1QSZA

The vegf-binding domain of flt-1 (minimized mean)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
b'SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 1
publication title Solution structure of the VEGF-binding domain of Flt-1: comparison of its free and bound states.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor receptor
total genus 25
structure length 101
sequence length 101
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 1999-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qszA00
4PRHA 3IDNB 1BVKB 4YX2L 1SHMA 4JZJB 5DMKA 1QFWI 1UEMA 2OJZL 4JO4H 4Q6IC 5K9OA 5C0EB 2PYFB 1AGDA 4PRHB 1H8SA 5DMKB 5K33A 2XQYK 2DKUA 3D3VA 4XVUC 3MUGA 2JJTA 3VFVA 3G04A 2XQBL 2GEEA 1AGCA 4M5ZL 3D3VB 3MUGB 3VFVB 3T0ED 1L7TL 3G6AB 4FFWD 3G04B 4ISVA 2BNRA 3G6DH 1FJ1A 4Z7OF 4D94A 5GS1C 3MLRH 4KQ3H 4JFZH 5IV2A 4YFEA 5C2UB 5F1NA 1BJ1H 4ISVB 2BNRB 1EEYA 1FJ1B 2IANA 4V1DA 3GMRA 3OKYA 1T03H 5IV2B 3KWWA 3T3MF 5F1NB 1FNAA 1JN6A 4CU6A 5D6DA 1EEYB 1ONQB 2IANB 3DXAD 4K7FA 3GMRB 1QFHA 1E4XH 4Y5YA 2NXZB 3BKYL 3KWWB 4HLJA 4HCRA 1MEXL 2DI7A 5SX5K 3B5TA 3RWDA 3CSYA 1JN6B 4TOYH 3RIFK 4Y5YB 3TA3A 3RWDB 1CXHA 3RBGA 4UV7L 4Q97A 5CUSL 2K9UA 4TUJB 1U3HD 5HYQA 4R96A 4CGTA 3TA3B 3F62A 2AGJH 4IOFD 1FBIH 4QXGL 3M1BA 5HYQB 4R96B 1KEMH 4JREB 1N59A 2DLEA 5GPRA 4IJ3C 4M62L 5I1IH 3QDAA 4EDWH 5ALBH 3BPNB 1F3JA 1NLDL 3P9MA 4LVOC 4MJIE 5B8CB 1N4XL 3UTPD 1UZ6F 2YWYA 32C2A 4Z5RA 1F3JB 2FWOB 4G6MH 2Z8SA 4PJ7E 3QNXA 3P9MB 4ZTOH 5E8DL 1BQUA 1T83A 1BFTA 4LLMB 4Z5RB 3ZDXE 3B9KA 3W5NA 5GGVH 5BJTA 4NQSB 3C60C 1CVSC 2IBBA 3B9KB 5BJTB 4KDTA 2W0LA 1G0YR 5E8EA 4C4KT 3O6MH 2PYED 2L0DA 4KMTL 5E8EB 5JPMB 3ZSSA 3CU7A 4XMPH 4HPOL 3TCLA 2GCYB 5M7QA 3OAZK 1F42A 1Z5LB 3FOLB 2MQ0A 5HDLA 3TCLB 3GGWA 5CGTA 3W9EA 2NQCA 1QHOA 2CR3A 4QYOA 2FGWL 4NDMB 1RMFH 3REVA 4U2ZA 3W9EB 4UUJB 4ONFH 2ZUQB 2BK8A 5DRNA 1DBMH 1RUAH 3REVB 4LLWA 4LQ1A 5IB1B 4WGWB 1TXKA 4P46A 4DGIL 1U8MA 3ZYIA 2ZJSL 4C58B 3QG6B 5DRNB 4ETYA 4HJGA 2IADA 2QSVA 5HYJE 3GBNH 4LLWB 5D2LA 1MCIA 3CFDB 1U8MB 3WNMA 3QCUL 1DBAH 2IADB 1U8HB 2YD4A 3OWEA 3RX7A 3SE3C 1GSMA 3AREA 5F44A 4L4TE 4NC2B 4TNVK 4DQOH 1MRFL 5C0CA 1R3LA 1P69B 2VAAA 2Q8BH 3X12A 3AREB 3OG6B 4MQ7B 2P8PA 1DQLL 1P4BL 4EVNA 4F15C 4OI7A 1R3LB 2HWZH 2VAAB 5FB8B 4Y1AA 4PV9A 2XKNB 4YEFA 1TETH 5FUZL 1RSFA 4EBQH 3OR6B 4PV9B 4BYHA 1VEMA 4QXUH 4XP1L 3BRGC 4LHUD 2DLTA 4OGAD 3MCLL 5F72S 5TDNA 4QRUA 4QNPF 5AUMA 2EEAA 4U1GC 1WIOA 4QRUB 4FQLH 3WS3A 3MV7D 4ONGL 5AUMB 4XXDB 5K59F 2R8SL 4L8CA 1FNSL 5JQHC 3FN0L 3WS3B 2DMCA 1QFWL 3MRBB 3QQNA 5JMRA 2JELL 3WUWA 1QFOA 1DR9A 4FXGA 5IFHL 3JWDL 3KJ4C 4DK6A 1AO7D 1OARL 2OSLA 2XY2A 3QDGE 4FXGB 2CJUH 15C8L 4HGWB 1XGUA 4XH2A 3U1SH 1UH4A 2OSLB 4XZUA 1WZLA 1NFKA 2EECA 3VXMD 1XGUB 4XH2B 4NQXA 1E6JH 4ODWA 5HGBA 2E5EA 4YEEA 1P5VA 2HT4C 4XZUB 4GUPA 2IMNA 4GG6A 3RKDD 4NQXB 4P4KD 2PW1A 5HGBB 4JKMA 3FB6A 2EDEA 3O4LE 1AJ7H 4GG6B 4H8WC 1HNGA 4KROC 1A7RL 2PW1B 3AMKA 2F5BL 4B53A 4JFDE 1LO0L 4J4PD 5T1KA 3N85H 4X9FA 3D85A 5FO9A 3CCHB 2LE9A 5T1KB 4XMKH 1PKQE 4K2UH 3D85B 1JNJA 2G9HA 5FO9B 1YY8A 5D7JC 4G3YL 4Z9KB 3WFCH 4K3JL 2MFNA 4IRZL 4UOW1 4MB4A 4HS6A 4LL9A 5GJTL 3W0WA 1I8LC 5C07A 1IZJA 3QQ9C 1KF9B 1EVTC 2FL5A 3UO1H 5BW7A 3C60A 4HS6B 1F2XK 4XTRD 1V05A 3C5ZD 4FZEL 2DQGL 4JVWA 1NBYA 4HIHA 2MWCA 2FL5B 4HX1B 1NAML 3QEGL 2HTLD 3BIKA 4OZHA 2PXYC 1JGLH 3H3BC 4JGMA 3T09A 5KVFH 4U1JA 4N8VA 3BIKB 1DQJB 4OZHB 4DN3L 4IHOB 1CD1A 2H41A 4MVBC 3O4OB 1MHEA 5D7KD 4U1JB 3HI5H 1EX0A 3CXDL 1CD1B 4R6UA 4Y4KD 1CFQA 3CVIL 3OKEA 2ADIB 3T3PF 2BNRE 4JLRA 1MHEB 4OKVA 5EOTA 1C5CH 3W11D 1CFTA 3BPLB 4PJEA 5AWNL 1IRAY 2XICA 1KXTB 3OKEB 4OKVB 5EOTB 5EOCL 2IANE 1CFTB 3J8F7 4JFQA 3L3HA 1ZMYA 5CJOL 3UP1A 4EUPG 4KI1A 2P42B 4JFQB 3T0WA 3L3HB 1P84K 1JRHL 1R5VA 1SMOA 4K3GA 2F54D 4MXWH 2C7UB 2Y07L 1V7MH 2BSSA 3T8XA 3FMGL 5JOPD 3TH3T 3E1F1 1KUMA 1R5VB 2WZPD 3U83A 1JGEA 5CZXC 1CBVH 3NTCL 3T8XB 2OI9B 4U3XA 3C2AH 2ZNXA 4R4FH 2VDQL 2XWBA 3S3JA 2EZ0C 2YRLA 3TIDB 3RZCA 2XWBB 1INEL 5IW3A 2LU7A 4D0BB 3WV0A 5C3TA 3JZ7A 3KLSA 3RZCB 1UA6H 5EU5B 1T20A 1YMMA 2DAVA 2XXMB 1NAMB 5E8OA 2JJWA 1A14H 4GRLD 1NCWL 3A6BH 5JUEH 1IARB 2EEDA 1T20B 1YMMB 3JV5A 3IKCA 1YMHB 2KDGA 5E8OB 1NCCH 5I1CL 3U4BH 1P7QA 2K7QA 3IKCB 1T7VA 4M6OH 5CSBA 2OBGA 3S6CA 3VG0L 3G9VA 4PY8I 4X4ME 1P7QB 2EKSA 5D96B 3EJZD 3LDBC 4UV4H 4JFYA 3SKOB 2VXVL 2QQNH 1CU4H 5BVPL 4LLVA 1FE8H 4D2NA 5DHVA 3RVUD 2GITA 3MRGA 5FHBL 4HJ0D 1RURL 4JFYB 4NT6B 3T2NH 2ZUVA 3FONA 4G8GD 1FYHB 3BEVB 2V17H 4LLVB 4ESKA 5DHVB 3SOBH 2GITB 2VH5L 1BD2A 3MRGB 4OZIA 4EQ2A 3FONB 3QRGL 5HBBA 4UAOC 4NO0D 4WWKD 3X14A 4NM8H 2Q7YB 3QDMD 5FGSA 1GH7A 3BP7B 4G9DB 4Z7UF 5D7SH 1TVDA 3HS0A 5IT2H 2DBJA 4EZMA 3ARGC 3HG1A 3K2UH 4HPYH 3RTQB 3HS0B 2NYYC 5CIPB 1MJUL 3WFDH 5FGCB 3GIZL 4HBCL 5HGDA 2V5MA 2D0HA 4ZUTA 1T6WA 2ZSWB 4MXVF 2EH8L 5F88A 1FL3A 1MCJA 3VXUA 4NNXB 5HGDB 3GSNL 4OTXH 3BRDA 1FL3B 3V52L 3QXTA 3VXUB 2P49B 5D7JA 4NKMA 1HHKA 2EDJA 4S1DC 1IGIH 2NY1D 2WWMD 4KRMB 2EDWA 5D7JB 1I8LA 4NKMB 3ZYZA 4E5XB 5I1KH 1UT9A 4JDZA 5D1QC 3EOBA 1I8IA 3KPLA 4NJAH 3A0OA 4TUKH 1NJ9B 1E6OL 1KCUH 2FHBA 5L6YL 1LDPH 2CK2A 3RJDA 1CE1H 2QQKL 1HK6A 3EOBB 1I8IB 3KPLB 1YEJH 1MIEH 1CDCA 4FG6D 1GCFA 3KXFD 1E4JA 4ZPTA 3IXAB 3HR5B 1WLHA 5FM5O 1B4JH 1OVZA 4NC1C 4F58L 1UVQA 5LGHL 1LO3H 3MZTA 1JGVL 2E3VA 2F8VA 4ZPTB 1N5AA 3WIIL 4AEIH 4TUOA 1HH6A 1UVQB 4QOKA 4R90H 2R0WH 1FFNB 1UJ3C 5L8KB 1HH6B 2W60B 4MXQC 5JW5A 4TSAL 4NQTA 4LOUC 3QXWA 1D9KD 3BN3B 1ZVHA 4M7LL 3HTLX 1FV1A 4DKAA 2XG4A 5INCB 3ARXA 3MR9A 1UG9A 1NCBH 3D39A 4YHYC 2BMKA 1FHGA 2AK1L 2BVUA 5GRJH 1FV1B 4OIBA 4KXZH 1H3PL 3D39B 2BMKB 4PGZA 2PCPA 5I73B 1KIUA 3C8DA 1G7PA 4J8RA 4ODHL 5C0AD 1FZMB 2PCPB 4PG2C 4JHWH 3SCMA 5I1EL 4LQFL 5F96H 1G7PB 3KPOB 4J8RB 5EZOL 3SE8L 1B0WA 5F9WB 1U2CA 1AXIB 3HNVH 2HJFA 3SCMB 3CUPB 3V6OE 1G7JB 3L3KA 4QTIL 5C9JA 5FKAA 4WW2F 3PHOB 5L0QC 4RISL 1IKNA 1QHPA 4J23A 3L3KB 3Q5TA 5DLML 5C9JB 3B43A 5FKAB 1U93A 4XCNA 2FSEB 1UM4L 1JPTL 4XWGL 3T08A 1U93B 1LO4H 4XCNB 4HT1H 3AB0B 1B2WL 1CDJA 4G9FE 3MLSH 1Q1JL 1GPOL 3RVTC 3S4SA 4U6VL 3VXSD 4LLYA 2EE2A 5C0JA 1TJHL 5J1SC 3VMPA 3S4SB 4DAGL 2HRPL 4JM2D 3OG4B 1TJGH 1MJ7L 2BVPA 1PYWA 1LVEA 1F4HA 1T4KA 4HK3N 1KCVL 2GY5A 3PWNB 3S35H 3IRZA 1A8JH 3LDBB 4MX7A 2BVPB 1OAUH 1PYWB 4H1LH 2VABB 4NN5B 3G6JF 4S1QH 4MX7B 4XNMA 1FO0A 4M5YH 4CJ0A 1UZ8A 4Y4FC 3SGKC 1A7OH 4QHUA 1BQHA 2QADC 2YMXH 4ELKB 4X6BA 1UZ8B 1NFDF 2Z8RA 3CFKA 1N2RA 1YEIH 4TRPH 3LIZL 1CLOL 5FUOH 4QHUB 5IB2B 1BFVH 5H35A 3ARGA 2D7OA 4X6BB 2Q6WA 4AENA 1N2RB 2VIRA 3J7HA 1C5DA 2XTJD 4NWTL 1UWGH 5H35B 3ARGB 5BQ7B 2AKRA 2Q6WB 4AENB 5DR5L 2VIRB 2LVCA 3GSWA 3U7YH 1UM5H 4RDQG 1IAMA 2AKRB 5ESAA 4AH2A 1UWEH 4N8PA 3BQUD 1X5IA 5JO5A 3HAEB 5HYEA 1A22B 2A6KB 4HUMB 3LN5B 5ESAB 4WNQB 5JO5B 3RL1A 1OSZA 4QRQB 3T4YA 3PF2A 1EXUA 4DN4H 1U8IA 4Q9RH 1OSZB 2BFVH 4Z95H 1CDHA 1CK0L 5DUMH 3T4YB 3TBYB 2CUIA 2VDRL 3NCEB 1EXUB 1XAUA 1YEGH 3NFNA 5D1QA 4K23H 1U8IB 1HIMH 1X4YA 5IVOA 3ARFC 2GY7B 1W72L 1YMME 5EPMA 1V7NL 5DHYA 3ZDYF 3ULVH 1LK3L 4M48H 4RDQF 3O9WC 4D9LL 2R69L 1T66D 2V5SA 1MAKA 3UJTH 2J12B 3BGMB 1MFCL 5DHYB 4M7JH 4YAQA 4CMMB 4XMLL 5H37H 4ZAKA 3DVNB 4LCCC 2OX5A 3D5OF 2CH8A 4ZAKB 4PJXF 1PW3A 1RIVH 3PP4L 1UCBH 4PGJA 4QO1A 5D7IA 1IEBA 7FABH 1UJ3A 5J57B 3FQRA 3U0WH 2OMNA 1MJJB 3IDMA 5IGXL 2BOBA 1J11A 3HFMH 4MJ5A 4WEBL 5ACMA 1MWAH 2XYCA 5AZEH 5KTEL 5D7IB 1KJMB 5HYSA 4KKLC 2VLJA 2YR3A 4LU5L 3IDMB 4Q74A 2NY2C 2BOBB 3WSQL 4MJ5B 1IEAB 2Y5TA 4X4YA 5BZDA 2GTWB 2CSPA 3BMWA 3P0YH 2Y5TB 5B22A 4YHYB 1G9EA 4PJBA 4HMCA 1IGML 1CXEA 3WMSA 3QXDA 5CBEA 5IBLC 3UTPE 5EBLA 4PJBB 2BNUB 5FGCE 5FYKL 5TFSL 3MRJA 4LLAA 5IHUH 4WRLA 9CGTA 1INDH 4XBGB 2CRIA 3QXDB 5CBEB 3FL7A 4KK9C 2J4WH 5EBLB 1DQQA 3O2DH 3T0DA 4QWWC 2J6EL 2HH0L 5K93A 5SWSB 3VXUE 2I5YL 3O41A 1DQQB 2OR9L 1W72A 4PD4K 5KVMC 5BVJA 5EG6C 2A9MH 4P5MB 2MMXA 3O41B 1WTLA 1W72B 1KCSH 4MJ4A 4PRBA 4NN7B 4OF8A 4HFWB 3PJSA 5L7XL 3ZKNC 4LPUA 2X1XR 1RHHA 1ZWIA 1QSFB 3UYPA 1BEYH 3H3PH 5CILH 5B4MD 5DEGB 3FO2A 1HHIB 3PJSB 4MQXD 4P2OC 5I1HH 4D0DA 1HEZA 1ZWIB 2HN7B 4JR9L 1NMCC 1G1CA 3UPRA 1CICC 1GZQA 4X8JA 4CVZB 2WLYA 4D0DB 3BJ91 4M6MH 4K8RL 3O3DA 1CDGA 1GZQB 1QSVA 4X8JB 1A6WH 4DEPC 4XWOC 1RZFL 5KJRL 4IOSD 1D5BA 4Y4HD 3O3DB 3SDAC 4UMGA 2GHWB 1C08A 3MBXH 4N0FA 4WDIA 3MA9H 3DYOA 4X7CC 3WLWC 2OCFD 1KXQE 3P0GB 4EN3D 2JLLA 3RU8H 3MLZH 2PR4L 4RMTA 4N0FB 4OLVH 4WDIB 3GEWB 3MO1B 2CRYA 5KVEL 1TQCB 4D3CL 3MLVL 5DD3L 2CR6A 4OKDA 3MGTB 2XZCL 5CS7A 4EKXA 4OAWB 2YPLB 2ZCHL 1KTLA 2E6QA 3LHPL 4Q6YA 5BRZD 1WJ3A 3VXRA 2V7NB 4KDVA 2FD6L 1KTLB 1BQSA 4YZFE 3EFFA 3MRMA 5T3ZL 3VXRB 5J3HD 1Q0XL 2IPTH 5I8KL 3ARVA 2X9WA 3CXHK 4LARH 3EFFB 4OUUB 3MRMB 3UTOA 2X6MA 4P5TB 3KHQA 1ITBB 4XB8A 4EXKA 2DF3A 3HB3C 4W6XB 1KOAA 1KN2L 3MFFA 4BSVA 3FAWA 3DROA 2R1XB 4X9IA 5DK0B 3BX7C 3NFPA 3D69A 5D93C 4HUXA 4BSVB 1RVFL 2X10A 3ARFA 3KJ6H 3NFPB 4H1LG 1RULL 1QG3A 3QNYB 4NQCD 3O9WA 1JBJA 2F19H 1N0XH 1CFNA 3OGCA 3ARFB 4JDTL 3MV01 4GLRI 3VFOB 4KJQD 3PP3K 3O9WB 2D3VA 2W59A 2OQJA 1OCWH 3OGCB 4LCCA 5J1TC 5JW4R 1MLCB 2CO7B 5I8OH 3I50H 1DVFD 5ILTH 4MGXA 2OQJB 4LCCB 3EYOA 1CQKA 3FFCA 2NW2A 1I3RA 3EYOB 4NO3A 5D1XD 3DURA 2ESVD 4GQ9L 1T22A 4M7ZC 2NW2B 1I3RB 2VKXA 3IFLH 4PJHF 3V4VH 1JHTA 3O2VL 3QIUB 1HYSD 1A7NH 2GYSA 4YGAB 3NA9H 1XF5B 2EYSA 5F6HI 2G5BA 1JHTB 4OF0A 3C6LB 4WY7H 4OLYH 5F70A 4WTXA 4JQIH 2EYSB 1FNLA 2FO4A 5GSVA 4QF1A 2I9LA 4WGVB 3CK0H 1NH6A 3FB7A 5ACZB 2FO4B 5TQ2H 4MHHI 4WHDA 4MMZC 1TENA 3FB7B 1S7UA 1T2QH 1IAIL 2GSIA 3L1OH 3P4NA 4YHKH 5ANMA 2EYRA 4ZS6D 4E0RA 2DLFL 1S7UB 1Z3GH 5IVXF 5H37G 4F3FA 1HKLL 2GSIB 1KIQB 3P4NB 3LS4L 4PUBH 2E7BA 2YD1A 4QRRA 5ANMB 2EYRB 4E0RB 2APVA 2X09A 4UT7L 4WI3A 1TJIL 1JZ2A 4P2RD 1T1YA 1YJDC 2NXYB 4QRRB 3S88H 1HXMA 3DPBA 3M8OL 5IKCA 4KHXL 3ESVF 1T1YB 1RZGA 1BREA 1U3YA 1MF2H 4KKCD 5JHLH 4EI6A 2AXHA 4C56D 1YNTA 5IKCB 1WGOA 2G60L 1RZGB 2ZUUA 4OCWH 1CICA 3UPAA 4ZO7A 4OI8A 1KB5L 1WIPA 4EI6B 1YNTB 2DJ4A 1NMCB 2R2HA 4QRSB 3F7PC 1CICB 2BXZA 1YA5A 4UINL 4M6NL 4HKZA 3F65A 2R2HB 4NC1E 4HXAH 4LEOA 3ROOA 3UC0H 3SDAA 3LRGA 4ODXA 5CP3A 1SM3L 4KK5D 5J11C 1YC7A 4HKZB 1XFPA 3ROOB 5D7IE 4LEOB 4YXHH 2XPGA 4BFBD 5DC0A 5J12C 1Y6NR 3RPIA 4RGND 3BE1L 5GIRA 2F74A 3O6FA 1A9BB 1ADQH 2P8MA 3D0VA 3RPIB 4P59H 4Z7QF 5FYLL 5CJXC 4LAQH 1W0YT 2F74B 1X4ZA 3O6FB 1RUMH 1WT5C 1NUGA 3CPLA 1I9JH 2P8MB 5E08H 5HDQL 3D0VB 3R4DA 1JWMB 2APWA 2VDMH 3ES6A 4JO4L 4PJBE 4Z0XB 3CPLB 1QFUH 4PRPD 5FDWA 4X98A 5DMGC 5T1LD 3GFUA 3MRIB 3ES6B 3HCVA 5F97E 3LSOA 2ENSA 5KSAA 4LSPH 1T1WA 5FDWB 4X98B 1WQVT 2AABH 5SWSE 3ZT6A 4Z78A 3HCVB 3LSOB 4L3EA 4AM0A 5KSAB 4FFVD 5FO7A 1T1WB 1LO2H 3GI8H 2WSKA 3MNWB 3DYPA 4NSKA 3G6DL 1OAXH 4ODSH 4Z78B 1AXTH 4L29A 2Y23A 1SQ2N 3MLRL 4KQ3L 4L3EB 5FO7B 4JFZL 1MCOH 2ADGA 2IH3A 2NW3A 4RAVA 3CH8A 2C3WA 3LH2H 3QIWC 4L29B 4EEEA 5F3BA 1T03L 4NZTH 1QSFE 2W0KA 2ADGB 2EDNA 2IH3B 2NW3B 5D93B 3SDCD 1X6NA 1KB5B 3QG7H 3DHMA 2DYPD 4JRYA 1E4XL 1DLHA 5B39G 3GMMA 1LWRA 4YIQA 2LFGA 5DMJB 5JR1H 2A6DA 3KPSB 4WUUB 5GRXG 4UNVA 4JRYB 4HV8B 1QQDA 5M94B 4YIQB 3MX0A 1NL0H 2AGJL 1FBIL 4IEFB 5TE7H 2VN4A 5F71A 3JV4A 1KEML 5JQ6H 4PRNA 3ZE0F 4DGVH 8FABA 1FFPA 2Z4QA 3VH8G 3ILQC 5I1IL 2HRLA 4A2MA 3MRHA 3MREA 3JV4B 5EOQL 4EDWL 5ALBL 1K5NA 3QEQA 3LB6D 4L1DA 1LE5A 8FABB 2Z4QB 3PIQB 3PL6C 4M7ZB 4W4NA 1BZ9A 5CEYB 3MREB 1I85C 1L9NA 1K5NB 3QEQB 4G6ML 1LE5B 3IS1X 4ZTOL 1UEYA 5FYKE 3RNKA 2HFFA 2YPLE 5TPWL 4GKOA 2BCKA 5GGVL 3RNKB 1JJUA 3GMQA 1FL5B 3MJ9A 2BVEA 4OFVA 1LNUB 5J6HA 4Z7OE 1G6VK 3O6ML 3UTTA 3GMQB 1OD7A 2W92A 1JK8A 1ZLVH 5J6HB 2QTEA 1BJMA 3QUKB 4M6AA 4XMPL 5GJSH 3UTTB 4LGSB 3JWDC 4GKSA 1JK8B 2UY7A 1JTPA 1U6AH 1NCAH 4JY5H 5E94A 1ORQA 2OL3H 1A02N 1J0HA 4UT6H 3UJIL 5E94B 1ORQB 1U3JA 5GRVL 4KAQH 3ELAT 1RMFL 2ICWI 1N7MH 3UZEA 1DBML 1MCCA 1RUAL 2ZUXA 2YUVA 5KSUB 2LU3A 3QDJB 1BVLB 4F57H 2DQHL 3RUGA 3JTTB 3GBNL 4EUPA 2YUXA 3AY4C 1FDLH 2VTFA 1WEJH 4L5FH 1DBAL 4EUPB 1UZ6E 3JWOC 1SMAA 1CG9A 4QT5B 4DQOL 2FHCA 5BS0A 2CDEA 1KIPA 1QLRA 2Q8BL 4PR5B 1K6QH 2WIMA 1J8HB 5J11B 1AHWA 1KPRA 2A6JA 4GJTB 4J3XA 4ZUSA 1FFRA 2CDEB 4Y19D 2HWZL 3SDDA 1KIPB 1QLRB 1HXYA 4LVHC 5GGVY 5H8DA 4YK4C 1AHWB 1KPRB 2A6JB 1GZPA 3BZFA 5J12B 3LEXA 3HZYB 4NKIH 1TETL 5TH2B 3SDDB 1PKOA 2FATH 5CJXA 1HXYB 5IF0A 5E2TH 1GZPB 3T04D 1EGJH 1WT5A 3LEXB 3TH4T 5T3ZE 3HMWL 1FNEA 5E7FA 4PGEA 5IF0B 1JI2A 5GGSY 1YEFH 2BSTA 3VWJD 1FNEB 1AI1H 2WINB 3T0EC 3Q2CA 4PGEB 3QXVA 4FFWC 4YUEH 5DUPH 2PTTA 3QHFH 5GGTA 2A74A 2FGZA 4KRPD 2EC9T 3QQ4B 5ISZA 1U9KA 4F7TB 2X44D 1OSPH 5ANME 3BH9A 1NUFA 1YPZB 4HG4J 2VDPH 5IEHA 4WI6A 4Z7UB 4NC0B 1VFAA 5ISZB 4KJYA 4MD0B 3O8XC 1OY3B 4LEXH 4OUOA 2OR7A 3BH9B 1WBXB 2CJUL 1J87A 1M6OA 2Z91A 3FHAA 4ODTH 3U1SL 5IEHB 1VFAB 4KJYB 5KS9F 3NABH 2Z91B 1CL7I 1E6JL 5EN2A 5FA3A 4IOFC 5CEZD 1YDPA 2JTDA 3OHXA 1A7PH 5IM7A 1WBYA 1OP5H 2NR6D 2AJZA 4NWUL 3QXAA 1ZLUH 5BV7H 5EN2B 3W82A 1AJ7L 2GUOA 3OHXB 3L6FA 2W0FA 2BC4B 1EFXA 4OCRH 4WTWA 5IM7B 1JPGA 2AJZB 3QXAB 5C2BH 2YC1A 2EDLA 1FVCA 3N1PC 1DJSA 3L6FB 2W0FB 4YXKH 3N85L 4HKXA 5BZWA 1VEOA 4ZNEA 4XP5H 3KYMA 3GZKA 1FVCB 3FT2A 5KZCD 4XMKL 3TESA 3PL6A 4K2UL 4LK4A 3KYMB 1JYXA 5F7KC 5KG9A 3FN3A 4QNPE 5IFAH 2JIXA 3TVMA 3FT2B 4BFIA 1Y6MR 4PJFE 1OQXA 1T80A 3PL6B 3EYUH 4U7SA 3SJVD 4OLUH 3HNSL 4LRIC 3SO3B 5KG9B 1BECA 2JIXB 5HHNA 3TVMB 4BFIB 4JFFA 4XCEA 3RNQA 3DBXB 3UO1L 1XIWD 4QXWA 4G6FD 5IMMA 1JIBA 3QA3A 3TYFA 5L2KD 4JFFB 4XCEB 3RNQB 4XPBH 3Q5OA 1OWWA 4BH8A 5IMMB 1J8KA 3BT2H 3QA3B 3TYFB 1AP2A 1B90A 4NRXA 1VSCA 3EFDL 4BH8B 5JPNA 1JGLL 5E2UH 5KVFL 2EIEA 2V2TA 1J9CT 3WXWH 1AP2B 2IEPA 4NRXB 1GC1H 3TNNA 5JPNB 1ZHKA 4JJ5A 2UZYB 4KDWA 2X89D 4L3EE 4OIIH 2DD8H 2D4FA 3OR7A 1WBZA 5EUOF 1ZHKB 4JJ5B 4IMLA 2FIKA 1C5CL 3D1MC 3VD7A 3OR7B 1WBZB 4IMLB 3FCTB 2FIKB 5JTWA 1SBBA 3SDYH 1FCCA 3GJFH 2BY2A 1BF2A 3KPSE 1QNZH 2UYLA 3GRWL 4WUUE 1R3KB 4JRYE 4U1SB 3R8BB 4M7KH 5I74C 1GJIA 3ZLQC 1ORSA 3SPVB 3BYTA 2IG2L 3GO1H 1MPAH 2UYLB 4MXWL 1A3QA 4PJDF 3P11H 1NGZA 1V7ML 4QRTA 4P9HH 5E00A 3U48A 4WW2B 4ZO6A 1ORSB 1AR1C 1VB9A 1CBVL 4K94H 2E9WA 3MA7A 4QRTB 3E6FA 3NIDF 3H9YA 3C2AL 3JBG7 4R4FL 1TVHA 1HILB 5FXCH 1A6TB 4OF7A 5FYLE 3DIFA 1WC7A 1A3LH 3VI3F 4OGAC 2P1YA 1IJ9A 2K3TA 1TVHB 3H9SD 3OAZH 4NUGH 3QEQE 4PYHA 5F3HA 4LVHB 3DIFB 3QWQB 3S96A 4JFEB 3D2UD 1WC7B 2YD6A 3KG5A 1UA6L 3EAKA 3S96B 1CDYA 1A14L 1JVKA 3A6BL 4ZPVA 5F9JA 5JUEL 5CEXA 4JB9H 1K3IA 2P7TA 1MJ8H 3QFDA 4OT1H 1B0GB 3G6JA 5CINL 4GSDL 1U91A 2VLKA 5F9JB 3U4BL 5CWSA 4HK0A 4M6OL 5EC1B 2P7TB 3G6JB 5LCVH 3ULVD 2VLKB 4JFHD 4I77H 1W0WA 3QJFB 5FV1L 1GL4B 1OW0C 5CWSB 3U79A 4GKNA 4HK0B 1NFDA 4UV4L 4TNWK 1EHAA 3UTTE 1IT9H 1YECH 2APBA 2QQNL 5IUSA 3BDXA 1CU4L 1WWBX 3DXAA 1W0WB 1FE8L 5I9QC 5HVHB 3V7AG 3ZTNL 1RZ8A 4GKNB 1NFDB 4LPTA 3T2NL 1WAAA 3O8XA 2CKBA 3GRWA 1XZ0A 1I7TA 2V17L 3SOBL 1RZ8B 1WFTA 1J86A 3FN9A 1KNOA 3O8XB 2CKBB 5E70A 3ZE1F 1XZ0B 3BIBX 3UAJD 4FQ2H 2OM5A 1KNOB 1MCSA 4HIIA 3VFSB 3RI5F 5IT2L 5I1GH 3QDJE 1R3IH 5HHOA 3K2UL 5JIKA 1OL0A 4HPYL 3WFHA 3QUYD 3OKOA 4GMSH 3WFDL 4NFBA 5HHOB 4MS8C 3WFHB 3RDTD 3TBWA 2AW2A 1NBVL 5AZ2H 4DK3A 4MNQB 1J8HE 1JPSH 4OTXL 1XMWA 2WIIB 5J9PB 1FH5H 5D71H 1MI5B 4HKJA 5E5MA 2D2OA 4DKEH 5DVOA 1KJ3H 1IE5A 2CLRA 3MLWH 1IGIL 4XTRC 3HRPA 3C5ZC 4FMKA 4LRIA 5E6ZA 3WFBH 4JO2L 3SKJH 2UVEA 1CXLA 5I1KL 2HTLC 4WEUD 3F6IA 4LCIH 2VZ1A 4PJXA 1KTKE 5D2NC 1DE4A 2YD9A 4TUKL 1OOAA 2DQIH 1LDPL 4U6TA 4LGRB 3L3JB 2PUQT 3FOMA 1YEJL 1MIEL 4PGBA 5F6IB 4I2XE 1DE4B 1U8JA 2X4NA 1WWAX 5E1AB 5GGRA 3FOMB 3JSSA 3HE7D 4PGBB 4OSUH 1JI1A 1U8JB 5C1MB 2DRUA 2AQ1A 5D1ZD 4YHLH 1B4JL 2X4NB 4LNRB 1LO3L 3IJSA 3X11A 3IGAA 4PRDA 1TLKA 2CMRH 4AEIL 4BUHA 4U1LA 1YPZE 4R90L 3IJSB 3X11B 3IGAB 4PRDB 4Z7UE 5ISZE 3NZ8A 4WUKH 1L6ZA 1XGYL 4U1LB 5E4IA 5GS3A 4HS8H 2X4SA 4KVNH 1FLTX 3VFMB 3VRIB 1P1ZA 3RX8A 1AKJB 4HWZA 4XHJD 3NZ8B 4N90D 4WFFD 3RP1A 2X4SB 3BAEL 2GJ6D 4PP1C 3DUSB 1SEBA 4HWZB 1NCBL 4HD9A 2P43B 4MXVE 4WI8A 3VFTB 5GRJL 1JNNH 2ESVE 5HSFA 5I6XC 3WO3B 5IOPA 3CDGA 1SEBB 5I1DB 4U1NA 2CLZA 3FO0H 2GFBB 3C6SB 1NBZA 5D7LB 5IOPB 1A2YA 3CDGB 4ZOAA 2ARJB 4U1NB 5C0DA 2CLZB 4JHWL 4HCRH 1A6PA 4HH8A 1A2YB 5F96L 2NY3B 3BGAA 4NFDA 5C0DB 2D7PA 3HNVL 3DJ9A 1A47A 1MRDL 5KANI 4LHUA 4WHTA 2D31A 3KPPA 4GRLC 1IAOB 7CGTA 2D31B 3KPPB 1OP3H 1EH9A 1E4WH 3TCXA 1G1YA 1ZOXA 1A5FH 4YX2H 1LO4L 2J5LC 2O26U 4KI5D 4UB0H 1MCQA 2OJZH 3FQWA 4JFFE 5EO9A 3MLSL 3EJZC 5EZIH 3DX6A 5H94A 4X6EA 1NAKH 4OV5B 4LCWB 3RVUC 1AO7A 1IQWH 4HJ0C 4X6CA 3DX6B 3DYMA 3O0RH 5H94B 1F02I 1OW0A 4HAFA 4L9LC 4NGHH 1BHGA 4NZUH 2EDFA 4WWKC 3S35L 5IIEA 2AV1A 2NY7H 35C8H 1WFUA 4RMSA 1OAUL 4UQ3A 3V5KA 3JVGC 5I9QB 2A73B 4S1QL 2AV1B 3MROA 1RUQH 5DTFA 5EUKA 4YO0B 4M5YL 3RY4A 1J0JA 2VITB 2Q20A 1A7OL 2YMXL 5DTFB 5EUKB 3RA7L 5GRWA 1OGAD 4P23A 4XVSH 1YEIL 4TRPL 1IBGH 4JKLA 1M4KA 2DIAA 4HHAA 1BFVL 3W5MA 2BRRH 2V5YA 2KH2B 2O5YH 4P23B 3SKMB 4LFHD 3AXLA 4LKXA 5C08A 1KPVA 4D9QD 2VLLB 4LDLB 3GK8H 2Z35B 4MD4A 4ERSH 4WFHE 3U7YL 2WQRA 1UM5L 5C0ND 5C08B 3AXLB 1KPVB 2X4PA 1UWEL 2NY1C 2WWMC 1HQRA 1WIUA 3I3EA 2RB8A 4MD4B 3VG9B 1WCBA 3VWKA 4EQ3A 1GGUA 4WO4B 3N9GL 5CKGA 2APTA 4L3CA 3LOWA 5GGQH 4XPGH 1HQRB 3VWKB 3WNKA 4PRPE 3C5ZA 3BHBA 1EBAA 4YFDB 5HVFB 1F45A 4DN4L 4MZ3A 4Q9RL 1JWSA 2BFVL 4JFEE 3PGCA 1AGEA 4Z95L 2HAZA 5E8DH 5DUML 2FBJH 3BHBB 2FEDD 4FG6C 4PJ8B 1PSKH 1I8MA 1YEGL 4K23L 1WZKA 1PX3A 5D2NA 1HIML 5GS0C 1JWSB 3QUMA 3WYRA 3PGCB 4HWUA 1I8MB 3B2UD 3ULVL 5MHSE 1EZVY 4M48L 5D2NB 4NO2B 1JMXA 3UJTL 3TFKD 3NPSC 4M7JL 1MHCA 3G6JE 4PJHA 2MCPH 1D5ZA 2VLKE 1Z9SA 3U7AA 3MJ7A 3QUZB 3VGAB 4BQ6A 3GMLA 3VFPB 4JRXD 4H1LB 3GNMH 1MHCB 4BSWA 4KU1A 5IQ7H 4PJHB 1D5ZB 1D9KC 1ES0A 1RIVL 1UCBL 4NN6C 1QBBA 7FABL 4OZFA 1NFDE 2CO6B 1BFOA 3U0WL 4BSWB 4KTEH 1IGJB 3HFML 1IMHC 1ES0B 1MWAL 3NCYS 5AZEL 1F6AA 2HG5A 4G8IA 3RAJH 2R1WA 5J1AA 1BFOB 2F54A 2CPCA 1T7WA 2HA1A 4O02H 5C8JA 1K2DA 3FB5B 5TJWK 5C8JB 4POUB 5DK2A 2B0SH 3PWLB 3NIFF 3P0YL 1K2DB 3I75B 5F9OH 3NH7H 4UNTA 2BY3A 4JHZA 3S35X 2ZJSH 4FNLL 5J7CC 1R3JA 5IVXA 2N56A 2APFA 1VGEH 3MOQA 5IHUL 1C7SA 5HHOE 4XGZA 1R3JB 5IVXB 3TNMB 3TGXA 4HWBA 4D8PB 2J4WL 1AD9B 4RGOL 5F9DC 4XCFH 4MNQE 3HZVA 3O2DL 4PLNC 1MI5E 1XGTB 1XF1A 5C7XH 4YDVA 3OKMA 2FX9L 2X9YA 3ZDYE 2A9ML 1HHHA 2DM2A 3GI9H 4KHTL 1OAKH 4YBLC 3VCLB 1KCSL 3OKMB 1ERNA 1PEWA 4HXBH 5ADOH 1HHHB 2ED7A 1S5IH 4JQXA 4XVJL 3TBTA 4ODVH 2UY6A 1WCQA 1BEYL 3H3PL 3STZA 4JM2C 5CILL 1QSZA 4PRAB 3TBTB 3TP4A 2AJUH 3MNZA 5I1HL 2OTWA 3UTSB 2W9DL 4XAWL 4AIZA 1LEIB 1VENA 1L0QA 4L9LA 3MNZB 3PWJA 4Y2DD 4RRPG 2OTWB 5IMKA 1WICA 1TDQA 3X13B 4ENED 4NO0A 4WWKA 2B7DT 4Z18A 1D3CA 5IMKB 1Q9WB 4H26A 1QRKA 3JVGA 3MBXL 3MA9L 2MCG1 3KPRA 1H3XA 3RU8L 3MLZL 3FZUD 4LLUB 4OLVL 2XTJC 4EI5D 4LKCB 2GAZA 2MQ3A 3KPRB 3UPCA 4OCXL 4E41A 5E03A 3PWUA 4UZGA 25C8H 3ZTJG 2VKWA 3BQUC 1QACA 5ESVB 4E41B 3PWUB 4Y19E 2DL2A 5DUBB 4EXPX 5B3JE 5D7LE 3ZL4L 4R2GD 2OYPA 3E3QC 1A7RH 5LJYH 5J6GA 4X99A 4C55A 1I8KA 2YXMA 1FVDA 3GJEA 5E6IA 2IPTL 5GSRA 4LARL 5GISH 2EIZA 3ARBB 5J6GB 4I0PD 4NRZA 1FVDB 1K8DB 2XFXA 1BAFH 5E6IB 5GSRB 1CD9B 2EIZB 3O45A 1PY4A 4NRZB 2XFXB 5JDJA 5FO8A 4NNYA 3QIBD 5K9QI 2HLAB 4OLZH 3KXFA 2QKIA 1RD6A 1L7IL 3KJ6L 1DBKH 1U3ZA 2GK0B 2F19L 1N0XL 4FZEH 2B20A 5T1MA 2FNBA 2RFXA 4HULB 1JZ6A 1KPUA 5F1SA 1CIUA 1T2XA 4LASH 4LCWE 2IALA 1OCWL 3BKMH 1M05A 5FYJU 4M61A 4OJFH 5T1MB 5JW4M 1KPUB 5SX4H 5ILTL 5I8OL 3MLYH 2C1OA 5B39A 4NBXB 4GW5A 5E99H 2WBJC 2IALB 1UGNA 1D9KA 2H8PA 3UXFA 3B2VL 3ZDZF 3LKOB 1XGRA 5B39B 2COQA 4GW5B 4PFEA 1EO7A 3CXDH 3EYQD 4NQED 4CN6A 5FEBA 2NX5D 5I8CA 2IPUG 3IFLL 3V4VL 4GS7B 1KXVC 1FORH 3VH8A 1CGUA 1A7NL 5I8CB 3BD4A 5CJOH 3T65B 2Z0BA 5DHVH 3B4NA 2BNQB 5FK9A 3G08A 1MNUH 4WY7L 5C6TH 3VH8B 1YN7A 4OLYL 3TN0D 3CD4A 4HGKC 2Z9TA 2OXGA 3LKRA 1XGPA 4JQIL 5EFIA 5FK9B 4M03A 3G08B 2NY6D 3LD8C 4PLKC 1YN7B 1T1XA 4Q58C 3BP5A 2IQAB 3CK0L 3ULUF 3LKRB 2DQTH 4APQD 1XGPB 1UJTA 5MP6H 1J1PH 3AMLA 4ZO8A 1I1YB 4JRWA 5TQ2L 4ALAH 3MV9D 1T1XB 3GSUB 3BP5B 1J10A 5AEAA 4PJGF 2XWJB 4X7TA 4U0RC 1T2QL 3VFGL 2NTSP 4H8WH 4GRWH 1Q38A 4KJWD 1KENH 2VDQH 4LGPB 4YHKL 4YXLH 1G7QA 4R0LC 1MSPA 3MRQA 5FOBB 1Z3GL 3UZQA 2EE3A 3HKFA 1M1SA 2OTUA 4PUBL 4DTGH 3DV6A 5CFHA 2Y06H 3VXSA 3MRQB 5TE6H 3D25A 4TYUA 2P24A 4JN2B 4XPHH 4MAYD 3S88L 3K1DA 3C08H 3DV6B 4XNYL 2PETA 5EO1A 3WUZA 5A3ID 3D25B 3QO0A 3V8CA 3SBWC 1UCTA 3MBEB 4N9OB 1QZ1A 5D2NE 2YPVH 2NY0D 1MF2L 5EO1B 1NMAH 5JHLL 5E8PB 2JB6A 3SY0A 4OCWL 2R0ZH 4WW1A 4Y4HC 1WZMA 1KCLA 3LS5H 1TQBB 1IGFH 2JB6B 3WUWG 4JO1H 4FXLA 4EN3C 2V9RA 3OKNA 3PXJA 2VXVH 2CIKA 1E28A 3UC0L 4HXAL 1AY1H 5DJZA 4IIQC 1YEHH 4KUCF 2CIKB 1E28B 2WWKT 4YXHL 4PTTB 3T0BA 5DJZB 5HHMD 2E7MA 3IDJB 1BF8A 3WNPA 4IRJC 4AJ0A 2WUCL 1ADQL 4MD5B 5FM5M 4P59L 5J3HC 4NKDA 1UKTA 4LAQL 3N06B 4LPXA 4MJ6B 1EAPB 3PABA 5E08L 3MOAH 1I9JL 1NC4B 4ZFOL 1YEDA 4XNZB 3WHXB 4PJ9B 3PABB 4MJID 5IVXE 5H2BB 4DZ8A 1YEDB 3MSPA 1FZJB 4X4ZA 43C9B 4LSPL 5KAQG 2GJJA 1EEZA 4DZ8B 5KS9A 2AABL 1FGNH 3HI6H 4YBQC 4ETQA 4XNUH 2EDTA 1LO2L 3GI8L 1EEZB 3O3BB 5KS9B 3C2SA 1OAXL 4ODSL 3VXQB 3V6ZA 2X1OA 3KLAA 1MCOL 3S36H 4V2CB 3P30H 4KJQC 4MNGB 2AQ2A 4LDEB 2Y36H 3ETBF 3LH2L 3V5HA 5F1KC 1KGCE 1S7TA 5FKPA 1SJEA 3V6ZB 4NZTL 3KLAB 4OGZA 1E6OH 1QA9A 3QG7L 1RPQA 4NZDA 1UWXK 1GGIH 1J0IA 2Y72A 3T0XA 3UTSE 1BOYA 4N8VG 5KAQF 1RZJC 4WI4A 4JPIB 5JR1L 1U8OA 2ZSVA 1SEQH 5D1XC 2WBJA 3VDBA 2JKXA 3O3AB 1U8OB 3F7QA 3LKPA 3N50A 3N1QC 2WBJB 1NL0L 1ZT1B 1CLYL 5TE7L 1Q72H 3LKPB 5JQ6L 4DGVL 2P5EA 4RA0C 4Z7QE 5F7FA 3KLHD 3QUXD 1K8IA 4L1HA 4R97C 5HYJD 2P5EB 3TZVD 3Q48A 5I71B 1HSAB 3TH2T 4ZFOA 5LVEA 3P4MA 5F7UA 5HHPA 1K8IB 3KPRE 3L7FA 5L2JB 4K9EC 3VD3A 2I07A 4ZFOB 3P4MB 4L4TD 3SE4C 2DDQH 1OB1B 3DETD 1FO0H 1NGQH 3MACH 4TVPL 3S97C 4R7DA 3DLQR 3C8KA 3QO1A 5DC9B 3TF7C 1J05A 3LD8B 2DQEH 5EUOA 3QO1B 1MFBH 5GS2H 5EZOH 1X44A 2D9CA 5EUOB 4CADA 3BUYA 4R0LA 3KPTA 4F7MB 4GAJH 5GJSL 4J3WA 4JG0H 3MRPB 1P2CB 1WWCA 4R0LB 1U6AL 1NCAL 1WWWX 4J6RH 1CGYA 4JY5L 2OL3L 4KKCC 2E8ZA 1FNHA 2O61A 4PJDA 4UT6L 1KB9J 4Y5XB 1QPXA 2NY4B 3BD3A 4KAQL 5JZ7C 2OMBA 1B2WH 1JUFB 4KK8D 4LLDB 1N7ML 5D9SA 3VJ6A 1EEQA 3BW9A 2UV3A 1BZ7A 4W81A 1I1AD 4KK5C 3ZE0E 2A0LD 1GOGA 2F53A 5FGBA 3VJ6B 4F57L 2WUBH 3BW9B 3QDGD 3NN8A 2EDOA 1BZ7B 1Z9LA 1FDLL 2NCMA 3WN5C 2ARWA 2F53B 4L5FL 4JVPA 3HE6D 3NN8B 4IIQA 4RGNC 3DMMD 3GMOA 3ISWA 4JJHA 1HYRC 4NIKB 1K6QL 3FB8B 4IIQB 5J4MA 5F93C 3K46A 3PWPA 1LILA 2VDLH 5BRZA 1QO3B 1WK0A 3O4LD 4F37F 4IRJA 1ZGLP 3QEUA 3PWPB 4P3CH 1RJLA 4NKIL 2CKNA 2BNQE 3LRHA 4JFDD 3LIZH 3WD5H 2FATL 5EU7C 3VFRA 4IRJB 5E2TL 3GIVA 3QEUB 4Y8AA 1EGJL 4X6FA 3R0MA 2ID5A 1MHPH 1UXWA 2Y9RT 2AI0H 1CXKA 5FM4A 3O11B 1YEFL 4WU7A 4X6FB 1UXWB 5DR5H 3QI9A 1AI1L 4FFVC 4KGJA 3RGHA 3NBNA 3LKNB 4YUEL 5DD5H 2EXWD 2QQQA 5T33H 4WU7B 3QEHA 5DUPL 3LPWA 3QHFL 3QI9B 2VZ3A 4L3AA 1BWMA 3TPUB 4GKZA 1RAMA 1HI6A 5DRZA 1ZVYA 3QEHB 2HKHL 3PV6A 3ZT7A 2E27L 3SDXF 4GKZB 1EK3A 4YR6A 1HI6B 4OCYH 1OSPL 3SGEI 3PV6B 1S7WB 5FCSH 4PRHD 2VDPL 4U6HA 2UWEE 2AK4B 2WMPA 4LEXL 4Y16B 4CNIA 3TT3H 4ODTL 1QLFA 4U6HB 1ZT4A 4FQHA 4PBVC 1W72H 3D3VD 2H6PA 3BZ4A 2VXSH 3NABL 2QEJA 1JZ4A 2DQDH 5HGAB 1T0NA 1QLFB 4FQHB 1EA9C 2H6PB 3BZ4B 1L9MA 1OTUD 5D1XA 4U1KA 1PDKA 4AG4H 2Q3ZA 2H9GA 2HKFH 2BNRD 4FP8H 4OCRL 5D1XB 3LQMA 2BX5A 3LB6C 2R23A 5C2BL 3NCMA 5ALCH 5DJXA 2IAND 3LMJH 4XPTH 2EDBA 4YXKL 1F2QA 2NXZD 5IGXH 5HXMA 5IK3B 2R23B 3GSVA 4WEBH 4XP5L 4HC1A 4JO3H 3IETA 2DWEA 1W8OA 1T04A 3GSVB 3OJDA 2VJXA 4R97B 3IETB 2DWEB 4RGMB 2J8UF 5IFAL 1T04B 5CLTA 3TA3D 3EYUL 4OLUL 3SE4A 4UU9A 1FP5A 4QCIB 1BLNA 1MQKH 1QRNA 4LIQL 4OZ4A 3AFLA 2VDNH 4PBXA 5EDXA 5DVKA 4TTGA 4JFXA 2WV3A 1T5XA 3ULSA 1BLNB 1QRNB 1LGVA 5FYKH 4OZ4B 4XPBL 1MY7A 1BQLL 3E6HA 3BVNA 2BOCB 5I30H 1T5XB 3BT2L 3ULSB 1IC7H 3RWGB 5DJ2A 1VFMA 3E6HB 2FHFA 3EUUA 1RZKC 3P9WB 3BVNB 1LQSR 5E2UL 3WXWL 5DJ2B 1R0AH 1GC1L 5TF1H 3PHSA 1HSBB 1TZGH 5KS9E 5I0DA 2OXHA 3BP6B 5DZNA 3RVWC 3B9KD 4W4OC 4OIIL 1N8ZA 4FQPA 2DD8L 5K9QG 2Q86A 4U6XA 4YFLF 4FQXC 4MNGE 1B0RA 1U41A 3WXVH 1LMKA 4QY8A 4U05A 2Q86B 1FL6B 3LQAC 4C83A 1B0RB 5EBWA 2VZVA 4JZOA 2C26A 3MV8B 3SDYL 2C1PA 3A6CH 3IJHA 4C83B 3EZ8A 4P57A 5MI0C 1QNZL 3HC0B 4JZOB 1DN0A 2YD5A 4M7KL 2C1PB 1LK2A 4S2SA 1S9XA 3IJHB 3QAZB 4FQ1L 3WN5A 3GO1L 1MPAL 4K8RH 4IRSB 1UKQA 2DIBA 3OB8A 5C0RH 1LK2B 1S9XB 5CKAA 3WN5B 4NKOB 3P9LA 3ECBA 5F1IA 3V0VA 1BQHG 3IU3B 5EU3A 3P9LB 3ECBB 1ZA3A 3I6GA 1DUYA 1WZ1H 3OZ9H 2P5EE 2YS4A 2NLJB 4OLWH 1V5JA 1UB5A 5LGJA 1A3LL 3M07A 4HUWB 2VC2H 2IAMA 5DD6A 3BMVA 1ZA3B 4NUGL 1JHLH 4N0RA 5KVEH 1GGBH 3VWJC 2I24N 5T1LA 4D3CH 1YEKH 4I5BB 1RJYA 1WVZA 2IAMB 3NFSH 4QHNA 5DD6B 2AV7A 3CVHA 2HP4A 3PNWA 4GAFB 5JORA 5D5MA 3ARED 4LP5A 4CN4A 4OF3A 2VO5A 1JHKL 2AV7B 2GW5A 4ORZC 4JB9L 4J3VA 4P3DA 3PNWB 5JORB 1CN4A 3D0LB 4OT1L 4PY7B 1AD0A 4NZRH 5F7NC 3DVIA 1S7SA 2HVKA 4TULH 4HLZH 4P3DB 4Y88A 2AJ3A 3TO4C 5DQJA 5EUOE 2X1QA 5DS8B 4RMVA 5LCVL 1XCQA 2BSED 4OQTA 1AD0B 3V8OA 1S7SB 5B21A 4I77L 2EDDA 5I75C 5DQJB 1IT9L 1YECL 1XCQB 2I26N 2HVJA 2R2EB 3MUJA 1U8QB 3CU1A 2V9QA 4DUXA 3I84A 5SWZA 4ZODA 1VHPA 5FF6A 2P5WA 5C0BA 3GJFB 1MIML 2NR6C 1G0XA 5SWZB 2VL4A 1RJCA 1HZHL 1RULH 2DICA 5FF6B 2P5WB 1Q94A 3L7EA 3P40A 5C0BB 1FYTB 1FVEA 4FQ2L 5MENA 1U36A 3HUJF 3LRSA 1QFWM 1FN4A 5I1GL 1Q94B 4NO5A 5JIPA 1FVEB 3NIDE 1R3IL 3F7YB 5MENB 1E27A 5AYQA 4H88H 2CUHA 4HQQH 2O93L 4NO5B 1EBPA 2F53E 3VXPA 3VRJA 3QPXL 4PB0H 2IF7A 3VI3E 5HYSG 1Q0YH 1J12A 4N1CA 4BQCA 3QWOA 5F21B 5I76A 4GW4A 2C5DC 5AZ2L 4KV5F 1MAMH 4GAYB 4MJ2A 3QWOB 1FH5L 3DTXA 5D71L 5I76B 4GW4B 3RVXD 4JPWH 1UENA 1XIWC 4DKEL 4TVPE 1CCZA 1KJ3L 3MLWL 3PWPE 4P2CG 3RI5K 3DTXB 5CP3H 3LV3A 3WFBL 4UDTA 3L5HA 4LPVA 1KJ2A 4M8QB 1T89A 2Z31B 4LCIL 2HTKC 4UDTB 2ITDA 1I4FA 5C0GA 2RCSH 5T1KD 2DQIL 1KJ2B 3C09C 5E2WL 3D85D 5F7WC 2ITDB 1I4FB 3BO8A 3OJMB 1Q9KA 5C0GB 1JMZA 1NC2A 3HLAA 5IVZB 4OI9A 3L5JA 4GOSA 3QFJA 4G80A 3BO8B 1JNLH 1Q9KB 1NC2B 3HLAB 4OSUL 4IMKA 2FLRT 4YHLL 4X6DA 1YQ2A 1I3GH 3QFJB 4O5LH 3ZE1E 1A1MA 1U8PA 1OGTA 1EEUA 2CMRL 1CGSH 5ID1A 1B88A 1IGYA 3IJYB 4FQXA 3WNOA 4HUKB 3JXAA 3GSQA 1A1MB 1JZ5A 4WUKL 1OGTB 2AK4E 4LVNC 4HS8L 4KVNL 1M71A 5ID1B 3ARSA 4FQXB 4HAGA 3MOBH 1L0YA 4QTHB 1QBMH 3ULUC 1EHLL 4DCQA 1P6AB 1DSFH 1XGQA 3WHE0 3T1FB 3V7AE 1BMGA 2VERN 4M9PA 4JGJA 4NQEE 1NSNH 1JNNL 2XQYG 4LSUH 1XGQB 4PJ5A 3EO1A 4YQXH 4S1SH 4CVXA 3FO0L 4PJ5B 1ZHLA 1Y6KR 5EO0A 4HCRL 1RY7B 5HHXH 3IDYB 1ZHLB 5EO0B 1LP9F 2X40A 1PX4A 1GYAA 3HA0A 4C4KO 5L9DH 3JV6A 2E6JA 2OTPA 1IGCH 4ZXBB 3SEPA 4AMKH 4AEEA 3FQTA 3VWJA 2DKSA 4PTUA 3X17A 3JV6B 4F8QA 4OCMC 2OJEA 4YDIH 3FQTB 1OD9A 2XTLA 3B83A 2BHUA 4MQTB 1E4WL 3JUZA 1OP5K 3G5YB 4Q9BA 1ZLUK 2OJEB 5J13C 4L8SC 5HDQH 4UB0L 2DQJH 2YD3A 5EZIL 2HMID 4OFYA 1E4KA 5TDPA 2JF1A 3TO4A 1NAKL 2APXA 5K9OB 1IQWL 3EIFA 3O0RL 5HDOA 1AGDB 2BHYA 3LKQA 5TDPB 2J2ZA 3RZCD 3NCCB 4M43H 3TO4B 4NGHL 1ND0A 4HMEA 4XBEH 4NZUL 3LKQB 4YC2C 4HG4K 4AY0A 3MJ9H 2NY7L 1YMMD 4RRPA 35C8L 1AGCB 5I75B 1EERB 5DJCA 1ND0B 1MFAH 3RIFF 1S78D 2OR8A 4D9RE 2R4SH 2AEIT 1RUQL 3QUYC 2VLRA 4V1DB 2RIKA 3MV8E 4XVSL 3OB0H 1IBGL 1YJDH 3MCG1 4CW1A 2VNCA 3RDTC 5MEPA 2VLRB 2BRRL 3PGDA 4K7FB 3QYCA 2ERJB 2O5YL 4KMLB 5HHME 3TT1H 3BP4A 2ZOLA 4FQIH 3CSYB 5MEPB 1KSRA 1ZGLA 1NGYA 3GK8L 5JOFA 4ERSL 1G7IA 3BP4B 4UILH 2ZOLB 4OQ1A 1VGKA 4HZAA 3SJVA 4IS6A 1NGYB 2R29H 5JOFB 1DCLA 4CMHC 1G7IB 3WFZA 1VGKB 2LABA 4KKBD 4JG1L 2EDRA 4X9GA 3M1BB 5GGQL 3CC5A 5EOQH 3QH3A 4EUPH 5DMIH 4XPGL 4R7NA 1N59B 4HLZG 3RTQD 1K85A 1MCNA 4LIQE 3CC5B 1JTOA 3QH3B 3GHEH 4R7NB 3GJFK 1B4RA 3EDFA 2VUOA 2FBJL 4ZFGH 3RGVA 1PSKL 5TPWH 1KCRH 32C2B 1KFAH 3QNXB 3HE7C 3RGVB 2DTSA 5D1ZC 3VXUD 4HH9A 1N26A 5IR1A 5IVNA 2X89A 5ECJE 2R1YA 3IRPX 3WNNA 1IILE 4HH9B 5E8NA 5D7JD 5IR1B 2MCPL 4RZCA 3NA4A 2R1YB 1RJZA 2H26A 4QGTA 3GNML 3GB7A 2WLZA 5IQ7L 1NBQA 1UXSA 4XHJC 4RZCB 3GB7B 4MA1B 4KTEL 1UXSB 1X5KA 2CXKA 4OM1H 5GGTH 3RAJL 5KVGL 3UJIH 1MQ8A 1JRHI 2MSPA 3KDMA 3S37H 4AIXA 5SWZE 2NY5H 4O02L 2VB5A 3GGWB 2P5WE 4XI5D 5C0BE 1FYTE 2MPAH 1IM9A 3KDMB 4PJGA 4UNUA 4QYOB 3H7LA 2DB8A 1BGXH 2B0SL 5F9OL 4MVBD 4JAMA 3NH7L 4HJJH 1OAQH 4NPYA 1IM9B 4PJGB 2DQHH 5MENE 4DW2H 4MAUH 2EC9U 5B38G 3N0PB 2CK0H 4P46B 1VGEL 4HJGB 1ETZA 1ZEAH 1ZLSH 5D2LB 4ZFFA 3D2UA 4YGVA 1LO5A 4XCFL 1ETZB 4ZFFB 4J2XA 3D39D 5C0CB 4YGVB 1Z0MA 1CFSA 1RI8A 3FQUA 5C7XL 3X12B 4KI5C 4K3DL 2P8PB 3GI9L 1OAKL 4EVNB 4Z7VA 1CFSB 3FQUB 1PD6A 5BO1H 4Y1AB 4HXBL 4POZD 2BDNH 5CZXD 5ADOL 1S5IL 4L8SA 1MFDH 3HMWH 4ODVL 1P7KA 3SCMD 3OF6A 3S34H 4IDLA 4Q6IA 4HIJA 4L8SB 3M45A 3DARA 4Q9QH 1F4YH 2AJUL 3SGDI 3GDBA 3OQ3B 4Q6IB 5ETUA 5FUCE 5TDNB 1H3VA 3UYOD 3V6FA 3NAAH 1GGYA 2VZSA 1HOCA 1PBYA 3QFJE 3V6FB 3AUVA 1HOCB 4L8CB 4I13B 1AIFA 4DZBA 2WM0A 5GS1A 2M26A 4UT9H 1JGUH 4YC2B 3W39A 2L4OA 3V4PH 5DYOA 1AIFB 3NIFE 2CRZA 4KQ4H 3WUWB 5GS1B 1EMTH 4N0CD 3TYGH 4JZNA 3W39B 4U2YA 5ID0A 5DYOB 3QUYA 5I1JH 2I27N 2B1HH 3WBDA 1OT2A 4JZNB 3RDTA 2FCBA 4LSQH 5C0NC 25C8L 3GBMH 3I3DA 1FC1A 3UEZA 2GJZA 4NWUH 4ODWB 3DRTA 5HDBF 3MXVH 4GUPB 4PJ5E 2GJZB 4Z76A 3L3GA 4BSJA 3DRTB 2BVTA 3FB6B 4X7DC 5ADPH 1OPGH 3NIGF 4U33A 4Z76B 3L3GB 2A6IA 3B6SA 5GISL 5DJDA 2PF6A 4XP4H 3DSNA 5CGMA 1BAFL 2FEDC 3V0WH 2EICA 3UBXI 3B9AA 2A6IB 3B6SB 4IJ3B 1MRCH 5GS2D 3ARGD 3JWOH 3B2UC 5IB3A 4LVOB 5DWUH 1BOGA 3HNSH 4OLZL 2G9HB 4R4ND 1YY8B 1AC0A 3TFKC 5IB3B 3HE7A 4O4YH 2CUMA 5T1DL 4G42A 1BOGB 1DBKL 5D1ZA 1KYOJ 3W0WB 3U30C 5C07B 1A1OA 1QBLH 4BFEA 4G42B 3VGGA 3C60B 4PRHE 3S5LA 2H2SD 4LASL 2MNUA 1MHHA 3BKML 1D5IH 1NBYB 4S1DD 4HIHB 4OJFL 3EFDH 1EHXA 5GGUA 4X5LA 2FJGA 3MLYL 4POYA 5IW1A 5E99L 4EOWL 1MHHB 1TPXC 3D3VE 5GGUB 4K7PH 3HRZA 5ABDE 5IW1B 2GTZA 4N8VB 4KJPD 1J5OH 2GTZB 1OP3K 1KT2A 3C9NA 2DJUA 1CFQB 4JLRB 1M7DA 1KLUA 3DGGA 1FORL 1JF5A 4V1DE 1KT2B 1D6VH 4ZAKD 3C9NB 4GBXC 2VR4A 4PJEB 5DA0B 4I3GA 1X5ZA 1MNUL 1JF1A 3BPCA 2CKBH 2QV2A 3DGGB 2VLRE 3GRWH 5C6TL 3DO7A 2XN9A 2BVOA 1XF2A 2IG2H 4BH7A 4XC3H 4ZYKA 3OPZH 4DGYH 3DO7B 3SE3A 4ZFZA 2XN9B 2DQTL 2BVOB 1FCGA 5EZLA 5MP6L 1J1PL 5DD1H 2ICCA 4LOUD 4ALAL 2BSSB 4ZFZB 3ILPA 2QHRH 2VWEE 5ELIA 2GQHA 1JGEB 4H8WL 1KENL 3PQYA 4YXLL 4HS3A 1U95A 4X7SH 1EUTA 4LDOB 3RUGF 2ZCLH 1CDUA 4F15B 3EDKA 4DTGL 3PQYB 1F8TH 5LAXA 5A2LH 2Y06L 1WSST 4GG8A 5TE6L 3C5SA 2FLBT 4XPHL 3BGFC 5LAXB 3C08L 5EU4A 2D9QB 3B9DA 4GG8B 4L4VA 3C5SB 3H42L 1FFOA 3MJ6A 3TWCH 5SWSD 1LDSA 3ZDZE 1HHGA 2YPVL 4ENEC 5FDYA 1NMAL 4L4VB 5CINH 3Q6GH 1FFOB 4GSDH 4LF3A 4OM0L 3CGTA 2R0ZL 4U1GB 1NCNA 3HZMA 3KS0J 5TQ0H 3LS5L 5IMOA 1IGFL 3PXHA 4JO1L 4XP9H 1U92A 2E7LC 3DV4A 5ESQA 3FT4A 4OLXH 3U2SA 1QSFD 1SYSA 5IMOB 3FZUC 4MB5A 1U92B 5EU6A 4EI5C 1AY1L 4I0KA 3DV4B 5ESQB 1NEUA 2EKSB 1OLLA 3BYYA 3ZTNH 5F89A 1YEHL 4WJ5A 2R15A 3NZHH 5EU6B 3KJ4B 3RVTD 1BFSA 2YWZA 4WJ5B 5I18L 4I4WA 2FX7H 2CQVA 3ZKSD 1BD2B 1S9YA 4OZIB 2BVYA 3X14B 1QSEA 4W6WB 2HJKA 4G7VH 3U82B 4PJGE 1XH3A 4WENB 12E8H 1D5MA 3MOAL 4I0PC 3SDXA 1QSEB 1X5AA 1KJVA 1I3UA 3O2WL 4BZ1L 3EHBD 3HG1B 1D5MB 3SDXB 4GRWB 5D2LE 3KS0H 1KJVB 4KROB 2W91A 5FFLA 3QIBC 1NBVH 1ZA6A 1F3RB 3HC3L 4V2BA 4ZUTB 5FYKD 2QSCH 2YPLD 4O51A 2HT2D 1CWVA 1FGNL 3DGCR 5F88B 5C0CE 3HI6L 1ZA6B 1M7IA 4XNUL 5IJVA 1CXIA 3WE6A 4KKAD 3VXRD 1M7IB 4JO2H 4RMWA 5GQBA 3S36L 4Y1AE 1HHKB 3P30L 3EOTL 4HBQA 2Y36L 3WE6B 4P5TD 2VAJA 1HHJA 4G7YH 3U4EA 4JDZB 1GGIL 3PHQA 3C8HA 3V5DA 1HHJB 4YH6A 4RX4A 2ADJA 3KVQA 5MEQA 3DECA 3U4EB 2PXYA 5TDOA 3B8YA 3V5DB 3EYQC 5KSVA 1SEQL 3AS2A 4PLOB 5CJ5A 2ADJB 2J8UA 3Q6FA 1QFPA 1TNNA 5T3XE 1I3VA 1VA9A 2PXYB 4YJZL 5MEQB 4KZEH 1BP3B 4LHJB 5IB4A 1IGTA 5INDA 5KSVB 3HR6A 4CVWA 4BUGA 2J8UB 3Q6FB 1S9VA 1Q72L 2FRGP 3ARFD 5IB4B 5FYKU 4IDJH 4K8RD 5INDB 3U0PA 4I1NB 3O9WD 1N5AB 1K3ZA 5CD5D 1XGYH 4TUOB 1S9VB 5SWQA 3TN0C 2RGSA 4QOKB 5I0ZA 5DO2D 2PW2A 3U0PB 4DFIA 1Z9OA 4GBXA 5SWQB 5JW5B 3BAEH 3RBSA 1JZ8A 1VERA 4APQC 2PW2B 4GBXB 2DDQL 3G5ZA 3OKDA 3MR9B 1FO0L 1NGQL 3MACL 4EIGB 1CVRA 1U8NA 2R2BA 5AG8A 4AL8H 4GG6E 4MCZA 3G5ZB 3ARPA 4RFOL 3OKDB 3WIHL 1KLGA 4X4XA 3RKPA 1U8NB 2DQEL 2R2BB 5HTSA 3ZHKA 3QIUD 3HMXA 1MFBL 4MCZB 3KNBA 3T2QA 1KLGB 4X4XB 2FDBP 1RHFA 2X70A 5DJAA 3U7WH 3C6LD 2C4XA 1MRDH 5IBTH 4MAYC 5T3ZD 4GAJL 5C09A 4JG0L 5A3IC 5DJAB 2HJFB 4Q9CA 4X5WA 4YHZH 4KRLB 4J6RL 5C09B 2NY0C 3MTRA 2XWTA 3CFCH 5IBLD 1R5WA 4X0KA 4YHIA 4PY8J 3LQZA 5JW3H 3GHBH 2IQ9H 4X0KB 4YHIB 2J8HA 3W0WE 5C07E 5DRWA 4HMDA 5F7YC 3T1WA 1IAIM 5MERA 1F4AA 2N4IA 3PDDA 1DANU 5TGBA 5F7LB 3UYRH 5BV7C 5DRWB 3MV11 3ARDC 4R3SA 4XRCA 2NXYD 2WUBL 4QRRD 3FRPG 3NGBC 3QUMH 5MERB 4LLYB 2H1PH 5C0JB 2LU4A 4I3SH 4QHKI 4GQPH 5BCAA 2P44B 3FJTA 4OZHE 3S36X 4XRCB 3LPGA 2QSTA 3SQBA 1G9NC 2XG5A 4Y5VC 3FQNA 1T4KB 5C9KA 4NOFA 5FIEA 2V2WA 3KGRA 5CLWA 3R1GH 4WEMB 1OTSD 2LQRA 2VDLL 4UBDD 3FQNB 4P2QA 3I02A 2YPKA 2V2WB 2VLME 1CICD 4LSSH 3RWHA 4XNMB 3RA7H 3WIHA 1FO0B 2IFFH 4PJEE 4P3CL 4UAOB 4OZFH 4UTAH 4P2QB 3I02B 3O3UN 3WD5L 1BQHB 4GXVL 4Y7MA 2FIRT 4PJIF 4PRIA 3B9VA 1MHPL 3CFKB 2AI0L 1WAAF 2ATPA 4F7CA 4JY6A 4PRIB 2XN9E 3WLWD 1R5IA 2X2YA 2ATPB 4UDUA 1C5DB 3QIBA 4JY6B 5DD5L 2A77H 1A4JA 5T33L 3ZT5A 3GSWB 3BZDA 3N9GH 3WDHA 3O6FD 4AH2B 1C8PA 1EO8H 3C87A 3HUJA 5HVWA 4OCYL 3PQYE 1CFVH 4QRPA 4HWBH 3RL1B 1YZZA 3HUJB 3BD5A 4LMQE 4W68A 3G9AB 4QRPB 5DXWA 3TT3L 4WHYG 4P2YA 2AAVA 5DT1H 5D1QB 3NFNB 4O58H 2VXSL 5KSAD 3I3BA 2ZOKA 2DQDL 1EFQA 4L4VE 2BP3A 1G9MC 3IXTA 5EPMB 4L3ED 2B8OT 1YN6A 2ZOKB 4AG4L 4PLJC 2HKFL 4N9GA 1I9IH 1OT1A 1W2KT 4Q0XH 3IXTB 3KLHC 3QUXC 4FP8L 4P9HC 1IEHA 4YAQB 1YN6B 3L5IA 4MDJA 4N9GB 4K94C 5ALCL 1XEDA 1F5WA 2Y7QA 4NQDA 3INUL 3LMJL 4XPTL 2R9HD 3ZKXC 4LVEA 1B6UA 1CGWA 5EU6E 4AQ1B 5IROC 1S9WA 2Y7QB 1NQBA 1FZKA 3KPSD 1IEBB 4JO3L 2D4DA 4NQDB 4JRYD 1UJ3B 4WUUD 3TN0A 3FQRB 3THMH 4QXTA 3MRKA 3DETC 3UTQA 2XZAL 4JDVA 4R4BA 1J18A 5HYSB 4GXUN 1BD2E 4OZIE 3BWUC 2VLJB 4QXTB 1ODAA 1XT5A 1V3JA 1ACZA 1H5BC 5A2FA 1FFQA 1JGDA 4R4BB 5EZJA 1S8DA 2AXFA 4X4YB 1MQKL 3ARRA 3EYVA 2VDNL 5BZDB 5EZJB 1S8DB 1QSEE 4FNLH 1IAII 2AXFB 4U6YA 1RZIA 5FA4A 1UWXH 4PG2A 5FYLD 3EYVB 3HG1E 4YWGL 3SDXE 1JPST 4GRWE 5D72H 1FNGA 5T5NG 5I30L 1IC7L 1RZIB 3QEQD 4LHUG 3RJQB 2FH8A 4HIXH 3MRJB 4RGOH 1H3WM 3T2PA 4MAYA 4TSBH 3UBXG 4S11A 1A6UL 1R0AL 2XOTA 5TF1L 4U7MA 2DI9A 1TZGL 3VDAA 2B5IC 2DLHA 2FX9H 2IH1A 1D7FA 1TCMA 4LRNH 4KHTH 5DI8A 1FSKC 5L0QB 3O81A 5D70L 3OXRA 5BVJB 3WXVL 1I1AC 4XVJH 4S10A 5DI8B 4OCSH 5HD8D 4JCMA 1MCHA 4PRBB 5T5NF 3ME0A 2ICES 3ABZA 3UTTD 3VFWA 4JQVC 1RHHB 3MYZA 3RFZC 3T0AA 2Y25A 3A6CL 1LP9A 4H0HB 2IGFH 3HE6C 2W9DH 3K4ZA 4XAWH 3ARDA 3RWFA 4YPGA 3FO2B 3DMMC 3VFWB 4LNVA 5GS0H 5DJ0A 1HEZB 4N0UA 2AJSH 1LP9B 3LEVH 3ARDB 3EOAA 3RWFB 5HYFA 4HEME 1NKRA 3NGBB 3UPRB 5DJ0B 1NPUA 5C0RL 4N0UB 2NPLX 2J8UE 4Y5VA 4WV1C 2FBOJ 2ED8A 5HPOA 4Y4FA 3SGKA 1YQVL 3QDJD 1D5BB 3MRDA 4QOKE 1WZ1L 3OZ9L 2P46B 5EBMA 4X6CF 1C08B 4OLWL 3BKJL 4Y4FB 2VC2L 1H8OA 1GOHA 1AGBA 1JHLL 3ARZA 4MJIA 2QADB 1GGBL 2X4RA 4OCXH 2D7NA 1YEKL 3BXNA 2YD2A 3NFSL 2EXWC 1FZOA 1AGBB 2HFGH 3KPMA 3VI4F 5KBNC 3D39E 3EO9L 2ARJQ 1GXEA 3LKSA 1J8HD 4ZUWA 3ZL4H 5C86A 3KPMB 5DDHA 3OGOE 3LKSB 4XBPA 43CAA 5I16A 3DI3B 4NZRL 2B2XH 5E1HB 2Z8VC 4TULL 3K1KC 5ICXA 5CD3A 5DDHB 3SDDD 3CFBA 1HQ4A 5I16B 1L4IA 1SYVA 5CD3B 3EDEA 3CFBB 4JHAH 4X83A 3PGFH 5AG9A 2JJTC 5C09E 2N7BA 1G7LA 1E4XI 1XR8A 4AEFA 2AEQH 2CDFA 3ZE2F 3MFFB 1NCUA 1OTUC 1G7LB 1OF2A 2BRQA 3DROB 1L7IH 1X7QA 2DQCH 2CDFB 1P9MC 3D69B 4HUXB 1BX2A 5E5UB 1KN4H 1RFDH 1X7QB 4M1DH 3ARQA 4A6YA 2X1WL 5JMOC 1CFNB 2NXZC 5AD0A 3ZMRA 4O2CA 5ISZD 3G5XA 1A9EA 5D6DC 1DP0A 4OZFG 4YDKH 4A6YB 4HWEH 4H88L 4HQQL 5HYJA 4ZOCA 5AD0B 3B2VH 3G5XB 4PB0L 3QHZL 1Q0YL 1XF3A 4OB5H 4JPVL 2VL5A 4B50A 2ZG3A 3TA3C 2RHEA 4L4TA 3RX5A 1NCDH 3ZKXB 1XF3B 2N7AA 1MAML 3MJ8A 3FFCB 1T7XA 4JREC 3B8SA 4JPWL 4NO3B 1XCTA 5JXED 3DURB 4Z7NF 4OZGF 4FFZH 2NY2B 1H5BA 3DSFH 3BPNC 1T22B 5J56B 5FYJE 4P2QE 1XCTB 5B8CC 1T1ZA 4H0IA 3H7BA 3U9UA 5E0QA 5HGGS 3CMOH 2FR4A 2HJLA 3EYSH 2RCSL 2G5BB 3HI1A 2RAMA 4PRIE 3MRRA 1N64H 1U8LA 2HJLB 3HI1B 3IDUA 3A6OA 4QF1B 5GSVB 2I9LB 3PL6D 5DJ6A 3MLUH 1U8LB 2ADFH 5ACLA 1X5XA 1JNLL 4N1HB 2JIXD 3TVMD 3VFGH 2ORBH 4LSTH 3RPKA 4RWYH 1I3GL 4O5LL 2F5AH 1GOFA 4KDTC 4NBYB 2QSQA 4DKDC 4JFFD 4ZS7H 2LAGB 1CGSL 2V6HA 1KB9K 2AJXH 1I1AA 4G6AD 4F3FB 5GXBB 1RK0A 4QRPE 2R0KH 3FRUA 3QWRA 4XNYH 4Z8FH 3MOBL 1KELH 5TF0A 1QBML 3SO5A 4YHOH 3QBTB 4DKFH 2C3VA 2OS7A 4JQVA 5CMAA 1DSFL 4P2OA 5FV2A 4OCLC 1HXMB 3GM8A 3OMZA 1NSNL 2C3VB 4P2OB 4LSUL 1H3GA 2BZDA 4J3SA 2VXQL 4WCYH 4C59B 5SV4A 4YQXL 4F7EA 4KV5E 4S1SL 3EW3B 3MRLA 5GZOC 5JHDA 3TIEA 5DQDH 4W70A 3K4DA 4OD3H 4F7EB 3MRLB 3OTTA 5JHDB 5D6CA 5B38A 5I15H 4RFEA 5HHXL 2YZ8A 4DEPB 2VDOH 2DWDA 4NQDE 1Q9LA 2PO6C 3MLTA 5D6CB 1VCAA 4YHMH 4ODXB 3SDAB 5B38B 5L9DL 2VE6A 5E2VH 2HFEA 3AS1A 2FJFA 4XCCH 1KIRA 1IGCL 2AEPH 4KC3B 1CS6A 1Q9LB 3DX9A 4CBPA 3MLTB 2XPGB 4AMKL 1PKQA 1DUZA 2VLJE 4F2MA 2FJFB 4WFHD 2FECL 2WUCH 1M7XA 1F11A 4YDIL 2X4UA 5E6YA 5BOZG 5GIRB 1EUUA 3BISA 3SGJC 3P73A 4TSCH 1F11B 1ITCA 5IB5A 2X4UB 4N0YH 3IDNA 1BVKA 2DQJL 3P73B 5HJ3A 1F58H 1FQ9C 2PYFA 5DURB 2WK2A 2WBWB 2XZQH 3NCYP 4JFED 5HJ3B 1CDIA 2NTFA 1J1XL 2OLDA 4M43L 1ZS8A 4XBEL 5D8JH 3DVGA 4HZLA 2NTFB 4TTDD 2FX8H 3MJ9L 1ZS8B 5MHSD 3G6AA 1MFAL 3W9DA 4AM0B 3DVGB 4HZLB 2R4SL 3Q1SH 4NSKB 3R06A 2A1WH 2B4CH 3W9DB 4Y0GA 1P9MA 2VLKD 1IC1A 4RAVB 4U1MA 3R06B 5F3BB 5A43C 1ONQA 3WJJC 2X9XA 1O0VA 1YJDL 4ORGA 3CSBA 4U1MB 5GHWH 1DLHB 3GMMB 1LP9E 3TT1L 4ZNCD 4ORGB 4FQIL 1FIEA 4MCYA 2A6DB 1MOEA 1A21A 2DN7A 2J1KA 3O8XD 3RVXC 1MCPH 4HK3J 4N0UE 4TUJA 1QQDB 5F6HJ 4UILL 4K3HA 4MCYB 1CLYH 1VFOA 3S9DB 2R29L 4OV6F 4IM8A 1N6VA 3F12A 4GLRH 4UQ2A 5DMIL 1J0KA 4PRNB 5LXGH 1DN2A 1L6XA 1T2JA 1FFPB 3F12B 3GMNA 3RWJA 2ZG2A 5DGQA 5EC2A 3V6OC 3MRHB 1G7MA 4UQ2B 5B8CA 1FAIH 1ZANH 3GHEL 5HHOD 3GMNB 3RWJB 2FWOA 1BZ9B 4ZFGL 1LD9A 4O00A 5EC2B 1G7MB 1J7VR 1KCRL 4LLMA 4TVPH 1KFAL 5KVDH 4MNQD 1MLBA 5IESL 1MI5D 1LD9B 2HFFB 4AQOA 5LQBL 2EH7H 4NQSA 1IAKA 3TV3H 2BCKB 3VDCA 3EDDA 1MLBB 4YDLC 5CP7A 3VXRE 3TJHD 1DFBH 5BW7C 1IAKB 2YN3A 5DZOA 3EYFA 5CP7B 4QLRA 1ACYH 1CZ8H 5JIHA 6FABH 1CIDA 3GMPA 5JPMA 4X4MA 3T3ME 3EYFB 4WFEE 4WI7A 3GMPB 2GCYA 4O2EA 1G7HA 3O4OC 4GKSB 4H25A 5DD0H 4OM1L 3BN9C 1Z5LA 5GGTL 3FOLA 2AS5M 3MGAA 4O2EB 1G7HB 3S37L 4NJ9H 2NY5L 4H25B 3BPLC 3P77A 1QR1A 1G84A 4NDMA 1OHQA 2MPAL 4UUJA 4OFPA 1BGXL 4HJJL 3P77B 1QR1B 1OAQL 1EPFA 5IB1A 3I2CL 4DW2L 4MAUL 1UADC 3QG6A 1JZ7A 2CK0L 2VXTH 1AKJD 3RUGB 3CFDA 4JM2F 3UJJH 5ERWA 1RZJH 1ZEAL 1ZLSL 1U8HA 2WBKA 3IDXH 2PO6A 5GRUH 1KCKA 5ERWB 3FFCE 2VUYA 2AJYL 4MQSB 2VQUA 1CG9B 2OI9C 4N1EA 4NQVA 2PO6B 4KTDH 5BS0B 1I1CA 4MQ7A 5D7LD 4LAJH 5FB8A 2WQ8A 3S7GA 5C6PB 1NLBH 4NQVB 1JF6A 4OBSA 2XKNA 4ZUSB 4DOHB 5DFTA 2HMIC 2OK0H 5BO1L 2NY3D 3SGJA 4HC1H 3B9EA 2BDNL 3BZFB 3OAUH 3OR6A 1AR1D 1MFDL 1B9ZA 2JK5A 2OZ4L 1OM3H 3S34L 1ZGLM 3RZCC 4J1UA 3LN4A 4K9EH 4FA8A 3AVEA 2JK5B 3ZYOA 1DTUA 3GSRA 4Q9QL 1F4YL 4J1UB 5A16A 1MREH 3LN4B 2BSTB 3NAAL 3GSRB 1S78C 4MMXC 4PJFF 5A16B 4XXDA 3PUCA 5KN5A 2HKHH 2PTTB 2E27H 3MRBA 2A74B 1MFEH 1BPVA 5D96C 5KN5B 1CR9H 1YYMH 2YUWA 4UT9L 1JGUL 3V4PL 3VGHA 4KQ4L 4LCWD 4QRRE 3QIWA 1EMTL 1GHFH 3TYGL 3OKKA 3ARYA 4HGWA 1K4CA 4JKPH 5I1JL 1F90L 5C0FA 3QIWB 1ZLWK 2B1HL 1X4XA 1M6OB 1U3HC 3WJJA 3OKKB 1K4CB 4LSQL 5TE4H 5C0FB 3GBML 2MKLC 2A38A 1HH9A 1QBAA 2LVEA 5FA3B 5K9KA 3MXVL 4KKBC 4OGYH 1YDPB 1HH9B 3WKNA 1WBYB 2X05A 3RTQC 5K9KB 5JHDE 5ADPL 1OPGL 3AM8C 3S37X 2VZOA 5JIIA 2GUOB 4M93C 1EFXB 1JPGB 5F8QC 4KMQA 1NMBH 4NHCL 2YC1B 4XP4L 2PTVA 3V0WL 4P23D 2CGRH 2OZ4A 4HKXB 5BZWB 3CCHA 1MRCL 3V6OA 4M3KB 1I85A 3K8LA 3JWOL 3WEXA 1I9EA 2W38A 1JFQH 1UFUA 2GKIA 5DWUL 5C08D 4FQJL 3WEXB 4LIQH 4MS8D 4K71C 4NNPH 5K59E 4O4YL 4WO4D 4P0DA 5E95B 3RY5A 1QD0A 5HHNB 1ROWA 3UCRA 5EORH 3VWKD 3QB7C 3OJVC 5IHZA 1QBLL 2J3SA 1BQLH 4CU7A 2ZNWA 4G9FA 1UH2A 4RCAA 4BZ2H 4HX1A 4RAUA 2FH6A 5IHZB 2R4RH 4YDLB 3VA6A 1D5IL 3CVHH 4Z6AT 4G9FB 2DLGA 4PJ8D 2ICWJ 4RAUB 4BK4A 1YEEH 4K7PL 1DQJA 4IHOA 5GZND 1J1OH 4TQEH 2V2TB 3UROR 4XI5C 1FRGH 1J5OL 1FPTH 3TNNB 4HF5L 1BM3H 1F4WH 4OQTH 4RMQA 2ADIA 3WKMH 4KXZI 3ARUA 3ARWA 3QUZD 5HDBE 1GIGL 5DEFA 1H15A 3H0TA 4ZQKA 4KZDL 4FTVA 1D6VL 2UZIH 2DM7A 3VFNA 5DEFB 1H15B 3H0TB 3NIGE 4ZQKB 2CKBL 4FTVB 3BI9X 3VFNB 3AY4A 4FQ1H 2YD7A 4XC3L 5E9DA 3OPZL 4DGYL 4UTBH 2C7UA 4J3OC 5EBGA 5I73C 5DD1L 1OLZA 1NKOA 5E9DB 4MA7H 3QULA 1NGZB 2QHRL 5E00B 4M7LT 4RMUA 4C54A 4PP1D 4NP4H 1SJXA 3QULB 1X5FA 1IKFH 4POZC 5F9WC 1ZVSA 4XC1H 3MA7B 4X7SL 3E6FB 3SCMC 2Q3AA 2ZCLL 1F8TL 1ZVSB 4K3EH 3TIDA 4YK4B 3OB0K 3E0GA 3WJLC 1YUHA 4HUVA 4D0BA 5F3HB 3MRNA 1AH1A 2Q1EA 4CRPA 2BHZA 3QPQD 4TNWF 5EU5A 3ZKMD 1YUHB 4HUVB 1NAMA 1JHKH 3OBAA 1IKNC 4G6JH 1R3HA 3TWCL 3MRNB 3T0EA 4ONOA 5AAMA 2FJHA 3K8KA 4K7PY 3AB0C 3Q6GL 1AQKH 1YMHA 2FEEI 4ZPVB 4KK6D 4MHHG 5CEXB 1R3HB 4G6KH 4NUJA 3T0EB 1KJ2H 2FJHB 5TQ0L 3QFDB 1MUJA 3T3PE 1FG9C 1U91B 4XP9L 1VPOH 4NUJB 1KGCD 1AC6A 4OLXL 4N0CC 4JN1L 1MUJB 3SKOA 3FRPA 2F8XC 4PJIA 4KY1H 2OP4H 1RZKH 3UTSD 3KYOA 5KSBF 3NZHL 4NT6A 3TBVA 2EO9A 3DXAB 4PJIB 3RKDC 2UVFA 3WDJA 4NN5C 1MIMH 3BEVA 1GGTA 4P4KC 3KYOB 2EKJA 3TBVB 1HZHH 1U3HA 1I7TB 2FX7L 1X5LA 4G43A 3KYKH 2Q7YA 3IAQA 1I7UA 1U3HB 1X6LA 3BP7A 4J4PC 4N5UA 4CDHA 4G9DA 4G7VL 4G43B 4K7PX 1H8NA 3W2DH 1PAMA 3OX8A 1QEWA 1D5XA 3LQAH 4H5SA 1I7UB 12E8L 2IFGA 4HIIB 1YPZF 1RZ7H 4U1IA 3OX8B 3RTQA 1QEWB 1D5XB 3MUHL 1GGCH 4H5SB 3QPXH 3AM8A 5CIPA 1QYGH 1GVIA 3RUGE 4JE4B 4N68A 2X7LA 1B3JA 3OKOB 1G6RH 3KPRD 4U1IB 5LGKA 2ZSWA 2D0GA 3DUHA 5LBSH 4M93B 1CL7H 4R4NC 2QSCL 2X7LB 4NNXA 1RU9H 3WHE1 2VYRE 1FGVH 3TBWB 4E41D 3FQXA 5BS0E 2E9JA 3FO9A 2NZIA 2VOTA 3ORJA 4HKJB 3FQXB