3AT9A

Crystal structure of the kir3.2 cytoplasmic domain (na+-free crystal soaked in 10 mm barium chloride and 10 mm magnesium chloride)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
199
structure length
196
Chain Sequence
IQRYVRKDGKCNVHHGNVRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Potassium inwardly-rectifying channel, subfamily J, member 6
publication title Interactions of cations with the cytoplasmic pores of inward rectifier K(+) channels in the closed state
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 196
sequence length 199
ec nomenclature
pdb deposition date 2010-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3at9A00
3SPCA 3JYCA 2WLLB 2WLNA 3VSQA 2WLMA 3SPHA 2WLKA 2WLHA 2QKSA 3AUWB 2GIXA 3ATDA 3ATEA 3SPJA 1U4EA 2WLIA 1XL4A 3SPGA 3ATAA 3K6NA 1XL6A 3SYAA 3SYCA 2X6CA 3ATBA 4KFMA 5KUMA 1N9PA 2WLJA 3SYPA 4LP8A 2WLLA 3AGWA 3AT8A 1U4FA 1P7BA 2E4FA 2WLIB 3SPIA 3SYOA 5KUKA 3ATFA 3SYQA 3ZRSA 2X6AA 2X6BA 3AT9A
chains in the Genus database with same CATH superfamily
3V7AG 1IKNA 1CICA 3QQ9D 4JDEB 3OB8A 1V3JA 4AT6B 1QHPA 1QZNA 3QIWB 3L3HB 4IS6B 3D0AA 3D0VB 4ZMPA 4ZMWA 5CGMA 3QZNA 3V7AE 3K46A 3SSGA 1TG8A 2V17L 4DOHB 2XIDA 3KLAB 1XCWA 3VGAC 4LK4A 2VO5A 3K2IA 1BDYA 1U4FA 3KBPA 4MJIB 2XG5A 1Z32X 3I02A 2LTQB 2ZOLB 3VWKC 4JL1A 5EU5B 3HNVH 3UGUA 2BW4A 2EIBA 4H88H 5CD3A 2XWTB 4EKXA 1W2KT 3NABH 2BS8A 3O4LE 3LZQA 1EAOA 2X4PB 2VSCA 4KI5D 4N0RA 3IE9A 4ORGA 4CVZA 4EMZA 3N5AA 3MUGB 4PRBB 5IEKA 5E8EB 1NA8A 1M7DA 3OAWA 1KG0A 3WTXA 3FQ4A 4W6WB 2KZBA 3ROLB 3ZDZE 4OLXL 3N85H 3PWVA 4X0NA 5CJBA 3P0VH 3GIZH 1IQDB 2WNGA 3DSFH 4JVUA 4OF0A 2APVA 1EJOL 1P9MC 1FO0L 2HFTA 5E56A 1JDDA 2QHLA 3GLZA 1XGRA 3RZCA 4ZS7H 1FCCA 2E3VA 4G3YL 5F44A 1RU9L 5ICXA 4JY6B 1IFRA 2ITCA 3MJ7A 4P4KD 4DT2A 4Z78B 3RX9A 3KE0A 4R4FL 2LVEA 3ES6A 3MFGB 5FOBA 1YEGL 3EO9H 3LHPH 4J3WA 1FL3B 3QFJE 4PI0A 1A0QH 3HI5L 4LDEB 2FO8A 1JGIA 3W3BA 1AHWC 2NW3B 4JPVL 2XQYA 3G5YB 4Y16D 1Q72H 5HY9B 3S36X 5IR1A 3TT1H 5A16B 5I19L 4ZAKA 3P9MA 1BZDA 1AANA 1ZLUK 3IRZA 2GSGA 3DX7A 3IKCB 3INOA 1HOCA 2QSCH 4OZHF 1IQWL 5AWNL 5GGVL 2D4FA 5FC9A 3T4AC 4KO7A 5D7IE 1OV8A 1XF3B 1N3NB 3INUL 3GIVB 3EYFA 3WKNA 1T0MB 1QVOA 4KKPA 5BCAA 4UDTB 4AIZA 3MOBH 3PGDB 4LBEA 4X7FC 1ES0A 3ZTEA 5GZOA 2ZXWB 4APQC 1G7QB 2WO4A 4HHAB 4Z0XB 2OXHA 3MJ8B 4HV8B 2XWJA 5C0AD 1SJEB 3GHBH 1TQCC 3KBEA 1QFWM 1T03H 2M2DA 1OSYA 1IAKA 4OY9A 4AJVA 2QVIA 1ZLSL 2VQ4A 4PBVC 3T09A 4WUUD 1JHKH 5DRZB 3SZKC 2O5NA 5IREA 4PJHA 4PGJA 2P5EA 4QRTA 3TPUB 2ESVD 3VFSB 1HEZB 1OQOA 4KTDH 4EUPH 1GTFA 2XN9E 3ECQA 4A55A 2WUBL 2R0LH 4YE4L 3TF4A 7CGTA 1OCCB 3NA9H 4YXKH 4EN3C 3E80A 1T2QL 4AJ0A 1U8HB 2Y7MA 4V2CB 1KBBA 3AS3A 2VDMB 4WEUD 2DQHH 2O30A 4LCYA 2H3KA 4YO0B 1A6ZA 4YSEA 3V0JA 3V0HA 4RRPM 1J86A 5F9DC 3Q13A 4GKZA 1L5GB 2PPDA 1WCQA 2BMKB 3DARA 4F8OA 4NIYE 3EW3B 4WI9A 2BSTA 2J73A 4DZBA 4XTRC 5JW3L 3BGMA 1OE1A 4DPCX 5D1ZC 3FFDB 3SYCA 3ZO0A 4WTWA 4EDXB 1G9NL 1HQ4A 2P43B 1MRDL 4UTBH 2XZZA 3S0PA 1TUPA 3QULA 1ZEAH 1WC7B 2HVJB 3UTZA 3F7LA 2Z93A 4D8OA 4WUKL 1U8KA 3TXAA 2A6DA 4XBPB 5E2JA 1AGBA 4QTFA 1IT9H 5EUOB 1HQRA 1VDGA 3EYOB 5C9JA 3MRGA 1NFAA 3VTAA 3H3KA 3T77B 1EVUA 3L4UA 4V11A 1IGFL 3EGDA 4JN2A 4JPSA 1JI1A 4HSAC 4EI0A 2VLKE 5B7FA 1BFOA 3QQDA 3S3SA 4RZKA 4FAAB 2D7TH 1FLRH 4GSDH 1T5XA 3CN1A 4GMSH 1KUMA 3RWCA 4HUVB 4MQ7A 2J6EA 2VUKA 1AFVH 5F6IC 1LE9A 1DVQA 1WWBX 1BQLH 4HISA 5AW3B 1BYNA 1P4IH 2OMYB 3X1GA 2GSMB 1OPGL 1EJ6A 4LSSL 2NUPB 5FKPA 1JN6B 1WZMA 1W8NA 1MZZA 1L9QA 2J5LB 4K9EL 3QJOA 1HHKB 3G04B 4P2RD 1CT8B 1UUSA 1U4EA 2FECI 3BWUC 3MO1A 4UOJA 1ND0B 1UURA 3QXVA 4D9QE 4E9XA 2X1QA 3Q5TA 4IM8A 4PCKA 4NUPA 4Z8FH 4HW6A 1C08B 3CLWA 3VD1A 3FQYA 4HAGA 5FYJD 4NZTH 2J43A 1R0AH 1G87A 1DQKA 4W9KC 4WFFD 1WTLA 1YNTB 5E9NA 1MFAH 2R39A 2QKSA 3X3GL 2FB4L 2KS0A 4YSAA 3MX0B 4EIZC 4C56A 4JK0D 1L0XA 1XIWB 1CDJA 4YLCA 2Q1EA 3RWFA 1NPJA 2B0SH 2O6CA 2B9AA 2CU9A 4GH7B 4YSCA 4MCYA 3PNWB 3WE1A 1AZZC 1F5WA 3QGVA 1JHTA 4W4OA 4BGLA 4NQCB 4PS3A 5CR8A 5AW5B 1HHGA 2BOLA 2L7UA 1DR9A 5F8RC 3RVWC 5HYJE 4MAYB 3CLEL 3Q1SL 4YHML 1USZA 4HXBH 4L18A 2B08A 2FL5B 2DQMA 3MACL 5FM5M 4PY7B 4KAQH 4B95C 4WJ5A 5FUOH 1NMBH 4RFEB 4YR6A 1WE5A 3BVNB 3UADA 3ERXA 2HN7B 4KTYA 1R5VA 4NZRL 3GXUB 5IQLA 3U48A 3ILDA 1T3FB 2OTWA 3NFPA 4G9FB 3QIBA 1NFDE 4TLTA 1I3VA 4JPKL 2W1NA 4UT6A 1IUZA 2IH1A 2W38A 1E8YA 4CU6A 4R2GD 3CN3A 3ZRFC 1F3JB 1S7RA 1NCWH 2NYKA 5JIHA 3BJ91 1E8ZA 4NC1C 4OSUL 4G83A 1CU4H 3F05A 3HKFA 3WKQA 2GJPA 1B9ZA 5IB1A 4WU7A 4M93C 3D4CA 1IAIM 1HE7A 3A4AA 2ZKMX 3SDCC 4NIKB 3T6ZA 4Z7UB 4EBQH 3CZLA 5E4EB 2OJ1A 5HHMB 3MRPA 3ULAB 4BDVA 4KV5E 3B3IB 1NMCB 2F9BT 1QNIA 2XPZA 3IS0X 4HCRA 4L05A 1C5CH 3QRLA 5D70L 4XN7A 3ALWA 5D1XD 5K93A 5F7EL 3QUZC 3NJFA 1IAMA 3NYKA 3ZTNL 1NAMH 4XBEL 4O5LH 1UWGH 5C0RH 4HDIA 1XCQB 4TVPH 1F58L 4JCWA 3ECUA 2CBMA 5E94A 4HWBH 4Q9QH 4FQJH 5EORH 4YSQA 3MLTA 5C0DA 1GY2A 2E47A 1E8WA 3IJ7A 2R8SL 1OGPA 3F58L 2NY1D 3N04A 4YFEA 3VWKA 3MYJA 4KPHH 2VLME 3PHOA 1RUML 5CBAA 3GMMA 3IDIA 4JM4L 4R5VA 4BQ6A 2B1HH 2CBOA 4JFEA 1FN4A 2R7EA 2OR8A 3H7LA 3OAUH 4LSQL 4N2EA 4F7MB 1U8PB 5AAPA 1AS7A 3WSQL 3UBXA 1FJ1B 1ZVNA 2G3MA 5CWSA 1A3RH 5C0BE 5GS0L 2J8UB 2J88L 3VFPB 4Q4IA 3AUWB 3AQDA 3H3PH 4GS7C 1WFUA 5MEPB 1RURL 3HLKA 4GG8B 2BHZA 5FF6B 5T1LB 1ZHKB 4TYUA 4U1NB 1O7DC 1A64A 4GPVA 4NUJA 1N0XH 3ZHLA 4TSAH 1F41A 3GS7A 3T0XA 1P9MA 1RZFL 3SDAB 2VJ8A 4OW6A 4HF5L 2FEEI 3LIUA 3LMJH 4Z18A 1QBML 3DRTA 3SO3C 1TZGL 1B6UA 4Y2LA 2WXFA 1DBAL 4E42B 4XMTA 3JVFC 3STLB 4ODVL 4G42A 4U49A 4BHUA 3UPRB 1RCYA 2VDNH 3BE1L 4R3SA 2YSSA 4IJ3B 3VFTA 3DVNA 1LO3H 1AHWA 2XTJD 3QBTB 3VQMA 4MMYB 4K5NA 4U6YB 4WWKB 2DM4A 4U4IA 3OKEA 4GSQA 4ELMA 2UUDH 1F42A 2VYRE 1NL0L 1DQLH 4NPJA 2MEJB 1A14L 4MHHI 5BMFL 1AHKA 3VDBA 2K8QA 1DN2A 5AYUL 3CMOH 1AQHA 1MW3A 4Q9RH 3L7FB 3T4AA 4IQHA 2ZIDA 2WMPB 4MA7L 1VEPA 3MOAH 4XVSH 4M3HA 3FU5A 4KQ4H 1OE3A 1QO3B 5KS9F 1MFEL 1SVBA 5JXED 1YUHB 4FQ2L 2KHAA 4BKSC 4ZMTA 2H26A 3MCLL 1FZKB 4XPGH 1HKFA 2DWEA 4APQA 2Q3XA 1I7UA 2BNUB 3G08B 3U4AA 1CDYA 3V5KB 4KO5A 3V9FA 3RA7H 3IN2A 1CG9A 2BOCB 3WBDA 3VD3A 3V10A 4YWGH 4Z7QF 3S3JA 5DMIH 3UC0H 2H4EA 2V9TA 2A6IA 5LGYA 1DVFB 1VPOL 4QYAA 1E9QA 4YDVA 2OI9B 2PW2B 3KPNB 4N68A 1X5GA 4FFZA 3ORJA 2IO5A 2FIRT 3NJNA 2WLMA 1D2OA 32C2A 4EN3A 3M8OL 3FOMA 5I76A 3HZYA 2D9CA 4Z9KB 3LKPA 1EAPA 2AQTA 5J89A 1RZKL 1G6RH 5GSRA 5SWZD 4BH8B 2VZ1A 5TH2A 1FFNB 3C5ZC 3HCVA 3MODL 4K73A 4YZFF 4XMKH 2QV2A 2GCYA 3HG3A 2B15A 3CBJB 3KD4A 2R9HC 4JREB 3TIEA 2V7NA 1XF5B 2PWGA 3ARDB 4G5ZL 3NDYE 3V6FA 4PJ8C 3LXAA 1MFCH 1SMOA 3RBSA 3MZTA 3WJMA 4J3OF 4PMEA 2ZQKA 4NB7A 4UQ3A 2W9EL 3OXSB 3FT1A 2ZXAA 4QTHA 5FK9A 5DMKB 1OAUL 3ILPB 3S4SG 3MXWH 4WV1C 4J6RH 2C4FT 1UXSB 1OOWA 2FHFA 3U6RB 1PAMA 2DD8L 3GJFH 1FZOB 3OMZA 1J1PL 4YN3A 4LSRL 4YPGB 4Z76A 4ZFFA 1JGLH 1TZHB 4FFYL 2ICWJ 2FHCA 5TF0A 3O6FB 4Y2DB 1NGZB 1EGJA 2HT2C 1GZQA 4CU7A 1N12A 1UZ8A 1IBYA 4PJ7A 4I0KA 4Q0XH 2AQRA 1O7SA 1OHQA 4PUBL 3BPLB 3RFZA 4YGVA 3S8GB 3VM7A 1EDHA 4PR5A 1F86A 5DUMH 1SUJA 1IAOA 2YGVA 2VDKB 3GSUB 3WIHH 2CNZA 4D0CA 2IBBA 4JPWL 1GH7A 1UVQB 2NQCA 2I7SA 3O0RH 1UZ6F 2B2XH 3BVXA 3QB7C 5IMLA 1KZYA 2YK1H 3DGGB 3QUYB 4EO5A 4N2DA 4PD4J 3TX4A 1XSOA 2DQGH 1E5AA 4UQDA 3T8XB 1QI3A 4Z7WE 4PW9A 1UD3A 1FFOA 4AQ8C 3IU3A 3VTMA 3C6SB 1G7PA 4MYWB 4FKKA 2X1WL 3A0OA 3DV6B 5DLLA 3VI4B 2V2TA 3GXNA 5D71L 3QCTL 4P5KA 5ACZA 4AEIH 3ZDXF 3VX1A 2JVUA 2XY2A 1RIUL 1WBZB 2OZ4A 3UAJD 1NEZG 3WS3A 3AY4C 1CF1A 2E8ZA 4IRSD 4CBPA 4HULB 4CGTA 1YEFL 2YPLA 3RDTD 2CO6A 1FYTB 1QP1A 2NXYC 1LK3L 2VAJA 5C0GB 3EBIA 4Z7VA 5I6XB 3PE9A 1KJ2L 5CCGE 1W0WB 4O58L 5I6KA 2WOBA 1F02I 1ZXQA 1EERB 4ODTL 4LGRB 5C0CA 1NJ9A 5DJDA 5HHVL 1JZDC 3JV5A 2PXYC 1GHFL 2J1YA 3PJSB 3KPPA 3BI9X 3FTGA 5JQHC 4JX0A 5DC0A 4FNPA 4LQ1A 4AENA 4U1JA 1HXKA 1MIMH 2BVYA 2NZ9D 3MSPA 43C9A 3JV6B 3FUKA 5ABZA 3LPWA 1AKPA 5E8OA 3I50L 1QBLH 4PJ6A 5G4OA 1YJDL 4TSBL 4IDJH 2EADA 3LPFA 2FD6L 2DL9A 3FRPA 1EXUB 4NO0A 4XP1L 1TTCA 1URZA 1SNRA 4GY4A 3T2NH 4K9JA 5B38G 2KUTA 3BPCB 5I73B 3O9WC 1WWWX 3H2PA 1M05B 5D7IF 1HEJC 3TJEL 3HMXH 5FHAL 3G6AB 4M62L 3IAQA 2DS4A 2Z65C 3L54A 4Y4FC 2JK5A 4HSQA 4PB0H 3KCPA 2PLTA 3V4VL 4N6QA 1H6UA 4NNPL 1I7RB 2DQJL 3WNJA 5F7UA 1F3DH 5DYOA 5SWQB 1SXZA 3K91A 2XN1A 4TLKA 5FW7A 1LDPL 3ZE1F 3SDCA 4A6YH 5EEUA 5FGBC 5I28A 3KYAA 4OIIH 3TV3H 3EH4B 2DIJA 3S5YA 2AJSL 3MLVL 1CICB 1FNFA 3GSVA 1DE4A 1G4MA 4R7DA 1G4RA 3QUZA 3EJZD 3GRBA 4U1KA 1T66C 3D52A 3X1NA 4HJGA 2IOMA 2YO3A 4BD4A 5K9QI 5DF0A 2I9TB 1OLZA 5BQDA 2Z31C 1NBVH 5CSZA 4I0PC 2GW5A 4MXWH 2XG5B 4LDCA 1PG7X 3AUVA 2X10A 3I02B 4HIXH 3NACL 1CLCA 2H32H 2QR0A 2WWMD 1HINH 5T33H 6PCYA 1V05A 1A7PH 5CD3B 1TF4A 1AQKL 4JM2F 4A2MA 3OJ2C 5FECB 5IVXE 4PJCF 3IAPA 4ZTEA 1J7VR 3HG1D 4NQDD 4K7FA 2NY6C 4ORGB 4CVZB 4KKCD 2C3WA 3LKNA 5IEKB 3WHE0 1OSPL 5AOMA 4L9DA 1M7DB 1R6VA 5DQ9A 1KG0B 2ZWSA 5B4MD 1UUNA 4XO8A 4RWYL 4PJEE 4P2RE 3PWVB 1HEHC 4ZW8A 2WN3A 1EX0A 1M53A 1JZFA 4Y8AA 4ODWA 5HHOD 4M5YL 5A2AA 2NQ3A 1SHWA 3ZX1A 4A04A 1XGRB 3RZCB 1FQ9C 1FVCA 3CZSA 4ZX3A 5ICXB 1RPUA 3S6CA 2ITCB 3LRHA 1N4XL 2F08A 3NZHH 3WOVA 4G7YH 3ES6B 1YEEH 2ZOOA 4NAQA 5TE4L 3SYPA 1PSKL 1FVEA 3WS6C 3NRQA 1MRCL 2QQQA 3E8UL 3ZKNC 1ZSHA 1WFNA 3ULSA 3S88H 2JCWA 5JW4N 4ONGL 3RWGA 5I18L 4LO9A 4OBSA 2OYMA 2A9CA 4XNDA 1OQXA 1NINA 3OZKA 2Z35A 4IJTA 1XD0A 4DO6A 4JFDA 1SDYA 3FF8A 2IANE 1VFBA 3BEVA 4Y1AA 5E5LA 2FX7L 5IR1B 3C8KB 3N42B 1WGOA 2BNQA 5CEYA 1C9SA 1QTSA 4RMVA 4ZAKB 5LXGL 3P9MB 4OZ4A 3VSTA 4N0UA 1AG6A 1JPTH 2GSGB 3DX7B 1TETH 3OKDA 5LDSA 1F4HA 1HOCB 3HUJA 2RH0A 2IWKA 1RZJL 1E7UA 4L1SA 3EYFB 1PJWA 1QVOB 1NLDL 3RWHA 4AIZB 2G2PA 4LBEB 3T3PF 4LEOB 2P8PA 2YA2A 1ES0B 3KYKL 4U1HA 1VF5C 4ZW7A 1AAJA 5GXBB 4Q14A 2OXHB 1YEWA 4YLBA 5A2CA 2XWJB 1YYLL 3TYGL 1EO7A 2IWGA 4N8VA 3WMQA 5D7LE 2DY2A 2IH8A 3UTQA 2VN6A 2OMZA 3LEYH 4HFUL 2F54A 1AR1D 4PJHB 1OB1A 1P4BH 2P5EB 4QRTB 3MA9L 3OPZL 1QWUA 3TEXA 2HT3C 1W0YT 2VGLM 3V0WH 3P54A 3BAIA 1Z5LA 3BN9C 3B2XA 3PV6A 5DI8A 2RCSH 4XNZB 5J6HA 3GKWH 2WWKT 4X9GA 2WUCH 4LCYB 4XCYA 4WO4C 3K8MA 5CZVL 1FRGL 4HS8H 1A6ZB 5IV2A 5DC2A 1RUAL 3D69A 1A6UL 4OLWH 1KTDA 4GKZB 3TL5A 6TAAA 5F7DA 3QEQD 3PY9A 3C5ZA 4G43A 5T3ZL 2AXGA 1XL6A 1PFOA 1MCWW 4MXQC 2OXGA 3ZL4H 2AJYL 1YG9A 2BSTB 1BV8A 2QADC 1PLAA 5D1XE 4AW4A 4DZBB 1AO7D 1RUQL 3ULUD 5F1IA 3BGMB 4KJQC 1WIOA 1KLFA 1QWHA 4PJ8A 5I82A 4OJAA 5C0EA 4CMHB 3KGSA 4NKDA 4XN8A 2A74C 4OCRH 1HQ4B 3ZKMC 3BDBA 1CCZA 3MZGB 2A73A 1C7TA 3OZLA 5ITFA 1KY6A 1TZAA 1OM3L 1VZGA 3QULB 4PRDA 2Y06L 5BS0D 4EDWH 3UTZB 2YPVA 3W82A 1OP9A 2Z93B 5LBSH 1ADQA 1U8KB 5AVZB 3FMGL 4Z7AA 5C0RL 2A6DB 1AGBB 5AW7B 5CKGA 2C9RA 5C9JB 3MRGB 2XDHA 3OZ9H 1EUUA 4FG6D 4HMCA 3ZLQC 1XBRA 2WVSA 3BVTA 2HH0H 3GM8A 2X89A 1FFRA 5E1QA 3EGDB 5FCUH 3P0GB 4JN2B 5AW6B 1BFOB 2PCFA 3QQDB 3W11C 1U3HA 3HG5A 3TU6A 1BIIA 1YNKL 2ISDA 1OAXH 4MNQA 3RWCB 4M5SA 1BF5A 1ZHLA 3D2UA 5CGTA 4ZMXA 1LE9B 2Z9TA 3VXMA 1IC7H 4JFFE 4ANVA 2BVTA 5T3ZE 4Y19D 4WNJA 3NCBB 3JQOB 4M8UA 5D2LE 3VD2A 5FKPB 3UYPA 2BP0A 1NSNH 1EZVY 1EDQA 4QXTA 3ZUNC 2GUYA 1GIGL 1MVUA 2IDCA 5KYNA 5CUSH 1I3RA 4RAHA 1KIRA 3ARRA 1GYUA 3F6JA 3HAEH 2ZTBA 3MO1B 1JVOA 2BFVH 2VDQB 1TVDA 2XTJE 5F1NA 3UAAA 4F91B 3VA6A 1ZWIA 3H0TA 5E51A 5G4MA 1JV5A 4ZBJA 1DL7H 3FFCE 1D9KC 1LEGB 2YD6A 1KNOB 2Y7QA 2ZX5A 4KITB 2XQYK 1QSEE 4FJZA 4OTXH 3QUMH 3WGUB 3FU7A 1BG9A 4N2LA 2Q8BL 1YEKL 4NQED 3GNMH 1PZ5A 1EANA 3P11H 3AY4A 3ZZSA 4PRNA 4F58L 1SEBA 3OHMB 2ZX8A 4F8NA 3ARBC 1Q38A 3MKGA 3V9CA 4C56B 4F37F 4PJAA 5HGHA 3OMIB 2EIKB 3RWFB 3DJZA 3QS2A 4ETYA 4MCYB 4X6CE 5ES4B 1JHTB 4HSCX 2CGZA 2F0CA 1FFQA 4KNSA 4TS6A 1HHGB 2ED6A 4WKXA 4NT6A 2NTFA 4KZEH 4F9PC 1KENH 1JHLL 3F6LA 1BD2E 3AB0B 1HI6A 3NZSA 1MH5A 1Z3RA 3EG9A 2R29H 4X9HA 2BHFA 2P44B 1JPST 5L9DL 2CCVA 4WJ5B 5K9KA 1RUPL 1E5BA 4U1IA 4YR6B 4AV5A 1KEMH 3IPBA 4LQFL 4BA0A 2E7MA 1AZNA 3BQUD 4L3EA 4GO9A 1NCCL 4JDTH 1R5VB 4XHQA 1IM3D 4JKNA 4YHLL 2OTWB 5E99L 3NFPB 1SXBA 3NG5A 3QXTA 2YUZA 4KROC 4NN7B 1T2XA 3HC2A 2XPYA 5DR5H 4B7IA 3QIBB 2ZUVA 5G5DA 4AYBA 5ALBL 3FT0A 3O9WA 1TVHA 1NAKL 2IH1B 2XETA 3IFLH 4YIQA 3ZPDA 1WITA 2G0LA 2GQHA 5F9OH 2CA4A 1S7RB 4JM2D 4NN6B 2J4WL 3MN8A 3M88A 4HEME 4P04A 1B0WA 4Y4FA 2J72A 3QISA 4M7KL 2XVGA 1J18A 4WU7B 1JPFA 1J1XH 2VL4A 5LNEA 2YQBA 5IB1B 5IJVA 1GC1L 2VLJD 3VSUA 3AABA 5C2UB 5KG9A 3NCCB 4ZMQA 5F3HA 4E41A 3EFDH 1O5PA 3Q2CA 3QNXA 5IP4A 2YR3A 2ZF8A 3AFLA 3MLWL 3MRPB 4MDJA 4BDVB 5ILTL 3LZLA 5FGBA 1K4CA 4LSPH 4EIBA 5IM7A 1BIHA 3NH7H 4W81A 4ZTOL 3VFUA 2E27L 1Y6MR 3RILA 1GR7A 1SHSA 1GGBL 2C9VA 1A7NL 1OEZW 2HRLA 4X7SH 2D0HA 2IQ9L 5FM4A 2X1XR 4LLQA 4QRBA 1LO2H 1LJMA 1R9FA 1X5XA 4HDIB 5JQ6L 2WLLA 4Q7DA 5E94B 5DZLA 5ETUA 2XIBA 2C4XA 4FG2A 5C0DB 3VGAB 2Y6SC 2Z31A 3CUPA 5DQDH 5AZEL 3OKOA 1U8IA 4I0PA 4ZXBC 3PLYA 3FU9A 3MYJB 3RI5K 5ISZA 3PHOB 4YMPA 3GMMB 3IDIB 5CBAB 2MOQA 3D33A 3FBKA 4JHAL 4JFEB 2HLFD 1FN4B 1TOXA 2R7EB 3MJ9H 2XA8H 3ZBMA 2FATH 1UM4L 3UCQA 1E9PA 4AEHL 1C8PA 1HWGB 5L7XL 3UBXB 1BMGA 1ID5I 5CWSB 4EPSA 2AEOA 2WXKA 3PHQA 3BUYA 4F93B 1ZGLM 3L7EA 1CYGA 4IHBA 5DEFA 3WFDH 4AI7A 3FAWA 4OQTA 1F6AA 2FQEA 4NUJB 4BCXA 3DTDA 3KBFA 1PZDA 3PDGA 2XFGB 2H2PD 3W2DL 2G9KA 3U2IA 5E0FA 3QDJB 2H1PL 1WHOA 2L0DA 3DJSA 4GI6A 3SGDI 3LNGA 4KI1A 5DVMA 3WJJC 3W57A 2NX5E 3ARGD 2AEIT 3BAWA 3N55A 4E9TA 1HZKA 4X6DA 4AEEA 3WS6A 2FBJH 1JF5A 4G42B 4OCWL 3KR3L 5DS2A 5AW9B 1O9VA 3BPNB 4O2FA 4R3SB 4Z95H 2YSSB 5AVSB 3VFTB 4Z7WB 3DVNB 1H3WM 2ZYHA 1AHWB 1UD4A 1CC3A 4NRYB 3H55A 3QDGE 4QWWC 2DI9A 2PPAA 1YPZE 4ELMB 4MJ4A 1P5UC 3BXNA 4JUTA 2FGWL 4XXCC 1SY6H 2N7BA 4DUWA 5I1JL 2W0PA 2PR4L 2WGXA 1YNLH 3HE7C 2F1BA 2LLGA 3T4AB 2NY2D 4D3CL 1PZ2A 2J1KA 3C60C 3DPDA 3VGEA 4TNFA 3G9AB 4WI0A 5C7XL 4M6MH 4UM9D 4YBQD 5AB1A 2WHVA 5I1CH 2VJXA 4ANWA 2EDJA 1P4LA 2JIXD 3PQYA 4O00A 2H26B 4APQB 2DWEB 2R1WB 5D9SA 1FLTX 1RHHA 3RNQA 2O5XH 4Z0BH 5GIRA 3DSNA 5FYKL 1CG9B 1DYZA 1TQCB 3LZFH 4UINL 3HRZC 3TJHC 5I1DA 5I0ZA 3DXAA 3O2DL 5EBGA 4YDKH 4V1DD 1KJ3L 2A6IB 5IB3A 1CIUA 3MV8A 4IKLA 3UEZA 2UUDK 4JRYA 2WQUA 1E9QB 4YDVB 1CFBA 4OZFG 5J12C 2QQLL 4HCIA 3BW9A 1J5OL 3VRLF 4YXHL 3R4DA 5EU6A 4DP8X 3RWJA 3T1WA 3SBWC 2YEZA 32C2B 3PNRB 4EN3B 5I76B 3FOMB 2CHDA 3S96A 1B4TA 3LKPB 1C7SA 1EAPB 1TNNA 4WO4A 5GSRB 4IOSD 5TH2B 3QUGA 1BZ8A 4H1LA 5I6LA 4K55A 4H8QA 4PJ5A 1OAQH 3VXSD 3TWCH 5GGVY 2CLZA 2DQIL 3GBNH 2GCYB 4GSUA 2EH7L 4KXAA 4QXUL 4EVNA 4LEBA 5KSBE 4IBQA 3TIEB 2V7NB 2NY0C 3F7VA 4Y5VC 5IMMB 1QFWL 4ZG1A 4WKZA 1W8EA 2BHYA 2MCAA 3WJMB 2WZ5A 3ASOB 1EH9A 3VB8A 3MI6A 4N5EC 4Y4HC 2AHIA 3APDA 4UQ3B 1COBA 4G5AA 2XBDA 1KIUA 2A74A 4GRMB 4QTHB 2YMTA 1QLEL 5FYKE 4MCMA 3OQRA 4A7VA 1QATA 2ZNXA 3TURA 4K8RL 5E03A 4JO3H 1DBJH 5BRZD 1I8LC 5H4YA 3W5MA 5BRPA 1UOKA 3AS1A 4Q6KA 2OP4H 1KGCE 1PX3A 4U3SA 4ZFFB 4Z76B 5H94A 1BQHA 3B9AA 1O9ZA 4M6NH 2ZICA 2BINA 3FU6A 5E2VL 1UHVA 1GZQB 5DHEA 4PJ7B 2YSTA 3S97C 1EZVX 1AGEA 1AXIB 5I75C 2ZWZA 2Y7NA 3QRBA 1MRFH 4YGVB 3RFZB 3Q9PA 2EDYA 1KYAA 3U36A 5KUKA 4PR5B 2AJXL 3DX6A 1IAOB 3D4GA 3SGDH 5F6IB 5FUZL 3S34H 3MXVH 2EABA 1VRSA 3WKYA 4D0CB 5AD0A 3MUZ1 5DVKA 2H2SC 5A6MA 3MV7D 4HS6A 4YSPA 5IMLB 4J8RA 3OLDA 2R69H 5KJRL 1K3IA 4KGJA 1S7QA 3ALPA 3FO0L 2EDNA 2I07A 1QKZH 1B3IA 3NEXA 3VTTA 4I77H 1GGCL 5PAZA 1WFIA 2W9DL 2YD8A 3UJTH 4O9HH 1FFOB 4ZUWA 3QW9A 3IU3B 1D6EA 1G7PB 3U30C 4PGEA 1JZ6A 2C3VA 4IRZH 1TEFA 5D72H 1A4CA 2ZWYA 4JFQA 2PYEA 1A66A 4RRPG 2V2TB 3TZVC 4XPAH 1J5IA 1CTMA 4P5KB 3T8VA 1GMIA 1F4AA 1JZGA 5ACZB 3KGTA 1D9KA 3ZQ9A 3L4TA 1YYCA 2PYFA 2DQTH 2OJZL 4XCEA 1XH1A 3WS3B 3ZR5A 5F0MB 4PN6A 4DVRL 4G8AC 1JPGA 2YPLB 4TNWK 2CO6B 4RISH 4Y9FA 3WLWD 4W70A 2CRYA 4MXVF 3ARBA 4PJIF 3ISWA 4KRMB 2DKUA 3DUHA 4Z7VB 1MDAA 2XKSA 5JR1L 4O02L 3DA0A 5EZOH 1UT2A 2AI0H 2NY7L 4AV0A 1A7BA 2UXVA 1UENA 1QOKA 4L2YA 5C0CB 5DJDB 5E6ID 1A22B 4DGYH 4KY2A 3KPPB 2LE9A 2BP3A 3FTGB 4F9PA 1NGQL 2DQCH 4AENB 2YAOA 3DV4A 2H9GA 4S11A 5GHWL 1AP2A 4S0SD 3K6FA 43C9B 5AEAA 4TVUA 4UTCA 1CLOH 2LU3A 5E8OB 1ECZA 2A9MH 5I1AA 3KVQA 5IW1A 2AZAA 2OL3H 3U0TA 3FRPB 3DDGA 4NO0B 3P69A 2YRPA 3B2VH 3VD4A 2EE2A 7FABL 5MI0C 4HJUA 2BIPA 2EYRA 1C1EL 4FABH 3QEQE 3BZFA 2R1XA 1MNUH 5E6ZA 4CVWA 2Q10A 4Q9CA 4J3OC 3ZE2E 3IPEA 5IOKA 2JK5B 5I8CA 3KCPB 2VDKH 1AO7E 5KVDH 2E56A 2NY3D 1QSFA 3FU0A 4G1MB 3D3VA 2AFNA 3EYQD 4HIPA 4JHUA 4M93B 5DYOB 5GRVK 3UTTE 1BG1A 3V4PH 4N3UA 3I2CH 1A7OL 2DKSA 1FH5H 3E7JA 3G3LA 3SDCB 4DESA 5J57B 2JCCF 1WZKA 3N1GC 3BMVA 4C4BA 3T4YA 3QJTB 2BVOA 4JS7A 2OK0H 3GSVB 2ZUXA 3IXAA 3T0EE 1R3IH 3DURA 3QUZB 3L1OH 2HFEA 3AG4B 4GG6F 4U1KB 1BQKA 1KYOJ 1S7TA 1X9QA 4HJGB 4XNBA 5EZIH 2XYBA 1SYVA 2N1TE 2BRRL 3AS2A 3IJ9A 2E6JA 4FEMA 4JANA 3PXJA 1H8OA 5CSZB 4DCQB 4HIHA 2K6YA 3T2PA 2DTSA 3A6BL 1T0NA 4OB5L 2R2HA 2QR0B 3ZHFA 1VKXA 2R2CA 3ECVA 4ZXBA 1BVKA 2VRAA 4MKTA 4OGXL 2ORBH 2HX8A 4NO5A 4Y2NA 5JHAA 1XF4A 4S1RL 4K7FB 1QG3A 1X5IA 4TVPD 2F53A 1PAZA 2GC7C 3ARFC 3LKNB 3VG0H 2GVYA 5DQ9B 3ROOA 2FH6A 4TMPA 3QIUD 1F3DJ 1J8HE 4FF9A 8CGTA 1XCXA 4YEFA 3UMNA 4GS7B 3LQAH 5AALA 2YD7A 2VZSA 4ODWB 1D7CA 4Q56A 4HA1A 3V4UH 1FVCB 1KN2H 3ESVF 4P23C 1IBGH 3IETA 1UB6A 4UT9L 1NCBL 5AOIA 2IAAC 2VSKB 2DICA 3GBLA 3H8NA 3SO3B 3WJJA 2A7BA 1FVEB 3EOTL 3GLAA 4ALAL 4JVPA 1LEIA 3ULSB 4PSPA 1KTBA 1K4DA 3ENEA 4QXWA 4W68A 4EKJA 1E9OA 4JKMA 1Q9OA 4NQEE 1I75A 1CZ8H 1Z7JA 2PP8A 3N43F 4U6HA 5CJQH 3E9UA 3RWGB 3VM5A 2Z35B 4W9ZA 3WGVB 4JFDB 4CSZA 2JB5L 1VFBB 1YEHH 2NZ1A 2WBXA 3BEVB 4Y1AB 4W93A 2JTDA 2BNQB 1F2QA 1QPKA 5CEYB 5JHLL 2ZG3A 4L4TE 4OZ4B 4N0UB 2HTLD 1FI8C 2QLYA 1P5UA 3OKDB 4M4RA 3ZSSA 4QHMA 3HUJB 4XXCA 4J4PC 5D2LF 2UZPA 3NAAL 2DB8A 3BKMH 3AZUA 3MNZA 4TM9A 4YBHA 3HE7A 3RVVD 1I53A 3QZMA 4A37A 4DN4H 4EI5D 3RWHB 5M7QA 1USQA 2LFEA 5DURB 4AW7A 3SKJL 1U36A 3S2CA 4QXGH 4MTMA 2P8PB 1L9TA 4N9GA 4E36A 4U1HB 3C60A 2VDOL 3CDYA 1SQMA 3MBXH 1OZUA 1BQUA 2O4EA 1EBAA 4PW4A 4E9QA 5HHXH 3VG9C 2WZAA 1CBVH 4Z7NE 5MERA 4N8VB 4P2OA 1JUFA 1S5HA 3VXRD 1Z3GH 4JM0A 1XVSA 2HKHL 3L5IA 3H6AA 2OMZB 2LFGA 2X7LA 3HRZA 2F54B 1WHPA 3FT3A 3WKPA 3WTWA 1OB1B 3QFDA 5FOBB 1LP9F 3M86A 3QC6X 5D93C 3VDAA 4H5SA 2FIKA 3K2KA 3QZWA 4LU5H 1MF2H 8PAZA 1Z5LB 2D3VA 2PP7A 3MUHL 3PV6B 4GW4A 4KFZC 5DI8B 5J6HB 2XYCA 3TN0B 1PF3A 4XCYB 4GKOA 1RJCA 5T5FA 1EAJA 1A5FH 1NWOA 1TENA 2PR9A 5IV2B 1I7TA 3D69B 3HNVL 3QUXC 1FPTH 4I48A 1KTDB 5HJBA 3DNKA 5ESVA 5IY5B 1W72A 5F7DB 4DTGH 1F8TH 4H88L 3C5ZB 4G43B 3F7KA 5HP5A 2AXGB 2CHNA 2OXGB 4L8SC 3NABL 2VXQH 4M1GH 3WTSA 4Y5VA 5F1IB 2BX5A 1KLFB 2W94A 4PJ8B 3L2LA 5F0JB 3WUWA 5C0EB 1OGSA 2QT6A 5FA3A 2LGNA 5CCJA 4Y4HA 5CIPH 1DVUA 4MYPA 1TEYA 3N85L 3RVXC 3P0VL 2A73B 2P4AB 3GIZL 5ITFB 3RPBA 3DSFL 2YA1A 4GQZA 3PP4H 3VD0A 4PRDB 3NIDB 1KCKA 4ZS7L 4GRWB 1MLCA 2GT9A 2MQ3A 1SJHA 2IAMD 1U8JA 1YQVH 1RQ5A 1R5IA 2PTVA 3EO9L 2F68X 3LHPL 4P9HC 4MMZC 2Y25A 3K72A 4QHNA 1A0QL 2ZUUA 1FIGH 2NDGA 3EJCA 2PCFB 2FBRA 2RBLA 2ZWNA 3JYBA 4G1EA 1Q72L 3B3BA 4YK4C 1U3HB 5E6YA 3TT1L 5F72S 4UBDC 5D1QE 2VC2B 3D2UB 4L4VD 3BDXA 5HVGB 3RP1A 3VXMB 2DMHA 1MFBH 2B16A 4LVNC 3DX4A 1OAYH 2QSCL 2X0WA 1DQJA 4Q4EA 2IF7A 4B9CA 1HC1A 3UYPB 5EIIA 1PKQA 3UG4A 4QXTB 4X42A 1GYCA 1S8DA 3MOBL 4LSTH 1MVUB 3NIFB 4XN5A 4BA8A 1I3RB 3GJEB 4HOMA 4NBZB 4UTAA 1KIRB 1S46A 2F5AH 3W39A 4CDGC 5F1NB 1ZWIB 3GHBL 3H0TB 2MFNA 4KKQA 5IB2A 2YRBA 1JV5B 4N2AA 4R97C 1T03L 1XGUA 3AITA 1THAA 3HLAA 2BCKA 4XXDA 2Y7QB 2B5IC 1BPVA 3IFOA 1JHKL 3SD2A 5BJTA 1ZMYA 3BLPX 3EHBD 1MCQA 3VFOA 1AZVA 3FU7B 2WXHA 4KTDL 1FAIH 1G9NC 1YUKB 2R0LL 1SJXA 3NA9L 4NUMA 1SEBB 3DIVA 1WCBA 4YXKL 2IPTH 4PJAB 4PCTA 1L7TH 5HGHB 4YDLC 2FJUB 3EXLA 4PJGA 3RHWK 4PU2A 3TH4T 4JDVA 3RPIA 1KELH 3H9SD 4WENB 3BAXA 1BOYA 2NTFB 4NT6B 5IW3A 4ELKA 1HZHH 4V1DE 2HWZL 2HX7A 3DETC 1H8NA 1CFVH 1HI6B 4IOFC 1MH5B 4NZFA 3EG9B 1IGTA 4PMFA 5DHVA 3KXFD 2EDWA 5K9KB 4PCSA 4JW3A 3SGKC 4DKAA 2FUQA 1KYFA 4U1IB 5CILH 4UAHA 4L3EB 2ZWKA 4LHQB 3X17A 4EUPG 1I1AC 4UTBL 3HFFA 1AZBA 5AVUB 5TDPB 2IGTA 5AZ2L 2CUMA 1ZEAL 1W15A 3OSKA 4RMQA 1A6VH 4FYSA 5D5MF 3GK8H 4UIMA 5G5DB 3VFRA 3O9WB 1TVHB 1JE6A 4K9EC 4YIQB 3VXSE 1FL6A 1IT9L 2A0LD 1LE5A 2WSKA 3M45A 1P4UA 4Y4FB 3V52H 4X50A 4PHXA 1RP9A 2YLHA 3BUDA 1JPFB 5IJVB 3N40P 3D25A 5B1KA 1OSEA 4GUPA 5IFAH 5KG9B 2D7TL 5F3HB 4BEIA 1FLRL 1V3KA 3OKMA 3QNXB 4GSDL 4E41B 3M7OA 4IMKC 2YQ3A 4GMSL 4MDJB 3BIBX 5E9DD 1TSHA 1AFVL 3WAKA 5I0DA 1K4CB 3HZKA 1BQLL 5IM7B 5F2FA 1P4IL 3UTPD 4K5PA 3VFUB 5CEZL 4LE8A 4AUUA 5GZNC 3NTCH 3TVMB 5GJSH 3QWRD 4TL4A 1JVKA 4AX3A 4LLQB 3KPLA 3DOIA 4Y4KD 3O41A 5CP3A 3CHXA 2WLLB 1YY8B 2OMWA 5ETUB 3BAJA 3NCEB 3CDGA 4I0CC 2E76C 2WPGA 3O3DB 2WBWB 1M7IA 4I3SH 4L1BA 2Z31B 3CUPB 5KSAD 3OKOB 4MS8C 1U8IB 2EEDA 4Z8FL 4BHUI 3MTRA 3K8LA 3TBTA 1HL9A 3LZRA 1UKTA 1VZHA 2QV4A 4RVBA 2XV6B 3QHFH 5ISZB 5C07D 1HESA 4NZTL 3GSNH 3S37H 1R0AL 4ABVA 1S78D 5EUOF 5T1KD 3RAJH 1E9PB 2GSIA 1XXFC 2BCMA 2LLLA 3E1ZA 4HUUA 1CXHA 1DQMH 2NY6B 4OVUA 3U2JA 5KZCD 4R90H 3ARFA 3BUYB 5SWSD 5JTWA 1SM3H 3AG2B 4CBZA 3L7EB 5DEFB 3GBDA 5IHUH 2DLEA 1F6AB 4LOFA 4O4YL 2IPUG 3I9AA 5IMOA 1A6WH 3MGOA 1X4XA 4H4NA 5L8LB 2NXZD 4A7SA 2QFPA 4MZ3A 5LAXB 1TJIH 1U6AH 3O4LA 2Y2YA 4P23A 4N25A 1PD6A 3A4DA 1YDPA 2ZXDA 4OZIE 3US1A 4X6DB 4HXBL 5TGBA 2ZCKH 3SYOA 1HDMA 3KH4A 3U46A 3LV3A 1TMCB 4KAQL 4O2FB 5FUOL 3X11A 1NMBL 4N1EA 4UT6H 5GGTH 5EN2A 2J25A 4NYLA 2CHZA 3QR0A 2HMIC 3LRSA 4C58B 4N22A 4TVSa 2KPWA 1E30A 2AW2A 2RIKA 3RY5A 4P07A 2DMBA 4GT0A 4KK8D 1NPNA 4GLRI 4J4PA 3B1TA 4HYTB 3FCBA 4PRHB 1MI5D 3LS4H 3QFJA 3AWFA 1YCSA 1NCWL 4H20H 1DZBA 1CU4L 3UFIA 4Z3IA 4WI0B 3SYQA 1SXSA 4FNUA 1BFTA 3RG1C 5IB5A 5FO7A 1U91A 3MRFA 1P4LB 2WQWA 4IBZA 3FJTA 3PQYB 4N24A 2Y7LA 5D9SB 1RHHB 3RNQB 4PYGA 4UV4H 3WIIH 4EBQL 1JWUA 5GIRB 4D0BA 1K6QH 3DSNB 3TP4A 3DMMD 5I1DB 3ATEA 3MV9A 3BZDA 3UP6A 1RHFA 2YWYA 2DIAA 2KBGA 3DXAB 5D7IA 3ARQA 5LCVH 3FULA 4F5CE 3MCKA 1C5CL 5D1ZI 5GS0C 5IB3B 3MV8B 1JD7A 2A9DA 2DDQH 3JVGC 4JY5H 4JRYB 2EUZA 2C8NA 1MG2C 1NAML 1OTSD 3BW9B 3P77A 4GRLC 5EU6B 2QPDB 1UWGL 4FQCL 2CKBA 4LDLB 4O5LL 3RWJB 2YEZB 1JXGA 3T8MA 3ZZ1A 4C4KT 3TJPA 4JY4B 4HWBL 1L6PA 1FO0A 3QIWD 5DQJA 4Q9QL 2C7UA 4FQJL 5EORL 3S96B 4JQIA 3SBQA 1E5ZA 2MMXA 4M1CC 4WO4B 4MNGE 3NCFB 4WWOA 5H2BA 4ZMYA 4AGMA 4H1LB 4MJID 4KPHL 5DO2D 1FGNH 3QUXA 2PP9A 3FKUS 4XPBH 1MJ8H 2CLZB 2D3NA 2FCBA 4EVNB 4HU2A 4TSCH 2MNJB 2B1HL 3F7VB 3OAUL 4L8SA 4H8UA 4WJG3 4MS6A 5K39A 2QADB 1JFQH 3LNEA 5IJKC 4WY7H 1A3RL 2FECL 2FQGA 3H3PL 4G9DA 4KZDH 1KIUB 2A74B 1MWAH 1Z9LA 2NNFA 4N2CA 3QEUA 2HUHA 2R2BA 3S7GA 1IGMH 3OVUB 3BWAA 4TSAL 3NCYS 3HS8A 3L1FA 3VFGH 4KUZH 1VAHA 3PXHA 3C6LA 3LMJL 2GJZA 4NWTH 4ZMLA 4NI6A 4ZFGH 4WCYH 4U3SB 2JXMA 2TSBA 2DM7A 3ZE2F 3LPPA 2VM9A 2A6KA 1T80A 2VDNL 2YAQA 5FLVA 1L3WA 4JO2H 5G2NA 2GHWB 4HWUA 1AGEB 1IIIA 1QLFA 3RVTD 5HJ3A 2WTRA 3GXIA 2OSYA 1BGXL 3ETSA 3LIZA 4RA0C 4RZCA 2FHBA 3DX6B 1DQLL 4NJ9H 3RB5A 3SPJA 1V54B 2KYIA 2CPCA 3QR1A 3NT0A 3LKRA 3O6KH 5DFWH 5AD0B 3CMOL 4QOKE 4W9GC 4HS6B 2WLJA 3ZMNA 1JTTA 4J8RB 3EO0A 1B0RA 1MZYA 1RK7A 3MOAL 5G4NA 4XVSL 2VLKA 3FL7A 5A7BA 4B41A 1S7QB 3N1QC 4KQ4L 2J8UF 3S36H 5DYFA 2VLRA 5A3ID 3I6LE 2I85A 5CU5A 4BUHA 4HWZA 4U6XA 4ZUWB 4XPGL 3EYVA 4CMMA 1D6EB 5GRZA 4PGEB 4ZMZA 3T3MF 3L5XH 2C3VB 5ELIA 1T04A 3DOSA 2O72A 4JFHD 4JFQB 2PYEB 4YDJA 1M3IA 4O2CA 3RA7L 2UX7A 2VIRA 4YWGL 2JLLA 3BDYH 2A1WH 1D9KB 1AZCA 4LKCA 5DMIL 3UC0L 2JKNA 2PYFB 1I8AA 1NUFA 4RMWA 1HOEA 1L0PA 3II3A 5F9AC 1ANUA 3QUHA 3BKCH 2KZWA 4WFED 5HDQL 2WJ5A 1CVRA 4Y7OC 5DJ6A 1JPGB 1P6AB 1AIZA 3IFPA 3NJLA 3DX3A 3ARBB 1A1OA 1A7RH 2XZCH 3FZUC 1AI1H 3IJHA 4LRIC 2J56A 5DD0H 3SDXE 3BP4A 1G6RL 2EDXA 1ECYA 4EI6A 2DLGA 1ZRUA 3B4NA 2HRHA 1CWVA 1N26A 4XMKL 5FCSH 1CDHA 4L1LA 1TDQA 1P2CA 1KCWA 3DYOA 3SKOA 2ICES 3DV4B 3NIGE 2H9GB 5A2FA 5DEGA 1AP2B 1MFCL 1NFIA 3DOHA 3M1BA 4LLDA 5CJOH 2N56A 3BLKA 3SGKA 4GINA 3ESOA 5F97E 5IW1B 1FYHB 5MP6H 4CA4A 5I1AB 1XT5A 1NCOA 3U0TB 2E86A 3VWJC 3L48A 2ZUSA 2P28B 1I1AA 4R4BA 5L9DH 1TJHH 1VFUA 3MXWL 3CZNA 5LGJA 5HYJA 4J6RL 2EYRB 1IGCH 3U6XS 3U9WA 2EUXA 5L88H 2Y72A 3BZFB 2R1XB 1GJUA 2EVFA 3ZZLA 2ITFA 3PS6A 1CYWA 2UWEE 4U1MA 2OMBA 3UZEA 1JGLL 1ZVHA 5I8CB 3U7AA 1FCGA 3WIFA 4FG4A 5AVQB 1LILA 1QSFB 2VITA 4YGAB 2WXOA 5L2KA 3D3VB 2Y3AA 4Q0XL 2WZPD 1MHHA 3VGDA 2X6VA 2F8XC 1Y1UA 3BESR 2WLNA 3L45A 1X4ZA 5DUML 4IMKA 2FEEL 1S9YA 3T4YB 4HJ0C 2BVOB 3WIHL 1NOFA 5LAXA 3O0RL 1DJSA 2BXZA 1J5CA 3IXAB 2BSDA 2B2XL 1MREH 5IT2H 3DURB 1I8UA 3MLPA 2HFEB 2YK1L 5GZNA 1DJIA 4NKIH 4KTEH 5IBLD 1G9MH 1S7TB 4W9FC 1WA0X 4WW2A 4E9YA 1KYUA 4XO4A 3D8MA 2DQGL 2WWNA 2AV7A 5IHWA 1SYVB 4JLRA 2JH2A 5KEZA 4JANB 5D6DC 4AKQA 4MQTB 3LVTA 1ROWA 4HIHB 2DWDA 1J05A 1T0NB 2YBGA 1E2WA 2R2HB 1VKXB 5IGXH 4ZXBB 1BVKB 4UILH 2G5RA 4WSKA 4JFOB 4AEIL 5KBMA 3MAWA 4NO5B 1XF4B 5I9QC 3ZKXC 3GFUA 3B43A 2F53B 3CX2A 1C8QA 4XO5A 3ROOB 4YX2H 2X4UA 4LCVA 2OYLA 3WV0A 3PHSA 4N8UA 1GY1A 2XWEA 3KHQA 1IX2A 2P42B 2HUEA 4X98B 5T1MA 2K9FB 4NQVA 2VDPB 3L9RA 3CDZA 1XIWD 2Q87A 5FGCE 3VSQA 1J0YA 2AP2A 1KTJA 1BX2A 1UH3A 1UB6B 3IETB 2BXYA 1WGVA 3QK0A 1CLYH 2PUQT 5HGGS 1NCDH 4NQCD 1MG3C 5I6NA 1LEIB 5GRVL 3KW7A 1K4DB 1MIML 2WIMA 1E9OB 1U93A 4NQSA 1Q9OB 5JYMA 4MAYD 4AZUA 1RV6X 4U6HB 4MHHG 4PJDE 3ESPA 4IU2A 4WHCA 2V3DA 1QBLL 4WSGA 5DC9B 4G6KH 3PWLB 4IDJL 5DD6A 3T2NL 4ADJA 4LT7A 5IROC 1P5UB 1QLRA 4M4RB 4RGND 5E7FA 4QHMB 2VDLH 2A4EA 3STBA 5HHNA 2JJWA 4G9FD 4DP0X 4B5ZA 5F0PB 4EOWL 3HMXL 3MNZB 4WI5A 3T6QC 3F7QA 3HE7B 1TLKA 2KPNA 3TLRA 5KANI 3PFUA 2ZKWA 4L0PB 3WHE1 2H0JA 1INDH 1G0XA 4JZJC 4N9GB 3C60B 2IBZY 5CN3A 3KXFE 3D05A 4HUKB 5BZXA 4Z7OF 2YKKA 3E9TA 2EYSA 5HDBE 2W95A 4UQAA 2D7PA 5MERB 4P2OB 3BUPA 1JUFB 1S5HB 3HHRB 4M4PA 4OIAA 4TTDC 1SRDA 3PG2A 4UOW0 5CP7A 4I8DA 3UG3A 4OIIL 3TV3L 1QUPA 2X7LB 2V9UA 3HRZB 5TTRA 4GYBA 2ARJA 1HH9A 4QHPA 3FT3B 4N2BA 1T0OA 3FO2A 3QFDB 3O3AA 5MEQB 3B2UC 4R7LA 4QJ3B 3UZQA 3GF8A 4H5SB 2FIKB 2VDRB 1XGZA 3JVGA 1PLBA 3QZWB 3UPAA 2R4RH 5J12B 1QRNA 5KJ4A 3EGXA 1LK2A 4ENED 4CKQA 1BXXA 2B77A 4GRLA 4GW4B 2C3HA 5JHDE 5J9PA 3NEOA 5C0ND 1NBVL 1NM9A 2FR4A 4MXWL 3UIZA 4HIXL 4MA1C 4U3HA 1M71A 1I7TB 4I48B 3ZGHA 1HINL 5T33L 2B1OA 5ESVB 1W72B 1YAIA 1YMHA 3GXPA 5AVVB 3TBVA 1SXCA 2APXA 2W8CA 4XVJH 3UTPE 3FUNA 5L8JB 2KQMA 2NY0B 3MBEC 4Y5VB 5K9JH 4AG4H 5AB0A 1ZGLP 5IJKA 3WUWB 3D87B 1ROCA 1JZ8A 1XEUA 5FA3B 3VW3H 1WFOA 2PN5A 2BC4A 4OLVH 1EHAA 2VAAA 4A2LA 2BFGA 2NMSA 4EF3A 2YAHA 1RZJC 1ITCA 3SJVE 2XWBA 1MLCB 3RUGE 1X44A 2GT9B 3PPEA 1SJHB 3QNZA 1YLBB 1IARB 1INQA 1MW0A 3NZHL 4FULA 3ME0A 4ANUA 2JKLA 4G7YL 1U8JB 3SDAD 1YEEL 3DTUB 3S88L 4UNUA 4LPCA 4ZFZA 4EZLA 3K72B 4QHNB 3K2UH 4KKAC 3BD5A 4BE6A 1RERA 2VL5A 3OAYK 5SWSE 3VXUE 3FXIC 4HKBA 2NUTA 4G1EB 4XCNA 3JTTA 5LDUA 2EXWC 4OZGF 4CILA 3VH8G 5GGSY 1I1YA 3RWDA 4KNUA 2UZIH 5I75B 5T3XD 5HYSG 5B3NA 1JPTL 1TETL 3JUZA 3AQZA 4PBDA 4KVNH 4MD0A 4WWKD 1HL8A 1DQJB 1JAEA 3MA7A 3V0EA 5EIIB 3S4SA 3V5DA 1PKQB 2EDBA 3GKZA 4GB9A 4AQ1C 1S8DB 3QJHA 1ZIBA 1RZPA 2JNZA 2MHAA 3L3DA 4KRLB 2YGPA 3K0WA 4PI2A 1ILUA 3LRKA 2F7OA 3ARSA 4JKLA 1HILA 3MRKA 5HI3D 3W39B 1DSFH 1X5YA 3QP3A 2FGZA 2ZUYA 5IB2B 1LGVA 1XTLA 2V5RA 1KLUA 2DJ4A 1XGUB 4HC1H 3HLAB 2XCMC 1QWNA 2BCKB 4XXDB 3LEYL 2EE3A 3IFOB 1JNNH 4P4KA 4X4XA 1ESOA 5FB8A 5BJTB 1LNUA 1SYSB 3OJDA 3VFOB 1P4BL 5DSCA 4F3FA 5FPIA 4MAUH 5HI4C 4U0RC 1UOVA 3GEFA 1RL1A 1A6AA 3KWUA 5MHSE 1DVFD 1E43A 1WCBB 4JG9A 2XXCB 4N8CH 2RCSL 3CFJA 4LP8A 4Y16A 2HAZA 3GKWL 2WUCL 2Z34A 4HS8L 4LRIA 4K5MA 4PJGB 2UY7A 1T7VA 1DHKA 1UYWH 4JDVB 2RJMA 1A65A 1RFDH 4OLWL 3HB3B 5CGYC 3RPIB 4FXLA 4P46D 2DQDH 4FFYA 5DJXA 3MCG1 4ELKB 3W0WA 3ZL4L 4UNIA 1IGTB 5DHVB 4W9DC 2YPVH 3PYCA 2IGLA 5GQBA 4CVUA 2R0KL 4OFDA 5EC2A 4BWWA 4WZ9A 5ITBH 4OCRL 1XBDA 4E9LA 1ZAGA 1D7FA 4BUGA 2YMOA 2MOGA 4BYHA 3OR7A 4EDWL 2OCFD 2B3RA 4KXZH 5LBSL 4UIMB 3VFRB 5MI0B 1FL6B 4JKPL 2GPZA 3EZ8A 3NP3A 1NMAH 5HGAA 2WLKA 5GRJL 5BNXD 3T2OA 3OZ9L 1LE5B 2DKMA 4OJFH 3TA3C 1X5FA 2HH0L 1Q94A 5A6IA 1F56A 1EV2E 4XAWH 5FCUL 3RKDC 2AANA 4AGLA 5HD8C 3F04A 3D25B 4GUPB 4BRVA 4OUOA 1JL8A 2OR7A 3OKMB 4EN2A 2EUWA 1HXMA 3ARXA 1OAXL 4U1GB 3LNDA 4JR9H 1IC7L 3HZKB 2CCWA 2VZUA 3BUBA 1PDKA 1CFTA 2I27N 1KTRL 3D39E 1OW0C 3ML8A 1NSNL 2PTTA 4FZ8H 3MLZH 5B38A 4OT1H 4OI8A 2D3LA 3KPLB 5C6PB 4N1HB 1WFJA 5I24A 5I66A 5FWQA 3O41B 5CUSL 3PAZA 2DJSA 3D09A 4NZJA 3W38A 1NBYA 4XMLH 2OMWB 1KJ2A 4R6UA 4B7LA 1JK8A 2W80C 3CDGB 3QUYD 4UOZA 2BFVL 4TQHA 2F7IA 1E3XA 4LPWA 5FS5A 1M7IB 3G5ZA 3UOAB 4A66A 3MJWA 2V5MA 5DGRA 3TBTB 1DL7L 3SKNA 4EQ2A 2FLBT 4HK3J 2VUOA 3O0LA 4FI7A 4D9LL 1NANI 3QUML 5FO9B 2GSIB 1II4E 3P0YL 5BUAA 3KLHD 3GNML 2LVCA 4HUUB 1CD8A 2ROXA 3P11L 3ARFB 1QFHA 3R06A 2IBGA 5DO8A 1EDYA 3FB7A 2CMRH 4N2HA 3RI5F 4XB3A 2V5SA 2EO1A 3T08A 1FYTD 5IMOB 1DVTA 3MGOB 4UT7H 5IJDC 1GZHC 3T2LA 4KH2A 1JF1A 1QBAA 3BIAX 1WAAF 3VXNA 1M9SA 1CGSH 1BYOA 3EJYD 3HAEG 3MRBA 3O4LB 1A4JA 1J1OH 4OR1A 4P23B 3S5LG 5CM1A 1YDPB 4KZEL 1KENL 4RQQA 4FZEH 4Z3JA 3LKSA 5CBEA 4OF7A 4F7PA 5TGBB 2R29L 4MB4A 4L4JA 1HDMB 1V8HA 3U46B 3LV3B 4P2RA 3ZR6A 3NQIA 2NNAA 3X11B 3ZDZB 2EZ0D 5PCYA 2OKMA 4AYFA 5EN2B 3CMGA 4I9WD 1KEML 1TTAA 1F6FB 2NPLX 4NYLB 5T1JA 2VH5H 4CUCA 2ARWA 4JDTL 1GXEA 2G3ZA 3LRSB 1BW8A 2IADA 1EEZA 1J0KA 2IBZX 3AXIA 5DR5L 3EH2A 1AGFA 2ZYIA 5IROA 1U3NA 4TULH 5C8JA 2VNCA 3CG8A 3IFLL 2Y0SA 5F9OL 1S9XA 3QFJB 1XV8A 4AVHA 3BAYA 2VERN 4RFOL 1ASQA 3F5WB 4AMWA 4U3CA 3RWIA 4JZJA 2A2QT 2OX5A 2IANA 2GG1A 5FO7B 1U91B 1XGQA 3MRFB 1B2WH 2H3NA 1RJZA 1J1XL 3CSTA 3H56A 3APNA 3EFDL 3JWNH 1ACCA 3VG9B 4D0BB 4WRLA 5J1TC 1I3GH 3MV9B 3RURA 4EIGB 5DS8A 2AVGA 4LSPL 4XAKE 5D7IB 4ES8A 3MCKB 5IWLC 3NH7L 1KULA 5EZPA 3EJPA 5LNGA 4X7SL 3H2QA 3MU3A 4HCGA 1MXDA 5D93B 4PTUA 1CICD 1LO2L 2E7BA 2GITA 3P77B 4FI6A 4YE0A 3CPUA 4N0FA 4WEEA 2CKBB 2YAMA 3HBZA 3RU8H 5DQJB 1FO0B 1HK6A 2C7UB 1XGYH 3ZE1B 4Z3EA 4FTVE 5D7LA 4YHNA 5CGBA 5DQDL 3U9UA 1Z5YD 3F64A 3QWNA 5H2BB 3R7QA 3MDJA 2MKLC 3QUXB 2IFFH 3VFWA 5F3BA 2E75C 2V9QA 4W1TA 2IC2A 4DP7X 3MJ9L 2KKQA 2XA8L 2FATL 4L8SB 3NIGF 5K39B 1PGRB 1VGKA 1J12A 3FH7A 1A1NA 1QW8A 5FYKU 4DZ8A 2FEDD 1EEYA 3WY4A 1PG7H 4G9DB 1SPDA 3EUUA 3WFDL 1JFHA 1HCFX 1JXFA 5CD5C 3QEUB 2R2BB 4PRPA 5CFAA 1KB5H 3BWAB 1BLNA 2VMCA 3MLXH 2P49B 4RH4A 3C6LB 1YEIH 1NANH 2GJZB 4ZOEA 3RZCD 5D1XA 4IRJB 3ZQXA 2AS5M 2JXMB 4NP9A 1QYGH 15C8H 2FBJL 3QO0A 4PGZA 1CGWA 2A6KB 4N0CD 3LY6A 1BZ9A 3ILQC 4V33A 2GBAA 4Z95L 1JNHB 4HHWA 4POZD 2VO8A 2CIIA 3BSHA 4GAAA 1LHZA 3AWEA 1QLFB 2FX8L 4YK4B 4XOEA 5HJ3B 3REWB 2WTRB 4N87A 4KMQA 1PD0A 4RZCB 3WNMA 1SY6L 1KCSH 1PCXA 2AQNA 2EEBA 3U7YH 3UTOA 3LKRB 4MVBD 1H3PH 5JOPE 1YNLL 5AVXB 5FYJH 1ORQA 2Y9RT 4LARH 1NC2D 2CJTA 3FUJA 3EO0B 1B0RB 4NQCE 2ATPA 2WXGA 2VLKB 3DX9A 3TH3T 3TYFA 1U2CA 1TIUA 3IJSA 4AQ1A 1BA9A 5EHFA 4M6ML 2Z7YA 5I1CL 4MBOA 2VLRB 3EJQA 4GUCA 3T71A 2W5PA 4GI9A 5F7LB 4K5OA 4HWZB 4U6XB 4X4ZA 5FYLD 2DYRB 3EYVB 5GZOD 2AERT 1JXDA 1T4WA 3BJLA 2QELA 4U6TA 2O5XL 5ENWA 1T04B 3DOSB 4Z0BL 4JFFA 1BF8A 1A9VA 4O2CB 1PZBA 3LZFL 4N6RA 4WI2A 4M48L 1BBDH 4R97B 3GMLA 2VIRB 2HP4A 5D2LA 5DJCA 4LKCB 4YDKL 3BCDA 2B5IB 2EDOA 1AGDA 4RGNE 4DK5A 1UG9A 2P45B 1JPSL 1ZS8A 5F7BA 1ZANH 5E2TH 5BUPA 3ABZA 1DEEA 4H1LH 1IM9A 3QI9D 1ORSA 1PTZA 1CB4A 4BFIA 1ZSDA 3EZJB 4MDIA 3WFBH 2VKXA 1CD9B 3IFPB 4GQQA 4K8RC 4HJEA 1A1OB 5CFHA 3IJHB 2IH3A 5E8PA 3FFCA 3BP4B 2CRMA 1KCRH 1RK0A 2X6UA 1TYJA 1EVTC 4BFRA 2NY5H 2E4TA 4ELMF 1DQDH 3OLIA 4EI6B 2L7EA 1YEJH 1QSEA 2AMGA 4EQ3A 1OAQL 3QJFA 4TNWF 2GAZA 4MJHA 3TWCL 3IFNH 3GBNL 4WVRA 5DRWB 4OUUA 4DFIA 1P2CB 6PAZA 4C57C 1ZT1A 4YSTA 4X8XA 3SKOB 2VXUL 2VRKA 5DEGB 1RY7B 3OKLA 1NFIB 3M1BB 1VSCA 1UGNA 2BOBA 3L3KA 2MCPH 2WSPA 2XN0A 3CDFA 5EBLA 2A6JA 4J3BA 2AMUA 4X6CA 2ZF9A 3BAKA 4A39A 2CUAA 2H1LM 3I9PA 1I1AB 4R4BB 2YQ2A 5B39G 4BK5C 4GJTB 4WO0A 4JO3L 1DBJL 2EDTA 5HYJB 5LGJB 5C3IA 3H9HA 4GT7A 1BD2A 1L9RA 1RSYA 1VZIA 3HPJA 4KKZA 2OP4L 2F7PA 1IE4A 2JE8A 1B6DA 4U1MB 1U58A 4HJJH 3DX8A 4YOKA 5C0JA 4GAYA 4M6NL 1XGPA 3TA3A 3F7RA 3WIFB 1MCKA 4K5LA 3ZJAA 2BY0A 3LSOA 4QI3A 2VITB 4EIUA 5L2KB 1I9RH 4DETA 4DH2A 3WDHA 1MHHB 3VNZA 2YXVA 4BZ2H 2OPCA 2KT6A 1MRFL 3GTNA 2ZYRA 5EC1A 1T1WA 3DHMA 1UB5A 4UQ2A 1Z1WA 2ALAA 1S9YB 2D7MA 2LT9A 2OV0A 2QQNL 3II2A 2L7QA 2Y24A 1TYEB 3JZYA 2ADIA 3MXVL 4FQLH 1UA3A 4JDEA 4GAFB 2E6QA 1U8NA 2ENPA 3LN5A 4NRZA 4UNTA 4PVBA 4HEMA 4KO9A 4QNPF 4CL7A 4LVHC 1OW0A 2VLLA 2R69L 2EEFA 4WW2B 1QKZL 2AV7B 4I77L 4JG0H 1NZRA 2R59A 4JLRB 3UJTL 4B60A 5IZ7A 4O9HL 4LKXA 1KDJA 3KDPB 4WI7A 4WTZG 2DWDB 4ERSH 1XO8A 5EU7E 4IRZL 5D72L 4XPAL 3KPQB 4M3JA 1QNZH 2XX1A 3T0EC 5DUPH 4GSXA 1RK1A 1TPXC 4P2CG 4CU8A 4QAWA 2DQTL 3NOIA 4NBXB 2CHWA 3FTWA 3NJHA 2X6BA 2X9YA 4S2SA 1BJMA 3ROLA 2X4UB 4JVWA 4FFWC 1A7QH 2V5TA 4RISL 4ZMOA 3KS0H 3CSFA 3E0GA 3U9PH 4PJ7F 3IBEA 2WOYA 3UYOD 4ABUA 1ACYH 4UQ9A 5DJ8A 3WTVA 1Z9NA 1LWRA 5T1MB 4NQVB 4C56D 4KU1A 5C6WH 3L9RB 3CDZB 1ZTXH 5EZOL 2AI0L 1BEYH 1BX2B 1GZHA 4JO1H 3AS0A 2RA1A 2Q20A 5I71C 2GJ6A 4DGYL 2J7LA 2NY4C 1NGPH 4DUXA 1FH2A 4BQCA 1N10A 2DQCL 2Y3NA 3MMEA 1U93B 4HKJA 1SGKA 3OD3A 4NQSB 4GNKB 2FQFA 1N70A 2X1OA 1CLOL 3BUTA 4IU2B 3G5YA 4XWGH 2A9ML 1RVFH 5LGHL 4S1DC 1ZLWH 3RJOA 2OL3L 2K4AA 1W8OA 2XSKA 4NDMA 2DQ6A 4KXDA 2JTYA 5DD6B 1OKEA 3B2VL 4WFGD 1DJWA 1UKQA 4E9VA 1N9PA 1QLRB 4AC4A 5D7JC 2NX5A 1KT2A 4RCAA 5HHNB 4FABL 1MNUL 3A3YB 3N1FC 4LF3A 1OSZA 2Y6TE 3MLSH 4OGZA 4ZK8A 1PCSA 3L5JA 4IRSA 3H2WA 1T6VN 2XG4A 5KVFH 1UA6H 5KVDL 4AQZA 4OF6A 3QDGA 2ZWLT 1LL1A 2MQCA 4HBQA 2EYSB 1SLUA 1YPZA 3V4PL 1JGDA 3CVHH 1FAKT 2Y5TA 3I2CL 1FH5L 1MFDH 4HQQH 4M5TA 2A9AA 1U21A 5D5MA 5CP7B 3AAZA 3DKHA 3IM1A 3ZL2A 1CTNA 3MLUH 2ARJB 1HH9B 2V6HA 2X70A 3FO2B 2OK0L 3O3AB 1HHHA 4MQSB 2YFNA 5BZWA 3P4NA 5CJ5A 5IWLA 3UZQB 5JZ7D 2BIQA 3L1OL 4JFVA 4XN9A 3D4YA 1QRNB 1R19A 3EGXB 1H3GA 4ZMAT 3WY2A 3ZYZA 1LK2B 5EZIL 4GRLB 2I60H 2E9JA 2QL1A 4W6YB 4XPHH 3EFFA 2V0AA 3ZZQA 5J9PB 4Z77A 2A38A 3QT2A 1SN5A 1KTLA 5BZDA 2FR4B 1AACA 5DZAA 3KG5A 3QEHA 1M71B 2HZHA 3VSVA 2DJMA 4HLZH 4P2QD 4PY8I 2ED8A 1YMHB 4JKKA 2OR9H 3HBQA 4IGBC 4IBUA 3TBVB 1DVZA 3BSZA 3ARDC 1RH8A 2ORBL 5EF2A 3AGWA 2APWA 3VWKD 4H0HB 4WGVB 3QYMA 1HVXA 4UYQA 3K6IA 4CNIA 3VG0L 5KVDE 5DHXB 3DDFA 4JFED 5FDWA 4HAKA 3JV4A 4TRPH 4FRWA 1JS4A 1T22A 2XICA 3LQAL 2VAAB 2W07A 2ZNWA 1MCWM 1SJVA 4JJHA 3V4UL 1RXLA 3DROA 1KN2L 1IBGL 3O3EA 3QNZB 4FFTA 1INQB 1BPLB 3ABGA 4K3DH 3ME0B 4JCLA 3R8BB 3GLEA 3O6FC 4Y2DC 4P48A 4YBLC 4ZFZB 1RSFA 5I30H 1CZ8L 1B0GA 5CJQL 2VL5B 4PGBA 5F96L 1UWXK 4HKBB 2NUTB 3DHUA 4G59C 4KKLC 4S1QH 4XCNB 3JTTB 1YEHL 1O6VA 1I1YB 1P1ZA 3RWDB 3O2DA 1MFNA 5GRUH 2J1XA 4JQXA 4BFEA 2HKAA 1IB5A 4XVTH 1DLHA 3MA7B 1JN6A 5E2WH 3BKML 4XBGA 3S4SB 4DN4L 3V5DB 1YO4A 3GMRA 3QJHB 2MHAB 3L3DB 4YUEH 1HHKA 4QXGL 2Q2EB 4P3CH 3PABA 1FUNA 5GGSA 3MBXL 3MHZA 5D1QC 5KBDA 1V10A 1HILB 3MRKB 1EHNA 4DP1X 5HHXL 4I9WE 3W5NA 1PU0A 2LR4A 3HA0A 1F11A 2V33A 1CBVL 4MQXC 3BN3B 1KLUB 1Z3GL 4ISVA 4APQD 3SCMC 4YL4A 1A3LH 4YHZH 2O61A 3GUFA 4P4KB 4X4XB 2LLNA 5FB8B 2MH4A 1LNUB 2ICEC 2JWYA 3IDXH 3DHJA 3IXTA 3OJDB 5DSCB 4F3FB 3IMSA 4ZX5A 5D4QA 4P5TC 2B8OT 4LU5L 3UACA 1MF2L 1FL5A 5F3FA 1MAKA 3CFJB 5D2NE 4Y16B 5LBGA 1MPAH 3QYNA 4LDOB 2ITEA 1HWWA 1M1XA 4EN3D 5AW1B 2UY7B 4NAJA 3PJNA 1FPTL 4UV7H 2FDBP 4HVBA 3CK0H 4J7RA 4AV4A 1F8TL 2JKXA 4M6OH 3HUJF 1HZLA 3W0WB 2ENJA 2XY1A 4MJ5A 2VXQL 2KI6A 4M1GL 3QYCA 1EWHA 3H7BA 1VJSA 3QCUH 4XNQA 3RHWF 1Y0LA 3CIAA 5LBVA 4PRIA 5D7SH 5I8OH 1NEZB 5EC2B 3TVMC 3EIFA 4JB9H 4OLUH 4E68A 5F88A 4XTRD 1V3MA 1NM4A 1ZV9A 3FCGA 3NRPA 5D1ZD 1L0YA 3UGXA 3PP4L 4UZUA 3OR7B 5AAMC 4CGUB 4BK5A 2H7WA 3CGTA 3Q8BA 4XE0A 4XXWC 1I1FA 5HGAB 3CV5A 5J3HC 3KAAA 4G71B 3FUHA 2EKJA 1Q94B 2UZYA 4AXWA 2P5WA 1FIGL 4TNGA 3WHXA 3QPQC 2FUTA 1PQZA 4HIJA 4FQXC 4QRAA 3ARYA 2APSA 4XWOC 1HXMB 4WFHE 3L8QA 4W9CC 1PW3A 1SOKA 2FE0A 1PKOA 3L4VA 1MFBL 3QEQA 3R1GH 4GQPH 4DQOL 3HC3H 1DJHA 1OAYL 4X4KA 4BXVA 1F4XL 3UO1H 1PDKB 3DO4A 1CFTB 2JKJA 8FABA 3CQPA 4AGNA 4P2AA 2PTTB 3ILEA 2JFCA 1E3FA 5B38B 2YD1A 5DZNA 3HBGA 4LSTL 5I66B 3BKYH 1TQVA 1NUNB 3UTTA 1NBYB 1KJ2B 2F5AL 1JK8B 2VR3A 5D8JH 2O1AA 4O02A 4NAMA 2CDGA 3G5ZB 3OC5A 3ESUF 1OCOB 4NCC1 2BZDA 3SBRA 2IV9A 1OM9A 3NIDF 3SKNB 3DLQR 1KFGA 2YD2A 4GRWF 2MQGA 3T0EA 2BVQA 2BIMA 3T6VA 1QFPA 1FAIL 4XMXA 5I9QB 2WAHA 2J8UA 4LLMA 3T0WA 3FB7B 2GK0A 3BOVA 5H37H 4ZPTA 1L7TL 1U92A 2Z8VC 2YPLD 1XX9C 2X05A 4BIKA 4HK3N 4A7GF 3WE6A 1Z0MA 4RDQF 1JF1B 1KELL 3VXNB 5TDOA 5DEZA 1BOGA 2N3JA 3MRBB 1A4JB 3QA3B 3FHAA 4FERA 3IMBA 4F2FA 1HZHL 2A9BA 4RQQB 1Y1DA 4XP5H 1JCKA 1UJ3A 3FCUB 5C0CD 4F7PB 5CBEB 3DK2A 1WYJA 3UPRA 4GBXC 3Q2NA 4U7KA 4W9IC 1J8HA 1DLFH 4PJHE 3E3QC 1KB9K 2Y7OA 1TMQA 2NNAB 4P2RB 4PJEB 5I74C 3MGAA 4UMGA 1F4WH 3RVWD 3A4EA 4AYFB 5ESAA 5HI5C 4KKRA 1B4RA 2EIEA 5CILL 3PWPE 2AQPA 4BFFA 4ZAKC 4BXSV 4Z6AT 2WBJC 2EINB 2BZCA 3B9KC 2IADB 5JMRA 1EEZB 1R3JA 2A3TA 3EXJA 1AGFB 1CGTA 1A6VL 5KAQF 2XV0A 4NO0D 5C8JB 3GK8L 3UJJH 5I0WA 3P40A 5D7JA 2YKLH 3B2DC 4HFWA 3KPSD 1AMXA 4O51A 3V6OE 4ZS6C 3VGGA 1S9XB 5IF0A 4NQEA 1KCLA 1MCPH 2VMJA 1D3CA 3GO1H 2JF1A 1I9JH 5DVNA 3RWIB 4JZJB 2OX5B 2IANB 2ZOUA 1YUHA 1XGQB 2F2HA 5DRXA 1PX8A 2H3NB 1RJZB 2JKSA 2K3TA 3SN6N 2J6WA 1UD5A 2X9ZA 2P9RA 4PJAF 5IFAL 4L4TA 1OP3H 1LMIA 4AGOA 1WZ1H 3GSRA 4DGIH 5L2JA 4YL9A 5K1NA 1IEBA 2VXSH 3D07A 3SDCD 3CFCL 1PY4A 1ZLVH 4FDWA 3PV7A 2EC9T 3NTCL 3RB7A 4KKBC 5GJSL 5FO8A 4PTUB 1HYRC 2GITB 4N0FB 1G1KA 3ULUH 1U8LA 3QUZD 2YIHA 2O6FA 2WQ8A 3VUAA 5KW9H 3TOPA 1WS8A 2PWEA 4I3SL 5CU9A 1ZE3C 2C9AA 5D7LB 4YHNB 3U9UB 4UT9A 2WTOA 4MA1B 1EA9C 2WQSA 2DF3A 3CH1A 5EV7A 3QHFL 3VFWB 5F3BB 2J8OA 3UYRH 4IGBA 3GSNL 1UC6A 3BUIA 2M83A 2VR5A 2YQGA 3FH5A 3RAJL 2N7AA 2ZCLH 1VGKB 3WFEH 4BQBA 5I5RA 1DQML 1HKLH 1A1NB 4R90L 4DZ8B 3UCRA 1SM3L 1EEYB 3RIKA 4IHOA 3JWDH 5JHLA 5IHUL 2APFA 3FT4A 1A6WL 1JZEA 2Z1KA 1RULH 4KK5C 2B3IA 1I9EA 1FBIH 1TJIL 5BO1L 4OGYH 1D7BA 5D1XB 2FYVA 4PJFE 4QRPE 2QFRA 3VD7A 2DM3A 3QO0B 4JPQA 2I9LA 2ZCKL 5JHBA 2BVUA 3CE1A 3KLQA 4GAJH 1BZ9B 2NSXA 3UZVA 3GTTA 4ZO6A 5GGTL 4UT6L 3JTSA 4KRPC 4NM4H 2CIIB 3HFMH 1E5UI 3BX7C 4KOBA 2V17H 1VFMA 3CBKB 1E5CA 1LWHA 4JFDD 1JF6A 5E8DH 4Y1AD 1KBVA 1E4KC 2OLDA 3HPLA 3NK3A 2BNQD 3B7SA 2WY3B 3ULVF 3HVNA 2AC0A 2EDMA 3OJVC 1G6VK 3LS4L 1HCYA 1XAUA 4H20L 1WH0A 5F7KC 1ZOXA 2ATPB 3ISYA 3TYFB 3DX9B 4AQ1B 3IJSB 3T1FA 3CSBA 4J12A 5DURD 3FU3A 2XWDA 1Q1PA 3UBHA 5D1QA 4P59H 4LEXH 1F6LL 1V5JA 1ET7A 4IKJA 3H3BC 4UV4L 5ENWB 3WIIL 1UXWA 4JFFB 1K6QL 1QHQA 3Q2VA 2CKBH 4N6RB 3CDCA 1IAIH 1BZQK 3GMLB 1EJOH 4WFGE 3MFFA 5D2LB 3B7UX 5LCVL 2FLRT 1JWSA 5E4OA 3SCMA 3KLSA 3NFNA 4JQIH 1AGDB 4NXKA 4R0LC 4G3YH 2VN5A 5EB9A 5HPOA 1KDIA 1ZS8B 2DDQL 2B4CH 2ICEA 2ZAHA 3B37A 4JY5L 2F54D 4HT1L 1ZD6A 4B50A 3VMPA 1DEEB 1IM9B 4P5TA 1ORSB 5DDHA 2PCPA 4LGSB 4BFIB 3LYRA 1ZSDB 2Y07H 3MUY1 3E38A 4MDIB 2ZZUT 4U4BA 3TCTA 5D96B 1BZ7A 2C9PA 2CPUA 4W4OC 3BISA 3FFCB 5E8PB 1FGVH 1RK0B 4KGLA 1RIVH 3MV11 4YXLH 1G5AA 4JFTA 4E9SA 1QSEB 3U6XA 4LVEA 1FGNL 3QJFB 4HEPA 1NICA 1ZPLA 1MJ8L 2GAZB 4G72B 4XPBL 1OTTC 5JOFA 4OUUB 2VB5A 4TSCL 3GDCA 1ZT1B 3W56A 3C5ZD 1KFAH 1JFQL 3OKLB 1UH2A 4WY7L 4UM9A 2R9HD 2BOBB 3QPKA 4KZDL 2W91A 3L3KB 5EBLB 4XE5B 2A6JB 4LPUA 4PJ8D 4X6CB 4NN7C 1MWAL 2ZCHH 4DGUA 3QIBC 4P9HH 5I5MA 1IGML 4Q2ZA 2HJFA 4DKEH 3VFGL 4KUZL 4P2QE 4I7ZC 4V1DA 5L6YH 4NWTL 1BD2B 4NN6C 2XV3A 3HPJB 3MRNA 4ZFGL 2CAKA 1EEQA 4WCYL 1KWGA 4XXWA 2NQDA 2WKLA 4F20A 1U58B 2CGRH 2VWEE 3LIZH 4WDIA 3THMH 3WTTA 3DX8B 1P7QA 4X9FA 4GAYB 5C0JB 5JYLA 1XGPB 5EZLA 3TA3B 3QORC 5BVJA 3LSOB 4QYOA 4AKOA 2E9IA 2X89D 4RA3A 4G8FA 1MCBA 4FQXA 2YA0A 2DV6A 4ZO9A 1T1WB 5EC1B 2HT2D 1UB5B 4UQ2B 1L4IA 4L1TA 4RX4A 4NJ9L 4Y5XC 3PL6C 3VXSA 3FTYA 4EUPA 3N41B 4MNQD 2ADIB 3O6KL 3QQ3A 5AOKA 3D2UD 1U8NB 3LN5B 4FQ1H 4NRZB 3VXMD 2VLLB 2R1YA 3FTXA 1KJVA 1DBMH 3S98A 1V7MH 3S36L 4RGOH 1YMMD 4E5XG 2I9TA 5JW3H 4OZGA 1BYPA 4LKXB 2K1MA 3EYUH 1WAEA 1TKWA 3CFEA 2CRZA 1XHHA 3L5XL 1RMFH 1HT6A 3P4MA 4MJ6A 1JYNA 3BDYL 1RK1B 2A1WL 2R83A 5FECA 1H9DA 3U7WH 2DQUH 4M43H 4MD5A 1PFCA 2AVFA 2K6ZA 3BKCL 2CSPA 3A47A 1AD9A 4WHTA 3K6NA 4S2SB 3EJUA 4L37A 4UTBA 1BM7A 1DSWA 4ZFQA 3S35L 1KIQA 1A7RL 2CDFA 1AI1L 1WK0A 3BT0A 5DD0L 5DJ8B 5I1EH 2BWQA 4S0HA 1X9RA 2NXYD 3ETBF 3BD3A 4H26A 1N5YH 2OSWA 2GJ6B 3L6FA 3TESA 1WD9A 3BPNC 1UGKA 2CO7A 3OB0H 2OZNA 3MMEB 5DMYA 3O4OB 4HKJB 4I1NB 2PXYD 2VISA 4GBXA 5CJOL 5DEJA 3V0AC 4XPFH 3QHTC 2X87A 3KPRA 2WXQA 5MP6L 4HMDA 4YH6A 2PWDA 3C8KA 3UDWC 5C1MB 3GYRA 2CLRB 4NDMB 4XODA 1TQTA 2WBJA 1TJHL 3B9KA 4PCYA 2X09A 1RJYA 2DM2A 2YD9A 2WNKA 2NX5B 3C2AH 3GBEA 1IGCL 1KT2B 1FG9C 4FXKC 4QHKI 4G8GD 3KEHA 5L88L 4TL5A 2V8LA 1CN4A 1OSZB 4LF3B 4D0DA 4AITA 5DD5H 4LEOA 3O9WD 3JV0A 4IRSB 1AQ8A 2XG4B 3KS0J 2ID5A 3QDGB 4GKLA 3UP1A 5TE7H 3R18A 4Y4FD 3WNIA 1YPZB 1MCFA 3MRHA 1JGDB 1D5XA 2Y5TB 1DP0A 1G1OA 1W6LA 1YEDA 4J27A 5C08E 5JIIA 4JDZA 4NCDA 5D5MB 3AAZB 2SEBA 4E41D 4XO9A 3GHEH 5E6IA 2X70B 1DJGA 1HHHB 5BZWB 3G5WA 3P4NB 3DPBA 5IT2L 1X4YA 4NKIL 4KTEL 3RVUC 1G9ML 1BM3H 1E40A 3EFFB 1ETB1 4Z77B 2DRUA 4HCFA 5F6HI 3ZDYF 4QLRA 1KTLB 5BZDB 1T66D 3MLYH 4JHWH 3AQYA 3QEHB 1JZ5A 1F90H 1XQ4A 4F5CA 5IGXL 4UILL 5BZZA 2Z31D 3OGCB 5IVZA 4I0PD 1R47A 4HK0A 4XHJC 2MPAH 4LASH 1FSKC 5ISZD 3LNIA 3TT3H 4CNIB 5CEXA 2M8XA 4IBYA 5FDWB 4YX2L 3JV4B 1DDHA 2C3XA 3CFIC 3KL3A 2NY6D 1T22B 4MNGA 3CX5K 2C34A 5J6GA 3DTXA 4PJBE 4HKXA 2W07B 3PGCB 4FADA 1OK8A 4UOW1 5CZXC 3VFMB 4Y9BA 3DROB 3QQXA 1M4KA 3IDYB 3O3EB 3RIFK 1UKSA 3KLKA 4UNVA 2R23A 1D2PA 1XH3A 4JFSA 2Z1PA 1CLYL 1NCDL 2NOYA 4ZYKA 2Y4SA 4A67A 3B7TA 5F71A 2C4FU 5ABAA 2IIJA 1B0GB 4JMXA 1KBWA 1UACH 4PGBB 3RFZC 3ATBA 3ZKND 2EO9A 4JFYA 4G6KL 2IQAA 5SX5H 1OP5K 1P1ZB 2MCMA 2JJTA 5KVMC 2YPLE 2PPEA 1WAAA 4JE0A 1IRAY 1L9NA 1Z9PA 2VDLL 1E4KA 1D5MB 1DLHB 1UD2A 3P2BA 1GS8A 1U2YA 4XBGB 5B1BB 4KVPA 4L1HA 2WQRA