1NWOA

Crystallographic study of azurin from pseudomonas putida
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
AECKVTVDSTDQMSFNTKDIAIDKSCKTFTVELTHSGSLPKNVMGHNLVISKEADMQPIATDGLSAGIDKQYLKDGDARVIAHTKVIGAGEKDSVTFDVSKLAAGEKYGFFCSFPGHISMMKGTVTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords AZURIN
publication title Crystallographic study of azurin from Pseudomonas putida.
pubmed doi rcsb
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nwoA00
3ABLB 2X87A 1MG2C 2FQDA 2OV0A 1ET7A 1OCZB 1KCWA 2UX7A 3NSFA 3AZUA 4WTQA 5I6LA 2BO0A 3FU8A 2GSMB 1NIEA 5B7MA 1IUZA 1GY2A 3FYEB 5F7BA 4QLWA 1R1CA 4E9YA 3UAAA 4AKOA 2PP7A 1KDIA 3FSAA 3PAVA 1BEXA 1PLCA 2PP9A 3IE9A 2H5UA 2DV6A 3NSYA 1TKWA 2IDFA 2EIMB 1FA4A 1KYAA 5I5MA 4YSRA 3AG1B 1GS7A 3WIAA 1AS6A 3KW8A 1WA0X 1ETJA 3X2QB 1W8EA 2BP8B 2XYBA 2P80D 3TA4D 1JZJA 4NB7A 2TSBA 3OMNB 2VN3A 1BQ5A 2MRYA 3NJJA 3G5WA 3PCYA 2H3XC 1ASOA 1NPJA 3CVCA 2VMJA 4A2GA 2GB2A 3QQXA 1AS8A 4CSPA 1AZNA 1PCSA 2EINB 2OCCB 1BXVA 1OCRB 2QDWA 4GXFA 1PZAA 3FU7A 5PCYA 1DYZA 5D4JA 1T5KA 3ZDWA 1OE2A 1E65A 1ET5A 1SJMA 2DY2A 4DP4X 2PPCA 4KOBA 1KGYE 2VSMB 3CVBA 3SQRA 4M4RB 3MBWB 2P80A 2PPFA 2YXVA 4FAAB 2PLTA 3OM3B 2PP8A 3T71A 2IDSA 2Q5BA 3QJSB 3SBRA 1GR7A 3BVDB 2XXGA 2YAHA 3H4FA 2HX9A 1IBYA 1N70A 3OD3A 4JHUA 1E5ZA 1PZCA 5B1KA 4DP6X 3OMAB 2JXMA 2TSAA 2DWTA 2DYRB 3PXLA 3EH5B 1W6WA 4KNTA 3CVDA 3ASNB 2HRGA 2CAKA 3UADA 1ZIBA 2UXFA 3NJGA 4E9RA 5ANHA 3FU7B 4TXVB 2I85A 4CSZA 1RZPA 1WS8A 2HX7A 1X9RA 1ASPA 3T6VA 4YSOA 1SNRA 2N0MA 3QJVB 3IBOA 3X1EA 4QKTA 3SBQA 2ZWNA 2I7SA 3NJLA 1XB8A 2CUAA 1BQRA 1UATA 1PAZA 1AS7A 1JXDA 1WA1X 2FTAA 4KO9A 4AX3A 1BYPA 1A4CA 4A67A 2JFCA 1JVLA 3FSVA 2XV2A 2YAFA 4UAHA 3BQVA 4AZUA 2FJSA 1MG3C 4A2EA 2EIKB 4YSCA 4Q89A 3FQYA 3NSDA 2B3IA 1CC3A 2BZ7A 2WSDA 3PAZA 4YL4A 4ZK8A 4A2FA 2Y1AA 2IH8A 2QT6A 2XUWA 2YXWA 2X88A 2GIMA 4BDVA 2FT8A 4M3HA 2GHZA 1SDDA 4BXVA 1N68A 5B1JC 2IWFA 3QPKA 4HAKA 5E9NA 2I7OA 1A65A 3QJTB 1PZBA 5B3SB 1L9SA 1E5YA 2W88A 2XXFA 1E30A 3EF4A 1OF0A 5B1BB 4F7KA 4E9QA 1J9RA 2WO3B 2J55A 3ZIYA 3IN0A 3EHBB 3TBCA 1JERA 1BXAA 1SHWA 3X1GA 1MDAA 2HX8A 2HXAA 2HRHA 3NYKA 2IAAC 5B7EA 4HZ1A 5B1JA 4L0PB 3WI9A 1ZDQA 4DP0X 4YSEA 4KNUA 3NP3A 5AKRA 2BP0A 1HAUA 4Q8BA 1WS7A 1JZGA 2UXTA 1V55B 1A3ZA 4BDVB 2J56A 1ILUA 4E9TA 2IH9A 1AACA 1NZRA 2OJ1A 1SDDB 2RACA 2VW6A 3S3CB 2XWZA 1J9QA 3T6XA 1KCBA 3X1NA 5I5JA 7PCYA 4DPBX 1OOWA 4KO7A 2FT6A 4HHWA 2BWDA 2XVBA 1AIZA 3FQ1A 1GS8A 4MFHA 3TASA 3CDZA 4DPCX 3ZX1A 1IC0A 5I6NA 3CG8A 5I6PA 8PAZA 2PPDA 3FPYA 2H47C 1L9RA 1URIA 3QJRB 4AI7A 3T9WA 2IDTA 1ZDSA 3WKPA 3TU6A 4F2EA 1JOIA 3PPSA 3H56A 2BP0B 3NJHA 5B1AB 1BQKA 1V54B 4K9JA 3WG7B 1DZ0A 1NIAA 4E9SA 2J57A 5TK4A 1AZBA 2R7EA 5I28A 1IKOP 1GY1A 4DPAX 1ASQA 1QHQA 3D12B 4E9WA 2B08A 5F7AA 5IY5B 3S3DB 2FT7A 3N2JA 1L9QA 3JTBA 2Q9OA 4AKPA 4YSSA 1KBVA 1PMYA 4YSTA 1AZRA 4PCYA 1OCOB 4W1TA 2XX0A 4G71B 3QJUB 5TK2A 1JZFA 3CDZB 1NPNA 1F56A 4DP1X 3AW5A 3PAUA 4EF3A 3AG4B 4YSQA 1A8ZA 1GW0A 2DYSB 2E86A 2BZCA 4HALA 2GI0A 1EHKB 2WO2B 1JZEA 3S3BB 1M9WA 4A2HA 1AQ8A 1CURA 7PAZA 3EH3B 2JKWA 2HLEB 1PLAA 4RH4A 4N8UA 4E9XA 1KDJA 4G7QB 1W6LA 4GP8B 2ZONA 1MZZA 3WKQA 4HCGA 1OV8A 3FSZA 2R7EB 1SFHA 1AZUA 1FFTB 1WAEA 1ZPUA 2XV0A 4HCFA 4ENZA 2YAQA 5AFAA 5I5IA 5EHFA 4BWWA 2GC4C 1NWOA 4F2FA 1JZIA 3FPXA 2DWSA 1IBZA 1ILSA 4GP5B 4BWTA 1OE3A 5I26A 1E67A 5I6KA 3MX0B 1X9UA 2BHFA 1QLEB 2ZOOA 4DP2X 4PAZA 2NRDA 3RYMA 1PNDA 5A7EA 5B7FA 2A3TA 3H4HA 1CYXA 4NERA 5LDUA 6PAZA 9PCYA 2IDUA 2Y69B 2LLNA 2PCYA 4G7RB 4NAJA 1M57B 1M56B 2AANA 3V9CA 1FWXA 1JXGA 1HFUA 4YVUA 2MTAA 4DP7X 2XLLA 2YAPA 2IDQA 3NJNA 3NJFA 2UXGA 1MZYA 5D4IA 4WKXA 2CALA 4FA7B 1ET8A 1HAWA 3GXUB 3ZBMA 2PPEA 1AANA 1J9TA 2PPAA 2VSKB 3NJMA 1CUOA 2AZAA 3ERXA 2PCFA 4JHVA 2XV3A 4HHGA 3IEAA 3L45A 4UF7C 1NTDA 2XU9A 3PLYA 3UAEA 2AZUA 1PLBA 3V9EA 3FSWA 4KNSA 1J5CA 1ID2A 1RKRA 2J5WA 3ABKB 4E9VA 1XMEB 5I6MA 1SFDA 1TEGA 3IN2A 3EH4B 3KW7A 2FNWA 3DIVA 4KOCA 3N55A 3NJKA 3ASOB 2VW7A 4P5RA 1RZQA 1L9OA 2EIJB 4KO5A 2BW5A 2UXVA 2QPDB 3AG2B 2FQEA 3T6WA 3FQ2A 3AG3B 5FC9A 1KBWA 3WNJA 2BW4A 3X1BA 1QNIA 3TBBA 3NSCA 1GS6X 4A2DA 1BYOA 4W9ZA 1VLXA 4DP5X 4KO6A 3UGEA 1AG0A 3FYIB 1JVOA 1J9SA 3DTUB 1ADWA 2VW4A 1NIBA 4YSUA 2YQBA 1J5DA 3HEIB 4UANA 5I6OA 1L9PA 3OMIB 4YSAA 2YARA 1PF3A 4G70B 4YVNA 3HB3B 3QJQB 4G7SB 3UABA 1AR1B 1PNCA 2CBPA 3FU9A 2VM3A 1AZCA 1B3IA 3T6ZA 3U25A 1I53A 1SHXA 1EZLA 2FQFA 2YAEA 1NDTA 1YLBB 1RCYA 2BWIA 3C75A 3SBPA 5D4HA 1NIFA 1ZV2A 5PAZA 4X4KA 5AZUA 1AAJA 3WNIA 1NICA 1NWPA 1XB3A 2QPEB 2GBAA 1GSKA 1SF5A 2VM4A 2YAMA 3S8FB 2QDVA 1OCCB 1JXFA 1BAWA 4HCIA 3AY2A 2YAOA 2AVFA 3NJIA 2CJ3A 3UACA 3GYRA 3OQRA 1CYWA 3FS9A 1KV7A 3CZUB 3JT2A 1SF3A 2W8CA 2XX1A 1TEFA 2GC7C 2UX6A 2IWKA 4YSPA 4BWUA 4GY4A 1GYCA 2AFNA 2ZXWB 1A4BA 4N4YB 2EILB 1AOZA 2CCWA 4YSDA 1AG6A 6PCYA 3S8GB 3ABGA 3NT0A 4HIPA 1PY0A 4AKQA 2FQGA 4DP8X 1JZHA 1A4AA 3FT0A 4P5SA 3X1FA 1NIDA 1BXUA 4GP4B 3NP4A 4G72B 1XB6A 4GYBA 2FWLB 4BK5C 4BXSV 1NINA 1TU2A 2IWEA 1L9TA 3ABMB 4JKNA 4A66A 3GDCA 2BP8A 1V10A 1ZIAA 4DP9X 3DKHA 1WA2X 2HZHA 1OE1A 4A68A
chains in the Genus database with same CATH superfamily
3IGLA 1NCDL 5GSVB 4PJEF 1GIGH 4ODSL 3U1SL 2COVD 4PGCB 4W6XB 1BM3H 2QGCA 2ZAHA 4I48A 3HUJF 1KJ2L 4NWTL 2IPUK 4E5XB 5J6HA 1PKQB 3FZUC 3IMTA 3PDOA 4IOFD 1GY2A 4R90H 5F88A 2AV7A 4LL1A 4I3GA 5C08D 4CAGA 1NFDA 2NY5C 4LNRB 3ZK0A 1E9PB 3X11B 3SJVE 3X14B 2YA2A 1C7SA 3FTXA 1FORH 1UZ8A 2DLTA 2MPVA 2C9SA 3B9DA 3D0LA 4HIXH 4B5ZA 2JIXD 4MNQE 4QRRA 5D5MB 1S7SB 3HW7A 5DJ6B 4PJXE 5TF1L 3TYGL 5I5MA 4NUMA 5IFAH 3QUZD 4U33A 1VZGA 4M1CD 2JCCA 4OT1H 5IFJB 2XYBA 5E8EB 4AM0B 3KLAB 1P7QD 1EQWA 3G5WA 4H8WL 1RLWA 4JRLA 2DQTL 2R2HB 3VFOB 3K2KA 2G2PA 3QIBD 5C07D 3FC8A 3T3PF 4I18B 2YD2A 3MTRA 3Q05A 4K73A 2QSCL 1S9YB 2EC9U 4G83A 5D72H 1R6VA 4H1LA 2Q0ZX 4UM9D 5KVEH 5CHNA 3DOHA 2SEBB 3O6KL 3P3RA 4EN3D 4MJ6B 1ZK9A 2OJZH 1RJLA 5EIIA 2GEQA 2WUBL 4HK0A 4BYHA 1TQVA 1PZAA 5PCYA 5BRZE 1U8QB 1QFUH 1CXKA 2IV9A 4A2MA 2O5ZL 2NOYA 3FB8A 2R4RL 4YC2B 3TF7C 3MKKA 1PJ9A 1JPTL 1MCLA 1DO6A 2O30A 1WG3A 2DQDH 3CVIL 2ED7A 3ZHLA 5IHUL 2NY1B 3C87A 2BVQA 3I74A 1J0KA 4PJ7F 2X1XR 2NNRA 2YPLA 3IETA 2B1HH 2VDNL 5EC1B 4YHOL 5ITBH 2LGNA 1VCBC 5HTSA 2DM7A 1O9WA 3VWJC 1QNZH 4OZHE 5DQJB 5F71A 4OKVB 1CTNA 5I5RA 3MRMB 2C7UA 5CLXA 2BVPA 5F7WC 1S7UB 3CZNA 4F80A 2WTPA 4EOWL 4Z77A 2V7HA 2DIEA 3LHPH 2BS9A 2YD3A 4LCCB 3AWEA 4Y2OB 2ZXDA 3PGDA 4Y5XC 3LS5L 5I1CH 2FJFB 4U6VL 2FX7H 1BLIA 4HIQA 5I24A 4FKKA 3N6YA 2FLBT 4UM8A 4XCYB 1WS8A 1MCRA 4AVJA 4V1DD 4P99A 1IAOA 3CDCA 5I74C 3KDPB 3QJVB 5DK0A 3K6IA 4F33B 1NDGB 2FJUB 1E8WA 1G7MB 1ZA6B 3A6BL 3P2BA 4MB4A 5F7DA 3ESPA 4F1SA 5CLZA 4LO9A 3SBQA 1UT2A 1GGIL 3FCSA 2IH3B 2WLHA 1JTTA 4C83B 3LH8A 4YK4B 3FT2B 4M62L 3GBML 1GZPA 1PAZA 1W8NA 4JB9H 4K8RH 3JV0A 1N8OE 3UPRB 4N2BA 4S1SL 4W6WB 4L1TA 1PBYA 4K5LA 2GBTA 4DK3A 1FVDB 4N9OB 3HNVH 2BSCA 3RJOA 1K5WA 5GZOC 3GXTA 1CTOA 5HGGS 2VJXA 1HU8A 3V0WH 4F7MA 4DVBB 1JGUH 3BVNA 4WDIA 2J21A 4Y1SA 5AKTA 5L8KB 3TH2T 2OR9L 5T3ZE 4MQTB 3SZ6A 3AT8A 1JK9A 3BD3A 4TMPA 1CD9B 2CK0H 4KI5C 4P23D 4PJ5D 2UWEA 4YL4A 4ZK8A 1UJ3B 3KD4A 3OKMB 4LMQI 3OWEA 3QH3A 1MFAL 4HEPA 1MREL 4U6TA 2CCVA 4NENB 4RMBA 2X70B 1HYSC 3SPVA 3D85B 5DJAA 3ZGIA 1JWMA 3IDIB 1E9OB 5EZLA 3IRZA 5J89A 3RL2B 3GSOB 5BNXD 4Y89A 3WY1A 3KWWA 1HZKA 4JFWA 3W57A 1OGSA 3WO4C 1YEFH 5ERWB 1SOQA 4ZTPH 3FHEA 2Z35A 4JKMA 5DJCB 4N8CL 2G0KA 1HCVA 3DJ9A 4NGHH 3V7AE 3PJLA 1B4LA 1IRAY 3P2TA 3P02A 3G5ZA 5AZEL 3SPHA 1AXTL 2IPTL 5ANMB 5A43C 2QKIA 5IMMB 2A9AA 3PF2A 4YXHH 4NPYA 2V3FA 2NX5D 2DTML 1A3ZA 3IT8D 4XZ4A 3HLKA 2J56A 4FEIA 3I50L 2GJ6D 4LCIL 1SDDB 1KJ2A 1MCOH 2G4GA 2WTRA 4XPHH 1SEBA 5DC9B 5AOJA 2XWZA 1VGKA 1FPTH 5IBLC 2BFGA 5J11B 2F61A 2LAAA 3GT6A 4APQA 4K3GA 3LNFA 4A04A 4HEME 5E4EB 1KC5L 3F5WA 1GS8A 1HCZA 4K2UL 3QO0A 3JV5A 2I5YL 4HETA 5AW4B 3HG3A 5JW4R 4EDXA 1TR7A 1L9RA 1MAKA 1PDKB 2ZUUA 4M61A 3SE4C 3NJVA 3LS4L 3T9WA 4JJ5A 2HA1A 3RVXD 4ODWB 3L3DB 2TRYA 3K72B 1KGUA 3D18A 1NDMB 3KS0H 4UQAA 2A9BA 5TGBB 4EXPX 2V33A 3FFOA 3QR0A 5LWYL 3APFA 1A02N 1JK8A 1M4KA 1NBYA 4CKVX 1ND0A 3PWLB 3FUIA 4X5LA 2E9JA 3WTSA 1MCSA 1G5GA 1MW2A 4NKQB 5D7SL 1CI3M 4PCYA 4NSKB 4NC1E 1BIIA 3P4OA 4CC1A 4P04A 4JRWA 3D2UA 3ET9F 1ODAA 3BAEL 3GD1C 5T3ZL 4MB3A 5E2VH 3MX0A 2ATPB 2MKLC 3CSPA 5F3FA 3AG4B 2O5XH 3ARGB 2DYSB 3ARFD 1OWWA 3FXIC 2BCKA 4GW1A 1YUHB 5KUMA 3DXAD 3W2DH 1I9EA 2XDHA 3BGMB 3FTUA 3VFRB 5IIEB 1WE5A 3BPCA 2VYRE 4DUWA 5C0ND 4HJ0C 4RETB 2UV3A 2ZKHH 3NCYS 3WKQA 1AXIB 1U8KB 4N2GA 4PTTA 3D87B 4WI0A 2AXGA 2HKFL 4YQXH 2A74B 1LYQA 2VAJA 4ENZA 1N7ML 4AWJC 1FZOA 4GW4B 5DF0A 2EUWA 2EVFA 4WO4B 2OSYA 2VLLA 3QDGB 4HPYH 4XX5A 1RUMH 1ZWIA 5IQMA 1JI2A 2YJLA 5EWIL 3WE6B 5MEOA 3IU3A 4JN2B 3FUHA 1CZ8H 4DP2X 4PAZA 3RYMA 1PNDA 2EDKA 1RPQA 4P4KC 3MXWL 5CJQL 3TVMB 5I6XC 3FF8A 3QCTH 1CBJA 4RNRB 1W72L 1NGQL 2BS71 4FGMA 2LLNA 2KQNA 3OGCB 5ITFA 3DV6B 4G7RB 4ZMTA 4HOMA 4WTXA 2AXWA 1OSPL 1CGSH 2QQKL 1T1XA 2WMPA 2ZSVA 3ATEA 2CJSA 5FO7A 5C7ZA 4AGMA 4BINA 4P2AA 3BXNB 3GRWL 4XRCA 4YVUA 3O41A 3PWPA 4YGVB 4HMCA 3TJEH 2YAPA 3Q8CA 4Y2DC 4NPKA 3H3KA 5L2KD 3BZFB 3ZO0A 3I02A 3F58L 4MNQA 5D7IE 4B0MM 1WFIA 4P05A 3TTSA 1HNYA 1KPRB 2DQUH 4WK4B 4EKJA 4KV5E 5HVWA 3TO2B 1F2QA 2J1YA 1J9TA 1FSKC 2WM0A 4RGND 2Q10A 4GKNB 1DJSA 1PL3A 2OMVA 4R5VA 2JB5H 4B6ZA 4QRPA 4CRPA 4JHVA 1H6EA 2BSED 3A4DA 2Z8RA 1HQ4A 4Z3IA 2V2XA 4JKPH 2DLFL 3MGOB 3VD9A 1LLAA 3V6ZB 3VFTA 4AQAB 3EYVB 5DA4A 1Z9OA 4TPRL 2GTWB 4XP4H 3ALWA 3OSVA 1UEYA 3OKKA 4PWHA 4LPUA 4F2MB 2ERJB 2FE0A 1ED3A 3O3AB 1SUHA 3DIVA 1VJSA 3IJ7A 3TT1L 2FJHA 1A6WL 4LEXH 3HG1E 4LKCB 3ARVA 2XQBL 4JFFA 1MFEL 3NCJH 4LLDA 2H45A 2DS4A 3X3FL 4DJMA 4M7JH 2YFNA 2PXYA 5C86A 3BWZA 3MLXL 5D2NE 1EX0A 1AQKL 3R06A 3RJQB 5DTFA 3AG2B 3DDGA 2ZCKH 3ZKSD 1GAFL 1H15A 4OFDA 1CFQB 3REVB 5DO2D 2O26U 4YR6A 1DO5A 1OSZB 2RTTA 5FM5M 4X4YA 2HFFB 4FFTA 3T8MA 5IP4A 4RVBA 1YRKA 1TSRA 4ZUUB 4IW4C 2VABB 1CLOL 5JDJA 4OZHA 3IDYC 3VW3L 2NYYC 1BQLH 5EDSA 1HE7A 4QRBA 1CDYA 4HD9A 4ZODA 1NKGA 5C0RL 1F4HA 4Y5YB 5BV7C 1LO3H 1M2OA 5E7FA 3CN0A 1J18A 5FA4A 3IVKB 3D3VE 5D9SA 2DKMA 2IH1B 5CEZD 1J5DA 5JIMA 2BLFA 5C09B 3B5GA 1PZSA 1SLUA 4U1LB 3B8SA 5IEKA 3OHXA 4Z7IA 1KTDB 2LVCA 1J48A 2GUOB 2EC8A 4R0LC 4B9FA 5GHWH 2APTA 1C5BH 2VDPH 4B9JA 4ISVB 1A8JH 1JMZA 5CO1A 1BM7A 2H0EA 1PG7L 2JSFA 1LE5B 5AG9A 3BVVA 3MMEA 3ILQC 4ZUTB 3D8MA 4U2YA 3KPLA 4PLNC 2ZZUT 4KK5C 4TYUA 3E6HA 3F7VA 4YDZA 2X4TB 3KLDA 1MHEA 2HB0A 4U31A 4YFLF 3SDCD 1SOXA 1X9QA 5C0BE 1CE6A 4Z5RB 1HJBC 5AW2B 3WNIA 3ZY7A 1VEOA 2H2PC 2G2RA 2AJVL 1GSKA 2VM4A 3MU3A 2WXGA 4AW7A 4KJWC 1FL5A 5J12B 3STLB 4FXKC 5JOFA 4EIGB 1UWGH 2BJML 3EUDA 5IJDC 3U7AA 3DX8B 2JJVA 1NMAL 4GAAA 3RVWC 1GXEA 4GG6F 3PFUA 2A77H 4FQCH 5DD1H 3MGTA 5C0IA 3GHEL 2DEYX 4I0PB 1RP9A 5T5FL 5DRZA 4BE6A 1HESA 4RDQF 4NRXB 4ZTEA 1AOZA 3ISWA 2Q87A 1HZLA 1HXYA 2Z8WC 3T65A 5T3XL 1WAAE 2OA9A 4PV8A 1E4KA 1QP1A 2AMGA 5FYLH 4TLKA 1N5YL 2GITB 4XMLH 3P3YA 2A9MH 3UL4A 3MOBL 4N28A 3VYPA 2OMTA 1KGCE 1V05A 2P5ED 3EOAA 1G9EA 1UB6A 4MJIA 2KLRA 5AB2A 3CMGA 1UYWL 2ZUVA 4JVUA 3LEVL 2ZWSA 2JJTC 4CMHC 4KRPD 3IJSA 3HB3D 4P46D 3RWIA 4BQ8A 3BAWA 2WV3A 3SCMA 4HPOL 2HT3C 1Q38A 2R0LL 2ICWI 3C5SA 4WUUE 5I1EH 1IC7H 3CVHB 2Z91A 1RJZB 3L7EB 3OQ3B 2RCSL 3LPOA 4Z7VE 3TCLB 1I3VA 2VB5A 3HI6H 1ZEAL 2EH7H 4N9GB 1UWYA 2C9RA 2UZYB 2DQGH 4XP6L 4FFWD 5MEPB 2FQDA 2X1QA 1F02I 4NYLB 3O3EB 4LOUD 1NCHA 3LN5A 1W72A 3LV3A 3K6OA 1K9TA 4XGZB 3FO0H 5HGDB 2HT4C 3RZCD 1XGYL 4LSSL 3DYMA 1Y18A 1T5WA 3GB7B 4U3SB 3G6AA 1BEXA 3GRWA 4HEMA 5TE6H 3W37A 2WQAA 1WZLA 3IGUA 3KL3A 2CM5A 1RUQL 2IDFA 3MNVA 5CLTA 2YR3A 4HULB 5F96L 1A6UH 4CUCA 3N85L 4IOFC 2EDMA 4AG4H 4NZDA 4FRWA 3TO4B 3ZHDA 1LE9A 1S7RA 3L9RA 2V17H 4XVOA 3X2QB 3MBWA 1W8EA 5HYEA 1T1WA 2K7QA 1UM4H 2BOLA 4XVSL 3AQZA 1BFTA 1OAQL 3OB0H 1U9KA 2XA8H 4Q4IA 4PRID 4A38A 5CR8A 4U7SA 2A6IA 4RGMC 4M1CC 4ODHL 5HGBB 5IOPA 1FCGA 4Z7AA 1DEEA 3M07A 4GRMA 2W80C 1JF1B 2W9EH 5DJXA 1CQKA 3MLUH 4JJHA 3WFEH 1NC4D 2IALB 2QADC 3VTAA 3QIBC 2CO6A 2R23A 5T33L 4GKZA 3Q48A 1G7JB 2ZIDA 2YZ8A 3P9LB 2HRLA 2YGQA 1ORSB 1F11A 1L0XA 2HWZH 4BKLB 3TEUA 3CVBA 4XNYL 4QOKD 5GRXG 4O9HL 5HYJB 2HKHL 1SXBA 3VU1A 4AGLA 4EN3C 4ZX3A 4Y4FA 4MCZB 2OW7A 1CIDA 1EVTC 3MUGB 5HHXL 3GXMA 4MD4B 3C5XA 5E6IA 3NZSA 5GGRY 1GR7A 2A6JB 3BQUD 4GFTB 5HVGB 5AW5B 1OXYA 3IGFA 3OMAB 2WIIA 3EHBD 5JLZB 3CN3A 2YFOA 5FECB 1JTPA 1R3JA 4N5UA 3RWGB 3CDFA 5CWSB 4PJ8B 3DVFA 5CSBA 1HIML 2B59A 5TDOB 4LKXA 3JWDL 4BJLA 4LU5H 4F5CA 1A7BA 1C5DA 5J56B 2H26B 4F7EA 2NDGA 4M8UA 1FLRL 1CR9H 4YDKL 3LQZB 4N8VG 3L54A 5AOIA 5D93B 4JDVB 2FEEI 5AB9A 1CDCA 3KPNA 1U8MB 3MV9A 5D1ZB 4P9HC 4Q9CA 4OKDA 5DHYA 4H40A 2H0JA 5ILTH 4KGLA 3QULB 2V8LA 3NJLA 5DCCA 5KYWA 1M7DA 5DD6A 4YO0A 3T2QA 3VXOB 3WJLA 1NMCB 4CC4C 2CU9A 1K8IB 4PS8A 4JHAH 3FSVA 3BPOC 4XMPL 2BSTB 2GJZA 3NABH 2KYIA 3DUUA 3FFCA 3DUSA 3MLVH 1A3RL 1QYGH 5BOPA 3T1FB 2BOCB 2X4PB 4M1GH 4X4ME 4F9PC 1NGWA 1Q0XH 2GQHA 2EECA 4J12A 5I0YA 1L7IH 2D3NA 3E2HB 3M1BB 2Y1AA 1U4EA 2QT6A 3WEMA 3FQUA 3IM1A 4PB9H 4F20A 4F7PB 2VMFA 1I85A 3V5HB 3VAEA 1CG9B 1MRCL 4IMKA 5T5FA 1G9NC 2AEQH 2ZG3A 4PM1A 5KSVA 2ZOTA 3MRNB 1RAMA 1E6JL 2GW5A 2J88H 1A65A 2NZIA 1DBJL 2LW3A 4H25A 4JFEE 1U8CA 3ARDC 4WWNA 1OKEA 4P23C 5B8CA 1E43A 3O9WB 4MTMA 4HT1L 4E9QA 1F58H 5I1DB 3HG1A 2UY6B 2JI1A 2GJPA 4R84A 4R4ND 3RUGF 5B7EA 3WU1A 3HCVA 1ZVNA 4U1MA 2GCYB 5ACZB 3KVQA 3CH8A 3NOIA 5D1QC 4PRHD 2X2IA 2QPSA 1UC6A 2XYCA 2CHXA 5DI8A 4OR1A 2X1WL 2BP0A 1HAUA 1I1AC 3ECBA 3EFDH 1AO7B 2EICA 4TSAH 3NFSL 4NIYE 2VIRB 4QRSB 2B14A 2AEPH 2W65A 3ZTJG 4TRPL 5FYJE 3IDXH 3X13A 2VW6A 5FW6A 1ACZA 4HUVA 1X3DA 5GS0L 3KPSB 3ULUH 4XCCH 1WEJL 2AV1B 3IFPB 1TO5A 3OR6A 4LSUL 3T77B 3IFNH 1CBVH 2CDEA 5KBMA 2BK8A 5KG9A 3QO1A 1VACB 4X9HA 4ZMZA 3IGKA 1DDTA 4XO5A 1P1ZB 1FUNA 5ALCL 7FABL 3U7YH 5I1AA 1S46A 5DFTA 3RNQB 2BSSB 5IW1B 1F45A 5K9QI 5KYNA 3HPLA 3KXFB 4P2RA 3WS3B 5DD0L 4GLRH 4HIEA 4NZTH 5CIPH 4P2OD 5TE4H 3FQTA 4HYTB 4U1KA 2PO6A 1BQKA 1Q72H 1TSHA 2Q86B 3WG7B 5KYXB 3K4ZA 1T21A 2Y36H 1BFOA 4NQDB 5C0BA 1Y0LA 4BA0A 5H2BB 1ASQA 1OB0A 1QHQA 5GIRB 3RGVD 2VKWA 3AY4C 3PWVB 1Q9WB 1I8IB 1PG7W 2OTUB 4H5SB 3RVXC 4ABVA 3BH8B 5FHAL 4U3CA 1KLUA 5KJRH 1JDCA 1Z3RA 2DYPB 1G7QB 2AAVA 4JREC 4DP1X 4L2LA 1TPXC 1YHPA 3MJGX 2ZUYA 4H0GA 5C6TL 3HPJA 3WXWH 1PFCA 5JHBA 4M8QA 1IM3A 1JCKA 3HMWL 3EFFA 3UAJA 1KTCA 5GGQL 1WJ3A 1M9WA 4FYSA 1U6AH 2G3NA 5HHOD 3Q6GH 3HE6A 5F6HJ 3UTTD 4Z6AT 5JHMA 1DQJB 3OJDB 3SQBA 1WAAA 3KYAA 4KITB 2YXFA 3BOVA 5GJSH 4ELDA 3V0GA 2FL5A 2J4WH 4OF0A 5LAXA 2QR0B 4WU7A 5E5UB 4XBGB 3ARFC 4LDCA 3JTTA 1CLYH 1J1OL 3UYPB 5JXAH 4AQ1C 2IPKA 3B34A 3IDJA 1HL8A 2KL6A 3N42B 1HNFA 3EDDA 3NCBB 2CA3A 2DQHL 3KLLA 3BEVA 5C0NC 5FYKD 1LP9B 2EIZB 5INDA 3U9PH 2K0RA 3VFGL 1UTDA 1HHJB 1DQQA 4MA1B 3ZGHA 1CK0H 1RU9H 2BHFA 1EMTL 1RV6X 2VR5A 4XC3L 5FXCH 2YZ1A 5CM1A 1CYXA 5E5MB 2CBTA 4PGJA 4URTB 1RZGB 4HKZA 5AQ0A 5AVQB 2VLJB 6PAZA 3DX6B 3IXAB 4NNPH 4ZFQA 1TG8A 1DQMH 1F3JA 1HSAA 2EDHA 5LDSA 4HUNB 5L6YH 3DGGB 1WFMA 3U4AA 4H20L 3HZMA 4FQQA 1H9VA 2FUQA 5CJOH 5DQ9B 3O4LE 1AZZC 1DEDA 3SDDA 4UQCA 1WWAX 1S7TB 2P5WE 3FT4B 1C12B 2LVEA 1YMMD 3MRRB 5K1VA 3SPJA 3TT3H 4J2QA 1XIWC 1DQVA 3HHSB 3MOQA 4EPSA 5DLLA 1IGFL 4K3DL 2JK5A 3SPGA 2H9GA 3V4VB 2YGOA 1OAKH 4PGBA 4PLOB 3HNTH 4H0LC 4TOYH 4YHML 4MJJA 4P57B 5CILH 4A7SA 1FNEA 3NJMA 3LZLA 4MVBD 4PJEE 4UT9L 4FOMA 1X7SA 2NY5L 5IEHB 2V5RA 3WUWG 2J8OA 3L3IB 1SJHB 3LIUA 4UWQB 1OGTB 2X4OB 1WD8A 3CC1A 2R1XB 4QIRA 3SDAB 1ODUA 1WBYB 2ZOUA 4BK4A 2YD8A 1KYDA 2P43B 3DTXA 1U3NA 3ABKB 1DDHB 1NEZA 5C0CE 2WLMA 3NDYE 5HPOA 1TEGA 3IN2A 2JF1A 1UXWB 2GVYA 2FIRT 3QUYC 5CKGA 4Z7UF 5AVSB 3RI5K 4YDLB 1EDHA 4AIZA 3VD0A 1V3LA 3QRGL 3V6FA 4WY7H 5F1IB 3GSUB 1PS3A 3JWNE 4P9MH 3F6LA 1L4IA 5AOKA 3VXSD 2RR3A 3MACL 2K3HA 2BIHA 3MLYH 5AWNH 2AQRA 3MLTB 3SDXF 5M94B 2RAMA 3WJMB 1D9KC 1MCKA 2Z31A 4ODTL 4O2EA 5T1LD 1NAKH 1AFVL 2BW4A 4G6JL 1ORQA 1QI3A 4I0KA 2CO7A 1DN2A 2GAZA 2K3TA 1IAIH 3PABB 3T3PE 5I8KL 2OMZA 4MZIA 5LGJA 5CGMA 1NCBL 4XB8A 2EXTA 2VRAA 3VI3A 5K1NA 1AG0A 2J20A 3HG4A 3CD4A 2B1AL 2IBGA 2YGVA 3AM8A 3DTUB 4M7KL 4PH8A 5EN2A 2HTKD 4FA8A 3BUTA 2WN3A 4UANA 2JQAA 4EE2A 1RVFH 3VXNB 3HMXH 3FB7B 3UZVA 4XPFH 5BVJB 3GMRB 4G7SB 4J6RL 5D7LE 5LQBL 4K7FA 1MJJA 2F5BL 3QNFA 5B39A 4JM0A 4PJ7E 1ZJBA 4Z1PA 3KS0J 4JZJC 1B3IA 4KROD 1QTYT 5C0FB 3EGDA 4G6FD 1EZLA 2BNRD 1NDTA 4HFWB 3C6SB 3FN3A 4MMZA 2BOBA 4HS6B 1MWAB 4TQPA 4XNZC 4Y1AB 4KKAD 3ENEA 1KIQB 3TONA 3DSFH 2PW2A 2GBAA 4QXGH 2UYLB 1SF5A 3ZL1A 5D55A 4HWBL 4MS8D 3S37L 3HR5B 3NJIA 1XQ4A 5GRYA 3UJTL 4PJFF 4R8WH 1CVRA 4IOSA 5IVOA 4X4MA 3SDCC 2UX6A 1JGDA 2Z92A 2PN5A 3TIDA 4B5EA 4W9DC 4LHQB 5CUSH 4PI0A 3IMVA 3Q13A 5DUPH 4AV4A 2DRUA 2YQ3A 4PJGE 1M1SA 1CFVH 3II2A 5IHWA 3K2UL 3WFDL 1NAMH 2HPTA 1MHCA 2OSLA 3TTYA 1AG6A 3GSWA 4GKLA 5EO9B 4HIPA 4JFDD 5GRJL 3ZE2B 4OQTL 4GSQA 4JFEA 1HOCB 4ZTOH 1MI5E 1T0MB 1T03H 1OGAE 4V33A 3OL2A 4GYBA 2VE6A 1SY6H 9CGTA 4LFHG 1SGKA 2NMSA 3DBXA 3KM1A 4J8QA 4WFFE 5AVUB 3RY6A 5IQOA 5HDBF 1L9TA 3D39A 4JW3A 5L4MA 4CSTA 5J1TC 4KFZC 2CNYA 2J73A 1HL5A 2BP8A 3UIZA 5HD8D 1BD2D 4CU8A 1K5NB 4IMLB 5JUEL 4PTUA 1HCFX 5AAWA 3ZTNH 3H6AA 1WZ1H 5J6SA 3ES6B 4GRWF 4M3JA 1F18A 2VLRE 3WFCL 2G9HB 4KRPC 2ZCHH 4P46C 2ITFA 4Z7WE 5EU3A 3O0RH 5I1IL 2WQUA 3U6RB 2EUVA 3FU8A 3MFGB 4KKNA 5DD5L 1RK1A 1EJOH 4GRWH 3SPCA 3FB5A 3P9WB 4X7EC 4GXVH 2VDLB 3MV8B 5AVWB 3T0EB 2ZSWA 4E9YA 2EDNA 2WINB 5A6IA 3HVDA 2GSGB 1IFHL 1TTRA 2QHRL 4FFWC 1KEGH 4LBAA 3K81A 4Z7OB 4LOUC 5IB3A 1XGZA 1XR8B 3QDMD 2X0WA 2OYLA 4URKA 1XZ0B 1RUPL 4NQUA 1OP5K 5JOPE 5A16A 5IB5A 5IQ9A 2EDLA 2K4WA 3VXUD 1IMHC 3RZCC 3WO3B 3MZGB 1HZHL 5A2CA 4UT9A 3ETBJ 2VDOL 3NJJA 3KPRE 3L3KA 3SKMA 4IRJA 1RZ8A 3H6JA 4AGOA 4NFDA 2HVJA 4M93C 5FDYA 5EEXA 3J7HA 4RFNB 1UJTA 1INEH 4JM2C 4I48B 4KXDA 5B38A 2B2XH 5CBAA 5J6HB 4HH9A 1IQWL 4WHCA 1AS8A 5MI0B 4F7CA 3GJFA 5I0ZA 3PDOB 1AZNA 1WCQA 2CJUH 4FFYL 5F88B 5I76A 2AV7B 2EINB 2A4EA 5D96B 1NFDB 2XWEA 1CIUA 1Y6KR 3QA3A 3WD5H 1AKJD 4JO4L 1UZ8B 4HAGA 2W95A 3D0LB 1RI8A 4YBQD 1QLEL 3GK8H 1A9BA 1SJMA 1Y1UA 4NQCA 4YHNA 2D31A 2NY0D 1PIFA 3WLWC 2JCCB 2NY3D 3NESA 3WMPA 4FG0A 1DBKH 3FBKA 1EGJH 5E7BA 3B7YA 1PZ2A 4N2MA 2IQ9L 1N70A 4OFQA 5F9WB 2A5UA 4L29A 4YXLL 1J1XL 3TEWA 4YBHA 4AYGA 3PXLA 2R8SL 4H1LB 1JNJA 3F01A 1NEPA 3N44B 1WISA 5CHNB 3VGAC 1QR1A 2IOIA 1UXSB 3CPUA 3QEQD 4UTCA 1RJLB 1SEQH 5EIIB 5IREA 4HK0B 3O3UN 5JHLH 3BQUC 3VI4F 4LOFA 4HUWA 3FB8B 3EHBC 2RH0A 3VWJA 5D7KE 4ZS7L 3CLFL 4BFEA 2KZKA 5JQHC 5DR5H 5ID1A 1EO5A 1RJYA 2WWKO 2I7SA 4MNHA 2BVQB 4OIBA 3TFKD 5GISH 1B90A 4AJWA 2Z93A 2YPLB 5J1AA 2CG9X 3BDBA 3I6KA 2VSDA 3FMGL 1A4CA 4OH2A 4PJBF 4EXKA 2C7UB 1XGQA 4RMWA 2BVPB 2YAFA 2Y24A 3K80A 4HX1A 4Z77B 4HWBA 1R4XA 2V7HB 3QUMH 5ECJE 2YPKA 4YSCA 5D7JD 4DZ8A 3R0NA 4MX7A 3PGDB 3ZKMD 3K6FA 1TQUA 2DIJA 3AABA 1DBBH 3VSQA 2B5IB 4AGQA 1BOGB 5IHHA 4I4WA 4UM8B 4WI4A 4A2FA 1TCRA 1PX4A 3B9VA 2IH8A 4DKFH 5F6IB 1IAOB 4FD0A 4I2XE 5BS0D 2YRZA 3H55A 5DK0B 4ELME 2JTYA 5GZOA 4FDWA 5F7DB 3IPFA 2VXQH 3E7JA 3FCSB 3JBG7 3BFWA 1CGYA 2IWFA 1QMUA 1A7PH 3QZOA 1L3NA 5C0CA 5ISZD 4OQTA 3IBEA 1GZPB 2EEDA 4N5ED 2VDMB 4GH7B 4F8TA 4JR9L 4KFMA 4R97B 3WIHH 4C58B 5HHQA 4NRYA 4XE0A 4GS7C 1IJNA 3A6CL 3T0WA 2DMGA 1TO4A 4J2XA 5TD4A 4HC1H 3IN0A 3EAKA 4WEBL 5D5MF 3UP1A 4MA8L 1JERA 4DIXA 1JZ8A 2OZNA 1ZT7A 5CGTA 5C2BH 3OR7A 4LCWE 1I7ZA 3UEZA 4F7MB 4DAGL 3IJ9A 4PMFA 4M03A 3BVNB 3EYQD 1H3XA 5IQNA 2ED6A 4IYKA 2Z4QA 3NIGB 3BDYH 4WFGE 1JK9B 4M5TA 5HDWA 4N3TA 4P3CL 5TE7L 4HG4J 1EV2E 2UWEB 3GM8A 4FTVD 4LQFH 2P8PA 1JZGA 4R26L 3QH3B 1MXDA 3WNPA 2K6ZA 4ZD3H 4PP2A 1MPAL 1DVZA 2Y06L 3SPVB 5KVDH 5DJAB 3H9YA 3S3CB 4DGWC 1JWMB 4PGDA 2Z0UA 1WZMA 2BVUA 3EZJB 5EZLB 3DA0A 1EA9C 3KWWB 4X80H 4DPBX 4EZMA 3BSZL 1YCSA 2WKGA 3I9GL 2CUMA 1PW3A 1EFXD 3LXAA 4ZFFA 3TASA 4YEFA 3AU1A 2Z35B 3IRPX 3PE9A 3QWQB 3S5LG 4DGIH 3UPCA 3BPNB 2WXLA 2B0SL 4XBMA 4ZX6A 1JV2A 1E4XI 3C2AH 3IAGC 3KJ4C 2IDTA 3G5ZB 4K3EH 5BV7L 1JNLH 4KHTL 2QKIB 2BRQA 1R34A 1IC5H 4U6HA 4NPYB 2RJMA 3TWYA 3NAAL 5LBSL 1X5GA 5J5EA 2WD0A 2ALWA 1L6PA 1PQZA 2YA1A 1A0QH 1EEYA 1GY1A 3PQYD 1TQCC 2M2DA 3D12B 1KJ2B 2WTRB 5F7AA 1SEBB 5I8OL 3S3DB 1DBAH 3N2JA 3QR1A 4D9QE 1VGKB 4OGYH 2C5DC 4WV1B 5FK9A 5JXED 1A6TA 3SE4A 4JRYE 2AKRA 4GIPD 4PI2A 2B4CC 4I1RA 1EO7A 4APQB 2CHZA 4V11A 4JO2L 5FUOL 1GGBL 3QQ3A 2ZP0T 1NFKA 1LO2H 3F5WB 1O6VA 2ARWA 1PLGH 1FIGH 2KC0A 3QO0B 3PAUA 4XVTH 1U8PA 4G8GE 2BZCA 1ZE3C 4PJGA 4EDXB 2E7CA 4M61B 1AD9A 4JJ5B 3RWEA 2Q6WA 1OAYH 4GMSL 3V4VH 1FFRA 1GKOA 4IGBD 3U0TA 5KW9H 1JYXA 4KQ0A 2XFGB 4B50A 4WW1A 4YHPA 1MI5A 4QJ5B 3MN8A 5DJDA 2DLHA 2J1ZA 1OGAA 3LVEA 2DM2A 1JK8B 1NOFA 4XMUA 1U42A 4ALAC 1NBYB 1ND0B 1BXXA 1GGTA 3B5HA 2WQWA 2WLIA 2X2JA 4KWUA 4OY9A 1BIIB 3P4OB 1XXFC 3D2UB 3W56A 3SY6A 4NT6A 5HI4D 1Q0EA 2R15A 2XG4A 3MX0B 4FNLL 5FYLE 2P4AB 2E8ZA 3TBVA 4BRJA 4G7VL 4YX2L 3QARA 2WWMD 2BCKB 4GW1B 1B9KA 3CK0H 3E80A 4NHUA 4Z7WA 1E5BA 2JKXA 1LEKA 4PRDA 2IC2A 4HP5A 1IGYA 1TLMA 3WKML 2LQRA 5TPWL 3BPCB 1QWUA 3V9CA 1GSMA 2FGZA 2VDNB 2YBGA 4Z23A 3NK4A 4XVJH 2YK1L 4WI0B 4PTTB 2AXGB 5E8DH 2K9UA 4RAHA 1RZ7L 4DP7X 5IW6A 4JN1L 4P4KA 1FZOB 3QXAA 4XMKH 4ZMPA 1ET8A 2ADFL 4WAFA 4HDIA 4YE4H 2VLLB 4OD3H 4HU8A 5JHDA 1U3JA 5I19H 1EAOA 2PPAA 2DI7A 1ZWIB 4X6DB 1BWMA 3IJ8A 3MLRL 3NH7L 2VDKL 5MEOB 3IU3B 3KPRA 1GJWA 3Q5YA 2G3ZA 4LSPL 5HGAA 2GSIA 5A7BA 3S96A 4ZO6A 4Y2DA 1ECYA 4H8QA 2AZUA 4JMXA 3AACA 3F7RA 3MOAL 4E9VA 4MVBC 1N0XH 3MV11 5ITFB 4KXBA 3GDBA 4TQHA 1S5HA 2WMPB 1JRHI 2ZSVB 5FO7B 3N0PB 1EJFA 4XXWC 2QQLL 4P5RA 3O41B 3PWPB 4XRCB 4LVHC 4JQXC 4L37A 5DA0B 4JFUA 3SJVB 4KKBD 3FUDA 5CSGA 3ZDZB 3GSXA 4K3JL 3I02B 1F3DH 4MNQB 2YD7A 4GKOA 3F12A 3N91A 4FZ8H 3VXPA 5I15L 5AZ2L 3IXTA 4M5YL 4BA8A 3FQ2A 3VX1A 1KIPA 3HE7D 2OMVB 4RAUA 5DHEA 3WNJA 4QRPB 5T5NF 5KSBF 1IARB 4OIAA 1QO3A 1YEJH 1HQ4B 3M1CA 1R3IL 3NSCA 2V2XB 3VM5A 4A2DA 5I9QC 4UIKH 3VFTB 1VLXA 1AY1H 1EAJA 2HUHA 1T2XA 3OKKB 4ATWA 4H7VA 1J9SA 2D0GA 5LBGA 5D1QE 2FJHB 4JY6A 3Q3GA 1AXSA 3UJIH 3BSZA 2EEAA 4QMEA 1B4TA 3EO9H 4JFFB 4LLDB 5CF3A 2ENSA 2P48B 3ZR5A 3QIWD 1PF3A 4W9EC 2PXYB 2XZCH 1W91A 3R06B 5DTFB 5KYYA 3QQ9D 4UAOC 1H15B 4N20A 3WL9A 4WW2C 4YR6B 1TTGA 2AJUH 4X4YB 1VFMA 4HW6A 1NIFA 4I3RH 5LBSA 5PAZA 3U4BH 3HG5A 4PY8J 3C12A 2Q7YA 3N06B 4C8XA 2R29L 4OZHB 4JG0L 3DHJA 4R0LA 1KG0A 3QE5A 3TX4A 3GS4A 4GXUN 4KROC 4PJAE 2QDVA 4P9HL 1FAIH 1YO4A 5FA4B 2WVVA 4HS8H 1A6VL 4XP1L 5D9SB 2JH2A 4GQ9H 4NM8H 3MRQA 4GY4A 5IEKB 5DUJA 1BAFH 3OHXB 3BGAA 2B15A 1FP5A 1D2PA 1JHLH 3G6JA 4ELMA 2EILB 3B2DC 1ROCA 3HZVA 3ME0A 3MMEB 4LCUA 2V5TA 3DPBA 4FXKA 3KPLB 3AMKA 3KZ8A 3E6HB 5BUAA 4WI9A 4Y9BA 3F7VB 1CE6B 1VGEH 1FDLH 3VMPA 3OSKA 4XBEL 1DJZA 5ESVA 3SE8H 1SBSH 2G2RB 3OX8A 4X8GA 1NINA 1S3KH 3FUMA 2DH3A 4FFVD 1G9NL 4K5NA 3EJJX 4OLUL 4XMTA 1FL5B 5ABDE 1IGMH 3BUQA 3HG2A 4YPGA 1O6TA 4KMTL 4BELD 1J8SA 5JOFB 4GQZA 3DGDA 3M86A 4QO1B 3PY9A 1VKXA 1E4HA 4XMVA 2X28A 4BQ9A 3MGTB 2PYEE 2B16A 5C0IB 1A2YA 2B3RA 4B3VA 1JGLL 4Z95H 2XG5B 5DRZB 3NSFA 2P44B 5IEHA 1HXYB 1I9IL 2VOTA 2JJTA 1MF2L 3T65B 3LPFA 5HD8C 3P30L 5JHDD 3FDWA 4PV8B 5F8QC 3PWNA 1MQKH 3VXME 1QSEE 3MLSL 3MA9H 4PS4L 2XWBA 1G84A 2NXZB 4TQIA 4ZFZA 3VWKB 5CMAA 2OMTB 3EOAB 3HBQA 5E6RB 3IE9A 3S4SG 1UB6B 4MJIB 5GSRA 1XGRA 2H5UA 1QA9A 3BZ5A 4KPHH 3NSYA 4XOCA 1FA4A 2J5LB 1QLRA 3HAEA 4WFED 3IJSB 2JKJA 3APDA 3RWIB 4IIQC 1E6OH 4UILH 3SCMB 5GRZA 1CCZA 2Z91B 1EIBA 3ULUE 4MKMA 1U0QA 3RDTC 1U91A 5H37G 4YZWA 5FW7A 2VMJA 3VFRA 5IVNA 1OHZA 3TLRA 1MH5A 1WBXA 5C0AE 1J87A 3LN5B 5J1SC 3LV3B 1UENA 1JHKL 1QWHA 1TQBB 1EZUA 1KN2H 1C1EL 1KTKE 1NBCA 2NSQA 3JUYA 3WHE0 1Y18B 1T5WB 2XN0A 3GJEB 1EXUA 1MEXL 3G6AB 1JHTA 2OTPA 4HOWA 2EDBA 3S5ZA 2GBUA 4S2SA 4ZI8A 4IRSC 3K7UA 1ZV5A 2MOGA 1XSOA 1MJ8H 1E65A 4AEIH 3MNVB 2WK2A 5F0PB 2P45B 3NCWA 2JJUA 4Y4HC 1SXAA 4JUTA 1PYWA 4BCYA 4DP4X 5E2WH 1LE9B 1S7RB 3L9RB 5KJ4A 3TPKA 2WQ8A 3MBWB 5IESH 3CFIC 4TVPH 1T1WB 3L2MA 1OP3K 3GS0A 3V0EA 2VH5L 4Z7QB 4YBQC 5AOZA 3QIBA 4PS7A 5C07A 2E5EA 2GK2A 2AJYL 2BVOA 2A6IB 1WK0A 2DWTA 3EH5B 4G5ZL 4RA3A 5IOPB 3CMOL 3NEEA 2Y7QA 1DEEB 2P46B 3B9KD 3TL5A 4GNKB 4GRMB 1D5IH 4EN3A 2CGYA 3VGGA 1IGCH 5DJXB 1EJ8A 1V7NH 1YEIH 2E0PA 3E3QC 3F2LA 5CEXA 2CO6B 2R23B 4NZ8A 1UM6H 4GKZB 1ASPA 4YSOA 2A4CA 1E8ZA 5F7EH 2N0MA 1XSJA 2BM3A 5E6YA 1OCWL 5G4OA 5BZWA 1F11B 3ALPA 4ONFL 2F5AH 4GBXD 3OKOA 4LASH 4F91B 4Y4FB 1QWNA 3MXVL 2DDQH 1XL4A 3K74B 3ARBD 1BV8A 3BAKA 5E6IB 4XP5H 4KVCL 2DQJL 3ZMNA 2QBWA 2R29A 2WIIB 1FBIL 3EYUH 3QUHA 4PWEA 3UTZA 1X5IA 3GNML 2DQCL 3F00A 1IT9H 4HK3J 1GYUA 5A2JH 2DEWX 1R3JB 4LHUA 4ELKB 1AOHA 1DFBL 3VG0L 4CNIA 4Y8AA 2R4SL 2B59B 4D0DA 4LKXB 5HHNA 3WUZA 1K2DA 5I2IA 1I7RA 3FQYA 1C5DB 1P4UA 1LWJA 4JGJA 1OK8A 4F7EB 1MNUL 3F04A 4G2AA 4A55A 5JORB 3L08A 4CC4A 4NM4L 3CVHH 4L4TE 5MHSD 4HUCA 5D8JH 3KPNB 3MV9B 3MJ7A 5DJ2A 1O7SA 4YH6A 5DHYB 3U82B 4BXVA 2COQA 5KVFE 4BFJA 3GLEA 3ZKMC 2XPZA 1D5MA 2KZBA 3II3A 1FO0L 3DURA 5KYWB 4MZ3A 1DSWA 2IFFL 1F4YL 4V2CB 4WO0A 3WEAA 1M7DB 5DD6B 4YO0B 3VNZA 4WIQA 4F9PA 5J13C 3NRQA 3D6GA 3AS1A 2PR9A 4JKWA 1DLFL 5E8NA 4RQQA 1MDAA 4K15A 1U58A 2GJZB 3NYKA 3SGDH 4XAKE 1V3MA 3VTMA 1R24A 1A7QL 3DUUB 3FFCB 3DUSB 4HZ1A 4M7LH 1C8QA 4N5EC 4RMVA 3S36L 2LR4A 3P9MA 5EU4A 4HKBA 1K4CA 3ARDA 4L4JA 1NGWB 4P23A 4PJ5A 5FCUH 5SWZE 1K6QH 5AKSA 3FQUB 3OG6B 4DPRA 5DDHA 4EUPH 1EHLL 4KZEL 4AUUA 1IBBA 4PJHE 1H3PL 2CRYA 2L7QA 1D5XA 5KSVB 4Z7UE 4D0CA 3L13A 1ZY9A 4H25B 5KANI 1U8CB 5D1QA 1L7TL 3QC6X 5B8CB 2XVBA 4YBLC 2OPCA 4C47A 1I1AA 2E27H 2LAGB 3HG1B 2KUTA 3DVIA 4YUEL 1GOHA 2Y7NA 1A6ZA 4N24A 5F7NC 1LWHA 1WZKA 3CLEH 3CG8A 4NUQA 3HCVB 3W5NA 3LEYL 4U1MB 2AI0H 3WKPA 4L1SA 2WXMA 3Q8EA 3DECA 3EJRA 4WEUD 4UNTA 5DI8B 4PYGA 1IVLA 2BP0B 3ECBB 4UBDD 3WBDA 2ODIA 1JFQH 2OMBA 3DX9A 3R8QA 1T04A 3HZYA 1F00I 2GJ6A 3NACH 3TBWA 3PHAA 2W65B 2B08A 4YWGH 2EH8H 3X13B 3EJQA 2YIHA 4N0CC 4IQHA 3JTBA 3SIKA 4Q2ZA 5I30L 4HUVB 1EEQA 1J88A 5FUZL 1WD9A 3NIDB 3KMDA 3GINA 3OR6B 5FHBL 3H9SE 2CDEB 1BG9A 2XN9D 5KG9B 3QO1B 3PRZA 2YRBA 1ZD6A 2XI9A 4Y19E 4Z7NF 5HVFB 4KZCA 3T0DA 4BQCA 5I1AB 3ZZ1A 4NKMA 5L88H 3FHAA 5JXEC 3OC5A 3HPLB 2VDRB 4LARL 4P2RB 4P2QD 3AY4A 4YDMA 3SYCA 4HIEB 4KK8D 2YKKA 4PW3A 3WFBH 3FQTB 2XZQL 4EZLA 2PO6B 1R0AL 1JSYA 5C6PB 1Z0NA 1ZVSB 1W6LA 2ZONA 2X2YA 4XPAL 3INUH 1JYWA 1T21B 1BFOB 5C0BB 1Y0LB 2BHUA 3QPXL 3L1GA 3KLQA 1AZUA 5DLMH 1ZPUA 2F54D 2XV0A 4HCFA 1OALA 4FFZH 3BHBA 4FL4C 3ILPA 2EVJA 2OZ4L 2ZOKA 1NUDA 3BZ4A 3JYBA 3QPQD 2V2TB 4PJFE 4DQOH 4GAJL 5C7XL 1S7XB 5FKPA 5IJVB 4IGBC 4K23L 7CGTA 3BRGC 1KLUB 5E9AA 4ES9A 1H8OA 4NKIL 4F57L 5I18L 4RISL 2Y72A 2E6JA 1BF8A 4HJUA 2NRDA 3ARFA 3HPJB 1KEMH 3L5JA 4ZYKA 1IM3B 4AQ1A 2GABA 3EFFB 4OBSA 2D7NA 3GHBL 3CXFA 4YIQA 1W8OA 1Y7VA 3U2JA 5JW5A 3P1VA 1LL1A 1RUKL 2JWYA 2NCMA 3HE6B 3PFQA 1V7ML 2HVBA 3SQBB 1YEGH 5HI4C 3THMH 4F27A 2UVEA 4N2AA 2FL5B 3VFNA 5D1XD 5LAXB 1UHVA 4WU7B 3I6LE 2WWMC 1CU4L 4QTFA 4BIKA 2WLLA 2IPKB 5LXGH 1ZSDA 4Z9KB 5TFSL 5BW7C 2KS0A 1U21A 2GIYA 2BVEA 4UDUA 4ZPTA 5KVGH 4JO3L 3BEVB 1JXJA 5AVXB 3LZPA 3QP3A 3R1GL 1WUZA 3OJVC 5INDB 2F1EA 4XXDA 5E51A 4GRWE 4YHZL 1DQQB 2AK1H 4DGVL 3FFDA 3VH8G 1DQDL 3DDFA 5DD3L 4LP4A 2XTSA 5TQ0L 3UAEA 1XIWA 1CD8A 2YN5A 4HKZB 6FABL 1J5CA 2NT0A 5SV4A 1VFBA 4MXWL 1F3JB 4N2FA 1HSAB 4Y2NA 4OCSH 5A2KH 5I6MA 3DI3B 1FO0A 3HZMB 4FQQB 4RDQG 4A7UA 3SDDB 4FNRA 3TJHD 3QG7L 2H3NA 4NCC1 3CU7A 4KO5A 4B9KC 2JK5B 3E9TA 1WSST 1K72A 2X5PA 3ARXA 4PGBB 3U30C 2MPAH 3UP6A 4ZAKC 3C5ZC 2FWUA 2OYPA 1K85A 4WHYH 5DVLA 1C8PA 1RZFH 1FNEB 4D9LL 3QUYA 4N2EA 4CN1A 4S1QH 2BSEA 1J8HD 2YD5A 2NR6D 1F0LA 1GS6X 1CE1H 3IDUA 3O6ML 1HSBA 1NSNH 3HN8A 3VM7A 5GGTH 2FHCA 4J4PD 1NCUA 4NQSA 1DE4A 5EOCH 3QFJD 3DTXB 4AITA 4PV9A 5I1JL 2HUEA 2WGNB 2P42B 3HE7C 3TV3H 4AXWA 4BFNA 1D9KA 1R5IA 4OZFG 4XHJC 5CXPA 2W92A 4AIZB 2JMRA 4UTAL 4CADA 5IQ7H 1HOEA 4J3UA 4XNQA 3N1PC 2A73A 3LQAH 1BVNP 3V6FB 1U3HC 3NQKA 4HJJH 4RDBA 4RRPG 2BIIA 2XKUA 1IBHA 2I26N 3IGAA 2XICA 1YEHH 2CBPA 3RTQD 1BFVL 2FWOA 3LPPA 3TBTA 4UB0L 1AZCA 3D51A 4OSUL 3UZEC 4DKTA 5L0QC 2Z31B 3OTTA 5IROD 2YAEA 1ORQB 3HS0C 3ARZA 2CO7B 2GAZB 3Q1SL 4HIJA 3RB7A 5CCKL 2OMZB 5ENWA 5GZNC 4KRMB 5LGJB 4X7SH 1Z5YD 3DI2B 2WZPD 2M1KA 4JDZA 3VA6A 3WY3A 3QQ9C 3M8OH 4Q6KA 3N42F 1T6VN 1JAEA 3L5XH 4UT6H 2F7IA 4K5PA 1E0OB 4NUGL 3AY2A 4JZJA 5EN2B 3WLBA 2X9XA 2EO7A 2EXYD 3GYRA 3VI4E 5E03A 1LP9F 2F7QA 1SF3A 2CPCA 3GZOA 1CICD 4NWUL 5F7UA 4LAJH 1XCWA 2GC7C 3RA7H 4R2GB 2ZXEB 3UZVB 2Y23A 2QTVA 2EE0A 3QWOA 4FQIH 3KBHE 4K7FB 3AXLA 4L4TA 5B39B 5GRUH 1XHHA 5DK3A 4ODXA 4KUCF 3S8GB 3EGDB 5ACMA 4A7TA 4MMZB 4DP8X 1BIHA 1A4AA 1BDYA 3B5TA 3FT0A 4TKWA 2BOBB 4OW6A 3SDCA 2WXJA 2SODB 1URZA 3QXUA 4JHZA 2PW2B 2ORBH 3W0WE 1GYAA 2N4IA 5SWSD 2OZ4A 2V9QA 3E8UL 3WV0A 4YHYC 4RESB 3OKLA 4NCC2 5F44A 1FJ1A 2VRKA 1LDPL 5T1KD 1SLVA 3U0WL 1X6LA 5D2LE 3NRPA 1JGDB 2Z92B 4XP9H 5EN3A 1KFAH 3TIDB 1G7PA 4A68A 2C3WA 1MG2C 1N12A 2Q3AA 1MHCB 1W80A 2OSLB 4PJHA 3S2CA 4WFHE 4MMYA 5EBWA 2MCG1 5KWYC 2X3CA 3GSWB 5CJXC 4NQED 4YLCA 1EFQA 3WKYA 1QPXA 4ETYA 1FGVH 4HCRH 1Q1PA 4UT7L 4JFEB 5DWUH 1KDIA 2V0AA 1W2KT 2P5EA 4FS0A 3RB5A 1NMBH 5E9DE 2DV6A 3H3BC 5JPNB 2VE6B 5EOQL 3DBXB 2R2BA 4P46A 3D39B 1KCSL 4R83A 3WIAA 1IEBA 3MDJA 1WA0X 5IOKA 2BP8B 3CH1A 1RZJC 3OMNB 3QXWA 2MRYA 3GI8L 5JZ7D 2QV4A 4PTUB 5EUOE 3W39A 1M6UA 1UKTA 4MDRA 3VXRD 5EU3B 2R59A 5FKAA 3A67L 4OZGE 4JGUA 1HX0A 1A4KA 3VRJB 1RK1B 1MAML 3FB5B 2FGWH 4HGKC 1P7HL 4UNIA 3RZCA 3ROLA 2ZSWB 4U2ZA 1M7UA 3H9SA 1F3DJ 3SQOH 3H1ZA 1WC7B 5AVYB 1OP5H 3WTVA 3FU7A 3J07A 4Y19A 1X4YA 3R0MA 1GCFA 4GOSA 5IB3B 1ET5A 1SBBA 1UD8A 3TFBA 4JM4L 4JM2A 5A16B 5IB5B 5IQ9B 1KGYE 1OD9A 3S6CA 2B4CL 3BMWA 1JL8A 1GHFL 3GRBA 3WS6C 3L3KB 1E27A 2EDDA 4IRJB 2AJ3A 1I8KA 1RZ8B 1AVAA 2EDXA 3O6LL 1QAWA 2HVJB 3H4FA 2D7TL 2DPKA 4F58L 4HJ1A 5B38B 5CBAB 1MJ7H 4HH9B 4HSCX 3N04A 1MWAH 3GJFB 4JVPA 2X89A 1FI8C 4F7CB 3CVDA 4ES8A 5I76B 4R3SA 4BH8A 3BD5A 1TTUA 1BZOA 3ATAA 3CN4A 4BK8A 2KPNA 1YEKL 3T1WA 2UXFA 4UTAA 3QA3B 1NC4A 2XBTA 3QT2A 5ANHA 5L4IA 4YDIL 4NN5C 4BFIA 4NQCB 1A9BB 4YHNB 5I8EA 3K0YA 4XMWA 2D31B 3UG3A 2CD0A 3X1EA 4JPKH 2VAAA 4ALAL 1Y6NR 4QUOA 2AQTA 3ZE2F 1DSFH 3ESNA 4OJDH 1IEAA 1KXHA 1A5FL 2J8UA 1VZHA 5HVHB 1X5XA 3K4DA 3BQUA 3TOPA 4KY1H 5HHVH 3QYMA 5CINH 3ZTCC 4A67A 3GQFA 2GK0A 4L29B 2YMXL 1TZGH 1LXMA 1DQLH 2P5PA 4GBXC 1RMFH 4AZUA 3RDJA 4NDMA 1QR1B 1HILA 1JPFA 4NJAL 1C16A 3ARBC 3LYRA 3KE0A 3DTDA 1QFWI 2QJDA 5FYKL 1ZTXH 2VL5A 4IBVA 1HEHC 3ZDYB 2NY1D 2VZ3A 4HUWB 4AZ8A 5J8OA 4FABH 4KHXL 4F7TA 4YDVB 1FE8H 3LKPA 2X4NA 1PD6A 3MRPA 3U36A 1GOGA 2CLRB 4MD5A 4OLWL 1ZK5A 5ID1B 1RJYB 4CVZA 2F19L 4MNHB 1RIHH 3LZFL 5KBDA 1DFXA 2OM5A 2ITCA 2Z93B 1F86A 5DUBA 2JKSA 1Q1JL 5J1AB 3DROA 3I6KB 4R4FL 6CGTA 4LL9A 4Q74A 1EAPA 2VDLH 2EXWD 3POHA 3TCTA 1CGUA 3MRBA 4Z7OF 1XGQB 3I84A 3UTPE 5I74B 3X1GA 2X0VA 1VADA 2BC4A 2HRHA 2J12B 4HX1B 4PVBA 2BXZA 5ANME 2YPKB 4L0PB 4KGJA 4DZ8B 2X42A 1HE8A 3U4EA 2R1YA 5CJ5A 3VGBA 1XSKA 3NZ8A 4KTDL 4I4WB 5F21B 1TCRB 5F72S 1JGIA 1TNNA 5JDSA 5E0FA 1R5VA 2CMRH 1FCCA 1QABA 4CJ1A 3RU8H 2WUCH 3GSNH 4TN9A 5CZKA 1RZKC 2GHWB 1J9QA 4ANXA 4OLZL 3P11H 5C0CB 1TTFA 2OSXA 7PCYA 1NFDF 3RILA 1MFNA 1U8OA 5HHQB 5FLUA 1YJDC 3AFLA 4FQJH 4NRYB 1AIZA 2R9HD 3DSNA 3R7QA 5DMJB 1YN6A 2NTFA 2CK2A 2FX9H 5C1MB 1ZT7B 2NNCA 4JJOA 3GJFK 1NQBA 3OR7B 3ATFA 1I7ZB 4CW1A 5INCA 4DWHA 4XC1H 4MDJB 3SKOA 2JCCF 4F15C 4ODUA 4FQXD 3ZR6A 1E4WL 2Z4QB 4PRHA 3SE3C 3CLWA 4OCXL 1QUNB 4S1DD 4MHHG 5B1AB 1B88A 2WBJA 3QHTC 3CQPA 4JKKA 2P8PB 1RH8A 2I25N 2WW8A 3WO4B 3OAUL 4PP2B 5ABAA 1M1XA 3NZHH 3OC8A 2FT7A 4FJ6A 4HGWA 5GS2H 4WI3A 3NK3A 4IBWA 4PGDB 3AITA 2NNFA 3QQNA 1KXVC 1PGRB 1RK7A 3UYRL 2CJTA 3QQ4A 3PGFH 4LAQH 2XX0A 2FB4H 4Z0BL 3BCFA 1JZFA 4ZFFB 2APSA 35C8L 3AU1B 3T8XA 4JANB 5HI5D 3UCQA 4Z3JA 3V6BR 4DESA 5J0BA 1I9RL 1IVTA 2V37A 4M5ZH 1JV2B 4QRUA 4TNVF 4XCFH 3REWA 5CSZA 3COOA 1TJGH 3SKJH 7PAZA 1RFDL 3HJ0A 2GUYA 4M48L 2HLAA 1GZQA 2C1PA 1MOEA 1RK0A 2VDOB 4U6HB 1OV8A 1PQZB 3A5VA 4JX0A 2MCAA 3VQLA 1EEYB 2WXQA 2BIMA 1RSFA 3W0WA 1DJIA 1M42A 5FK9B 1A6TB 3QXDA 2AKRB 4N1EA 3B3IA 3BWAA 1JZDC 1CL7I 2FAUA 1FRGL 2BSBA 3QQ3B 5I1HH 4TUJA 1N64H 4FULA 1FGNH 4ZFGH 5D2LA 1T20A 3AUVA 3MRJA 1QLEB 2EKSA 1A14L 2OI9C 3H4HA 3QPQC 4DHLA 4PJGB 2KZWA 4X8XA 1OM9A 1AD9B 2IDUA 5J57B 3RWEB 5HHOA 2Q6WB 4PG2C 3UTTA 4OIFA 2E9BA 4UQ3A 2W9DH 3U0TB 3WMQA 3R4DA 3OAWA 4FLQA 4WW1B 3KDMA 3QXVA 1UD3A 4YHPB 1MI5B 2ED9A 2WP3O 4NNYA 5DJDB 2ESVE 2VDMH 1OGAB 4RCAA 3N41B 3SBWC 4BGDA 4N1CA 4TSBH 3TIEA 3C8KA 3GXUB 5KTEL 3ZYZA 4G5AA 4S0SD 2WLIB 1NM9A 3NIGF 2XRAL 3FF7A 1B0GA 1CUOA 1TVDA 3S48A 4YHIA 1WFOA 2X40A 4WSGA 2UWEF 4NT6B 4JRXE 43C9A 2XG4B 1ZVHA 2H0FA 1MHPH 1NLBH 3GTNA 3JSSA 4UF7C 3TBVB 5I1LA 2YD0A 4ANWA 1PLBA 4OJCA 2WKOA 3RX9A 4PBDA 1S7QA 4ONGH 4NHUB 1ID2A 4F1ZA 4POYA 4Z7WB 5IUCA 1LEKB 1SQMA 4OZGA 4PRDB 3TYFA 1ZANL 5KBNC 1IGYB 5HYSA 5IT2H 2ED8A 1K8DA 5DMGC 3ZDXB 2VXSH 1ESOA 2LU7A 2YUZA 1N59A 1YMMA 3IFLL 5D6DC 3QDGD 5M7QA 1Z9MA 4G6ML 5AUMA 3CFKA 5IW6B 5HDQL 4MA7L 2OXHA 2J3SA 4P4KB 1BBDL 3BP6A 3QXAB 5I6XB 1S9WA 2RBLA 1MCFA 2BERA 4HDIB 4RGOL 4HJTA 3KPPA 4KK6C 1JPSH 1RURL 2F9BT 1F6AA 3AG3B 4LMQE 3TVMD 4B3EA 3WXVL 3TJHC 4OGAD 3KPRB 4NC0B 4XXWA 5HPMA 5HGAB 2GSIB 1CLZL 3VFVA 2XJKA 4JQXA 3S96B 5AYTA 4Y2DB 5IJKC 2O6EA 5GRVL 2WB7A 1NCDH 3H7BB 1Z7JA 4ODSH 1QQDA 3U1SH 4UV7L 1BLNA 5GGRB 1TXKA 2OXGA 4NWTH 2OMNA 1KJ2H 4WJ5A 1FSKB 1KENL 1S5HB 2CO3A 4R4BA 3S37X 2EIEA 4AMXA 2YQBA 4WF7A 2NR6C 5I6OA 1U8NA 4L37B 1LQSR 2QQNL 3EIFA 5BUPA 3VXSA 3GSXB 1LK3L 4J4PC 3D2TA 3FH7A 1KCLA 3F12B 5FGSA 3MKGA 3VXPB 4OCYL 4Z3EA 5MENE 3IXTB 3TESA 25C8L 4ACPA 1LEIA 5TF1H 1USQA 2Z8SA 4Y7MA 3T6ZA 1D5RA 1KUMA 1U8HA 3U25A 1KIPB 3TYGH 1AKPA 3RX7A 2ZYSA 3ZU8A 4RAUB 1QPPA 4NP4L 4OM0L 4ZUVA 3MREA 1QO3B 2IPUG 3PAYA 3D30A 2WLNA 3MBED 1MDTA 4WGVB 4H8WH 3RTQC 4L1LA 2DLGA 1AC0A 2DQTH 1OCCB 5IROC 3I9IA 4P5KA 2QSCH 2CGRL 1NGZA 3FS9A 3Q3GB 1AXSB 3CZUB 4JY6B 4WW2A 2W8CA 2X44D 2IWKA 1I7UA 3O6KH 4S1RL 3UBXG 4KXAA 4O00A 4MGXA 5HHMB 5J9PA 3AMLA 2WUBH 5KYYB 2H6UA 4U1NA 3IDYB 5A40E 2AMUA 5F7FA 2O5ZH 5FYKU 5HYQA 2R4RH 3WL9B 1JPTH 5BV7B 3WIIL 1CICC 4XAWL 1IL1A 3CVIH 3CIAA 4ZDHA 3NJXA 4P5SA 5IHUH 3CFCL 2DQMA 5F9OL 5EFIA 2A6KA 2Q7YB 4LLVA 4D0BA 1MVYA 2VDNH 1KG0B 4R0LB 1NM4A 5IMKA 5C09D 1B6DA 4R7VA 4YHOH 5HJ3A 3ARTA 5F7MC 3FUJA 5ECGA 4NBZB 2D73A 4XPBL 2WVVB 4TVPD 3QJZA 1PEWA 4X6DF 1PD0A 4UV4L 4HS3B 4EOWH 4QHNA 3DKHA 4MKTA 1M57B 3MRQB 1NFAA 2VLKE 2DOCA 1WH0A 1UWFA 3LS5H 3WNOA 4U6VH 3G6JB 1ET7A 2YHGA 3KPOA 4ELMB 2NY4B 2WBWB 3PGCA 3HZVB 4XTRD 5HP5A 4HF5L 3ME0B 5EO0A 5BZXA 3RHWK 4LCUB 4NBXB 4LPVA 5HBBA 3DPBB 3A6BH 4FXKB 5FM4A 1X7QA 4MQSB 1GGIH 4GI8A 2NNAA 4LSVL 1GGYA 2WLZA 3ARYA 3MCKA 4M62H 4WWKC 2UY7A 3GBMH 3ZDZF 5ESVB 1F97A 3OX8B 4S1SH 1KN4L 4EI0A 4X9FA 4YSRA 2WOYA 4LPTA 1YY9C 3QEGL 4N0FA 4I0PD 1AS6A 2WXHA 3LH2L 4YPGB 2NDFA 4ZMXA 2AC0A 1JE6A 3FAXA 3EOTL 1HWWA 2NCEA 1JZJA 4OLEA 1VKXB 1SMOA 1S9KC 4GUQA 5LKNA 2OR9H 1A2YB 2G30A 1I3GL 3VG9B 3H85A 2VT0A 2GB2A 4CMHB 5LGHL 1MFAH 1MREH 4IIQA 4K5MA 1ANUA 3PWNB 1G9HA 3NTCL 5JZ7C 5JMRA 4E5XG 2LFGA 2XWBB 1HWGB 5CU9A 4ZFZB 3WMSA 4MDIA 5CMAB 5C3LD 3L6FA 1NKOA 3RDTA 3V9FA 5GSRB 4YS4A 1QA9B 5EBGA 3QDMA 5HYJE 3KH3A 2KHAA 2NY6C 4ESKA 1QLRB 3HAEB 2N0KA 1WV7T 3PYCA 4OQ1A 3VXUA 1D6VL 4F8PA 2FR4B 1PZ3A 4GMTL 4N8CH 5EEZA 2CCLA 2LE9A 5DRXB 15C8L 2LOEA 2A9DA 2PP8A 2VDKB 1U91B 4H44C 4L1BA 3EGXA 3D9AL 5EOCJ 3CIQA 1AXTH 5AZEH 2IPTH 1Y07A 3HHRB 4IRSA 4ZSOE 3P0YL 1IBYA 5E4AA 1MH5B 3BISA 1DLHA 1PZCA 1WBXB 4OZHF 2O61A 1YG9A 5HXMA 1GJIA 4IS6A 2DTMH 2DYRB 4Y4HA 4ABUA 1UH2A 1KELL 1MFMA 3I50H 2FBJL 1EO8L 2CAKA 3KG5A 4LCIH 2G9KA 1YEWA 1EXUB 2ZKWA 1JHTB 2AQ3A 5DU7A 2Y7LA 5T1DL 1AKJA 5H37A 4DZBB 4S2SB 3TO4D 2VLME 2C9AA 1TZHA 1DTUA 4KRLB 3OLDA 3TN0C 1SNRA 3BPLC 1II4E 3JTSA 2R56L 3EJZD 1FYTE 1FNFA 1KC5H 1PYWB 3NVQA 1NGXA 4K2UH 4LEEA 4U3XA 4ERSL 4HOZA 2I5YH 1CDUA 1MHHA 3EDEA 1UACL 3FULA 1AS7A 3LS4H 4K7PX 2BSRA 2FECI 1FL3A 4KO9A 3L7FA 2QADB 4L8SC 3QIBB 5C07B 4FG2A 2JFCA 2BVOB 4ANKA 2ESVA 1PY9A 1THCA 3EJSA 4L8BA 2H1XA 3S0PA 1YC8A 3HKFA 5FGRA 4RWYL 2Y7QB 2X09A 3VACA 5LWYH 4EN3B 4C4KO 1QX1A 2IQAA 3KEDA 4PD4K 3EYOA 3II1A 5CEXB 4NQTA 4HJEA 2XY1A 5D7SH 4JRXA 1OO2A 5BZWB 2XA3A 5FO8A 2GIMA 2OKMA 5T3ZH 3BAEH 5TTRA 5EU7C 1N0LA 3VVVA 2ZYRA 4P06A 3FH8A 3OKOB 5IVXE 4OFPA 4A7GF 3EJPA 3SD2A 1INDL 2IG2L 5IFHL 4IRZL 1ES0A 1CD0A 3EDJA 2BFVL 4IKLA 4PJ8D 2I07B 1XX9C 1KJVA 4Q0XL 5AW0B 3HC0A 3UTZB 5E1AA 1SHWA 1PD1A 3H8NA 2HXAA 3L5WA 4LHUB 4Z78A 2HKFH 4CNIB 4ABQA 1N7MH 3B37A 1AO7E 5HHNB 4D0DB 1K2DB 1MFUA 5I2IB 1I7RB 5KJ7E 4KI1A 2ZUQC 1U2CA 1YVLA 4J3VA 1S9XA 4JFOA 2ZUSA 2DQIL 2B20A 3FW6A 2MNWA 2XPGA 1RZIA 3DPDA 5BS0A 3UO1L 1OAXL 3KPSE 1NZRA 3MJ7B 5EWIH 5DJ2B 3BPOB 5CN3A 2IBZX 4QY8A 2AJSL 5I5JA 1D5MB 1R19A 3MXWH 2GJJA 3P0GB 1QLFA 5CJQH 5ISZA 4J3OH 3DURB 1ZOXA 4OLXL 1NCCL 1NGQH 1OOWA 1W72H 3DX2A 5EZPA 3M45A 4MXQD 3Q7JA 4DCQA 2XWDA 1OSPH 3LH9A 2QQKH 3KXFE 3GXNA 5E8NB 4HWNA 4RQQB 2AITA 1U58B 1UA6L 3GRWH 1B4JL 1QSFD 1R24B 5IGXL 2LU4A 3FPYA 1URIA 3QJRB 5MENA 1KY6A 2YS4A 3F58H 3GTTA 3RIAK 4DEUA 4TTGA 3D06A 4KX8A 5EU4B 4HKBB 1K4CB 3ARDB 2R9HC 4NQDE 4P23B 4PJ5B 4Z7QF 4ZOEA 4FTVA 3CE1A 5DDHB 4DOHB 3FO2B 3FONA 4N26A 4DPAX 1MCWW 3O9WD 1MIEL 1D5XB 5FDWA 4FQXC 2DLFH 2XN2A 3QCVL 5D1QB 1R33A 3GO1L 4S1DC 4FKEA 4TPRH 3FK3A 1I1AB 5D4QA 1EFXA 4QHMA 1O5PA 3OF6D 3TT1H 1A6WH 2HYMA 1A6ZB 1IFRA 3T3MB 4YSQA 1GW0A 1TZOA 2E86A 4Q4EA 3VMOA 2XQBH 4OJFL 1MFEH 3RJDA 3X3FH 5ID0A 3UBHA 1WRFA 2HTLD 3MLXH 1CF8L 3BW9A 3L16A 1J12A 1AQKH 5CD3A 3V4PL 1CDJA 2O93L 2EDWA 1G0XA 4TULL 2ALAA 4JPQA 1GAFH 3HC3L 2YOAA 5JO5A 1UA7A 4UDTA 3DX9B 2K4AA 2PTVA 4LIQL 1MZZA 3HZYB 4ZUWA 4I9WE 3PQYA 2GJ6B 3EXLA 3TBWB 4U6XA 2Y6SD 3K3QA 4RA0C 5T5NG 4XO3A 4NCDA 4R6UA 5EHFA 4Q2ZB 1LP9E 3AGWA 4PJAB 3RTLA 3BKCL 1CLOH 3GF8A 3Q5OA 2KBGA 4UQEA 2KDGA 3UZQA 3VW3H 1ZTMA 1NC2D 1N2RA 2DTSA 2ZUTA 5C0RH 5C6WH 4HU2A 1UM5L 3ZW3A 4LBEA 3R8BB 2NZ9D 1YYML 4HBCL 2VLKA 2ZOOA 4NKMB 5E4EC 5EDXA 5E5LA 1BMZA 2XCMC 4QPEA 4PWJA 3LKRA 4BKTC 4J23A 3BUPA 4IGBA 3ROOA 1YNKL 1M7IA 2AANA 2I27N 3CFBA 3H42L 1ZGLP 1CFSA 1PG7H 3AVEA 3WCYA 5C9KA 4I3SL 1CS6A 4JREB 4KXZI 2WLJA 5EC2A 5GS3A 1ITBB 5FV2A 4LGRB 1TPXB 1W0YT 3P4MA 1SDYA 3BHBB 2DYPD 3CHQA 3ILPB 2V9UA 2ZOKB 3BZ4B 5IW3A 2ZAGA 1AR1D 4OF3A 5LNEA 4Y16C 5FKPB 4KV5F 2EDJA 5CZRA 2AJVH 1JZ5A 2VSKB 4H4NA 4TL4A 3H0TA 2OL3L 3FUFA 4W9IC 3I3DA 1QFOA 2A1WL 5G4MA 1PAMA 2BJMH 1GPOL 4E41D 3KLKA 1NMAH 3ARFB 4EBQL 4ZYKB 2G75A 1TYJA 2MNJB 3TP4A 1EDYA 2YLHA 3FSWA 4PU2A 4AQ1B 1P84K 4F8QA 4YIQB 5BW7A 3GHEH 2CO1A 5JW5B 1H8NA 4FQ1L 1MSPA 4DUXA 1KCRL 5T5FH 1SFDA 2EE6A 2P7TA 2YMOA 4OV6F 1GTNA 4IRZA 4MCNA 3HTLX 3VXMB 4NO0D 2XY2A 5IG7A 3VFNB 1RZJL 1CF1A 1XMWA 2J2ZA 2F0CA 5T3XH 3AT9A 1COBA 1N5YH 1BGXL 2WLLB 5ICYA 4X5XA 1ZSDB 3R18A 4M5SA 4B7LA 3MOBH 3V0VA 3KBEA 5F89A 4UDUB 2HRPL 4PW4A 4ZPTB 1UYWH 5EU6D 1A1OA 4BSVA 1OOAA 3LEVH 5FUCC 1OAJA 3DX0A 4M00A 4XXDB 2VLJD 1XD0A 3OAZK 4L2YA 4HPOH 3FFDB 4KUCD 2R0LH 4MRBA 1ZVYA 2IF7A 1WLHA 3EYSL 5E94A 1XIWB 4ZSOA 2RCSH 4NN6C 1LD9A 1ZEAH 3EOYG 1OQOA 5BXFA 1E2ZA 1VFBB 5ETUA 4XP6H 3GKZA 4KQ4L 3QDAA 4ZAKA 3C5ZA 3RKDC 1N6QL 3LTVA 1SM3L 4O2CA 4G8AC 3TVMC 3FT1A 4EVNA 1FO0B 1QBAA 4AQOA 4OGAC 2EP6A 3K5RA 4FG6D 2XTJC 1KFGA 4GPVA 2H3NB 3DYOA 2YRLA 3OMIB 1XGYH 2XQYA 1N4XL 4LSSH 3LN4A 1R3HA 3SHSA 5EV7A 4GG6A 1F8TL 1ZMYA 2FRGP 1JZ3A 5DK2A 3LAFA 3MTXA 1FYTA 4ZNEE 4MRCA 1RUQH 4JFHD 1KCKA 1NCOA 3HE7A 3QUYB 2FQFA 5F96H 3SDAD 3N85H 1YLBB 4QWWD 5A2FA 4E9LA 3WDIA 1CT8A 1AGCA 1U3HA 1HSBB 4XVSH 2O5NA 1OAQH 1NICA 2B39A 2PW1A 4R5XA 2RD0A 4NQSB 1DE4B 4JG9A 3S8FB 1UASA 1YN7B 4PV9B 4AXWB 3D0AA 3RX8A 1D9KB 2AVFA 3UZEA 1XTMA 5GGSY 2VZUA 4ODHH 3ZTDC 3JT2A 4N0YL 4MJHA 1SXNA 1S4IA 3DETC 2A73B 3EG9A 4IBYA 4JBSA 4N0UA 4RBPK 4XNQB 5BQ7A 3MBEC 1WO2A 2XC8A 5GZNA 1GYCA 3G3LA 2NUTA 5KAQG 3IGAB 2E3VA 2JB6A 5T33H 3SGJC 3CSFA 3U6XS 2FWOB 3TBTB 2DBLL 2BHYA 3DHMA 4JZNA 3N43B 4OZFA 5IVXA 1WAAF 4HIJB 4XNYH 3OHMB 1GGCL 4O9HH 2Y6TE 2HKHH 2CLVA 5ENWB 3N1GC 3P69A 1JI1A 1ZTXE 4JDZB 4UQ9A 5HHXH 3ZZLA 1T4WA 2D9CA 4EJ1C 2MEJB 3J8F7 4PJ9A 3PHOB 1TU2A 5DRWA 1J5OL 2BNQE 3LNGA 2ADGA 3WLBB 4A66A 2UZXA 2BDNL 2A9NL 1ZIAA 4GT0A 4Y5YC 1J8KA 3B56A 4B9GA 1HIMH 1MCPL 3JWDH 3QWOB 4XNZB 5HSFA 2CGZA 2XIIA 3AXLB 1Z2KA 2OV0A 3OZKA 4L4TB 2UX7A 3PXJA 3AZUA 3KJ6L 2MFNA 4P0DA 1P7BA 1FLRH 3MV8E 4YDKH 4Y1AD 4WSKA 4WCYL 1LQBC 1BSIA 3QK0A 3HC4L 4R7XA 1BJMA 4GSXA 5JOEA 3SDCB 2H2SD 2ID5A 4XTRC 3UMNA 4WNSA 4HJIA 2PABA 1XGPA 2ICWA 5DJYA 2C4XA 4PBWD 3KLHC 1BVZA 1RZKL 5CJXA 4XMPH 1FJ1B 2GKIA 2OL3A 4ZQKA 2ZX6A 5DMIL 1YJDL 1G7PB 1A3RH 4AYSA 2DICA 4JY4A 2W07A 4A2GA 4HBQA 4N25A 1J0JA 4PJHB 3RGBA 4MMYB 5EBWB 2V3DA 1AJ7L 1MRCH 5B1CA 2F53D 4QRRE 3KYKL 4XNXL 1E6JH 1OTUD 2P5EB 3NPSC 1DBJH 3QYCA 2W1NA 5C70A 1LNUA 1FH2A 2DY2A 4HT1H 4KRPB 1YQVL 2X4QB 3P77A 2R2BB 4P46B 1IEBB 1H8SA 4DT2A 4U4IA 3MRIA 3CH1B 1OZUA 3W39B 2IDSA 1YEDA 3MBXL 4ADJA 3UEQA 3T0ED 5ES4B 3P40A 4ZS6D 3NFSH 5FS5A 4P3WA 5FKAB 1H6TA 5HHPA 1A4KB 3DNKA 2IAMD 1TZAA 3RZCB 3ROLB 4TRPH 1GC1C 2A7BA 3H9SB 2KERA 3NDZE 3NJGA 4M9OA 3S34L 5GS0H 1PTZA 3FU7B 4TXVB 3WS6A 1VB9A 1FN4A 1WEJH 2V8MA 2ZWZA 4L4VE 3V0FA 32C2A 4Y19B 4LSUH 3L1EA 4APXB 4ZPVA 3VU2A 4JM2B 2Y3NA 2XV6B 4JL2A 3V6OC 4MZ2A 5ALCH 4FHKA 7FABH 2I60L 5E6ZA 4XWOD 2G60L 5DD0H 3BZEA 2PYFA 1E27B