5L9DL

Afamin antibody fragment, n14 fab, l1- glycosylated, crystal form i, parsimonious model
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
214
structure length
214
Chain Sequence
IVLTQTPAIMSASLGERVTMTCTANSSVSSNYFHWYQQKPGSSPKLWIYSTSNLASGVPTRFSGSGSGTSYSLTLSSMEAEDAATYYCHQYHRSPPTFGSGTKLKMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MOUSE ANTIBODY FAB FRAGMENT, IGG1-KAPPA HEAVY CHAIN
publication title The N14 anti-afamin antibody Fab: a rare VL1 CDR glycosylation, crystallographic re-sequencing, molecular plasticity and conservative versus enthusiastic modelling.
pubmed doi rcsb
total genus 57
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2016-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l9dL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l9dL01
5C0EA 1DVFD 4YNYA 4PJBA 3N1FC 4JN1L 3NA9L 1SJEA 5L2KE 5DHXB 4G8EB 3P9WB 3FCTB 3MUZ1 1BFOA 4XP4H 3WCYA 4TPRH 3OZ9L 4PYGA 3PWPB 5IBTL 5INDB 1EHLL 1QFWL 1MFAL 4YIQA 1FL5A 1PX3A 3TN0D 4DEPB 1CGVA 1Z9OA 4NJAL 5KSBE 5LGKA 3DV6B 2V2WA 2VRAA 3DARA 3VGGA 4W4NA 4YR6B 4C56D 5F6HJ 4OZIA 4FFYH 4PJXE 1AY1H 3HPJB 1GIGL 2OM5A 1JK8B 3OL2A 4XPBL 4AMKH 4O02L 3B43A 1E6JL 1TCMA 3KJ6L 4QHUB 4W6XB 5BS0B 1AO7D 3O3BA 1A6WH 1CVRA 2G60H 1J9CT 3DI2B 5HYJB 3ZDYF 5KOVC 3QQ3A 5H35B 4PTTB 1B2WH 1HHGB 2AXFB 1H3GA 3LRHA 4KJYA 1LD9B 2QBWA 1DLHB 1F90H 4QRUA 3QEHA 3O6LL 4PJFE 4ZO6A 2VL4A 3DGGA 2P8LA 1ZOXA 2DLGA 4XGZB 3TT1H 1BAFL 4P46D 4Q0XH 4YXLL 1JNLH 1UKTA 4NHUA 1V3LA 2FLRT 3RVVD 4E41A 4TYUA 5I1KH 3TBYB 5J56B 1A9EA 4J8RB 3WJJA 3RX8A 4NQED 3ARGB 5E8DL 3NZ8B 3GIVA 3I2CL 1KJMB 3GHEL 2A83A 2W9DL 3EYUH 2XNAB 3KLAB 3L1OH 3QCTH 1PY4A 1E0OB 1MJUL 1OB1B 4P2RA 4RFNB 4LKCB 2R2BB 5HHOB 5E8NA 3K81A 3OKMA 2HRPH 4X4XA 1LO5A 3MLVH 4OCXH 1IEBA 1BZQK 2Y5EA 5ABDE 1MQKL 5CJ5A 1MAJA 5DJ8B 4IMKA 4XC3H 4CN1A 1W0VA 3GI9H 3P3YA 5GS2D 3QIUA 3LH2L 4B5EA 4HV8A 3X12B 5CILH 4YC2C 4AIOA 4HS3A 3WNKA 3D18A 4HWZA 2NY4D 3W9EB 5EO1B 3AM8A 3BE1L 4MD5A 4XNZC 4LPYA 3IDYB 1IGIH 4KI5C 2HKHH 5HDQH 1XCQA 5EZOL 1ADQH 4DUVA 1FVCA 2F58H 5C0AB 2EDBA 1LMKA 4ALAH 4PRHE 5F93C 5DJZB 3QG7L 2WUBH 3RI5F 3W2DL 2YPKB 2VXUH 1DL7H 3RKDC 2HFTA 2V2XB 4LKXA 3GSNH 2ARJQ 3WKMH 1KCVH 2WAHA 3VFUA 2B39A 4KK5D 5DJYB 3VGFA 2DQCH 1Q38A 3NIGE 1C5DA 4XPTH 5KANI 1I3GH 5B22A 3NFPA 4RFOH 3WJJC 1WVZA 4MJ5A 1FFRA 3CXHK 4XRCB 3DHMA 3LEYH 1ZA6B 3D85D 2YWYA 4AQ1B 1UADC 1LO3L 1SMAA 1OQXA 5JHDD 4KZDH 1DLFL 3S37X 1INEL 2FJGA 4G9DA 1UWGL 4UI2A 1YMHB 1F2XK 5C0BE 4G80B 5DLMH 2FSEA 3PQYD 2AI0L 3GSRB 3QISA 2HJKA 5CBEA 4FXGA 3WXVH 4NFCA 3LZFH 4DZ8A 1Z3GH 4DKEH 4IMKC 3LIZL 1A1OB 2QADC 3QIUC 3OR7B 1JGLL 3H9SB 1SY6A 2DYPB 3HNSH 4HZLA 3AGVA 1BX2A 2VH5L 4XNYH 2EDLA 2HVKA 4P9ML 1T3FB 4RIRB 3AM8C 3MV11 5GIRA 4G8IB 3DBXA 3GSQA 4B53A 3EZ8A 4JDVB 5KS9F 1MI5D 4MDIA 5DZLA 4I3SH 3QDMB 2DQDH 3MV8A 3LB6C 4OLVH 1MHPL 1OGAB 2NY6B 4PGCA 5ITFA 4WWKB 4ZS7H 2P8MB 1UJTA 4EBQH 1FYHB 3OAZH 4LMQE 4X6FA 1YC7A 5MEQA 4Q9RH 5I17B 4ODHH 3IU3B 4M93C 3O2DH 3QFJB 3FN0L 3IS1X 2FL5A 1CR9H 2FWOA 4LEOB 5TGBB 3WFDH 3ZKXC 4HIHA 5D70L 3KYKL 4U7SA 5KVEH 3HI5H 4DW2L 5EORH 4GKZA 4Z7NE 4LSUH 2FO1A 5D96B 1BJ1H 2FATH 4P9HC 5F1NB 3CZJA 3S96A 2R69H 3UC0L 4LLVB 5TQ0H 1BQHA 3FN3A 1WQVT 3TWCL 1DEEB 5GXBB 1R5IA 3MGOA 4HLZH 3WO4B 2NY7H 3LKSA 1CDHA 2C3HA 1UQSB 3HUJA 3PV6A 5ADOL 4FQ1H 3TYGH 1JZ2A 3ULUD 4NKDA 4POUB 3O11B 4WUKH 3WHE0 1QFWI 5T5FH 2BNUB 2DLEA 25C8L 4JO1L 3WDIA 4YHML 3VFVB 1CFSA 1A4KB 3BH8A 4K7PY 2JTDA 4JFQB 5IHUL 3MFFB 5F7EL 1UM6H 4K3JL 4X83A 1VGEL 3VGAC 4OLZH 5I66B 3ULUH 4EI5B 1HQ4B 1S8DA 3DETC 3AREA 1MCRA 3E2HB 1F3DH 2DI9A 2DBJA 2IAMA 5KSBF 3BGAA 4NO0B 1DVFA 2Z91A 3S97C 2OZ4A 1YA5A 5DHYA 1FCGA 3WIFB 3WNNA 1T7YA 5C07D 3EYFA 2IJ0C 4PJXF 3MRRA 4FG6C 3UZEA 4D8PB 1FE8L 1UVQA 3DGCR 3VXSB 5BZDB 3T2QA 3NCBB 2GAZB 1EXUA 1INQB 3FOMA 4BELD 3TN0A 2L4OA 4FHBD 3W81A 2E6PA 1U42A 2NY1B 2YHGA 5SWZD 2XZAL 3BO8B 2Y5TB 4HIJB 1KCSL 3R1GH 1N6UA 4C56A 3TYFA 4WIQA 2KPNA 4H25A 3HC4H 4PJFF 1JWMA 4PRIB 1HWHB 1S7TA 1U8HB 1S78C 1AO7A 4G42A 1G7PA 1YEFH 5KVFL 4U1LA 4U1JB 3V6BR 1R24B 5FCSH 4BSWA 4BZ2L 1CVSC 1KNOA 1OOAA 4Z0BH 1XEDA 3HZYB 4HUUA 1MWAH 3T0ED 2ZCKL 1GPOL 1XH3A 3CZFA 4I3RH 1AP2B 3GBMH 5HHMD 1AQDB 3OJ2C 4HX1B 1C5BL 3QSKB 5F1IA 4WDIB 5DD5H 1OM3L 2HT4C 3PGCA 4Z7WA 5T1KD 2K7PA 2PTTA 3AREC 4G9FD 3ES6B 4P46A 3MXWL 3SDCA 4WJ5B 3CJJA 3WLBA 3U30C 4JQIH 2KZ1B 3FAWA 1RURH 4TTDC 2P8PA 4NQEA 4QXUH 5L2KD 4HIEA 1EEQA 4PJ5E 4LLWB 4U33A 2K7QA 1DVFC 4QOKA 4NOFA 3T1FA 3X11A 5EZIL 2CKBL 1DUYA 3MLYL 3ZLQC 1A47A 4G7YL 3VFMB 4DGVH 4XMLL 1MCHA 1SBSH 1XGUB 5IQ7L 4TUOA 4MCZB 1JHLL 2VLMD 5GGTA 3TN0C 4Y5VB 4ZUVA 3E3QC 3EOBB 4N1EA 3PWVB 1N59B 5CJQL 2AEIT 3KNBB 2XTJD 4TULH 1LK3H 2AEPL 1K5NB 1XF3B 1DQTA 1QSVA 1ZT4B 2VR9A 1ITBB 4UILL 1MVUB 1PLGH 4RGNB 4JPIA 1I7ZA 2ITDB 1KBGH 2VXTH 5IB2B 3UTOA 2V5TA 4CN4A 1KTDA 3GMOB 3NA4A 1NEZB 3S9DB 3CU1A 2H32H 4FP8L 1J0KA 4XVTL 3VFPB 3NIGF 2OI9C 1WWAX 5A2KH 1YNLL 1A6ZA 4JN1H 3NA9H 3DUUA 2NNAA 1AD9A 3OXSB 4IEFB 3D3VB 2EKJA 5BRZE 3SDAA 1ZA3A 5LGJA 4PG9A 3NCCB 4HKJB 4S2SB 4OGAD 3JUYA 4ZD3L 3JV6A 3QNXB 2JIXB 1MFAH 4P46C 3SDCC 2CK0H 3KPLB 4Z5RA 3RVVC 2FX7L 1XAUA 3PWPE 2MMXA 5TDPA 4BH8A 5CWSA 1P2CB 3P73B 5E6ZA 2EE2A 2AQ3A 3AMKA 3VDCA 4WHTB 3LS5L 5I0DA 5ITBL 3IDIB 3RHWF 4M3KB 2QQLH 1D9KB 1MCCA 4N5ED 4ODTL 3WUWB 5JUEL 1VENA 1YEEH 2JJTA 3HC3L 3MJ9A 4NN5C 2WWKT 1E6JH 2NW3B 4HG4K 2VMFA 2FEDC 3H3PL 1AC0A 4C59B 2OYPA 3SKMA 5B3NA 1YY9D 2DQGL 1AGFB 2VKWA 5BS0E 2AP2A 3PDOA 3NN8A 3W39A 5CINH 4RDQF 3C08L 5HYJE 4X5WB 1DQQB 1I9JL 2PR4L 2IALB 4HW6A 5EG6C 2PXYA 3O6LH 3SPVA 3VWKB 4CRPA 2NY4C 3KPPA 4XH2A 4BYHA 5EIIA 3MRQB 3X17A 4X6BB 4PRAB 4V2BA 1A0QL 4WUUB 4C4KT 1X44A 3AFLA 1RZGB 4UV4L 3EKCA 1B90A 1MPAL 1XZ0A 3LRSA 4YFLF 4OZFB 5GGVY 4GW5B 2ATKA 1U93A 3QYCA 4FQCH 2VDNL 4PRHD 5E8DH 1U8KA 5IG7A 3DRTA 1G6RL 3VFSA 1H15A 2H1PL 4P9HL 1IKFH 1MJUH 4JDTL 4K2UH 1AGBA 3SDAC 3S36H 4D2NA 5HHOE 2CR6A 1AXSB 2Z92A 4X9BA 4KK5C 1TTUA 2EXYD 1MQKH 1D5XB 2MTPA 4YUEH 4X7EC 4LNRB 5FYLL 1OSZA 3LH2H 3QWRD 2BY0A 4PRBB 3ZKMC 1MIEH 2NZIA 4XCEB 4BZ1L 4NZTL 1ZTXL 3UAJD 4ZYKA 5CZVL 4ZSOA 2AJ3A 3BGFB 4KMTL 2J3SA 3HS0B 1CFBA 3BKJL 4NT6B 5CD5D 3BE1H 2ADIB 2GSGB 3HFMH 3QO1A 2VABA 4U6XB 2ZOKB 5CJBA 5T3XD 3W0WE 1TJGL 1W8OA 2W07A 1G7JA 4HFWB 2VDPL 3HC0A 5FO7A 5EZOH 2AERT 1S7UA 2XG5A 3IF1A 3KHOA 3QJHA 2PXYC 2RAMA 1HCFX 4WFEE 4GKOA 2XY1A 2BK8A 3QG7H 1U8QB 4XVSL 2ZNWA 4EUPA 5KSVA 2CQVA 3C6LB 4EOWL 3P0VL 5ID0B 5C08B 3SGJA 4NO3A 4HBCL 1L9NA 2JJSA 2D9QB 4IRZH 2A6IB 1MCOL 1TZHB 3D0VA 5I74C 3FQNB 3WE6A 5C6TL 3QZWG 3S3SA 1C7TA 1LO3H 1IGFL 3DV4A 5C9JB 3BYYA 1JPTL 1DLFH 1ZANL 5KS9A 5IUSA 1INEH 4IRJD 5J4MA 4ACPA 1UWGH 1FZKB 3IJSB 2IFFH 3GMPA 5C07A 1IKNC 5JIKA 2EYTA 5TPWL 5FKPA 1S9WB 2H9GA 3SE3A 1F6LL 4DCQB 5ANME 2YR3A 3HZKB 5HTSA 4OCLC 5BJTB 4V1DE 3BI9X 4POYA 2OJZH 3LIZH 3P40A 1JGLH 3MJ6A 1JPGB 3GSOA 2DKSA 2VH5H 4Y2DD 4M8QB 1BIIB 2BY2A 4XVUD 4C83B 1CDBA 4P9MH 3S35L 5CCKH 1T21B 3MRGA 1KJ3H 2BCKB 5D71L 2VLKD 4ETYA 3MJ7B 1U41A 2VSDA 5HYEA 4U1NB 1RUKL 4LL9A 1ORQA 5JTWA 5JPNA 2YKLL 1CE6B 5CIPH 4F2MA 2SEBA 4XNXL 3VD3A 5DK2B 3MMEB 3T0EA 1OGAE 1GZPB 1MHEA 4JM2A 4J1UA 3DX6B 4ZTPL 5SWSA 1JBJA 4BSVA 5E7FA 3U2SB 4UDUB 4OZHE 4ZDHA 5B21A 4TNWK 4LSPL 3AU1B 3FKUS 4M7ZB 3RWEB 4JRXB 1VB9A 4ENED 3ME0A 3MCKA 3FN0H 2JJSC 3IETB 4U1KB 3IJYA 4X8JB 1CTNA 5T1KA 5CEYB 5GGRA 2MPAL 3KYKH 4FFWD 1JPSL 4M1DH 5L2KA 5T3ZL 2IBZY 2C7UB 5FXCH 4LCWD 1HHIB 1P7QB 3GI8L 1CIUA 3O81A 4N90E 2NYYC 2D0HA 3STLB 3UC0H 1T0NA 2IPKA 2Z35B 3T2OA 5K59E 2QHRH 4ZFOA 4DGYL 3SE3C 4MCYA 5DSCA 2APBA 5F7NC 3QDJE 3MROB 2MCG1 4MWFB 5KSBA 4LPCA 3L5WB 4NNYA 4XI5D 3ARYA 5ADOH 1B6UA 4XAKD 2OTPA 3LN4B 3CD4A 1KPUB 5MEPA 3STBA 4PPTA 2ZSWA 3BMVA 4PJXA 3SDDB 4YHMH 1A7NL 5BCAA 4YDVA 2CMRL 2J5LB 4JFEB 1AHWB 1KIUA 5DT1L 2I9LB 5EC1B 5DS8B 5F7EH 5ICXB 3B6SA 4K3JH 1J11A 3V7AE 1VGEH 1U95B 2A74B 5I1HL 5IROA 5IEHA 3BWUC 5DURB 3Q6FA 4AEEA 3GUTA 1NCNA 3G08A 4N1HB 4PJFA 3T0EC 1M05A 3T0BA 4JM2C 1S9VB 1U3HD 2VE6B 4YGVA 4AEFA 5J0BA 1X5HA 4QTHB 2Q76B 1REIA 1B4JL 5SX5K 2BX5A 1NFIA 4A6YA 1FE8H 2A6JB 3QUYD 1OVZA 1I7UA 4PJ5D 2CXGA 3BIKB 3G5XA 4NQCD 5FM4A 4FA8A 1T2QH 4UMGA 4G6ML 3VXSE 4UTBL 3ARFD 2G75A 2XZAH 2ZUWA 3QFDB 4U0QB 1JNNL 3HE6D 1FL3B 1J8KA 1FHGA 3WN5A 5F7KC 3OAYH 3V5KB 4ONOA 1WBYB 1TVBB 4JB9L 3C60C 3O8XA 3ZDZE 4LNVA 5GS0C 3BAEH 2QR0B 3BD5A 3TFKD 2HFFB 3D2UB 5KVFH 3T0WA 4BZ2H 1EFXB 1WFNA 1K8IA 3RVWD 4JY5L 5FO8A 5FDWB 4HPOH 2ZCKH 5L2JA 1P4LB 5D7KD 5D6CA 3U4EB 2GUOB 4IJ3B 5KZCB 4UQ2A 2OR9L 3JTSB 3OQ3B 1VADB 1C5BH 5IIEA 4M4PA 2JLLA 3DI3B 5BXFB 4OKVB 1MSPA 4GRLD 2D4DA 4LQFH 4AYFA 1X5KA 4X5XA 1TCRA 3MXWH 1Y6MR 1WZKA 5ELIA 4P3WA 2AJZB 4PRHA 5DD3L 5T1LB 2EC8A 2EXWC 2GTZB 5BRZD 1RY7B 3VG0L 3MRHB 4MS8C 3L3HB 3RVUD 1KB9K 4OZ4A 2CKBH 1JTTA 1U3YA 3AS1A 3MOQA 1WLHA 4PJDB 2MQCA 1MCWM 3JZ7A 1BWWA 4G7YH 1Q9WB 4NBXB 3K3QA 3HE7D 4IHOB 1IC1A 2YK1L 1JHLH 3FMGL 3UTZA 2XKNB 4B7IA 1SBBA 4UU9B 5IMKB 1RZ8B 2NZ9D 3P0YL 5CJQH 1HHJA 3DXAD 3VXPA 2AEPH 1MCJA 3QWRA 3RWIB 2FHBA 3WN5C 5C7XH 1JZ3A 1IBGL 1HWGB 2XXCB 5TE4L 4UILH 1UA6L 4KKCC 4N5EC 3O8XC 3H0TB 5DD1L 3I6LD 2NQCA 3F7RA 4OAWA 1MFEH 3LEVH 4IOIB 3QWQB 4PIRF 1Q9OB 1YY9C 4PB0L 1EAPB 4IIQA 1LDPL 3STZA 4HCRL 1YNLH 2ADFL 5JORA 2X1OA 4QRQA 4YEFA 2OR8A 4O00A 3LV3A 3DO3A 3D3VE 1FGNL 4KU1A 3TH3T 2ICWA 1PYWA 2K3TA 2F54D 2FX7H 1CGSH 5HHQB 2DICA 3DX7B 3BKML 2GJ6B 2VN4A 4MNGE 2ZZUT 3T77A 1CK0L 1CBVL 3L7EA 1ZLSL 4N8PA 3WNOA 5FUOL 2ITCA 1CLYL 2YA2A 4FFZL 4H26A 4JN2A 5FF6B 3TVMB 3IXTA 1RJZA 4PYHA 4IRJA 1BZ9A 4ODTH 1KB5L 1UB6A 3Q3GB 5JUEH 1WUNT 3HC3H 5DJDA 4D0BA 1HEZB 1RK1A 2ZUQC 4JQVA 5F71A 3OXRA 1NKRA 3H3PH 3GMLB 2EXYC 4F7EA 2DQGH 5EU6D 4ZAKB 1Q9KA 5E00B 1J05B 5IM7A 4QHLB 1PY9A 4NRXB 3C08H 4I0PB 4CVXB 3GMMA 4KHXL 4BK4A 5D2LB 3P4LA 1KC5L 5CMAA 3PP4L 4ZFZA 1N8ZA 3MA7A 4DKFL 5H94A 5E1AA 5C3LD 3BKYL 3W0WD 5DZNA 3RWGB 4OZHF 4FQXD 4UV4H 2VLKA 3MCG1 1MPAH 1JYWA 4WUUE 5CAYB 1LNUA 5IOPA 1OLLA 4IIQC 4KKBD 1G6RH 1YNTB 1JV5B 1EERB 3D39B 4K71B 3NCMA 4E5XA 3DTXB 4PBWD 4JDTH 5DGRA 1G7IA 1F4WL 3TIEB 3LOWA 2AGJH 2Z4QA 4AIZB 3G9VA 2BNQE 5K59F 3DMMB 2BY1A 2EYSA 5BOPA 2IPTL 1A6VL 4HUVA 1WFUA 2X4NB 1T20B 4R2GB 2YSSB 5HGDA 1FBIL 3GRWH 2EDXA 3EOAA 1V3KA 4ZUUA 4U6HB 2VR4A 4BZ1H 4NZTH 3W5MA 5DMGD 1OTTD 1S7SB 4IRJC 2R2HA 4KMTH 1GGCL 1PZ5B 3ARDB 4O2FB 4D9RD 3BKJH 3DIFA 5EFIB 1I3RB 5D7IB 4Z77B 2VIRB 4LU5L 3F7VB 5MI0B 1A2YA 4JQVC 1IRAY 4V1DD 3U6RB 5DRXB 1VACA 1JNJA 2CSPA 3BZ4A 5C09B 4GAJL 1TJGH 4JFDB 2VDPH 4F33B 1VFOA 5J12B 3I02A 4CADA 5IJKA 3GMNB 4J4PA 1YEHL 1XR9A 3UPCA 4I8DA 5IMLA 1JFQH 1RIHL 2ADJB 4DKAA 4XVUC 4RGMC 1I8LA 5T33H 3HA0A 2UY6A 3EGSA 4ZG1A 4XVSH 2A73B 4F57L 3QHFL 1FORL 4RNRB 3P0VH 1GZQB 5F9JB 4HBCH 4WGWB 5E8OA 4UOJA 4Z76A 2DLTA 1VGKB 5C08E 1MCOH 2ICES 2AJVL 2CIKA 3P11H 1KPVA 3ULSA 1E4KA 5DJ6B 4RAVB 1WWBX 1Z9MA 4EEEA 4GRWB 4WTXA 1IGFH 4W68A 1JGUL 3C5SA 1JPTH 1TVHA 1ZE3C 5TFSL 3E6FA 3S5LA 4OSUL 1F02I 5GS0L 3BKCL 5TPWH 4PJ7E 4ENEC 4L4JA 2LU7A 1I1RA 3BESR 1ED3A 3ZDZF 4KMQA 5CLTA 5ECJE 1HXMA 2Q86A 3BUYB 3QHZL 4PJ5A 2YXMA 4YHPB 5D6DA 4H88L 2DTSA 5IGXL 4N90D 3ARFA 1A9BB 2XQBL 4JZOA 4KRLB 4OF6A 4NO2B 3QG6A 4J23A 3HE6A 3CSYB 1SQ2N 4MXVE 2ENSA 1ES0A 3S34L 3QDJD 4YDJB 5IVNA 3S35H 1XMWA 3E0GA 5F7FA 1A6UL 5D71H 3QAZB 4KAQH 4Y4FB 2YMXH 5FCUL 1DQDL 5F44A 1RUKH 5BV7H 3I6GB 3MCLL 2YKLH 4Q6IB 5EZJA 4L29A 5I8KL 5IJKC 4XNXH 3T2PA 3MLPA 2YD3A 3IDGA 4J4PC 4WI9A 3HMWH 3WFEL 4P5KB 1AFVL 4HUXB 1U8IB 3R0NA 3EJJX 3ARZA 1I8LC 4X4YA 2X40A 5DDHA 3CH1A 1G7MB 4QRPE 2C1OB 5I9QC 5I1LA 1TQCB 2AABL 1SVZA 2CKNA 1A8JH 4Q6YA 5F7MC 5JXEA 2G9HB 2B1AL 3MRCB 1X5ZA 2MPAH 5DJ2A 5KSUA 4HUWA 3VD5A 1E4KC 1J10A 4GFTB 1U8LB 1JPSH 5FYJD 4LVHB 5T3ZH 1Q0XL 3TCXA 1J8HB 2HRLA 2ICCA 3TBWB 5BRZA 3RWJA 2AV7B 4ZFFA 4ZS6D 3RZCD 3FCTA 1LWRA 1NUFA 2QV2A 2X4SB 2YD4A 3ALWA 3KWWA 4G7VH 3Q2CA 3HE7A 2HFEB 3K80A 4OTXL 4OGZA 4Y1AB 1SJHA 2EYRB 5D6DC 3O0RL 2X42A 4NDMB 4KZEL 2XI9A 2A6DA 3ARFC 4M02A 1XGRB 4ZO9A 3SO5A 3DXAA 3HE6C 1L0YA 4YR6A 1KGCD 1FH5L 2CMRH 2X4UA 1MCIA 4G6AD 4WEBH 1UZ8B 3HPJA 4HS8L 2WBWB 3NCYP 1NCTA 4J2XA 4JFEE 3MRMA 2HMID 4ODVL 2WM0A 4MSWB 5I1HH 1Q0YL 4JFHD 3TFKC 5BS0A 4GT7A 2Z31B 2YN5A 1RULL 4HJJL 5HYJA 3UROR 1KEGL 5H35A 1OP9A 4PTTA 1LEGA 3RVWC 3TPUB 5E9DB 1MUJB 1NUGA 1OAQL 1LD9A 1ONQB 3BQUB 1AH1A 4JFPB 2NY2B 3MUGB 2YWZA 5ICYA 3VFTB 2R0KL 1NGWA 4IDJH 3S8WA 4DUWA 1B4JH 5JXEC 5SX5H 4XGZA 4Z78A 2DDQL 5B39A 1H5BB 5TF0A 5DJXA 1MAKA 3DVGB 3OKKB 3TBYA 1PQZB 2PCPB 4UTBH 3L3DA 4PV9A 3CFKB 1WBXB 3SKJL 2R4SH 3F7YA 3KLAA 1JNNH 2VQ1A 1MELA 5HHOA 2AXGB 3RVUC 4K8RD 4EIZC 3MLRL 4UNTA 3RWDB 2HTLD 4LPTA 1BP3B 1XF5A 4WI7A 3CFEA 3HE7C 5T1DL 5A43C 4M43L 1V7NH 1YEGL 3VG9B 4DEPC 5AWNL 5EU6A 2NZ9C 5DJ8A 3TBSB 4JY5H 1A22B 4QRTA 1FO0L 3IFOB 1UKSA 2OR9H 3ARBD 4QHNB 3TF7C 1CG9B 1JTPA 4X6DE 2GCYB 5EO1A 3SE8L 4ZUWB 3TNNB 3W0WA 1X7QB 1J7VR 4FQXA 5IB5A 2E9IA 4J3VA 1PW3A 3U7YL 3MNWB 1OW0A 5MHSE 2XZCH 4ZPTA 5DD3H 3QQ9D 4Q7DA 1YEJL 1RZJC 5TE6H 5E8EA 3VG0H 3TLRA 3RY6A 1T4KA 2VXVL 12E8L 5DJZA 3BP7A 1IEHA 2YPKA 2R2EB 2V2XA 1C12B 4PJDE 3QCUL 1QA9B 1KEML 3V5DB 3FMGH 2WSKA 3RNKB 3S98A 1INDL 1S9KC 1T22B 2C4FU 3P0YH 4AJ0A 4CUCA 3V5HB 1MREL 1ZHLB 2LTQB 5HSFA 4RFNC 3QUKA 5GRJL 3FB8B 1IBGH 5TE4H 1D5BA 5D5ME 3RUGB 4W6YB 1FNLA 5ANMA 5DD1H 3EUUA 1FJ1A 1YMHA 3R06B 2P7TA 4V1DA 3GSRA 3OKDA 1IQWL 2P5EB 4OB5H 5DHVA 4N0YL 4PB0H 1QBMH 4JLRA 2FJFB 5AG9A 1CWVA 5DK3A 1A1OA 1LDPH 3OR7A 3TCLA 3LDBB 4HCRH 3X3FL 2DYPA 5IWLA 2Y1VA 1T3FA 2YEZA 3GHBL 4WW2B 1L6XA 1NCAL 3O2WL 2APFA 3QPQD 4FQXC 1R3JA 1FGNH 1HYRC 4N0FA 4PJ7F 4MAYD 4ETQB 2B8OT 1OW0C 3BKMH 4X9FA 1CBVH 1CK0H 1OGAA 1AJ7L 2Y23A 3VI4E 1ZLSH 3CVIL 4KKBC 5FUOH 3UYOD 1A1NA 1CLYH 4E9LA 1EX0A 2GJ6E 3O3AB 32C2A 4FFZH 3RY6C 4WWKA 4OZHA 2P8MA 5GGSB 2BNQD 4JKLA 1GOGA 3S5LG 4RISL 3C5ZB 1KB5H 4MXVF 3BP6B 2CDGA 1RUAH 3JWDC 4OCSL 4LEOA 3GJFH 3VH8B 5D9SB 3BJ91 4N9GB 2BNRB 4WNQB 3KXFB 1YNKL 1EEYB 1EFQA 4HWNA 4PGEB 2WBJB 5C1MB 5DMGC 4MGXA 1KC5H 3DO7A 3PP4H 4R7NB 3CH8A 3OTTA 4LLVA 3WLWD 4DKFH 3QDJA 5D2LE 5HHPA 1DEEA 3BKYH 3EFFB 3RWHB 3FL7A 3VFRB 2O5YH 1UQSA 3RIAF 3E1F1 3ETBF 1YPZB 1VERA 1LHZA 4PLJD 4XNQA 3L7FB 3LHPH 5BQ7B 3O11A 4KQ3H 4ZMAT 4LBEB 3RPIB 4ELME 5IWLC 2KQNA 3QA3A 1A4KA 3SKOB 1F4WH 3D39E 4YXHL 2OTUA 3IAQA 4AEIL 1KIPA 4G43A 3MFFA 4NQDB 5GJTL 2Q8BH 2IPTH 1E28A 4EI5A 3SGEI 4HBQA 4LHJB 2BJML 1I85A 5GZND 1EHNA 2RQ8A 1JVKA 3HAEA 4CNIA 2FZ3A 1FBIH 2NY6C 3KR3H 1OTUC 4JKPL 2X1WL 2LE9A 4WWKC 4NO0A 4AQOA 5EIQA 5JLZB 1SJVA 4MNHB 3OHXA 2FECL 3FONA 4LU5H 4OI8A 4D9LH 4D8PA 4MYWB 3DJ9A 3QUZB 4U05A 4XB7A 5D7IE 4GAJH 5BZDA 3LAFA 2NXZD 3RVXC 1INQA 4JHAH 3TT3L 5EOTA 5C09E 1TNNA 3F7QA 1N0XL 3MGTB 3RGVD 3CMOL 1EPFA 2DI7A 5T5NF 2OSLA 4HIJA 5TDOB 1OAXH 1RIHH 1KG0B 1EUTA 2R4RL 1DJSA 4F57H 1MH5A 3PGFL 3QHFH 4UIKL 3UCRA 5L0QB 5KAQF 4GQ9H 4HKXB 4XBGA 3T0XA 1U8HA 1AI1L 1JMXA 2IADB 2DMKA 2PKDA 4JANB 3OKOB 3N1PC 4DTGL 2AJVH 1R24A 5CEXB 5FB8A 4LSDA 1JF1A 1YUHB 2DQJL 1FIEA 1JGUH 4QRPD 3E6HA 4PLKD 1FZMB 5EO0A 4KH2A 1VPOL 2IEPA 4HX1A 4OSUH 3BKCH 1LVEA 3BPNC 1GAFH 2EDEA 2EO9A 3MUHL 4OJFH 5IV2B 4EI5C 3MLWH 4LPUA 1I85C 3QHZH 3E2HC 3OJMB 4OGXL 4PRNB 4QWWC 1JUFB 4H88H 5IGXH 2IBBA 2ICWI 4LLYB 1TVDA 2XQBH 4DK6A 1P7QD 3U36B 4GXUN 3RL1A 3KPSE 5JO5B 2YUZA 1MHCA 4AENA 3TC9A 3UYPA 5HBBA 3QULB 4C58B 1QFWM 2PYEE 3HNTL 5C0GB 5GRYA 4LMQI 2N56A 3QUMH 1K4CB 5M95B 1A6UH 2R39A 1JPFB 1PKQB 5DUBB 3A6OA 5ACZB 5FCUH 3NBNA 4X6DF 1DQDH 3BP4B 1G1CA 3B2UD 1MQ8A 3A67L 5GSRB 4MCZA 2W0KA 1CYGA 5I8KH 2EC9T 3DX9B 4JGJA 1T1ZB 1N59A 1RZJL 3K8KA 1AFVH 1NCCL 1QHPA 1Y6KR 1R5VA 2ZUYA 3CSPA 3GMQB 2BHZA 1NMBL 2NX5B 5J7CC 5ACMA 1C7SA 1YEKH 3ARBA 3WHXA 1SHMA 2CLRA 3I9GL 2ITDA 5JA8B 5IB2A 2HMIC 2B1AH 2VLLB 3GMOA 4NRZB 3SDYL 5DUPL 2ARJB 4PJDF 2I27N 2YXFA 4QRRE 1J1PL 1RK0A 2OXHA 2ENYA 4F37F 1R3LB 2A77L 3QR2A 1RFDL 3QCVH 2MQ0A 4FFVD 1KTKE 3KPMA 4JY6B 4M9PA 3AAZA 2DQFB 2EDTA 3GJEB 4JRWA 1WTLA 3RJDA 2AJSH 2HVJA 5M7QA 3OXSA 1NMAL 3LKNB 4M7KL 1IAIM 3D3VA 3HMXL 2Y7QB 5D5MF 4HKJA 1X6NA 3QNXA 2E6QA 2HFGH 2BFVL 4MNGA 4OTXH 5TF1L 3DRQA 1IZKA 3O0RH 2R0LL 1OD7A 1E27B 1T04B 1VFAA 4JFYA 4OF7A 4KZEH 1P2CA 4PJHF 2RJMA 1FPTH 4WHTA 1QLRA 1S7QB 2J12B 4K7FA 5E5RB 3VXNA 4HK3J 2P45B 2R56H 3SGEH 1FH5H 4HF5L 4K8RC 2M26A 4XBPB 1S7RB 3S88L 2R1YA 2Z0BA 2HTLC 4HS8H 4LP4A 5DRWB 1IVLA 1N5AB 2CIIA 3ARVA 3VFOA 4UTAL 4ODVH 4XNMA 4X5LA 1BMGA 2WIMA 1RULH 4HJJH 1AGFA 5C0EB 4YNYB 4JVPA 5GS3A 2P44B 4DOHB 3ORJA 2N7BA 1Z6JT 5AAMA 1OAQH 1BFOB 2ILLA 3EIFA 2YA0A 1DBJH 3ARBC 3MRQA 4YXKL 3ARTA 2EDNA 4X6BA 4QYOA 4YIQB 1K6QH 4GAFB 4WUUA 3JWDL 3CVHA 2DDQH 1HXYA 2XY2A 4MAYA 3U48A 3QQ9C 2WNGA 2V9TA 4YC2B 3SKJH 5JMRA 4XZUA 4UAOB 3F58L 2BNQA 1UH4A 4LDLB 4M00A 3MLRH 2KKQA 4LSSL 2EDFA 4ZOEA 3O3BB 4KVCL 4XNZB 5D2LF 5T1DH 4M43H 1E4JA 3QNYA 1YEGH 3RBSA 3QQ3B 5EO9B 1LDSA 1ZKAA 2DS4A 4KJYB 5AWNH 1KB9J 4ODBD 4QRUB 3P30L 3DGGB 1LEIA 1FO0H 4PRBA 4G8GB 5DEFA 5DZOA 4ELMF 3ULVL 1W72A 1DQJA 2VISA 4NT6A 3RL2A 3RTQD 2ADIA 4YK4C 3V6FA 2WP3T 5DMIL 2ZOKA 4YWGL 3GIVB 5AD0A 1G9NC 1N5YH 1YMMB 4F8QA 1BREA 1YEJH 5E8NB 3OGCA 3OKMB 4DWHA 2Z8WC 12E8H 1HYSD 1LO5B 2FR4A 6FABH 3V7AG 2P4AB 5HJ3A 3BDBA 1YYLL 1O7SA 3BMWA 3QPQC 3C6LA 5C08A 4R8WH 5E95B 4MAYC 2VYRE 3VDAA 1W0VB 5D7IF 1TZHA 2QADB 3QIUB 5C0CB 2ZUXA 4HV8B 4HS3B 3D18B 4HWZB 1KXQE 1MREH 5DJCA 3FO9A 3IT8D 1KLUA 2KH2B 5C9JA 3OX8B 3GBLA 4Q9CA 1AGDA 4PJ7A 1FZKA 3IJSA 4MD5B 1IT9H 4HGWA 2AK1L 3PWNA 4I3GA 3RUGE 3T0VA 1IQWH 3UBXB 1KXTB 4DCQA 3OSKA 2PUQT 1IAMA 5DQ9B 1QBBA 5IKCA 1DFBL 4RGOH 1JPGA 4WO4D 2G2RA 1FLTX 3FOLB 3I3EA 4LKXB 4NUGL 2VZTA 5DWUL 3R8BB 3GHBH 3VFUB 1K4DA 4M93B 3O2WH 2R9HD 2BCKA 3WXWL 3NFPB 4MJ5B 2DM2A 4U1NA 1NCDL 5EN2A 4OI7A 2W60A 1LK2B 3JV4B 3UEZA 2BXYA 4GXUM 2FD6H 5JNYB 1GHFL 2V7NA 4PLJC 4QXGL 3CVIH 1EMTL 2FJGB 3MMEA 1GZPA 1TTFA 2RCSL 4QRPA 3DX6A 4OCRL 4K55A 3MUJA 2E27L 4RISH 4PBXA 5C6WH 2FSEB 3NGBC 4UDUA 3C6LC 2F15A 5L7XH 3LEXA 2HJKB 5CBEB 1OL0A 4FXGB 5FUCE 3IETA 4X8JA 4NQUA 4OCSH 4X0KA 4DZ8B 1BFSA 5GZNC 4KGLA 4OQTA 1M7IA 1YNKH 4Y16B 2AJXH 1BX2B 1ERNA 1NC2D 4N8CL 3B3IA 4NQXA 1A21A 4CVZA 1HHIA 2BNRE 1P7QA 1UYWL 3KXFE 4WVRA 2GY5A 5I1IL 3DYMA 3STLA 3DBXB 3GSQB 1N3NB 1YQVL 2Z35A 4MDIB 3VGAB 2M8XA 4RWHA 1PFCA 2E9WA 1Q8MA 2YD7A 3O6FD 3BH9A 3TO4D 4G6FD 5KG9A 3MROA 5C09D 4NCC2 1MLBB 5FYKD 5ITFB 5TH2A 5F6IC 1RUPH 3LN4A 3GNML 1KPUA 4WGVB 1YPZE 4YHYB 5GS1A 1EO7A 1UZ6E 4X6FB 3SDDA 5MEQB 2XKSA 3HI1A 2P48B 4P2QE 5TQ2L 4JFEA 4AEIH 2FO4B 4EDWH 4MVBD 5DS8A 5KTEH 5ICXA 2X4PA 4X98A 3VCLB 5GJTH 3MOBL 2A74A 1NEZG 2BJMH 4NQDE 2X4TB 3MBED 3T0AA 2D3VA 3T09A 2JJWA 4LFHG 1LEKB 4JKPH 3W82A 4K9EC 1WSST 4C4KO 4R90L 1BQHB 4PLKC 2IAND 1QFHA 4QTHA 5C2UB 1JGDA 2Q76A 4XP6L 3MGOB 4XP1L 1ORSA 3LKSB 4M7ZC 3HUJB 1UM4L 4XP9L 4LPWA 4JFOA 4CU7A 1UEYA 3FO1A 3WSQH 3DYOA 4D9QD 4MJ6A 4NKDB 3F65A 3TT3H 1U0QA 4P57A 3KPSD 2Y25A 1N0XH 3GBNH 3CMOH 1XGQB 4TSAH 5FFLA 2PYED 1NGPL 4J7RA 1FL3A 1X5YA 2R4RH 5F8QC 5GRUL 5DF0A 1WBYA 4JRYB 3WUWG 1TVBA 1ULVA 3AREB 1IL1B 3B2UC 2QR0A 4RAHA 4FQLL 2HFFA 5H37G 1TDQA 3WIHL 2IAMB 1FZOB 3MJ8A 3PUCA 1OPGL 3LKOA 1DVFB 2Z91B 1EFXA 5DHYB 2DQJH 5GS1C 5FDWA 5DO2D 3SDDC 4WY7L 3EYFB 4FQQB 3BVNB 5CJXA 4X6DA 3WEXA 5I8CA 5AYUL 1H3UA 2J5LC 4OF8A 2ED7A 3MRRB 1ETZA 2XXMB 4LLDB 4U1HA 3B9KD 1GGIL 4NIKB 3DUSA 4QRRD 4D0CB 3MV7D 4OKVA 5IP4A 1EXUB 3PF2A 3TN0B 1VEPA 2DWDA 2XZQL 3TNMA 3VFWA 5IW3A 4OZFG 3REVB 3AB0B 1KYOK 2AJZA 4XT1C 4MZ3A 4FFVC 4JO3H 4CJ1A 3ZO0A 3TYFB 4C56B 2ZCLL 4BQCA 3CXDL 2B4CC 3GDBA 3HNTH 5GGUA 5DMKA 4KKAC 4PJDA 1JL8A 1MFNA 1JF5A 2CDFA 4YFEA 4PLNC 1AO7B 4G42B 1G7PB 3WDJA 3VA2C 4U1LB 4CN6A 4NN7C 4IHOA 3A67H 1MCSA 4BSWB 1KNOB 3VGEA 4HUUB 5IJVB 3L3JB 3CDGA 1CDYA 4NQTA 5IMKA 1RZ8A 5KJRL 2CJUL 3CZFB 5CEZD 1CTOA 1FLRL 1A3LL 5D5MA 4N0CD 3VFNB 1FNGB 1KLFA 2VDQL 3GK8L 5F1IB 3EJYD 1G7QB 1I9EA 5MP6L 3PGCB 2BSSA 3OB8A 3N9GL 2PTTB 3RTQA 2CK2A 3AVEA 4P46B 2E9BA 1M6OB 5FM5M 4HK3N 4PJHA 3WLBB 3G6JE 2VUOA 1MFCL 4N8VA 3SDYH 1KIQA 3MRJA 5DUPH 1J1PH 2FCBA 4HWUA 2VZUA 2A77H 1RFDH 3QDGE 1CE1L 3QO0B 4IJ3C 1QHOA 5CJXC 4KVNL 4BKLA 5T1MA 4M7KH 4NN5B 3HMXH 4GO6B 4TUOB 3MR9A 4U2YA 2EIZA 1LO0L 2H2SD 2KDGA 3BIBX 3GM0A 5TF1H 4DAGL 1HHKA 1TZGL 4NZJA 3IDUA 3NCFB 4M62L 2R0LH 2GJ6A 43C9B 3VRLF 4MB4A 1BVZA 4WTZA 4FMKA 3S3JA 1CT8A 5ETUA 4L3CA 4LPVA 4LCUB 4Y5XA 2NY4B 5FF6A 4HF5H 2BMKA 2DQUH 4N5UA 3A0OA 3BFOA 1KTDB 3OKNB 3Q3GA 4G5ZH 3MX0A 1HEZA 4XX1G 2ZUTA 2FYYA 1DN0A 1FFOA 4MXWL 4WCYH 5E2WL 4WW2F 2J1KA 4ZAKA 5E00A 4FQPA 5FA4B 1A6ZB 1KJ2H 4QHLA 2ADGA 4NRXA 3BD3A 2FBJL 3GKWL 1OT2A 4CVUA 4WO4A 4DOHE 1ZA3B 5D2LA 4N0UB 5LGJB 4KQ4L 3IGAB 3JV6B 3RVTC 3QP3A 4CMMA 3RTQC 1L7TL 2XFXB 4YXKH 4M61A 3ZYIA 2UZXB 5C70A 4Z5RB 1NCUA 1T89A 4KK8D 1P6AB 2ZJSL 5TDPB 1YEIH 5CWSB 1EBAA 3D85B 3ISWA 4JO2H 1PAMA 1QRNE 4ELMA 4X6EB 1GC1C 1YNTA 5JHDB 5GHWL 3TEUA 2ICWJ 1HYSC 1NUNB 5J8OA 4NC0B 1I7TA 5IB3A 3PQYB 4LSSH 3BD4A 4ODUB 5ALBL 4KVCH 1W8NA 3S7GA 4WI4A 1DE4A 5IQ9A 1WZLA 2X4NA 3NN8B 4JO4L 1T20A 3W39B 3UPRA 4HH9B 4NP4L 5IHZA 4MA8L 5IW6A 4FXLA 3P30H 4U6HA 1NC2A 3ET9F 1T1XA 4Y5XC 1P4IL 4XH2B 1L0QA 2B5IC 1YPZF 1IJ9A 1JHKL 3ULVH 4O2FA 4G8GE 3ABZA 3LCYA 1MI5B 5D7IA 1IC5H 2B0SL 4NPYB 3U6RA 2W38A 3O6FA 5KVGL 3TO4A 4X99A 5IMOB 1U93B 4J3SA 2E3VA 5C09A 2H2PD 4TNVK 4JEGB 1U8KB 5IG7B 3DRTB 4ZAKC 3VFSB 1H15B 5I74B 4F33A 1U8OA 4FQ2L 3ARPA 3AS0A 3GMNA 1WEJL 2XA8L 1WAAE 1MEXH 4ODSH 4WO4C 1C8PA 2VZVA 5INCA 1CICD 3BXNA 1YMME 2ADJA 3H8NA 1DDHA 4P59H 2VDOL 2W9EH 2PO6D 1YYLH 2R9HC 1FC2D 3JWOC 1Z9LA 5F3HB 1T89C 1SYVB 4Y88A 3ZHLA 4KRPD 1RJCA 3MBEA 2FGWH 1FG9C 1X5XA 1WZ1H 2MOVA 4RAVA 2NY0D 4F7CA 1IGYA 4ZYKB 4ZSOB 2AJ3B 1F6FB 4PJIB 5C0CE 1MJ7L 2DLIA 2IANA 1WISA 3QO1B 2VABB 3Q1SH 1OGTA 1AE6H 2AK1H 3DOSA 4F9LA 3RAJH 3HC0B 5CGTA 1S7UB 1ZLWK 1OAKL 4R2GC 4XWGL 3BUYA 3IF1B 5IW1B 4M03A 3KPSA 5F6HI 1QVOA 1DFBH 1DANU 3X13A 1A9BA 5HYSA 3ZKND 2PYEA 1I1FB 5FHAL 2CO6B 4NO2A 3W9DA 4R0LA 4EUPB 5KSVB 1CU4H 4NJ9L 4JG0H 2ZUSA 4NUGH 5DWUH 3Q48A 4YDJA 4PD4K 4NO3B 4P5TD 5MI0C 4BQ9A 3TO4C 3ILQD 3WXWH 4HULB 1E4XL 4Y4FA 1NCDH 3D0VB 2BC4A 2IG2L 2YZ1A 3I6GA 3WE6B 1GHFH 4HIIB 5J12C 1J86A 3AC0A 2X10A 3DV4B 2VAAA 5KS9B 5I1GH 4P2QD 4Z0XA 4MJIE 2RCSH 1QOKA 2BOCB 3GMPB 4OCRH 5C07B 2ZUVA 4IRSD 2EYTB 5FKPB 2H9GB 1G7MA 5C0IA 4JPKH 1QSFD 4MVBC 4WHYG 5L6YL 2FLBT 4QRRA 3QXTA 2R29L 3MV7A 1VFBB 4HUNB 3MRCA 4BFGA 1VCAA 3MBEC 1H0DA 2B20A 5SWZB 1I9RL 2APVA 4RFEA 4N8CH 3J8F7 1UYWH 3TBWA 4HQQL 1TJIH 3MXVL 5D2NB 3MRGB 1YQVH 1ORQB 2HG5A 2JE8A 5JPNB 2EEDA 2V17L 4F9LC 4ZODA 4JCLA 4F2MB 1A7QL 4OGYL 2ZG1A 5JQHC 3G6JF 2VITB 1GRWA 3T0EB 4LSRL 1MHEB 1DBKL 4J1UB 1XCTA 3GNMH 2ICEB 5HI4D 4BSVB 4R0LC 5HHMB 1CGUA 2F8VA 3BEWB 5D7SL 5DC0A 5CKAA 3EYVA 5TQ2H 3RWFA 3AS3A 2DTML 3QIBD 2XV6B 3MCKB 3IJYB 5T1KB 4G9FB 3QAZC 4Y4FC 7FABL 5GGRB 4MSWA 4YBQD 1HSBA 5ALCH 5L2KB 2EZ0D 1YJDL 1U36A 4B0MM 5DO2C 1T0NB 2L0DA 1ONQA 3BQUA 2H45A 4LSVL 4PJ9D 4R7DA 4XP6H 4ZFOB 4U31A 3VFTA 5DSCB 5EULV 3MQIA 4MNQE 3ROLA 3CFJB 1TQCC 1UM4H 3ZTJG 2FDBP 2QSTA 4NNYB 3FT2A 3VGHA 3ILPB 5IK3A 3ARQA 2YRPA 4ODXB 1RHHB 5MEPB 4U3CA 2ZSWB 2XTJB 4PJXB 2Y6SD 3CUPA 2H32B 3M8OH 4WTZG 3CFKA 2BHYA 1EV2E 1WBXA 4X9IA 5HHNB 1NGPH 2APXA 1YZZA 4LOUD 5I15L 1RD6A 3TH4T 2XT1B 4RWYL 3GEWB 1JYXA 4JRYE 3Q6FB 1KPRB 3GUTB 3L3GA 3G08B 5DEGA 3WIHH 4XCFL 1M05B 3EAKA 1GC1L 1OPGH 1FP5A 4YGVB 4TVSa 3PWUB 1ZV5A 4GRMB 4WY7H 4OUUA 5AYUH 1RUQL 5AZ2L 4A6YB 1QZ1A 3QRFM 1GGIH 1I7UB 1X7QA 1Y6NR 3G5XB 4YDIL 3T8XA 2XZQH 4U0RB 3MNWA 3QDGD 2QLVB 3F8UB 4EXKA 4P3CL 4OFKA 4FQHA 5JDSB 1HILA 4UT9L 3WN5B 4H1LA 4LHUD 3BQUC 4ZFGL 2ZCLH 2ZG3A 3CXDH 3C2SA 3B5TA 3O2VL 3L5XL 4YBHA 1WBZA 2R2EA 1TZIA 2H2SC 4HZAA 5H37H 1OP3K 3IDNA 1K8IB 4NYLB 2Q7YA 5FO8B 1JN6A 5D6CB 2CJUH 1T22A 5J1SC 3B9AA 1A3LH 2AEQL 8FABB 3TZVD 2VXSL 5D1XD 3GK8H 2OJEA 5IIEB 1WAAF 4WHDA 2X9WA 4Z8FL 5LXGL 3UJJL 2YN3A 1EA9C 3NPSC 5MP6H 4OLXL 3RUGA 5DJ0A 3JWOL 3N9GH 1CXKA 3EJZD 2EEBA 3R06A 3BZFB 1MCFA 1IM9D 1FSKC 4OZFH 2I9TA 1MFCH 3VG9C 4PRHB 3MYZA 3FJTA 3MTRA 1NQBA 2FJFA 2D7MA 3ROOB 2KBGA 4LPXA 4OZ4B 2XWTA 1X6LA 4KVNH 3UMTA 1CICA 1G0XA 1R6VA 1GGTA 2ZUQB 4X7TA 4WW2A 1F45A 1LO0H 4R97B 3UTZB 1WZMA 1QRND 4KK8C 2WK2A 5TE7L 5JW4N 5E8PA 4M62H 1HHJB 4CDHA 3VXPB 4POZD 3MACH 2YUXA 4M7LL 1G9MC 2FNBA 4OAWB 4H8WC 1VEOA 1HIML 3CAFA 5CP3A 4LASH 5SWQA 5CGYC 4YAQB 3C8HA 4DZBA 2O93L 5E2WH 4MXWH 4HHAB 4PB9L 3STZB 1VDGA 4KC3B 4WNQA 3KXFA 4NWTL 1G7LA 5I19L 2ZPKL 4ZOCA 2FBJH 4PGEA 3GKWH 2LTQC 3SQOH 5JORB 4G8GD 4BK5A 2OXGA 4QRQB 4CAGA 4L8SA 4KQ4H 3LV3B 4ORZC 5BW7A 1HHHA 4N0UE 3U46A 2JJVA 5JPMB 3KYNB 1KLGA 3VFRA 1U8PA 3L7EB 2H2PC 2VWEE 3V9FA 1YPZA 5K9OB 2C4XA 2GTWA 1O5DT 4HUMB 4H26B 2OTWA 1EGJA 1BLNA 1RJZB 4P2QA 4WFGD 2OL3H 3D6GA 4IRJB 4LBEA 3JTTB 3RPIA 1CICC 1UM5L 5E2TL 2V5MA 4R4BA 5JHDE 4OLUL 1AXTL 4D0BB 4IRSA 1RK1B 3IYLW 4WW2C 5ALBH 3OXRB 1J1XL 1P7KA 4F7EB 2R0WL 3PQYE 2WQ8A 1Q9KB 3EOTH 5IM7B 2OX5A 4NP4H 4MA8H 3GMMB 2NY0C 4F58L 4Y2DB 4ZFZB 4RGMB 3EO0A 3MA7B 5H94B 5E1AB 4LAQL 5D7JD 5JLZA 3FRPA 3DNKA 4Z7OF 3VXQA 1EVTC 2DWEB 1KN2L 2VLKB 5FUCC 2BVTA 3LS4L 4MNHA 4YHOL 4W4OA 3RA7H 2J6EL 3KJ4C 2JK5A 2B0SH 5KVGH 4MAUL 2H3NA 5KN5B 1MI5E 4X80L 4ISVB 3C5JA 3B2VL 2N7AA 4FQ2H 5SX4I 2YD5A 2XA8H 3ZKNC 2O5XH 2L7UA 4L8SC 5BW7C 2Z8RA 2R0ZL 3QIBA 2ZWLT 3H9YA 4HUVB 5FKAA 1GL4B 3ILQC 4ERSL 3CPLA 5I2IA 4XP5L 4HKXA 4K7PL 2HJLA 2XICA 4KUZL 2IBGA 5HGDB 2IADA 4WI8A 5E1HB 3EOAB 5B4MD 4GH7B 4MJID 1NAMH 5I30H 5JHLL 2LU3A 4LCWB 4L4VD 5CEXA 4PJ8D 4MQXC 1MRFL 3IVKA 4R26L 1HH6A 5FV2A 3SEPA 1MJ7H 2KZWA 3KPQA 1M7XA 3DIFB 2MCPL 4IRSC 4PJ9A 4ZSOE 1A2YB 4PJIE 1WJ3A 3SOBL 4OD1L 4F3FA 1GSMA 3VFGL 3BZ4B 4KXZI 1J1OH 2RBLA 1R3KB 3BGMA 1N7ML 3FFDA 5E6ID 3I02B 4CADB 1ZLWH 1OAKH 2D7NA 1U91A 4XWGH 4L3ED 2B7DT 1XR9B 3MA9H 1E6OL 4PRNA 5IMLB 4GS7B 5D4QA 5CFHA 3ULUE 3U36A 1CS6A 3EGSB 1NMCB 4FS0A 3GIZL 3QULA 5EDXA 1HNFA 5C0GA 2HT3D 4W4OC 1GGBL 1K4CA 15C8L 3VXOB 5DR5L 3B83A 5E8OB 4Z76B 1E4XH 2IG2H 4TVPL 3ULSB 5GSRA 3FB5B 4D3CL 1FVEA 4Y5YA 1J87A 3DX9A 2WBKA 1U3HB 1T1ZA 3C5SB 4TSBL 1TVHB 1S3KH 5HI4C 3E6FB 1RJLB 4MMZC 3QIBC 4WTWA 4LRNH 5L6YH 3G6JA 7CGTA 3OJDA 2Q86B 3QUYB 2R29H 4PJ5B 2VLLA 4YBQC 4NQCB 4NRZA 3IXAB 3JV5A 6CGTA 4I18B 3QDGA 4IBLT 3ARFB 5BVJB 4X7DC 1I9RH 3WFZA 4D94A 1H3TA 1F13A 1O7VA 3HE6B 4HLJA 5SWZE 1W2KT 5IB1B 4PR5B 4JY6A 4HD9A 4MNQD 4LHUA 4NOBA 4HQQH 4PJ9C 2D7TH 3IB4A 4H20L 2AEWA 1N2RA 3HKFA 3CGTA 5D2NE 1U58B 2V17H 5EZJB 5M94B 5F7WC 1OCWL 4L29B 4RMSA 2ESVD 5CSBA 3CC5A 3IDGB 1A7RL 5EOQL 5EA0L 1CIDA 5F97E 4LSRH 1E27A 1DBKH 1T04A 2Y6SC 5IBLD 5I1AB 2VLJD 4OQ1A 4M1CD 2NY3D 3PL6D 5DDHB 1S7QA 3TZVA 4LOUC 4UDTB 5D1XA 5D7SH 1MRDL 4WHYH 2DM4A 3TM6A 2DTMH 1QNZL 2P24B 2A0LD 1ZXQA 5JW4M 5J89A 4GRLB 4KK9D 3F5WA 7FABH 2CRIA 3NCJL 5DJ2B 1D3CA 5KSUB 1IM9A 4HUWB 1V7MH 4Y5YC 1UC6A 3C2AL 4G9FE 5FAAA 3G6AA 1ZGLB 1YJDH 3WS3A 2WLZA 4XMKL 3RX5A 1U3JA 5BRZB 3RWJB 4RA3A 4ZFFB 1MCEA 2DD8L 5JW3L 5LQBL 2CGRL 1MLCB 1G9ML 3SE9L 3QIWD 4LSVH 1V05A 5F8RC 1P1ZA 4YO0A 5DRZB 3KWWB 1B3JA 4H8WL 2DLHA 1DUZA 3HE7B 5SX4H 1SJHB 4LIQL 3ZHDA 1FFPB 2NY5H 1QRNA 2FBOJ 1ACYL 2A6DB 2VLME 4AIXA 3FTGB 3V0WL 3DXAB 5C6PB 2EIBA 5CSGA 2X4UB 4F9PC 2XTJE 1XGPB 4WU7B 5F9WC 4JG1L 3BN9D 3Q5YA 3RY4A 3MRMB 1KYOJ 5F7DA 3LVEA 4HJ0D 4PV8B 4AH2A 4Y4KD 3MLSH 5EO9A 4MQSB 1PSKH 4JVWA 1LEGB 5HY9A 3VH8G 3TJHD 4XCFH 3DSFH 4G3YL 4J3XA 1GC1H 2AK4D 3RWCA 4YDLB 4KXZH 5ICYB 4HC1L 5FGSA 3TZVC 1NGWB 3LQAL 4G8GA 5D1XC 1RUQH 1QBAA 5AZ2H 5F89A 3ZTJH 4Z78B 1NJ9A 3EJZC 1T5XB 2HP4A 5B39B 1IAIL 3H3KA 2F54B 5C0JA 3VXTB 5DJXB 3TP4A 5BZWA 4YDIH 1B0RA 3L3DB 5C3TA 4PV9B 5JOPD 4P3CH 5DYOA 1CXEA 1FNSL 1WAAA 1P4BL 3F7YB 2VQ1B 1YMMA 3BZEA 4ZFGH 5GGVL 4MA3A 3AROA 3KGRA 3O2VH 5LGHH 1GH7A 3Q6GL 1XF5B 3CFEB 1J5OL 1MOEA 3OGOE 5EU6B 1OP3H 4DN4L 4LK4A 3WO3B 2ZKHL 1BD2E 4QRTB 1S5IL 1ZHBA 5C0CA 1KELL 1JYVA 1S5HA 2AEQH 4POZC 4UAOC 4HIXH 5FHBL 1EBPA 3OX8A 4Z8FH 5LXGH 3UJJH 3W0WB 4OM0L 4OLXH 4FQXB 3JWOH 5IB5B 3VGDA 4S10A 1EHXA 5HYFA 4QEGA 5DD0L 3UBXA 4ZPTB 1CGWA 1URLA 4XPGH 5DQ9A 5DC4B 3ZE1F 1EGJL 5E8EB 2D7OA 1T4KB 3OB0K 2ZCHL 4U3XA 3BP7B 4S1QL 2HJFA 2J88L 3FOLA 2VZOA 3AY4A 4EJ1C 1AGCB 3NMEA 4PJIF 3O6ML 4JPWH 3I50H 2CRMA 2R15A 5TE7H 1LK2A 3JV4A 4JKMA 1FYTE 2PW2B 5JNYA 5E08L 3VMOA 4MJIA 4PP1D 3BEVA 1ITCA 3PP3H 2JB5L 1OF2A 2R2CA 3QUKB 4PJ8A 1JZ6A 3O4LE 5FA3A 1D5BB 1J12A 4RX4D 5A2FA 2DB8A 3ULUF 5ANMB 3R0MA 1FJ1B 4Y8DC 1LILA 2P7TB 3DURA 4NO5B 4YH6A 4V1DB 3OKDB 3FAXA 1CF8H 4M1GH 4ZNEE 3DX8A 4LSTH 5DHVB 2JELL 4H0HB 4JLRB 1IM3B 2W0LA 1N64L 3D5OF 5T3XE 4CW1A 4PB9H 1O0VA 1I1AD 3LKPA 3TCLB 3VRIB 4NWTH 4UT6L 4Y16A 5I19H 2ZPKH 1DZBA 4APQD 2YEZB 2WW8A 5F7YC 2E7MA 3FB6B 3NTCL 4ZOBA 2AXJA 5I8OH 3C8DA 1N3NA 4P4KD 1R3JB 4N0FB 5I18L 3BWAA 4L1HA 4F7PA 5C0NC 2NXYD 1IE5A 4YE4L 3UJIL 2LAGB 1G0DA 3CX2A 1IILE 1A1NB 1MLBA 4GRWH 3SKNA 32C2B 3F6LA 2DQHL 4OZHB 1QLEL 5E7BA 4TUJA 3U1SL 1UM5H 5E2TH 1HN1A 3G5YA 4OLUH 4HWBA 3AY4C 1AXTH 5FEBA 1FN4A 2CDGB 5KVMC 2FO4A 4G6KL 2J2ZA 3MRDA 2I07B 1J1XH 3AMLA 3VCLA 4KJQC 2DKUA 5FGCB 2BSRB 2IH3A 1WC7A 5B4MC 3MRNA 2X4TA 2BDNL 2JCCE 1QLFA 5BV7B 3VRJB 1RUML 1LEKA 3DO7B 1KTLA 1F3JB 4IM8A 5BVPH 2MHAB 5B38B 4MNQA 4QGYA 3QDJB 5HHPB 4U1MA 4WV1B 3MLUL 3T4YA 3DVIA 3HR6A 4YHOH 2J6EH 3QDAA 4XXDA 4MAUH 1H3WM 2DI8A 2VLKE 4M48L 4X80H 4XNQB 3UYRL 3G04A 1HSAB 1IGCL 2OBGA 4Y16C 2NR6D 4OCWL 3QA3B 3V4UL 1XGQA 2VLJA 1CD1A 3PL6A 2OTUB 5CBAA 1KIPB 4G43B 1T83A 2R0ZH 3BPNB 4JRYA 1E28B 3FT4B 3MBXL 4ERSH 4LCYA 4PJEF 4OIIL 4XP5H 1Q1JL 4K7PH 1IL1A 4KUZH 3HI6L 3HAEB 4CNIB 2FZ3B 2PTVA 4KROB 4E42B 2MJWA 3PWLB 1FZOA 5JHLH 4W6WB 5D7LB 2O5ZL 2XPGA 3ZSSA 3MOAL 1MRFH 4PD4J 4NGHL 1Q94A 3HG1D 4R26H 5E5UB 4YHYC 4B7LA 3RZCB 1DBML 4LCWE 2WP3O 3QEGL 3QIWA 4FQQA 3BVNA 3TPKA 3OHXB 2MCPH 3V8OA 3FONB 3SOBH 4LLDA 4PRPD 3ARUA 3UJTL 5EC2B 4D0CA 4OCMC 4KKLD 3L9RB 1N7MH 1MFBH 5EOTB 5FDYA 3REVA 1GOHA 2OSLB 2UWEB 5L88H 2EIDA 3WL9A 1IAII 4XAKE 4NQVA 35C8H 1KCUH 3GIZH 1MH5B 3BJLA 3BT2L 5IBUB 3F62A 4XBGB 1FZJB 1GGBH 3FHAA 4I13B 15C8H 5DR5H 3UX9B 1ZHKB 2VLRE 2BVOA 4BUHA 5E6YA 4TVPH 2HKFL 5FB8B 1R0AL 1JF1B 4NZUH 2EDYA 5IJVA 1U6AH 3GSVA 3L3JA 4RRPA 1Q72L 2AK4A 3E6HB 4TSBH 1BQUA 5IBLC 5EO0B 4M1CC 2Q7NA 2NY3C 3PL6C 3S4SA 2XOTA 4ZQKA 2OP4L 4HAGA 1G6VK 4H0GA 3VFNA 1T83C 1FNGA 2W0FA 2P5WD 3T65A 1OARL 5I6XB 1G7QA 2WMPA 2A0LC 2DIBA 4KK9C 4OF0A 1EO5A 3QEUA 5I8EA 2XYCA 1M6OA 2MKLC 4DGIL 4AL8L 5I1EL 2IAMC 3K0WA 4WWID 2X5PA 4NQCE 1BBJB 3RL1B 1MHCB 4AENB 3QO0A 1EO8L 4FZ8L 2Z8SA 3QIWC 4GMSL 3RIFK 3LMJL 3QXAB 1JGEA 3QXUA 3U9UA 4H20H 4BQBA 1Y0LA 2F19L 3OF6D 4J3TA 5JW5B 3V79C 3CLEL 4P0DA 4XB8A 1I4FB 4S1DD 2AKRB 2P49B 5EA0H 3ZL4H 3AB0C 5AAWA 3QWOA 3HPLA 43C9A 1R5VB 3ARBB 3WHXB 5D7KE 1ADQA 4LCUA 4MJ2A 2AJYH 2CLRB 5L9DH 1MRDH 5BOZG 3BN9C 5BO1L 2WV3A 3LPFA 3OKLA 2D0GA 3OKNA 2F5AL 1OD9A 4HJ0C 3ZT5A 3NCJH 1T1WA 5EBLA 2QQQA 1J0HA 1RK0B 3UBXG 3CIQA 3GSNA 3TJHC 4K3HA 5K93A 3KPMB 3EFDL 3QNZA 4TUKL 3AAZB 5FA4A 2A1WL 4O5LL 2A38A 4F7TA 4YBLB 2DD8H 2HVJB 1M71B 1QTYT 1H3PL 3HZVB 3SE9H 3ARXA 4Z7VE 4N0UA 3QUXD 4NKQB 3OZ9H 2YD8A 3IGAA 5IBTH 4MNGB 1EHLH 1QFWH 1HINL 2XFXA 3S36X 1BQLL 1BVKB 3DRQB 4NM8L 4LIQH 5MEOA 3UPAA 4IMLA 4NJAH 2W65A 4JFYB 1VFAB 1ACYH 3VXMD 3D85A 4M7JL 1QLRB 1YN6B 4GUPB 3VXNB 4K7FB 4X6EA 3V6ZA 2VERN 5JHDA 4DVBA 2HT2D 3DXAE 2R1YB 1GIGH 2DM7A 4RX4A 3FQTA 5EBGA 1FG2A 2CIIB 4XPBH 3VFOB 3L5HA 3G5VB 2X1QA 4O02H 3PQYA 3KJ6H 4ODUA 4YK4B 1DQML 3P77B 4NKMA 4XNMB 3FQUA 2I60L 3I6LE 4O51A 1BD2D 4LGSB 3EDDA 5D72L 5E2JA 3AXLB 4Z6AT 4G3YH 4HH9A 1I1AA 3MRIA 4HXAL 3VW3L 3H2WA 4HH8A 1MF2L 2IQAB 2X4QA 4HC1H 1BBDL 5ERWA 3QRGL 4NRYA 3LQAH 1R3IL 5CHNA 2XTLA 3V8CA 5IR1A 5I1JL 4QYOB 2DIJA 2EDJA 3HZMA 3CVHB 1BAFH 1MI5A 4YXLH 1HXYB 4NPYA 4MAYB 1YC8A 4HPYL 4MZ2A 3H9HA 5IMOA 1U9KA 5JW4R 1OAZL 5IFJA 4LCCB 4YZFE 1XF2B 5F88B 1NFDE 2F54E 3I2CH 3ECBA 3O2DA 3GHEH 5E5MB 1FNSH 2W9DH 1P4BH 4XZUB 1D5MA 3GJFB 2FIKB 2JCCF 3MGAA 2DQTL 2BNQB 2HA1A 3EZJB 2UZIL 1D7FA 2R1WA 1WFTA 3Q6GH 1EVUA 4BUGA 3DVFA 4GBXD 4NKIL 1HNGA 3VD9A 2VWEC 1EJOL 3QNYB 3NIFF 2E8YA 2ATPB 1FYTD 1J5OH 1F4XL 5F3HA 5HHVL 1U8MA 5A40E 1SYVA 1QYGL 4LCIL 3PDGA 1SY6L 3VE0A 4GXVL 3O4LD 5DMJB 4PP1C 5HVGB 5EU6E 1LEIB 1JWUB 4U1IA 5DEFB 2VDLL 2BSTB 2RIKA 1W72B 4PJIA 1BQHG 1T5WB 1CGXA 1DQJB 2VISB 2J8HA 2JJTC 3RL2B 4BSJA 4OM0H 3B9VA 2C1PA 4HXBL 3V6FB 1A6PA 2JKXA 4JAMA 1K2DA 5AD0B 2X1PA 2H6PB 3D1MC 5LG1A 3V4VL 1I1AC 4EVNA 5IW1A 4S1SL 5C0RL 3OGCB 2C3WA 4N1CA 3OB0H 2ZCHH 4PTUB 5DTFA 1RVFL 2FR4B 5KW9L 1I1FA 3W2DH 4S1QH 2J88H 5HJ3B 3NGBB 3KDMA 5JOFB 1WGOA 1TETL 3RU8L 4BA8A 3VD7A 1HKFA 2A9ML 3O6MH 1NLBL 3I6KA 3KPRE 2NXYC 4LSQL 2PYFA 3WJLA 1T03L 1KACB 1TQBB 2EEAA 1HDMB 5E08H 3BDYL 4G6JL 4HIIA 5EPMA 5DJCB 3FO9B 1KLUB 2JB5H 3FO0L 3HG1A 1AGDB 4PJ7B 1CQYA 4XCYB 2BOCA 5J06A 2NLJB 3WS6A 4HGWB 1AQKL 3PWNB 2XWJA 2AI0H 4S1RL 4D9RE 3UTQA 4HUKB 4PRPA 3N0PB 5ISZD 3T4AA 2OR7A 3H3BC 1VFBA 2NXZB 1QR4A 3IFLL 5IKCB 2RHEA 3PV7A 5F6IB 5SWZA 1YN7B 2C4FT 3RGVB 1NCWL 1PG7L 4OD3L 4UT6H 3V0VA 2G2RB 2DF3A 4NNPL 1I3VA 1H3VA 4GQPH 4PJGE 1S7XA 5CD3A 1K4DB 2BXZA 3CFBA 4GKSB 1MWAA 5D2NA 2AV1A 1AD0B 5DRNA 5I18H 2VDML 5EN2B 2W60B 1MHPH 2V7NB 3UJIH 3ULUC 2VITA 2OZ4L 3CK0L 2F53E 4MDJB 2DQHH 3JVGA 4IOSD 4RRPG 1CQKA 4QRPB 2ICEA 1QLEH 3LPWA 2YPLD 1NAKL 2P1YA 3U1SH 2AQ1A 1NDGA 3FFCD 3J7HA 3BEWA 2XN9D 2P5WA 3LEXB 3SGJC 4G6KH 1AY1L 4X0KB 4QGTA 4G9FA 1FDLL 1T7VA 1M7IB 5D70H 3WJLC 1TFHA 3QUMB 2UVFA 3KYOA 3B3IB 2FH8A 4NQXB 1A6WL 4CVZB 4DW2H 5FGCE 1RUMH 3L3KB 3ZYOA 4O9HL 1T7ZA 5DA4A 4CL7A 4ZPVB 3GM8A 3WS6C 1FAIL 3TWCH 1F90L 3MLUH 3BH9B 2EO1A 5KG9B 3CFJA 3MYJB 3CCHB 3OF6A 1G7HA 1T6VN 4KKLC 4M48H 5TH2B 3ILPA 4I2XE 4JKWA 3TT1L 1H9VA 1G9EA 4ODXA 1RHHA 4Q0XL 2RR3A 3UTTD 1JNLL 3IAPA 5GS1B 4OCWH 25C8H 4JO1H 5K9KB 2H32A 4MQ7A 3V4UH 4YLQT 3HI1B 3WD5L 4XMPL 5HHNA 5A3ID 5IHUH 3L6FA 1JTOA 5D2NC 2VLRD 3P9LA 3TO2A 3WFCL 4BFIA 4Z7VF 2X4PB 4X98B 5J9PA 5T3ZE 3MBXH 4OIIH 5GRWA 1Q1JH 4KDVA 3HHRB 3HI6H 3MLVL 5F7UA 2WZPD 1KPRA 1IGJA 3EDFA 4OCXL 1PKOA 4OF3A 3JVGC 4DUXA 3UBXI 2GQHA 3ZMRA 4NGHH 5FYJE 1JGDB 3EO9L 3PWUA 5CP7B 1ORSB 1DBMH 4J3UA 5D7LE 1ZVSA 4GRMA 3QEGH 2RGSA 3ZDXF 3LN5A 2BVYA 1MCWW 5ILTL 3DYPA 3QUXA 4RMVA 5CILL 4CVWA 4JFOB 4MD0A 2D7PA 1RZKC 2E6JA 1WICA 4QT5B 5GGTL 3FO1B 4NN7B 3UJTH 3UTSE 4LLQA 2CR3A 4MJ6B 3MLXL 1DCLA 3PDDA 4L8CA 4P57B 5E99L 1D6EB 1NL0L 2WQRA 4Y19D 4UIMA 2ZSVA 2HKHL 1KCSH 5HDQL 5JDSA 2BVEA 2NCMA 1RIVL 1D6VL 4L8DA 2UWEE 4PJAB 1KGCE 2CUMA 4P3DA 1DL7L 1JPST 1RI8A 1BD2A 2HKFH 3MJ8B 3LKOB 4JFHE 1CL7L 4KTDL 4Y0GA 4GMTL 3KVQA 4NYLA 2XTJC 1Q72H 1GPOH 4YZFF 4R3SB 2GHWB 1NFDF 5I8CB 1UCBL 4X6DB 3LEYL 3WEXB 8FABA 1P53A 1CN4A 2OP4H 1ETZB 4U1HB 2Z93B 4PJCF 1OARH 4Z7QE 1ZT1A 4QXTA 3DUSB 3DLQR 1OM3H 4KZDL 1SVCP 3PHQA 5IROC 1FGVL 2DWDB 3TNMB 3VFWB 4PG2A 3BZFA 4DGIH 4AL8H 5I1EH 1PBYA 1YDPA 1RMFL 5MENB 3DUHA 4U2ZA 3AS2A 1G1YA 5L8KB 3ELAT 4XC1L 3LZFL 3ROOA 1Z3GL 2ID5A 5EZIH 1DSFL 4FZ8H 5GGUB 5DMKB 2CD0A 4NNXA 4GMSH 3MJ9L 3LMJH 4HSQA 3MLYH 2CDFB 3QUXC 1HZHL 4OGAC 4XMLH 3VU2A 3U82B 2F19H 2Y06L 5IQ7H 3RKDD 1FYTA 3CLEH 3CDGB 4L5FL 4U0RC 3K1KC 5D93B 3RNQA 5AEAA 3O4LA 4E41D 2VO5A 5LWYL 1LP9B 2UY7A 5I1DA 5D5MB 3O9WD 1MHHB 5FK9A 4YX2L 2A2QT 1XIWD 4NHCL 2BSSB 2YC1A 3RTQB 4O58L 4ZNEA 1J0JA 4PJHB 2F5AH 4N8VB 1KIQB 3MRJB 1CFTB 4FP8H 3RPKA 4XVTH 4BH7A 4ODHL 5DQJA 4YAQA 4KK6D 1J0IA 3ALXA 4HHAA 3WV0A 1VHPA 3EFDH 4TUKH 4MX7B 3KLSA 4O5LH 2FEEL 3ESUF 3S37L 4BKLB 2R23A 1H3PH 5T1MB 3PGDA 5EORL 1M7DA 4EUPG 4LSUL 4ONFL 2X4OB 4ZD3H 1J88A 3MR9B 2EIZB 5F1KC 2R69L 2F8XC 1HINH 2BVQA 5TQ0L 5B8CB 4PG2C 1BQLH 1HHKB 4YHKL 5JPMA 4NM8H 1T7WA 3KYNA 4EZMA 3RI5K 2PTUA 4JHBA 1RZIA 3RKPA 1CT8B 4M7JH 3LS5H 5ETUB 5K9OA 4L3CB 5ITBH 3UTPD 3G5ZA 4Y5XB 2N4IA 2Z8VC 3Q0HA 4WW1A 1N26A 1A3QA 2B5IB 4P2OD 2BMKB 3JTTA 3RDTD 1C08B 2LVCA 3EYOB 4PJGF 3JUZA 1DQMH 5JZ7D 5ID1B 1HK6A 2I60H 2FYYB 1DN0B 1FFOB 4R97C 2JCCA 1I1YA 3KPOA 2EE9A 5HDLA 4EI6B 3ULUL 4I0CC 5D72H 2ADGB 2NTSP 4GW4A 2FB4L 1I9JH 3VW3H 2PR4H 3SKUD 4WO4B 4L8BA 1MF2H 4Y2DA 3UAJC 5CIPA 1FFNA 3QRGH 4CMMB 2BHUA 3W5NA 4M61B 5CD5C 2J8UE 5J1AA 5GJSL 5I1JH 5HVHB 1W0WB 1A0QH 2DWEA 5IHLB 3LD8B 5KN5A 4ELMB 2VDNH 4ISVA 4WI2A 1NC4D 1CGYA 2H1PH 4P9HH 1H8SA 2DQTH 3OPZL 3QEQE 1I7TB 4QO1A 2YPLA 5IB3B 4WFHD 3D69A 3DVNB 5FYLD 4DN3L 3KPRD 2QSCL 2NW2A 4NKIH 1KIRB 1EJOH 1DE4B 3HC4L 5IQ9B 5AUMB 1NBYA 3UPRB 3H7BB 2IGFL 3CSBA 4V2CB 5IHZB 5IW6B 1EZVY 1QYGH 1SY6H 4GXVH 4NM4L 3MV8D 1NC2B 3O41A 1UXWB 1T1XB 1YEFL 5FYLH 4LCWA 3F12A 1ZTXH 3PXJA 3KLHD 2VDLH 5CZVH 1X5GA 1I1CA 5CZXD 4OKDA 3H7LA 3IRPX 3O6FB 4I3RL 3TO4B 1AGEA 3FQRA 3GBML 4G6FB 4X99B 2V6HA 1WFOA 3HB3D 4JVUA 5CJOL 1R3KA 4HKBA 1U8OB 4X7SL 3V4VH 5GRVK 5GRVL 4S1SH 4Y2DC 5INCB 4F8TA 1BGXL 3BXNB 5H2BA 1DTUA 1KENL 1RURL 1RVFH 1DDHB 5KW9H 4J3OC 1CFNB 1TETH 2VLRA 3RU8H 4EOWH 1RZKL 3VXRE 2A9MH 3VXOA 1NLBH 3MBEB 2F53D 3RBGA 4DGVL 1S78D 3FB5A 4XAWL 3CU7A 4F7CB 5C6TH 4G6JH 1IGYB 1U3HA 2VNCA 1ZANH 2IANB 5LBSL 3FO0H 4L4TD 3V6OE 4LVOC 4ZFOL 1RJLA 1CL7I 2F9BT 4TULL 1LK3L 1OGTB 2UWEF 1ZGLP 1JI1A 3KPTA 4S1RH 3SO3C 1SYSA 3QUYA 1NSNL 4FFWC 4NQCA 3B8YA 2X4RB 3IXAA 3KPSB 1QVOB 4I18A 2Y36L 3X13B 4Y19A 4JJHA 5BVJA 1NCWH 1PG7H 4OD3H 5HYSB 2PYEB 1QSEE 4X4ME 3W9DB 4R0LB 5IB1A 4NNPH 4PR5A 1BHGA 5F7HA 2VJXA 3CNKA 3HLAA 1UG9A 1BVLA 4Z7QF 2VDMH 4HK0A 5DFVD 2BC4B 2D03L 1U58A 3PNWA 4XI5C 4XCCL 2HYMA 2XWBA 2VAAB 5DFTA 1CLZL 2FIRT 4DK3A 2OZ4H 2CK0L 3CK0H 1I7RA 4Z0XB 4GS7C 3V7MA 5AZEL 1KTRL 2X70B 1ODAA 4ZTPH 5I1AA 2EDWA 1NAKH 1NMCC 5A3IC 2BVPA 5C0IB 5T3ZD 3ARSA 4UDTA 4LSPH 4A6YL 3B9KB 4OCNC 4QRRB 2P24A 2QQLL 3MV7B 4XPFL 4GRLA 1FDLH 3O4OC 1H0DB 2CKBA 1YEEL 3PIQB 5GISL 1ZGLA 4KROD 4RFEB 3GMRA 1C16B 5D7LD 3L5IA 1U3HC 1Q9LB 3GI8H 4Z7VA 4IS6A 1PX4A 2DQEL 4O9HH 2OCFD 5CINL 1MLCA 3CX5J 3IKCB 1FAIH 5EBWA 2HG5B 3UTSD 4DGYH 5DRZA 3F7PC 5C8JA 2FEEI 3QUYC 4NZRL 1X4XA 1T1YA 3DECA 4Z7UF 1BOGA 1FFPA 2AAVA 2EE3A 5E94B 1ZHNB 4I18C 1XCTB 1UGNA 3SDCD 5DFWH 5LJYH 3FTGA 5C0FB 4R4FL 1A7NH 3O9WA 4FQCL 3GGWA 2C3GA 3EYVB 4UV7L 4XMPH 5HGAA 3RWFB 3WD5H 1XIWA 1XGPA 2NTFA 2Z9TA 4AM0A 4QOKD 4WU7A 5DT1H 1D5ZB 1IKFL 2ZNXA 3WFCH 4K2UL 4MA1B 1RIUL 3UO1L 4UT7L 1HSBB 3S36L 4PV8A 1CDGA 2HLAB 3LQMA 2FEDD 3N50A 2J4WL 4OUOA 1Y18A 4KWUA 4R7DB 4YUEL 3EBAA 3EO9H 3ROLB 3BHBB 4EKXA 2LQRA 5ILTH 1MIEL 2V5SA 3PHOA 4JZJB 4GRLC 3FT2B 1V3JA 4RDQG 5GGTH 1T5XA 2QQKL 4B50A 5IK3B 1NFDA 1ZEAL 3MLXH 2F54A 3VXTA 4MA7L 2GY7B 1QEWB 3LSOA 2Q6WA 5E99H 4G6MH 4GG6E 9CGTA 3GSXA 3HFML 1NL0H 1CDIA 3CUPB 5GS2H 1WIPA 4RA0C 4PJCA 3OKEA 5IVOA 1RIVH 1D6VH 4P2OA 3TBTA 3RDTA 1KJ2B 3NPSB 4JB9H 3QJFB 5E2UL 5I73C 4PJAE 1MCNA 5T3XL 2J8UF 1FSKB 3SDAD 3OR6A 3RHWK 1PGRB 3L3GB 3P4NA 5DEGB 4Y7MA 1LE5A 1CL7H 4KTDH 4F15C 4GMTH 4IRZL 3BYTA 4AY0A 3O9WC 3JV0A 1NGZA 5DQDL 3O3EB 5DC9B 1UCBH 2LVEA 4OUUB 3TIDB 1XIWC 4LP5A 3QXWA 4L9LB 4ZUTA 5HPMA 1A7PL 1G6RA 4WI3A 3ZKMD 3U0PB 3T08A 1FGVH 3KYMA 3T8XB 2IFFL 3LQZB 4X8XA 4KK6C 1ZK9A 4JFXA 5I16A 1RMFH 4LQ1A 4FQHB 4EXPX 1HILB 5E4EC 1NC4A 4H1LB 4JREC 4YDLC 5MENE 4XC1H 1W0YT 4TOYL 2F74A 2OJZL 4NQSA 1DSFH 5F96L 1WBZB 3GRWA 3MJ9H 4FQIL 1TZIB 2PXYD 1HZHH 2H26B 2D9CA 3BZDA 4PY8I 1AGCA 2VTFA 3KPRA 1U92B 1BZ7B 2Y06H 3IDNB 2YK1H 4RMRA 5CCKL 2Q7YB 5E4IA 1JN6B 1KJ3L 4L5FH 2PW2A 1SEBB 5L8JB 3G9AB 1SMOA 4K3DL 1K3IA 5LWYH 4K3GA 1B6DA 4YX2H 2OJEB 4MLIA 4P2OC 5EUOE 1LP9E 3RDTC 1T0MB 1UA6H 4NHCH 5DJ0B 1QFPA 4O58H 1R3HA 1WWWX 4NO5A 2VL5B 5JZ7C 2I9TB 3BISA 4LVEA 3OJVC 3UDWA 4J12A 4PJHE 1IM3A 3I3BA 3HTLX 4CMHC 3P4MB 2XWTB 3VRIA 4PJGA 3D25A 4U3HA 4F7MA 1I9IL 2IMMA 2ADFH 5E56A 1CICB 1XGTB 1BQSA 3X3GL 3S37H 4GW1A 1QPPA 4M1DL 4AZ8A 2PO6B 2JF1A 3FB6A 4ONFH 4X7TB 3X14A 1KXVC 4YHKH 1GOFA 4FTVE 5E8PB 2QHRL 4KRPB 5SV4A 4JM2F 3SDXB 1J0ZA 4OZGB 2F53A 3QEQD 2NY0B 5JIHA 2IQ9L 4HDIA 4RZCB 3QPXL 1BFTA 2C3VB 1JYNA 4L4TA 2AVGA 1MCQA 5LAXA 3KJ4B 2PNDA 5SWQB 3VWJD 2LABA 4DZBB 1NLDL 2I07A 4OIBA 5HYQB 1NPUA 2BSRA 2DM3A 4JFFD 4U6YA 1G7LB 3ZZ1A 2VUYA 3SY0B 2FB4H 2O61B 3VRJA 4KHXH 5GZOD 4NC1E 3KLHC 2A9NL 1OTTC 4L8SB 1GVIA 4EUPH 1F3JA 1RQ5A 2MHAA 5B38A 3QZWA 5CZXC 1HHHB 3EOYG 5GJSH 3IS0X 4P5TB 4WV1A 3U46B 2NYYD 1NDMA 1KLGB 1FRGL 3UDWC 1U8PB 1OAYL 5DI8B 3HB3C 4I2XA 1JZ4A 4HMCA 5HPOA 1QRKA 5HYIA 2GTWB 4YHNA 2CLZA 4Q2ZA 2OTWB 1HSAA 1BLNB 3QT2A 4P2QB 2D31B 3M17B 1PJ9A 1T2QL 3OPZH 2IC2A 2X89D 4R4BB 3T2NL 4IRSB 3VXRD 1PEZA 2YD6A 2UYLA 3W11D 1QSFB 1UEMA 4DN3H 1P7KB 2QSCH 3OAYK 1UXSA 1A6VH 4JJ5A 3FT4A 4MLSA 2IGFH 1I8KB 4NZDA 3BAEL 2NPLX 4FNLL 2DJSA 4NM4H 4E42A 4JZNA 3PWLA 5D7LA 3EO0B 2P46B 3OKYA 3RZCA 1B0GB 1GGCH 3VXQB 4HPOL 3ZYJA 4JM2D 5SWSD 3HRZB 2JK5B 3UTSA 2H3NB 2GJJA 3C5JB 1WV7T 5EC2A 5CJOH 1XFPA 3L9RA 3SCMD 2VN7A 1OAUL 4X7SH 1QSED 5KVDL 2CDEA 1YEHH 2QKIA 4LQFL 3WFHA 3FO2A 5BV7C 2E7CA 2UWEA 1F58L 3FZUD 5FYKE 1K8DA 1BGXH 3TA3D 1KENH 3F6IA 2O26U 2VR5A 1CZ8L 5IB4A 1A6AA 3QIBB 4P5MA 2YD2A 4WV1C 3L3IA 1FORH 2Q87A 5FKAB 5I2IB 3CPLB 1RZKH 4OFYD 1ND0A 3IDMA 2HJLB 1FZJA 5DFVC 4OT1L 1KULA 1ZHKA 1ZS8B 3C60D 3WKNA 4JGMA 5GS0D 3PXHA 1HOCA 4P23D 4XAWH 3SGDI 3IVKB 1HH6B 4GG6F 3KPQB 5LBSH 5TFSH 4FQJL 3L3OA 4I77L 4PJ9B 8CGTA 4F3FB 2QL1A 5GS0H 2IANE 2AW2A 3V0AC 5C7XL 2CUHA 4M6NL 4NCDA 3BGMB 3FFDB 5LKNA 4PJAF 1U91B 4LLUA 5B39G 5C92A 1NSNH 4H5SA 1X4ZA 3IRZA 4XHQA 3P2TA 1MFEL 3LEVL 4KROC 2Y36H 4D9QE 1I8MB 4FN0A 4XTRD 1BBJA 3MFGB 1TPXB 4ZS6C 3RZCC 5FO9B 3RRQA 3S34H 2EXWD 3DROA 3QXAA 3NVQA 4MMXC 4MS8D 5HI3D 4WEUD 5F1SA 3MCLH 4Y4HD 4YFLI 2D03H 5JW5A 1FVEB 4Y5YB 5FECA 1D5IL 1T66D 4XCCH 1I4FA 1CLZH 2AKRA 2YA1A 4C55A 5FV1L 3WFEH 1DANT 1CGSL 2CH8A 5AZEH 5EU4B 4G6AC 4WU5A 4LLMA 3G6JB 4Z7UA 4A6YH 3OJDB 2AABH 3G6DL 3C8KB 4HMEA 4XPFH 4KKCD 2Q3AA 3O8XD