6LC 1WD9A 2YKLH 5DZAA 2DD8L 1VIWA 4UM9B 1CURA 4S2SA 3N40P 1QRKA 1FO0H 4I13B 1RU9H 4Z76A 2VRAA 4XCFH 1DE4A 4ELME 3PQYE 2WLKA 1I1AA 2JF1A 5I1LB 3BVUA 5KSAB 1TO4A 3PXHA 2YEVB 3GIVB 3DIVA 5E9NA 2X1QA 5BNXD 4EIBA 4XX1G 5I75C 4FKEA 3LIZL 4NJAH 1RZIA 1AKPA 1BWWA 5A16B 3FFDB 2YAFA 4YSRA 2DWSA 5BOJA 1QG3A 4OT1H 3TEZA 1KTBA 1NMAL 2NXYD 3QIBC 3RKDC 5BZWB 5D1XC 3ZMNA 5M95B 3MV8E 3P4NB 2OMZA 4PV8A 4BCYA 4EI6B 2MRYA 4HBCL 3EBHA 5J5EA 2ADGB 3X1FA 1QRNE 4XB8A 2A99A 2DJUA 3QI9B 5FYJH 1DEEB 4KJPD 1NCWL 1U33A 3ECQA 1QTPA 4A2LA 1CFBA 1UKSA 5C7XL 1V7ML 4NAMA 4JRYD 2EO7A 2G4GA 4PJIE 5E99H 1H3VA 4GBXA 1EVTC 1IAIM 5JW4R 4D3CL 4M5ZL 1NTDA 1HT6A 4NKMB 1W91A 3HS0C 4G6MH 1H0DB 1I7UA 1D6VH 5I0VA 1NICA 4IEFB 4QKTA 1MFCL 1A1NA 2X1XR 4LAQH 5I9QC 1KT2A 2GK0A 5E0QA 3W37A 4Y9FA 2BHUA 4DZ8A 4F7PA 5JQ6H 4WJ5A 4A7QA 1QABA 3NYKA 5IFAL 4GS7C 3OM3B 1U36A 3GRWL 1BOYA 3U7AA 2A6IA 3LN4A 1AVAA 2FX8L 8PAZA 5E24E 1GGUA 4NOFA 3S7GA 3IJYB 2F5AH 1A02N 1QO3A 4HKBB 2VXQH 4WWKA 4LLQA 1CFMA 1OGTA 4NPJA 4LNVA 1BEXA 1GOGA 3AS3A 3I6GA 3WOVA 5ITBL 1NGYB 1EXUA 1BQ5A 2IMNA 5FUCC 5KVGL 4WU7A 4IRZL 4KPHL 2OJZL 4Y89A 4Q9RH 2IQAA 4PJCF 5HDBF 1IGML 1MRFH 2H0JA 3ARVA 1A6ZA 1RZ7H 3M45A 3MRIA 3NJFA 4NN6B 1BVOA 4EZKA 3GSRB 2EVJA 5SX5H 2EC9T 3WNJA 4BQ6A 2Q76A 4MXWH 3B43A 4NWTH 3ZE2F 4X2UA 5F6IB 3PV7A 4AYFA 1V5JA 4A63A 5FLVA 4CA4A 3EFOB 4GFXA 4YDNA 4UAOC 3LD8C 3FQXB 1MFEH 1FSKC 4J3OD 4OFPA 5LDUA 5CCKL 4NKDA 4XRCB 5SWZA 2IAMB 4JFDE 3TBYA 1E30A 1LVEA 2L7UA 3LRLA 3W5MA 1T3FA 1WC7A 2OK0L 4O51A 4M48H 2QPSA 4RQQA 1ETJA 4JVUA 2FL5A 3QUML 4WI3A 2EEDA 3K6FA 4YUEL 3LB6D 3LXBA 2VW7A 4G7YH 3HCVA 1RUPH 2H26B 4G1EB 3P02A 4KQ4L 5DZOA 2VXTL 5DU7A 2DBLL 1NM4A 3GBNH 3NCXA 4ODWA 2O6EA 4EBQL 4J8RA 2OJEB 3N42B 4NIKB 1I1CA 4LEOA 3FT3A 4N28A 4Y1AD 4K5OA 3EBIA 1S7RA 5D93C 4HULB 2IAND 2GJJA 4Q56A 4IKJA 3UBXG 4C4UA 4DQOL 1G0XA 4KHTL 3RY4A 1JWUA 3MN8A 4JGJA 5K1JA 1CE1L 1G84A 1NAKH 3AABA 3BXNB 1MFBL 4X99A 2IGFL 1LGVA 3FOMB 3MLSH 5F8RC 5D5MA 4PP2B 2A9ML 3EH3B 1SM3H 4Y4HD 1UYWH 1GS6X 3DO7A 1T4WA 2HJLA 3CN1A 5TDPB 3D3VA 4HUVB 1E9QB 3ECUA 4OJYA 3T65B 2ZXEB 5DEGA 4MCZA 2VERN 2DDQL 4XPTL 1M1XB 3D87B 5I82A 2ZOUA 3QDJA 4HAKA 4QXWA 1Q8MA 3O6MH 3KZ8A 5FWQA 3VXPB 4AVKA 2CKBB 4QTIL 4BH7A 2JKIS 5IG7A 4AJ0A 4RLDA 4FNLH 4WFHD 3F84A 1NZRA 4UDUB 4HU8A 2MOGA 3O9WD 2HUHA 5I17A 4Z95H 4OZ4B 3HPJB 3MKGA 2DTMH 4FERA 3PWUB 4S1RH 5I8KH 1V05A 2PXYB 5J13B 4FXLA 4JHZA 2VZOA 3DROB 3L3GB 2G3ZA 3NIGE 2GITA 1R3HA 2FGWL 2NY6B 4OUUB 1AP2A 1AZCA 2P5EA 3LEVH 4DVBB 3TS8A 3VFTA 4WI9A 4BQBA 2RMNA 5DF0A 1IX2A 4UOZA 1NFKA 3QISA 1A6VH 4HJ0D 3IMSA 5IEHB 3UC0L 4Y5YC 1ZA3B 1BF5A 1FC2D 3QS3A 4LP4A 3BP4A 3BQUA 1SMOA 1AGEA 4WNQA 1J9TA 4MD0B 2VMJA 5GGVH 3GHBH 3GMPA 4Z18A 2CR6A 5KVDL 3UYPB 1UHVA 4Q9CA 1CLCA 2XKSA 2QQLL 4GAFB 2H3KA 3CXDL 4FQ2L 5GS1B 2J43A 4BK5C 5B3JF 1FNLA 2QEJA 2CRZA 2PKDA 1JTPA 3QQDA 2PW1B 4FTVE 4M8QB 1OPGL 3MLXL 4CILA 3U79A 3GSNB 2ZX8A 1OHZA 1Q9LA 4NJ9H 3V0JA 2BOBB 4YPGB 3CLWA 4X4ZA 1PZAA 3OAUL 2CUIA 4WHTB 3C6LA 5F1IA 1P4UA 4ANWA 4OB5H 4QGYA 3HG4A 5B8CB 1D5BA 3CG8A 5LWYH 4WDIA 3ULVE 4PJ7A 3V95A 3H9HA 4YSCA 5CWSB 4B5ZA 3BD5A 1OP3H 4K23L 4WI0A 3CHPA 2W65B 4NM8L 4XC1H 3DJTA 1CT8A 5DFTA 1ORSB 5DUBA 2YRZA 2OXHA 4NRYB 3WE6A 3FCSA 3LZFL 4MNGE 4PJGA 3QIBA 1N7MH 4XN9A 5D1XA 3L5IA 4WTZA 3SDCB 3VYNA 5IK3B 2FJFA 3VVVA 3HE6D 1KIPB 5GZOC 3TJHC 2L7QA 3AU1B 1DBAH 3F3HA 4AKQA 3D85A 4RMRA 4FHBD 4HCGA 1FVDA 4U1MB 3WNPA 3N9GL 4OQTH 2H32H 3OKDA 4GQ9L 4ZBJA 1TDQA 3TIEB 2JIXB 1UWYA 4YOKA 3MBEC 3VI3A 1AQKH 3HS0A 1AGFB 5EZPA 5ISZA 1ZS8A 2YEQA 4TQPA 5AW2B 5CEXB 1JAEA 4JO1H 4CVXB 4A7TA 4Z7VB 3VRIB 1INQB 4B95C 3OKKB 1N64H 4N9OB 5B1AB 4MQXD 5E94A 4F9LC 5KVEE 3KJ6L 1QR1B 4TQ8A 4WI5A 1R3JA 3QCUH 3I9GH 3R19A 4HXAH 2AJXH 1J88A 3QCTL 3X2QB 1OY3B 4HGWB 4PS4H 3STLA 1Z3GL 2CKBL 4KROC 1LEIB 2X4TB 2F7PA 3KD4A 3S3SA 3A0OA 3SCMD 4QJ3B 2VLRD 4BZ2L 2G5BA 4ZPVA 1W72A 2Z35B 3L2LA 4HJTA 4C54A 2DYPD 1S8DB 5T3XL 3B7TA 2ZXAA 2KQMA 1C7SA 4GW1B 4LSRL 2UY6B 3QDME 3PGFH 3U9PH 3ZVVA 4KKBC 4MCYA 3GTTA 4DGIH 3R4RA 4HLZG 4ZZFA 4M6OH 2YPLA 3SDAC 2BOCA 2AGJH 2NW3A 2O6PA 3H55A 3IJHA 2NQ3A 4YK4C 4IHOB 3A67H 1NBCA 1IGTB 2FX7H 1UG9A 1KJVA 4FG2A 2ITDB 2AAAA 5FV1L 5FGCE 4TMPA 1GH7A 4X9GA 5E6UB 1OTSD 3NJKA 4Z8FL 1HH6B 4WW1B 1YECH 2R9HC 4P2QB 2D73A 3JXAA 3ASWA 1MQ8A 2H0FA 4S1SL 4N2LA 5HHNB 1N70A 2AV1A 1LP9A 3V0DA 3WE1A 1HZKA 3IBEA 4MD5B 5D7LB 3MBXL 1KF9B 3TWCH 1RK1B 2A38A 2YGNA 3MV9E 1M6UA 3HKFA 3N04A 3N85L 3CWGA 2EYSA 4N8UA 4MVBD 4DP2X 5AL8A 1FWXA 4AW7A 4U3SB 1TKWA 4O2CB 2CGZA 4JQXC 1F4WL 1LK2A 3D4GA 2WXPA 1ZVSA 1T0PB 3HUJA 3KPMA 4P3DA 4S10A 5FDWA 4MJIA 1DBJH 2ZCHL 4J28A 4BXVA 3UAFA 2OTPA 3V2AR 4IBTA 4LQFL 5HHPA 4XCNA 4D8OA 2WLZA 5BS0A 1LO4H 5LBSH 5C09B 1XCTA 5T8IA 4PJBE 4PWGA 4YDMA 4AIZA 1RK7A 1KFAH 4ODHH 4XZ4A 1F4HA 4WTQA 5CGYD 3A6BH 4L05A 3DARA 1LXMA 1MY7A 3E2HC 5JXAL 2VDRL 3G5ZB 1RMFH 4CAGA 2XWTA 4ZAKD 5I71B 5ELIA 3KLLA 1N67A 2GCYB 3IVKA 1Q0YL 4N2BA 1EJOL 2YD3A 1MPAL 3L45A 4APXA 3JZ7A 4WFFE 3RB7A 4Z7WF 1G9MH 5DSCA 2HFGL 3ESVF 3UBHA 3S3PA 1ULVA 1F3JB 3EOAB 1OARL 1RUMH 3IF1B 3T4YB 3VXSA 5JMOC 1UZGA 3OKYA 1PF3A 3MV7B 3K91A 2APXA 2EDOA 1JPGA 4X4ME 1BQUA 1YEEH 1D5XA 1ZVNA 4EI5D 1A4KB 4YHNA 5GRUL 3V0WH 1PY0A 4KQ0A 4N8VA 1FVCA 3NA4A 4O02L 4WW2C 1IL1B 1Q1JH 1ORQB 2YRBA 3FRUB 5HTSA 3OJDA 4NT6A 2HFFB 3UAJC 4G42A 4GH7B 3QFJB 4FA8A 4PRNB 1AGDA 3BDYL 3GJFH 4ODTH 4WI8A 3CDCA 4M5YL 4F3FA 4G9DB 1HEZA 4QRFA 1UEYA 2CLVA 3GQFA 3QXAA 4QXUH 3TX4A 2VDOB 1A6UL 2EO9A 4I4WA 1X7SA 3NH7L 4LLYA 2G5UA 2WP3O 3FZUD 4Y5YA 2Z31D 3HC0B 1WHOA 5KS9B 5FYKH 2PTTB 5HHXL 4YE4L 2PTUA 3EJRA 4HSQA 1ZGLP 1HL8A 3WY3A 1QLRB 2EZ0C 1LE5A 5IHUH 4UF7C 3QAQA 3HC4H 1ZHNB 1AKJD 5I2IA 2NYYD 4BK5A 3QXDB 5HGDB 4PJHE 3V4UH 2FX9H 4CU7A 1TVDA 5CJOL 4LNRB 3US1A 2AVGA 3G5XB 4HUXA 4FNPA 3CC1A 2FSEB 3RY6C 3PHOA 3VFVB 3AB0B 4RSYA 2ZONA 1HNYA 5ILTL 1BFVH 4DQAA 1EEZB 4KXAA 5DLLA 1SLVA 3UMTA 2ZYIA 5E8PB 2C7UA 5BMFL 2X6MA 4R0LB 5FDYA 5C86A 4KMLB 1F97A 4N2GA 3GLDA 5EU7C 1GGBH 1MY5A 3N43B 4RBPK 4ZQTA 1GSKA 5EZLA 3LDBC 1E50A 4A66A 1HX0A 1RZKH 2DPKA 3LKRA 4PTTB 1BJ8A 1TUPA 5KTEH 2M26A 3MFFA 5AW7B 2NTFA 2FB4L 5EZJB 1ZLWH 1PCSA 3BAWA 1AO7D 3F12B 4QLWA 3HG5A 4YHIA 5DHYB 5BVJA 1A7OL 4M7JL 1ZRUA 3PNRB 2XWXA 4F2MB 3V6ZA 2VRQA 4JDZB 1SLXA 2X0VA 4P2RE 5E8OA 5GZOA 3G3LA 4PJFE 2EXYC 2PCXA 4A04A 5I8OH 3FTSA 3RE0A 1VRSA 4HXBL 3Q2CA 1BZ9B 4QRRD 3RAJH 5FFLA 4KGJA 2YBGA 3FTGB 2V6HA 1GPOH 1FL3B 4JGMA 4K7PX 2WXGA 1WF5A 3MBEA 1R5WA 2DEYX 2MHAA 2Y4SA 1F0LA 3DPBA 4GP5B 1MFDL 4P5KA 4PJDF 4QHNB 1X6LA 4JJHA 4PRHE 4NQVB 1G7JA 4Q9BA 1TU2A 2YRLA 3E3QC 4UM9D 1DVYA 1F00I 4XWOC 4F9LA 3MJ9H 5C3TA 3GBMH 4KK9C 1A1OA 5H94A 4D0CA 2Y69B 4ZX5A 3P0VL 5KSAD 2NNAB 3TEXA 5ICYB 5DMKB 2IDUA 1DJYA 2BP0B 1B2WH 4PUBL 3NACL 3LS5L 2KLTA 3KPRA 4OBSA 3S5LA 5GRWA 5JOEA 4CKQA 3VFUA 3O3BA 5CEZE 5TE7H 5TGBA 5A2LH 1USQA 3EUUA 5KBMA 2R2HB 2RHEA 4D7PA 2GG1A 4EXKA 1AY1H 3QJFB 4HF5L 4OY9A 5CLXA 4S0TD 4ADJA 3QPXH 4G6FB 1MXGA 1BVKB 4XN2A 1F8TL 5FM4A 4PJ6A 3QI9D 3APDA 1J1PH 3IN0A 4NGHH 1XF5A 3MLTB 1U21A 4FX5A 3FU7A 2Q10A 3EFFB 4WUKL 5GS0D 3SDAA 2E9BA 3GLEA 4MKMA 4L5FL 1J8HA 1NCCL 1U8CA 3FHEA 2F74A 4NUJA 3WI9A 1SEQH 5F71A 3FHAA 3ZHDA 5F96L 1BPLB 4ZOEA 3VSVA 1TTUA 4PJ9C 3EHBC 4I89A 3BUIA 2XCMC 5CSBA 4UUJA 1J11A 2AJ3B 2COVD 3AXLA 5IESH 3CFBB 3UZVA 2VGLM 5HGAB 4V1DD 2IH9A 3Q3GB 1C9SA 2JE8A 4DGYL 3HAEH 5E51A 1UJTA 2VDPB 2VLME 3C5XA 2XBDA 3ZKSD 1HHHA 1L6XA 5DD3H 5EBGA 3WIHH 1IM3A 3VE0B 3FQNA 3TXAA 1Y6NR 2XXMB 2ZOKB 4YHLH 3GMMB 4JQXA 1HQ4A 2HSIA 5K9QI 2ICWB 5BQDA 2AQNA 4Z77A 5ID0B 2BC4B 3MRMA 1NLBH 4FQCL 5HPMA 5INDB 1BLNB 3QWQB 5I73C 2FO4B 1CYXA 3FFCB 3PY9A 5EF2A 2YPKB 1URIA 1X7QA 4AENA 2CO2A 4AEHH 1Z9OA 3ZYIA 1CXEA 1PX3A 1XH0A 3D4ZA 5F9OL 4DKEL 4XPBH 1A14H 5D2NE 3SYCA 5D7JD 2OL3B 4AITA 1AXTL 2R23B 3DHUA 4G59C 5IW1B 3OB8A 4KDVA 4L1LA 3UGXA 2XBZA 1CDJA 2ETWA 5E9DB 4AL8H 5D1QE 2LLGA 3WHE0 3TC9A 3GSOB 4DETA 2J4WH 3P73B 2IBGA 3DRQB 1VKXA 1A3QA 5D7EA 4AEEA 1I82A 2YO3A 5IUCA 1HQRB 1WP6A 2JMRA 4Q8BA 4X5WB 2DQ6A 1OHQA 2ZUVA 1DL7L 4PJXA 2BVUA 2YPVL 3ATBA 4M9OA 3H3BC 4PJIB 1PDKB 5FWRA 3QAZB 3TCLB 4N8CH 1LO3L 5DZLA 1OOWA 1UA6H 2Y3NA 3OKMB 3BAKA 1U3ZA 2LU3A 3FRPA 3HMXA 5CJ8A 1P5VB 4WUUA 2OR9H 4JB9L 4WW2A 3AREB 3CFDB 3UAJA 1M1SA 3GXIA 4QMEA 3E6FB 3MODH 2H9GB 3E80A 3KLHC 1DQLH 3RZCB 3CX5J 3DTUB 1BXXA 2B59B 2ZSWA 3SPHA 3Q06A 5K39A 4PP1D 3NPSC 5CAYB 1BZ7B 2HX7A 1HAUA 2WXHA 1QBML 2C1PA 2CJSA 4GAYB 2HFEB 3VXUD 1BF8A 2R8SL 4XMPH 4EUPB 3VU1A 2X05A 1KBGH 4L8SB 5KSUB 2AVFA 2B1HH 3GMLB 5T3ZH 5EZOL 2AZAA 4ZXBC 3M07A 1OK0A 1HAWA 2I07B 5DJ2B 1JVOA 4KY1H 3JVGC 5CILH 3WLBA 5L2JA 3M7OA 4H8UA 2J55A 3FOLA 1IV8A 3H8NA 1C12B 2WKOA 1QLEH 3FAWA 3RY6A 3C08H 1E2ZA 1Q9OA 5JHLA 3K2IA 3WNOA 2NUTA 5BW7C 1OCWL 5AOKA 2E7DA 1W9XA 2JI1A 4P3CL 3HIZA 2VZTA 4XH2A 7FABL 4Z7IA 4JG1L 2W0FA 5E8DH 2EE3A 3EH1A 2PXYD 4XP1L 2VL5A 3TYFB 1M2VA 1CB4A 5T1KA 1D5MB 1GY2A 1KXTA 1MLBB 3I9AA 5I1GH 3GLAA 3RWDB 3V10A 3J27A 2Y23A 5D7KE 2XNAA 2Q8AL 5KSBF 2IGLA 1RL1A 1FF5A 4L4TE 2I60L 3L7EB 3K72A 5CJBA 3ARPA 1I75A 2UUDK 4Y2LA 3MV01 5AAPA 4YDLB 5KSVB 1RZPA 2GYSA 3NSCA 2LV4A 3OF6A 3BIKA 1U58B 4QDGA 4N0YL 1ZWIB 2B0SL 2F58L 2ROXA 3CZNA 4G72B 1J9CT 3VFOB 5KYWA 3RFZB 4FFZH 4GW4B 1I53A 4P23B 2X53A 1J1OH 4H8QA 4JN2B 1FIGL 4N86A 2YMXL 4BZ1A 3ARYA 1SZNA 2GJZA 4DN4H 4X6CB 4M5TA 2Q7YB 4U6YB 3FL7A 2PWGA 3PP3H 3DHJA 3F7LA 1JGLH 1JHTB 1TQCB 3S3CB 2CGYA 2EDNA 3EG9B 3T8XA 4ZMAT 2K3TA 2PPCA 3IJSA 4JW3A 2RCSL 2BIMA 2FEDD 5I1KH 3NP3A 3B2VL 3L1OL 2NY7H 5F7AA 4OF5A 4ODVL 5DVKA 3VWKC 3II1A 3K71B 3IDYB 3MTRA 3P77B 5CU5A 3IDMB 1ZLDA 4NRXA 4HS6B 1CU4H 3OLDA 4UB0H 4CKVX 1NC2A 2XWEA 4LP5A 4Z0XB 3UBGA 3BKYH 2Q20A 2WXJA 2ZUXA 2XV6B 1N4XL 2YWZA 3KHOA 4X8JB 4YZFF 5D7IF 4M1GL 3L13A 1MQKH 3ISRA 4HAGA 5B7FA 4J4PD 2GI7A 4LCUA 4Z7NE 3SDCD 3WJJC 2JI2A 1TTBA 4LPVA 1MAKA 3PHQA 4IOSD 3L16A 3N2JA 5DWPA 3H4FA 2UY7B 4UV4L 4YFEA 1ZT7B 3GXTA 1DVUA 5CM1A 1ZOXA 4OM0L 5IP4A 3HR5A 1G5AA 3NFSL 4ALAH 1ZXKA 2JIXD 1TZHB 2DI7A 1YEGL 1RPKA 4U7KA 4DW2H 1HN1A 4CVZA 1BXUA 1T22B 3ZO0A 3B9AA 4DERA 4R7DA 5BQ7A 3AQYA 3MLYH 4PJ9A 2DQJL 4CDHA 4DGVH 1YYLH 3Q05A 3K4AA 2GTZB 5EIIA 4I2XB 3N0AA 5F3HA 3GMNB 3DRTA 2FE0A 2N56A 4JPVH 1WSST 4BJLA 5KUKA 5DFWH 1L9TA 3GFUA 4NXKA 3W0WE 2DLFL 2ITCB 3CLFL 4GAAA 2I5YL 1U91A 4HG4K 2Y22A 3V4PL 3OZKA 1IKNC 3T0VA 2WN2A 2CO4A 4J3WA 4XNZB 2VC2B 3RB5A 1NKGA 1WFOA 2FT8A 1P84K 1JNNL 1MHCB 4MSWB 3TCTA 1EHLL 3RA7L 3MROB 3FW6A 3L4YA 1LO0H 4IGBC 4LVHB 4DGUA 2J8UA 1UZ8A 1JZFA 4M4RB 1ZDQA 4OLZL 3CFEB 5B7EA 1RUQH 1JGVH 1EDHA 4JM2A 4JFHE 2B3RA 2VXVL 3L5WA 1BD2D 2ZWKA 4I9WD 4LKXA 3IXTB 2TSAA 2IADB 2EILB 3KPTA 4JO2L 2XWZA 1R17A 4XO8A 1YAIA 4MRBA 3QT2A 3SQOH 1CF8H 1MW2A 3Q01A 4XCCL 1A25A 3OXRB 1GJUA 4B9KC 2LAGB 4HIXH 2H41A 1CTNA 1Q0XH 1GA2A 3QUYB 4P2QD 1PYWB 4CADB 2NT0A 2BHYA 3HNSL 1U8IA 5AB2A 1U8MB 3NBNA 2AK4E 4GAJH 3TBSA 2LGNA 5A2CA 5D7LD 5CCGE 1RZFL 3P30L 1E28A 3LY6A 3E6HB 5DR5H 1P2CA 3LXUX 5KBPA 1W0VA 1ONQA 3MRFB 4IKKA 3GBLA 5HYFA 1IC5H 2XJLA 2DY2A 1JERA 3L81A 4WGVB 4POZD 2IIJA 2IDCA 4XE5B 4O9HL 4XN1A 2LW3A 3QR1A 1SY6H 4ATTA 2DLIA 2R1YB 4O58L 5JIHA 4Q58C 2HJFA 3QQ3A 1OP5K 4LO9A 4H40A 4JO5A 1D2PA 3JT0A 1T2XA 2UZIL 3H7BB 3K4DA 4JFTA 1UGKA 3MV9A 4K9JA 2EKSB 1PD1A 5C09D 4BKLB 4DP4X 4QXVA 1BREA 2HB0A 2BSBA 2ZCKL 3S4SB 5JW5A 2H6PB 3C9NA 4Y1SA 4BKSC 4M02A 1QKZH 6FABH 4ZXBA 5DO8A 4M7KL 3FQUB 3QQ4B 2MQGA 3JVGA 4Q7DA 3VXMB 4BH8A 5F3BB 2ED8A 5GGUA 4KNQA 1UA3A 1Y6KR 4P0DA 1X5IA 2GSGA 3QWOB 4HUUB 1FYTA 2FRGP 4A2GA 2OSWA 1A6WL 4OCXL 1O6TA 4GI9A 1NIFA 2EUXA 4PJBA 3GIZH 4PW4A 4P46A 5BW7A 3GMRA 1WZKA 2M1KA 4XN4A 4EN3B 1WIUA 3QHTC 3FAXA 2HPTA 4NX0A 3RL2B 3CAFA 4AGMA 5F7EH 1EZLA 5ICZA 1KCRH 1L7TL 1HHIB 1Z7JA 1MJ7L 3QEQB 2FBJL 2P1YA 3ARBC 3QFJD 4ORGB 2FJSA 3SDXB 5DK0A 4HJSA 3UGUA 4R5TA 2HRLA 5ABAA 3BX7C 4HDIB 4AY0A 4R7XA 4X4YB 4NQCA 4E68A 3JTBA 4HJGB 4L3EA 4N2IA 4FFVC 1GYVA 2CLZB 4X4MA 1AQDA 3RNQB 5HHQB 4JM4L 3OG6B 1O9WA 4KTDH 1EHAA 1PU0A 2VN4A 4MB1A 3RVXD 3MLZH 1NEZA 3HB3B 1DQIA 3K7UA 2W07B 3D2UD 2VN3A 3CX5K 1T6BX 1NMBH 2FYVA 4OJEH 3ZDXE 4R9HA 3AG1B 5IR1B 1I9IL 1ICTA 1OE1A 4OIFA 3ULVL 4HK3N 4PJ8C 1MWAB 3H7LA 2RGSA 1U2CA 4YN3A 4LPYA 1MIML 5HYQA 4N0UA 1IGJA 1VCBC 2PW2B 3EFDH 3KM1A 3P2TA 1NIEA 4LHUD 3KJ4B 1KJ2H 2R29A 4LRIC 5IMOB 2VE6B 3WELA 5F7UA 3ARFB 2FUQA 4ES9A 1VSCA 2C9UA 4UM8A 2C1OB 5ESVB 4DEUA 1UWGL 1S7XA 2P8PA 5DS8A 4ELKB 1MFNA 4X98B 3W2DL 3FU6A 1WBYA 2Q2LA 5DJXA 3CN2A 5KWYC 4Y9BA 5EBLA 2EIDA 4HIEB 4PJHA 3VWKA 3CSGA 3MCYA 4ZFOB 5FGRA 4UMSA 2UWEA 2OP4L 4OIIH 2Z7UA 1HDMA 4EVNB 1K6QL 4Y19A 1P9MC 1PZ5A 4KOBA 2JELL 2E4TA 3GSUB 1UXLA 4XB3A 2UX6A 2X2IA 1H8OA 5DRXB 4U1SB 2E0PA 3T77B 5C0BE 5TTRA 2OM5A 1GZPA 3T3MB 3CDZA 4IRJB 1GCYA 2W9LA 3II2A 3DSNB 3SKJH 4F8NA 4WCYL 3EOBA 4PWIA 4IBLT 3K0YA 3H2QA 5DUJA 2X3CA 5E4IA 3CFJB 2L7EA 4ISVB 5I74B 2F8IA 1CJYA 3DGGA 3WJJA 5KVEL 1I9JL 3ES6A 1R33A 1FVEB 3P3RA 4TUKL 1B3IA 3OKNA 5L2KB 1D5ZB 3U7YH 3BGMB 4AQEB 2R39A 1P7BA 2EEAA 3X13B 5B22A 1IAIH 3PYCA 4K3EL 2D31B 3GPEA 1ZV5A 2ZZUT 2CQVA 4LU5H 4LIQE 4FKHA 4AVHA 3EO9H 3O2DH 4G9FA 1SOQA 2MQCA 4I5BB 2B1OA 4KXZH 3V6FB 1NIBA 4RZCB 1KELL 2VITB 4AE0A 2XG4B 4H20L 3MCKB 2D7QA 4J12A 2JJSC 2KDYA 1X5LA 4NI6A 5I6PA 1NCNA 3GJEA 4P2RA 3TL5A 2RAMA 3SKUD 1ZGLB 1FN4A 1K3IA 1R3KA 2BFVL 1MUJA 4PJFA 1Z0MA 5EEUA 2QDVA 4PJAF 2Y2TA 2AHIA 4XVUD 4G5ZH 4XHJD 1SJEA 2LU4A 4MX7A 4N2KA 1QEWA 2H2SD 5AYUL 4BSWA 1WDAA 1FAIL 3SN6N 1QWNA 2YQGA 4JFFD 1IKNA 4OCWH 2LTQB 1TO5A 3BLKA 4JKPH 4XVOA 3Q5YA 3FB5A 4NQEE 1UD8A 3O6KH 1VGEH 5GRZA 15C8L 1TJXA 1ZTXE 2ADFL 3GINA 1U4EA 1FGVL 2QKIB 4K7PL 4MDJB 1J0YA 2NCMA 2VQ4A 5CMAB 5IIEA 5I6OA 4IGBA 4HALA 5F7YC 1F11B 3BGFB 2K70A 3V52L 5EU6B 2R0ZL 4FNTA 3NQIA 4YHZH 3I6SA 3LNEA 4XX5A 3ZE1F 4JANB 1EHKB 2VDQL 2DW5A 1OAQH 2F7RA 2V3EA 2YMOA 3BDBA 1Q0EA 3L4XA 4G8GE 1HWHB 1KTKE 5E5MB 3ZXAC 1G7HB 4R3SB 5K9JL 4UIKH 2IH1A 2J88L 4L1DA 2EVGA 4ODSH 1SVZA 3LV3A 2PCFB 2ARJA 3E8VA 3OWRA 2C34A 4YQXL 2R2EA 3LN9A 1JYXA 1JF1A 2P8MB 3H9SD 1U41A 3Q6GH 5IOKA 1FV1A 3A24A 1NEUA 4TQHA 4ANUA 5F1OB 1JZ7A 2BNQE 3O6FB 5FXCH 1F3RB 1HZHH 4NP4H 3MVSA 3BZ4A 2WTRB 1I8AA 1UXMA 4QWWC 5AUMB 4EAEA 3IDXL 3SKMB 1KTCA 4KRNA 1L0QA 2C4FT 4WV1B 2VSCA 4DVRL 2Z8SA 3UTPD 1T7YA 2HZHA 4I87A 1ZHKB 2WZ0A 2OXGB 4LOUC 5C6PB 2BX5A 3SY6A 5JOFB 4YBQC 1MCOL 2ZNXA 1N0XH 3NJHA 4PN6A 4ZFOL 5J3HC 2EEBA 3FFCD 2VM4A 3IGFA 4OI8A 2JXMA 4U1JB 3RUGF 2NY0B 2Q6WA 4ZSOE 3VCLA 2WLMA 5B39B 3CTTA 3GZPA 1FFNA 1QVOA 1GL4B 3B9EA 4LCWE 4W9HC 5F9JA 1UUNA 5E9DD 2FR4A 4I3RL 4AV0A 4HZLB 4YDIH 4MB4A 2YD7A 3NT0A 3Q1EA 4GIPD 1JFQL 1QATA 5GJSH 5DI8B 3H3PL 3DURA 5JDSB 4NUGH 5C7ZA 2WBKA 1A9BB 3HI1B 1FE8L 2FHCA 2ZJSL 3QRBA 3QORB 1NEPA 1QA9B 3MYJA 1I3GL 2DWDA 2ZKYA 3U36B 1H3GA 4W1TA 5KUMA 3WXVH 2EABA 3C8HA 1EIBA 1IE5A 3DOHA 3RVVC 1IJNA 3F7QA 2AJVH 3K5RA 3ARBA 2F53A 2C9QA 3TNNA 4LHJB 1I7ZB 3ZQWA 2HTLD 4HS3A 3CDGA 4NZRL 2EINB 2EIZA 3X3GL 4YVNA 3VGDA 4MDIA 4UU9A 5BRZB 5FB8B 3RZCD 1CDYA 3EKCA 5I28A 1A3ZA 4FMVA 4Z7OE 2FO1A 2P8LB 1TQBB 1J87A 4YGAB 4PIBA 1FFOB 3D0VB 3IJEB 4N8PA 2J6EH 4Z9KB 3KCWA 4P5TD 2CIIA 5KBKA 1FJ1B 3ECBB 3IFOA 2VSMB 1MFAH 2NX5A 3QXVA 5DMIL 4HPHA 2PR4H 3SDYH 1KEML 4M6NH 4PJ8A 1BFTA 3CK0H 2Z92B 4A37A 1KZYA 3EJZD 5GGTL 1S7TB 2YLHA 3FN0H 1FPTL 4LRIA 2R83A 2VMDA 3R7RA 3IYLW 3K6SA 1U92B 3DX9A 3FSZA 1UURA 5D2NB 1U6AH 1T7ZA 3FU3A 1DBML 3QFDA 4YHMH 5E08H 5DQJA 4JCMA 1YEIL 4UWQB 4LSDA 3T2LA 4Z76B 1FZOB 1G7LA 1DE4B 4MFHA 4QHUB 4UT6A 1MFMA 2E9IA 5TF1L 1ZANL 4PVLA 5AW8B 3KBPA 5T5FL 4O4YH 1H3WM 1MI5E 4HS8L 1P9MA 4YFLI 4AW4A 1AXSA 1RZIB 5EEZA 5IB3B 3LEYL 2CLRA 4K8RH 1IO4C 2HT4D 1UM5L 2FIKA 2WOBA 1I8KA 1G6VK 2QMJA 2JSFA 3DHPA 2OMZB 3X12A 4PHXA 1ADQA 1HINL 4NLHA 1FDLL 1IC0A 3SPIA 3VFSA 2KPWA 3UJTH 4X7CC 2WBWB 4OV6F 2BCKB 3K46A 5FHBH 4P23D 5JHBA 2PWHA 2DWYA 3EYSH 1ETZA 1LO2L 3ZKXB 1QW8A 4MJ4A 1HCFX 4U0RB 2HAZA 1O5PA 4NBXB 3QRGL 4UV7H 2DQFA 2I25N 1I7UB 3VG9B 3QJOA 2JJSA 3CVHH 3WTWA 1NBVL 3C2AH 1XGUA 2JCCE 4B5EA 1A1NB 4KUCF 4OLVL 3QZLA 5FGBC 2MOVA 2GK0B 2VW4A 1MIEH 2MCPL 4TV3A 4P8QA 2AABL 4DKDC 2BVYA 3M1BA 4WJ5B 5MHSE 4YFDB 4LRNH 3UZEC 5JTWA 4L8BA 3O2VH 2FECI 3LN4B 4JHUA 5FYLL 4D0DA 1NCBH 5EMYA 5DJ8A 3NRPA 4CGTA 2YUWA 5HY9A 1CBJA 1CR9H 1HTYA 1BM3L 2EDQA 1H3PH 4FLQA 4WWKB 5JDJA 4LLQB 1TNMA 1R75A 3I6GB 4LF3B 1HIMH 4KI5D 4MMYA 1EXUB 3CQQA 3EYUH 3O8XD 1CFVL 2G3NA 4E41A 3FO1A 4W9JC 4X6DF 4WU7B 2IQAB 4HMDA 1T7XA 1V3MA 3MRIB 2FSDA 3SIKA 5EA0H 2XFXA 4FJZA 1I8UA 3OLEA 4PRPE 1Z9PA 1XX9C 3UPCA 2Q76B 1TZGL 1GTFA 4JO3L 4OZHF 4AYFB 2CH8A 5E8NA 2WV3A 1MJUL 1GIGH 4FLOA 1WZLA 4YDJA 1PQZA 1UWEL 4NCC1 4R7LA 1AMYA 4XVTL 3TA3D 4CJ1A 5CHNB 4Z7UE 3F6LA 1UWXK 1WC7B 3NA9H 4AK1A 4OZGE 3FU0A 3FUKA 4OGZA 1I7TB 1Y7VA 2CR3A 2AC0A 3CZEA 2Z7ZA 2JTDA 5T3XH 2J73A 3ZYZA 3HCVB 1KC5H 2NY3B 4NZ8A 1NUDA 2MJWA 2ZG3A 5HVGB 2HKFL 5E4AA 5E70A 4DAGL 1S4IA 1IJ9A 4LSSH 5C07E 3K80A 4GRMA 1LHZA 3FT3B 5TH2A 1CIDA 3EOYG 2JKLA 2EYRA 3NPZB 4MAZA 4BSVA 1HKLL 1Q72H 1HILA 1ZEAH 4TSCL 4GRWH 1CGSL 2FWLB 2BIOA 3K6DA 4M62H 2O30A 1FO0A 4LESA 3G6JA 5IMKB 2NZIA 5TFSL 1BX2A 1XO8A 2DKUA 2FT6A 3G6DL 4FNUA 1XGYL 5ACLA 3VGAC 3E7JA 4X99B 5LBGA 3C60C 1AHWC 2QJDA 2AJZB 4RGNC 5D5MB 3VYOA 1YEHL 4JR9L 2LU5A 2HJLB 2YS4A 3QC6X 3WJLC 3ZKMC 3KS0H 3D3VB 5ICXA 5CP7A 1J05A 4QO1A 4MCZB 5DEGB 2VM9A 3N41F 3QH3A 3TFKC 2OMUA 2VDLL 2QL1A 3UTSA 3QUYD 4S1DC 3BPOC 2OS7A 3BVTA 5DK3A 5D72H 4KZEH 5IG7B 2C8NA 1W2KT 1ZLVK 1UWFA 4XNYL 2EEXA 3Q48A 4A1RA 2GB2A 3AG2B 3AVEA 1QZNA 5I17B 3CZSA 4H88L 4M8VA 1AFVH 3B9VA 4P2OC 4PGCA 5A7EA 1UH3A 1JPST 3AG4B 3EYOA 4F1ZA 3T0BA 2GITB 1J5HA 2XA8L 1R3HB 2HT3C 1U0QA 3UTZA 5DEZA 3TZVD 2P5EB 1SXBA 1GYAA 3VFTB 3VUAA 1IAOA 3QW9A 2JJWA 5C0AA 5EO9A 3W0WB 1MCHA 4K4KA 1YUHA 4PIRF 2DD8H 3RURA 2WVTA 4Q6YA 2I24N 1B88A 5ACMA 3Q44A 3PABB 1ZLVH 1CQKA 3BP4B 4BE6A 3ABMB 1KGCD 3BQUB 1AGEB 3I85A 4KV5E 2OW6A 4A39A 2O72A 3SE8L 4W6WB 4XO9A 2EH7L 4GQQA 4AZ8A 4QNPE 3T4AC 3ECWA 4DWHA 1RP9A 3LIZH 4BFJA 7PCYA 2NY1B 6TAAA 1A2YA 2VXQA 3VXMD 1QI3A 3CLEH 1ECYA 3ZKNC 1VERA 2NY5L 1PZBA 3DMMC 1NMAH 3QQDB 2YA1A 3TEWA 1GYUA 1KCVL 5JYMA 1ZLUK 1GR7A 4PQXA 1Q9LB 4I88A 4KKCC 2VZUA 2ZKHL 1EAQA 4XMTA 4PWEA 1NGXA 4HBCH 2UVFA 1NBYB 3C6LB 4PJEE 5F1IB 5GS2D 4M7LT 2EQDA 3QZWG 4LPWA 5D70L 4AM0A 1D5BB 3EJQA 4EN3D 2HA1A 4H0LC 4XNXL 2QFPA 1U8HB 2WK2A 1P4IL 1V7MH 3H9HB 1JNJA 4D3CH 4M5ZH 2N1TE 5DUML 3AJ7A 5LCVL 1NANH 1F02I 5LGYA 2AK4B 5I75B 5M7QA 2BXZA 3L4TA 3V4VH 4WI0B 4L1TA 4K5NA 3IRZA 5D4QA 2A74C 5MEOA 1ZLUH 5DUBB 2OXHB 3WE6B 3FCSB 3FCTA 1MFCH 2Y1AA 2XYBA 4PJGB 3QIBB 4X8CA 5TE6L 2QGCA 4Y5XC 4UMGA 5D1XB 3KWUA 1P7KA 3E9UA 1ASOA 1Q4NX 2IDQA 5IFAH 2BSEA 1JZEA 2BLFA 3GRWH 3N1FC 4MXQD 5I5IA 4TPRH 6PCYA 3D85B 2WINA 1JGDA 1USZA 2FX8H 3GBEA 5E5UB 2FWOA 1EK3A 1RV6X 1FVDB 3BMVA 3OKDB 3CZGA 2CBQA 2X6CA 3HNTL 4Q2ZB 5KOMC 5IJDC 4J3OG 5ITBH 3ARFD 4MA7L 3L5HA 3HVDA 3TTYA 3HS0B 1A1MB 1MRDH 4FJ6A 3ZHNA 1ZS8B 4WWNA 5KVGH 5ISZB 4IRZH 2OJZH 1IGMH 3AUVA 3TPUA 5H8DA 2YGPA 4LAJH 5F6HI 5G5DA 5F7NC 1XSJA 5E94B 3OJVC 2EUVA 5I9QB 5CJXA 5FGBA 1NFAA 3SPVB 1PW3A 3VB9A 1BZQK 5CFHA 2ATPA 9PCYA 1NH6A 1OM3L 3BP7A 1F56A 4U7SA 3ORJA 3Q8AA 4GS7B 3GSVA 3UZEA 4F7EA 3LQZA 5SV3A 3FYEB 3W5NA 3SOTA 3JV6B 2OQJA 1UD2A 5CCKH 1G9MC 3WN5C 4GKNA 1YEFL 3RVUD 2PPEA 3TONA 3MLRL 4MYWB 2G5BB 4IRJD 3VQLA 4ZPVB 1W72B 5AWNL 4TOYL 4ANKA 2OK0H 3MGAA 1KEGL 1J12A 4MJ5A 3QUMH 4DKAA 3T04D 1DUZA 4YUEH 3BEVB 4ZMWA 4DOHB 5F72S 5C9KA 2OW7A 4KQ4H 1T7VA 2MMXA 2VXTH 4MCYB 2DBLH 5L2KD 1G9HA 4WIQA 4BHUI 1RP8A 5J7CC 4EBQH 4Z3HA 1VESA 2YPLB 4WY7L 5HGGS 2KZKA 3FUEA 2E7CA 5CEYA 3IJHB 4LLAA 4PCYA 4ACPA 1KLGB 4FQXC 5HHOA 1VPOL 4UAOB 1YNKH 3LD8B 1FSKB 4GXFA 4XP6L 1JCKA 1U9KA 3O41A 3DOSB 4AG4H 2GSMB 1WRFA 4AWJC 4DQOH 2XIDA 3O2WL 4PG9A 4MXVF 3MRGA 5CCHE 1CE1H 5KJRL 1W8NA 3ZRCC 3QK0A 1L9QA 3BVVA 1MFBH 2IGFH 2AV1B 1LP9B 2A9MH 2X7LB 5FCUL 1SQ2N 5GXBB 3BPLB 4HOMA 1YMMA 2TRHA 1A3LL 4AQ8C 2Y6SC 3CFTA 3GZOA 3DC0A 3E8UH 5C0ND 3OR7A 4IQHA 1IQDA 4HUCA 4XPTH 5KYNA 3FT9A 5J6HA 5F9DC 1TKWB 1M57B 4AK2A 3MRPA 1ZVSB 3VH8G 3KPMB 4QTIH 3FF7A 5FDWB 3GWJA 3AXHA 4MJIB 4CMMA 3IMBA 3MBWA 3QS2A 3RU8L 4OZFH 1PY9A 5EU6D 5HHPB 1MOEA 1J7VR 5C0BB 1COBA 1XCTB 3C60A 1AHWA 5KBDA 4N2OA 3EUDA 4AIZB 3CHOA 3ZHFA 1C8PA 2VDNB 3BP5B 2FGWH 3ROOA 3T3PE 4PCSA 4HWZA 1A7PL 3WJLA 1RZKC 2GK2A 3LEXB 1FLTX 4J3UA 4N2MA 4M7ZB 2XWTB 3HFML 3IVKB 3RL1A 2VDKB 2R27A 4QJ5B 1I1YB 2D9CA 2QSTA 4AEIL 4MQ7B 3UC0H 4TSBL 5DSCB 4W9CC 2R2CA 4K3GA 1CFNA 3S3JA 1M9SA 4AQOA 5D1ZC 2A6DB 5SWSD 1EAJA 2DMCA 2R0KL 2WTOA 3O6FD 3HJ0A 4ZODA 4MJ6A 2DEWX 1KJ3L 5H37H 4QTFA 1WIPA 4XZUA 4XNAA 4Z0BL 4WHYH 5KVDH 4MHHI 3GHEL 2PYED 4JUSA 2E47A 4EIZC 2QQLH 4IU3A 4XO3A 3CXDH 1MRFL 4FQ2H 4MA1C 2HLAA 3MLWL 4OQTA 1QP1A 1FVCB 2H32A 4P2OA 1R19A 1BQHG 2ZUSA 4BRJA 1RIUL 3OJDB 2JLLA 1IM9B 1EH9A 1OPGH 1AGDB 3QIUC 3RX8A 5JORA 1YEWA 1T1XA 2BNQA 1N5YL 3KEHA 2CLVB 3QXAB 1NCAL 4M4PA 2IFFL 3OAUH 1AZNA 3ZMRA 4AUJA 1XD0A 3DX7A 5ICUA 4JRFA 3THML 4EZJA 5LDSA 3MU3A 3NMEA 4Y5YB 2CA4A 4LSVL 3HJEA 4JLRA 4QLRA 4NQEB 1T21B 4FQQB 4XMLL 5KBLA 3OD3A 1IFRA 1X4ZA 3BUDA 4PPTA 2BW4A 3T4AA 4KUZL 2D3NA 3M8OL 4JHAL 3VXOA 1LDPL 1F4XL 3BN9D 3O3DB 4K23H 5JR1L 4NM8H 5J12C 2NMSA 4UNVA 5DMGC 1L3NA 2WLNA 1HL4A 3DMMA 4V2CB 1QASA 4HUXB 1T1ZA 3LZFH 4AKOA 3PHOB 4NNYB 1ITBB 1C5CH 1IAKA 1NFDB 1Z9SB 4ZSOA 3VSQA 3W11C 1JDAA 3GB7B 1KB9K 4R4BA 4Y9CA 1TETL 3QORD 3KL0A 3VDBA 4OLWL 2C7UB 4NUQA 4OJAA 3T0EC 3C5ZC 2XN9E 5AW5B 3ARGB 1BAFL 2YWYA 5GRVL 1KUMA 2AQRA 2VZSA 1F2XK 3S3DB 4ENEC 3UPRA 3N9GH 4QD2E 1CXIA 4GQ9H 2HMIC 3QDGE 3ISYA 4JKWA 1IEAA 4RZKA 5EZLB 1RFDL 3LPOA 1GHFL 3FTZA 5BRZD 5KYYA 2A74A 2NTFB 4H0IA 4XR8C 4HJUA 3STZA 4JK0D 5LLIC 4F24A 1NIDA 1XWVA 3KJ6H 4OFDA 4YHIB 4Y5XA 5BVJB 2ATKB 3FUFA 4BSJA 2C9VA 3A6CL 3V6ZB 5HD8D 2WKLA 1OT1A 1ZK5A 2EDLA 4LCVA 3QCTH 4DCQA 2A4EA 5E8OB 4ZNEE 3H56A 2JKXA 4FFWD 1KIUA 1KG0A 1Z3GH 2CKBH 4PMEA 1BVZA 3KWXA 1WZAA 4S1RL 5I8KL 2P4AB 4Z7QF 4R96B 4BZ2H 1JK9A 2AEOA 3AFLA 3I75A 5IQ9A 3U2IA 3BWAA 3MBEB 2ZXWB 5E56A 5FHAL 1KGWA 2YD6A 1R5WB 2MHAB 3K3QA 3DPBB 4P5KB 5D2LB 5GGQL 4Z7WA 3S6CA 1VFBA 3SO3C 3ZOAA 1U95A 5HJDA 2BNRE