1QSZA

The vegf-binding domain of flt-1 (minimized mean)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hormone/growth factor receptor
molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 1
publication title Solution structure of the VEGF-binding domain of Flt-1: comparison of its free and bound states.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 101
sequence length 101
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 1999-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qszA00
2FB4L 2GK0B 2RR3A 4AQOA 1I1CA 2AW2A 1CICC 5IVZA 3FQTB 1KCVL 1NEZA 4PLJD 4UDTB 2AV7B 4QCIB 3DXAB 1N6VA 4PJXA 4QF1A 5FECA 3CNKA 1DLFH 5LAXB 1KJ3H 5IB3A 2NZ9C 1OARH 3JZ7A 1FYTA 4ODXA 4F9PA 3KPSE 4R4BA 5TDOA 4OD2B 3KYAA 3KLSA 5C08E 4QHMB 3K1DA 4Z6AT 4NM8L 5K9JL 3WFZA 5DJ8B 1A9BA 2R1YA 1MI5B 4MD0A 1NCWL 3OSKA 2OLDA 3QDGB 4OCXH 4HUXB 4FFVD 3F8UB 4L4VB 5I1LA 1K5NB 1YEFL 3OX8A 1J8HD 4P2RD 5EN2B 3MV7A 4L3CA 5IW1A 4G6MH 5T3ZD 1OAKL 1JGEA 4JFFB 5F6HI 4J3VA 2BNQE 3EKCA 3NABH 3HUJB 3ZYOA 1OL0A 1MAJA 2SEBB 1FAIH 3IDIB 3VD7A 2J8UF 4U6VL 4Y4FA 3NPSC 5FUOL 5DD1L 2E27H 4KVCH 4X4ZA 3C2AL 2AEWA 2BHZA 3NZHH 5JUEH 5HI3C 5DD5L 1MVUA 4WU7B 4WW1B 3ZE0F 4O5LH 4M93B 1UH4A 3GJEA 4MXWH 5D70L 4WO4A 5IGXL 3D5OF 2RGSA 1KCSL 1R24B 1AXIB 5D5ME 2OCFD 4YNYA 2EC9U 1MHEA 3BP4B 1S7SA 5E6ID 4NO3A 4K7PH 4U1HA 5MENE 4EKXA 3IFPA 1KC5H 2FHBA 2K3TA 4AT6B 2PXYA 3KPOA 3REWB 4X4ME 5IESH 2A0LC 5D72L 2D7PA 2VLRD 5HI5C 3O9WD 2MKWA 1HXMB 4KWUA 4S11A 2ZSVA 3TBSB 4MCYB 4PGEA 3LKQA 4YHZL 1U8KB 1XGTB 2JCCF 2KZWA 4LVOB 4I1NB 3QO0B 5FKPB 2PXYC 3GJFB 3VCLA 4Z7UA 5CHNB 2E8YA 1WF5A 2ZPKH 1LK3L 4QEGA 2EE9A 3NVQA 1CCZA 2ED7A 4Z7NE 4KRNA 4R4FL 4FQCL 2BCKA 1X6NA 3LRSB 1ZV5A 3EYUH 5IM7A 3L5JA 4J3TA 1KSRA 2ZOKA 1I9JH 2FBJH 1DDHB 2OJZH 5DHYA 1AQKH 2YWYA 1GPOH 3MC0A 1N6QL 1M4KA 4TVPH 5JHDA 3UCRA 4JO1H 1ZHNB 2XTJD 2HFTA 1I8MB 2NMSA 4WI7A 5HY9A 1SBBA 2GY5A 1UKTA 3BN9C 4M7LL 1IJ9A 2BRRL 1JWMB 1RJYB 1ZHBA 4DAGL 4Q9CA 3K1KC 2IBZX 4KXZI 2VLJA 4ONHB 1NCCH 3RWDB 5GS0H 1HXYA 3SGJC 2X2YA 4RMVA 4X80L 1A7RL 4O4YL 2H8PA 1YEGL 5DRWB 1K6QH 3EFFB 3DYMA 4O00A 1OAYL 4K71C 2IMNA 4I8DA 2KQMA 1LGVA 5CILL 2EDXA 3PP4L 4M9OA 1CFQA 1YEJH 4CRPA 5D2LA 4WI6A 1KCRL 4QOKB 1GC1L 1MIEL 5KS9F 3DSFL 5ADPL 4MA1C 1L7TL 4UAOB 2H32H 3SCMA 2JB5H 5CZXD 3N85L 4LHJB 1YY9C 1D6VL 4LLWB 1K85A 4G6JH 4XNYL 5D93B 5D7IB 2Q3AA 4XPAL 3EOYG 1WAAE 2X4RA 4UIMA 4NQED 3SCMC 5IBLD 1HQ4A 2JJUA 4QY8B 3NTCL 3LV3A 4AH2A 1T1YB 4M7ZB 5DSCB 4Q6IA 2BSTB 5FCUL 5KG9A 4GBXB 4Q2ZB 2J6EA 1FGNH 4R97B 1P5UA 3DROB 2IPTL 3HS0B 4NRZA 2IQ9H 5GGSA 3RDTC 1U8HA 4AYFA 2DLHA 4HWUA 4WGVB 2ILLA 3ZYZA 2R56L 4Q6IC 2YK1H 1HSAA 5HHNA 5DYOB 5JQ6L 3SQOL 1BLNB 3VA2C 2I07A 4YEEA 3MLTA 1P7HL 3EO0B 5ERWB 3TT1L 1CF8H 3SJVB 3L5XL 1J86A 4XMPL 5IK3A 3ZE2E 1JHTB 5ISZE 2VXUH 3FRUA 2DYPA 3G5YB 4LAQH 5C07D 3KYMB 2X4PB 5KTEL 1FNFA 3DUUB 3RL2B 1T0NB 1A3LH 1ZANL 1G7HB 2DQDL 1N8ZA 3O8XD 1I7TB 1NC2B 2IJ0C 4N8VG 1XF2B 5ETUA 1GIGH 3OKDA 4G6AC 3C8HA 3UPRB 3GIVA 4HWEH 4U6XA 4LFHG 4YDLB 5HVHB 2H9GB 3VA6A 1R0AL 2N7BA 1G7MA 3T65B 4O51B 4ZXBB 1F3DH 4I0KA 2Y6SC 2V9TA 5JW4N 1XMWA 4Q0XH 1KJ3L 3GGWA 5HHOB 3VI4F 1AGBA 2CDGB 4UV4L 1IILE 4DOHE 1Q8MA 3AM8C 2APWA 1XF3B 4HZLA 4GW1A 1N3NA 4RAVB 5DJYB 3ZTJG 4WV1B 4D9LL 2X4SA 2P43B 3QULA 4CVXA 3EDJA 4A6YB 5JLZB 2P5WA 1YECL 3O3AB 3V5DA 1ED3A 3P2TA 3ZL4H 2BFVH 4NDMA 3G5ZB 5ID0B 4HKZA 4TUKL 3TO4C 4H26A 4HJJL 1J1XL 2NY1D 1CGVA 4E41A 1S7UB 4E0RB 2OR9L 5C8JB 2JLLA 4LLYB 4DGIL 4EUPA 1QSFA 1CD1A 2E9IA 4IJ3C 2LU7A 2LTQB 5DJ6A 3BT2L 5EZOH 4IRZL 4NC2B 4OZGE 2ADIA 1LP9F 1FFNB 3KR3H 4GMSH 2YKLH 1WGOA 4Z7VF 4KFZC 4YHKL 1FJ1A 1QFOA 1U8JA 4QXTA 3EYVA 3PWNB 5I76A 1NC4A 4JVUA 4LDLB 4XCNA 3PL6D 1U8IB 2YD6A 4FQHA 4WHYH 3JTSA 1EGJH 2DN7A 2ZJSL 3ELAT 3LCYA 3O45B 3ARFB 4KROC 1VSCA 5C70A 3RY4A 3EO1A 2Z92B 4IIQC 2ITCB 2YRPA 4NUGL 3ARDD 1OF2A 4UOJA 5J7CC 3O2VH 2X05A 1MCCA 3NMEA 1RY7B 3QG6B 4BFEA 1YQ2A 1OW0A 1WJ3A 3WIFB 1AO7D 3K8MA 4YR6A 3UJIH 5J3HC 3VXSB 3WJLA 4X98A 3W9EA 2GJ6D 5IESL 1GGUA 2EKSB 5FK9B 5E56A 3DUHA 4OCWL 4EVNA 3QXVA 4XI5D 3BPOC 2AJUH 35C8H 5FEBA 4YO0A 1OW0C 1RULH 1WBYB 2NW2B 5GZND 3VXUA 3FFDB 4XCCL 4ZFZB 3WJLC 4ZFOA 3H3PL 4X5WA 4FABH 5FYJU 4OIAA 5DO2C 1NFIA 3EJYC 2XZCH 3KPTA 4KDTA 1BIIA 4DKFH 2YUZA 2DWDB 3BMVA 2YSSA 5B39A 5HGHB 1A47A 3EJZD 1URLA 4P2YA 4J6RL 1O0VA 4JB9H 2DQCL 3MYZA 4F8QA 2HN7B 3EYUL 1D6EA 1MVFA 5C0GA 1A6VH 5B22A 4ISVA 1AC0A 4YHYB 4KDTC 5M95B 4WTZA 3L3HA 3SO3C 4HBCL 2FATL 5I1AB 3QEQA 4HUKB 4TVPL 1A6ZA 4JO1L 2UWEF 4JM4H 4LCWB 4PBWD 3KLHD 3OHXA 4TTDC 4XBGB 1KENL 1JK8A 1XGYL 4ODHL 3U0TA 2F19H 3O6FA 3V6BR 1E28B 1DN2A 5IVXF 1HHKA 3QDJB 2IAND 1DZBA 3O6LL 1YC8A 1HWGB 1S7QB 1D5ZA 1A7QL 2Y9RT 3KVQA 4ODUA 5GRXG 4MA7H 2F5AH 3VDAA 1AR1D 1BBJA 4M6NL 1WBXB 5C86A 3PP3K 3S3PA 4LLUA 1IGJB 3S98A 3M1BB 1PQZB 4ZUUB 5IOPA 3TIEA 1LMKA 3F58L 2G5RA 3CSYB 3UROR 3SGDI 3DV4B 3MRJA 1KB9J 4R4ND 3I2CL 1RSFA 1MJ7L 3CMOH 3OV6A 2J8OA 2AABL 4JRXD 1P84K 4X6CF 5GGVL 5C3LD 4GW5A 5CEXB 2DIBA 4GRLD 1T7WA 2V2WA 4EI5A 3GSXA 4PJGE 2PW1B 2WWKT 5JXED 4NQVB 3HZKA 1FIGH 1M7DB 1SJHB 4WIQA 4ZS7H 3D39A 2V17L 2Q3ZA 2NZIA 1KPRA 3G6JF 1JZ5A 3V6ZA 2EKJA 3I84A 3KPRA 3JWOC 5JIIA 3HC4L 2IQ9L 1FZJB 4IBLT 1D3CA 5FO8A 1BD2E 1CZ8H 3L3IB 3DTXB 3GZKA 3QI9C 4H20H 4LSTH 4ODVH 5C0CD 4MQ7A 5F93C 2YK1L 4RFNC 4XCEB 5F9WB 2EZ0C 3HR5B 1QEWA 3QFJE 4C83A 2VDML 3MRHB 1QSZA 4OZFH 5DMKB 1DBKH 2ITDA 1DVFD 1GGCL 5IQ9A 4GO6B 6FABL 1ITBB 4AENB 2YPVL 5DUMH 2E3VA 1FFOA 4MJID 2WUBH 5HI4D 2EXYD 1GIGL 4L8DB 3JV4A 3WN5A 4OSUH 2XRAL 4XWOC 4HIHA 3VFSA 5EWIH 5DK2B 2XZQL 4DZBA 3GKWL 5L88H 5J13C 2Z91B 3PWPD 4X4XB 5DJ0B 5KVEH 4Q9RL 3WN5C 3QIUB 3QDMD 3LKOB 1U8PA 3LPWA 4LCUB 2VIRA 4BH8B 4ZNEE 5TDNB 3RWHA 5EOCH 1XIWB 2IPUK 2IG2L 3QCTL 1C7SA 1YEKL 3B6SB 2FJFB 5EUOE 3QXDB 5BS0B 3MRGB 4H5SB 4CU7A 2APFA 1GAFH 3ES6A 4URTB 1OSPH 2BFVL 1N2RB 4OF0A 4X0KA 1QFUL 1EVTC 2ADJA 2BY2A 3KPSD 4OLXH 5E8OB 2CXKA 1N7MH 1UXWB 3CUPA 4JPKL 3SKMB 1UZ8B 1S7VB 3LEYH 3B9EA 4GMSL 3ARRA 3ILPA 1BFVH 3DSNA 1W8OA 5I75B 1DBBH 4X99B 1XZ0A 4LVNC 1Q9OA 1PKQE 3HHRB 1BWWA 5HVGB 2HMIC 2WINB 1EGJL 5L2KE 4PJ8C 5D9SB 2BNQD 3M07A 4R90L 4S1DC 1OGAA 1ETZA 5BJTA 2D7QA 3GI9L 5HPOA 1OOAA 3RX5A 2UZXB 1A6PA 4YHML 2DLIA 3MRPA 4DKAA 5DQ9A 4XP9L 4S1RH 4ELME 2NYYC 4K7FA 3O2VL 5C0BE 3BRFA 4FQJH 5CD3A 1KG0A 3NCCB 1VFAA 4GKOA 4ZODA 4ZTPL 1OTUD 4WW2F 5ACZB 5I6XC 5J9PB 5DR5H 3P9LA 3HC3H 4BSWB 4LNRA 5JHLL 1MCOH 3U83A 2QL1A 4YHIA 4LOUC 1PEWA 5JPMB 2QHRL 2X4NB 4MAYD 4FABL 2VH5L 1A5FH 5MEND 2XZCL 4IHOB 1BZ9A 3GMLA 1JGLH 1I1YA 3ZHDA 1FLTX 3P4OA 1E4XH 2CLZA 3DHMA 5J8OA 4PS4H 5ANMB 15C8H 2ADFL 3IDNB 5I66B 4KUCF 4XZUB 3GSNH 5FO7B 3DBXA 3EYQD 2EYRA 3R1GH 2R9HC 1MHHB 3T0VA 5CINH 2YOCA 1I9IH 4PTTB 3JWOH 5F96H 2YD5A 5C2UB 4I2XA 4IRJB 5CBEA 3SDYH 1E4JA 2F19L 3QHZH 4H0GA 3AS0A 4PR5A 2P5EE 5GS2D 2YRZA 3OF6A 2G5BB 3QNXA 1JPFA 1I9RH 3STLB 1MWAA 2J6EL 4YFLI 1MQKL 1KGCE 5CWSA 3KXFE 2DQGL 3PV6B 3HE6B 1XGUA 3MLVH 3RJDA 2ZUQC 2XKUA 4KQ4L 3RVXD 2CGRL 2YEZA 4PP1C 3TFKC 5SX5K 3B9VA 3H9HA 5INDA 1TXKA 5DUPL 4OFKA 1BBDH 4LBEA 2JELH 4JY5L 3TJEL 1AGEA 2NW3A 4PJHE 3T04D 2DQFB 2Y5EA 3MV9A 3BP7B 1ZA3B 3A0OA 2OTPA 1F2XK 2GK0A 1FG9C 3MOAH 1NGZB 3LQAH 3NA9L 3SDCC 3V7AG 5HVWA 4OLWL 4UDTA 4XBEH 2AV7A 4QCIA 3D25B 3DXAA 4QXUL 1RJLB 1V3MA 5LAXA 5MEOB 3FZUD 2J88L 4NYLB 1AXSB 3AY4C 1I8LC 4LLAA 4XC1H 1CZ8L 2CJUH 5EPMA 5EH1A 3IETB 4OD2A 4JLRB 5EOQH 5IG7B 3QUXC 1SYSA 3VD5A 4KMTH 1J0IA 1RK1B 4NKIH 3W82A 5DJ8A 3OQ3B 2IH1B 4UINH 3UBXG 1HYSC 1KT2B 1ZWIB 2YZ1A 3QDGA 4JPWL 4HUXA 2QV2A 4OZIF 4U0QB 5FYJH 4L4VA 4TNVF 3ULVE 3T0EC 5DUML 1K5NA 4YBQD 3BKCH 4Y19E 5EN2A 4OJFL 4X6BA 3MA7B 1OWWA 4PJIB 4JFFA 4P57B 4OSUL 2IQAB 5E2VH 3OTTA 2SEBA 4FQ1H 4HUNB 3E3QC 4U3CA 1C12B 3IDIA 2EC8A 3GBNH 5B4MD 5EWIL 4L1DA 2NY7L 3IFLL 2D7TH 4PJDF 5L88L 2H1PH 4U05A 5JTWA 2IAMC 5LCVL 3P0GB 2AEQL 1HIMH 2YHGA 4HUWA 1LE5B 3GI8H 5GGTH 3GEWB 3BE1L 4WU7A 5EOCL 3ZZ1A 2XV6B 1IAMA 1FFPB 4XH2B 3CSBA 1EHAA 1NGXB 1R24A 3LD8C 4MVBC 2IFFH 3U82B 4EN3D 1KIQB 4QNPF 3BP4A 4M93C 5DRNB 1VCAA 1BVZA 4KJPD 5I16A 1TMCB 2OTUB 4UUJB 1KTDB 2XQYK 3CDFA 2PO6D 4M7JL 1YQVL 4AT6A 2OZ4A 3REWA 3L6FB 3FN9A 1KBGH 1JYXA 1MIML 2B5IB 1HXMA 2NXYB 3A67L 3TBSA 4MCYA 1NBZA 1PFCA 1U8KA 5D71H 1CIUA 3QO0A 5FKPA 3GJFA 4FQXD 3H7BB 5CHNA 3STBA 4KJQD 4D0CA 4ZFOL 5ENWB 4ZMAT 4S1QL 1B4JH 2ZSWB 2BVQB 2WLZA 3I02B 3LRSA 3BFOA 4LHUD 3C08L 4LVOC 5DMGC 1DDHA 5EU4A 1UT9A 1JZ6A 4MD5A 1ZHNA 3DVFA 4CVUA 3ZLQC 4WEUD 5T1DH 5DJXA 3U7AA 3M17B 4FQJL 5KSVB 3BP6B 3QH3B 5H35B 4MZ3A 1JWMA 1RJYA 3I50H 5CJQH 5KVGH 3RWDA 1BVLB 4HGKC 1VKXB 4N8VB 5IHUL 5DRWA 3FO2B 3B9KD 3UO1H 5CGTA 3EFFA 4BK4A 2QSCL 5DD3H 1OSZB 4P4RB 1RPQA 1MCOL 4YH6A 3RZCB 3MREB 4QOKA 2WV3A 1Q0YH 4P23D 1LWRA 2IPKA 3MUY1 1JGLL 4NC1E 4F58L 1F8TH 4L4JA 2EDLA 4IRSC 3LZFL 2QSTA 4LSSL 4H8WC 2Q76B 4M1GL 1LO3H 3SPVB 3RAJL 2VDRH 4BUHA 3QEUB 3RVVD 3VDBA 4LLWA 4F57H 1UWXK 2C4XA 5D7IA 3VFMB 2O5XL 2V2XB 4UAOC 1QTYT 2CIKB 3JWOL 4QY8A 3MRIB 3V52H 2VAAB 4NQDD 1T1YA 4BQCA 3QHZL 4K7PY 2BSTA 1BQUA 4GBXA 4XNUH 1O7SA 3DROA 3HS0A 4LU5H 1IZJA 4BSVB 4GLRH 3O6MH 4KKLD 3P11H 3BKYL 1GXEA 5DYOA 5H8DA 3L9RB 3U46A 4MNGB 1RURL 3EO0A 4RAUA 2XTJC 5ERWA 4OF7A 3SJVA 1U92B 2ZP0T 4I0CC 3MXVH 1JHTA 4Y4HB 3AUVA 4R7NB 2H2SD 5F72S 3G5YA 1AD0B 1E4WL 2X4PA 3KYMA 3DUUA 3OGOE 3RL2A 2GW5A 1T0NA 3K2UL 3U0PB 5I8CB 4XVSL 1NC2A 1XF2A 1BF2A 2GT9B 2OXGA 3J8F7 1X5GA 1MRDH 3UPRA 2K9UA 2H9GA 2CR3A 2HKHH 4J1UB 4JGUA 3T65A 4O51A 4ZXBA 3LEVL 1WWBX 3SEPA 4PJ7E 1A1OB 4PRHA 3HR6A 1T1XB 1DN0B 5HHOA 1LO5B 2CDGA 2HFGH 1UWXH 2CIIB 1T80A 4ZXBC 3LIZH 2E7HA 3HKFA 1XF3A 2CJUL 4RAVA 4WV1A 3FJTA 2CMRL 5CEZL 3PXHA 2FECL 5T3XE 5JLZA 2CK0H 4EQ2A 4UINL 3O3AA 4OGXL 3LSOB 3CAFA 3HPJB 4I0PD 3VFGH 4P4KB 4PJFB 3G5ZA 1EHNA 4LASH 4YDKL 5ID0A 5IMLA 4WV1C 1S7UA 2A1WH 4E0RA 4TSAH 3BKCL 5C8JA 2NY2D 5BV7B 4ZPVB 2EC9T 5FV2A 4PJBB 5JOPE 2NCMA 1A1MB 1HILA 1NQBA 5JW3H 1FFNA 3TCXA 2CKBH 4ZS6D 4OM1L 3QFJD 3GBNL 1GHFH 2R2EB 5HYJB 2H1PL 3PWNA 1Q94B 1U8OB 4LQ1A 2NY3B 2VN4A 1OAZL 1U8IA 1HIML 3EFDH 5T3ZH 3GMRB 2DQIH 2BZDA 4JO2H 4PJEA 2D0FA 1U9KA 1OTSC 3JBG7 4R7DB 5EIIB 1U3HB 3TBWB 2GTZB 5C7XH 3O45A 3ARFA 3D69B 3C09C 4QRPE 2Z92A 4HBQA 5DEFB 2ITCA 4M8VA 4K07A 3IDUA 4CL7A 1TJHL 3O3BB 1NCUA 2XY1A 5EU3B 3WIFA 1KPUB 2XXMB 2QQNH 3VXSA 3B9DA 1AQDB 3MCKB 2EKSA 5FK9A 3NCMA 3C5ZD 3O0RL 1A6WL 3ARVA 5M94B 1WBYA 2NW2A 4CVZB 4Z7VB 3FFDA 5D71L 2W0LA 1RMFH 4ZFZA 3LKPB 3L5HA 1N5YH 2DTSA 4WJ5A 2DWDA 1OD7A 2VXTH 5HGHA 5IFAL 3LVEA 3Q5TA 4RA0C 4Y5YA 3DO3A 5DD6B 4BQ8A 3BDBA 4Z7NF 2D03H 3VRIB 5J0BA 4YBHA 3CVHB 4CGTA 4G8GB 1JMZA 3B8SA 4PJDA 1WTGT 5I1AA 3MO1A 3UTTB 4LCWA 4HK0B 5L2KD 4XBGA 4Y5YC 2VKXA 1E28A 4HK3N 2BOCB 4YHYC 2F53B 4XT1C 5KVGL 2HH0L 3QDJA 1A7PH 5K9OB 1S7QA 4Q9QH 2VZUA 2BNUB 1WBXA 5J57B 2P24B 1IQDB 1TTGA 3R8BB 1XCTA 1MWAL 3DYOA 5L8JB 3M1BA 1PQZA 4ZUUA 4PGBB 3FQRB 4XB8A 4OD3H 3V6OE 5L0QB 1T66C 4XVUD 1UWGL 3CPLB 4Z7WF 3CSYA 2LABA 3DV4A 4X7TB 4R0LB 2WANA 3PF2A 1BM3L 1LO3L 4LSVH 3R4DA 2FNBA 3X3GL 4G7YH 3B5TA 2ENSA 3BKMH 2A9NH 4KPHL 2BP3A 2PW1A 4XI5C 3ZTNH 2A2QT 3JV5A 1EUUA 4NQVA 1UYWH 3UYRH 2E6PA 5GZNC 1QBAA 1M7DA 1SJHA 2FL5B 2GYSA 2Z8SA 4KJYB 4M6ML 4K9EH 2EO9A 5L6YH 4LP4A 4PJCF 1FZJA 4LU5L 4R6UA 1XCQB 4NHCH 3CIQA 5I1GL 3QPQD 2J12B 3L3IA 3DTXA 1F4AA 4H1LG 1Q9KB 1JPGA 2BX5A 3AXLA 1FNHA 3RPIB 4C4KO 4XCEA 1M7XA 1VADB 3EOAB 1CL7H 3HR5A 4PYGA 5H37G 3KLHC 4IOFC 2XXCB 3MRHA 1P69B 5DMKA 2P5ED 1Z9OA 5C0NC 3FCTB 5GRYA 3K4ZA 3MJ7B 2Z31B 2KQNA 4AENA 1I3VA 4K94L 3ZE2F 1KGCD 3KXFD 2MFNA 1AE6H 1J88A 3C6LB 4L8DA 2CUIA 3KS0J 4XCFH 3NCEB 1FZKB 5FHAL 4TSBL 3WIIH 2F74B 1FL6B 5DK2A 2NLJB 3OMZA 4OLZL 2Z91A 2OS7A 4X4XA 5DJ0A 4LLMB 1L6ZA 1IFHH 1S7RB 3QIUA 5E8EB 5GRJH 3V2AR 4RWYL 4LCUA 4R2GC 4R4NC 2VL5A 4ZYKB 1CGSH 5TDNA 4ONFL 4LP5A 3ESVF 1I3GH 1XIWA 1BHGA 3NPZB 4PREB 4F7MB 3M45A 3B6SA 1CXFA 3QRGH 4OF3A 2FJFA 2OL3B 3QXDA 2YPLB 3VDCA 5BS0A 5JXEC 2AVGA 4ZUVB 1J8HB 1LO2H 3VFGL 1EZVX 3QUMB 1WITA 1XIWC 3JWDC 1N2RA 1E4KA 4KAQH 2E8ZA 4UBDD 1CK0H 1ONQA 1I7ZB 3STZB 5E8OA 1T7YA 5DEGB 2NQCA 2A9ML 1UXWA 4XP1H 5SX4I 3O41B 2F9BT 2XKNB 3SKMA 1UZ8A 5JW3L 5DZNA 2R1XB 3MUZ1 1F02I 1S7VA 1DFBH 1FVCA 3FT2A 4K3GA 4XXDB 3TBYB 2OZ4L 4OCYL 4G8IA 1F58H 1ZTXL 1VFBB 3F12B 4HMCA 3VGDA 4OZGF 3X11B 2EDWA 1HKLL 2K7QA 3MRNB 1DVFC 4EEEA 1E0OB 5F6HJ 1HSBB 5FXCH 2WINA 2DQIL 1FORH 5GGUB 5F6IB 4KGLA 3QISA 3EO9H 1YMMD 1IGML 1UH2A 1D9KB 5DVKA 3OZ9H 1KXVC 2HLFC 4ZDHB 4Y1AB 1DJSA 5T1KD 3HAEH 2DTMH 2E5EA 4WUUE 4JFZL 2OR8A 2FX9H 4UU9B 2VLRB 4ENEC 3PGDB 3O9WB 3WLWC 4XPFL 3L3GB 1UH3A 2QQNL 5FOJA 4QYOB 3MA9L 5ACZA 3PQYB 4ZFGL 3MGAA 1KACB 3C9NB 3ZSSA 5J9PA 5E2WH 3LQMA 3UBXI 1FHGA 3K0WA 4BSWA 2WW8A 3ZHLA 1U41A 3TYGL 5JPMA 1BOGB 1QBBA 2X4NA 5IT2H 1MOEA 3QQ9D 2WBJD 4H8WL 3KPQB 5FUCE 1TTUA 4IHOA 1JGVL 2ESVB 1U3YA 4RMWA 3BDYH 3QFDB 1TCMA 3MUHL 4DKEL 3SDAB 3E0GA 3HMXA 2VZ3A 4UT6L 5ANMA 2R2BB 5I66A 4XZUA 3C8DA 1BAFL 2W1NA 5FO7A 1MHHA 1QBMH 4LL9A 4PTTA 4ZO6A 5FA4B 5GJSH 5HYQA 3UBXB 1NAKH 4YDJB 4Y5XB 3D48R 4IRJA 2EIBA 2JIXB 2P44B 3INUL 1I1RA 3DX7B 3QHFL 5C0AE 2G5BA 3C60A 5C6PB 4GFTB 4XNXL 2BXZA 3STLA 1I4FB 4Q9QL 4F7PB 4WEBH 1Z3GL 3ARBB 4KRMB 3HE6A 2Q1EA 4IRJC 4HWBA 3RHWF 5SWQB 1WEJL 4RMUA 3UMTA 3C60C 2AXGB 1T83A 4ZFFA 4AL8H 1K3ZA 1KTRL 3IFOB 5D4QA 4ZSOB 1JI2A 3HE6C 1VEOA 4FMKA 4MB3A 3VXME 4POUB 3QCUL 5F9OH 2DQFA 3BP7A 1BZQK 1OTUC 4DUXA 1T83C 4YLQT 5EU7E 1NGZA 3LKSB 5A2IH 1C5DB 3BKML 5BCAA 3SDXE 4S2SB 5IJKA 1JIBA 4KQ3L 2QHLA 4JDZB 1UYWL 1KJ2B 1P2CB 3H42L 3CLFH 3MLRL 4PJ5A 4WY7H 4XAKE 1NPUA 3D25A 1RJLA 4J8RB 1MREL 4XP6L 5MEOA 4M1DH 5J12B 4FQ2L 4NYLA 1AXSA 2CLVB 3FFCE 4FZ8H 1PD6A 5L6YL 3T77B 2ICWI 2A83B 3SQBA 1NSNL 1FVDA 2YMXL 3IETA 4FS0A 3MLXH 4R3SB 4JLRA 3KDMB 2XTLA 3JWDH 5IG7A 4MCZB 1I7RA 4KMLB 4N1EA 1RK1A 2IH1A 3EOTH 1KT2A 1ZWIA 1FNGB 3CXHJ 3Q1SH 3VFPB 5C09E 2EH8H 1NFDB 4GAJL 3I3BA 4GS7B 3MA7A 1D5BB 4PJIA 1Q1JH 1NUGA 4P57A 5E2JA 5DQJA 5F7EL 3WL9B 2IQAA 1XGQB 4G43B 5IBTL 4DKDC 5ILTH 5IEHB 3CFDB 1CD0A 4WTWA 5GRJL 4NGHH 1LE5A 1T5XB 4O9HL 1T2QL 3WBDA 1X9QA 1XR8B 1CGSL 1CD9B 1YNKL 1H0DB 1QFHA 4PJ9A 3SE9L 1R5IB 1Q9WA 1BIHA 5ALBL 3VG0H 2X09A 4FQIL 4OLUL 2CUMA 1FFPA 4XH2A 2F8OA 2X1QA 2XKSA 3LRHA 2NY1B 4M3KB 2HVKB 1R3KB 1NGXA 4APQB 2DQJL 2O5YH 2B2XL 4UQ3A 1KIQA 1SYVB 4P46B 4L4TE 4PJ9C 3M8OH 3QR2A 4XRCB 3KPMB 1M6OB 5DRNA 5HVFB 3VXNB 3FZUC 1VPOH 2OTUA 2AJYH 1KTDA 4UUJA 3TH3T 4TVPE 2R69L 4UV7L 4D8PB 3L6FA 4NN5B 1LEGB 2O5ZH 5T3XD 4Z5RB 1NGYB 2DBJA 4J4PA 4OZHB 5TQ0H 4ZAKD 1S5IH 4B7LA 1KULA 3RUGA 1PLGH 2VDKL 4NQUA 1TVHA 5BRZE 3DMMD 2BOBB 5CP7B 3H7BA 3QZWG 2OP4L 3MLYH 2DLTA 4MMXC 2B5IC 2D9CA 4J4PC 1T4KB 5ENWA 4DGYL 2ZSWA 2NXYC 5D2NE 2BVQA 4HXAH 3I02A 3WNLA 4X8XA 3LN5B 5LQBL 5FHBL 5F97E 3MR9A 1MCPH 3EDEA 3CXDL 3ARDB 3WNNA 3TF7C 3P4MB 3O81A 3SDDD 1AHWB 2BY0A 3RKDD 3HI1B 1N64H 3LB6D 1RZ8B 3WUZA 2XN9B 4Y2DD 2GJ6B 3ULUC 3DGCR 3M17A 4M48L 1ROWA 3BP6A 3QH3A 5H35A 2X89D 3W2DH 3MLUH 1KLFA 4NCC2 1D5XB 1BVLA 5D1ZB 5E2UL 1VKXA 4N8VA 5DTFB 3HI5H 1OAXH 5E9DB 4YUEH 2J4WL 4QRPD 1QSEB 3H6JA 4WI3A 1OSZA 4P4RA 2VZOA 4PJXE 4U7MA 5C71A 5K59E 4NWTH 4PV8A 1F4HA 4XVJL 5F1NB 2VKWA 5K33A 3EIFA 1YYLH 1FYTE 1OCWH 4F7EB 1ADQH 1ULVA 2Q76A 4ONGL 4K3HA 2NTSP 3HC0B 4NNXB 3SPVA 4O02H 5I30H 4CN1A 3QEUA 3MGTB 4BFIB 4NQSB 1QRKA 1OP3K 3VFMA 5I1HH 2BC4B 1MFEL 3KYKH 2V2XA 5IHZB 2PYEA 3MRIA 4YC2C 1P6FA 2W38A 2VAAA 1F4XH 3GMMB 1UM6L 3MV7E 1W0WB 4NZTL 5D7SH 2F54D 1QP1A 4PIRF 2Y25A 3GM0A 2PYFB 4WEBL 3V4VL 3OGCB 3QSKB 4N1HB 4PYHA 5TFSH 5MERB 1CXLA 1E6OH 5TE6H 1JNHB 5GRUL 1JNNH 5HHVH 5CUSH 1MJ8H 2I5YH 3L9RA 1YPZE 4MNGA 3L3KB 5IIEB 5GS2H 5SWZE 1SY6A 1U92A 1CLZH 4Y4HA 4R7NA 2W9EH 3RVTC 1AD0A 4X7DC 4K55A 5F9OL 3MCG1 4OV5B 1WWCA 3MV01 5IF0B 4JQVA 5I8CA 3U0PA 5EO9B 2YA2A 4PJHF 3B9KC 5TH2B 4I5BB 4UNUA 3O2DA 4J1UA 3QA3B 1G6RB 2VC2H 4RZCB 4LRIC 3CLFL 4JZOB 4ERSL 1BJMA 1PDKA 3PHOB 4P23C 5DFVC 4I3SL 3S97C 4GAFB 1RHHB 3V6FB 1T1XA 4FZ8L 1DN0A 3G04B 5ICYB 1F3DJ 1LO5A 3LRGA 3I85A 4TPRH 1G9NC 1FSKB 2CIIA 2ZUVA 3LS5H 1LEIB 2DQEL 5GS1B 1INQB 3F7YB 5TE4L 3S5LG 4KY1H 3WFBL 4PLKD 5MP6H 3BJ91 1CXIA 1QHPA 2WWKO 4Z7UE 5F8QC 4WUKH 2VSDA 3HPJA 3LSOA 4Y4KB 4P4KA 5F9JB 4PJFA 1L9MA 4NRYB 5F7NC 3UZEA 3BGAA 5D96B 4YK4B 1XGRB 1EHLH 4ZPVA 3HB3D 4ZUTB 1Q1JL 4XPHH 4PJBA 4Y16B 2I24N 1A1MA 2WMPA 4JHAL 1HQRB 3TH2T 1MF2H 43CAB 1OTTD 2R2EA 5IQ7H 5HYJA 1NANI 5ILTL 2AJXL 4QWWC 4W81A 5BV7C 1Q94A 1U8OA 3N1FC 4JVWA 1PG7H 3U0WH 3GMRA 1RUKH 4Q74A 2CD0A 2FX7H 1NCAL 4Y5VC 3OAZK 2B4CC 2HLAB 1JF5A 1N59B 5DD0L 1TPXC 2MPAH 4LQFL 3VRJB 5E1HB 1MCFA 4R7DA 5EIIA 1U3HA 1VEPA 5BMFH 3TBWA 1IGYB 4JFEE 5LXGL 3D69A 4MYWB 2O5YL 1J05B 2HKFH 4WENB 4GQ9L 4OFDA 1CE1L 5DEFA 5ADOL 1NGPH 2R0KL 2K1MA 4GRMB 5C08B 1DR9A 3K4DA 5EU3A 3MRKB 1KPUA 1EAJA 4NCDA 2BK8A 3BH9B 3MCKA 3VFWB 1EFXA 1NEUA 3AMLA 1A6AB 1NCBH 4MXQD 5TQ0L 4YFEA 5HGAB 1QLEH 1S5IL 2AV1B 1PY4A 1GGTA 1A4KA 4O58L 7FABH 4CDGC 4GG6F 4RMTA 4CVZA 5JMRA 5FDWB 4YE4H 2X9YA 4I0PC 3MLWH 3LKPA 3V95A 4JFQB 1H3XA 3NFSH 4LCIH 2HJFB 4F15C 3IB4A 2YPKB 2NY2C 2FO4B 2HWZH 4RX4A 5DD6A 4J3WA 3FOMB 2VDNH 3HMXL 1WFNA 4H1LB 3VRIA 3IU4H 3CVHA 3I3EA 4G8GA 3ZTJH 2VTFA 3UTTA 2IBBA 2WIIB 5F1IB 4HK0A 4LSUH 1PJ9A 2CRIA 3OAZH 1JPTH 3WFCH 2Z93B 3MRFB 4L8BA 4Z7OE 4BZ2L 2BOCA 5D5MB 4NZRH 5DUBB 3W2DL 2F53A 5HHMB 4C56B 3MLUL 2VJXA 4MDIB 5K9OA 4U6YB 4YFDB 1CDHA 1OAXL 3JXAA 4HMDA 2BNUA 5TJWK 1RUMH 2P24A 1IQDA 1KXQE 5CGYC 3BZFB 4IDLA 5AG9A 3HE7D 5FGSA 3I9GL 4PGBA 3FQRA 4HWBL 4OFPA 3WO3B 4R8WH 3UTSB 3CPLA 5EU6B 1RV6X 1X4YA 1OCWL 3RHWK 2AI0L 43C9A 4X7TA 4R0LA 2Q8AL 4RDQG 4YXHH 4CMHC 1U2HA 1S8DB 1IEBB 4KV5E 3C5ZC 2P5WE 1NUFA 3KAAA 5CLWA 4U3HA 2FL5A 2M2DA 4JY4B 4E41E 3S96B 5I8KL 5A43C 1G9NH 1IARB 4KJYA 3VD3A 1RVFH 1F4XL 4LARH 4K3EL 4PRIA 2R23B 3AAZB 3TA3D 5D7SL 1XH3B 5J6GB 3WE6A 3IYLW 3MBEC 3QEGH 2H45A 2XOTA 4AJ0A 4N0CC 1IT9H 3U9PH 5A2FA 1XCQA 4P2OD 2ARJB 3HMWL 4GAGH 5TFSL 3WD5L 5HHVL 3RPIA 5CUSL 1MJ8L 1UEMA 2X4TB 1JZ4A 1VADA 3EOAA 2CDEB 4X5XB 5I19L 3WJJC 4X6DF 4LCCB 1T04B 3BPNC 3F7PC 1A3RH 4NQTA 1CLZL 5KZCD 1FC1A 5AWNH 5CKAA 3DOSA 3FCTA 5C0AD 3MJ7A 2W9EL 2Z31A 3TVMB 4JFPB 4P5KB 5I18H 1D5MB 1FRGH 2B1AL 4LGSB 2FIKB 1EO8H 3G9AB 3C6LA 3S6CA 2ERJB 1CLOL 1IGCH 1TJIL 1FZKA 2Z31C 4JFDB 5EZJB 3B2UC 1CBVH 1YNLL 2F74A 1FL6A 2NLJA 4YPJA 2B4CH 4X9HA 4LLMA 5F3HB 3VXMD 3C6LC 1S7RA 5E8EA 5D7JC 2A6KB 2EDYA 4X8JA 4PJ7F 3MNZB 4GXUN 4ZYKA 2Z8RA 5DRXB 1T22B 1CG9B 5JZ7D 3IJYB 4PREA 3T2OA 3WKNA 4F7MA 1CDUA 2VLME 1G9ML 4PGCB 5H94B 5DJAB 3VXUE 1ZA6A 5IVOA 5L7XH 2OL3A 4LSDA 4XAKD 4LGRB 2YPLA 4WTZG 4ZUVA 1OLZA 1AY1H 3DVNB 1XR9B 4FNLH 3QUMA 1HH6B 3IVKB 4JHWH 5DGQA 3JUZA 5ESQB 4KKCD 1EMTH 2NX5E 3VFRB 1I7ZA 3WKMH 5C2BH 3BPCB 1QR4A 5E24E 5DEGA 2DJUA 3O41A 5ISZB 4Y8AA 4XPHL 2XKNA 4B7IA 2J8UE 3QPQC 1Q38A 3CFIC 3BW9B 3MJ9A 4ZUWB 1PYWB 2R1XA 3T8XB 4XXDA 3S8WA 1MF2L 5F70A 3TBYA 5E03A 2D2OA 3WSQL 3QIBD 1VFBA 3QJHB 2PCPA 1NCDH 3X11A 5C09D 1GOGA 3MRNA 5E6ZA 2GJZB 2VDPL 2CRYA 3SE4A 5SV3A 4DN4H 2E7LC 4RFEB 4W70A 3L3JA 5GGUA 4EN3B 5F1KC 3U1SH 3CX2A 1D9KA 4HWZB 3BKJH 3UJTH 3V8OA 1S3KH 4ZDHA 1KLUB 4Y1AA 3ULUL 4XX1G 1WZLA 4LKXB 2HKFL 3IKKA 3SE4C 3ZDXE 4FQPA 4LLQB 5FF6B 7CGTA 4PRDB 5EBWB 5F6IC 1FNAA 3B43A 1D9KC 4UU9A 2PR4H 2P1YA 3PGDA 3O9WA 4NNPH 3LMJL 3L3GA 5D7LB 1NGQL 4QYOA 1S78D 3N1GC 2HA1A 3PQYA 4HPYL 3O3UN 3C9NA 5D1XD 2XZAL 4FQXB 2JJTC 3BSZL 5HYSG 3D39E 2Y06L 3MYJB 5ICXB 4HF5L 1RZ7H 3ILQC 5HPMB 1SJEB 1KNOB 1BOGA 1L4IA 5E6YA 4PFEA 3KPRE 3KPQA 1L0XA 4AEEA 5C9JB 2ESVA 4TVPD 3GSWB 4WEMB 2YD4A 3QFDA 1QD0A 2GAZB 3ZMRA 3SDAA 2X1WL 2AAVA 3EGSB 3T09A 2GY7B 3HNSH 5BO1H 4GRWF 2R2BA 4OIIH 2GEEA 5I1CL 1Q0XH 3HNVL 3IU4L 3S7GA 4HX1B 3Q6GL 5FA4A 5ELIA 3UBXA 3SDAC 1J5OL 4YDJA 3PGFH 2HRLA 2CDFA 2JIXA 4JO4H 3DX7A 3V5HB 5LBSH 1MH5B 2GCYB 5ABDE 1GGBH 4NOBA 1I4FA 4F7PA 4KVNL 4JO3H 1RUML 2Y07L 5KANI 3ARBA 4DEPB 4M02A 5SWQA 5KS9E 5I1EH 5D8JH 2AXGA 5FUZL 3IFOA 3CFBB 3ARBC 3MGOA 1SY6L 1FNSL 1JPSL 5CEZE 4X83A 1RIVH 3CDGB 3N1PC 1NAMH 1V7NL 2MNUA 4L8CA 3LKSA 1C5DA 3HCVA 4S2SA 5H2BB 3OKNB 4CJ1A 4JDZA 3UJJH 5ALCH 3O2DL 1KJ2A 1P2CA 5E00B 1FYTD 3PIQB 1G9NL 2WBJC 2YWZA 4HQQH 4NSKB 4LARL 5FAAA 4BSJA 3OWEA 2XFXB 5JW5A 2CLVA 5TE7H 4P2QA 3QEGL 3SN6N 3T77A 3K74B 2C1OB 2A83A 3NZ8B 5I9QC 1NL0H 1DL7L 2PF6A 2VQTA 3Q5OA 3BJLA 1U8QB 4R3SA 3KDMA 4MCZA 1NLBH 5E4EB 1ZLWH 2ZCHH 3E8UH 3MV7D 1A3RL 3LY6A 4TOYH 2D7MA 4HC1H 4ODSL 1CDIA 4NWUH 3ROOB 3VFPA 4KKBD 5GIRB 2HJKA 2P4AB 5I18L 1NFDA 1OGAE 1VGEH 1UM4H 2DD8H 1QBLL 4PG2C 5KSBA 5HI3D 1QR1B 1D5BA 3NFPB 5HHXH 3T3PE 3S88H 1IGCL 3VWKB 3WL9A 5BV7L 2ICWA 4NQCE 1U3JA 1XGQA 5F88B 4G43A 1DQLL 2WP3O 1EXUB 5SWZD 3MJ9H 5DT1H 3ZT7A 5IEHA 3CFDA 2H6PB 4Z95L 5FYKU 4PJGB 1T5XA 3NBNA 1B4RA 1XR8A 4NBYB 1H0DA 3O4LA 1R5IA 5FM4A 1I8IB 3NACH 4P48A 2A0LD 4JE4B 5HI5D 5L7XL 4GAYB 2HVKA 1R3KA 4APQA 4YBLB 2X5PA 1SYVA 1JVKA 1GH7A 2XWTB 1BD2B 4P46A 3T2NH 1GGIH 2DF3A 3ROLB 4XRCA 3KPMA 2PXYD 4XPBL 1M6OA 3WXVH 1CDGA 5TGBB 3VXNA 5DZOA 1X4XA 2Q20A 3QFJB 4LLVB 2AGJL 1MCJA 2VOTA 4CN4A 4P46C 4D8PA 2AQ1A 1LEGA 3PXJA 5DJCB 4ORZC 3TPKA 4Z5RA 1NGYA 2W0KA 4OZHA 1I1AB 5KOVC 2ZWLT 4G6FB 2YXFA 2YZ8A 2EO1A 4Y8DC 5DC4B 5DI8B 2BOBA 1IAIH 3G5VB 5CP7A 2QQLL 5F3BB 3SGEH 1EHXA 5EUKB 2NY4D 2DI8A 1T4KA 3A6CH 3BN9D 4OQTH 3RGHA 2C7UB 5I1DB 3LN5A 5HGGS 1IBGL 1FP5A 1MRCH 4MAUH 5B8CC 3UJTL 3B4NA 3EAKA 3P4MA 5M7QA 5F1OB 3FB7B 1AHWA 3CDYA 1CFSB 3HI1A 1Z9MA 1T7ZA 3CVHL 2VLJD 2XN9A 1MFDH 2A6JB 4UMGA 2PR4L 4Y2OA 5EUOB 5MI0B 5JMOC 1IC5H 3MROB 5LKNA 4M1CC 2O61A 4POYA 1AHWC 1D5XA 4K2UH 5D1ZA 3U6RB 4FHBD 5DTFA 1OB1B 3RWEB 5CCKH 4JFED 1YY9D 5I8EA 5E9DA 2WM0A 1X3DA 1QSEA 2DDQH 3DXAE 3GB7B 3RP1A 1RZ7L 2FEEI 4BZ1L 1DQQB 3MRDB 5ITBH 4RISH 1JNLH 2DMBA 3SCMD 5IFHL 5D1ZC 5F1NA 1UM5H 1CYGA 1T6WA 4GUPA 4F7EA 4NPYB 2ZCKH 3F7QA 2VLKB 3UZQA 4NM4H 1UJ3B 2EDOA 3HC0A 1PKQB 4NNXA 2B0SH 4ZQKB 4TQEL 3MGTA 1C7TA 4LNVA 5L2KB 4NQSA 3S5LB 4AMKH 2BDNL 2BC4A 3QDGE 4M6OL 4YWGL 5IHZA 1RD6A 3E3QE 4M03A 4L4VE 4PB0H 4NCC1 5IVXE 3ME0A 1CGWA 4EDWH 3GMMA 4N9GB 4BQ9A 4KTEH 4JJ5A 2DKSA 1KEML 1W0WA 4JFFE 4WHCA 4LEXH 4ELMB 3QPXH 3T0XA 4MJ2A 4ZO7A 3QQNA 1GGBL 2PYFA 5C0BB 3GMOB 1MRFH 3OGCA 1JTPA 2XG5A 5MERA 1JNHA 3TN0B 2QQKH 1CWVA 3RKDC 3L3KA 3FAXA 1AXTL 3LB6C 5IIEA 1DE4A 4G3YH 5CJOH 4QT5B 4X6CE 3VMNA 3IAPA 3LKRB 4OV5A 1TETL 5FM5M 5IROA 5IF0A 4KRPB 5SWSB 5E5UB 4EBQH 3D0VB 5TH2A 4I5BA 1NLDH 2IEPA 1UFUA 2D31A 1DBJL 4LVEA 3MRCB 1XEDA 4HT1H 4M4RA 4QRSB 1HI6B 3QA3A 1G6RA 3A6BL 4RZCA 4NZUH 2MCPL 1BOYA 2MQ0A 3SDXF 5C92A 3IDYC 3GO1L 5IROC 1HHHA 4JZOA 3WV0A 3V6FA 5TE7L 5ICYA 3RWCB 1REIA 1UZ6E 3X3FH 4KTDH 1FH5L 1MJJB 5A16B 1LEIA 2VSCA 2P5WD 4RAHA 1PVHA 2PKDA 2AEPH 3LAFA 3F7YA 1HE7A 2P5EB 5T3ZE 1K4DA 4PJAF 1A6TB 4E41D 1IGIH 4JM2B 2XZZA 5EG6C 2I9TB 4OLYH 5I1KL 4Y4KA 5F9JA 4UNVA 2NY5C 4NRYA 3KPLB 1MFCH 3PGCA 2DD8L 1A2YB 2GITB 3MBXH 1XGRA 2LQRA 4DUWA 1IKFL 4ZUTA 1F6LL 1U42A 2VDOH 5T5FH 4Y16A 1BZ7B 4Y4KC 1NC4D 2VRAA 4UZGA 3ZO0A 2W91A 3CH1B 1HQRA 1WFTA 5CJ8A 43CAA 4KROD 4ODWB 5AD0B 3MJ9L 4JFXB 3I6KB 4ZTOL 2VDQH 3TV3L 3HG1E 4Y16C 4NJAL 1FO0H 1NFKA 5J4MA 2HLAA 3B8YA 3VW3H 1N59A 4I4WB 5J3HD 1LDPH 3P0YL 5TPWH 3VRJA 5I15L 2JF1A 2MHAB 4NKQB 1MLCA 3AREC 3K46A 3VG9B 1ZVSB 5E2TL 5FIEA 1IGYA 4MA3B 5BZWB 3WHE1 1S9WB 4GMTH 1J05A 2UVFA 4W6WB 3T2NL 2IALB 1Z0MA 5DJZB 4I77H 2EEDA 4GRMA 1L7IH 1C16B 1PAMA 5C08A 2YD2A 5DFWH 2XI9A 4YHOH 4Q58C 5BW7C 3I6GB 3MRKA 2DOCA 3VJ6B 2C3HA 2QKIB 4K3JH 2VLMD 1MJUH 3QXAA 3BH9A 3VFWA 3VXUD 5I73B 3WNPA 4KZEH 4JKPH 3FN0L 1A6AA 4Y19B 2BVTA 5HGAA 2W60B 1DSFH 1AJ7H 2AV1A 4XCYB 2DQTH 5FDWA 3S36H 3S37H 4TTDD 4JFQA 4HFWB 3SKJL 2HJFA 2XTJE 4FFZH 1UWEL 1LK2B 5KVDL 2QSVA 4TUOB 2AK4E 4HFUH 3DI2B 2FO4A 4OQTL 5T3XH 3U9UB 3HB3C 4UT7H 4MAUL 3J7HA 2EDFA 4P9MH 3FOMA 2MCG1 3VMOA 3F7VA 4H1LA 4RMRA 2XA8H 1NMCC 5F7KC 4AEIH 1MCQA 2WIIA 5F1IA 1SMAA 5HDQH 3VRLE 2Z93A 4LHQB 3AS3A 2APVA 3MRFA 1A21A 4NBXB 5D5MA 5EFIB 5DUBA 4C56A 3OAYK 4K2UL 4MDIA 2GUOB 4U6YA 4HS8L 1J10A 4XVTH 3LH2H 2R15A 3H3BC 3BZFA 3MJ8B 5HDOA 4PRHE 1JN6A 1R3IL 4RISL 5DHVH 4UQ2A 3SGKA 4P0DA 5KSAA 4JPVL 5HHOE 4I18B 3UTSA 5EU6A 4PJXF 5K59F 5FYKH 1JP5A 4EI5D 3QWOB 2FR4B 2R0WL 2ZCKL 1FDLL 2HT3C 4K8RC 4B50A 3ZYJA 4LMQI 1S8DA 3SGKC 3K7UA 4K23L 4TRPL 5KSAC 3D39D 4AMKL 1I3UA 1DQDH 3LN4B 3KPRD 2GFBB 4LDEB 4P59H 2EZ0D 4JY4A 3S96A 1T89C 4PB9H 2OBGA 2CRZA 4OT1H 1KJ2L 2R23A 3AAZA 3R0MA 2G75A 3ZE1E 1MHPH 1XH3A 2V6HA 5J6GA 1II4E 1K4CB 3PE9A 4LEXL 4XWGH 4KGJA 4I13B 2ARJA 3IFNH 1OM3L 2GSGB 1F6AA 1N0XL 1IL1A 3QEHB 4GRWH 3ET9F 2NY5H 4HIJB 3KYNB 2QQKL 2X4TA 1FQ9C 2CDEA 4X5XA 4OF8A 2GKIA 2I60H 4LCCA 1T04A 2FX8L 1YNTB 2A77H 3TEUA 3FT4B 4PJEE 3TVMA 4JFPA 4DWHA 1D5MA 1H15B 4KHTH 4OTXH 1ZS8B 2FIKA 5AYUH 4RBPH 3B3IB 4EBQL 1VB9A 2FB4H 1NLDL 2VLLA 3GDBA 3SE8H 5EZJA 4JFDA 5DF0A 4HT1L 2VXVL 2R29L 4P3WA 5F3HA 5CEZD 4O2EB 3VXSE 2Q6WB 4KZDL 2A6KA 1T6VN 2XQBL 3WCYA 1WAAA 2Y5TB 1OQXA 3MNZA 1RFDH 5DRXA 5LWYL 1EIBA 1DBML 1T22A 4Z78B 1UEYA 1CG9A 2BMKB 4WTXA 3IJYA 3CFCL 2AEPL 4HS6B 5H94A 4PGCA 3D9AL 2AS5M 5DJAA 1ZLSL 1AIFB 4HKXB 4OAWA 2X4OB 5HYSB 3HZMB 4RIRB 4U2YA 4OZIE 3DVNA 4NM8H 1I9EA 1XR9A 2CLRB 1E27B 1P9MA 1QHOA 3MRQB 2DI7A 1HH6A 4YGVB 1EJOH 25C8L 4W6YB 2HMID 5ESQA 3IVKA 4J3UA 4Z7UF 3VFRA 4P5MB 1QA9B 1RK0A 4I3RL 4JREC 5JXAL 4YX2H 5ISZA 1P9MC 3BW9A 4ZUWA 1PYWA 4LSRL 3WNKA 5CSZB 3T8XA 4PJDE 4P99A 4L8SB 3KJ4B 3OXRB 4GKZB 4U6VH 4WFHD 2ICES 1TZIB 4NO0D 5DJ2B 3D18A 2NYYD 4OLVL 1OGAD 2GJZA 1KIUA 3BX7C 1FO0L 3LQZA 4QHLB 3C2AH 1QVOA 2UZIH 3VFUB 4RFEA 2FYYB 4JGJA 5DD5H 4PJ7B 3C6SB 5TPWL 4RGND 1AO7E 1T1WB 4HWZA 5I2IA 1OP9A 2Q7NA 4AEFA 1MPAL 1KLUA 5IGXH 1CU4L 1MEXH 4GMTL 1KCSH 4LKXA 4HJ0C 4TTGA 4LLQA 5FF6A 4JQXC 4PRDA 5EBWA 3G08A 4LOUD 5D2LF 2GTWB 1EJ6A 2G9HB 2Y4SA 5D7LA 1IRAY 4K3JL 1MCLA 3VXRB 1KPVB 5D72H 4FQXA 4WDIB 2BNRB 3B83A 1DSFL 1G7QB 2R9HD 3MYJA 5ICXA 1BECA 1IVLA 1KCLA 5HPMA 1SJEA 4HEME 1KNOA 3O3DB 3EW3B 4MZ2A 4YHZH 1ZHKA 5IW6B 4K8RH 5LVEA 5HYFA 5C9JA 3VFTB 1UB6B 1QFPA 5CEYB 1LHZA 3O2WL 1LK3H 3GSWA 2GAZA 3K8KA 1X5AA 4MJ6B 3SDDB 4FQCH 4LPUA 1VDGA 5EZIL 4P9ML 5K9KB 3RGVC 1SVZA 1G9EA 2OK0L 1KN2L 4Y2DB 1NDMB 1D5IL 3KLAA 4HX1A 5C3TA 3QIBC 4RGOL 3NOIA 3TIDB 1A4JB 1N6QH 4AEIL 3UEZA 4HEPG 5HDQL 4H0HB 1QSVA 3V5HA 4M7LH 1RU9L 2BRRH 1MH5A 4DAGH 3VWJB 4FFYL 2GCYA 2MOVA 5E5RB 4X80H 4Z7OF 4O4YH 1YEGH 1IGFH 3CCHA 3LH2L 4N0YL 1A64A 2ZG2A 4OCSL 5CILH 5C0DB 4M3JA 3BOVA 3PP4H 3MV9D 1CDBA 4UTAL 1GC1H 3CFBA 1TNMA 4WHYG 5GPRA 5FYKL 1G7PB 3DSFH 5ADPH 2IMMA 1L7TH 1C5BH 1FGVL 1SQ2N 3CDGA 5EO0A 3NCFB 1EO5A 3N85H 3G6AB 4QGYA 4ZOCA 2R4RL 4UI2A 1D6VH 1ZVHA 1U93B 3DXAD 4E5XB 4C4KT 5DURB 4XNYH 5H2BA 3OKNA 3Q6FB 5CIPB 2DLFL 4KV5F 4XPAH 1CE6B 3UYPA 2W65B 5E00A 1HYSD 3PIQA 4OGYL 3NGBB 5FO9B 1G6RL 3NTCH 4NSKA 4X9GA 3JVGA 2XFXA 1KN4L 4X9BA 2RB8A 1ZHLB 4U31A 5LGJB 5FCUH 5C0JA 5BOZG 1DUYB 2C1OA 2IPTH 2H2PC 3NZ8A 2EXWD 1CR9L 1T3FB 4EQ3A 4ZOAA 3KLDA 3BD4A 1U8QA 3QDGD 3JVGC 5FA3B 3KWWB 2R56H 2QADB 4L4VD 5JQ6H 1SMOA 2PW2B 5IHLB 3TT1H 3H9SE 2OM5A 3DETC 3GMPB 3QQ3B 2ZCLL 4JFFD 4U3XA 4XMPH 5GIRA 3QZWA 2LAGB 2HFFB 1P4BL 1KXTB 4NFCA 5KTEH 4F7CA 1HHIB 1W72B 1SEBB 2W9DH 4D0BB 1ZANH 1QR1A 4KKNA 2EH7L 4WWID 3NFPA 3VGAC 2NY0B 3VWKA 1AGCB 2NY6B 3SE8L 5F88A 1R0AH 3VXOB 4MVBD 1HYRC 4WHTB 3JTTA 5EBLB 3MFFB 5B3JF 3VXQA 4AEHL 2H6PA 4PJGA 5D1QB 1RFDL 4UV4H 2DM4A 1TTFA 2RAMA 3S35X 3D3VE 3W9DB 1KV3A 1EBAA 1I8IA 5EC2B 4D9LH 1AD9B 3DRQB 3KJ6L 4GAYA 2R1WB 1G84A 4DFIA 2XWTA 1BD2A 1YECH 4F9PC 3ROLA 2BY3A 1EJOL 5TGBA 4TUKH 4M5ZH 4HJJH 1J1XH 4OD1H 2OR9H 1C5CL 4DGIH 3FOLB 4YBLC 3BWAA 4LLVA 4YX2L 2P46B 5CFHA 3ARGA 4CW1B 4ONOA 3BT2H 5DMGD 2LE9A 5T1LB 1Z2KA 4IRZH 3QAZB 1I1AA 3TZVB 3P73A 4YXKL 2YD1A 4YHKH 3IDXH 5KW9H 2F8VA 5DI8A 4MA8L 3DGGB 3IXTB 4X7FC 3G5VA 3ARGC 3D85B 4KKBC 3EDFA 5EU5B 5F3BA 5EUKA 2UZIL 1I1AC 3MUGB 5F89B 3THML 1KB9K 3LDBC 2C7UA 5I1DA 3QIWB 1QG3A 4Y4FC 4DK6A 1DEDA 4NOFA 4YIQB 2ZJSH 5MEPB 1MEXL 3FB7A 4JG1L 4OM0H 4U1NB 4ZNEA 4KRLB 1CFSA 5I1IH 3HG1D 4Y88A 2V2TB 4P5TB 4OZFG 1IC4L 4NUGH 1ORQB 3ZDXF 1ES0B 5EUOA 4PY8I 2C1PB 4WO4C 3EOBA 3MROA 2D4FA 3AB0B 4IRSD 2CQVA 3OG6B 3QJFB 3U6RA 3RWEA 1OB1A 3PDOA 1DUZA 1VA9A 2APBA 2R2CA 4O2CB 4QOKD 4HK3J 5F9DC 4OCWH 3ZT5A 4HKJB 4HCRA 5MI0C 4PJ5E 1KB5B 3ARPA 3GB7A 3IF1B 4MNQA 4JG0L 1DQQA 3MRDA 5I71B 2W9LA 4XCCH 3MACH 3H3PH 4K8RL 4L29B 5I0ZA 2BJMH 5C9KA 1CGXA 1JYNA 5DQDL 2VLKA 4V2BA 1UJ3A 4J6RH 5IUSA 2DQCH 1OPGH 4JZJB 4ZQKA 4NN7B 5B38G 2G60L 3S5LA 3QUZB 1U8LA 2GHWB 2V9RA 4HBCH 2FATH 3BHBB 1XF4B 5ID1A 3GMQB 2X6MA 4HULB 1KENH 2AK4D 1XGYH 4ODHH 2NY4C 2XY2A 3P9WB 3FQXB 4N9OB 1UKQA 4PJIE 4V1DB 4ELMA 4WUUB 3Q48A 3O6LH 5C0BA 3GMOA 4GQPH 1A7QH 1IGFL 2BSSB 4L3AA 4M6NH 1WSST 4ETQB 3ARXA 4Z8FL 3TN0A 5GGRY 4DVBB 2ZOLB 4Z7WE 4TULL 4QT5A 2EDKA 2P8LB 3B9AA 4M7KL 4U1SB 5E8DH 2K7PA 3F58H 1MCSA 3LKRA 1T5WA 1JF6A 2ZUTA 1C5BL 3I2CH 1MJ7H 5GGVH 2AABH 4LLDB 5SWSA 4ZXBD 5JPNB 3D0VA 5FKAB 1NCNA 5JDJA 4PRHD 3F6LA 3MRCA 3FO1B 1ZMYA 5GHWL 3EZ8A 1HI6A 3PWJA 4ZOEA 1AP2B 5HHOD 3N9GH 3D2UA 4HHAB 5J1AA 3VGEA 4AIOA 4FN0A 5A3ID 4PJCE 1IM9B 2V17H 4KUCD 2IPUG 3GRWA 3F65A 5L9DH 3RWCA 4PY7B 3HC4H 1MJJA 2FDBP 5A16A 5EIQA 3BEVB 4XHJD 1J87A 2VXQL 3RUGE 3QT2A 2HVJB 5KZCB 4MB4A 1BVKA 1A6TA 1OT2A 1E6JL 4JM2A 4AG4H 2I9TA 4X7SH 3DVIA 4LEOB 2VDMH 1IAKB 3KPLA 1GGCH 3K80A 6FABH 1U95B 2P7TB 2YPVH 3ULUE 1A2YA 2GITA 3IU3B 1JWSA 2W9DL 5E95B 4FQQB 5F7WC 1OTSD 1BZ7A 2VB5A 3MLZH 4DW2L 2JTDA 4ODWA 5AD0A 2F8XC 3T3PF 1FFRA 2BHYA 2XRAH 4JFXA 3I6KA 5FGCB 5K93A 2XZQH 3GKWH 5SV4A 1RUQL 3SE3A 3JV6A 4Q9RH 3EHBC 3G6DL 4KI1A 5J89A 1FE8L 3ARFD 5IBUG 1JRHI 1L0YA 3OL2A 4I4WA 4ZO8A 1P1ZB 1PX3A 1RUPL 3TCLB 2IG2H 2MHAA 3H3KA 3QCTH 3HZYB 3FFCB 1YEKH 4MA3A 3WXWL 5A2KH 5BZWA 1NGWB 2X70B 5HHPA 2QR0B 2IALA 5DJZA 3VI3E 1GGYA 3VXSD 1C16A 3IAGC 1IM3B 3P77B 1QFUH 2I26N 4M5ZL 1WIOA 4OD1L 5EZLB 3I6GA 4QTHB 3VJ6A 4OIBA 2QKIA 1J12A 4JPKH 2AXFB 5KAQG 4XGZB 4JVPA 2PYEE 4Y19A 4GSDL 2W60A 3LPGA 1YYML 4JPIB 4LDOB 4LPYA 5DK0B 3LN9A 5C1MB 1R3JB 3IDXL 5KW9L 4G42B 3ORJA 4S1SL 3NIFE 3B2VL 3WUWB 5I73C 4HFWA 9CGTA 1LK2A 4TUOA 1LO0L 1M1SA 3U9UA 3ARYA 3VFOB 2AJVL 3IXAB 4R90H 1J1PL 1JF1A 1XAUA 3GI9H 8FABB 3CMGA 4MNGE 1H3PL 4YHMH 4OM0L 3HNTL 3QUYA 2O93L 3NN8B 5I1IL 4XP9H 5C0EB 1T66D 1IEHA 1G7JB 4JJHA 1A7OH 5EFIA 2J2ZA 2JJSA 1SHMA 3QUYC 4ELKB 3CK0L 1LEKB 4L4TB 2GUOA 5IWLA 2DMKA 4ZTPH 3GMNB 4X4YA 1X5IA 4F37F 3MJ8A 4I48A 4G5ZH 3QB7C 3IJSB 3GHBH 5JHLH 1HNGA 4RGMB 5LGHL 3O3EB 3PUCA 5I1JH 1JWUB 4Z77B 4WWKB 2QHRH 2O26U 3MACL 4I18A 3T3MF 4MGXA 2VH5H 1H5BB 2BJML 2UV3A 3QWOA 5EIVA 4TN9A 2FR4A 4NQDE 4JR9H 4XB7A 5BRZB 3DNKA 5A1AA 1OPGL 1H8OA 2ADFH 2JK5B 3BVNB 4M62L 3LN4A 4PJFE 2DM7A 2EEBA 3T4YB 1VFUA 3O6KL 1A1NB 1NBYB 4IOFD 2YD3A 4POZC 5C0ND 4WI4A 3CX5J 4F3FB 1K4CA 2FD6L 2H32B 4PJBE 1CICB 2P42B 3WO4B 1UCBH 5I0DA 1CFNB 2J6EH 1MQKH 2GSGA 3P9MA 2AJSL 4DK3A 5HYJE 5F7MC 2DQGH 3QEHA 2YS4A 5FGBA 4HIJA 3O6FC 4KQ4H 3KYNA 3LPFA 3CFEB 2CGRH 3RWIB 3CLEL 5IVZB 1L0QA 1NEZB 1P7QD 4RWHA 1YNTA 5E8DL 5DUPH 1S5HA 2EEAA 1GOFA 4JY5H 4QF1B 3TJEH 1H15A 4R2GD 4EDXB 1ZS8A 1WT5A 4F33B 3B3IA 2VUOA 3JV0A 2B39A 3RNKB 4DFHA 4M7LT 4FFWC 3NA9H 1NJ9B 4N5UA 5CP3A 1MFBL 3N9GL 1QFWH 4OLWH 4OCNC 1WT5C 3HI6L 3FO0L 1XIWD 4QXUH 1BJ1J 3IDJB 4C59B 3DO7B 2GSIB 2W59A 4O2EA 5BZDB 2R1YB 2Q6WA 4EI5C 2UZYB 2J88H 5F7LB 2Y5TA 5L9DL 1EK3A 4F9LA 3TM6A 1KJMB 2HT4C 4Z78A 3L5IA 2BMKA 3OX8B 1UZ6F 3NPSB 4HS6A 4A2LA 1AIFA 4HKXA 2X4OA 5HYSA 4AG4L 4RIRA 4X7SL 4PRPE 4BH7A 4PGJA 3WEXB 1EV2E 1GOHA 2CLRA 1E27A 2OR7A 3G5XB 1LVEA 4YGVA 2VR9A 4FTVB 4JPWH 4P5MA 1QA9A 2J5LB 2R0ZL 1YPZB 4EZMA 1GSMA 4XC3H 5DS8B 5SWZB 4OJFH 1OWRM 4PP2B 1MCEA 3PP3H 3U36B 3ESUF 3MLZL 4KU1A 4G8GE 4EUPH 5CSZA 2HLFD 4L8SA 3UTTE 1DBAL 3OXRA 4GKZA 3TT3L 3H9SD 2NY7H 1YUHB 3IFLH 1TZIA 5DJ2A 4N8CH 4BFGA 2GK2A 5LCVH 4U4BA 2F53E 4QHLA 2AEQH 1MHEB 4M6AA 4ENED 3VFUA 3WLWD 2FYYA 3BE1H 1S7SB 1W0VB 4RNRA 3C6SA 1T1WA 1RZFL 5HGDB 4CDHA 4M9PA 5DMIL 2FGWL 1FYHB 1J7VR 5C6TL 1UACL 2NXZB 4I9WE 2G9HA 4DCQB 3D3VD 4HJGB 3X13B 5EBGA 2A73B 4M7JH 1YQVH 3VXRA 1KPVA 1CDJA 1MCIA 3ARSA 3BGFC 4WDIA 2BNRA 1UB5B 1MIMH 5FOBB 5IM7B 1G7QA 5D7IF 3A67H 5E8NB 4PRIE 4HCRL 2XG4A 4IOSD 1T0PB 2RFXB 4OUOA 5IW6A 3VFNB 4RQQB 4OFIA 3VFTA 2ADGB 3KPNB 2OI9B 4N5ED 5CEYA 4F2MA 4K71B 4S1QH 2ATPB 3SDDA 3V0AC 5K9KA 3C08H 2UVEA 1NDMA 2VE6B 4IRJD 2H8PB 3BQUA 2DJ4A 2XT1B 4MA1B 3TIDA 1A4JA 3UZVB 4YPGA 3VXPB 3C60D 3D87B 3DVGA 4LPWA 2VZTA 1PBYA 4HLZH 4JHBA 4P3CL 4G7VL 2YN3A 4JFEB 4U1GC 1A7OL 4YDVB 3HE6D 3ALXA 2FEEL 3BQUC 4DUVA 5F21B 3VRLF 4JQIL 3VWJA 4RGNC 5IHUH 5IB2B 1NBVH 3TLRA 2QSCH 5JW4M 3CVIL 4G5ZL 3GHBL 5DVNA 5C0DA 3MLSL 3TP4A 5I1JL 5AUMB 3T0DA 1JHLL 3RDTB 2BXYA 1G7PA 1JE6A 4JR9L 4F58H 4D3CL 2WUCL 2JKXA 3LZFH 4LSSH 4M1GH 3G6AA 3RAJH 1VFOA 4PJ5D 4BM7A 2YPLE 1U93A 4E5XA 2DL2A 5E99H 3AMKA 3Q6FA 5JORB 4HH9B 2YD8A 4B0MM 1CE6A 3MFGB 2O5XH 1TDQA 2QLVB 1OGTB 4U2ZA 3SBWA 5FO9A 3MLTB 3N0PB 1F42A 3JUYA 5BXFB 1ZHLA 5LGJA 4L9LB 2DQHL 1DUYA 4WGWB 3OPZH 1UCBL 1T0MB 2CKNA 2CXGA 3GRWL 3MMEB 1T3FA 3ZE1F 3SBWC 2I9LB 3NGBC 2FLRT 4Z18A 5FA3A 5ETUB 3S35L 3KWWA 4WCYL 3OKOB 4OV6F 1R3LB 2R4SL 3BKYH 2PW2A 1RURH 4OCRL 4WRLA 3GMPA 32C2B 2HFFA 1E4WH 4PPTA 5GISH 1HHIA 1W72A 1SEBA 3AS2A 4D0BA 3K2UH 4PJEF 3GKZA 4XVSH 4Y1AE 1KTLB 4MD4B 1AGCA 4QTIH 1CXEA 3TO4B 4HG4J 5LG1A 3FQTA 3VXOA 1QFWL 4WHTA 3LEVH 4N0UB 4OZFB 5EBLA 3MFFA 1YEIH 1RIUL 4PJ9D 1RHFA 3GHEL 2AXHA 5D1QA 2I27N 2NY6C 3PQYE 3KG5A 3W9DA 1V5JA 3V7AE 4EUPB 5EC2A 2L7JA 4JN2B 1QO3B 3BAEH 2E9WA 5IB1B 5DJ6B 4QHMA 3P4LA 1AD9A 1ZT4B 3DRQA 5IVNA 2ZG3A 2R1WA 5D1QC 2CMRH 4FZEL 5CEZH 2LFGA 5IV2B 1DTUA 3E6FB 2FGZA 5CSGA 1RZJC 2APXA 4OGXH 1MI5A 2ESVE 4W4OA 1AI1H 4YDKH 2Y36L 4XCNB 2C4FU 5DVMA 4J4PD 4XC3L 2NXYD 3FOLA 5I17B 1J0HA 4PBXA 2EXWC 3U4BL 4IIQB 3TWCL 3VMPA 4CW1A 5ECJE 1TVDA 5B38B 3HUJA 5T1LA 3UTQB 4K94C 1YMME 5SX5H 3TZVA 4E9LA 4OM1H 3ULVL 4M00A 1QOKA 4H88L 2A38A 4N8CL 5DLML 3DGGA 3IKCB 3IXTA 2IADB 3UAJD 1XT5A 3D85A 1N26A 1OAZH 2X4UB 3ULUD 2M1KA 1UGNA 2EICA 3QAZC 3MUGA 5F89A 1RJCA 3BPOB 4WW1A 3QIWA 2W0FB 3UDWA 2ARJQ 4YIQA 1MCKA 1DLHB 3OKYA 5MEPA 4F7TB 1KFAL 3W9EB 3BD3A 3V0VB 1VGKB 4U1NA 1H3GA 1T2XA 2M8XA 4EVNB 3MRBB 1DANU 2AK1L 2V2TA 1HH9B 1U91B 4P5TA 1ZK9A 2YRLA 4YXLL 5C0RL 1ORQA 3S3JA 3UDWC 2XA3A 1JMXA 1TJHH 2C1PA 4LFHD 3JSSA 3QNYB 4XMLL 3RU8L 4PRAB 3AROA 4P5TC 1LNUB 1YEHL 4O2CA 3TJHC 4GG6E 2NX5B 4XTRC 1CGYA 5DRZB 4HKJA 2YUWA 2V5YA 3O0RH 3WIHA 1A6WH 1KB5A 5HSFA 3IF1A 1N4XH 3AB0C 2J8UB 1XGTA 3W11C 4L29A 4P2QE 1E4XI 4QXGL 3C5JB 4F37K 4K7PX 4OUUB 3P4NB 2GQHA 3BZDA 2IBGA 4TUJB 5IFAH 3W39B 3P0VH 2EE2A 2PYED 3FHAA 2NR6C 3FQUB 2DKUA 5DVLA 4W4NA 3QUZA 1NCTA 4EJ1C 4L3EB 2E7MA 2P45B 3BHBA 4Q7DA 1XF4A 3W0WB 4JRWA 3GMQA 4HAFA 1NFDE 1I8MA 5KSBE 3RVTD 3FQXA 5BVPL 3QUZC 4PRNB 3P30H 4L5FL 5JIHA 2Z8VC 4V1DA 4ONHA 4WUUA 2HH0H 1B2WL 1JI1A 2HTKC 3HRPA 3I75B 1CVSC 4HD9A 2BSSA 3GSNB 1NBVL 4Z9KB 1LO4L 4Y4HD 5TF0A 2V2WB 1MWAH 3U7YH 4ACPA 4DVBA 2ZKHL 2ZOLA 3PWUB 3RKPA 2AJ3B 2JJWA 2P8LA 4U1SA 4KI5C 1UWGH 3H8NA 4JAMB 4XXCA 2JCCB 5DFVD 3VGFA 4CUCA 3O4LE 3D39B 3QI9B 1G0XA 4CN6A 3L1OH 5IBUB 4LLDA 2X44D 4RFNB 1BM3H 3X3GH 3V7MA 5FKAA 2PUQT 3F7RA 5FYLL 4XXCC 3FO1A 3HAEG 4KPHH 5E99L 3CC5B 1AR2A 1AP2A 3BO8B 4HHAA 5JOFB 4U7SA 3TO2B 1IC7H 4CKVX 5E1AB 1IM9A 1BQLL 4M6MH 4HUUB 4R26L 5JDSB 5DSCA 4Q2ZA 5D93C 3WFEL 3OPZL 4PY7A 1J18A 3BEVA 1JBJA 5JO5B 4S0TD 5F71A 3SOBL 5I1GH 1RZJH 5J13B 4M61B 4P4KD 1HOCB 1TJGL 2HVJA 4X6DE 2WP3T 4QKXB 4M7ZC 3WN5B 3JV4B 4AIZB 2RBLA 2VISB 4GBXC 4R97C 4NN6B 1BLNA 3ZKMC 4QWWD 1RI8A 4LEOA 1JZ3A 4HIHB 3RTQB 4UDUB 3TNMB 1U95A 5KS9B 5GISL 2J3SA 4K94H 1HEZB 1G7HA 2X10A 4FQQA 5HYJD 1I7TA 3GFUA 5D6DA 2VIRB 3GJFK 3MZGB 3RWHB 4U6HB 4QTIL 3U4EB 3RA7H 4FOMA 5FHAH 4TSBH 5GQBA 1QYGL 1J0ZA 1V7ML 4OLZH 1YEIL 5D6DC 3H0TB 4RMSA 1INDH 2LVCA 3BUTA 1U3HD 4U1MB 5HVHC 4YDLC 1EFQA 4NFDA 4RWYH 5E9DE 1PZ5B 4NHUB 1P1ZA 4ONFH 3TCLA 1QSEE 1ZOXA 5DJYA 3HZYA 5GJTH 3FFCA 3BAEL 4O2FB 1WZMA 3RVWC 1NGWA 3T08A 2V5TA 4A6YA 3QYCA 2QR0A 4PJ8B 4OCMC 5A3IC 5GZOC 1AI1L 1IM3A 3P77A 4TVSa 1TZGL 1EFXD 5EZLA 1RIHL 5F7DB 12E8H 4QTHA 2FEDC 4LLYA 5GGVY 4ALAL 2A9MH 4XP5L 4XHJC 4NO0B 4XGZA 4PRPD 4YHLL 2OZ4H 4JPIA 2XPGB 4OCYH 5J1SC 5DK0A 1ZTXH 1R3JA 1JFQL 1FIEA 3GSQB 1LD9B 2LTQC 1HKLH 1Q72L 3EDDA 4RX4D 4NQCB 5F7UA 4OCLC 4G9FB 5I6XB 4UIKL 5JR1H 3GJFH 3VFOA 4G8GD 4QRTB 5DFTA 2L4OA 3IXAA 3DUSB 1KTKE 1IGMH 3UTTD 4UOW0 8FABA 1IE5A 5FYKE 5CGYD 1F97A 1NUNB 1AKJB 4X7CC 4JRYB 2F53D 5DK3A 3P9LB 3T2QA 5C0EA 4JFZH 1INEH 1HKFA 3WLBB 1GZPB 1G7JA 3QG6A 2FO1A 1WCBB 3ARFC 4XPFH 4ELKA 1LEKA 4L4TA 3V4UH 3MA9H 4ZFGH 3GMNA 4HUMB 4OB5L 1MCNA 3QG7L 4MLSA 1LP9B 3IJSA 4YFLF 1N4XL 4I9WD 3TYGH 3HA0A 1JWUA 4Z77A 4WWKA 5JQHC 2D3VA 1V3JA 4H8WH 2PTUA 3CXHK 4MLIA 1H5BA 4G6KL 4GRWE 3UXFA 4JKMA 1JGVH 2ZUQB 2NNAB 1KIPB 3GSVB 3MBED 4DKEH 5IMMB 5BRZA 1G0YR 4CU6A 3MZTA 5DVOA 3PABB 3P0VL 4N0CD 2FJGB 1CQKA 2F54E 2HN7A 4UT6H 1L6XA 2VMFA 4WWKC 2Q8BL 4TSCH 2JK5A 3BVNA 1BAFH 3MXWH 4NO2B 4FQLH 4PRID 3L7EB 1WVZA 4KXZH 3T4YA 1A1NA 1NBYA 3ZKNC 3REVB 2KZ1B 4M43L 4K3DH 4OF5A 1JHKH 1OD9A 1YY8B 4F3FA 1WTLA 3INUH 1RZGB 3WDIA 3P30L 2H32A 4GLRI 1CICA 3QHFH 3SDCB 1WICA 4KUZL 1AGEB 1CFNA 1JYVA 4XNXH 4PJIF 4IDJL 1Z3GH 1R3HB 2NTFB 2Z31D 3U7YL 1WEJH 3B2UD 3CFEA 1IGJA 3MRMB 3RWIA 3WO4C 1ORSB 1MUJB 1QLFB 2VXSH 3C6LD 2V7HB 1PG7W 5D7JD 5TQ2L 3L1OL 3QCUH 3QUXB 4EDXA 2FWOB 4F33A 3VGBA 5CEXA 1D7FA 1KYOJ 4M8QB 1QRNB 3RNKA 1W72L 3WDHA 5IMKB 1NJ9A 5EPMB 4KQ3H 3T0EB 5AZEH 5IJVB 1SYSB 1IC7L 3H42H 3MLRH 3IDJA 3DO7A 2UWEB 2GSIA 5BZDA 3GIZH 5I8OL 1J8KA 1MREH 4XP6H 4FQ2H 1U58B 4YEFA 1KJMA 2F5BL 2YPLD 5IVXB 4LVHB 1RZJL 1NSNH 3N1QC 2YMXH 3TYFB 4X6BB 5ESAB 2IAMB 5FM8A 4QRRE 1YJDC 2ZUWA 3RUGF 3WEXA 2DMCA 3G5XA 5DJDB 3GNML 1IKNA 4A6YH 2KKQA 1CGUA 4FTVA 4IEFB 4XMKH 2VDLL 5I74B 1CIDA 1YPZA 4GAJH 1MCBA 3LEXB 2Q7YB 5DS8A 5SWZA 4HUWB 4PP2A 5F9WC 3LD8B 3WFDL 4X6CB 1SM3H 1FV1B 1WFUA 3U36A 3ROOA 1IKNC 2VR4A 3ULUF 4UOW1 5F7EH 3KHOA 3RA7L 3RZWA 3Q3GB 5IBTH 2J5LC 1JRHH 1YUHA 1KEGL 2OMBA 1CXHA 5BOPA 2P48B 3BZ4B 1INDL 5HHME 4C56E 1D9KD 3RBSA 1BPVA 3U2SB 3LKOA 3G6JB 2AKRB 5EA0L 4LGPB 4O9HH 1T2QH 4Y1AD 4BH8A 4KKAC 1W0VA 1UJTA 1YNKH 5I16B 3SE9H 3UTPE 5ALBH 2LU4A 5GJTL 5GGSY 3QWRA 4FQIH 5HGDA 2CKBB 1S9YB 4GG8B 4OLUH 3RFZC 3H2WA 5F44A 1NMAH 3QIUC 4LKCB 2AERT 4XNMB 5HXMA 3GSOB 3ZKSD 5D7KE 3UTSE 2DQJH 3MRGA 4H5SA 4P2RB 2B2XH 3ILQD 5EU6E 4HW6A 3HTLX 1EO7A 1NBZB 4JN1L 3PQYD 1U6AL 3HN3A 1EGJA 1KLGB 3MOBL 3VI3F 4DCQA 12E8L 1JV5B 4HJGA 3X13A 1FC2D 2Y1VA 1HWHB 2DS4A 4D0CB 3E6HB 2A73A 1ACYH 4DTGL 2R69H 4UV7H 2NXZC 1T21B 1XGPB 3TNNB 3NH7L 1E4KC 1JZ8A 1UB5A 5FOBA 2ESVD 5E8NA 1OHQA 5EU4B 4DVRL 1GZQB 2ZNXA 5L8KB 2VDKH 3WIHL 3SDAD 2RFXA 4PD4J 1KB5L 4X99A 4MD5B 3EUUA 3SGJA 3VFNA 4RQQA 2DQUL 3HZVB 2OP4H 2ADGA 2DLEA 3KPNA 3NIFF 4QRQB 5DJXB 5JR1L 5D9SA 4DGYH 4HPOL 2ATPA 5LQBH 3HG1B 5FHBH 5I75C 3RIFK 3CXDH 4PTUB 5KAQF 2VE6A 3H9YA 4G8EB 2JIXD 2OI9C 5E6IB 3VXPA 3LHPL 1KCKA 4IRSB 1JGUH 4NC0B 1X5LA 1INEL 4JFEA 1KCUL 2A6IB 4M48H 3ARBD 4YDVA 4YQXL 4HIXL 3BZEB 3FN3A 2EDEA 2IPKB 3V4UL 3MODL 1WLHA 1NMBL 2VERN 3DIFB 5E2UH 4JFDE 4OGAD 3SKNB 5IB2A 4NJ9L 2J4WH 2RCSH 4CADB 2VZSA 2YD9A 4HXBL 3HFMH 1FFQA 4IMLB 4PY8J 5AUMA 3RIAK 3NAAL 4XVJH 3X17A 5GSVB 3RDTA 4GKSB 3UC0L 1C08B 1VACB 4JY6B 4A2MA 3H9ZA 4QHKJ 4QHUB 4ONGH 1UVQB 3E1F1 3IDNA 2XTJB 4TSCL 5EDXA 4HGMA 2CR6A 3MXWL 2VABB 4FQLL 2AK4B 5JORA 4HH9A 4BKLB 5CS7A 1B6UA 1MFEH 4P2QD 1OGTA 4AQ1B 4MXVF 1X5JA 1O5DT 4UILL 5AZ2L 2OYPA 3U46B 4K3DL 4PJFF 1JHKL 4NQXB 2HP4A 4ODTL 4RAUB 4D9RD 5BXFA 1UM6H 4N5EC 3VFVB 4L9LA 5DWUH 4NZTH 3ZDZE 1T0MA 3ALWA 2FHFA 5ACLA 1IZKA 3MMEA 2YD7A 2V9QA 1YJDH 4NKMB 3SHSA 1CL7I 2I9LA 2BHUA 4PJBF 1JGDB 2IBZY 3PV6A 4WW2B 3V4VH 3SGDH 2EDNA 4YZFF 3OKOA 1R3LA 1YMHB 5GRUH 4L9LC 2N56A 3FT3B 3HPLB 2VXSL 3AM8A 32C2A 3AFLA 4PRBB 2A74B 1A22B 1WWWX 4H25B 1DLFL 4PRHB 4MQXD 1ZA3A 1EBPA 1OARL 1KTLA 3MV8E 4NQEB 4MD4A 4UT9H 3U4AA 3TO4A 3A6OA 2X41A 5AZEL 1V05A 3VE0B 4N0UA 4OZFA 5GRVK 4CAGA 3O4LD 4X7EC 2N7AA 4G8FB 4ERSH 3R8QA 3GIZL 4MX7B 4LHUG 5D7LE 4I3SH 4OCXL 5IMLB 5IJKC 5LGKA 3NCBB 2HT2C 2WK2A 4APQD 5IR1B 1DP0A 4PJAE 4L8CB 2DQEH 4P46D 2PTTB 4JN2A 4G6ML 1QO3A 5IB1A 1ZT4A 5TE4H 1V3LA 4PGZA 3IT8D 3ALPA 3NABL 5C07B 1HILB 2PTVA 3E6FA 3WFBH 5IV2A 1FAIL 3O4OB 3O8XB 4A6YL 4XMKL 1VESA 2B7DT 1KIRB 1QLRB 5KVMC 5F9AC 2E27L 4PG9B 4KVCL 2ZUXA 5I17A 3C09B 1SM3L 3NZHL 5JUEL 4IIQA 4PJEB 5B38A 2MJWA 4O5LL 5DXWA 4JHAH 3UTQA 4TNWK 2ATKB 4OKVB 1C12A 3OXSB 4MXWL 1JRHL 3CJJA 2AJXH 4J3SA 3FRPG 4RSVA 3IKCA 2IADA 2X4UA 4QXWA 4YDIH 1NCAH 4YGAB 1P4IH 1EDQA 1KELH 4M1CD 4U0RB 2VO5A 4K7PL 3RRQA 2W0FA 5DD0H 4M4PA 4LQFH 1KC5L 1DLHA 2XN9D 4F7TA 3V0VA 1NMAL 5LXGH 1VGKA 4OKDA 3VD9A 5JW4R 3MRBA 5KANG 3FB5B 1HH9A 1U91A 4GQ9H 1CE1H 1G9MC 5ADOH 2R0KH 5D1ZD 5E7FA 1B6DA 1FN4B 2EIEA 2VN7A 5E9DD 4OZIB 1QSED 3QNYA 4WJ5B 1FVEB 2ZPKL 4PRAA 1ACYL 3RJQB 1LNUA 4EOWH 1XFPA 2NX5A 5DRZA 5HYIA 3PL6B 3HAEB 4Y5YB 2LVEA 2WIMA 1I9JL 2FBJL 3FAWA 2OJZL 4O58H 4BFBD 2J8UA 1AQKL 1GPOL 4LCYB 4PJDB 5EC1B 3MO1B 2D9QB 3C5JA 4OUUA 3P4NA 4TUJA 3W39A 1S7WB 2YR3A 2ZUYA 3FQUA 3DX8B 5GS0L 1NCCL 3EYOB 1J0YA 1DQJB 5A2LH 3QRFM 4J2XA 1BREA 3PDDA 5BQ7B 3HMXH 2WNGA 1K6QL 2EDQA 4FA8A 4L3EA 1AO7B 3W0WA 1AGFB 1G7IB 1XCTB 1CFTB 2WWMD 1JGUL 1UCTA 3KHQA 3UAJC 2DB8A 1YEJL 3RQ3A 5KSVA 4RRPG 4PRNA 2OMNA 4BZ2H 3WS3B 1RQ5A 1FL3B 1A14H 5FYKD 3I3DA