1NWOA

Crystallographic study of azurin from pseudomonas putida
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
AECKVTVDSTDQMSFNTKDIAIDKSCKTFTVELTHSGSLPKNVMGHNLVISKEADMQPIATDGLSAGIDKQYLKDGDARVIAHTKVIGAGEKDSVTFDVSKLAAGEKYGFFCSFPGHISMMKGTVTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Crystallographic study of azurin from Pseudomonas putida.
pubmed doi rcsb
molecule tags Electron transport
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nwoA00
1ADWA 3T6VA 1ILSA 2PP7A 3FPXA 1M9WA 2IWFA 2BP0B 4BXSV 3UACA 1QLEB 3AY2A 1WA1X 4PCYA 2X88A 3WKQA 5AKRA 1R1CA 1MZYA 1OCCB 3SBQA 1ZIBA 4W1TA 4HHWA 3UADA 2BP0A 4DP4X 3N55A 3U25A 2AVFA 3JTBA 3UAEA 3X1FA 1NIAA 1V10A 3QQXA 1KCBA 2XV3A 1HAWA 2HX9A 1ASOA 3OM3B 2QPDB 4KO5A 1DZ0A 1CC3A 4Q89A 2H3XC 1BAWA 5I6KA 3OMIB 1PLBA 1L9QA 3ASOB 1A8ZA 3T71A 2WO2B 4X4KA 3L45A 1FFTB 1OCZB 1PY0A 1SHWA 1PZCA 2IWKA 5FC9A 2YAOA 5I28A 5I5IA 3DIVA 2UX6A 1AS8A 1JZGA 3GXUB 5B7MA 3QJRB 2UXVA 3KW8A 1CUOA 4BXVA 1PZAA 1PMYA 2J57A 5B1AB 1PLAA 1ZV2A 4AKPA 4G7QB 1OE1A 2FQDA 1GSKA 1WS8A 3NP3A 4HAKA 5AZUA 1URIA 4HIPA 1OF0A 6PAZA 1NPJA 1JOIA 2PPEA 3SBRA 1J9TA 1J9QA 2IH8A 1KBVA 3H4HA 1TEGA 2IWEA 1GYCA 4UAHA 1RKRA 1SNRA 1MG3C 1FWXA 2VM4A 2VSKB 3BQVA 5D4JA 4A67A 3AG1B 2YAPA 3OQRA 1UATA 1A3ZA 3WNIA 1XB3A 3ZX1A 5PAZA 1AAJA 3AG3B 5I6OA 2W8CA 3PPSA 4DPCX 1BQKA 1N68A 1E5YA 1AZCA 3MBWB 1AZBA 2BP8A 3PAUA 3NJLA 3TASA 1L9TA 2Y69B 3PAZA 3NJKA 3X2QB 7PAZA 3FQ2A 2TSAA 1WA2X 2I7SA 1JERA 4KNSA 3T6XA 1J9SA 2HX8A 3QJSB 2P80D 2PCFA 3ABLB 4F2EA 2IDFA 3NP4A 4G70B 2PPDA 1ASQA 1ET7A 2RACA 1A65A 3EHBB 5B1JC 3RYMA 4DP9X 4GP4B 1E67A 4ENZA 3QJVB 1ZDSA 2YAMA 3NT0A 3CDZB 1L9OA 1OE3A 2FTAA 1AZUA 2J56A 1VLXA 2AZUA 3X1BA 1NICA 4KO9A 1SHXA 2XU9A 2XXGA 3QJTB 1OCRB 4G7SB 2ZONA 3ZIYA 1SF5A 4YSTA 3NJIA 2UX7A 4YSCA 1CYWA 4HCGA 2OCCB 2B08A 1AS6A 3NSYA 3FSVA 4MFHA 2GHZA 3S3DB 2JFCA 3FU8A 3TA4D 1AZRA 2HRHA 4P5RA 2R7EA 5B7FA 2FT7A 3GYRA 3N2JA 5AFAA 2XX0A 2YAHA 3D12B 2VM3A 4WKXA 1ZPUA 1AQ8A 2CAKA 4E9XA 1NZRA 1IUZA 3HEIB 5I6LA 3BVDB 1RZQA 2UXGA 1MDAA 2NRDA 4W9ZA 2LLNA 4L0PB 3SQRA 4A2FA 1J9RA 1EHKB 2IDTA 3CG8A 1I53A 2IDUA 4BWUA 3S3BB 1W8EA 4YL4A 4YSSA 4JHUA 2FWLB 1TKWA 1BEXA 1XB8A 2UXTA 3NSCA 4JHVA 2B3IA 3QJUB 3QPKA 4AI7A 1N70A 1GS6X 1ET8A 2DWTA 1GR7A 5I6PA 3ZBMA 3T6WA 1SJMA 2VSMB 2QDWA 1V55B 2H5UA 5I6NA 2GBAA 2VW6A 2YXWA 1A4CA 2FQEA 4DP8X 4AZUA 2GIMA 1BXUA 3X1EA 3EH3B 3UABA 4GY4A 4RH4A 1L9RA 4YSAA 5D4IA 2X87A 3IN0A 3V9CA 1HFUA 3X1NA 1W6LA 1JVOA 2XX1A 4FAAB 1JZFA 5B1JA 5PCYA 1ASPA 1PCSA 3OMAB 4F7KA 3FYIB 5I6MA 5LDUA 3TBCA 3OMNB 2VN3A 5ANHA 4AKQA 3EH4B 2CBPA 1X9UA 3NJJA 4P5SA 1GW0A 1SFHA 1V54B 2N0MA 1TU2A 1KDIA 2HRGA 3FQYA 3JT2A 3AG4B 1RZPA 4YVNA 4E9YA 3FSWA 1FA4A 3AG2B 1KYAA 2QDVA 4YSUA 1YLBB 3MX0B 2FNWA 1JXDA 1BYPA 3OD3A 3WKPA 1KBWA 2XXFA 1AR1B 4E9WA 1MZZA 3HB3B 4N8UA 1SDDB 9PCYA 4GXFA 2H47C 3NSDA 4EF3A 1BXAA 1SFDA 4CSPA 2YAEA 2DV6A 2GI0A 1OCOB 1ILUA 2Q5BA 4G72B 5D4HA 4F2FA 1IBYA 2FQFA 1GS8A 1SDDA 2MRYA 1JZJA 1PZBA 4BK5C 1W6WA 4YSEA 2GSMB 5I26A 4DP0X 1ZIAA 3TBBA 1XB6A 3WG7B 3ERXA 1IKOP 2ZOOA 4UF7C 3FU7B 3ABGA 2Y1AA 4NERA 1RCYA 1KGYE 2HX7A 5E9NA 2PP8A 4E9SA 1AG6A 2TSBA 4M4RB 1JZIA 4KOBA 3NJHA 3T6ZA 4WTQA 1BQRA 2HXAA 5F7BA 1AZNA 4DPBX 4FA7B 1F56A 4E9VA 1PAZA 1AS7A 3CDZA 4DP6X 1JXGA 4GYBA 2BW5A 1NDTA 1OOWA 2UXFA 4AKOA 2MTAA 4HALA 4A2DA 1JXFA 1MG2C 3PXLA 2EIMB 1BQ5A 2HZHA 3WIAA 2XYBA 4E9RA 3IN2A 1NWPA 4HCFA 2AFNA 2J5WA 1E5ZA 1KDJA 2EIJB 4KNUA 1ZDQA 4KO7A 4TXVB 2IH9A 1HAUA 4GP8B 3FYEB 4Q8BA 2GC4C 4YSPA 1JZHA 2EIKB 3H4FA 2PPFA 5B7EA 1JVLA 1NIDA 2CCWA 5I5MA 1NINA 3FSAA 1NIEA 2XUWA 4DPAX 2GC7C 2PLTA 1WAEA 2IDQA 2IDSA 2PPCA 3G5WA 1JZEA 3QJQB 5B1KA 3NJGA 2BWIA 4A2GA 2EILB 3FSZA 1GY1A 3NYKA 3H56A 1NTDA 4UANA 4YSDA 4E9TA 3CVCA 2EINB 4M3HA 1PNDA 4HZ1A 1NWOA 2BZCA 4A2EA 1BYOA 2YXVA 3TU6A 1L9PA 3DKHA 5IY5B 2YARA 4ZK8A 3UGEA 2XVBA 2VMJA 4YSOA 1DYZA 1XMEB 5F7AA 1OV8A 2HLEB 5EHFA 3FQ1A 7PCYA 2JKWA 4KO6A 2Q9OA 2WSDA 3UAAA 3FT0A 4HHGA 1NIBA 3IE9A 1AIZA 2BHFA 1TEFA 3KW7A 1ETJA 1CURA 2YAFA 3CVBA 1J5DA 2BZ7A 1AANA 3ABKB 4A66A 1SF3A 3AW5A 2AZAA 2W88A 3EF4A 3X1GA 2FT8A 3GDCA 1B3IA 4DP1X 3WNJA 3NSFA 3S3CB 2XWZA 2DWSA 3FS9A 4NB7A 2BW4A 1EZLA 2PPAA 4KNTA 1PNCA 1X9RA 3CVDA 2QPEB 1QNIA 2FJSA 1ET5A 2JXMA 1WA0X 2BWDA 4K9JA 2VW4A 3NJNA 4YSQA 2DY2A 2P80A 1IBZA 2A3TA 3IBOA 2VW7A 4BWWA 1KV7A 3T9WA 1J5CA 2PP9A 3C75A 2OV0A 2I7OA 4N4YB 4QKTA 5B1BB 1A4BA 3WI9A 2IAAC 4A2HA 1NIFA 2BO0A 2BP8B 4DP2X 1NPNA 4YVUA 4DP5X 2CALA 2XV0A 3V9EA 1QHQA 4A68A 3ABMB 3ZDWA 3NJMA 4E9QA 4DP7X 2XV2A 4HCIA 2YQBA 4NAJA 3SBPA 4CSZA 1CYXA 1E65A 3FPYA 1GS7A 1IC0A 3FU7A 5I5JA 1BXVA 5A7EA 3S8FB 4G71B 4GP5B 3EH5B 3PCYA 6PCYA 4YSRA 1A4AA 1GY2A 8PAZA 2DYRB 2YAQA 2OJ1A 4BWTA 2ZXWB 1AOZA 1WS7A 3PAVA 4AX3A 2DYSB 4PAZA 1M56B 2I85A 1PF3A 5B3SB 2FT6A 2QT6A 4QLWA 2E86A 3NJFA 3PLYA 4G7RB 4BDVB 1M57B 2J55A 1AG0A 1PLCA 3S8GB 5TK2A 3IEAA 4JKNA 3DTUB 1ID2A 3FU9A 3AZUA 1OE2A 4BDVA 1KCWA 2AANA 2GB2A 2R7EB 1E30A 1AACA 3CZUB 2ZWNA 2FQGA 5TK4A 2CUAA 3ASNB 2PCYA 2CJ3A 2WO3B 2XLLA 4KOCA 1L9SA 1T5KA
chains in the Genus database with same CATH superfamily
2Q20A 3NPSB 4ZXBA 5I71C 5D6CA 4NO0B 3UMNA 3WSQH 1CLOL 3CX5J 3Q2LA 1AQDB 4BXSV 1M1XA 3VJ6A 5I1JH 3CUPA 5KS9E 1Q1JL 2HT4C 5CR8A 4FLRA 4HH9B 3T3PE 2B15A 3UADA 5C86A 3MCYA 5EEUA 2E76C 4HWEH 1U92A 3JTBA 2Z0BA 4LQFL 3QIUD 4MJ5A 2GSGA 5CJ8A 2ISDA 1O6VA 3I75B 4D0BA 1QSZA 3Q5YA 4PWFA 3B9EA 2GTQA 3WIHL 1S7XA 2O5NA 4IEFA 2EXSA 5D2LB 4P2QA 1KEGL 4ODVL 3RL2A 4WJG3 2ENYA 5FYJD 4EN3A 2NMSA 2X4OB 3LRSB 2WQXA 3V6OE 4XC3H 3IGAB 3C08H 1S5HA 4JG5A 3VSUA 3ZTNH 2X89A 4U7KA 2NZ9C 5I5IA 4C47A 2UX6A 1Z7JA 3WD5L 3GXUB 3SE3A 1NMCC 3LXUX 3QJRB 2AJVH 1YY8A 2WLYA 4HWBL 3STLB 2E9IA 4UM8A 3NFNB 1KY6A 1TJGH 3EFDH 1ZHNA 3LV3B 3RWEB 4N8VB 2CO3A 2EO7A 1BZDA 3LS5H 2XN1A 4WK4B 5JIQA 4X98B 2Q6WA 1FSKC 4P3CH 3OHMB 2WVSA 5EBLA 5EOCH 2MKWA 1GSKA 3CFKB 4JO2L 5BO0D 5E56A 4H44C 4W81A 2VCOA 1JNNL 3RX8A 5HVFB 5T1MA 2VDOB 2F58H 4IJ3C 4LPXA 4M6ML 3GJFA 4JMXA 5CSGA 3ZDZB 4WU5A 4X7TA 4JFHE 5B38G 2OMUB 3HFML 4WSKA 4MA3A 4XBPA 2NX5A 5D72L 2FEEL 1HL4A 2PUQT 1N8ZB 2DF3A 3FRUB 4PJIA 5IT2L 5DS8B 3JXAA 3NIFB 1NAMB 2QSQA 3QAQA 1F6FB 1XH0A 3B2PA 3O2DH 1RUKL 2DWDB 3HI6L 2NNXA 2X10A 2BP8A 5HDOA 3CXHJ 3PAUA 4R26L 5CAYB 5CSBA 2H3KA 3O8XB 3CAFA 4UZUA 4WWKD 4YPJA 4PJFF 43C9B 5KSVB 3FT4B 3UTPD 4TQEH 2YEQA 5F7KC 2HFGL 2E46A 1KB3A 4OQTL 1MLBB 4PJ5E 1EXUA 2X1OA 1J8HA 3V4PA 4F2EA 2JCWA 2WZ6A 5EH1A 4X6FB 4OSUL 4LRNL 4QRBA 3VGAB 3JWDH 1E67A 3J7HA 3RIKA 3D3VD 3BH9B 3L1GA 2VL5B 4QT5B 5AD0A 5KS9B 4R4FH 2WXPA 2OL3L 4IOIA 5CGYC 5E94B 1OP5K 5FHAH 4XO9A 2WYZA 3BRGC 2A74C 2G5RA 3T0EA 5LGJA 4H0GA 3AU0A 5FGSA 2Y7OA 1YN7A 2BIOA 1SHXA 2QLVB 1HHJA 3GTTA 2R2EA 3E3QE 1NH6A 5TQ0H 2HFFA 4PY7B 1F41A 4U1GB 5F0JB 1T83C 4QWWD 1RZ7H 2B08A 4PLOB 4R96A 4UB0L 4WY7H 2UUDK 3NSYA 4RFOH 2P26A 3F2LA 1RJLA 2K3TA 5EU3A 4CJ0A 1L0XA 1RMFL 3FUKA 5F3HB 1J05A 3IDYC 5HHQA 4NQDD 4PJBA 5CEZE 1CLYH 4HJ1A 1X4XA 4WUKL 1WD8A 2YAHA 3BPNB 1BAGA 1CGYA 1TTCA 2YPVL 4E9XA 4XP5L 4QHLA 2K9UA 1EH9A 5AL0A 1AD9A 4F33B 5I30L 2OTWA 4AM0A 4IBSA 3LPFA 1WAAE 3DYOA 2NRDA 1V05A 1VESA 3VXNB 4MJIA 1TZGH 3VGGA 1MJUH 4GAJH 4CVUA 3I9IA 3PWPE 1W8EA 5AW5B 2NY7L 1CFTA 4IQHA 3ZHDA 3TWCH 2DD8L 4JPIA 3POHA 4OD2A 4WW2C 4MQXC 5L8LB 1KEML 2ZZUT 1IEHA 2D3NA 4Z3TA 1KSRA 1KJMB 2KDGA 5DHVH 4TSAH 5K1NA 3SBWC 1MVUA 2F9BT 4L29B 5JA8B 1C9SA 4L4JA 3S88L 3S8WA 2H0JA 4QYOB 4DP8X 3OSKA 5DMKB 5DQJA 2GTZA 1Q9OB 2HTKC 3VXTB 4WHYG 3ALXA 3SKMB 5LNEA 4CN6A 3VYOA 4B7IA 4RA0C 1Q38A 2D7QA 3UJIH 2FNBA 3ELAT 5I1JL 2IOIA 3KYNA 3Q8BA 1UUSA 4Z7QE 4HS3A 2WQAA 1KGWA 1S7QB 2FYYA 1QA9B 1ZHBA 5JZ7C 3BZ4B 3QFJD 3QO0A 1RZKH 1MAKA 4FYRA 4NQSA 4NNPL 4PJ5B 4XBEL 2WP3T 3UYOD 4A6YH 4FFVD 3IF1A 1GL4B 3BHBB 3QJFB 5I1LB 3ZKQD 1C5BL 3BN9D 3T2PA 1HS6A 1DN2A 3AG2B 5CMAB 4L0YA 1NKGA 3HG1A 1CGVA 5CN3A 2FO1A 1KN4L 4JFYB 1SY6H 4HPHA 1BYPA 3SY0A 2CLVA 5HYJE 4JFEE 4TVUA 3SDYL 4CSSA 2LV4A 2RBLA 2AEOA 4H2CA 5D1XC 1YEIL 2WINA 4EZMA 3JV6A 1TQBB 3IDJB 4OT1L 2WLHA 1OCOB 4G9DB 4K15A 3FOLA 4JM2A 3LNHA 2MRYA 1WICA 4XPTL 3D3VA 4G8IB 4MQ7A 4OV5A 4HXBH 1S7WA 4UINL 4X9IA 2VL4A 4ZMYA 2FJFB 5FUZH 3L5WB 4G80B 1RHHB 2VISB 1G7QB 3T0XA 3ABGA 1IC1A 1Z3GH 2Y1AA 2J72A 1RCYA 4NKDB 5DFVD 5E9NA 2BFVL 4ZTEA 4EPSA 2F53E 4XVUC 2UVFA 5HGAA 3MNZB 1DJSA 3K6FA 4G5AA 4AE0A 5KTEH 1YNTB 3VCLA 2OR7A 5FGCE 5JPMC 1BQSA 2R0KH 4O02L 3TZVC 1QWHA 1NCDH 3QDHA 1MCLA 3TVMA 1QR1B 4LHUB 2X40A 3MXWL 4YIQB 3TA3C 1XL6A 3OLDA 3RVWC 1FBIH 1FFNB 2WNXA 4QLRA 4ODWB 1FL5A 3HN5A 3N91A 4H4NA 5GGSB 4FXGA 3BXNA 4GS7C 4Z76A 4HDIA 4QF1A 2WAHA 3G7TA 2BJMH 2CHDA 5HJ3B 1AYRA 1P69B 1NA8A 2L8AA 3CQFA 1YEFH 2LW3A 5I76B 3RUGF 2AK1L 5B8CA 2GC4C 4FJ6A 3DOSB 2ICWA 3WY1A 1OK8A 1KELL 1MCPH 3H4FA 2PPFA 4CAGA 5JMRA 4NQXB 4F9LA 3T1FA 3SOBH 2B2XH 2X53A 3LHPL 4NQVB 5BUPA 4Z3JA 3MJ7B 3UTZA 5FHBL 2NW2B 3AWGA 1WAEA 4YHIB 4X5LA 1YYMH 4I9WE 1AGCB 4DO4A 2YMOA 12E8L 2DICA 3FHEA 3UBXG 3NCJH 1BZ9A 2M83A 4M6NH 4LPCA 4PB9H 4LEOA 2YS4A 4KZDH 4ACTA 4ZPVA 3QDJA 3TYFA 3B9KB 4KJWD 1PD1A 3FCGA 3BT0A 4UTCA 4G82A 4JQIL 5ITBH 1G9MC 4KHTH 4U31A 1MRCL 4PJGA 4AQ8A 3VH8B 3P02A 4XO5A 4DGWC 1A0QH 2VM9A 3WDHA 7PCYA 1KIQA 2W95A 5HYJB 4JFEB 4LCYB 4I1PA 1M2VA 3FT0A 4KTDL 4LNRB 1NCAL 1L6XA 3L4XA 2W59A 3MGOB 2OSYA 4C59B 4LXFA 3BYTA 5I8OL 1VHPA 4K9EH 3VFOB 4JQXC 1BMGA 5HHXL 4CC1A 1ZA6A 4J28A 3APDA 2IH1A 3LD8B 2HCZX 5D96C 2EP6A 2OMVA 4GKNB 3PS6A 1J0KA 3ARYA 3N06B 4KQ3L 3UMTA 5MEQA 3VGBA 2GY5A 2VLKD 3GDCA 3C09B 4FZEH 1IBHA 4HJTA 4NB7A 1G7LB 1ZRUA 4RFEB 2X4QB 3E6HA 2V9TA 3QUHA 1GHFL 1NGYA 4TF4A 5ISZE 1JHTA 2JKXA 4R7NA 2F53B 1T1XB 3CVIH 3RGVD 5CUSH 3O2WH 1ZTXH 3FU6A 3KLDA 3SE4A 2VN4A 3PAYA 4EVNB 4HUXB 3TTSA 2V5SA 5E5RB 4DGVL 3LYRA 4MJ6A 4CDGC 3RTQD 4TOYL 4CSTA 4UT6H 1N59B 2GK2A 1I8IB 1T22B 4HKXB 3SZ6A 2DQIL 4XOEA 1G7JA 2SEBB 4UT9L 2QKIC 3U9PH 4NPYB 4UDUA 4H88L 5EZLB 2ZNXA 2A3TA 3O81A 3KD4A 1M05B 5DS2A 3VD2A 1SXSA 4R0LC 4QKTA 3WIIL 3QS2A 3AREC 3QJHA 1SMDA 4PJIF 3ARDD 3L3OB 2XSKA 4I4WA 4JFFB 5GGRB 4GKOA 2E7CA 4HSQA 2ENPA 1DO5A 3QZWA 5J6GB 3O45A 5JXED 4XO3A 4G8AC 2X6VA 4WUUA 4YPGB 2AQTA 2P43B 4NUJB 4Z7UA 3T5WA 2ERJC 4FMVA 3VQLA 4AH2B 4OJFL 3CZKA 1U95B 3K1DA 1K6QL 2DLEA 3OB0H 1E65A 4DK6A 1AGEA 4LLDA 4GAYA 5CIPB 4FLHA 3SDXB 3G5ZA 5HGDA 5KZCB 2Y24A 2ZCKH 4K23L 2OJZL 5DD6A 1TNNA 1HXYA 3TCTA 1XIWC 1GIGH 2EAEA 2XWBA 2AK4D 5FUCE 3VXOB 3EXJA 1AOZA 3QIWD 1CICA 3PAVA 1R3LA 2YD0A 4MD4A 1M56B 2I85A 5ALCH 2QTVA 1XF3A 3O9WC 1OGTA 1QX1A 4AGOA 1SN5A 3DSNA 4OGAC 3DUUA 1S78D 4BEIA 3WFHB 1G1KA 1FVDB 3EDKA 1OAUH 1DUYB 4KUZH 5KSAB 5HHOD 1ZSDA 1XF5A 3DTUB 4PJDE 1BXXA 5HSFA 3L9YA 4N9GA 1BA9A 2HT3C 4RRPA 4RGND 1MCBA 3TCLA 4WJKB 2Q8BH 2XLLA 2C9QA 4AQ1B 2X6UA 5GS1B 3H9SB 1ADWA 4JGUA 2P8PA 2D73A 1JZ8A 1M1SA 3IKCB 4AIOA 4Z7NE 3CK0H 1MCWM 3U4KA 3V4VB 4OCYH 3EYUH 2X3CA 5ILTL 3WKQA 1OQXA 4H25A 2P5EE 3G6JF 5FIEA 4UAOB 2PYFA 1SEBB 3VX0A 4URKA 4H8HA 2AXFA 1CLOH 3CDGB 2GEEA 1XO8A 4LAQL 3TBVA 4IGBC 3X1FA 1CT8A 1R5VA 1I9RL 4PGJA 4KVNL 1Y7VA 2XWCA 2F19H 1KPUA 5B38A 2FVNA 5AVRB 4N20A 2QPDB 4L37A 1CLZL 5H37H 4F58L 1K5WA 5ABDE 4E2OA 3SCMA 4G3YH 3IJ7A 3P73A 1L7TL 3PXJA 3ASOB 3WIHH 4UYPA 3WLBA 2O6CA 3GPSA 4KXBA 3Q2NA 1AQKL 1W15A 2NXYC 3MLXL 3CBRA 5TDPA 4NOBA 1KEGH 4ODVH 2YAOA 5IMKB 5E2TL 5KYNA 4P99A 5A16A 3BUTA 2YHGA 3LH2L 1L3WA 1JZGA 3IU3B 1RK0B 4JMNA 3KW8A 4N2LA 4PTUA 1FAKT 3BWSA 4BXVA 4MAZA 2WXOA 3ZKXC 4H5SB 1IZKA 1FI8C 1ZGLB 4YDZA 3DO7B 4BZ1A 5C6PB 3MYJA 3ZJAA 3LKSA 5E51A 4KMLB 1OE1A 3WD5H 1UKSA 2J4WL 5IJKA 4UU9A 3RFRA 1PEWA 5F6IC 1RP9A 3CJJA 4AY0A 2WHVA 3NPSC 4MX7A 5SWSD 1NPJA 2ITEA 5DRWB 3QEGH 2PXYD 2CM6A 5LB1A 2VB5A 5IHWA 4HUNB 5KVGL 1FNGB 1BLIA 1TEGA 1IRAY 4MTMA 2CLZB 3NSJA 4RRPM 2ZNWA 1JFHA 4S2SB 4FXKA 4A67A 1HWHB 5IOPB 1JNNH 3F7PC 2V7NB 5FYLD 1A1MA 3LZFL 1JGDB 3D39E 3OAZH 5IVZB 1BJ1J 2J1YA 1NMBL 3HBZA 3MUUA 4S1RL 1RZ8A 1TQSA 4OM0H 3HFMH 3I6KA 5KBLA 1OAZL 1AI1L 2C7UB 3I6GA 1DCEA 2XXMB 3OKLB 2NW3A 5IT2H 3TCXA 3FU0A 1KG0B 2ZYRA 4PJDB 3CN3A 2DQFB 1RUKH 4MDJB 3HI6H 4LOEA 4JM2F 4OJDH 4R26H 2XWJA 5AOIA 2NY3D 2P80D 2VUOA 2ZSWB 4AQAA 2E9JA 3PL6C 1S9WB 4D8OA 2FE0A 4XVTL 2DEWX 1ZDSA 5CILL 2HFGH 1AIFA 4LBEB 2WLLB 2Z3FA 5A3IC 2CJSA 3ULUE 3PNWA 4OSUH 4FF9A 4LRNH 5C07B 4AVHA 3BRFA 4YZWA 1ACXA 1QHPA 4QOKE 5JHBA 2QADC 2OL3H 5IROD 2VN5A 3OAUL 2PNDA 4NQQA 1XH3A 3QHFL 1BG9A 5H94B 4X4MA 3NBNA 3L3HB 1U8JB 3B9VA 2YFNA 5FOJA 5EU6D 1ZLDA 2WBJB 5D7JD 4HOXA 3GMQB 3MKGA 2H3NB 2Q7YB 2JSFA 3CSBA 2PO6B 4NQEA 4UB0H 2FT7A 2I27N 1DVXA 4YLBA 4E42A 3S98A 5FYLL 4BJLA 5BW7A 1UB6A 4MMYA 5CO1A 2D3JA 2WGNB 4FJZA 1RMFH 1T1WB 2CAKA 3KYOA 3ZE2F 4AENA 5DJDA 3L3DA 4FTVD 4MNQE 1UCBH 4MMZC 2UXGA 1I85A 2AAAA 4DJMA 3I3EA 1RUPL 3MUHL 4WUKH 1YY9D 5GZND 5I8EA 3FUEA 3VWJD 4M9PA 4UUJB 1U30A 2E27L 3L9RB 4TL4A 3SDCC 5F9JB 1U8LB 1IM9A 1A8JH 4ZO9A 1FZKB 1H6TA 5KYXB 3BP7B 3SGEI 4AI7A 3TBWA 5LGKA 3VGAC 1BJ8A 2Z31A 3V6ZA 5HD8D 1V55B 2H5UA 1UJ3C 2NY7H 3S35L 1JBJA 4H1LB 4M5TA 1VB9A 2DD8H 2CRMA 1A4CA 4QTIH 5L8JB 3QULB 1J18A 4F7PA 1T7XA 4PJGF 1KEMH 4FQQA 4TSBL 1WTGT 2G2NA 2DMCA 5E1HB 5MEND 2EYRB 1QFPA 3D39B 3MCKB 3Q6FB 4AG4L 4X4YB 2DMGA 1AO7D 3JWNH 3S88H 4U1GC 4HLJA 3VD7A 1I75A 5CJQL 5LGYA 1G1OA 4F2ME 1XF2B 1VCAA 5DQDL 1KYOK 3AUVA 5IBLD 3KGSA 2VDLB 3SDDB 4JUSA 5EU4B 2VERA 3HBQA 4PCTA 4UQ3B 1GRWA 2AI0L 4GUOA 1UD6A 3BPNC 4XE0A 4YEFA 2AJ3B 1FPTL 4Y1AE 3X3FL 3CSTA 2YN5A 4N2IA 4BSWA 5DCCA 4S1DD 4NNPH 4LCCB 3LH9A 1NMAL 5BOPA 1C5BH 3BVVA 1XXDC 1MZZA 3WGVB 3ZL1A 4W9KC 1UCTA 4NO2B 1JGLL 3MX0A 1SEQL 3EFOA 4N8UA 1KN4H 1SDDB 3L54A 4PIRF 3KCPA 3O6ML 1MDTA 1I9JL 3SDYH 3QYNA 2ZUUA 4Y9CA 3HHMA 1FG2B 1LMIA 1X5JA 1DVFB 4N0CD 4PG9A 3CU1A 1MFDL 3GSVA 5I82A 4DP0X 4C8XA 1FL6B 2ADFL 3B9AA 3FFOA 3IRPX 4I5BA 4OT1H 3JTTA 3K4AA 3KL3A 4PLJC 1WZ1H 3UBXA 4FZ8H 3BAJA 3C5SA 1IEBA 3VFNB 3D6GA 1AG6A 1VADB 3P9MA 5IMOB 2IAND 5E8OA 1BD2D 4X5QA 2DKUA 5F7BA 2EDHA 4JFTA 4MNQB 3SGDI 4F93B 5I17B 1F56A 1AS7A 4APXA 1KFGA 4M4RA 4FQ1L 4R2GD 1PX4A 3ARGA 4MBOA 1ZLVK 3UP1A 2XTSA 1F6AA 2YPLD 1A7NL 3WKML 1SHMA 1A1NB 3PXLA 4ZS6D 4BQ9A 3DARA 2BVPA 3G08B 5EU6A 1V3MA 3RG1C 4EMZA 5JDSA 4KDTA 1XZ0B 4TYUA 1AQMA 1G7PB 4O02H 3ZSTA 4OLYL 1EMTL 5JA9A 3L81A 3QIBB 3MXWH 4PMFA 4N2KA 4FX5A 5FB8A 1HAUA 2FCBA 3KPQB 2EDFA 3KPRA 1M7IA 3D0LB 3DGGB 4F1ZA 4XCYB 4MYPA 1PDKB 2GAZA 4HA1A 1LO3L 3QDGA 1JCKA 2VE6A 5C0AB 2NQ3A 3IFOB 1QSEE 1J5OH 1BSIA 1TQBC 4K94C 2AK1H 4KKBD 1FJ1B 4OD1L 2X6MA 1KELH 5E9DA 2F54D 4RMTA 3HMXL 3NYKA 5BOZG 3LHPH 1Y1UA 2XPGA 5L2KE 4N5ED 5FHBH 3FO9B 4QJ4B 4QRTB 5H35B 3O3AB 12E8H 1FZMA 3ZKMC 3ZZSA 3O11A 4HZ1A 1TR7A 3ETBF 1RY7B 3GMNB 3KL5A 4FQJH 4GPVA 3TU6A 5I0XA 2BSRA 2ODHA 3KS0J 4JREC 4Y1AB 1AO7A 4U1NB 3WY2A 1CMOA 1UQSA 4WHCA 1DYZA 3TWYA 1WT5A 2HSIA 4IBYA 4MAYB 2HJFB 1NPUA 3H7LA 4ZG1A 4JQIH 5CP3A 1AIZA 1EGJH 4XP1H 3RWFB 1ETJA 1B3JA 4N2DA 3OJMB 3RVTC 4NDMB 1YEJL 2HVJB 2OX5A 5F89B 3US1A 3D30A 4KTDH 3K6SB 4GW1A 1P5UC 2PYEB 4KKLD 4MA1C 2FT8A 5I8OH 3ROOB 5J11B 3MVSA 3HVDA 5HHXH 3IGUA 3GSWB 4CBZA 1CDYA 3KM1A 1G43A 3FTVA 1P6FA 2BW4A 1FIGL 4K7FA 3PV6B 5DJAA 1I7UA 1OSYA 2PCXA 4KQ3H 2ARWA 1YCSA 2XZCH 3CVDA 5H8DA 4HOMA 2VDKL 2WQSA 1K5NA 1FFOB 2J8OA 1GHFH 2HP4A 1TSHA 1WA0X 1FFPB 3LN5B 3QRBA 4ANWA 3LZNA 4I0PB 4LE8A 1G94A 3MRHA 2Q86A 5F8RC 4DGVH 4FG6D 5FECA 3QC6X 4TOYH 4LEEA 1DLFL 2WVVB 2DQIH 3SPVA 4YAQA 1F00I 3CVHB 3WL9A 1IAIM 2DQTL 3NN8B 4X5XB 1CVRA 3UGXA 1WV7T 3DIFB 2HG0A 3QZMA 3I9AA 1KV3A 3FL7A 3O6FC 4G1EB 2P5WD 4HJIA 3FBQA 4KKAC 2OZNA 3RY6A 2X9WA 3WEAA 3WIIH 4D7BA 5EO9A 3T8XA 4AGLA 2ICWJ 4JE4B 4MHHG 1UD2A 3SBPA 1FLRL 2R69L 4YZFF 4F7TB 4FG4A 1MFMA 5LBGA 1A47A 3LRMA 2ZUTA 5DDHB 3BX7C 3U6XA 2XFXB 2BSTB 4OJFH 5JNYA 3GLAA 3QUMB 1K6QH 3LMJL 3P0GB 5L2KB 2IDCA 3SDAD 3GMPB 1TZHB 2ZXEB 4LPVA 1UA7A 4OZGE 2CIIB 2LR4A 4K23H 2JJSA 2X3AA 4ZRGA 1G0YR 1NC2D 2CU9A 4NSKA 4DQOL 3NCYS 2OI9B 1SYSA 4H26B 4G6ML 2CRIA 3O2DA 4NIKB 3KWUA 4P5MA 5E8PA 1WUZA 4BE6A 1K3ZA 4GINA 4P2AA 5C09D 2EDNA 3HRZC 2HJKB 3OR7A 2B16A 3QR1A 3M1BA 4NO5B 1ED3A 3B5GA 3S4SB 1EEYA 1AQHA 4G6AC 2J55A 1AG0A 3MMEA 2F6AA 4PJ8B 4N2NA 3GSNB 1F4WL 2AEWA 5DC4B 4UT7L 3HIZA 1YAIA 1ID2A 2TRYA 3V5DB 1P84K 1UXSB 1KCWA 1BOGB 5KJ7E 3DYMA 2GB2A 1NBQA 3PQYE 1AACA 2YRZA 3SKJL 2XA8L 5DGRA 4W9LC 1NCNA 5DZLA 1P4UA 3DMMB 3FF8A 3MRPA 4GBXD 3RB5A 3KVDD 1NUNB 2J44A 3KPSA 4HWZA 1WCQA 1P5VB 5FYKU 1U8CB 2NOYA 3IJHB 1QBAA 3AY2A 2PTUA 1JPSL 1Z9LA 4AV0A 1YMHA 2R1YB 5I6XB 1HHKB 4YFLI 1UXLA 3QRFM 5KJRL 1MZYA 5BRZD 1AYOA 1ES0B 2KL6A 4PJ9A 5AL8A 5DVLA 3L3IA 4C4KO 2VYRE 1K3IA 5IV2A 1MREL 5ILTH 4Y4FB 1QOKA 2NY4C 3LNGA 1Q9LB 4ZUTB 2VO5A 1JK8B 3L1FA 1SXZA 5JW3L 1TJXA 4G5ZL 2YKKA 4Y4KA 4K71B 1I9RH 2VLJE 1QRND 2ZXDA 1Z9MA 3E80A 3GS4A 4KVNH 1Y18B 2WSPA 2I26N 5D1ZD 4X42A 4PBXA 3ROLB 4WEEA 4F58H 5IFHL 1GYWA 1SHWA 4GIPD 1DQDL 1ONQA 4ESKA 2I5YL 3CDYA 3M17B 2VJ8A 4Z5RB 5HI3D 4Z3IA 4Q52A 1L7TH 3TJEL 2VTFA 4R5XA 1AQKH 1WGOA 2Z7YA 5KSAC 4LCVA 5KVEL 4IRZH 3REVA 5GIRA 4DERA 5ESQA 2ESVA 2ZG2A 4TVSa 1YPZA 1DUZA 4OCSH 3C9NA 2GT9B 4GO8A 1U91A 2J71A 2ZD0A 4U3XA 3OZLA 3DX8A 4GI8A 1X9QA 5J8OA 1Q94B 3WKNA 4PJXE 4G8FB 3C6EA 1QEWA 5DHVA 5K59E 2J4WH 3HC2A 4UAHA 3HI5L 2M2DA 3GFUA 4BFGA 1BFOA 3BIBX 2VM4A 1JF1B 2V8MA 4UAOC 5ICZB 2YQ3A 4Y19E 2P5WA 5KVGH 5CCHE 3V0GA 3RVUC 5KSBA 1D5IL 3ASWA 1VFBA 1XB3A 5AVYB 3AG3B 3CFJB 2BS8A 2XY2A 1T3FB 2LHAA 2E6PA 3UFIA 4L4TA 4HUVA 3BMVA 5FDWB 5KYWB 2OQJB 3LZFH 2ZXBA 2VITB 4XXDA 1EAJA 2R4SH 4A6YA 1UA6L 3K2MC 1NMBH 2QFRA 2Z91B 3IS1X 3PQYB 4PGBA 2FO4A 3O3BB 4S1RH 5TGBA 4KKZA 1CIDA 2A9DA 1OAZH 1AI1H 3NPZB 1PZDA 1E5UI 1I1AA 3SD5A 2Y6SC 4TM9A 1L0QA 1QASA 3WLWC 1KENL 1SY6A 1TVBA 2VXSL 3MRCA 2P8LA 2Z8VC 5CBEB 4OCRL 3QXVA 3TT1H 3WEXA 5JOEA 1HQ4B 1W0YT 5C0CD 3M07A 4XVTH 1YC7A 2EQDA 3ETBJ 1JV5B 1WH0A 5J1AA 2NY1B 3LPPA 2AV1A 5C0BB 1ECYA 3H3PL 1AE6L 3QAZB 4V1DE 5D7SH 3RZWA 5I16B 3IJSB 2VQ4A 1ZK9A 2EKSA 2NNAA 2WGXA 4GW4A 4AVJA 2XOTA 4ABVA 5HVHC 4I0KA 4WSGA 4YBLB 2JV6A 1P7KA 3VMOA 3CFUA 4E0RA 4AZ8B 5FFGA 3OAUH 3B3BA 4Y5XA 1YUHA 3IJEB 1P2CB 1YZZA 3QHFH 1FO0A 1AXTL 4P5KB 3IJYA 5KAQG 3BD5A 1S7SA 4XNZB 5AFAA 3LTVA 1CO1A 1I3RA 3CMGA 4P2YA 3HB3C 2IQAA 2OMXA 3MAWA 5FA3B 5FKPB 1C5DB 1NZRA 3EJYC 1USZA 4HZLB 3VXPA 1J8KA 1NC4A 2YPKA 4LMQE 4MA7H 1AP2B 2XFGB 5FYLH 1KF9B 5IVXE 2ICEC 4N2GA 3QNYB 3GRWA 1WISA 1PKQA 4MS8C 2AEPL 3DETC 3GRBA 5D1ZA 5GHWH 3QPKA 3QUXB 3SO5A 1UXWB 2C34A 2IFFL 2VMFA 3MN8A 3C60C 2KPNA 3QHZL 4X6CF 1FUNA 3SGJA 2GSIB 2E27H 1CDHA 5BOJA 2NY2B 1IGML 3GKWL 2DWEB 4ZOBA 1G1CA 5SX4I 2ZAGA 2Y2YA 4Y19B 1JHKL 1U3HA 4OCNC 2Z65C 1BXUA 2BERA 3G04B 3S35H 1OGAB 4JFPA 1CFSB 2IXQA 2V7HB 4MB4A 2XX1A 5IB2A 1CB4A 2CPCA 5EBWA 3DX2A 2XNAB 5I6MA 4F57L 5HVWA 2BCKB 4ZMXA 4AG4H 4A55A 4L9LC 5ANHA 3EYSH 3RIFF 2K6ZA 2CBPA 2ATPB 3CCHA 4WGVB 1D3CA 5E2UH 5CJQH 4YX2L 2B59A 2NYZA 5DQDH 3WDIA 4B9IA 1ITBB 5I74B 2HRGA 3FQYA 3D50A 4L8CA 4I18B 1RZPA 4YVNA 4LEXL 1G6RA 5DFTA 3EJQA 3IGFA 2ZCZA 3E0GA 4LCWE 2AI0H 1I8KB 4LHJB 4NC1C 2OCFD 4LLUB 4OFPA 2VMEA 3CFBA 3T4AB 2CK0L 4J8RA 2FGZA 4H8WH 4U6TA 5BZZA 5IMMA 5FYKE 1FPTH 3VXME 1CFQA 3X3FH 5DTFB 3ZKSD 1PZ2A 2QFPA 3BP5B 4CMMA 4DZ8B 3QQ9C 9PCYA 1GAFH 3L3JB 4FNPA 4HOWA 2X4PB 1RAMA 2ZF9A 3K91A 1L0PA 4OZ4A 5HYQB 5AB9A 3QI9D 3HZYB 1P6WA 1JGLH 4YK4B 1OIOA 1GCYA 3OKEA 4JLRB 2NPLX 4M7ZB 1I9JH 3ERXA 4IBUA 1F97A 4NHCL 3D2UD 1EJ8A 4BQBA 2R0LL 2HH0L 2HX7A 2ZCLH 1MCFA 3MCLL 1MFDH 3EYQD 3OR6B 4XX1G 3LRKA 3OKKA 4ISVB 2R8SL 4UT6A 4YE4L 4QRFA 4WWID 3SDDC 2A6KA 5IVXB 4P04A 1J48A 2PTTA 1ZVSA 4AYMC 4ZNEE 2UXFA 4TUKL 4B50A 3HE6B 4LU5L 4MXQC 4ELMA 3N1PC 1YDPA 2KYIA 4LBAA 2HT4D 2UWEE 4FA6A 3KDMB 2XTJE 2IIJA 3DJTA 2VABB 3OB8A 4MD0A 4E9RA 1N0LA 2J6EH 4FQ1H 3RJDA 5HI5C 5MEPA 2C9AA 3CU7A 3BEVA 3IXAB 3WKMH 3H9HA 1A7NH 1FYTE 4LCCC 2DMHA 3DV4B 4Q8BA 2F7PA 2Y22A 3E8VA 5JQIB 1FVEA 1WSST 1D7DA 4F27A 3D18A 1T5WB 1N19A 4K5OA 4PN6A 1UWYA 4TNFA 3RWDA 5EZOH 4E41E 1EMTH 2CCWA 3MLRL 2WLMA 2R9HC 3NG5A 3P77A 5CN2A 5F72S 2ATAA 1VFOA 4OFKA 1UM6H 1FH5L 4AM0Q 4R7LA 4KZEL 3UZEC 1H8SA 3ZVVA 2NZ9D 3VJ6B 1TITA 3H56A 3INUL 5DRZA 4TVPE 3VXSA 3A5VA 3MUZ1 3AU1A 4XNBA 3VD5A 4OD1H 4KKPA 3WV0A 1U92B 1K2DA 2IPKA 4HEME 1P4LB 1V7ML 2HA1A 3HMXH 1JGUL 2P8MA 4KNQA 4B97A 2IV8A 3IWUA 1S7XB 2WNWA 2DQCL 1SOXA 3V52L 1R6VA 2XVBA 1IC5L 4IEFB 4P2QB 3RL2B 4YSOA 2LT9A 5DJ6B 1YMMD 4GRWE 1TZ8A 3HR6A 4NM4L 2IADA 4HYTB 2DI7A 2AJSH 3QB7C 1OW0C 3C12A 4CVZB 4P23A 3EUUA 3EYOA 3BWUC 3UPAA 2EEDA 4PW3A 4Q14A 1CD9B 3QIBC 1N3NA 2DN7A 3BKYL 2AZAA 3OJDA 4H8QA 4UM8B 1ZHNB 4G8GE 3VGDA 5FUOH 1DJYA 1R5WA 3KLQA 5DJCA 2Q6WB 5EBLB 3RNKB 1YEJH 2P7TB 3ES6A 3FH8A 5C2BL 3DURA 4MCNA 4W4OC 4ZOCA 2AQ1A 1JL8A 5DJ8A 5IHBA 2DEYX 1KIRA 2YWZA 1GGIH 1PNCA 1X9RA 1YPZF 4GUQA 1Q9WA 4M1DH 1QNIA 5T1MB 2FR4B 4PRIE 2APVA 2J43A 5IW3A 4LRIA 1E2ZA 1B4TA 1XGTB 2BOCA 3Q44A 3GJFB 4OF8A 3KL0A 3VU1A 4Y5VB 5DF0A 2NX5B 4GKLA 4M7LH 1KTDA 2VDKH 3MFFA 1U3NA 2WAQA 2LTQB 3WHE0 2XTJB 1U21A 5CGYD 5C92A 4HFWA 1HL8A 1RUML 2A6DB 4POZC 4Z18A 3F04A 4QIRA 3KNBA 4NN6C 1PVHA 2BP8B 32C2A 3EJTA 3H2PA 4FMKA 4WI7A 1FYTB 1DJZA 2I9LA 4LSPL 4D0DA 1QAWA 2ZUWA 2HLFC 2GIYA 3BAWA 1RZIA 2GJZB 4A68A 3F7YA 3U0TB 1DLFH 4AJYV 3OTTA 2PF6A 4AJVA 4E41B 5HHMD 1G87A 3ARBB 3OC8A 3U48A 4HCIA 3BDBA 2ZUVA 1J8HB 2DQTH 2I60L 3V4PB 4K3HA 1KTBA 2K4AA 5GGQL 4XMPL 4LGPB 1A7OL 3SGEH 2QELA 3K71B 3S37L 2XG4A 4RGMB 1CGTA 2NY0B 2JIXA 5AD0B 1TENA 4AK1A 4LASL 3TV8A 1SXBA 1FLRH 1WWCA 2R69H 5DZJA 1R0AL 1FNFA 4LLMA 1TTAA 4Q2ZB 4BWTA 1VZHA 1A64A 4X5RA 3T0EB 3GLEA 2C9RA 5LGJB 2C1OB 4HLZG 4NUGL 1LK3L 1XSKA 2H9GB 3EJJX 3LMJH 5A43C 2VSCA 3PLYA 1DO6A 1WWWX 4N28A 3GMLA 5I66B 3MBXL 1XVSA 2NTFA 5AB1A 3D85D 1U4EA 3LQAC 4MQXD 3E6FA 4GOSA 5EU3B 5D2NA 1PAMA 1JUFB 5HHQB 2PR4L 3QDMA 1KLFB 4HP5A 4PJBB 5JO5A 1O9VA 1HKFA 2CUAA 3QNXA 1YNLL 1MI5A 5C0EA 1FC1A 1GOHA 1A4JB 4UT7H 3MRQB 5LWYL 4IKLA 2YOCA 3ISRA 2HTKD 2E6JA 1A6TB 4DEWA 3ARSA 4TULH 3P40A 3SKJH 1QLEB 2XA8H 3ECQA 3U36A 1OTUC 1TETH 3QS3A 3NCMA 5F9WB 4MJIB 4BKLA 3A21A 2R27A 3DBSA 3QORB 5AKRA 1P1ZB 3SBQA 1LNUA 4X7SL 2JQMA 1MN4A 2CZNA 2BSED 4OBSA 2JKRM 4OFDA 4YOKA 1JPSH 3ATEA 5JZ7D 3HCVB 1V10A 4F7CA 5KJRH 3RIAK 4PRIB 5F7UA 2XV3A 2KLRA 4PI0A 4HIJB 3PABA 2Z7ZA 4F7MA 2YXFA 1OB1A 1MVUB 1UD8A 3C5ZD 5D7HA 2W0KA 1MREH 2DBJA 3JV5A 1TZAA 2J88L 5DQJB 3OF6A 1BVZA 4FYTA 1K72A 5JW3H 1M6OB 4G5ZH 4NLAA 2PR9A 2DH3A 2H2PC 5D1QE 5D1XD 3TJPA 1E5BA 1HH6A 1LO2L 1G7IA 1VDGA 2GITB 3BH8A 3BP6B 3MRLA 4LL1A 5C0IB 4B3EA 4OF6A 1PZAA 5L2JA 5IFHH 4HS3B 1ZJAA 2B14A 5AWNL 1T4KB 2ZTBA 1ZHBB 4NYLA 4HSCX 2X4RA 3W0WB 3TJEH 3QO0B 1ZT1A 3V95A 4NKOA 3S37X 4AL8C 4Z78A 5B1CA 1R34A 2BIHA 3BUYA 3DVGB 1JYXA 4PB0L 4UV4H 1NGZA 3NEXA 3W3BA 5C9JA 1IC7L 1CD1B 2XHNA 3ARWA 3HG1B 4ZFOB 5BV7B 4YQXL 1DJXA 1ML0A 4XVUD 5I6XC 4BV1A 3SY0B 2CLVB 1FWXA 1L4IA 5I1GL 1WYJA 5T5FA 4GRMA 3U2SA 5DJ2B 3S3PA 3AG1B 5I18L 4D8PA 2WINB 3OQRA 3TZVD 3PWLA 1QQDB 3HI5H 3JV6B 5FGBA 4Y4FC 5BXFA 4Z77A 4BKSC 2W8CA 3PIQB 1Q9KA 3TA3D 4DPCX 5IBTL 1E5YA 1DN0A 4NCC1 3RVWD 2IJ0C 1ZT4A 3NJLA 4GSDL 3GM8A 1D5IH 2WB1A 2DAVA 4WFED 4BA0A 4JG1L 4KFZC 4QCIB 3FQ2A 2Z4QA 3JVFC 4F8NA 3K2IA 5GISH 3PGDA 5HHNB 1E50A 3IBEA 5L88L 3MV7A 4C56A 2CIKA 3CC5B 2F18A 4WI0A 2C9VA 1INDL 1I82A 1GTFA 3EHBB 1G84A 4PJEE 3KLKA 1ND0A 4L3AA 3NCEB 3LB6C 4FQIL 3U7WL 2FZ3A 2FTAA 4N8VG 4P05A 4PCSA 5AAMC 4ODHL 1FFQA 4MJJA 4X6DE 1J5HA 3TVMB 3DJRA 4OB5H 4RMRA 3RFZA 1FZJA 2JLLA 1HWGB 3QPQC 5F7MC 4WW1A 4KO9A 5HDQL 1D9KB 4OCRH 1EO7A 2DIEA 3MLSH 4ELMF 4UOZA 3BXNB 4FLOA 4Z76B 3DI3B 4HDIB 4RAVA 1WDAA 2ARJA 3WY3A 1CYWA 5AEAA 3BVNB 1KBGH 3Q13A 3BZEA 2DYPA 1NCCL 1IQWL 4AYEC 5GRUL 2ICWB 3FSVA 1AE6H 3H3PH 4OTXL 5I5RA 5GGTA 4HGMA 4Y9GA 2EXTA 3ZMEA 3IMRA 1ADQL 4J8QA 4WQOA 2A99A 2H8PA 4LMQI 1U8IA 4I3RL 1MFEL 1RLWA 4U3SA 2IAMA 5K1VA 5D1QB 4F15B 2D3VA 5BO1H 4FULA 1AQ8A 4YNYA 4QUOA 1GGYA 2XVLA 1F1DA 1T1ZB 4FL4B 4GKZA 1AXTH 1I3GL 4LEOB 1QMUA 4W9ZA 4CGUB 3C5ZA 3CZFA 3V7AG 4A2FA 4B9GA 4ZPVB 5IOKA 1AHWB 3L95A 4MB3A 2MHAA 2ROXA 5I8CA 1EFXB 4U6YB 2DIAA 2X9ZA 3LJ3A 4ZAKA 4Z1PA 1I7ZA 5F3BB 2CDGA 2QL1A 2ZXCA 3T6WA 2HJLA 3BVXA 4RBPH 4CN4A 1S3RA 4WK2B 3H85A 3JYBA 3DVNA 1KIQB 2AEPH 4BRVA 1E6JL 1COBA 2E5EA 2FWOA 3FO0L 3PG2A 5F6HI 1XD0A 3HZMA 3UTSA 1A3RL 4ERSH 4LT7A 5DRNA 3QHZH 2NY1C 4JFSA 3CZNA 5AW2B 1IGMH 1ZA6B 3GKWH 3ZL4L 2Q3AA 1BYNA 4R4NC 1BG1A 1T7YA 3T0AA 2OMVB 3ALWA 3PYCA 3NRPA 4LPWA 3E9UA 3ARED 4YBLC 1P0SE 4M93C 3RWCA 5IR1A 4J3UA 5F7DB 2EE0A 3E6HB 2CR3A 1NGYB 3CGTA 1JHTB 3LKRA 1D2PA 1G9ML 4AYBA 3OWRA 4R7NB 1M6UA 4F57H 3GM0A 1YAZA 4UM9D 3AG4B 4PJEB 1VFAA 3IT8D 1A9EA 1MFBL 3B37A 5TE6L 4YX2H 1RULL 5GS2H 4IMLB 1SHSA 3RLSA 3GXIA 4X5WA 3C8KB 4UDUB 1EGJA 4DGIL 4LEXH 1UM4L 1XIWD 3QUZC 2QHRL 3FFDA 1H15A 2AQQA 3GXDA 3QJHB 1NJ9A 3UG5A 3NIGE 2NT1A 1BXAA 4I4WB 2CK0H 3O9WD 3IWVA 4P2OA 1RZFL 3N41B 1G4RA 2D31B 3MBEC 4OGAD 2G4GA 2NY2C 3G5YA 3GB7B 5C6WH 4WUUB 2GK0A 1A6PA 2NNRA 4BK5C 2GCYA 2RFXA 4Z7UB 2H26B 2PKDA 3RA7L 1XR8B 4UF7C 3EOAA 2VDML 1AGEB 5F7WC 4LLDB 4GAYB 4IMKA 3GWJA 4JDZA 3G5ZB 5HGDB 2HT3D 4NBZB 4UOJA 4O00A 4UNTA 4WTQA 5IP4A 4OZFH 3U2IA 3PWUB 4X7DC 3RWJB 4W6WB 3R4RA 2R0LH 2DWXA 2HLAB 4N2CA 3TYGH 4G9FE 1CICB 3KGUA 1ZLEA 1R3LB 1VIWA 3MCLH 1T66C 4RZCA 1OAQL 2OYLA 3GUFA 1XF3B 2R8SH 1OGTB 4K7PY 5GRJL 4YE4H 5I74C 3DSNB 2XETA 2XYBA 3DUUB 2LVEA 1XCTB 4IGBD 4MZIA 3BT2H 2EEFA 2MJWA 4LU5H 4RQQA 1ZSDB 5LN8A 1XF5B 1EJ6A 2X4TA 4U2ZA 1FVCA 1D6EA 3I2CL 4N9GB 2X4NB 3SE9L 1RXLA 5CJOL 5INCA 4OGXL 3Q5TA 4Y1SA 1NIDA 1OT1A 5B21A 3ZE0E 3CMOH 4HJJL 4OGQC 2P8PB 1QSFE 5MI0C 2FWSA 3V79C 3DJSA 2NXYD 4HC1L 2NCMA 1X5MA 4PRHE 2VGLM 1FZOA 2X5PA 4NRZA 3MLRH 1T04A 5ACZA 1F02I 4YK4C 4H25B 2QPUA 1ZD6A 4LIQE 4B0MM 3ZYZA 1FH5H 2VQ1A 4M7ZC 3GK8L 2AXFB 4ODUA 4UANA 5DD1L 4ZSOA 4KZEH 3W56A 1R5VB 2EINB 2QQKH 2CKBL 1TVHA 3INUH 5KANI 4MXWL 1LEGA 1TDQA 3NK4A 3LKNA 4XPHH 5F88A 1K4DA 3APNA 3UGEA 2C3XA 4L37B 4Y16A 4GI9A 3MRGB 2OMYA 3NA4A 5E95B 2EDOA 2VWEE 4L4VD 1BIHA 4IBZA 1OLZA 2CDFA 4JO5A 2WSDA 3WLBB 3HE6C 4LHUG 3HI1A 4APQA 2WIIA 3MJGX 3NCWA 2V5TA 4FFYL 5TDPB 4AYGA 3CLEH 4DKFL 3UOAB 4MAUH 5JW5A 1HSAB 2JK5A 2B4CL 2GJRA 2DB8A 4PTUB 3BWAB 1LLAA 1DVQA 1MWAB 4JG9A 2ITDA 3QNZB 2IBGA 2E7LA 3QUYA 3LKSB 4MCYB 5BVPL 1RFDH 3ZMRA 4PJHA 1S9XA 4UIMA 3D34A 4UU9B 3DTXA 4ZXBC 2PPAA 5EU7C 2MQ3A 5IKCA 1LE5B 2XN9A 1L5GB 2OP4L 4HJUA 2FIKA 3Q9QA 4JJOA 5C08E 3VI3E 5C2BH 1THAA 3PL6D 2JXMA 2OMWA 3HC0A 4FCAA 2CLRA 4GT0A 4XRCB 2V5YA 2F8IA 4FXKB 4OV6F 2BHZA 4P5TA 4PREA 2X7LA 3I02B 5ENWB 1OB0A 1RIHL 3PJSA 5A3ID 3VE0B 4X0KB 4IBQA 3U4BH 3FW6A 3C75A 1JD9A 4IU2A 3PGCA 1RZ8B 4AJ0A 4JFXB 3R7RA 3I6KB 1A4KA 2O1AA 3A67L 1QW8A 2BO0A 3IDMA 5G55A 3W1ZA 1A2YA 4IRZA 2H32H 4U6HA 2NW3B 2QADD 5FW6A 2WTRA 4EN3C 5IG7A 1RUMH 5JXAH 4LVNB 5D7IE 1E4KA 3GMMA 3KYMA 2X0WA 4WKZB 3ZE0B 2XWJB 1DZBA 3APFA 4LSPH 2F7QA 4G6JL 2GVYA 3LAFA 4RAUA 2AC0A 1QSFB 4MXVE 2A6IA 4ONFL 5DYOA 3SE3C 3T08A 4PRHB 2Y07L 3GBEA 2WUBH 5A7EA 5TJWK 1AIFB 4KK5C 1SJXA 2I60H 4HBQA 5DO2C 2WXNA 3PNWB 2OTUA 4GXVH 5HHPA 4XMPH 5SX4H 1A7OH 1MRDL 3TONA 2JI2A 4XPBH 5IZ7A 3S37H 1ZWIA 1R33A 2DJMA 1T0MA 2AQ2A 3QEQE 4F3FA 4FKEA 2R2CA 3FB6B 4QHUA 4LASH 4XCEB 4GG8A 1PLGL 2QT6A 5IQLA 1R0AH 3SDCD 4BDVB 4BGLA 4ZFFA 3KDPB 3VI4A 3VFVA 4JBSA 4IRSA 4YXLL 1SDAB 3SPGA 1E27B 3IAQA 3DX9B 3QXAA 2J1ZA 1EAPA 3PDOB 4MQTB 1AMXA 5DA0B 2ZWNA 4JS7A 4NQEB 4BK8A 4JHWL 4E42B 4YFEA 5ELIA 2D03L 4KOCA 4MMYB 3HJ0A 3KYOB 5KOVC 4NQCE 5DJDB 3BGMA 5F1SA 2PR4H 1QNZL 4NHUA 1BECA 3VYPA 3GJEB 3NZUA 1E9QB 1MW1A 2XQ0A 5I8EB 4Z3GA 3V6FB 3F6JA 1UJTA 4NO0A 5LWYH 3N40F 5F0MB 1B0WA 2EABA 4LVOC 3M1CA 3SIKA 2J1KA 4DP4X 1XGPB 4EZKA 1AQDA 3U25A 1IM9B 3OKOB 4U0RC 2RQ8A 5BJTB 1INQA 3GZKA 4QJ5B 2H1XA 3TBWB 5J9PB 2Z31B 2A83B 4HH9A 4N2HA 1KCBA 3V6ZB 1S7RB 3W38A 2NY0C 3VI3B 1ASOA 4KXZH 1NAML 4PJAE 4PUBL 2K8MA 3I75A 4H7VA 1S7VB 3GMOA 2BVQA 5IESL 1LL1A 2W80C 3F8UB 4NT6B 3CD4A 3T0EC 2WXFA 5D2LA 4U1IB 4X4KA 3FTUA 2BM3A 2NXZB 2EH7L 4NKIL 3EIFA 3HBPA 2X4OA 3AY4A 1G7MA 4FNQA 4GRLB 4PBWD 3VXUE 1WWAX 1ZKAA 1UVQA 4AKPA 5D7IB 4BCYA 4KDVA 2KQNA 4DIXA 1LO2H 3STLA 3MRKA 4XPGL 1WTLA 2R2HA 5AWNH 2VDNL 1KTLA 4F24A 1JOIA 4PLJD 5AZ2L 4CDHA 4X98A 4BSWB 1QFUL 3CFKA 5IUCA 4YDLB 1OP3K 4L3EA 4PB0H 3P4OA 4GEIA 1IC7H 3QEQB 3EZJB 3TX4A 5KVDL 1UA3A 1Z6JT 2R15A 1ECZA 3PFQA 4YQXH 3WNIA 5BCAA 1RZJH 1XCXA 2FB4L 1ICTA 2OMUA 2ZOKB 4LHQB 3FRUA 1GZHA 1N8ZA 1C7SA 2PWHA 2OM5A 2VQUA 5IK3B 3UZQB 1P9MA 3GSVB 3DV6B 1ZA3A 5IFAL 4XO4A 3KHOA 5IBTH 2J8UE 1BQLL 1EVUA 3O8XA 2FAUA 3C5SB 3BQUA 3EH1A 4GSDH 43C9A 2HT2C 3S3SA 3P9MB 4N87A 5DR5L 5H2BB 2RACA 4QEGA 3O0RL 2QSTA 4OLWL 1BWWA 3TH3T 3ALPA 4APXB 2CCVA 2VO8A 2O61A 4BUHA 4PP2B 2GBTA 1INDH 4GB9A 3ARGB 3KYAA 2YA1A 5TE4L 4JFDE 3FO1B 2J56A 5EPMB 3K5RA 2BVPB 4MBRA 3AT9A 5B3JF 3U7WH 3EJCA 5KS9A 1X5LA 2A5UA 4ODHH 2N01B 5H4ZA 3ZKMD 3MRMB 4KGLA 2QQLL 3BYYA 3SJVD 2NNFA 5I19L 5BV7C 2DLTA 4PJAB 5LQBH 5E99L 5JOPD 1SMAA 3KPRB 1M7IB 3I9GL 4K73A 4XH2B 2R2BA 5F8QC 2JFCA 3MJ6A 4PY7A 2GAZB 4IM8A 2OR9L 1IBGL 1OGSA 4URTB 3QDGB 3I3DA 1EZVY 1NCCH 1IQWH 4LHUD 5GRUH 1X7SA 5F3HA 4KI5E 4OTXH 3V6OA 5JMOC 3VXUB 3BSGA 4JM2C 1ADQH 5CKGA 1CDJA 3BCFA 1T6VN 3RVTD 2XPGB 5I6LA 3A22A 2DL9A 4I3RH 5JDJA 1FZMB 3NA9L 4ZMOA 2YUWA 5TQ2L 5KBDA 4F33A 3C6LA 3HA0A 4DTGH 2J6EA 3LEXA 3IFPA 1XB8A 3SD2A 5CLYA 1N8OE 2BSRB 3VXNA 2OPCA 5T1LA 2WNKA 2JI3A 3LVEA 2VW6A 3BDYH 43CAB 1YG9A 1EHAA 4K94L 3S7GA 4EQ2A 3TVMC 4Z3HA 2BNQE 4OH2A 3GPEA 1EZUA 1CXIA 4GQ9L 4L29A 5DVOA 4MA8L 3MTXA 5I1DA 4FXGC 3FO0H 3T3MF 1A7BA 4QYOA 5HJBA 2R29H 1JZFA 4G6KL 5B1JA 2UV3A 1Q9OA 3DVIA 5LDUA 1UC6A 5B8CC 3PNRB 1IBBA 1WCBB 2VN3A 4XN5A 3ZL4H 4OUOA 1VCBC 3K74B 4F9LC 3HMXA 3FDWA 4J4PD 4JRXE 4K7FB 5E4IA 3O6FD 5K9JL 4KKAD 1EAQA 1XGRA 4HK3N 5CS7A 5IQ9A 1KDIA 4LKXA 3WHXA 1L0YA 5DHMC 1OQOA 1QA9A 4WO0A 1IVTA 3BZ4A 1F2XK 1G9MH 4PJ5A 4S0TD 4YSUA 3N3EA 5BZWA 2DBLH 1A7RL 3QJFA 4R5TA 4JFDB 1S7TB 3MLYH 1MFBH 2BSSB 4KC3B 4FQCL 1MHEA 5CMAA 4ZOEA 4K3EH 1FAIL 4KV5E 2NY6B 2W9LA 3GJFK 4JFYA 1YRKA 5T33L 1ZS8A 4GO9A 5D5ME 5F1OB 4PV1C 4DGIH 5FWQA 4AQ8C 1UM4H 1AGBB 2Q5BA 2WYIA 5E1QA 4TV3A 3CN0A 4JZOB 4B27A 1QBBA 4G6AD 3IDJA 4HKBA 1KBKA 3OPZL 5EO9B 1N7MH 4L23A 2LLGA 2ZOOA 4G9DA 5GJTL 1RZFH 3EJRA 5EIIA 5AYTA 4Z7VE 1PBYA 4ODTL 3QH3B 4G8IA 2PP8A 1JZIA 2FJFA 1QR4A 4XMXA 4G80A 5E6ZA 1RHHA 4AT6B 3SPIA 4LARL 2VDMH 1IVLA 4NKDA 1SBBA 1HZKA 3IXTA 1KGXA 4JFFD 4N0YH 4NSKB 4QY8B 1Y6NR 1SYSB 3DK0A 5CZXC 3IDUA 4AKOA 1XZWA 4N0RA 4P5MB 5E8PB 1TLKA 1JXFA 3HAEH 4PTTA 2EIMB 2CK2A 4YO0B 3VUAA 3VG0L 1WAAA 2HZHA 4DZBA 3OR7B 4G11A 1JDDA 1ED3B 3SE4C 2AFNA 3PWPA 2EC8A 4L8SB 2I25N 3MMEB 3MV8D 1QR1A 1GGBL 5FCSH 1OAQH 5IBUB 4KO7A 1HL9A 5GRJH 2NY4D 2NUTB 5CZVL 3ARQA 3L2NA 3NDZE 4EDXA 1LK2A 3GLDA 5E2VL 1EUTA 3VI4F 1GPOL 5GSVB 2CBTA 4WJ5A 5T1DL 5HJ3A 2FECL 4Q9RL 3WOVA 3C5XA 5I76A 3U0PB 3U7YL 3KPSB 2D2CC 2ZYIA 5L7XH 3I2CH 1O7DE 4FNTA 3SE9H 5SWZE 5B1KA 4HK0A 4X99B 4NQXA 5CJOH 2R69A 4OGXH 2VKWA 1YMHB 3V6BR 1T6BX 3NJXA 4NQVA 2NW2A 3N40P 1I1RA 4KQ4H 2FJGA 2E8ZA 2WIMA 3E8UH 5E1GA 5KSAD 2XWTB 4XBGA 4HC1H 2BLFA 4JRXB 4PJ9B 4WENB 5BUAA 1TXKA 3WTVA 3LX9A 4U2YA 1UD4A 3RX9A 5LCVA 3UC2A 3HZKA 3RDTA 3S6CA 3MTRA 3GK8H 4NFBA 3H9SD 1E3XA 3MKKA 5DD1H 1KPRB 3RHWK 5BS0D 3B9KA 2KMWA 2B1OA 4Y4KB 4HJEA 2YK1L 4U1JA 2CKBH 2DQDL 3UERA 4MXWH 1CICC 2ZAIA 5I75B 3L5XL 3O6KL 3FH5A 3JVGA 5MHSE 3QXUA 3V0JA 1QYGH 5IJCC 1F18A 3IE9A 5C3IA 3VH8A 2IALB 1HHHB 1BVLA 1VPOL 3D2TA 3T6QC 5HYJA 1J5DA 4JFEA 4LCYA 5D5MB 3RVUD 5D2LF 4LNRA 3QSKB 2X05A 3MGOA 4DUWA 5GIRB 4DKFH 4XMVA 2YEVB 3LY6A 3QHTC 5K69A 4XN4A 4Q6YA 1BW8A 1ZVNA 1DUZB 4OY9A 2B4CH 3C9NB 5KW9L 4P2RE 4GKNA 2XPZA 5FX3A 4Z7VB 4KY1L 2D7PA 1UH2A 3DX8B 4KJQC 3ZYOA 4KJWC 5JIIA 5DHVB 5BVPH 2E59A 4RFEA 1AY1L 2X4QA 3ESVF 1U8NB 2VLRD 3WLWD 2F53A 4LP8A 3NJNA 4RX4A 2OP4H 1IKFL 3N44B 1JS4A 3VSTA 5KSBB 3L5IA 4QRPE 1SJEB 5ABZA 4PVMA 1I1FA 1N59A 2BY3A 1A4BA 4HKXA 3RNQA 2JB6A 5AKTA 3WI9A 2AP2A 4DP2X 1CE1L 3OKNA 1RIHH 3ZDZF 5F7LB 1GSMA 2Y7SA 3FUDA 3QZLA 3SCMC 2OAAA 2N4IA 1I7TB 1RH8A 4A6YB 3UDWA 1OTSD 1SGKA 4PGBB 1QHQA 2FO4B 4BCZA 3L3OA 3NIFF 5IB4A 2VUKA 3A67H 1T1YB 1HKLL 4JFFA 5GGRA 1I1AB 3HW7A 5I0WA 5J6GA 2OJEA 1DTUA 4P59L 1FRGL 4X4ZA 3FPYA 5J1TC 1HWWA 1MY7A 2WYHA 3BZFA 4NUJA 1HOEA 3ENEA 4AH2A 2D7TL 1QG3A 1TVBB 1U95A 3QJXA 4P2CG 2P8LB 4J3TA 4X9FA 4XI5C 1GH7A 4G6JH 1YQVL 3HB3D 3HPJB 1XGYL 3AXLA 3WEXB 1R5IB 2MPAL 3EJYD 4JJHA 3W5MA 2EADA 2YAQA 4ONFH 5DGQA 4U05A 2N1KA 2VZVA 2F1BA 4IOFC 1ITCA 4WI3A 5C8JB 5J1AB 4XZ4A 4GQRA 2EE6A 2YA0A 5EOTA 2RH0A 3DHPA 2QSCL 3FT3B 4O58L 4ZDHB 2VIRA 1E43A 4QLWA 2EKSB 4MS8D 1ZK5A 2BNRB 3LZRA 4IOSD 2BK8A 1MRDH 3DETD 1ULVA 5KS9F 3CZEA 3RBSA 1I1CA 1KGCE 2XQBH 4OBRA 1H9DA 4FXKC 2DQGL 3IEAA 3C60D 3WFHA 1YECL 2YMTA 1FVDA 4Y5XB 5HDRA 1E30A 5IW1A 1DUYA 5AB0A 1XL4A 5C07D 2PCYA 1TQVA 1ZTXE 4NZDA 4ODSL 1ETA1 1L9SA 5DVNA 4ZS7L 4YXLH 1S7UA 3RILA 2OMXB 1FORL 3VXPB 4LSQL 1PPIA 1CFMA 4EZLA 2BP0B 2WC7A 1J0JA 2YPKB 1JZ3A 5GS1A 4AQ1A 1KYOJ 1XT5A 3RUGE 4QRQA 1WFOA 2D03H 3ZR6A 4LVNC 3GMRA 4OZHE 1OCCB 1PW3A 1PKQB 4GAFB 3IKCA 4P2RB 3FCTB 4HMCA 5EUKA 2VDQL 4PSRA 5E24E 5BMFH 1Z0NA 3MXVL 3FQTB 4OJYA 1NOAA 5ISZA 3LZOA 1R9FA 1SVZA 3CDGA 4LESA 2AW2A 3ARZA 4Q89A 4BFNA 5I6KA 2HFEB 3M46A 3MV9E 1U3HB 3FQNB 5EC2B 1PLBA 5FKAB 4B9JA 1JNHA 5HGGS 4IBVA 4JFPB 2DM7A 5IB3B 2IXQB 4PUBH 2VZTA 2ZCHL 5IESH 4ICXA 5EBWB 4UTBL 5ERWB 5TF1H 5DHDA 5B7MA 4FERA 2Z8RA 3QQ9D 1CUOA 3QWNA 1J12A 3K1KC 4JPKL 5D71L 4NI6A 5IMKA 2EH7H 2LQRA 4XNQA 3TIEA 1FDLL 2JJUA 3CCHB 1G0XA 5F1NB 3IU3A 1RK0A 2VXQA 2GJPA 2B59B 3MOBL 4GSRA 5BW7C 3ZT7A 1G9NH 4JQVA 1XCQB 4MJ2A 5CBAB 4L8CB 4FFZL 2JELL 3IRZA 3CSYB 5CJ5A 1I85C 1EK3A 4PRPD 3OAYH 5KUKA 2V33A 4WO4B 4XPGH 4Z7OE 5AW7B 4W93A 4LIQL 4J8RB 5DRWA 2VDNH 4ANUA 5DD0L 3W9EB 2WQRA 5IMMB 3ESPA 1CFQB 3SDDD 1OD9A 2O30A 1QLFB 5LO7A 5CLTA 3ZDYE 1QFUH 2CHNA 2X38A 4CMMB 2KC0A 5H4YA 4I89A 5PAZA 4S2SA 1EIBA 5C0DB 4MXQD 3PPSA 2Z31C 2BOBB 4PG2A 1NL0H 4TVPH 1FHGA 5E1AA 4EE2A 2C5DC 5IOPA 1CFBA 1AZCA 2V7NA 4E68A 5KVDH 5HI5D 3W39B 1N0XL 3OKEB 5IVZA 3H54A 1IEAA 3W37A 3IFNL 3TPUB 3O4LD 3DJZA 3CE1A 2DKSA 2I7SA 2C7UA 2XQYK 2ED6A 3FN9A 4NQTA 2XTLA 1QTPA 3HZVB 2V17H 4PJDA 4G70B 2DQFA 4XGZB 1ASQA 2QGEA 2R9HD 3OKKB 4FKHA 3T65A 4X6BB 4GRWH 4N1CA 3U1QA 4R83A 1BQLH 4UOQA 3JT0A 1QPKA 4I48A 4RGOL 2A6KB 2OMTA 5FF6B 2ZSWA 4HD5A 1ZVSB 5FM8A 4OZHB 1S9WA 5DR5H 5IJDC 3MLVL 1YDPB 5ESAB 4WFHE 4LBEA 2WLLA 4MD0B 3SKUD 1N0LB 2P5EA 5I8KL 3QJTB 1CFNB 5BRQA 3GIVB 3FFCE 4MMXA 4CW1B 5J57B 2J6WA 4UQIM 2G60L 5TE4H 1YNTF 2EUXA 5DMJB 1LWJA 3MI6A 4YDLC 3CFEA 2HYMA 1MSPA 1VEMA 1D5ZA 2JTYA 3EJPA 1JRHI 2QQLH 3VRLE 3GINA 1SN2A 3BN3B 5I19H 4JO4L 5H94A 5E99H 3L3HA 2H0FA 3I9GH 1AR1C 4PU2A 5MEOB 5LG6A 4X9BA 1UB5B 3R0NA 4WKXA 2WBJA 4TS6A 3CLFL 3CSFA 1UT2A 3GMQA 4HKJA 4D3CL 2OR9H 1IBGH 2PO6A 4K7PL 1N64L 3M88A 3VXSB 4OGYH 2EDEA 1RZQA 3AU1B 3BVDB 4N0FB 4WGWB 3QIBD 2O5ZH 3NK3A 2WJ5A 3WAJA 5DSCB 3CG8A 4PS7A 1TT6A 1KYUA 1MRFL 1TKWA 1HQRA 1PZSA 5EF2A 2NLJB 2P8MB 3BSZL 4I3SH 3TO4A 5E0FA 5C0AD 2Z92A 4NN5B 4UUJA 3CFCL 3NA9H 3L9RA 5CLXA 5I24A 5TQ2H 2EKJA 1FZKA 1LTXA 3BP7A 3G6JE 4Z7OB 3OJ2C 3ARGC 4YDMA 4B9PA 5E8EB 4JGJA 1MCWW 1IGIH 5KYYB 4NWTL 2IADB 5CWSB 5K9QI 3ZDYB 1QI3A 2DQHH 3BPOB 4KDTC 1NBYA 4H1LA 4PLNC 5FYJE 5D4IA 4ZW3A 3QULA 2X44D 4NS0A 2AXWA 4TNGA 1N3NB 2C3VB 3NCBB 3HE7A 3IDNB 2XJLA 3OJDB 4POZD 4JANB 1PTZA 2EYRA 2N1TE 3ATFA 3D39A 3Q6FA 4F7KA 4GQ9H 3V4LA 4X4YA 4N25A 4MA8H 5KEZA 5DJCB 1TU2B 1CXHA 3ES6B 5G4MA 3EH4B 1WC7A 2YKLL 5FO9A 1CI3M 3DURB 5HJDA 3NJJA 4G6KH 2HLFD 4P5SA 4FP8L 4JFWA 4MAYD 4AEFA 1Q9WB 1R3IL 5EU4A 4DT2A 2WXIA 5E5LA 4K8RC 2YGQA 4NKMA 1P7BA 2E0PA 5F9DC 1DE4B 5K9JH 5HD8C 3HS0A 4KAQL 4HUCA 2GTWA 2FNWA 3MFFB 1BQUA 2PYED 4ZQTA 1MHPL 4EBQH 5B4MC 5JHLH 4MWFA 1J1PH 4HFWB 1DJGA 3GZQA 4HPYL 4X6EA 1MUJA 1W72H 4B60A 1QPXA 2WXKA 1A9BA 1EAOA 4M48L 4L5FL 2I9LB 4OUUA 1A6ZA 4D0DB 4XMKL 8CGTA 3WTXA 1EJFA 1WT5C 4NO2A 4QOKA 1L6PA 2YQ2A 1FAIH 1TLMA 4ZUVB 2N7SA 1IBYA 2YLKA 1QSVA 1RZIB 1SDDA 5D8JL 1HL5A 1PZBA 1PX3A 4Z9KB 3D0VB 4TNVK 2MOQA 1P84J 1QW9A 1AFVL 2WQUA 4ZBJA 5D7LD 1FG2A 5DUPL 2AJXL 3L4CA 1JWUA 1DVFA 1DVSA 1XDTT 3K80A 4K7PX 4G8EA 3K72A 4HT1L 2TSBA 4NXKA 2IOMA 2XG4B 2JIXB 1AH1A 2E9WA 5GJTH 1OOAA 3MRNB 1PAZA 1QRKA 2EDMA 3VFNA 3K4DA 4DK3A 4DP6X 1VADA 1VJSA 5LVEA 1OTUD 3D3VE 4JRYD 5E8DL 1ZXKA 4S1QL 4MNQA 5I17A 3SDXF 1CD0A 3JWNE 1BQ5A 4LARH 4K5NA 3SSGA 3ZGHA 4ETQB 2ARJQ 4BFBD 3VD9A 2Q1EA 3IN2A 3WN5B 2EEBA 2Y5EA 3GMLB 1T0OA 4WU7A 4XX5A 3GO1L 1FGVL 5GRVK 3G08A 1R3KB 5BRPA 1YEEL 1XZ0A 2QZQA 1BZEA 5D2NB 1G7PA 2BX5A 3QR0A 5LKNA 2DQMA 5B7EA 4W6YB 1GGBH 2NY6C 1MI5B 2VNCA 4WI4A 3FHQA 2BRRL 3HN8A 2PCPA 2XUWA 4J3WA 3GIZH 4PGEB 5CZVH 2XZQL 3D0LA 5E2VH 2HUEA 1GPOH 2APWA 3BW9A 4NQDE 5J7CC 4Q9RH 4FQXA 3RY6C 3IFOA 2H2PD 4J3OG 3OLIA 4J3VA 4PS4H 4BKLB 3U7YH 3RY5A 4JO3L 3II3A 3BPCB 1FJ1A 4A37A 5DZOA 4F2MA 5EBMB 4E9TA 2OL3B 5KJ4A 4UMSA 3LQAL 1TQWA 2B20A 2D9CA 4A2EA 4WZ9A 5EB9A 1EHNA 4F7CB 1J88A 4ODXA 4JNXA 4B95C 4HIQA 1JZ6A 3FO9A 3RZCD 3DMMD 3OLGA 3NCXA 4QRTA 5H35A 3GSRB 5C2UB 1WHOA 3EF7A 1NKRA 2Z1PA 1NGXA 4QHPA 4MD5A 2MWCA 5LAPA 2JJSC 5LBSL 2VH5L 3BUDA 2Q9OA 1MH5A 3E9TA 3MLZL 4QRSA 4XPAL 4Y1AA 5BZXA 4IBTA 4U1NA 2Q10A 3SODB 2NY5C 4JJ5B 3PHOA 4G59C 4YHOH 4XMTA 2EXYC 2ZUQC 1TEFA 2IQ9H 1PJWA 1VERA 2DQDH 4MAYA 2HJFA 3BH8B 1G7IB 3L5XH 4B6ZA 4BSVA 4PGDA 3O6KH 4Y4FD 2W88A 3EF4A 3RWFA 5DMIL 1A21A 3UO8B 2CO7B 4NYLB 4LLYB 4WFGD 1QABA 1K8DB 2VT0A 2X4RB 2DWSA 4NDMA 1DBAH 3H8NA 5F89A 3CXDH 1SZNA 3K6SA 3IFLL 2YD2A 4WWKB 3AM8A 5KG9B 3BUYB 1NGZB 1U8OB 4JZJA 4PEEA 4M5ZH 3STZA 3GSWA 5C9JB 3QWRD 2QPEB 1HSBA 3P9LB 3QFJE 2RMNA 4Z95L 3KBFA 3B5HA 4KY1H 4U1HA 2O6PA 4GRMB 3LB6D 3KLSA 4PJ9C 1FFOA 1GC1C 5FO2A 3PWLB 4EO5A 3KLLA 1FFPA 3LN5A 2AXGB 2PP9A 2I7OA 1DN0B 4I0PA 3QPQD 5D7KD 2DM4A 3THML 2B1HL 2HN7B 3KVQA 2LFEA 1IKFH 4AL8L 4Y4KC 3SKOB 2Z7WA 1L9NA 2JE8A 3PRZA 2Z4QB 5I75C 1Y1DA 3MUJA 3PGDB 3B7TA 3Q0HA 3NN8A 3JTSB 3ZU8A 1M53A 4NAJA 1FFRA 3DIFA 1HE7A 2CGYA 2IGFL 1KXHA 2FZ3B 4PJDF 1HKLH 4L8BA 5F7YC 3WO4C 3IS0X 1QSEA 4F7TA 4P59H 1FRGH 4J2QA 1MCNA 3TFKC 3H42L 2B39A 3B2VL 4FG0A 4O2FB 5E4EB 3QXDB 1I9IL 1URLA 5DDHA 1A6AA 2XFXA 2BSTA 3KJ4C 3QUMA 3DHUA 4XNAA 3PQYD 4E36A 5L2KA 2GUYA 4IRJA 1YQVH 3GMPA 1TZHA 3VXRD 1TTRA 2WY3B 4RAVB 2YWYA 4KK9C 3VG9B 1DSYA 2DEXX 4H26A 2O6FA 2L7QA 2KS0A 3G5VA 4CVWA 1QZNA 3OXRB 3PF2A 4OF3A 1E3FA 4LVEA 2QSCH 3GNMH 4O58H 2APSA 3SN6N 2HJKA 3U0WL 4ALAC 3AZUA 4NO5A 2RHEA 4NIYE 3S4SA 3ILDA 4YFLF 4PJ8A 4AMXA 4YHZH 2H8PB 2J2ZB 3GSNA 2LGNA 4B9YA 1CXFA 1WPCA 2IAMB 2JJTA 2DQGH 3V5DA 1CDUA 1FNSH 4NBXB 3UBHA 1PG7W 2NY1D 5C0BD 1YECH 4AV5A 3RAJL 1CYGA 3NUKA 2FJHB 2A38A 4R4ND 3RZCA 3DMMA 2EVJA 1WA1X 3W57A 4ZX6A 4HIXH 1RZKC 3WIFA 4ODSH 1IGFH 4WTXA 4ZS7H 2Y06L 4AYSA 1P5VA 1U8CA 3L95B 1ZIBA 3IJHA 4OLVL 1FORH 3QGVA 1I1AC 4LSQH 4O02B 4BCXA 1I7ZB 2CDGB 1RIUL 4XAWL 2O93L 3QPXL 1ES0A 3G6AB 4JY5L 4N9OB 3DVNB 2VDQH 3M8OH 5KSUB 4M1CD 2GABA 3RIAF 4M8RA 2FWOB 3UTSB 5JHDD 3HZMB 4TNEA 1UASA 3NRFA 4JPWL 3WUWA 3P4MB 1BBJB 4ZW5A 1Q9LA 2W0PA 4ZUTA 5E6IA 1PU0A 2FYVA 2APFA 2WO2B 3V5HB 4QXGL 2V9UA 3MLPA 5JOFA 2QLYA 5IVNA 3QUZD 3AABA 1PY4A 3K6IA 3DIVA 3DJ9A 3NRQA 4DVRL 1Y18A 4XB3A 1U8MB 3EDDA 4Q6IB 1E6OL 5KANG 1IT9L 1XFPA 3RWCB 5TPWL 5IR1B 1PMYA 1KN2L 2VRKA 4HUMB 1M7UA 2J57A 1PLAA 2ZCHH 3MBED 1FGNL 4Y5XC 2NY2D 3T2NL 2EZ0C 3BDXA 4FQHB 4YHPA 2EYTA 1UENA 4Y19D 2VLKE 1FCCA 4JPKH 3ATAA 5D71H 3T0WA 1JF6A 5E4OA 1VFAB 4LSSL 2CHXA 4JVWA 1FDLH 1CIUA 1OGAD 2ZIDA 1KIPA 1O75A 2WKLA 3F7VB 2GT9A 3MOBH 2IWEA 4S11A 1RKRA 1Q94A 1ZT7A 3DOHA 3BQVA 3QYCA 4G8FA 5DC2A 3WNNA 4B0MB 2JELH 2GW5A 5D1ZC 5I73B 5IIEA 3ZX1A 2R29A 1T66D 4OZGA 3QUGA 5ICZA 4LIQH 3IVKB 3TS8A 4OI9A 5DD0H 3TN0B 3SGJC 1K4CB 1OM9A 3U4EB 1DBKL 1P7QD 1RVFH 2YLHA 4FTDA 4JHAL 2FSEA 4YLQT 3ULUF 4N2FA 1CG9B 2GK0B 4Z0BH 2C4FU 2F7IA 2RFXB 3DIDA 3SEPA 3ZE1B 1MW2A 3ZOAA 1U3HC 1OAXL 7PAZA 2O72A 3H9ZA 3ZHLA 1R47A 4B53A 1SLXA 3II2A 3HG5A 2MKLC 5KYWA 2OQJA 2ZICA 2HX8A 2XZZA 4IKJA 4NFCA 1N0XH 5A6IA 3IFNH 3PQYA 3P2TA 2EDKA 1GJUA 4M7JH 4ENZA 3ATDA 3VDCA 1A66A 2KZKA 3NMEA 5HYSA 4CC0A 1WEJL 1AZUA 3MRIA 2WM0A 3H0TA 4RZCB 5E5MB 2Y0SA 4LCIL 2XWXA 3B6SA 1XGUB 2FUTA 3DXAD 1A6UH 5CBEA 1T89A 4DETA 5JR1L 2AK4E 1HQ4A 3NJIA 3O2VL 1DBBL 4RQQB 1WVZA 3RPIA 3FQUA 2LU5A 4TLSA 1UUNA 1FVCB 1D6EB 3KMDA 2XIIA 5I8KH 4K9EC 5INCB 3ZT5A 3N5AA 3NQIA 2VR6A 2OSWA 4ZFGL 3D5OF 1AZRA 5TDNA 1XGQA 2CH8A 2G60H 4Q0XL 4IHOA 5HHOE 2APBA 3BFOA 3BWUF 3HE6D 2VLJA 3KGRA 3P54A 5IJKC 4RGNE 4NRZB 1T04B 4G2AA 3RB7A 5ACZB 3MUY1 4P5KA 4H8UA 4JO4H 3TH2T 4OKDA 2J21A 5KVGE 2VQ1B 2LLNA 4ODUB 3HAEA 5FA3A 3CLFH 1PG7H 1C5DA 5F1KC 4D3CH 3CFDB 4N8CL 5DEJA 4JHUA 1XEDA 1TVHB 4QHKI 3U30C 1N64H 5KN5A 1DQVA 1LEGB 1AP2A 1Q72L 4FABH 1OTTC 5LNGA 3QNYA 1N5YL 1IM3A 2F08A 4ZXBD 3BGAA 1PEZA 1FL3A 2OMYB 4ELDA 5DJXB 5I6NA 4L9DA 4ACPA 3QQNA 3R1GL 1A25A 2CDFB 2QGBA 3QUXA 4QR7A 3RGVB 3BSZH 4PJXA 1UXWA 1FQ9C 3HI1B 3DA0A 3GRGA 3QUKB 4APQB 2O26U 1RUAL 3LIZA 1CD8A 3CFCH 1GZQB 5JW5B 3BAEL 2DWEA 5J6HB 1A3QA 4PJCE 2JK5B 1E9OB 1MIEH 4MB5A 1C5CH 3ME0A 4P4KA 4Y19A 3UYPA 4RZKA 3X1NA 1JVOA 2OYPA 2QQNL 2JWYA 4NWTH 3LNEA 3I3BA 3IDIB 3G04A 2ITDB 2DJ4A 1J0YA 1CFSA 2XN2A 3AMLA 4F8PA 1QBML 4P2QD 1S9XB 2V7HA 4PJHB 4UIMB 5GS0C 1H3PL 1E90A 2W0LA 4EN3D 2K8QA 3DTXB 2XNAA 2I32A 3VSVA 2BCKA 5TDOB 5IKCB