1NWOA

Crystallographic study of azurin from pseudomonas putida
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
AECKVTVDSTDQMSFNTKDIAIDKSCKTFTVELTHSGSLPKNVMGHNLVISKEADMQPIATDGLSAGIDKQYLKDGDARVIAHTKVIGAGEKDSVTFDVSKLAAGEKYGFFCSFPGHISMMKGTVTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic study of azurin from Pseudomonas putida.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords AZURIN
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nwoA00
1AACA 1JZFA 4DP4X 1SF3A 1WAEA 2BO0A 1SFDA 3RYMA 5IY5B 2Y69B 5F7BA 2BP8B 1WA2X 5A7EA 2FWLB 2JXMA 1JXDA 4YSRA 2QDVA 2UX6A 1A4CA 2HX7A 3X1GA 4YSSA 2IDFA 3AG3B 3FSWA 1FA4A 2FT7A 2IDTA 4YSUA 2PPFA 1DYZA 3QJSB 4M4RB 2CALA 1NPNA 3JT2A 3TBCA 2EILB 2Y1AA 4YSEA 1KBVA 2B08A 4P5SA 1BYPA 4E9XA 1QLEB 1PLCA 1I53A 2HRHA 1JOIA 2LLNA 3CVCA 2J5WA 2IDUA 4G71B 4A2DA 2OJ1A 1NTDA 3HEIB 1KDJA 2MRYA 4DP2X 3UGEA 5D4HA 2TSAA 1NIDA 1ZPUA 3H56A 1A3ZA 9PCYA 2BHFA 1IUZA 2FJSA 2GI0A 1QNIA 3EH3B 5ANHA 1AR1B 4YVNA 5I5MA 1PF3A 2AVFA 1A4BA 4GXFA 1AZCA 3QJRB 2JKWA 1FWXA 3FS9A 2BZ7A 3TU6A 2XV3A 3MX0B 4E9TA 2IWKA 1NIBA 3S8GB 1PLAA 4A2HA 1ADWA 1TKWA 3EH4B 4M3HA 3NSYA 5I6NA 1NWOA 3ZBMA 4AKOA 2VMJA 2GC7C 1PZAA 3V9CA 3TA4D 1J5DA 1J9QA 5F7AA 4G72B 1W6LA 4L0PB 1GR7A 4E9WA 3NSDA 2P80D 2Q5BA 2FQGA 2ZWNA 1RKRA 1HAUA 3GXUB 1SJMA 2VW7A 2VW6A 2FQFA 2XYBA 3L45A 1TU2A 5AKRA 1CURA 4BWTA 1L9OA 4G7SB 4KO7A 4DP8X 2XX1A 5I6LA 3UACA 1KGYE 1RZQA 3PPSA 6PCYA 2J57A 3PAUA 3X1NA 1SF5A 1EHKB 2FT6A 2FT8A 4HIPA 2CUAA 5E9NA 1J9SA 2EIJB 4G7RB 2H47C 2PP7A 3OMIB 4E9YA 1OV8A 2QPDB 3ASNB 1L9QA 3WKPA 4EF3A 2XUWA 5I28A 3CDZA 2Q9OA 2XV0A 4YSDA 3WNIA 2AZUA 3T6VA 3WIAA 3GYRA 5B3SB 5I26A 3S8FB 4JHUA 2YAOA 5B1AB 1L9TA 5EHFA 2JFCA 1E67A 1HFUA 2HX8A 3QJQB 4GP8B 1PNDA 5I5JA 1KV7A 1CYWA 2BP0A 2H3XC 3FSAA 4PCYA 1ET8A 2ZOOA 1BXAA 3QJUB 1W6WA 1JZIA 1W8EA 2VM3A 4KO5A 1BAWA 1A4AA 3FQ2A 4AX3A 5I6KA 2H5UA 2R7EA 2B3IA 3IE9A 3AY2A 3BQVA 4F7KA 1BEXA 1BQ5A 2UXTA 5LDUA 3ZIYA 1ILUA 1TEGA 2CCWA 4E9RA 1MG2C 3NJNA 2OCCB 2YXVA 2I7OA 2I85A 2CAKA 3SBPA 4A68A 1AZRA 2GHZA 2GSMB 2XXFA 3KW8A 3U25A 1EZLA 2VSMB 2DV6A 5TK4A 4DP7X 3FU9A 4DPBX 1AZNA 3TBBA 4A2EA 3WKQA 1GW0A 5I6MA 1JZEA 1UATA 4E9VA 1E65A 2IWEA 1L9PA 1NPJA 3OMNB 1PNCA 3FQ1A 4MFHA 3PCYA 4KO9A 3EF4A 1SDDB 1IKOP 2E86A 1N70A 5I5IA 3C75A 4AZUA 3IN0A 4E9QA 2IWFA 2XWZA 3FU7B 2AZAA 5D4JA 1GS7A 5AFAA 1J5CA 4W1TA 5B1JA 3CVDA 5B1BB 2ZXWB 3KW7A 3SBQA 4ENZA 1CUOA 3FQYA 1ASOA 4F2EA 1AANA 2VM4A 4AKQA 2FNWA 2BP0B 5PCYA 1GY1A 3ZX1A 3CG8A 1AG0A 1M9WA 1JZJA 3EHBB 1JVLA 1BQRA 1KCBA 2PCFA 2J56A 1PY0A 2PLTA 2YAFA 2A3TA 2QPEB 2YAEA 3FU8A 1JXFA 1M57B 2DWSA 4QKTA 3X2QB 2GC4C 3EH5B 2N0MA 3V9EA 2X87A 3T6XA 3QJVB 2W88A 4TXVB 3QJTB 4HHGA 2HRGA 4GY4A 4DP6X 1ZDQA 3SBRA 2WO2B 1ET5A 1XB8A 2TSBA 3WNJA 2AFNA 3D12B 3G5WA 3T9WA 4ZK8A 2YAMA 3IBOA 4YL4A 1V55B 1URIA 2EINB 1IC0A 4HHWA 2BWDA 2HXAA 4N4YB 1WS8A 2UXFA 1V54B 2FTAA 4DPAX 4DP0X 3BVDB 1CYXA 2RACA 1NICA 3TASA 4YSCA 1OE3A 3DTUB 1NIFA 2BWIA 1OCZB 3WI9A 3FYIB 4A66A 4HCFA 7PCYA 1NWPA 3DKHA 1ZIAA 3H4FA 3FYEB 5B7MA 3PAVA 1BYOA 3NJGA 4AKPA 1JVOA 3PXLA 1E5YA 2R7EB 4KNSA 1A65A 1RCYA 3NP4A 2VN3A 1MG3C 3IEAA 3NJIA 2IDSA 2HX9A 3UAEA 1XB3A 4N8UA 4WKXA 1ASQA 1WA0X 4Q89A 1A8ZA 4UF7C 1NIEA 1KDIA 2HZHA 1AZBA 1AIZA 2PP8A 4WTQA 1B3IA 2GBAA 4G70B 2BW4A 1PMYA 1OOWA 5B7FA 1AS7A 1N68A 2I7SA 2QT6A 4KNTA 5B1KA 2XVBA 3ABMB 1JZGA 3NJLA 3ABLB 3N2JA 2DY2A 2EIKB 3CDZB 3S3CB 3FT0A 4FA7B 2DYSB 3PLYA 3SQRA 4Q8BA 2PP9A 1GS6X 3T6ZA 4A2GA 2W8CA 1AS6A 1SNRA 1VLXA 3ABGA 4CSZA 3ABKB 4BDVA 1ASPA 4G7QB 3ERXA 4RH4A 3CVBA 3NJHA 4W9ZA 1FFTB 4DP9X 2IH9A 1AAJA 4NERA 1SDDA 4DP5X 1TEFA 3QPKA 1J9TA 4FAAB 3UAAA 2UXGA 1OE2A 1XB6A 3NT0A 3AG4B 2WO3B 2YAQA 4K9JA 1GYCA 1J9RA 1OCCB 2PCYA 3MBWB 1GY2A 1JERA 1OCOB 1IBYA 4HCIA 2FQEA 2IDQA 1CC3A 4DPCX 3OQRA 4KOBA 4YSQA 4YSOA 3X1EA 1F56A 1OF0A 5B1JC 4AI7A 2PPAA 3S3BB 4BXSV 4PAZA 3OMAB 4BXVA 1PLBA 3NYKA 1MZZA 1NIAA 3OD3A 1L9RA 2XLLA 4HCGA 5PAZA 1E30A 1AQ8A 2DWTA 2VW4A 1X9RA 2VSKB 1ET7A 3FPYA 2ZONA 1ZIBA 4YSAA 5D4IA 1PAZA 2IAAC 4GP5B 1ILSA 1BXUA 2X88A 3AG1B 3H4HA 3NJMA 1WA1X 4YSPA 3AZUA 2FQDA 2WSDA 3ASOB 4JKNA 1SHWA 1PZBA 2NRDA 2XV2A 3X1FA 2YARA 5B7EA 3S3DB 3X1BA 1NINA 1QHQA 4DP1X 2MTAA 2PPDA 4GP4B 3T71A 2UXVA 1AS8A 1AOZA 5TK2A 2J55A 3DIVA 3JTBA 1L9SA 4BWWA 1GSKA 5AZUA 1BQKA 2IH8A 2XXGA 4BK5C 6PAZA 4KNUA 1RZPA 2BP8A 4YVUA 2AANA 1KBWA 4HAKA 4A2FA 3AW5A 5FC9A 3UABA 4JHVA 3FU7A 1JXGA 1GS8A 2CJ3A 3N55A 1KYAA 1KCWA 3FSZA 3ZDWA 3NP3A 2QDWA 2YQBA 1X9UA 3OM3B 1YLBB 4NAJA 1OE1A 4KO6A 4GYBA 1SHXA 4UANA 1OCRB 2XX0A 2GB2A 4NB7A 7PAZA 4HZ1A 2DYRB 2YAHA 4QLWA 1E5ZA 4UAHA 4BDVB 4X4KA 5I6PA 4CSPA 1MDAA 1BXVA 1T5KA 2YAPA 1NDTA 4YSTA 2PPEA 1AG6A 1R1CA 2EIMB 4P5RA 4KOCA 1ETJA 1V10A 3NJJA 3UADA 2HLEB 2GIMA 2XU9A 1MZYA 3WG7B 4BWUA 1JZHA 2PPCA 1HAWA 3NSFA 1ZDSA 1DZ0A 4E9SA 3GDCA 2YXWA 1PCSA 1XMEB 4HALA 8PAZA 3IN2A 2OV0A 1M56B 1WS7A 3NSCA 3NJKA 3NJFA 1PZCA 1ZV2A 3FSVA 5I6OA 1ID2A 3FPXA 3PAZA 2CBPA 1IBZA 3QQXA 2P80A 3CZUB 3T6WA 4F2FA 2BW5A 1NZRA 2UX7A 1SFHA 1AZUA 2BZCA 3AG2B 3HB3B 4A67A
chains in the Genus database with same CATH superfamily
1M7UA 1AACA 3BKJL 4WU7B 3ZRCC 4C4BA 1PFOA 3FULA 4G9DB 5EOCL 2WOYA 4V1DB 1RUPH 1HESA 2JXMA 1MCPH 2B1AH 3D18B 3TV8A 3NA4A 2WBKA 3FXIC 3SKMB 4YSSA 4OUOA 5H35B 1WAPA 2IDTA 3LKSA 5ISZA 1AHKA 2VR8A 1I8IB 4Z5RB 3RWFA 4PJGA 1RZGA 4EIGB 1PLCA 1FNEB 1I53A 3F2LA 3KZ8A 4TSCL 1HTYA 2OJ1A 2EXSA 2AV1B 3OJDA 4J6IA 3S4SA 5F9JB 4R7DA 4GAGL 5E6ZA 4OLVH 1M1XB 3KYMB 4UNIA 1Y07A 4ANVA 5J1SC 5JHLL 1LEIA 4KKPA 2O61A 2FB4L 1OB0A 4W9GC 5DC9B 5J06A 2G2RA 2I5YH 4TSAH 3WUWG 5D7JC 1G9NC 3U48A 4P2QA 4DGWC 1A3QA 4PV8B 1W0WB 4ZW3A 1A4BA 5F1NA 4BFEA 1VDGA 3GSNH 3VX1A 2JKWA 1OGTA 1CLCA 2OBGA 1FFPA 4QAWA 5A1AA 4I89A 3QO1B 5FO7A 2IWKA 1UB6B 3DPBB 4XBEL 4I5BA 2R0WH 3E9TA 1FORH 5C6TL 2XTJC 3E8UH 2JB5L 3KGRA 3VFWA 4EPSA 4AKOA 3HFMH 4OZFG 1P2CA 3H55A 3TC9A 3L3OB 2LTQB 4D9LL 4NP4H 5EEYA 4LHUA 3BW9B 1H3GA 2ZUSA 4Y5YA 3ISRA 4BHUI 2GCYB 1QLEH 2O6EA 1JTPA 1TDQA 3INOA 2WZAA 3VXPA 5GJTH 3JV6A 2C7FA 3IDGA 5KSAC 4QCIB 1HWWA 3V79C 1FAIH 4N2HA 1HHHA 3RNKA 5GGQH 1E28B 3V0WH 1W8OA 5DQDL 1MWAL 5HI4D 4H26A 3PAUA 2R27A 1SF5A 1Q0XL 2NY2D 5GGSB 3QORD 5K39B 1KYOJ 4H44C 5IVXB 1J9CT 3QE5A 4ZX3A 4JVUA 4O4YH 2QPDB 4WFED 3IAQA 5BRZD 5E6ID 5I28A 5BMFL 3BGAA 1DQJA 1TQBC 3R06B 3V4LA 4PJ9D 3VI3E 3VXQB 1NFKA 4OF0A 1TEYA 2C9XA 2P5WB 3N9GL 1JCVA 3TO4A 5CUSL 3ARWA 2PR4H 1RMFL 1YEFL 2DWDA 2X53A 3O2DL 4RGNC 1MCSA 1QLFA 4NZFA 5KVMC 3RVTD 1X7TA 4FFZL 3KYKL 4XTRD 1GHFH 4FXGB 3VMPA 1LK3H 5AYUH 1T5WA 4UQCA 3CFNA 3FQ4A 5H94A 4M1GH 1OD9A 5KBDA 2WINA 2WKOF 2EC8A 1JZ6A 1ZMYA 3BPNC 5GS0D 1OGAB 2DQHH 2XTJD 2VM3A 4IIZA 3VXRB 3IU4L 4IBZA 2CSPA 3KPPA 1WIUA 2Z92B 4L18A 2EZ0D 1I9JL 4XXDB 5FGBA 4ODTL 3STBA 3VFWB 3M88A 3BQVA 1BEXA 1JGLL 3BSZL 1RJZA 1CFTA 1JGUL 3R8QA 3QXAB 1HXYB 3L6FA 2ETWA 2I7OA 5KAQF 4ETQA 3TZVA 2J1KA 2J25A 3EJRA 3WELA 2X4QB 5IB2B 1HQRA 4QXTA 3KW8A 1Z5YD 1YEWA 2OTUB 4H8HA 5BZDB 1K8IA 1QSEE 4M7LT 4Y4FB 5F1IB 1B0GA 4ZQTA 1NSNL 3M1BA 3CVHH 5T3ZE 4GS7C 1KXVC 3TT3H 4FL4B 1YNKH 1KN4H 4WHTB 1N70A 2ZUWA 3W39B 5F9JA 5EBMB 2F54E 3EG9A 2C9VA 4NZTH 3QCUL 4LEXL 1RIHL 5IVXA 1F42A 1F5WA 2LTQC 3IXTA 2B3RA 1ZAGA 5G5DA 4KRPB 4P3WA 3HW7A 2WZ6A 3BDBA 4K23H 1KBBA 3TVMB 5KW9H 1FGNL 4Z7NB 4PWGA 1JZJA 1NBYB 1GC1L 2YA1A 3QFJA 1I7TB 2L3BA 2DWXA 4QHUB 3AUWB 1OP4A 1B4JL 3D85B 3IK2A 4KX9A 1QLRB 3S8WA 2M1KA 2YRBA 4W9KC 4ZDHB 4FZ8L 5K1NA 5CD3B 5HHMB 3Q8AA 5E8PA 1UTDA 1PX3A 2PXYA 3RZCB 3U82B 3L3IB 1FYTD 3T8XB 3V9EA 4HKBB 3ZUCA 2W88A 4TQIA 5DZ9A 1UM6H 5T3XE 5L88H 3SDXA 4N2NA 3EGSA 3O41A 2VDLH 4UILH 5I6XC 2TSBA 2X4SB 4JM2A 4UBDC 1AGBA 4LF3A 4DVRH 3FB7B 3QDME 3BAYA 1IC7H 2X1XR 1A25A 4JHZA 4B9KC 2EVJA 2AJ3A 3KJ4C 3N0AA 1FVEA 2JQMA 2UXFA 3KWWA 5BNXD 1CWVA 2WLZA 4P9MH 3D48R 4DPAX 1I85C 4JKPH 2DQJH 3WOVA 1BQHG 2PN5A 3TASA 1OE3A 4XNXL 4HAGA 1QKZH 2A9DA 1SXZA 2KERA 3L3HA 1RHHB 2FX9H 4JFPB 4QRRB 5FGCB 2Z31B 4JGJA 4KJWC 2QQNL 4KAQL 4LLVA 3DO7A 4S1DC 4IMKC 1S5HA 2B9BA 3T77B 3KMDA 5DQJB 4S1SH 3OLDA 2QKIC 3JWNH 3QQ4B 1WSST 4PJ5A 3BFQG 4PRHA 4M6OL 1VADA 4PJDB 3VD3A 1UH3A 1MCOL 4WEMB 3IJ9A 4Z0BL 5KVEH 5TDPA 3HNVL 4JFYA 4A37A 5I1HL 1V27A 1WJ3A 5IJCC 4PJ7F 4WU5B 3BOVA 2OMTB 3P0VL 2PXYB 4WTQA 3RZCA 2K3HA 1ACCA 1GTFA 4WV1B 5FO8B 5IMOB 1B90A 4WV1A 1AS7A 3UTPD 4AC4A 4OGYH 4HUXB 4YL9A 6FABH 1GGCH 3T08A 4N8CH 1NEPA 2DY2A 3D4YA 4X4ME 4YGAB 4Z7VF 1UWGL 5C71A 1KBGL 2AJUL 2YD4A 1PSKL 4G8FA 4TNFA 4WENB 4PHZA 1G87A 3T6ZA 5FV1L 3RY4A 1JK8B 4ZO8A 2JNZA 4OZGE 2BMKB 1FFNA 1TZIA 4V2BA 2LAAA 3IDMB 1V7MH 1BQLH 4AIZA 4ANKA 1BG1A 4R0LB 5B1CA 1L7IH 2JIXB 4Y2DD 3UP1A 2J73A 3D0AA 4WUKH 1IC4L 5AD0B 4F57L 2A73B 2NY2B 2VXSL 2ZXAA 1P84K 1FG2B 4RFNB 2ESVB 3NACL 4MJID 1KACB 2BWQA 3CLFH 4RGNE 3U6RB 3I6GA 4H8WC 3ULUF 4N0FB 1RERA 1G0YR 1FNLA 1VZIA 1YMME 2BFGA 3VJ6A 4YMPA 1BZ9B 4J4PA 4LEBA 4MCZB 2O5NA 5D5MF 1ZLVK 2EZ0C 2VO5A 2G9HA 4OSUH 3FQRB 4KUCD 3F04A 4R97B 2YD8A 1PY9A 1QOKA 3CFDB 3QUXA 4NN6C 4AITA 4WO0A 1EVUA 4NQCB 2OX5B 2QMJA 5B1JC 1YPZF 2QELA 3HAEG 3PJNA 3FAWA 3RVWC 4WFGD 1L0YA 2WLYA 4UAOC 1E8YA 1FRGH 4K5NA 4X5QA 4Y5VC 3OD3A 2WBJD 1KFGA 3O41B 1G9HA 3LQAC 4NI6A 3W1ZA 4DETA 1XDTT 1LO0H 4GJTB 3VXRA 4UWQB 4Q0XH 3IETA 1CR9H 3KLLA 5KVGH 4HFUH 2J4WH 3TNNA 1KLUA 4MXQD 2EXWC 1FUNA 3J07A 3Q2WA 4WJG3 1FAKT 3PGCB 4YSPA 4P57A 3WFHA 4NRXB 1AO7D 2HKFH 3ASOB 4GQRA 3N42B 2DN7A 3BP7A 3VD9A 4KFMA 4LNRA 4MB1A 3W9EB 2ZG3A 1MNNA 4S2SA 5F0MB 2R29A 1UGNA 4KJPC 1BVZA 5I0YA 4LT7A 5FKPB 4MNQB 3QK0A 4RMTA 1CICC 4YO0A 3TV3H 4GSDL 3V5DB 4X9GA 4BK5C 5DZAA 3AB0C 1UCBH 4YN3A 1TPXB 1U8MB 3ETBJ 2VLJB 2F5BL 2WZ5A 4CBPA 5F7LB 4FJYA 1OY3B 4EOWH 3I6KA 1T1WB 4HU2A 3N55A 2CHWA 4FTVE 3MRQA 4XAWH 4AQ1A 1LO3H 3CJJA 3GO1L 4EO5A 4W4OA 4TMPA 3GTNA 4QY8A 3MBXH 3IFPB 4XXWA 2GQHA 2F58H 1PVHA 3POCA 1H8LA 4NNPH 1GA2A 1XHHA 3HC0A 4PTTA 1ZRUA 4XC3H 3DUUB 5GRUL 3NEEA 5DVOA 2XG4B 4XX1G 3I84A 5HGAA 3B9KA 2XXCB 4WNJA 4B95C 1E8WA 1MJ8H 1YNTA 2BVPA 3MUZ1 5AL8A 2WGNB 2WZ0A 3QEQB 2HLFD 2HYMA 4QRPB 4MBRA 3QZNA 4PGBB 3EYVB 3VNYA 3KCPB 4HC1L 4YPGA 2EH8H 2Z9TA 3BGMB 1B6DA 1FL6A 2VDML 4IOFD 1M56B 4KXZH 4RMUA 1ODAA 3FSVA 4NQDE 1FH5L 3PAZA 4WI6A 1I8MB 1Q1JH 3T6WA 5F7WC 5GSRA 4QHNB 4F33A 3P11H 1N5AB 4HEME 1H3WM 1MHHB 1WAEA 1SFDA 1ZS2A 3FBQA 3U6RA 5BVPL 4EBQH 1XZ0B 2FIKA 3BT2L 4IRSA 4XN2A 3RYMA 1JS4A 2P5EB 4W81A 4MHHI 4ZOCA 5KUMA 2W07B 2YMXH 1EEYA 2ICEB 4Y2OA 1DJSA 4WHDA 2MCAA 4OCWL 1CG9A 1TZ8A 1PPIA 2IDFA 3WN5C 5DVMA 1PZ5B 3TH2T 4YSUA 3LEVH 4P2OA 4JRFA 2OQJB 3HBZA 4Z7VE 3QI9A 4YS4A 4HHAA 1C5BL 2YR3A 4M1DL 3VFGL 1R5IA 1SLXA 3EXLA 2BSCA 5IF0A 3TEYA 1FV1B 1PKQA 3U1SH 3L3OC 4A2DA 1F4WH 3GSRA 4F7EB 5KS9A 5ETUA 2AEIT 4QRUA 3U6XA 2WXLA 2UZXA 3EYSL 4OFYD 4ZUWB 2GT9B 5CR1A 4LSDA 4NWUL 4KK8D 4XBPA 3UZEA 1NC4D 3IWVA 2C3VB 1A0QH 3IDYB 4KZCA 3A21A 3GSVB 4RDQG 2R59A 3LZLA 5JPNB 3BUPA 2QHRH 4AQAA 5I5MA 1KB5B 2BNQE 1NUFA 4JKPL 4Q6IC 3FTGA 4PRBB 1NA8A 3KGTA 1T4KB 4ZAKA 1BQHA 1YN7B 3MXWL 4W6XB 1DEEB 1URLA 2GJJA 4MJJA 4K2UL 1TTRA 3KLAA 4M6MH 1EK3A 5T1DH 2EO1A 1KG0B 3PWNA 4J3OG 3QI9C 4R7VA 2WZPD 4KHXH 3D4GA 1XCXA 1E9OA 1W72H 2HFEA 2Z8WC 4F20A 1J1XL 1JHLL 5JIMA 5EUKA 5F7DA 1NKGA 2EICA 5C0AA 3TBYB 3J27A 3TA4D 2H2PD 4OFKA 4PJAB 5F7AA 4G72B 5LQBH 3KPOB 3LEYH 3ECWA 2NUTB 4IKJA 4E9WA 3C8DA 2FR4A 5IGXL 1U3HB 4ZOBA 3DRQA 1MCJA 1HAUA 2AQNA 4YBLC 3VXUD 3MBEA 4OJYA 1IGJB 2B4CH 5FYLD 2H41A 4HBQA 4M6NH 1KGYE 4L8SC 5I82A 4IDLA 4JFXB 3VGBA 3TWCH 2DLHA 3AABA 1A5FH 4HCRA 4I2XB 4TNVK 4WTZA 5TDNA 2UV3A 2EVHA 4MKTA 5AYTA 2CUAA 1RVFL 1PKQB 4GXUM 3OBAA 5HVGB 2XWTB 5CR8A 2BJMH 4NUJA 5H37G 3O81A 3MJ7B 1PSKH 4WHYH 3FO0L 3B2XA 2VSDA 1IAOB 3GZPA 4YSDA 1TVBA 4X6CF 3S37L 3IGAB 5DSCB 5H35A 1TZOA 1QSFE 3NFPB 1T7XA 4P4KD 4L4VD 1HXKA 5IW6B 1QX1A 1XGQB 1HCZA 3UPRB 2G3MA 1LD9B 1YNLH 4H8PA 4U1KB 1UH4A 4LRNL 1NC4A 2NPLX 5JW4Q 3FQNA 4XP6L 3IDNA 2FECL 4HJSA 2OR7A 4HFWA 1MCNA 2EXYD 2H3XC 3ZZ1A 2UUDK 3WLWC 2DICA 1VB9A 2OTWA 4DK5A 3IYLW 1OF2B 3DROA 3GJEA 1UB5B 4LLDB 4F91B 2ENPA 4LSQL 4PS7A 2A38A 2FBJH 3B3IB 3EBHA 4X4YA 1PLGL 2ZWZA 5AVWB 3NZUA 3HMXA 4YFDB 4AG4H 1I3GL 4X9IA 5L9DH 3D25A 3MRMB 3K0WA 2AERT 4BK5A 4CVXB 2LABA 3GRWA 5HHOB 4RX4A 1CICA 3CMOH 3L7EB 5EEWA 3T0DA 4B27A 1W8NA 4DK3A 3G08A 1U8IB 2F7QA 4DEUA 1XF2A 4KKZA 2A1WH 3T0BA 4WFGE 5J8OA 3CSTA 5EIIA 3HAEB 1MG2C 3K91A 5DJ0B 1UASA 3TYFB 3ARYA 2W38A 5KTEL 1JYXA 5K33A 2BNUA 3MJ8A 5D70H 2YMTA 4DP7X 2JCCB 1ED3B 2OLDA 5D93B 1KBGH 2F0CA 4OD1L 3RE0A 5HPMA 2A0LC 4A6YL 1R5IB 1DCEA 3MCG1 4JO4L 4S1QH 4Z0XB 1H3TA 3NH7H 4KO9A 1QMUA 2DYPD 4NQDB 2NZ9D 3DGDA 4XH2A 2H9GA 2WINB 3F7KA 5A2JH 3SPVA 3N5AA 2A2QT 2I07B 2PO6C 4OM1H 5HJ3B 2B2XH 5IB4B 3MROB 1NAMB 3FO1A 3AADB 3CZFA 3LH2H 5F96H 8FABB 3SBQA 3QEQE 5CHNB 2NMSA 2VDQL 3MLZH 2VM4A 3B2VL 1IARB 4GQZA 1FO0L 3PWLA 4I3RH 2HT2C 4R3SA 1QUPA 2OL3A 3QWNA 2VXUL 1SYSB 2DM3A 2V7NA 3K80A 3QA3B 2EEDA 1LDPH 4MMYB 4BGDA 4MMYA 1HSBB 4NBXB 4JCMA 3WJLC 2AS5M 4CU8A 3DGGB 4ECNA 1MLCB 1UM4H 1N8ZA 4Y4KC 4IW4C 2ICES 4QTIL 1FL6B 1S3KL 2H45A 1X6LA 4ZXBA 3UMTA 4G8GE 1HYSD 3O6KH 3AGVA 3QNYB 1EMTL 4OI9A 5DO2D 5DD5L 4FQXC 3QJFA 4XCEA 1AYOA 1P7QB 1XF5A 1XGZA 4X98A 4R84A 4LSRL 2IAMA 3FH5A 4O5LL 4K5OA 1P6AB 3SBRA 3BN3B 5HHNA 3FQWB 1KJ2B 5I15H 1CGSL 3LNEA 1KULA 4ANUA 3ZDYF 5H94B 4HULB 3VGHA 1NBZB 3QFGA 4LPWA 5LHDA 4GIAA 4LOVA 3OB0K 2NDGA 2P5ED 3OAYK 4AK1A 1PQZA 3ZHLA 1D5ZA 4D2NA 4H1LG 1V54B 1Z9SA 3J8F7 2QVTA 3MRIA 1O75A 1N26A 2B0SL 3DJ9A 3PFUA 4D9QD 3TF4A 4H8WH 2RACA 2X7LA 4WV1C 4ZYKB 1AGFA 5BRZA 2HVKA 1HL4A 2EE0A 2XQYK 4X7TA 5LDSA 4GEIA 2NTFB 3GKWH 2EDMA 4D0CA 3Q06A 2XFXA 5IHZB 2WXHA 2X4QA 5D4QA 3H9SE 4GKZB 1W16A 2X05A 4P07A 1C9SA 3VA2C 4HOZA 4Q58C 4WI0B 1U4EA 3A23A 3NJGA 5D5MA 4C59B 1BOYA 1KSRA 1NLDL 1UVQB 1S7RB 3MA7B 5HI4C 5I1GL 3IEAA 4EUPG 3GBML 1I1AB 5LAXA 1D5XA 3O6MH 5C0FA 3W0WA 5FA4B 4XO8A 3RVVC 4GXUN 2GUOB 5BUPA 2ATKA 4PJFE 5TH2B 1SQ2N 4H40A 1WBYA 2WB7A 1CFNA 3SDAB 4S0HA 4WI7A 3QZPA 4N5EC 3CFQA 4EVNA 2HWZH 5B1KA 3SYCA 5D7LA 5EU7C 3VFNA 1JZGA 3KPRE 5FFLA 1HIML 2EIKB 3VQLA 5BXFA 1DJIA 3TJEH 3FB8A 3U4BH 3PLYA 2CRYA 4C56D 2LW3A 1T66C 3N1QC 3TWYA 1ACYH 2YXFA 5DJYA 3ARDA 2QPSA 4I2XA 4UOQA 3C8KA 1ZV5A 5AVTB 4G7QB 4KI5D 1R3KB 5IB3A 5ISZB 1L0QA 1U8KA 4M6ML 4HD5A 5JW5A 1OQXA 3MROA 5ILTH 2AJVH 1L9NA 1SDDA 3KDMA 3OHMB 4X8XA 3QZWG 5ALCH 5DVLA 2A6IB 3ZTJH 2JXMB 4U3CA 4F3FA 4NQDA 1KELH 4FFVC 5KVDL 3WEMA 2M26A 4NKMB 2H6PB 1NCAH 4AVIA 2CGYA 1MUJA 1ZTXL 5C7XL 3ULVE 2V3DA 3P77A 4M7ZC 4WEUD 5EA0H 5E4AA 3L1EA 2NW2A 3ARSA 1GIGH 2AK1L 2Z1PA 4JRXB 4L4VB 4LSUH 4Z7NE 3VXSB 4MQXC 2Z35B 3QQ3A 4PJ5D 5SWZB 4Y9CA 3VRIA 1A3RL 4PWHA 1FO0B 4XNAA 3RWEB 3L5IA 3UDWA 4X4YB 2OJEA 1FFNB 1RK7A 1TZIB 2GTZA 4WQOA 3ULSB 1NMCB 4H5SA 5EO1A 5I17B 2YQ2A 3AXLB 4XPTL 3EGDB 2VSKB 1AXSB 4L5FE 2PW1A 1ZLSH 3FPYA 4CSTA 4JG1H 1AY1H 4JO2L 4N2FA 4C47A 1ZANL 2XY1A 1M2VB 3W38A 1G1OA 4LO9A 3HR6A 1T7ZA 1UH2A 2OMWB 3S37H 2BHZA 4OLVL 5HYJD 3OKMB 3VWKB 1YEKL 1K3ZA 5CILL 4KVCL 2C3HA 1KWGA 2CBTA 3C60C 5FLVA 2NSQA 3ZKMC 5F8QC 3SY0B 4DP1X 1X5LA 4OZ4B 4QO1B 4Z3FA 2Z7YA 4GP4B 1J88A 2HRPL 3RI5K 3SKJH 5H4YA 3CIQA 5EFIB 3TGXA 3GIZL 5JW5B 4F8PA 3CLEL 2J55A 4JG0L 4NQSA 5FO9B 3FFCB 4MXWH 1NCIA 3IGAA 4HK0A 5DMIL 3SE9L 1SJEA 3CD4A 5E6IC 1XWVA 4HK0B 3GRWL 1OK0A 4JE4B 2XG5A 3M1BB 3GNMH 4F7CB 4C56A 4Y8DC 3LN5A 3RL2A 2WANA 3OR7A 3WFCH 2I9LB 2ZXBA 3BKJH 5DEFA 3HLKA 1CBVH 1UKQA 2X38A 2AJYH 4GRMB 3GHEH 3RFRA 3SDCB 1USQA 3ARGA 4MMZA 5DFVD 5FGRA 4ZUUA 2VLRB 2Y06L 5DLLA 1DL7H 1DJHA 4KX7A 3L7FB 3HZYA 4IOSD 3EIFA 1N10A 2O5YL 4N2AA 4P3DB 4U0RC 4R6UA 1UT1A 4BA0A 2ICEC 2GTQA 4HPYH 3B9EA 1RUQH 2NR6A 3U2SB 4ZX5A 1XH3B 1SLUA 3LN9A 5AL0A 4GKSB 4BDVB 3KXFA 3RHWK 1I1AA 1IGML 3WFBL 5LWYL 2BJML 3VI3B 4A6YH 2EIMB 1BZ7B 2LOEA 3LRLA 5GS0C 1V10A 5HVHC 5J6HA 4UQ3A 4WJ5B 3HJ0A 5CJOH 4IS6A 2Q6WB 3VG9C 2G9KA 5AW4B 3WFDH 4YHML 3VXRD 3JZYA 4HALA 4X7DC 3VI4E 1WITA 2BS71 4X80L 3HIZA 4WY7H 1OSEA 1WS7A 2IPTH 1HDMB 4I8DA 5E4IA 1BAFL 3BDXA 3GMRB 4LAQH 4IRSD 4JG9A 2O5ZH 2HT4C 2Z34A 2BZCA 3TIDB 4AUJA 2IF7A 3HS0C 3S5LG 4C55A 2DTSA 2M2DA 2IALA 3ATBA 3NG5A 2WYHA 4XWOD 3TA3D 1DN2A 3B2PA 4LCCC 3NZSA 2EADA 2Y23A 3PV7A 1ZVSB 2QDVA 1RIUH 4H8UA 1F3DH 5JDSA 2YD7A 3RVVD 3T4AB 2C9PA 3L4WA 3GBNH 5F89B 5E08L 3B1UA 3BX7C 4J6RL 5IQNA 1XXFC 2NUPA 4JVWA 4NUGH 4E9XA 4RQQB 1AR1D 3QYMA 1E4XH 3CXDH 4E41D 4TSBL 4L8BB 3V5DA 4PMFA 4JN2A 2Z4QB 2ZUVA 3VA6A 3CBRA 3U0TB 2IOMA 2E8YA 5D4HA 3TH4T 3BO8B 1NIDA 5F8RC 5IB1B 2RH0A 3WGUB 3S96B 4GMTL 5F9OL 5EN2B 1MHHA 4ILDA 4NQEE 5JDJA 5J9PB 5C3TA 1BM3L 1O9VA 3QDJA 1QVOA 2B1HH 4IS6B 4V2CB 5IBLC 2VAAA 3VFRA 2XZCH 1Z9MA 5EEXA 2MH4A 3GK8L 2G5UA 1XGRA 3GKWL 2GABA 3TT1L 3S8GB 1Q72H 3U4KA 3VI3A 4KXAA 1NCDL 2PYFB 4L3EB 4NKDA 5J6HB 1S7UB 1NWOA 4NKDB 3L3JA 4LEXH 2DW5A 1XR9B 3B3BA 4LZKA 3O2DH 2E9BA 1AQKH 5DMJB 1B2YA 3WHE1 1A9BA 4BFOA 5JORA 1B0RA 5F9AC 3SKUD 1HXMA 3ILPA 1RKRA 2K4AA 3VXOA 3VD1A 1KC5L 2A5UA 4EUPB 4QWWC 5DYFA 3O6KL 2KPWA 3FHQA 4X5WA 1L9OA 1KGCD 5DMKB 1A3LH 4XWOC 5C8JA 4HWZA 3NIFE 4NYLB 3IDMA 4AUYA 2VXVL 2XG5B 2FATL 2F9BT 4IOIA 5CZVL 5EOTB 2V2XB 4NQVB 5I1LB 2IPKB 3EBAA 2A73A 4F9PA 2EIJB 4G7RB 1JGLH 3MQIA 2CO7A 2UUDH 4JRYA 1QFOA 3MRBA 4MB5A 5T8IA 4RGOH 3HE6B 3Q9QA 5I0DA 4F1SA 4APQC 1G9NH 3NTCL 2D3NA 3PQYD 5D7IE 4HKJA 3T6VA 2V9TA 3UTQB 1ZSDB 3HZKB 3QXDB 5FM4A 1DUZB 3FT3A 1BPVA 1CS6A 1ZS8A 3ULUL 4PJBE 1HILB 4NGHL 4NCC1 4J2QA 5BS0D 1L0PA 3QQNA 4I2XE 3GMRA 1ZEAL 1AXSA 2ITDB 3M17A 1N8OE 2WXIA 4GFTB 1MQKL 4L48A 1MAMH 5E8EB 3WY3A 4JO8A 2VWEE 5EU6D 4K3EH 1S9VA 4R83A 3EFOA 4JZJC 3TJHC 4IIQC 4KK6D 4RDQF 2R4RH 2JJTA 2ZG2A 4WKZB 1W8EA 2VABA 5EA0L 3OAWA 4FEMA 4PJAE 1IBBA 1T6VN 4KZDH 1BFSA 5GJSL 3NFSL 5C08D 3LSOA 1IT9H 3VYOA 3IE9A 2AXJA 3GPSA 3TLRA 4LL1A 4GMSH 3ETTA 3ZVVA 2R4SL 2WXFA 5DRNB 3RX9A 4AYFB 3C12A 2X1WL 1KFAH 1F18A 2QSTA 3D33A 1NCGA 5DD3L 4NHUB 2LFEA 3FFDB 5I1HH 1J1PH 1HZLA 3MRHB 5F7EL 4U7MA 4RAUB 3G5ZA 3O2WL 4P5KB 2WSPA 3ARRA 3MBED 1YEIH 3U25A 4NO5B 4YHZH 3P3RA 4RVBA 3OR7B 3FFCD 3COOA 2XNAB 4IGBB 5E8OA 2ZWKA 5D7LE 3WKQA 4DOHB 3BPNB 4GRLD 2NUTA 2FR4B 3VJ6B 4HLJA 4AIZB 1T21A 4WO4C 1YEKH 4MTMA 4YBQD 4N25A 3QH3B 4PLJD 5GZND 3FN0H 5E1HB 1EXGA 5CGYC 2IWFA 2GJZA 3ZDZF 5FCUH 4GBXB 2HT4D 1GGUA 4NRZB 3PDOA 4QNPF 1JYWA 4WWID 1CUOA 2WBJC 2Y3AA 1AANA 3EYUH 1UFGA 2Q7AA 1CYGA 3K1DA 4MDIA 3D69B 5SWQB 5JIQA 5A16B 3UIZA 1YN6A 2R2CA 1ZK9A 3V0VA 2C9SA 2HFTA 1LNUA 1ID5I 1MCRA 3SDYH 4HUVB 2VN6A 2QPEB 3KL3A 4QKTA 5AKTA 2QPUA 5JO5B 5JPMB 1UM5L 5JNYA 4X6DF 4L3CB 1OTUC 1JSYA 2Q20A 3QIUB 5EBLB 1PDKA 4LLMB 3QUMB 4XWGL 3GWJA 3X14A 2RFXB 4HIXH 1WIOA 4GUCA 5C08A 1ZDQA 3KPNB 5DGQA 3VI3F 2VABB 1QI4A 3WNJA 2MWCA 4Z3IA 4CMMB 3DBXA 2DJMA 1XIWA 4FFTA 1R3JB 4JO2H 3QZWA 3TA3B 1QWUA 3NPSC 3DVNB 1XR8A 1MFDL 2BWDA 4ZS6D 2W07A 4WUUD 4NQVA 2VLJD 1G7HA 2XN0A 3LEXA 3QG6B 3LRSB 5CLYA 2Y7QB 4KKAC 1IRAY 3HUJA 1XZWA 3ML8A 1ZT4A 2FEDC 2WWNA 2XNAA 4IGBA 5EEUA 3G6JB 4PLJC 1OZTG 1O7SA 5AOIA 4XNBA 1WFJA 4FTVB 2WQWA 3FYEB 3FUNA 3OAZK 4I85A 2A6DA 4WJKB 2ENQA 3VB9A 5LKNA 1YC7A 2CA3A 2DI9A 4EI5B 3PXLA 1LE5B 1I1FB 1OB1A 2FWUA 3B9KB 35C8L 3CLFL 3F58L 3II2A 2ITDA 4N8UA 1QW9A 1Q9OB 1T1ZA 4HJTA 4WW2F 1OM9A 4APXB 2PP8A 4IGBC 2VZ1A 5E8PB 3B7RL 4APXA 4AGMA 1E4XL 3CXDL 4GQQA 2O5YH 1AKJB 4P5MB 3FZUC 3IGFA 4CA4A 4P9HH 3C8HA 1DDHB 1YY9C 3CC1A 3ABMB 2XIBA 3HC4H 1VFAA 4J3XA 4BE6A 3UZVA 2OCJA 1N5AA 4PGBA 5EZPA 3QEGH 3WFEH 2X6CA 1G94A 3BIKA 3T2NH 3VRLE 5E1AA 1NFDE 2E9GA 3HE7B 2EXTA 4DCQB 2VJXA 1OO2A 1VGEH 4NHCL 4WK0B 1KCSL 2E0PA 4H4NA 3UZQA 3LVEA 4XOCA 1KJ3H 5SX5K 3BDYH 3ABGA 1PU0A 4KJQD 3FU6A 1EEZB 2B1OA 2IFFL 2QADB 3CVBA 4IRJC 5D2LB 3TT1H 4UQIM 5IQ7H 4YNYA 1BAFH 5KN5A 3U6XS 1TJGH 4LPVA 5SWSB 2FZ3B 3D2UA 3GDBA 4RFOH 1JIBA 4NM8H 1K8IB 4Q7DA 4AEHH 2XKNB 4OB5H 1OLZA 4HETA 4UUJA 4OF7A 3DXAA 4AL8L 1QEXA 3V52L 1D6EA 4FG0A 4Y19E 5DURD 1CTOA 1ZTXE 3KAAA 5F6HI 3L9EA 3ULVL 4Z76A 1KCRH 4JVPA 2BVOA 1VHPA 2VDLB 3FCSA 3H9SD 4GAYB 3K5RA 1TMQA 2QMKA 5FXCH 2C9UA 3VD2A 4NUGL 2X9YA 3T2QA 1BYNA 3ZE0F 4LSPH 3IB4A 3I9IA 2ZP9A 1RUAH 1DCLA 2A0LD 2ZOLA 5EZOH 1WBZA 1UD6A 4DZ8B 1EZVX 4N87A 4PW3A 1SVBA 2WXRA 4NQQA 3IVKB 5HYIA 2VW4A 4OCNC 1X9RA 2EH7H 4I77H 2YD3A 1UB5A 3D34A 2ZONA 3MLWH 1MI5A 3S3PA 1OP3K 3VFPB 4DKEH 1RHFA 4BFBD 1SZNA 4E42A 4YDIL 4AUUA 5KS9E 3FTXA 1LK2A 2VDRB 1KTBA 12E8L 3NCCB 2AEWA 3T1WA 5HDQL 1XVSA 3IETB 1KXTB 5G4NA 3HRZA 4OV6F 1QRNE 1B6UA 2XV2A 2Q8BH 2YARA 3VXUB 2WQXA 1QFPA 2MTAA 4NCC2 4OR1A 4XT1C 2X3BA 3HMWL 1VPOH 2BSTB 4WGVB 2I24N 4BA8A 1C7SA 3DIVA 4HF5L 1IBHA 3B8YA 2VLJA 3OPZH 3P3SA 1WZ1H 2J21A 1J8KA 1SEQH 3MOBL 3QIBC 4OGAD 4WGKA 1MIMH 3F85A 2LE9A 4KPHL 4NSKB 1ZT4B 3RA7L 5JIIA 1DQLH 2XWRA 3RL1B 3C2SA 1E90A 4KZDL 2NYYD 1MY5A 4KKRA 4P4KC 4NAQA 1WK0A 3OKOB 3BZEA 2YQBA 4Z76B 2FX7L 3P3UA 1G4RA 4GBXD 5C09E 1N2RA 1TU2B 2ADFH 3OKMA 1DVTA 1AGEB 3VWKA 3PIQB 1T5XB 5HYQB 5ERWB 4MQTB 1YEIL 5C0RH 5DEGB 1HH6A 3F12B 4I1NB 1E9PA 1BREA 3ZKND 1J48A 2D3VA 3LZFH 4ISVB 2ZCLH 1D9KB 4LCWB 5M7QA 2BOCA 2V3FA 1BF2A 2ZCKH 4P5RA 2F6AA 3B3IA 1OTSC 3DX1A 2XBZA 2N59A 1DE4B 2D0GA 2XU9A 3MV9A 1Y6NR 1A1NA 3VDAA 4J5VA 4H25B 3NSFA 3P30H 4Z7UB 5C6PB 4OD2B 3GDCA 4UCFA 3AITA 2GITB 1JI2A 2YWZA 1H3PH 3OF6D 3IWUA 3EYOB 2OKMA 3Q2LA 1WFIA 1JNNH 3IMUA 4NQTA 1ZK5A 5EU3B 3CK0H 2AHIA 2VDNL 4ZFZA 5JIDA 2ADYA 3HPLA 1CDJA 4R7DB 4UT7H 1I9IL 5IROA 1N7MH 3KPRA 4XCNB 1SF3A 2FDBP 5A2AA 3MLUL 4RRPA 3QR2A 4UB0L 1KXQA 3THML 1NL0H 4OKVA 2DIEA 1K2DB 1KLGA 1RUKH 4G2AA 4NUMA 4HX1A 2HX7A 1RU9L 3OGCA 1TUPA 2JVUA 3FSWA 3QG7L 4PJ6A 4U33A 2KT6A 5TTRA 1JRHL 3HHRB 3ZSTA 1DJZA 3JT2A 2DYPB 4NQDD 3PAYA 4Z7WA 4PG9B 2R23A 5TF0A 1HC1A 4Y16A 1E4KA 4KV5F 2J5WA 2EVGA 5IHUL 1L6ZA 3UJIL 5I1AB 4KK8C 1QWHA 3RPBA 4YHZL 2PYEE 2I32A 3OXSA 2J43A 4YHYB 4MD4A 3DX0A 3TWCL 1BZOA 3QWQB 4BFIA 5FWQA 1E3ZA 1Q4NX 4JR9H 1A3ZA 1MW1A 1IUZA 3APMA 4ZW8A 5C09D 3V0VB 2Z7WA 3SN6N 1T7VA 3BEVB 4XI5C 3AACA 2ZKHH 2Q7YA 3FB7A 3TBTB 1A1NB 2OMTA 2ZG1A 1FWXA 4ODUA 3P0YL 3GHBL 2P1YA 3AQZA 2DQEL 3WUWB 1I1YB 3QZWB 2NCEA 1BD2D 2DIJA 2TRHA 1JHKL 4XVJL 5F21B 3TA3A 2CHXA 5LGKA 3MA9L 1BECA 3TEWA 5GZOA 2NZIA 2EKSB 2YKLL 1JD7A 1WBXA 3FB6B 3VM7A 3FUHA 1G7MB 4APQB 2YJLA 3NFNB 4L5FH 4HW6A 4XPGH 3VXRE 3CH1B 1W6LA 1Y0LA 3QHZH 2R0KH 2P80D 2IBZY 1J8RA 3HS0A 4MMXB 3L5XL 5AVSB 1P0SE 1T1YB 2XIIA 1KTJA 3E80A 4WLCA 5HYJA 3IDJB 3UACA 2J6EL 5F3FA 1UM4L 3GKZA 2WVVB 4OCXH 2BC4B 1R3KA 3PPSA 5EV7A 3VO0A 3D30A 1MPAH 1CIUA 3JQOB 3QXTA 1ZWIA 2K8MA 1JZDC 2FT6A 2FJFA 4FS0A 3OQ3B 4HIPA 2YBRA 2F54D 1NKRA 1BX2A 1NDMA 1T3FA 4JRXE 3WKPA 1E40A 1NGZA 3M86A 1TTCA 4UTAL 5IW1A 3KGUA 4PVLA 4CC0A 3BWUC 2XV0A 1OGAA 2TRYA 1TZGL 1U3HC 3VXUE 3EO9H 2Z4TA 4ZMLA 3ARED 1QRNB 3MLYH 4IOSA 5T3ZL 5FHBL 2X1QA 2J1WA 5EF1A 4OLUH 1HT6A 1I1AD 4XNYL 2F74A 1IGFL 3EO0A 1KCVH 3MDJA 2B5IC 1MIEH 1N8ZB 2DDQH 4LQ1A 4B9PA 1FE8H 3CSGA 4NDMB 5JIPA 5A40E 1O9ZA 3BGMA 1UVQA 3MA7A 4A55A 3D3VD 4OLEA 3H8NA 3GXMA 5IFAL 2OR8A 2GSGB 3VCLB 1T03L 1TITA 3QEQA 1ZHNA 1N0XH 2VXTH 4IBUA 1MDTA 1PW3A 3TTYA 1KCRL 4JRYB 4JFWA 1WD8A 3I9PA 4PWKA 3BAEH 2R7EA 5D1ZA 2HKHL 2EUXA 3F7VA 2WQSA 1M05B 4NT6B 1FNSH 5L2JB 4TVPL 1I9JH 2WLNA 4MJ4A 4L2YA 3GBMH 3CSFA 3C60A 4DGUA 2NNCA 4TV3A 5HI3C 4LBEB 1Y18B 1EHLH 5BV7L 4YLCA 2O6FA 2VSMB 1I1CA 4GIPD 2QVIA 2YD5A 4P46D 4OM0L 4XMKH 3EW3B 3MLWL 4KRPD 1E6OH 2W0LA 3WFEL 5FYLL 2DZEA 1SXNA 2BNUB 4YDIH 5HGHB 4E9VA 1UD5A 2R0LH 1GPOL 5KYXB 4YXKH 4TNVF 3MV01 1QUNB 3AXHA 3GJFB 3TYGL 1HIMH 4KHTL 4HLEA 3KR3H 3IN0A 4J1UA 5EOCJ 3ZMNA 1QSEA 1VZHA 3DX6A 5T1KD 3KD4A 1G6RA 1V7NL 4J23A 2QR0B 4FQIH 4JRXD 2R15A 1EEQA 3VFVB 2K45A 2B0SH 1ECZA 2MHAA 3OPZL 5CUSH 2ZXEB 1QBLH 2DQFA 4ZMAT 1F4XL 2WP3O 1MLCA 2MTPA 3A4EA 5FFOA 1JVLA 3Q1SH 4EZKA 3QR0A 2WM0A 1KCBA 2PW1B 3GMPA 1IEAA 5K9KB 5F88A 1CE1L 1G6VK 1TFPA 4NRXA 1TR7A 2AGJL 4JDTH 1S7TB 4ABQA 4A7TA 3OHXA 2GC4C 3JSSA 1BMWA 4UDUA 5ECGA 3T6XA 1PG7X 5CFAA 3GMNA 3HNSH 4FYSA 4FQLL 1HDMA 1SDYA 4UQBA 4R7NA 2ZYRA 5FKAB 2GBUA 2K3TA 3T77A 2NY1D 2BXZA 5MENA 4XGZA 2YEQA 5ACLA 2VSCA 3O9WD 3QQ4A 4K55A 3OWEA 1CD1A 2D3JA 1UADC 3K74B 3WMQA 4B9ZA 2F61A 4GAFB 5AAMA 3RPKA 4GO6B 4KKCD 1NCJA 4FZEL 3BN9D 1DBML 2FECI 4PY7A 1KJVA 4H0IA 4IBVA 1B4RA 3C5ZB 4OV5B 5T3XD 4AYFA 5I1AA 1U95B 5F3BA 3RTLA 2CA4A 2YUWA 3NPZB 1UOLA 3NFPA 2DH3A 3ARUA 4P5TA 2LVEA 2P7TA 2YD1A 5FW7A 1I9IH 5IUCA 1UZGA 1XF4B 2E4FA 3QEHA 2JE8A 3CHPA 2EUVA 5EU4B 1RLWA 4H25A 4L3AA 4G43A 3K2UH 5JW3L 4AEIL 3GIZH 2Y5TA 3TPKA 4JE0A 4FERA 5ALCL 1EZSA 2W81C 5LAPA 1UWXH 4AQAB 3ZTDC 1BZ7A 5KW9L 4HUXA 3ML9A 1CL7I 1YYML 3RAJH 3N42F 1CD0A 4UF7C 3BE1L 5E51A 4DT2A 2CDEB 2DBLL 2GJPA 2JWYA 3TFBA 2MKLC 2PCFB 4G70B 3K71B 3QUHA 4KRNA 2EDQA 1PMYA 4ORZC 3TONA 1K8DA 1OOWA 1YY8A 3Q6FA 4KNTA 4ONHA 4G3YH 5GQBA 5B22A 1D6VH 5FYKU 4OT1H 4GFXA 4N3TA 4OBRA 5C07E 5FIEA 4JB9H 5T1MB 5IZ7A 2QSVA 5CBAA 4WFEE 4B7IA 4NN5C 5I8KH 3I6SA 1KJMB 1FFQA 4Y9FA 4N8CL 3V7AG 3OKNB 2KLSA 3PWPE 1U93A 2KDGA 1K2DA 1KLGB 2Y24A 3ZYOA 4QJ4B 1U92B 3EFDH 3BT0A 1BGXL 1MJUL 1PD0A 2CRIA 2KYIA 4Z7OB 5IJVB 1IVTA 1C1EH 2IAMC 4JM4H 4Y2NA 1I8AA 3HN3A 2OMUA 3WLBA 2R29H 1K4CA 4YE4H 5EN3A 1JNNL 3X3GL 2IH9A 2BFVL 4Q52A 3L08A 4JFHE 3ZO9A 1TEFA 1WC7A 2KLRA 3UYRL 5CILH 3QS3A 4AVHA 1LE9A 3VH8G 2P7TB 2WTPA 4N85A 4HQQH 1BWWA 1EBPA 1CPUA 3I2CL 2C3VA 3K4DA 3L5WA 4GUPA 3TIEB 3WJLA 5K9OB 5JW4R 5D1XB 5K9QG 3MBWB 1VCBC 1CFTB 1JERA 2BP3A 1IBDA 1P4UA 3LRKA 1IBYA 4MQXD 4ZXBD 3WMSA 1UD8A 5DZOA 2EAEA 3EGSB 5CJQH 3ASWA 5LUMA 2VZOA 1BZEA 4K7PH 3BPOC 4PJAF 2KKQA 1F4YH 4QHPA 3X1EA 2J20A 3CGTA 1RIUL 1CF8H 2DLEA 2PO6A 3GSXB 1R9FA 3ARBB 3UAJD 1NIAA 4KRPC 3DHMA 5E6YA 2NXZD 3VGAC 4DAGL 3BRGC 1E4WH 2JELH 3PU7A 3L3KA 5DJYB 4ZMYA 1SRDA 3OKEA 4UNUA 5C0JB 3QARA 4JR9L 4PCKA 4N1HB 3EFOB 1JGVH 3MACH 1J0KA 3AMKA 5CBAB 5EUOA 4N0RA 3Q48A 3I6KB 5I8OH 1BVLB 3CFJB 5C0AD 5D9SB 3UTSA 1F0LA 1NAKH 1JPSL 1EGJH 5HJDA 2NRDA 1E7VA 3X1FA 1UD4A 4F3FB 5INDA 5DLML 4BSJA 4I18B 2NLJA 1NBYA 1ZGLB 3QNFA 4WUUA 2V0AA 4PGDB 4ELMB 2A74C 2XXGA 5EZJB 1TTBA 3MMEB 3RP1A 5I6XB 1S6NA 4AYEC 3RJOA 2YWYA 4KK9D 1ZGLP 3I3EA 2VXTL 2Y5TB 2XQYG 1QYGL 4NYLA 3NEXA 4WCYL 5T33L 3IMVA 4NKOB 1IQWL 3MFFA 2GW5A 5EOTA 3MUUA 3EOBB 1AQKL 5C9JA 3PQYB 2OMVB 2WTRA 1FIEA 5TE4H 1IKFH 3QRFM 1BVNP 1OE1A 5T1KB 3P73A 1N64L 3V4PB 4HT1H 4U6YA 2EEBA 2FZ3A 3D2UB 3EGXA 1AD9A 5HGGS 1AQDA 3V4VL 3DSNA 1AVAA 2W59A 4HZ1A 1U4FA 2OXGA 5C0FB 4XAKD 3A5VA 4UAHA 5FYKH 2YGVA 4UQ3B 1GGIL 3VXMA 3F7YB 5CAYB 1FNFA 3BP5A 5D72H 3QWRD 1RZKC 4UTAH 1QR4A 1R1CA 2XCMC 2G5BA 2FLBT 1TJXA 1ETJA 3ZTNL 1V05A 4HWEH 5EU6B 1VFBA 3VFMA 2P5EE 2PPCA 2PYFA 3ARXA 3EBIA 3L2MA 5D1QC 1QFWM 3BISA 3WJJA 5ICZA 4M8RA 1FL3B 2OV0A 3Q6GL 1UEMA 2VL5B 3IFLH 5KZCB 3RFZB 1AHWC 3BFWA 4L8SA 2VITB 3T3MF 1BP3B 5C0NC 3ULVF 4GG6A 3PPEA 2OMXA 4L05A 3MBEC 4ZZKA 2HJFB 1AZUA 3KJ4B 1YEJL 3HB3B 4PJXE 3VQMA 3MRJA 4PJEB 1EO8L 3LKRA 3O45B 5AOZA 4K9EC 4GAJL 1Z9NA 1NEUA 5D2NC 4NUJB 1UWEL 1HK6A 1E8ZA 5A7EA 1SJEB 5J3HD 4HDIB 1MAML 1UCBL 3GSOA 3LKSB 2PPFA 4RQQA 4JM0A 5BRZE 3ATDA 3D0LB 4LSTH 1G1YA 1P69B 1RZGB 2MHAB 1R19A 3KBEA 4FI7A 4JAMB 4L2LA 4N68A 5DC0A 4ZUSB 3V0GA 4AQOA 4YSEA 3KPQB 2XPYA 2ZSVB 2OZ4H 3KPQA 5IEHA 2WN2A 4ZAKC 5JW4N 1OAYH 2H0EA 1NTDA 2NXYB 3U9WA 5DD6B 4OF8A 2WLHA 5ESAB 4X9FA 2QZQA 2FX8L 3MV8A 4FTVA 2DOCA 4XBGA 4M29A 3KPOA 3SJVB 2ZAGA 4NJAH 4YFEA 2WXGA 3FQUB 1CLOL 4OZIA 4YDJA 1HN1A 3JUZA 5A2CA 3MVSA 2GI0A 4JY6A 5ANHA 2ED7A 3HPJA 3QCTH 3B43A 5D2NE 2Y07H 2AVFA 3UO1L 3QJRB 4R97C 5EO0B 1F3DJ 5I1KL 4LMQE 1T1ZB 1ECYA 3QO1A 5FO7B 5F3HA 1QPPA 4Y9BA 4KZEH 1OT4A 4GG8A 4K4KA 1RZ8B 1C08A 2FHBA 3H42H 2RCSH 3RFZA 3GEWB 2ZICA 1NAML 3B7SA 5D1QD 2NQ3A 3WTYA 1NBZA 5I9QB 4MYPA 1S9YA 4IBYA 2J8UB 2VMJA 3HI6H 4TVPD 4W6WB 5T1DL 1YPZA 2DTML 2X89A 2YLKA 5DI8B 2ODIA 2IH1B 3BZFB 4PY7B 4JLRB 1W72L 3VMOA 2VLRE 4F7PB 2E7DA 3E9UA 3MV9E 5EIIG 1AOHA 2RHEA 3ILQD 2ZWNA 5I8EB 1OK8A 4Z7WF 1YYMH 2L0DA 3DOSB 3GI8L 4PY8J 3RAJL 5INCB 3SB3A 2FQFA 2P45B 5AKRA 4UT6H 1HE8A 1RZFH 2DBLH 3MLVH 25C8L 3X12A 5A43C 2AJSH 2H32B 2YMXL 3I9GL 3TBSA 3CUPB 1AGDB 1AHWA 2XN2A 3EYQD 4PJXF 2NW3A 2KZKA 5DHYA 3R7QA 4FQLH 1MFBH 4QHKJ 4OD3H 3X1NA 4J39A 1OAXH 3QPXH 2AMGA 2PYEB 1F8TH 3DVNA 3ZIMA 1AP2A 3MLRL 3WJJC 5IREA 1M7IB 2N1TE 3LRMA 5IQMA 4P04A 3O6LL 5ID0A 4R3SB 1FDLH 3HE7C 5GGTA 3ETBF 5IVXF 1BPLB 1A4KB 2PF6A 4OKVB 1I7ZA 3T0AA 3O2VL 5D1XD 3VD0A 1T2QH 1QO3A 3BZ5A 2NY0C 3OG6B 4HPOH 3MYJA 3IJ7A 1JMZA 4FZEH 5I26A 1A9EB 1T83A 5GSRB 1BGXH 1MJUH 3E3QC 4DKDC 1OF2A 3DROB 3GJEB 1G7JA 4LSSL 4CC1A 1MRDH 3IU3B 4LL4A 4DZBA 2O6DA 5D8JH 2XRAL 3QWRA 4NO2A 1CYWA 2CDEA 4UIKL 4NC1E 4OQ1A 4M02A 3GSQA 4MDJB 1A6UL 3FSAA 4P4RB 1RIVH 1TETL 5HHOD 2C1OA 4N90E 1YY8B 4EKXA 3UX9B 3LYRA 2ZOOA 3BH8B 3QUZD 5D7JD 5DK0A 4Y1SA 3QULB 4PUBL 3TYFA 3BZFA 5F3HB 3TCXA 4L4VE 1ZHKB 2AEOA 2A74A 1JL8A 4P3CH 4O58H 3VVVA 4E68A 1CGVA 4PJDF 1HHIB 3H3BC 1AXIB 4L8DA 4POZD 5ICUA 5BRZB 3RWDB 5JYMA 4AQZA 1WDAA 1CCZA 2DKMA 3O4LB 2I85A 2XTLA 5DUPL 2CG9X 2ZTBA 3D7PA 1UT9A 1MHPH 5T5FH 2ZOWA 3QC6X 1E4WL 4PJ9B 1BJ8A 1C5DB 5SWSD 5DD0L 5IEKB 1RHHA 4AGLA 3PHQA 4O00A 4JZJB 5FUOL 5BRPA 3AUVA 3CDYA 4ZNCD 2ZSVA 1JN6B 3VACA 3FQ1A 1LJMA 4CGTA 2V9RA 1F11A 5IBUB 1CTNA 3QEGL 3D4ZA 3NCJH 3CX2A 4Y5VA 3UTTD 5GS2H 5I9QC 4JO4H 4S1QL 3UTSE 5D4JA 2CR6A 4FFYL 4OTXH 2YGOA 5B1JA 5CEYB 5CGBA 5JHDA 5A2KH 3CWGA 2Y7MA 1ASOA 3BUYA 4LDCA 2XHNA 2LFGA 1E27B 3SGKA 4K15A 3VFNB 4X99B 2C1PA 4JDEA 1PZ5A 1M9WA 5DJ6A 1HYSC 1X5ZA 2K1MA 2O1AA 4GQ9H 3IKKA 5CMAA 4DEPC 2BSBA 1TO4A 4XMXA 3F5WB 5GS1C 3L4ZA 1INDH 4NO0D 2CCVA 4XPAL 3IDYC 3VFPA 2VXUH 1CU4H 4JQIH 2ZE0A 2OS7A 2CNZA 5J4MA 2ZWLT 2NT0A 3QXAA 4UMGA 5I18H 4ODWA 5DO8A 3A6BL 4Q6IB 3ULAB 1IE4A 4XNDA 2KUTA 1S3KH 3QUZA 4AV5A 4CKQA 4Z7NF 4HT1L 2HCZX 2NY7H 3RTQD 1I3VA 3K5SA 4TNWK 4LP8A 4PWEA 2Q3ZA 2QV4A 4O9HL 4D94A 4W6YB 43C9A 1JHTB 5KSBB 5E9DB 3PGDB 5EU5A 3T9WA 4ZK8A 2ZF9A 3UG4A 4TSCH 3JZ7A 1D7DA 4JS7A 3UERA 4G9FB 2CK0L 4LLWB 2BX5A 1O0VA 5DJCB 4EUPA 4Y2LA 3PNWA 4P9HL 1AQMA 1NGXB 2OJZH 4QOKD 1R4XA 2ZKXA 1WPCA 5C2BH 2GAZB 3DTUB 3REVB 2APVA 2D03H 5BS0A 4NNXB 5DD6A 3LZRA 4ZJ9A 5JXEC 4WSKA 3RWGA 2DM7A 4O4YL 4MJ2A 4QXGL 4HWBA 4LGRB 4LBEA 1C8PA 3ZE1F 4P99A 5BMFH 1HINH 1NWPA 1QBMH 3VGGA 2BY2A 4FTDA 2XT1B 3ZTJG 2NY5C 4X5PA 5B7MA 1BLIA 3PAVA 1VCAA 5EBWA 4F7EA 1RI8A 4YX2L 4J3WA 4EN3A 4EDXA 1S46A 5LNEA 2HN7A 4LCWD 1E3FA 3BVNA 4I3RL 1QBBA 4FNPA 3KPPB 1ZT1A 1LDPL 1MLBA 2R0ZL 5BO0D 4WW2A 5J57B 2J7LA 3K7UA 4N0UA 1WIPA 3JV4B 1XTLA 5DFTA 4CKVX 4HGWA 5GZOD 3BAXA 3BD5A 1C5CH 1RJLB 3SPIA 3AJ7A 1ZXKA 1GC1H 1Q9OA 4N8VB 3RWCB 3SO3B 4DKFL 5HTSA 1IB5A 4N8VA 3RWCA 2PMZA 4C83B 3P40A 2PWGA 3QUMH 2NY0D 1C12A 1DBKH 2DMHA 1BWMA 1KLUB 3II1A 1DLHA 1JZ2A 1MCFA 1IEBB 5IB4A 4N6RA 4OVVA 3IDXL 1S7WB 4Q8BA 3R18A 1GS6X 1VSCA 1MAKA 4KJQC 4WAFA 3VG9B 3UAFA 1FNEA 4J3OD 1F4AA 3VSTA 3D51A 5EB9A 5DO2C 3O9WA 1O9WA 2CKBL 5BVJB 3QFDB 3ABKB 2HLAB 3GSWA 4ZTPH 4FNQA 2Z7ZA 2ARJB 1GJWA 1IAII 5FKPA 2A6DB 4YHIB 3QG6A 3PF2A 3N9GH 1U58B 3OHXC 5J89A 4IRZA 2X3CA 1XBRA 5I1IH 3VXSD 5LG1A 2EDYA 3HS8A 3AREA 4UV4H 1A7NL 4N2KA 5K1VA 4CAGA 1M9SA 1IFGA 4AEFA 3AG4B 4X2UA 1GYCA 1D2PA 2NY4B 1GW6A 4PH8A 5EIIB 1SXSA 5J7CC 4W4NA 4NZTL 3GI8H 4QRFA 3VFTA 5CLWA 2BSEA 4M1GL 25C8H 3SE6A 4EIBA 1C16B 3B9VA 5E00B 4PRHD 1ZKAA 1DQDH 4CNIB 4TUJB 4ODUB 1CLYH 1H3XA 4HIHA 2RA1A 3MJ9H 1KTLB 1PLBA 3P4MB 1DP0A 4G59C 1OAJA 4YHLL 4PYGA 2VZSA 5ECJE 4A6YA 3BEWB 5C70A 3QUMA 5CCGE 1OSYA 2IALB 1FG9C 3QUZB 1ZIBA 1EERB 4YSAA 2JIXD 4RETB 5AG9A 2EDKA 3NJMA 5DWUL 3CZGA 4F80A 5F0PB 3UROR 1WAAA 3S97C 2X5PA 3MODL 2FQDA 5FDWA 5HHQB 3HNTH 4IMLA 3OKYA 3WE1A 4O2FB 2VXQH 5B7EA 1CGTA 1IGCH 1QHQA 2DLTA 4ZQKB 2NX5B 5JOFB 4KZEL 3F7QA 5GIRA 2UXVA 3CFKB 4DUXA 4M00A 4P2OB 5D1ZC 3M7OA 5FGBC 2E27H 1CVRA 2F5AH 2F1AA 3B8SA 1NGWA 3BLPX 3V10A 4LLVB 1F86A 5DJAA 3DO7B 3WDJA 5AW2B 4OJFH 2CDGB 2HTLD 4RNRB 5DEJA 3HG5A 5ITFA 4LLAA 4Q56A 5T1LD 3GJFH 2DQJL 4M48H 3UABA 4LGSB 1A4KA 1EBAA 4MB3A 5KJ7E 4O58L 4P23A 5MERA 1KYAA 4DIXA 1KCWA 4EXPX 1H19A 3SQBA 5T1LA 2HPTA 1J0HA 1OXYA 1VEOA 2HPOA 3BAJA 4F92B 5MEOB 3BKYH 1WTLA 4HUKB 3T3PE 2D0FA 2WC7A 1QHOA 3TO4C 2AK4E 3KWTA 1SVZA 2XX0A 3LPWA 1KTLA 3IMSA 3P4MA 1N6UA 1OAZH 4KKCC 2QGEA 2HFGH 2L7UA 4B3VA 2ZX8A 2IBGA 1PZDA 2HH0L 5HGAB 4I4WB 1NGQH 2ADJB 3U9UA 3R0MA 2AF2A 1F58H 4GIOA 2F68X 3LSOB 1MJJA 1IEHA 1K5NA 1Z9PA 2E6QA 5DK0B 3TBYA 1KYFA 1SY6A 1HAWA 3B7UX 2VZTA 4JM2B 1A6TA 4WUUE 3GSNA 3SYOA 1DEEA 1A2YA 3KPSA 1HHJB 4IMLB 2OMNA 3MLXL 5JOEA 3LZQA 1ADQH 4YHMH 4X83A 4QTFA 3CZUB 3T8VA 5FOBA 1QKZL 3STLB 2VDRL 4LASH 4A67A 3KH4A 1JZFA 3DX7A 5I76A 4IKLA 1YDPA 1IGFH 1USZA 2F7IA 2J5LC 1PZ2A 4XMZA 2OYLA 4Y5YC 3BWAA 4KH9A 2BP8B 2ATPB 4P46B 2FEJA 5TF1L 1QAWA 5HHXL 1U58A 1A4CA 1RD6A 4QHMA 4MDIB 3SE9H 3UGXA 1BFVH 3M1OA 1ZSDA 4JPVL 3WYRA 3ZYJA 1KUMA 5GZOC 2WLKA 2ZX5A 4QF1B 3GNML 2EUZA 1N3NA 1NPNA 1HVXA 3T09A 2ADIB 3SOBL 4ELMF 2AI0H 4O9HH 2GI7A 4JO1L 4XTRC 3P9LA 4LLUB 2YUZA 5I23A 3QPQC 4UUJB 1N18A 3ISWA 5B4MC 1WFNA 2OMXB 3A24A 4TVPE 2D73A 2VLMD 4K3DL 3UL4A 5B39B 1T04B 1YQVH 2WXNA 5IBLD 4L3ED 4LHUB 1HXMB 3AQYA 4IDJH 5H4ZA 4M3KB 1V3MA 2NOYA 4TUKL 3AWGA 5LWYH 1AZCA 2F7RA 2UWEB 5LBSH 4QXTB 2IMMA 2CIKB 1E4KC 1KB5H 1FRGL 1EV2E 1MI5B 2MQGA 2BZ7A 1BVKB 3CDFA 1A7OL 1W2KT 4Z23A 1BVKA 1P7KA 2A4ZA 5F71A 2ADGA 3CNKA 1ERNA 4B97A 1HINL 2CWRA 2X4TB 1KV3A 4LIQH 2VZUA 5M95B 5DFAA 1XH1A 3W39A 2XPGA 4H20H 1XQ4A 4M7LL 5CCKL 1F45A 2WUBL 1G7HB 3JVFC 5D71L 2VR7A 2VDMH 4CU7A 3G3LA 2NDFA 1FG2A 4XMWA 4X6CA 4LLWA 4XBGB 3DMMA 1FH5H 2ZP0T 3IFOB 4WWPA 3VWJD 3T0EA 2O5XL 3MUHL 1TQWA 5EPMB 3MREB 3SSGA 4ZNEE 2XX1A 1QHPA 1NGPL 2X4RA 2BHUA 3DI3B 3M6DA 1IM9B 4HUUA 4GSDH 1C5CL 3VW3L 3M45A 2WD0A 3JBG7 4AQ8C 3NIDE 4YR6B 1SYVB 4JQXA 3GS0A 1D2OA 3C08H 1G7IA 1HYRC 3F7RA 2MOVA 3ZE2F 2RB8A 4XZUB 4CADA 1UYWH 5CLXA 1RP8A 3HG2A 4CADB 1S7SA 2AXFA 2C7UB 3ASNB 3B7TA 2FJFB 3ORJA 4KKLD 4XCFL 3QNXB 3OAUL 3QNXA 1IU1A 4UTAA 1NCBL 4XAKE 3GSOB 1I7RA 1SM3H 3V0AC 4Q0XL 4NN7B 5C9KA 1GZQB 2XQYA 2CKBH 1F1GA 2W94A 2ZUQC 1FF5A 1ONQA 3VXMD 5C2BL 2FHCA 4QEGA 1DVXA 3ZKXB 3V6ZB 1LO5B 4H1LB 1SXBA 4S2SB 3ET9F 1XTMA 5KBKA 5GRUH 2E46A 1NCUA 4JDZA 4HOXA 3U30C 2NYKA 4NRYB 3WFHB 5LXVA 1LEGB 1P6FA 1QPXA 3EYFA 5E2TH 2QHRL 2Q87A 2GY7B 3M8OH 3CCHA 4EAEA 1QQDA 4TPRH 2D7MA 5C0JA 5DR5L 1T21B 1U3NA 4NQCE 3RGVB 3T2OA 3U4EB 2K0RA 4QYAA 1M05A 4NT6A 3VCLA 1OARL 5HVHB 1MCIA 3MJ9A 4QTHA 4LDEB 5ABZA 1U8IA 2CLRA 2I25N 2X4TA 3NA9L 3NIGE 1R3HA 1A7RL 4PJXA 4AMKL 3LXUX 2XVLA 4L9LA 1DN0B 3FQTB 3Q8FA 1KBPA 4U1JA 3I50H 3EJUA 2BC4A 2IO5A 2OMZB 5AVXB 1B3JA 2OXHB 3HRZC 5FOJA 2G9HB 3QDGB 5J9PA 1KT2B 4WO4D 3QUXB 2F58L 4LL9A 4OCWH 4AMXA 2A6KB 5CEXB 4Z18A 5DSCA 1T04A 5T1LB 1NQBA 4N0FA 5KSBE 3LZPA 4OT1L 2F74B 4JJ5A 3EF4A 3U79A 4HGMA 1KEMH 5KBLA 3F62A 4QIRA 1FZOA 4E9QA 2XWZA 3PJSB 3VSQA 1D7FA 1UXMA 3MKGA 5HGDA 4NZDA 4Z7UE 3GI9L 2A74B 1B4LA 3BJLA 4ZFFA 3EADA 1EXUB 4J3OF 5I2IB 1NC2A 4ZFOL 1CXEA 3RKPA 3MV7D 5LJYH 4TTDD 5J3HC 2QEJA 3RURA 5ANMB 4RWHA 1UOKA 1QTSA 2ZWYA 4HOMA 1JPGA 1Q1JL 1NJ9A 2CO6A 2NXZB 3DVFA 4O2FA 2PCFA 1BD2E 1YNLL 3N85H 4YAQA 3MYJB 4JFSA 5C0BE 4PJ7E 3ENEA 3GLEA 4U1MA 3M1CA 4OD2A 4BQ8A 3FB5B 4U6HB 1YNTF 2BNRB 5J13B 5JW3H 5C0AB 4AJWA 2R4RL 2WWOA 4XZ4A 3ARGD 4I0PA 5HYSB 4IRJA 5CEZL 1I1YA 4TLKA 4RISL 4GRWH 2IQAA 4WSJA 1KB9K 3GTVA 1WP6A 3K6IA 2EVIA 4Z7AA 2VLKB 4MASA 1JRHI 5C0AE 4M7KH 1YUKB 1CL7H 4J3OH 4QRRE 3IBOA 4YL4A 2ZCZA 2ZZUT 2X9XA 3ZKXC 4U1IA 5SWZE 3WU1A 1F97A 4KWUA 1QTYT 5HHPB 4F58L 4QXUL 5TDNB 3PE9A 3FTWA 4GH7B 3MRCA 3MNVA 1DQTA 1BSIA 3V4UL 5IOKA 1L6XA 2XWXA 4IK6A 1NICA 2CRZA 4P23B 4YSCA 3K6DA 3Q2CA 1EJOH 5HYQA 3IJYB 4KMTL 3W2DL 2Q3AA 5FFGA 3WUZA 2E27L 1TVBB 2F5AL 4QKXB 2ORBH 3MXVL 1RK1A 4LQFH 4M4RA 3ZLQC 1BQHB 2P9RA 4CC4A 5JHDD 3DETC 3VE0A 4CC4C 1WUZA 4IHOB 3JWDC 4LF3B 2VN3A 4JY6B 5A6IA 4U4BA 4ZO9A 2V2XA 5FS5A 1XB3A 4R2GC 4PJGB 3SYPA 4OI8A 5CGYD 3GXPA 3TBWA 1A8ZA 5FKAA 5IMLA 4AXWA 4HS6A 2HZHA 2AAAA 2P52A 3HE7D 1Z9LA 3C60D 4XCYA 4AYID 5LGHH 4I0PB 3ZKMD 3N40P 2CO6B 3SDXF 2VITA 1XX9C 2HFGL 3UTQA 2DS4A 2JI1A 2P24A 3PL6B 4NZUL 3HB3D 3QI9B 3UTZB 3FH8A 3O11B 3P4OB 5AKSA 1N6QH 2JK5B 4NLAA 3FT4A 4R96A 2YN5A 4N3UA 4NSKA 3WS6A 3ZE0B 5CD5C 4DAGH 2AXGA 5SWSE 5A6LA 4YXHH 1INEL 4OFPA 3NQKA 4O5LH 3UCRA 4CMHC 1L7TH 5C3IA 2A9ML 3VRJA 3MRGB 1QZ1A 1CD9B 2HA1A 1XF4A 5BW7C 5DS8B 5ICXA 1X4ZA 2OQJA 5FM5M 3QW9A 4L4TA 4ZAKD 2WQ8A 5DS2A 3PIQA 3U1QA 4OF3A 4K71B 4OGXH 3B2UD 5LO7A 3RLSA 2PYEA 3GSVA 3H9SB 4QD2E 1DQML 1PFCA 1TXKA 1R5VA 5DLMH 4YIQA 4XP4L 2GCYA 1TYJA 1LP9F 3UXFA 2FYYB 4AY0A 5JPNC 1MUJB 2YAQA 4B60A 3K72B 4JW3A 2PCYA 3KL0A 5K9QI 2FGWH 4Y1AD 3GZOA 1I8MA 4WTWA 4LKCA 2EUWA 4JO3L 4H1LH 1AO7A 1SN0A 5F96L 2X0UA 2WBJA 4YFLI 3E8UL 2QVKA 5EZLB 5AYUL 3UFIA 1JFHA 3B2VH 3FONA 1S7WA 2CKBB 1GRWA 1RSFA 3UTTA 1XF5B 2WJ5A 3FUIA 2IG2H 2CBQA 3KEDA 3NYKA 1XCQA 3A6CH 4LSTL 2AP2A 4A2LA 5LBGA 5PAZA 5TE4L 1QQDB 1BFOB 2AEPL 2V17H 5DMGD 1UURA 2YA0A 3IBEA 3MV8E 4OQTL 4J4PD 4BZ1H 5CGMA 4JFEE 4UINL 4KXBA 1WA1X 4FCAA 3TO4B 2F53E 4LARH 3PS6A 1WF5A 2XVKA 2OMYB 3MRPA 4WW2B 5LBSL 5E95B 4KXZI 4JKNA 2BVEA 2YZ1A 1XXDC 1JBJA 2GK0B 4L9LC 1NAMA 3FO1B 2XA3A 5AKVA 3QIBD 4ZUVA 2P8MB 1AC0A 1M6OB 5E5MB 1U91A 4JGUA 4L4TB 4AGPA 2HVJA 1AOZA 2RAMA 2V5SA 1T3FB 2Q0ZX 1GSKA 3DUSB 1G84A 1DJXA 1BIIA 6PAZA 4PD4J 4BQCA 5EBGA 2NYYC 5KWYC 4WO4B 2ERJC 3O3EA 2ZOTA 4FNRA 1TJGL 5MP6H 3BP6B 2IWGA 1U8CA 3PWUA 4OCLC 4E41E 4HAKA 1JPST 3QQ9D 4NQCD 1CDHA 4JZJA 4P2QD 1FO0H 5DR5H 5A6MA 4IKIA 3J2PA 2F1BA 3TBVB 1K4DB 2VQ1B 3HUJF 3IPEA 4IU2A 2K7PA 4P2RA 2B14A 2OL3H 4GG6E 2WO4A 3QDJD 3V4PA 2EDXA 2DH2A 5DUBA 1MN4A 3RB7A 2VLRA 3KYKH 3OM3B 4DHLA 4JGMA 3FRPA 3O8XB 3PQYA 3PGCA 4R9HA 3VXTA 1DBAL 4UANA 1R3JA 3X13A 1U8JA 1EFXA 1AR2A 1OCRB 1TSHA 2GB2A 2ZWSA 2ZT9C 4GW1B 4O02B 5C7XH 5I6PA 1RJYB 3H6AA 2YAPA 2G75A 3O0RL 1G7MA 4APQA 4XCFH 4XMVA 4E9LA 3HAEH 3E2HC 3SBWC 4KQ3L 3RBSA 4ZG1A 4R96B 4ZODA 3O6ML 1DBJL 2D7NA 3WO3B 2I60H 2Q6WA 3F84A 4I5BB 5KN5B 4F9PC 1MWAA 4RMRA 5HHOE 5ADOH 3TTSA 4DVBB 2KDYA 8PAZA 4TQ8A 2P24B 3L9YA 3O2VH 4OZGF 4AQ8A 4ODXA 1PYWB 3Q3GB 5IB5B 4M61A 5FYJH 2FH6A 3Q6FB 2WNWA 4I9XA 2YJQA 4U3SB 2JK5A 3SQBB 4F2ME 3H3KA 3L13A 2XWJB 1AY1L 3L4VA 2V5YA 1DUYA 1SFHA 3DMMC 4JFTA 1ZANH 4K9EL 4MVBD 3SE3A 1CJYA 4MCZA 2VLKD 4JY5L 4RFNC 4NENB 5T5NG 3SE8H 3VAEA 5DVKA 3TM6A 3MYZA 4YZFF 4UIKH 1ACYL 2QTEA 1U2CA 4TQHA 5JUEL 1WAAE 4TUOB 1GYAA 4YEFA 2Y1VA 4K7FB 3TPUB 2EVFA 4ZFQA 1HNYA 2W9DL 5HGDB 4MA1B 4UB0H 4PYHA 1H6TA 1OPGH 4G8IB 4LPCA 2UY6A 2XA8L 5EULV 3W3BA 4HKZB 3MNZA 4UZSA 1MFEH 5TE7L 1QBAA 3ZU8A 4OZHE 1KBVA 2JH2A 2YUXA 4V1DE 3RX8A 1GKEA 2AK4B 2UWEE 1QLEB 5DMIH 1YYLH 1GMEA 2LLNA 2J2ZB 3WIHL 5HYSG 3LXBA 1ITBB 1ZT7B 4JKWA 2OSYA 4D8OA 3U46B 1PG7L 4RAVA 4DNLA 5JHLA 3WFCL 1R3LA 3QFJE 2ZF8A 4KJYB 4PJGF 1OHZA 4U1MB 3G6DL 3NABH 2TSAA 1K5WA 1F1DA 3C5SA 3PWPA 2BZDA 2E7MA 4TOYL 1F8TL 2JMRA 3UBHA 4G1MB 2ZX7A 3DX7B 2VDPL 3PHAA 5MHSD 3LY6A 1U9KA 2DEWX 4LVOB 4NO0B 3F6JA 4ODHL 3FOLB 2GYSA 4ABUA 1AQHA 2ERJB 3K4AA 3LB6D 1V3LA 1YZZA 3X11A 5C08E 2WTOA 2GJ6A 3MXVH 5E4EC 1VFOA 4ATTA 2GJ6B 3ECUA 2CLZA 1IM3B 3DV4A 1U95A 4JFUA 5F3BB 2K7QA 4KKBD 4P9ML 5I1EH 4C57C 1QRKA 2ITCA 4WKZA 5E9DD 1G0DA 1JHKH 2ADJA 3EJZD 4LCCA 1S5IL 3QI9D 4GRLA 3CFEA 4PP2B 4FMKA 5ERWA 1XH0A 4PJCF 4BZ2H 2BNQB 4XP5H 5HXMA 1IAIL 2H6PA 1INDL 2H6OA 3FFDA 3N1GC 4Q6KA 4R4ND 4JAMA 3IDUA 1NC4B 2P3YA 1LE9B 4IU2B 1WAAF 5DT1L 3O6FD 5F7KC 2CO7B 2EEXA 3FTSA 4GQPH 1QA9A 1MCKA 4XCCL 5E94B 3ZGHA 1EX0A 1HHGA 3GB7B 4D0DB 5IT2H 2XUWA 1BZ8A 2Y6SD 3TEZA 4ZZFA 2C4FU 5AW5B 2OP4L 1CDBA 4JKMA 3UJIH 4J6RH 4MA7L 3K6NA 4RFEA 1I1AC 1GZHC 5F88B 1EFXD 5B3SB 2G3XA 2E56A 4M8VA 3V6FB 4NFDA 2A9MH 1RPQA 3GM8A 3KYAA 4I13B 4R4FH 2ICEA 3QHFL 2CK0H 3OHXB 3CHSA 2VL4A 4QHNA 3S48A 2WVUA 2RGSA 4FNLL 3NESA 2HTLC 3OXRB 4NQEB 3FO2A 4MMZC 1A6ZB 2OAAA 1UWGH 2ZAIA 3BUBA 2P42B 3GHBH 3B1TA 4FFYH 3ZPDA 4AYSA 4C8XA 1EH9A 1PYWA 3Q3GA 1EZUA 4MLIA 5IB5A 3MI6A 3OZ9L 2XKUA 4NJ9H 4BYHA 3G04A 4IEFA 5E6IA 5C1MB 1P5UB 5IQOA 1E42A 3GK8H 3EOAA 1FN4B 2IBZX 4M43L 1MCCA 5C0IA 2DLIA 1YVLA 2WWKT 5I6KA 3QQDA 2IH3B 5ACMA 2NY6C 4LCUA 3RVXC 3EFFB 1AJ7H 4XX1E 3D06A 1D9KA 4XPAH 3UTSD 1CU4L 3W0WD 1JGDA 2WUCH 2DLFL 2R0ZH 2VR3A 2WCGA 1JGDB 2GHZA 3AQDA 4Z1PA 4Y7OC 3ROOB 2XXFA 3T0ED 2J6EH 3VFUB 3MO1A 2D3LA 4OCXL 3BKCH 4PVNA 1K4DA 1DTUA 2MSPA 4TVPH 3U36B 2PETA 1WICA 2JJSC 4A1RA 3U36A 3ZE2E 3REVA 1RUQL 1R5VB 2OL3B 4JDZB 4IKNA 4UINH 3CMGA 5T3XH 3GBNL 4HMDA 4Y0GA 2IWEA 2ARJA 4UM9A 3F6IA 3D39D 2H3KA 4R26H 3MV8B 2BXYA 2IAND 2YSTA 4PN6A 1HILA 3DYMA 1NC2D 4AZUA 4F8QA 3H7BA 2AZAA 3UDWC 4N2DA 1N59B 2HG5B 3VI4A 3ARZA 3WIHA 1T5WB 4X9BA 3S35X 3QJFB 4BUGA 5GGSY 3RU8H 3T1FB 1EAPB 3BPCB 1SYVA 4ALAL 5DD1H 5K9JL 4F2EA 4JPKL 1Q9LB 3H1ZA 4KDTC 3LPPA 4OLXL 4Z7QE 5HI5C 3BI9X 1GY1A 3NTCH 4FQHB 4Z95H 2X6AA 2HMIC 3KWXA 1S7SB 1QVOB 1K9TA 5MP6L 1JV2B 1ZGLA 3FUKA 4YUEH 3SDXB 2O5ZL 4X6DB 1Z6JT 4FQ2H 1BQRA 1BM3H 2Z8RA 5IFHL 1SLWA 3ULUH 4JDEB 2VIRB 3AREC 2YD9A 4NQEA 2WPGA 1A7NH 1JXFA 1K85A 1QG3A 4X5WB 3BUTA 4OIIL 3S7GA 2IH3A 2BSSB 5FECA 4NQXB 2WQAA 4MJIA 2CM6A 5E08H 1KN2H 2H9GB 2HKHH 2K4WA 1BBDH 4HVBA 2YEZA 5KYYB 5E6IB 1RPKA 2CGRL 3CN3A 1GMIA 5KJRH 2JV6A 2VRQA 1HI6A 3HI5H 2V17L 5BJTB 3KVDD 4H8QA 5E94A 1URIA 3EGXB 5IEKA 4M1DH 2YIHA 4FXKB 2JQZA 4PI2A 1D7BA 2GAZA 4NXSA 4OM0H 2O6CA 4LSVH 2Q2LA 4D3CH 3D52A 4G6JL 1FYTE 2VAAB 2Y7QA 4P9HC 3H0TA