5L9DL

Afamin antibody fragment, n14 fab, l1- glycosylated, crystal form i, parsimonious model
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
214
structure length
214
Chain Sequence
b'IVLTQTPAIMSASLGERVTMTCTANSSVSSNYFHWYQQKPGSSPKLWIYSTSNLASGVPTRFSGSGSGTSYSLTLSSMEAEDAATYYCHQYHRSPPTFGSGTKLKMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOUSE ANTIBODY FAB FRAGMENT, IGG1-KAPPA HEAVY CHAIN
publication title The N14 anti-afamin antibody Fab: a rare VL1 CDR glycosylation, crystallographic re-sequencing, molecular plasticity and conservative versus enthusiastic modelling.
pubmed doi rcsb
molecule tags Immune system
total genus 57
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2016-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l9dL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l9dL01
4J8RA 1CR9H 3G6DL 4S11A 5FA4B 4LU5H 1EVUA 4OIIH 3AMKA 5EC2A 3VXRA 1L7TH 2NTSP 3B9VA 2VAAA 1MIEL 5DSCB 5IKCA 4XC3L 3BW9B 1T1WB 4H26A 5DEFB 4LSVH 4P4RB 5T3ZL 3T8XB 5L8LB 1A6ZA 4YDIH 4UQ3A 5IFHL 2KQNA 3OAUL 3Q6FB 2ESVB 4PJGF 2E6PA 1X5FA 1IKFL 4EDXA 2CLRA 1WAAA 3N1PC 2HJKB 3G5YB 1P5VA 5DEGB 5EIVA 4W6YB 3EZ8A 4W6XB 2VLME 3VI3E 1RIVL 4HQQH 1MI5E 4U6XA 5I1AA 2FB4L 2W07A 2OP4L 4HSQA 5BRZB 2PNDA 1OGTB 4LPCA 3TA3C 1S5HB 3ARED 3GJFH 1YMMA 3RJQB 3ZE0F 1A47A 4G80A 1A7PL 1MH5A 4OLZL 3KLHD 2HMIC 4YDLB 1MCWW 3DVNA 5FHBL 4MJ4A 3O45B 4LLYA 3VI4F 1WWCA 2UUDK 4IDJL 4LHQB 1K4DB 3QIUC 1VCAA 2YMXL 5EOCL 3TO2B 1KN2H 3I3DA 2BVYA 2AK4B 2IANA 1F8TL 2DM4A 1RV6X 3O0RL 3Q6GL 2I27N 1N8ZA 4MA7H 2D2OA 3VFNB 4W68A 4G7VH 4FQXD 1DN0A 4X99A 3E3QE 3EO0B 1QUNA 3QDHA 4DOHE 2V17L 3SGKC 4JB9L 5FYLE 4HX1A 5CGYC 3OXRA 4HFWB 4K23H 4M7LL 3RWDB 3DGGB 4OM0H 1FSKB 4LSUL 3QIWA 4NO5A 4UUJB 2NNAA 3BIKA 4H1LG 3ARGB 2E9JA 3OJ2C 3UJTH 5T33L 3PGFH 3BSZH 1S9YA 3ULVF 3ARSA 1NGPH 2NXYD 3WFHA 4JKPL 5CJ8A 1YN7B 3U30B 1AC0A 1F4YL 1H5BA 3ZKMC 4X9IA 1J18A 4OI7A 3KPNB 2XIDA 4EQ2A 4U2ZA 2HTLD 3HKFA 3N1QC 1SEQL 1NCAH 4LNRB 2FDBP 4LEOB 1BBDL 3MFGB 3QJFB 3BKJL 1MCKA 3TNNB 4F8QA 1KACB 3MRMB 3STZA 2OZ4L 5JW4M 1ADQH 3KJ4B 4IRSB 3U9UA 1MWAA 3FZUD 1MFAH 4MWFA 5E2UL 3WHXA 5CKGA 4Y88A 2GTWA 5K59E 1KCRH 4JREC 3DRQB 3P4NB 4JKMA 4G6FD 2HFGH 1MSPA 3NZHH 1KT2B 2JLLA 1F58L 5D93C 3QCTL 4N9GA 1MAMH 1NAKH 4PTTA 4PRHB 4QT5A 4N8VB 1UJ3A 4MXWL 1TCMA 3L3OA 4PJ7E 2VDKH 1NAMB 3DX9B 1RZJL 3MJ9L 1KIPB 3I2CL 1MJ7L 3FB8A 3FO1A 4HF5H 4QHKI 1PAMA 1BQHB 3PL6D 5CD3B 1VSCA 4S0SD 2F74B 3QHTC 2BNRB 1WK0A 3AXLB 4CVUA 3DVIA 3CAFA 1P4LB 3CLEH 1JHLH 3QXAB 1HDMA 1HE7A 4PG2C 3HE6B 1LO2L 1OAYH 3QXUA 4POZD 1IGTB 3L7FB 4UU9A 4ZXBC 3FFCE 5KSVB 3GIVA 3GSUB 4QKXB 2E6JA 3QUYB 3QEUA 2Z31A 1KGCE 3TH3T 3EJYD 2JJUA 4U4BA 2XPGB 1MCPH 2AV7B 1EJOH 1BHGA 4JPKL 3CZFA 3SGJC 2CKBH 2R4RH 4DGYH 2YD9A 2CKNA 5ILTH 3EYUL 3T1FA 1FNGA 3EW3B 3OKKA 4ZSOE 3L1OL 4WWKD 2X10A 2NY1B 4LLVB 3ZYOA 1AO7E 2WANA 3O81A 1U8HB 4JFFE 3VFSA 5J6GB 3BPLC 1DLFL 3S96A 5KVDH 3L95B 4MMZC 3ME0A 4N68A 5T1KD 4L1DA 1JHTB 4M1CD 1OT2A 5DD6B 1KTDB 4Y16C 3FN9A 4OCWL 1S9XB 1FVCB 1ES0A 3MA7B 5JW5A 2VLRE 1Q72H 4XP1H 3TGXA 5CEZD 2QKIB 1BJ8A 5JQ6H 4LGRB 1NFDF 5FEBA 3WO4C 1ZA3B 3A67H 3VWJD 4F15C 3LHPL 1G6RL 1T1XA 4OCXH 1GYAA 5LGJA 2YXMA 1I1AD 4PGBB 5BV7B 2D31B 3MROB 3W9DB 4PJGA 2XA3A 5C0CE 4ZUTB 5C7XL 4JFOA 3NMEA 3QPQD 3BUTA 5E95B 1A0QL 5F7UA 1UA6H 3LKSA 2EDXA 3D85A 3OV6A 3RWFA 3PDDA 2YPVH 2NY2D 4ELMF 4NQVB 1A7QL 3QO1B 1MRFH 3K4DA 3KNBA 2HFFB 3GSNA 4NC0B 3F8UB 4HWBL 4YK4B 4LCCC 4CVWA 3ISWA 4HAFA 2MFNA 4HWUA 5CD5C 3MRNA 1RVFL 1MCHA 4NM4H 4E42B 5I1CL 3CSYA 1QSEA 4CU8A 4X6EA 5F70A 5ID0A 3WUZA 5IB5A 3WLWC 2Y5TB 1R3HB 3CSGA 3LQZA 4G43A 3PWLB 3UTPD 3T0AA 1L7IH 1S7QA 5HHOE 1DP0A 2VERN 3TO4C 3MRJB 2CH8A 4Z8FL 1NBYB 4DKFL 5D7LB 1JNNL 2WW8A 3O6ML 4QRRE 3ZYJA 5CKAA 1UJTA 3BRFA 3IFLL 2YEZA 1P7QA 5JTWA 3KYNB 2WP3T 3KYOB 5E8NB 4ZDHA 3UBXA 4CVXA 2HLFD 4MAUH 4EUPA 4I4WB 3ARXA 3FOLB 2Y23A 3MV9D 2J8HA 2DM3A 2R0WL 3DSFH 4MQTB 4ESKA 3W11C 1RMFH 4PJBF 2DD8L 5FGBA 3NCEB 1MJUL 4D9LL 1TIUA 2Z92B 4NWUL 4WO4B 1TJGL 4AJ0A 3FMGH 8FABA 4YXKH 2BDNL 4Q2ZB 4LCWA 3QCUL 4N0FB 5HDBF 1R5IA 2X4RB 1OTSC 4NC1E 2E27L 4NUJB 4XAWL 2Y07L 4JM2C 4MS8C 3BGMB 3BQUD 4NUGL 1I1RA 3TYFB 1XF3A 3WFDL 1YMHA 1ZHKA 2I5YL 1H15B 3MOAL 3LEVH 4KMLB 1NCUA 3GI9L 2H32B 2VQTA 4RAUB 1NC4B 1MHCB 1FFQA 4X8JA 5JO5A 1DBAL 2X4UA 4FMFA 1DVFC 3ROOB 1WFNA 1MCOL 4WV1C 1FNAA 2CIIA 1SEBA 2QTEA 2NXZB 2HWZH 3M45A 4L29B 4PRIA 4Y4HC 1T1YA 5I75B 4IMLB 4HKBB 3LSOB 5I16B 2EDKA 1T6VN 2DQGL 3MLYL 3GMPB 3MLPA 1B88A 3KJ6L 4ORGA 5HY9A 4YR6B 4UT7L 2WWKT 4JKLA 1HNFA 1MNUL 4FFWD 5T1DH 1X5JA 2G5RA 2JB5H 4XCFH 1NCTA 1JN6A 1T2JA 2OK0L 4PTUA 3SN6N 2O61A 5DA0B 3PWUA 2IAMC 2DYPB 2IEPA 2OJZL 2AJYH 3MUGB 2DQJH 2BSTB 4YDJB 2VUYA 4CMMB 2UWEB 2H6PB 4NBYB 4LIQL 5DHYB 5I1GL 4Z7WF 4Z78A 2X40A 1OCWL 4KPHH 3RTQA 3FB5A 5A16B 1FYTA 5DRWB 4UIKL 2NZ9D 1I1FA 1RUKH 3CNKA 1N59A 3JWDL 3L7EB 2N56A 5DFVD 4U1IB 4GRMA 3F7VB 4YDVA 2WP3O 3SJVA 1ZAGA 1UH3A 1H3GA 1T0MB 1D5IL 4KTEH 2DLFL 1WBYA 1U8MB 1PQZB 1RAMA 3OWEA 3TVMC 4Q6IC 4M7ZB 2F8XC 3ZMRA 5FHAH 3CUPB 4XCNB 3JV5A 4EN3D 4D9QE 3HNSH 3DXAE 3R8QA 4G7YH 4LCIL 1B0RB 4GRWH 3IKCB 2ARWA 5C0GB 3HTLX 4PV8A 4NN5C 2G75A 3E0GA 3KPSD 2NZIA 1OD7A 1P53A 1GZPB 4MLSA 5DC0A 4KHTL 3K80A 1TETH 5E2TH 2ZUUA 1G7LB 3SDCC 4HZLB 2VDLH 5KG9B 2WLYA 3SE3C 1FO0H 3T4YA 2Q3ZA 3E2HC 1IT9L 3UTZA 2B8OT 1MCDA 3K74B 3BN9D 4JRXA 1PLGL 3RGVA 2FGZA 5HHPB 3OGOE 1IGYB 2AK1H 1U3ZA 5L9DL 2XNAB 3HC4H 4MNQA 1K8DB 2CQVA 1AGEB 3P4OB 4WFGD 4X7FC 4M1GL 3LN5B 4LMQE 3D69B 3BIBX 4X6DF 5EN2A 3DETD 3ZHDA 3WO3B 1CDIA 4NHUA 2DQHH 5BO1L 3KYMA 2FX8L 3NA9L 4EXKA 2VWEC 4LLMB 5HYJD 3VG0H 3UBXI 3H9SB 2UY7A 5IROA 4KQ4H 2CR6A 1NFDA 1G6VK 1NLDH 4NKDB 3LMJL 3VRIB 3I6GB 3VXME 5SWQB 2AI0H 2WIIB 3VGFA 4QHNB 2VLKB 3NACH 4YFDB 1SBSL 1G7QA 1R3IH 4ODUB 2PTUA 4NRYA 1WITA 2W38A 4TULL 4H5SB 4D3CL 2QHLA 3IDJA 4BFEA 3SDDC 1VA9A 5JPMA 3D39E 2PXYB 2UUDH 5D1QA 2O5YL 3O8XC 1GGCL 1A7OH 3DX6B 4ZTOH 4BYHA 1DUZB 2JE8A 3JVGC 4FQCL 5D7KD 4PB0L 4I48B 4NQUA 4ELMA 4MD0B 1TVHB 2FYYA 2VDPL 4ZYKA 1MCJA 5MEPA 1LP9F 2VLLB 3IDMB 3M1BB 3OKMB 1I8LC 3JV4A 2WNGA 2WQRA 2YPLD 4L3EB 1KV3A 3UPAA 2V9RA 1D9KD 4P5KB 1OAQH 5EULV 3L5XL 4V2BA 3QI9C 4GRLD 5GGTL 3DI3B 1KOAA 5DD1H 4K9EH 4NJAH 3KR3H 1NLBL 4NQCA 3KXFA 1EGJA 3QAZC 1CLYH 5FGSA 5EZIL 3HR5A 1RZJC 3LRHA 5HHVL 4G6KH 2A6KA 5C07E 1C1EL 1E4XL 4PJ9D 4NKIL 4IIQB 1K4CB 2QJDA 3VWKB 4CJ0A 3BAEH 4NN7C 2IGFL 4TSBL 1U9KA 2EEAA 4PJBA 2ILLA 2G5BA 2P5EB 3G9VA 4WCYL 2W9EH 2H2SC 3GBMH 3U48A 3WD5L 5JXED 1VB9A 1J05A 4OCSL 3T2NL 1JHKL 2QL1A 5DHXB 5EU3B 1J1XL 1GC1C 3P11H 5HVFB 4JG1H 1EHLL 1FH5H 4AENA 1LO3L 4OCNC 2KDGA 2CLVA 3JV0A 5IMMB 5DR5H 5BQ7A 5EBGA 1FFNB 1VEPA 1QSFD 1TJIL 1BAFL 5HGAB 3LKPB 3NCMA 4I0KA 4PJ8C 5ISZA 3PQYD 1WV7T 1JNHA 3VCLA 4L9LC 5CILL 5ENWB 2EZ0C 3QDJD 3SKMA 3VXOB 1IC4H 1RY7B 1WWBX 5AEAA 4XH2B 1UM4H 3PXJA 2Q3AA 4U0RB 4JN2A 3MYJA 5EC2B 2VXUL 3TZVA 1KNOA 4H26B 1YPZE 3D3VE 2E9WA 1E0OB 1CFVL 4TN9A 1IGMH 4UQ3B 1U6AH 4X4ZA 2XWBA 3RA7H 2PTTA 4UT6H 1RU9H 1PW3A 4KDVA 3BRGC 1XIWD 3PWJB 4N90E 1ZHBA 3B8SA 4FFVD 1UB5A 4EDXB 3NPSB 5TDPA 3RWCA 2CLRB 2HFEA 5FFLA 2RR3A 1N5AB 3QWQB 3N9GL 4R97C 3ROLA 4ZUSA 1D6VH 4N0CC 1R6VA 4Z7WA 5GJTH 4HXAL 4U6XB 4Y5VB 3DX8A 2BNQD 2ZCLH 1LEIB 3HMXH 2GEEA 4F7TA 5F93C 1PVHA 1A6UL 1YMMB 3RBGA 1JZ7A 1XF1A 4G80B 2VMFA 3IU3A 5GRXG 2ZOLA 3ULUD 1KIQA 4NBXB 1YEFH 4DZBA 2EKSB 5IBLC 3QUZD 3WNLA 4LLYB 4KRPC 1IGIH 1A7NH 3DYOA 1NCCL 5D7IF 4AIXA 5DMIL 3NVQA 4YHYB 5F44A 3OKNA 4O4YH 3MRFA 2IANB 1HYRC 3L3HA 1QLRA 2D03H 3BE1L 4NQDA 4EEEA 1NCDH 4MMXC 4ONGH 2DQIH 5L88H 2QQQA 2OCFD 3EOTH 4MB5A 5H37H 1YY9C 3C5JA 3G6JE 5DI8A 5EC1A 4HKJB 5CEXB 4ODVL 4LAQL 1WWAX 4H88H 2AEPH 7CGTA 3NCBB 5IW1B 2BRQA 1KJ2L 4HX1B 3OXRB 3S98A 3L5JA 4P2OA 4AY0A 5BZWA 1YQVH 3BIKB 3RVWD 4YGVA 5EUKA 2XFXA 4DWHA 1H3VA 5DK0A 5L7XH 5FKPB 3VA2C 2XZQH 5EUOF 3JWOL 4OQTH 1S9YB 1EO8L 4TTDC 1J0ZA 1VENA 3WFHB 5BV7H 1L9MA 3KPQB 5GSRA 1RULH 4UB0L 3VXSD 1IAKA 4N8VG 5E7FA 4DTGL 4AYFA 5KW9H 4XPBH 5DS8A 5HYSB 3RKPA 4UV7L 3SGKA 1NDMB 1BQHG 2XZCH 3STZB 4KVNH 1B0WA 5CZKA 2KZ1B 4OT1H 4X7EC 1MWAB 3QDMD 4QRPD 1UEMA 4MWFB 4EOWH 3TBTA 3UO1L 1INDL 2APVA 4MB4A 1EBPA 1P6FA 1CDYA 3FQUA 5DQDH 1ITBB 4JQXC 1JVKA 1SMAA 1CL7I 5T3XL 6FABH 4GXUM 4N9GB 3AGVA 2HAZA 3QH3A 4PTTB 4AIOA 4QT5B 2VE6B 1DDHA 3L3OB 5GGRA 2ICWJ 1QOKA 3CMGA 5CIPB 5IK3B 1LP9A 4XBEH 1OTUD 3FB8B 3HAEA 5KVGH 3V8CA 1S78C 3BDYH 4JFDE 2FJGA 3MTRA 3O2WH 3EDJA 3RUGE 4DW2H 5C0IB 2DJUA 1U3HB 4QRTA 1ZVYA 4NQEE 5EU5B 2GJJA 2QQKH 1SQ2N 1VPOL 5TGBA 4WY7L 1S9VA 4G9FE 2VZTA 2NY5L 4LEXL 2EYRA 1V7ML 4UU9B 1BGXL 3VRLF 4D8PB 2QSTA 4XAKE 2WBJD 5E99L 3GIVB 3I6KA 3QEUB 4Z7NE 4OUUA 2AERT 4I9WE 1CTOA 5C9KA 3NH7H 4O2CB 5DWUL 2H32H 1EDQA 1RJYB 3EO1A 4EI5C 4Q9QH 1AFVL 5I76A 2P8MA 4XZUA 3RDTB 3FOMA 1EHAA 3MV7D 1Q9LA 4KXZI 5DMGC 5HI3C 1OQXA 3IXAB 1MF2L 1FNGB 2HH0H 2EDHA 4JVWA 2I07B 4GQPH 3WXWH 3VG9B 4XXDB 5I17B 3WKMH 1YJDH 3MJ8B 5IBTL 2DQEL 5BMFL 2Y06H 1UCTA 5F6IB 4Y1AA 1T03L 4EKXA 5GIRA 4D0DB 1L0XA 2EXYD 4ODWB 5CJQH 1K6QL 4YO0B 4I8DA 5T5FH 4APQC 3P0YL 1K5NA 1FCGA 1MRDL 4LARL 1DBML 5I19L 4QRQA 3C6SA 3ZKXC 2XTJD 3RWHA 5JW5B 3ABZA 1FE8H 4NZDA 3QRGH 3REWA 4HJJL 4BSWB 3T0VA 3P40A 5GISH 2YZ1A 2HTKC 3VFOA 1CBVL 3GBLA 3VXQA 3GZKA 1RZ8A 3KPRA 3GSVA 2OR7A 2FWOA 1RJCA 4MLIA 5KANG 4E0RA 1Y0LA 1T1XB 3HE7A 5FYKH 1TVBA 5LGJB 5DVNA 3OAYK 1CK0H 1P84K 1PSKH 3SDXE 1FZKA 1IAOA 4JFOB 4YWGL 4AQ1B 4MD5A 1P6AB 4XP6H 5E6YA 4ZPVB 5DJCA 2PO6C 1S7SA 3MXVH 3LKSB 3O9WC 4XPGL 3D85B 4PRBA 1P4IL 2JTDA 3RWFB 5I71B 1KLGA 2ICES 2W9DL 4XP9L 1TMCB 2PF6A 4Q97A 3GSNB 3CCHA 4N1EA 5E24E 4MXVF 4XC1L 3CC5A 3F6LA 2Z91A 1WEJL 3LKQB 3CSYB 1QSEB 3EHBD 5D1ZC 3NN8A 2CDGA 5ID0B 4NNPH 3C8HA 5IB5B 3LIZH 2Q86A 3LQZB 1IKNC 4OTXL 1K8IA 3HC3H 3B6SA 4HV8B 4XPFH 1S7QB 4FQJL 2JCCE 5IESL 1T04B 5D7IA 3HPJA 3NIFE 2GI7A 3QUKA 5FGCB 5M7QA 4RFOH 1VGEH 2F58L 1MHHA 2APFA 2C5DC 3E3QC 4R4ND 5DQ9B 4A2MA 1P7QB 5JHDB 3UBXB 3V0WL 4ZDHB 5F96L 3IDIB 3MUHL 4ZO9A 4HLJA 5JDSB 4LDLB 3G5VA 4JZNA 5FECA 4KKAD 2WUCL 3WDIA 1FL6A 4DUWA 4RRPG 3OBAA 4IRSD 2PUQT 3P30H 2R4SH 1R5IB 1GIGL 4A6YL 3WS6C 1BQLH 4HFUL 4P59L 1MOEA 2BFVL 3CFIC 4WFHD 4R8WL 5IOPB 2VL4A 1ZHKB 2CLZB 1U8LA 1UM5H 5EUOA 3VGAB 1NGWA 3U9PH 3AFLA 2FSEA 4MDIB 2JIXD 1KLUB 3U7YL 4UIMA 1LGVA 2X4UB 4ZFOL 2ED9A 4GJTB 3QWOB 2R1YA 1XCQA 2VC2L 2CIIB 1SEBB 1OLLA 4PRIB 3C8DA 2R2CA 3PDOA 1T1YB 4YFLI 1K85A 4LFHG 3RZWA 1DQDH 2FR4A 3ILQD 2AJVH 4PYGA 4M6AA 4GW5A 5HY9B 2AEQH 3AAZA 2JJSC 4M4RA 4UBDC 1KELH 2VL5B 3G04A 2L7UA 4LLWA 3U4BL 2F54E 3QUYD 2NX5D 1JN6B 5E9DE 2J8UE 3M07A 1C7TA 2O61B 5DJXB 2ADJA 5J8OA 3GB7B 3LPWA 4P57B 4OZFG 1ACYH 4XBPB 2ZUVA 4OSUH 3HZKA 4Z78B 1M7IA 1WLHA 1ZHNB 4I0PA 2DKMA 3RTQB 3FB5B 5IJVA 2DBLL 2R8SH 3GMNB 4O02L 5DJZB 1S7XB 1N2RA 3MBEA 4U1JA 5KVEH 3E1F1 1DVFA 4C4KT 1N59B 1HHGB 4R90L 2Q7YA 3IU4L 3MACL 4GRMB 4LDEB 3SJVB 4KGLA 4WEBH 2VXQH 5CFHA 3CFKB 3ET9F 4G8EB 4XVTH 5GRWA 3O4LA 2ED7A 3I84A 1A21A 4LVEA 2XRAL 1KPUA 3BUYB 2R1WB 1CS6A 3EDFA 4NQXB 2I60H 2R0LH 5HJ3B 2IAMA 4PV8B 3TT3H 2Y36H 4U05A 4IRZH 4M1DH 4XNYL 2Y72A 4LF3A 3HFML 4FXGA 5CEZE 3WXVL 5E1HB 2V9TA 3T4YB 4PJDB 1YNLH 4XWOC 3UTZB 2IALB 4XVJH 3AROA 4U1GC 4MAYB 2ZG3A 4JRXB 5CZVH 3GI8L 5TDNB 2Q8BH 2NW3B 3QFDA 1JWMB 2CUHA 1QPXA 1QFUL 1JWUB 4MJID 4P2RD 5EOQL 3EYQD 3H9HB 5EU4B 4ONOA 5EN2B 2BHZA 3GSRA 4JHWH 3TVMA 4NHUB 1T2QH 3ARFD 4S1RL 3S37H 3CXDH 3AM8A 5KTEH 4N8CH 2ZKHL 5TFSH 4AT6A 4E9LA 4QHUA 3SO5A 3UTQA 1VFAA 1WICA 3OX8A 1ZHLB 2FX9H 1KEML 3SDCA 1EXUB 1WC7A 2NMSA 4LSRH 4R96A 5DZNA 4RWYL 3B5TA 2XQBL 2EO9A 4NO3A 3M8OH 1G7QB 2CMRH 3UTPE 4NRYB 3T77A 5KS9F 4Y8DC 4JPVH 1GHFH 4RSVA 3RNQB 5ICYB 4NZRH 3CPLB 3MRKA 3IDJB 3BGAA 3MRBA 4C4KO 3MRLA 3A6OA 5J4MA 5TF1H 1RUAH 4C54A 3R0MA 2ARJB 5ACZB 4ELMB 4ZNCD 2R56L 3QG6A 1O7VA 1Q0YL 1I8KB 3MCLH 5MEPB 3HB3D 2FCBA 3T0EB 2ZPKH 1RZFH 3JV4B 3RWEA 4JEGB 3CFEB 5DT1H 4C56A 1AXSA 2D4FA 2YUWA 3BP6A 1VGKB 5HI5C 3QCVL 3UTSA 4U33A 3BZ4B 5D72H 3IS1X 1GH7A 4H0HB 1EERB 4NHCL 2MCPH 5IWLC 1A5FL 1SY6H 3T2OA 1G9NC 2YA1A 4CBPA 4KMQA 1ZANH 5C0JA 1JYVA 3HR5B 2A6KB 1LK2A 4O2EB 3SE9H 1I9IH 4CN4A 5HGDB 3MLTA 3FCTB 3LKNA 3C8KA 4IOFC 3MXWL 4U1SB 1NAML 1QBLL 3ARBD 1ZLSL 4GMSH 2NTFA 3O8XA 2VRAA 5FO7A 4Y19D 2XZAL 3X17A 5E8PA 1NKOA 2GT9A 4PJBB 3C60D 2G5BB 2D7MA 4QRSB 1B2WL 1NUDA 5ANME 1H3WM 2GKIA 4L4JA 1TENA 1J05B 3EO9L 4XNXL 5I30L 2PR4L 1S7TA 2OZ4A 1FG9C 5IVXE 1I8LA 3TYGH 1AR1C 1HOCA 1RIHH 2NY5C 4HBQA 3SCMB 4AENB 3EOBB 3QI9A 5SWZD 1WCQA 1CE1H 1IZJA 2F5BH 1N7ML 1JGDA 4L4TA 3UP1A 2CUIA 5GZOD 4LHUA 1MWAH 4QY8A 5FYKD 5ISZB 1AGDA 3QUMB 1NGYA 3C2SA 4YBHA 1JTTA 5I15H 1JNHB 3MJ9A 3VCLB 1BX2B 4UOW1 2XKNB 1LDPL 4HJ0C 3SKMB 4NJ9H 1P84J 5GSVB 2VZSA 1QRNB 2NY0D 3C5ZC 4JN2B 3MYJB 4HS8H 1E6OL 1KNOB 5T1MA 5GGSY 1IGFL 3EFFA 2P45B 3MC0A 2LAAA 2EC8A 2VZ3A 4TPRH 3SGDH 2A9MH 1FN4A 2FIKA 2XQYK 3STLA 5F7DB 3MPCA 1ZHBB 4OLWL 4Z95L 5FIEA 3MLVL 5TDPB 3RWCB 2BMKB 2HFEB 4YC2C 4M7KL 2ZCHL 3GRWL 1BOGA 5EA0H 1ODAA 3GO1H 1J1OH 5HGHA 1YEDA 2VKWA 3ROLB 4Z7WB 4CNIA 3DX8B 3KPSE 3OR7B 1LO4H 3WNMA 1KB9K 4L9LA 5GGQH 1F3JB 1I4FB 1GGIL 3IDGB 4OUOA 5ITBL 4LSTH 3QUXD 1TITA 2DI8A 2WAHA 1IM9A 2A83A 3QNYA 5KSBE 3VFMA 3GSXA 4K94H 3IU3B 1BD2D 2ZOLB 1YUHA 1AKJD 2XOTA 1CICC 2F19H 4OBRA 1A14H 5F7MC 1ZVHA 3S3JA 3WV0A 4ACPA 4DZBB 4OI8A 4ZS6D 4KMTL 1KFAH 4OAWA 3C6LA 2J7LA 3DVGA 5CINH 4IDLA 4UI2A 4WFGE 1O7SA 4LBEA 2IFFL 1AQKL 4ENEC 4TOYH 4WUUA 4F58L 2H2PD 4U3HA 2FD6L 3HUJE 1PEZA 5GZND 1UFUA 5IIEB 4OZGF 5J56B 2VZVA 3D9AH 3MOBL 1OM3L 1YEEL 3W0WA 3BXNA 2CO6B 5TQ0H 2CJUH 3T3PE 1FVDA 5HHMD 5JIIA 3FQTB 3C5JB 5DI8B 5EC1B 5C92A 2RHEA 2VLKD 4P48A 5EIIB 5TQ2H 4DAGH 1G6RA 1KCUH 1OT1A 3L3DB 3V6BR 5HYSG 3SDYL 5C2BL 3H7BB 3QHFH 1CGSH 1WIOA 3TA3B 1BJMA 2HVJA 3S36H 3BDXA 4MXQC 3WLWD 3HI1B 1N64H 5IB2A 4KUCF 4YGVB 1OAUH 2V6HA 2XICA 5FO8A 1RIUL 4P5TC 5EO9A 2D7NA 5SV4A 2UVFA 5HHXH 2E7LC 4KK5C 5IF0B 2AJXL 4L8CB 2EYSA 3OPZL 5SX5K 2X5PA 1IAKB 1X7QA 4R4FH 3HNVH 4HWBA 5D7KE 1JPTH 3B9AA 5GS1C 4J3VA 5F9OL 3L5WA 4GFTB 1YEHH 4X7TA 2YPLE 3KYAA 4KKNA 2EDNA 3BYTA 1U8JA 2K7QA 1BF2A 4JQVC 4PUBH 3LD8C 5E00A 3DTXB 3MUZ1 3WNOA 1CF8H 4E41A 2EH7H 1DFBH 4J4PC 1A1OB 1JNLL 1MCNA 1MQ8A 4K3DH 3SKNA 4GKSA 3SQOL 5C9JA 4KVCH 3TWCL 2OL3H 5J3HC 3I6LD 2EH8H 2XN9A 2B0SL 5BS0A 4RAVA 5JZ7C 1FNEA 4LGSB 5J89A 5E2VH 3QH3B 2ZSVA 2P5ED 5HDLA 1DDHB 5GGRB 5F9WC 5DFTA 1FGVL 1I7ZA 2MOVA 1NCBL 4WDIB 3STBA 1QKZH 4WUKL 1DEEA 4LP5A 3B9KD 4EUPH 2CRIA 2C3WA 3CDGB 1S7RA 5CCKH 4S1SH 5D7JC 4M9PA 5IEHB 5K59F 1H8NA 4HUWA 4YDKL 5TGBB 3V52L 5CBAA 5I73B 3VFUA 3U0WH 1S9VB 1H8OA 3IFPA 3MCKA 1T3FA 4JVUA 4X9HA 5AZEL 2EYRB 1YECH 5GGSB 4LKCB 5TDOA 2AS5M 3VXTA 5EPMB 4ZS7L 3I6KB 4Y2DD 4NBZB 5D93B 4OUUB 3PQYE 5F1NA 1H3PL 3JTSB 4S10A 3VXRD 1IGJA 2GW5A 3EO1B 4IHOA 2P8MB 2VITA 5A2JH 3FOMB 4F7PA 5DUBA 1R5VA 5IW3A 1T66D 1Q9LB 3BESR 3RWGB 4ODSH 3S6CA 4YHOH 3TFKC 2X2YA 4EBQH 1Z9OA 5J7CC 4YBQD 3QO0A 3FN0H 4CW1B 1HH6B 1NL0H 5E6IC 1WIPA 4O51A 2IF7A 2MKWA 4Y1AB 5GIRB 4M7JH 4PLJD 5D1XC 5IM7B 4WNQB 3FQNB 1CDUA 4GMTL 1I9RL 3QWRA 1II4E 2V5YA 3HC0A 3WIIH 4QRQB 4ZXBB 5A43C 3V0AC 3RWHB 3O6KL 1KJVB 5DQJA 1DZBA 2A77H 3REWB 1RHHA 4EDWH 2BNQE 2A6DA 3LQAH 3U1SL 4M8VA 3VFOB 4Z7UE 1HQRA 2B2XH 4F7CB 2FWOB 1ETZA 5F7LB 4WFFD 1G0DA 1DBKH 2QEJA 1TVBB 3QEQA 1EX0A 3PABA 5BZDB 5JW3H 1QQDA 3BKCH 5E4EC 4BFBD 1MEXH 5F1OB 4RIRA 2VXVH 2F8OA 1CXFA 1FZKB 3VXPA 4MD5B 1HXYA 4KAQL 1AGCA 3IDNA 5DJCB 2F8VA 1S7SB 3P9LB 3TIEB 3OZ9L 4B7LA 3BPLB 4ZFZA 4PRBB 3BJLA 4RCAA 4APQA 1IQWH 3UBXG 5I1HL 1INEL 4ZOBA 4HC1L 3WEXA 1U8QA 1HWGB 3RAJL 4RNRA 4YHLL 1F90H 4UAOC 5F7NC 1OAXL 3CC5B 1LE9A 4PY8I 3QIWD 1B0GA 1CLOL 3GMMB 4GW4A 5LGHH 1FZJB 3H3PH 3H9YA 1ZK9A 2MJWA 4N1HB 1WFTA 3WO4B 1X4YA 3O6FA 4KKLD 4TSCH 5DJDB 4FFZL 2R2EA 3B6SB 4XMPH 5D7IB 5F7WC 3HPJB 1MCFA 1PKQB 2EIEA 3SDAC 1FGNL 2D4DA 5K93A 2HKFL 3HA0A 1A3RL 4AL8H 4K2UH 1MHHB 1UM6H 3BGFB 3FN3A 4HZAA 4QXGL 3QQ3B 3LRSA 4F57H 1ORSB 4OZGA 3O9WA 4DN3L 5I1JL 3UJJL 4JFEA 1F2QA 1T5XA 5C09A 1QD0A 5GS3A 1JPSH 1FL6B 5E0QA 1F45A 1QNZH 4PJAE 3HCVA 3SKUD 1B9ZA 4LCCB 4X6CE 1MRCH 1WT5C 4NO2B 4KRNA 2IPTL 3FT3A 3EJZD 4GAJH 5D70H 3CFCL 4AG4H 5FK9A 2V7NB 4YE4H 1C8PA 4PRNB 4D94A 3U79A 3THML 2GY5A 5IR1B 1IKNA 4OD1H 3B8YA 4CN1A 1V8HA 5FYKU 1U8LB 4H20H 4Z7QF 4GG6E 1QHPA 4HUUA 4WW1B 3TO4B 4MJ6A 1MFBH 25C8L 1XZ0A 1A4KA 1U8OB 4U7SA 4UIMB 3F7PC 3QIBC 3ZSTA 1OP5H 1UADC 2AEWA 1JUFB 1DSFL 4M8QA 1EFXA 3PDOB 3DMMC 4W4NA 1RPQA 5FYJU 5CAYB 1OGAA 3HRZA 3OQ3B 4QTHA 3MJGX 4H1LA 2KUTA 2IG2H 4LCYB 4GRWE 4GW5B 3AAZB 5LWYH 2APTA 1LD9A 4X7SL 3G04B 1KB9J 4NNYA 4LLWB 3BKML 5ESAA 5A2IH 2ENSA 3WS6A 2X1PA 5H2BB 1KUMA 4HHAB 2Z31D 3GNMH 2O5ZH 4FHBD 5TPWH 4XMKL 1ZT1A 4ZPTB 3TBVA 3FB6A 4I3SH 4KTDL 4LSVL 4JN1L 4WI6A 1EGJH 3GGWA 1GZQA 1M7IB 4YDIL 4B7IA 1YNTA 4CADA 5LCVH 4I0PB 3UJIH 1Q94A 5IQ9B 1RZGB 5GHWL 3WN5C 1N2RB 3GFUA 3S35X 4F8TA 1DVFB 3AY4C 2EDLA 4QF1B 2Q7YB 4F9PC 5JOFA 4Y4HB 3E8UH 4XGZA 4P4KA 2OSLB 4FQHA 2W1NA 4MCZA 2ITCB 4L8SA 4M00A 4WI4A 4C83B 2JF1A 4UINL 1KPUB 3O2DL 4S2SA 3F7YA 1A6WH 1URLA 3NFSH 5F6HJ 1JMXA 1OSPL 2IAMB 4PV9B 2XTJE 5CSGA 5I8KH 4ALAH 1EAPA 1KENL 2B39A 2ZJSL 5CGTA 3UZVB 5MEND 4NWTH 2XI9A 3JWNC 4LAJH 1NBVL 3LQMA 5L2KD 2PYEA 2G9HA 1IM3B 1U8IA 1ZMYA 1J0YA 4JM4H 5DHVB 1Z0MA 5J1SC 4M43L 3A6BL 3QFDB 3GBNH 5C6TH 2DS4A 2KQMA 1WBZB 3D85D 3FFCA 3QDGB 5ESQB 3N1GC 4P23A 1LE5A 4UNTA 3QYCA 2ZSWA 5B8CC 3O2VL 1YEKH 1U8PB 3TVMB 4Q6IB 1IAII 4M48H 4HS3B 4OM0L 4JRYB 1R3LA 5GRUH 1H3XA 3ARQA 1T4KA 3AREC 4XPAL 4AT6B 2IBZX 2CDFA 5D96C 1VFAB 3LKRA 4NN5B 4X80H 5CP7A 1XF2A 1I85C 3KLHC 4WGVB 1JPGA 3VD3A 1P9MC 4ONHA 1OSZB 1NGPL 3SDCB 2VLJB 2P5WB 4R96B 1F4WH 3MLUH 2MQ0A 2VQUA 2OR9H 1JGLL 4KHXL 1AE6L 5E1AA 3D18A 4WI2A 4LASL 3MLWH 4NO3B 2BVQB 5LQBL 3T77B 1P7QD 4ZFGL 1OQOA 5IT2L 5AG8A 3MRKB 4KV5E 4HIEA 2MSPA 3MRBB 3QPXL 3GJEA 3MRLB 4AEIH 2A74A 1G1YA 1EPFA 1C12B 4FQXC 2JB6B 4TUKL 4LHJB 4BZ2L 2PW1B 2C1OA 3VXNA 4RQQA 5E8OB 4FZ8L 1MFAL 3I02A 1PX4A 1NGQH 3IVKB 3Q48A 1UG9A 4LCWD 5IMOB 2YC1A 3FQRA 1IAIM 1KJ2A 5F7KC 3WFZA 3CU7A 2P43B 1AXSB 1Y6MR 4U1MA 5EWIH 5JW4R 5GXBB 2R0KL 3BP6B 2GTZB 2W65A 4HWNA 3P4LA 3UTSB 3TN0A 4MNGE 1BWMA 5C0BA 2NXYC 2C3VA 3JTTA 4WFHE 3V5DB 4K3EL 2BY3A 2GJ6D 1JGUL 3ESVF 4PRHE 5C0JB 5LKNA 2AJSH 4Z7OE 4OBSA 3VXUD 1LK2B 4KK8D 3QG7H 1P4BH 2EIDA 3LKNB 5I8OL 1IARB 2EXWD 3C8KB 3R4DA 5GRJL 3SDDB 1MCSA 4G5ZL 1YYLH 5CP3H 1OW0A 4Z7VF 1UB6B 2VYRE 4GBXD 2NTFB 3O8XB 1UZ6E 5DJ8A 1DLHA 5EORH 5CWSB 1OB1A 1OAYL 4QTIH 3OAZK 1WUNT 5SX5H 2ZOKA 1I75A 3LAFA 1NSNL 3FZUC 4JAMA 1NCWH 5GJSL 4S1QH 5DK2A 3B43A 2Z8SA 3QI9B 2EDRA 4M4PA 3NCFB 4JCLA 1SVCP 4JO3L 3CH1B 3X11A 2AXFA 3I9GH 1Q0XH 2XQYG 3AB0C 4RFEA 2NX5E 3OF6A 2BK8A 3LN4A 2DN7A 4U1HA 4G8GA 2EECA 4KFZC 4QY8B 3QAZB 3DV6A 1BM3L 1A64A 3D2UA 1AGDB 1FYTD 1NGYB 1UXWB 4JJHA 2Y6SD 5HYQA 3MNWA 4O9HL 3R1GH 5ETUA 1UVQA 5BW7C 1B4RA 1BFVH 4LQFH 1XEDA 5J0BA 4RDQG 3A6CL 5T1MB 3BHBA 1FJ1B 4U6VH 5ALCH 2RCSH 3EFFB 1FIGH 4POZC 3WFCH 1KCSL 3HAEH 3ECBA 5B39B 1FN4B 2FIKB 2GIYA 1Q72L 5I6XC 3STLB 3F6IA 1NDGA 5H37G 4F3FB 4ZD3H 3EJYC 3B9EA 4FQ1L 5IG7A 2VDML 3MRIA 3CMOL 2OMNA 3AS0A 1S3KH 5J11B 4CNIB 1RUQL 2KKQA 4JFZH 4Z0BH 4L9LB 4OB5H 3SQBA 3RGVD 4WWKC 1IM9B 4MNQD 4HGMA 3GSXB 3VFMB 3WCYA 1J8HA 4HIXL 2W91A 4E5XB 2YKLH 3IJYA 4PJXF 4RGOH 3DVGB 4X83A 4M1CC 4TVPH 1ZGLM 4MJIE 4P2RE 5JIPA 1FFOA 1MI5D 3UC0H 3V4PH 4MGXA 4GKOA 4RZCA 4L4VB 4JZJC 4RMQA 3VW3L 3MJ7A 5ELIA 4PPTA 1XF4A 3VFVA 4HIJA 1BVKA 3VWJC 3W0WB 1EH9A 3BXNB 4R97B 1FVDB 4OV6F 1FBIH 1YDPA 2ORBH 1NMBH 1ED3B 2QHRH 1FORH 2A6IA 2VAJA 1I1AC 1U41A 2NW2B 5B21A 5DVLA 1I3GH 2HVJB 4G6AD 1LMKA 1A7RH 4XBGA 4RMVA 4OV5A 5J1AA 2HT4D 3ULUL 3QPQC 5D7LE 3SBWA 4LKXA 1AD9A 4PJEE 5F6HI 2V5RA 5GS0H 3Q1SH 5D1QD 2R2BA 1MCLA 1ZE3C 4PP1D 1DBJL 2R9HD 5TE6L 4KRPB 1A1MB 4UDTB 5EU6B 43CAA 3DWTA 4YAQA 2NY2C 3FMGL 2I26N 2BRRH 3U83A 1U93B 3I50H 2EYSB 4YHIB 4N8PA 5E8DH 3U36B 2RQ8A 3L5WB 4OFDA 4WHDA 4G6JH 4OGYL 1U8JB 3ZDZF 3MBXL 4NQCD 3KXFD 2FECI 5D2LE 1QR1A 1U95A 3VD5A 5D7SL 1S9KC 2X44D 3PWPA 4PGDB 5CLTA 4PS4L 4GKSB 2YR3A 5C9JB 2HWZL 3MA9L 4DUXA 4M93C 2XN9B 5BS0B 4XCEB 2HLFC 4NYLB 3VDCA 4Z0XA 5ADOL 4P9ML 1N26A 3U0PB 5E94A 1RURH 4PRPB 4WI3A 1NKRA 3DBXA 2COQA 2DIJA 3GMRB 2Q7NA 3H42H 2ID5A 1I8IA 4Y19E 3OB0K 1WJ3A 5DRXA 1DEEB 2YRPA 2DWEB 4NO0D 3O3EB 4OM1H 1ZV5A 1I9EA 3ZL4L 4A6YA 3BQUC 4JQIH 3UROR 1MFCH 1UEYA 1FG2B 1RUPH 1S7RB 3RPIA 3MRPA 5HDQH 3VGEA 1CLCA 3BH9B 3ZDXF 4FFYH 4HUWB 4JG0H 1P2CB 3V6OA 3VFUB 5SWZE 5IEKB 4BQ9A 4J4PA 2G60H 4FQLH 3IFPB 3MCKB 4PJCE 3TPUB 1VADB 1OAKL 3DRTA 3SE4A 2R23A 3AS2A 3EYOA 2X4SA 2VDOH 2W0FA 1GRWA 2VO5A 3VXTB 5D2NA 1F4XH 4ZFOA 1A02N 4P2QB 5DXWA 4K3JH 3AUVA 5CHNA 1MREL 4Z7VA 4HT1L 3TZVD 1IGJB 3D87B 4YHKL 4P5MA 1G7PA 3LH2L 4IHOB 3WJLC 2FGWL 2VITB 1CG9A 2NLJA 4F7PB 5DUBB 4PY7A 1Y18A 3UTTA 4Z6AT 3MQIA 5DJYB 4ZAKA 2AP2A 1NGZA 4FFWC 2GK2A 1UENA 3QO0B 1FPTH 3RRQA 4Y5YC 3K8MA 1VHPA 4Q58C 4P3DA 4O51B 4V1DB 1E28B 2BCKA 3HI6L 2AXGA 3KWWB 1FAIH 1KGCD 1SYSA 3P77A 4HWEL 4KUZL 4ODHH 2FBJH 4JY4A 1TXKA 3V7AG 5FA4A 1AGFA 5EOCJ 3HMWH 3NAAH 1PG7X 2NZ9C 5DQJB 2BY0A 4JANA 5C08A 3BW9A 5DFVC 1T1WA 2P8LB 5F8RC 4P4RA 4ZMAT 1UGNA 5DD0H 5DLMH 2GK0B 3O4OB 1NMCC 3TC9A 2X7LA 4EI5B 2Z8VC 1AO7D 4DEPC 4Q9RL 5DJ0B 2B4CL 1M05B 1A8JH 2ESVA 1FL3B 1BD2E 5T1LA 3KLDA 4HXBH 3B2VH 3TNMA 4HKXA 1I1YA 4EN3C 3VG0L 1HCVA 1JP5A 5DEGA 4NQDD 5FUZH 5C6PB 4KJWD 3CXHK 1HXYB 2BSSA 1OARH 1AGCB 5BOZG 3IDNB 2EYTB 4ZFZB 2Q6WB 4APQB 5BRZA 1QFHA 4JPWL 1S5HA 2A1WL 5EBLB 3ZKXB 1U8QB 2X09A 2M2DA 4X8XA 3MV01 4P2OD 3BN9C 4O5LL 2VLKE 1B0GB 1OTTD 4HH9A 4Q7DA 1VFOA 4DGVL 1IC5L 4LDOB 2OM5A 4R6UA 1EV2E 4Y4KA 1A7OL 3O6FB 1MIEH 4HJGA 4HUXB 4XC3H 1AY1L 2R2EB 4LSQL 4HPYL 4N5ED 4P46D 2AK4A 4PJXA 5T3ZH 4K7FB 3DETC 5IFHH 5BVJA 3F5WB 4PGEA 4ONFL 3OAUH 1CDCA 1C5DA 3VFNA 2E7HA 3EO0A 4LMQI 3TP4A 3MODL 1X3DA 2PO6B 3O9WB 3VFWA 4H8WL 1T5XB 5C86A 3MLRL 1MVUA 2DQUL 1RIVH 3RWDA 4M5YL 5FV1L 5GGVL 2FB4H 3W82A 4UUJA 3ARGA 5HI5D 1QSVA 4FXLA 2R69L 3U0TA 2JJTC 3BH8B 5D1ZB 5FK9B 2NY4D 3BP5B 1A7PH 4NPYA 2XWJA 4OLZH 3MRQA 5I74C 5IVZA 3MV8A 5EOTB 5FHBH 1YN7A 5D6CA 4IDJH 2GFBA 3I6LE 4HUUB 5EOCH 2YMXH 3V9FA 2VXTL 1RJZA 3KPNA 3JUYA 4MJ6B 1AGBA 3P11L 1XZ0B 1X6LA 2P5EE 1D5BB 2X89A 5B3JE 2JJWA 4HGWA 3T04D 1D9KC 2CGRH 4LEOA 3W9EA 5HI4D 3Q6GH 3QJFA 2Y5EA 4M8QB 3TNNA 4GRLC 3HRZB 4QTHB 4H1LB 1M7XA 2OXHA 4KROD 5IB4B 4JO1L 1WZLA 2V17H 4JB9H 1PZUB 1CL7L 1MCEA 1JK8A 1FC1A 3DRQA 2X41A 4Z76B 4R4BB 1CCZA 5ESAB 1ZOXA 1AIFB 4D9RD 1MCQA 2DQCL 1N4XL 4LSUH 5A40E 4PJ9C 4FRWA 2UWEF 5E5RB 3QHZH 1CXLA 2CO7B 1ZT1B 3QUML 3PHQA 5T33H 1UC6A 3S88L 3QR2A 4QOKA 4HIHA 3GGWB 4HJ0D 5JXEC 4CADB 1YNTB 5FA3A 1K2DB 4JKPH 2IQ9H 3VXRE 1BQHA 1Q94B 5CD3A 4TVPD 2BNRA 2VSDA 1F4YH 3Q2CA 2H26A 5I8CB 1JPFB 1AHWC 1P4LA 3D25A 4KI5F 3DMMA 1ZEAL 1CLZL 4MB3A 4BA8A 1A4JB 3IAGC 3D0LA 5IVNA 4MCZB 3BKJH 5B4MD 1WAAE 5KSVA 2OZ4H 3ZYZA 4RMUA 3ORJA 5E2UH 4KZDH 4JGUA 4S2SB 3F7YB 4PJ7B 4RMRA 1HKLL 2AV7A 1X5XA 2F53A 1F58H 4ETQA 1FLTX 2OLDA 5JNYB 3QCTH 4NRZA 4EZMA 3J8F7 3KPRD 5GS0D 5C0AA 1YMME 2C9AA 3DNKA 4MXWH 3HE7D 1ZGLB 4WW2F 2SEBB 5F1SA 5IJKA 1JGEB 4LLUB 3CLFH 3I2CH 3WHE1 1MJ7H 4LLVA 2PYEB 1TJHL 1CICD 1XIWC 2DQIL 5CBEA 4CGTA 1U8IB 4FFVC 4G9FA 1UWGH 3S5LG 2IANE 1JHTA 5DD6A 2Z0BA 3FFCB 5FDWA 3GRWA 3CGTA 3BKYL 1LO2H 2DIAA 2J88L 1U8NB 2ZSWB 3SKJH 2C3XA 4U1LB 5SWSA 5IHUL 1ZA3A 3LKRB 5MEQB 1F4AA 2XZQL 4L5FH 1HILB 1VACB 3QUZC 4PGBA 2D31A 3MROA 4JPKH 3W9DA 1QBML 1RULL 1FZMB 4ZUTA 3EYUH 5E1AB 3D18B 1ITCA 2BC4A 4DVBB 4JFFB 1R24A 3L1OH 3SE8H 4IOSD 1PG7W 1QO3B 5DMKA 1UCBL 5L8JB 3B5GA 2N7AA 3NA4A 4HIEB 3PF2A 4QXTA 1NBQA 3C9NB 2ZUQC 2C1OB 1DLFH 1KYOK 2E8ZA 2HFFA 2VLRB 4RQQB 3VXNB 1R3KA 1GAFL 5DA4A 5JDJA 2D9CA 3VXMD 1X5GA 2X1OA 5BXFB 4E42A 2OQJA 4OCWH 4CKVX 3FQRB 3LN9A 2VNCA 4U1MB 2V5MA 4Y4FD 3PWLA 1I85A 2P42B 3RVWC 3D0VA 4K8RH 3OGCA 1D7FA 3ES6B 1G9MH 3TN0B 3MRJA 4DGIH 1NBYA 1T1ZA 2DTSA 3LHPH 5C0CB 1G6RH 4FN0A 4K7PX 4TTGA 4XBEL 3KYNA 5E8NA 3X14B 4KH2A 4X4YB 4FZEL 5FCUH 4I4WA 3FOLA 4HUMB 4YBLC 5C71A 4UOJA 5DO2D 4R2GD 1A0QH 3OHXB 1H8SA 2Z92A 2NYYD 4WO4A 2EE3A 1DLHB 1UKSA 5KSUB 3GHBL 4N0FA 2X4RA 2VH5L 1A7QH 2ZOKB 4NUJA 3B3IB 4JAMB 4HWBH 5FF6A 2P47B 3CU1A 2GSIB 2RJMA 5ECJE 3TYFA 3JSSA 4WEUD 1X5LA 2DBJA 5DK2B 1H3TA 4QLRA 1T7ZA 1H15A 3IDXH 5D7JD 5HHOB 1HHIB 5I1CH 4UTAL 5C07D 3P3YA 5B39G 3X11B 1CFTA 1W72B 4FNLL 3CVHH 2YBRA 1IJ9A 3LN4B 2JJVA 2ZG2A 1BZ9A 2BHYA 4U1HB 4DJMA 4G8GB 1PY4A 4I0PD 3D2UB 1E4JA 4Z8FH 4DKFH 1JNNH 3ROOA 3O6MH 4RRPA 3MBED 4L29A 1OTUC 3HN3A 3N85H 4NKMB 3IFLH 1DQLL 3NGBC 5ETUB 3DX7B 4F7MA 4YR6A 2R0WH 5CJQL 4PR5A 4A2LA 2DD8H 3BHBB 4ODBD 1MJUH 4GXVL 4NWUH 3DYPA 3O4LD 1TJGH 2Q87A 3OB0H 1N6UA 3ECBB 2BDNH 3QCUH 1PDKA 1JL8A 2WBJC 2WBWB 4NSKB 1BZ7A 3NIGE 4XAWH 2BSTA 2A9NL 2Y07H 1D5XB 4YDJA 2UWEA 3I3EA 2H6PA 4NUGH 4MA1C 5DHYA 2QQNL 3WFDH 1EEQA 4L1HA 5IG7B 2I5YH 3CZJA 3MOAH 3MRIB 4ZOAA 5FYKL 5A16A 5HVHC 3GI9H 4GQ9L 5DRWA 5T3ZD 3DI2B 4X0KA 5GRVL 3F7VA 2FO4B 5CJXA 3PL6A 4QNPF 1DBAH 5ALBL 3B2UD 3OKEA 5DURB 4U7MA 3BPOC 5BW7A 4P99A 5E6ZA 2GY7B 3EDKA 5HHNA 4N90D 5DD3L 4PJGE 1U8MA 4AEHL 5FYJL 2EXYC 5BOPA 2DQGH 4OZFA 3IJYB 3CUPA 3UAJD 1M6OA 3KJ6H 2YZ8A 1PYWA 4UT7H 1V5JA 1TCRA 3UPRB 1FFOB 2XTJC 1CU4L 1T89A 4F2MB 3GMQB 4OFPA 4RZCB 4BK4A 5L6YL 4XPTL 2OK0H 4OZHE 1XGUA 4YC2B 1G7LA 2OJZH 1XF4B 3I75A 4HIJB 5KG9A 4XXCC 1M7DA 5DFWH 5DUML 1S7VA 3ZE0E 4LIQH 5I1GH 1QSEE 4WW2A 1JIBA 3FTGA 2CK2A 3S35L 1HZHL 1OCWH 1QBBA 2A6IB 3V4VL 3OSKA 3KLSA 4YHMH 3RZCD 2XNAA 1AGEA 3VI4E 4WWKA 2C7UB 3QA3B 3P4OA 4UIKH 5J1AB 3JWDH 2BNUB 3LN5A 4LKXB 2R2BB 2VISA 1D5IH 4CL7A 2DLIA 4K9EC 2DLFH 1AP2B 4KQ3L 2OX5A 3H9SA 1OVZA 4C56D 1BQLL 2MTPA 2HT3C 3QXTA 1FSKC 4JZJA 4NKDA 4R7NA 2P48B 3CDCA 3VRIA 5SWQA 1A22B 4LCWE 2WIIA 3RKDD 2C26A 5IV2A 5TE4L 3ZTNL 3U9PL 4LPWA 3HG1A 4ODUA 1QR1B 1GGTA 1U95B 3MUY1 2GCYA 1I1AA 1IT9H 3LB6D 4H5SA 3BOVA 2E6QA 3PWPB 4XWGL 4U3XA 1PLGH 3ULVE 1J0KA 4R4NC 1G0YR 1SM3L 5F21B 3T08A 4KK6D 2HYMA 5L9DH 2B1HL 1IMHC 1DUZA 4I48A 1DQDL 2J6EA 1WQVT 3SOBH 1TVHA 1U91B 4KKAC 4RISL 1FFPB 4P5TB 5E94B 3RHWF 4M1GH 3M1BA 3IDMA 2YD5A 4U1KA 4IRSC 4HLZG 5FB8A 1VFUA 2OTWA 3GM8A 4P5KA 1I8IB 5BO1H 4NT6A 2FX8H 1J0JA 2XACC 5GS1B 4FG6D 3V79C 2ZG1A 2HT2D 1M1SA 5HD8D 1ACYL 4PIRF 4L4TD 4NZTL 3FONB 1QFWI 3VFRA 3UYRL 4YGAB 3LMJH 4LHUD 4M6NL 2BX5A 5CJ5A 4WIQA 5H8DA 1ZLUK 3DRTB 3D39B 1SBSH 2R23B 1CXEA 3UCRA 4IIQA 5KJRL 1KG0B 5EG6C 1ACZA 3N1MC 4URTB 1CGVA 4D3CH 4TULH 5JORB 1FYTE 3X3FL 3MV9A 5CHNB 4Z7VB 3TT1L 4PLKD 4P5MB 1GGCH 1OY3B 1UH4A 4Y8AA 5ESVB 4ZUUB 3ILQC 3HE6C 4FQCH 1NJ9B 5F9WB 5HXMA 4PB0H 1CG9B 5JIHA 1A1NB 2VDPH 4PY7B 3SJVE 1Y18B 1XAUA 3BEWA 1NGZB 3E6FB 4YPGB 5IMMA 4JDZB 3QUYC 4R26L 4F33A 3BQUA 4OF5A 1FFNA 4XAKD 3F62A 5FM8A 4P3DB 2JKXA 2KBGA 1T83C 2BCKB 2WWMD 5GGTH 4WJ5A 1QFWM 4I9WD 1BVLB 1NLBH 1SYSB 3P77B 2B20A 4YZFF 4F9LC 4PLNC 2FIRT 3IKKA 1N5YL 1YNLL 4HWZA 5JPNB 4XH2A 5IB1B 3ZYIA 1AGFB 5HHVH 4GS7C 4PJFF 1C1EH 1E4XH 2FATL 1FNSL 4LSDA 4JANB 5C08B 4NKIH 4YHZL 1I3VA 4HUNB 4TSBH 3FFDB 3C6LD 2X7LB 2IBGA 1A6AA 4MNQE 1KYOJ 5C0RL 1T2QL 3PWJA 3CXDL 4KJQD 4OCSH 5T1LB 3T2NH 3DURA 4N8CL 1JHKH 5FUOL 3TNMB 4HKXB 4WUUD 1J1XH 1I1YB 5F9AC 4K3HA 1EHLH 5E5MA 1N5AA 3O2DA 1LO3H 1JNJA 1D5MA 5E6IB 2AV1B 3T65A 1X5YA 1H0DB 3R06A 2BSSB 4K8RD 2DQFB 5CEYA 1RUMH 4Y5VA 3V6ZB 5L8KB 4OJFL 5IBUB 4OCYL 1FL5A 4LSRL 2NY3D 4NFBA 1LEIA 2ZNXA 1TJIH 5B38B 1NFDE 3GKWL 5DUPL 4MNHA 3CX5K 5BV7C 3N1FC 5CILH 5E7BA 4TSAL 5AWNL 4HH9B 1YPZB 2EKSA 3ULUF 2VR4A 3TJEH 4Y4KB 2VXUH 2ZUTA 3AS3A 5EZJA 4HJGB 3EYQC 4U7KA 4PJXB 5E4EB 2DMCA 1CFVH 1AR2A 4CMHC 2ZPKL 2F5AL 4QGTA 4UQ2A 5BVJB 3ARFC 3K0WA 2P24B 4PGEB 4EN3A 1MLCB 1C5DB 4ELME 3T0WA 3NTCL 4JPIA 4XTRD 4HKJA 5CEXA 3D5OF 4RGND 3VFWB 2FO1A 5IW1A 3N9GH 2HN7B 1MVUB 3QJHA 4HXAH 4HS6A 4E41D 3DVFA 4UAOB 4MQ7B 4I3GA 2V9QA 4Y89A 3UX9B 4NQCE 3KXFE 1A6UH 3U0TB 4PJIF 5FKPA 1L0YA 4BSVA 4NPYB 4WHTB 2XWJB 3X13A 3MRQB 1QYGL 5IVZB 3MV8B 3KPQA 3GIZL 3X3GL 5D6CB 2GFBB 4JFYB 1SHMA 4HCRL 4L3CA 3SDAB 1RJZB 3WIHL 4GKNB 2H3NA 3VGBA 1AGBB 1TTGA 2NY6D 3HB3C 4PJBE 5HYSA 2BVOA 1KULA 4HGWB 5HYJA 2FX7L 3BE1H 3W9EB 4XP4L 1NDMA 5FUCE 1YY8A 5HDBE 4M03A 1KEGL 4QHLB 2DDQL 4ODVH 4YXLL 4LAQH 1DUYA 1G7JA 1JK8B 2ENYA 4W4OC 1KJ2H 3HI5H 5JR1L 1QR4A 1CFSB 1HCFX 1IAMA 1YJDC 2VE6A 4CN6A 3ARBC 5I75C 1RZKH 1MAKA 2O93L 1GGBH 3PHQB 3BT2L 4MCYA 5CIPA 5ACLA 3K46A 5IK3A 3C60C 4QOKB 3JWOH 4HIHB 4TPRL 1EO8H 5FA3B 1NANH 5IHZB 1ZGLP 1PKOA 1J7VR 2IH3B 4PREB 2D7QA 3GK8L 4UB0H 5DJAB 5C0IA 3QIBB 2HJLA 5D6DC 3TIDA 1U3HA 5DF0A 4BJLA 2H26B 3VD9A 3EJJX 3NABH 5EU5A 3D25B 4NIKB 2ZUSA 3DMMB 2EO1A 2IH1B 2F54D 4GRLA 1T22A 1PBYA 4UV7H 5E9DD 1NFIA 1GC1L 3D0LB 3F65A 4ZTPL 5GZOC 4D8PA 3QWRD 4N1CA 3ETBF 4LSTL 3UO1H 1WTLA 1INDH 3TBSA 2Z4QB 3EKCA 1OPGL 4O2CA 4K94L 1LDSA 4W6WB 1RJYA 2F53B 5T3XH 4ETQB 2NY0C 2F19L 4NRZB 2P46B 3RDTA 3OB8A 5C0AB 1Q1JL 4PJDF 5CINL 4JFDB 3IXAA 2NCMA 5E8EA 3QEQD 6CGTA 5I17A 3CD4A 2I07A 4XXDA 3F12A 2FZ3B 2LFGA 3P73A 4GLRH 3MJ8A 4Y7MA 4KKCD 4NQEB 1V3JA 4MD4B 2RAMA 1AHWA 5CBEB 4D0DA 5HGGS 4XVSL 4ODWA 1JF1B 4ODXA 4G9FB 4YO0A 2CJUL 4MDJA 3S3SA 5FDWB 4NQDE 1KCVL 5TQ2L 1QSFA 4WY7H 3HPLA 3D6GA 4FQIH 3GEWB 3QHFL 1CGSL 4LEXH 3S36L 4BSWA 1V7MH 3QDJA 4JO2L 1BGXH 3T0BA 4X4XB 5SWSB 5E99H 4PJFA 3QUXC 3I3BA 4KY1H 2DJSA 2IBBA 3LS4L 1QHOA 3T09A 3W39A 2LQRA 2OI9C 3QXDA 5DWUH 1QFPA 4ZS6C 4AEFA 3IXTA 1AFVH 1RZIA 4DQOH 1CVSC 3B5HA 5IMLB 3HNVL 1NPUA 1JJUA 2BC4B 4MA3A 1XIWA 1R24B 4OFVA 2C4FU 4ZPVA 4X6DE 2H2PC 5DMKB 5GZNC 3KG5A 3RIAF 5IBTH 3IF1A 1T7VA 2DQEH 4OLXL 5BMFH 1JZ3A 1J0IA 2KH2B 3BVNA 3QZWB 4QXTB 4JFED 1T03H 3ZTJG 4OLUL 5C09D 3OKLA 1K6QH 3CFBB 1R3KB 3P0YH 5B8CB 2EH7L 1S7UB 4TRPL 1MCBA 4P2CG 1MRDH 1DBBL 4K3DL 4PBXA 1CD1B 1PG7L 4LARH 1DBMH 3OG4B 5I19H 1B90A 2OQJB 3LKQA 1TQCB 2OL3L 5D96B 4KUCD 1V05A 4HJJH 3D0VB 1FFRA 2QSCL 3IT8D 1YEIH 2UZYB 3OGCB 4HV8A 5AUMB 1CBVH 1T04A 4BSJA 1RJLB 3QUZA 3V5KB 4GW1B 1T1ZB 2QQLH 5DQ9A 4I3RL 5JHDA 1GPOL 2XXMB 3IDIA 1QKZL 1KN4H 5AD0A 5KSAA 3LEXA 4JO4L 5JDSA 3ZDYF 1SYVB 2LVCA 1IGCL 4GSDH 4ZOEA 1EFXD 4YWGH 2ZCKL 4D0CB 3IB4A 1LP9E 2GSGB 4XX1E 1IBGH 3MREA 1HEZB 4FQXB 1OGAD 4XPGH 1P4IH 1TVDA 3MLZL 4IRJD 1DQJA 1N6QL 35C8L 2W9DH 4XP9H 5FF6B 4XC1H 2FHFA 1I7RB 4JGJA 5IOPA 1CFBA 1MFEL 1NUGA 1WEJH 4PJIA 2CLZA 4UTBL 1AH1A 3EZJB 4S1DD 3R8BB 1CFTB 4D9RE 2YBRB 4OTXH 5B3NA 1BZ9B 4MDIA 1CN4A 2NXYB 1KLUA 4FQJH 5JLZA 5IESH 2BSED 4GAGL 2FEDD 3V4UH 3QWOA 3VXSA 5HTSA 5KN5B 5LXGL 2PW2B 4OLYH 4H25A 4S0TD 2F58H 4U6YA 1DL7L 4JHBA 4M6OH 2X4NA 3V0WH 3B9KC 1W2KT 5F96H 2DM7A 5CMAB 4OD2A 3UYPA 3NFNB 4TVPE 4MA8L 4P4KD 4F7MB 5A3ID 4NDMB 4WHCA 4PR5B 2WUCH 2VL5A 1CZ8L 3T3MF 4M3KB 3BD5A 2XA8L 3QDMA 4QRPA 3O3DB 1MHEA 4Y1AE 4YHNB 5DJXA 3GB7A 3CX5J 4P57A 2WQ8A 3OKDB 1BZ7B 4A6YH 4EDWL 4HFUH 2AABL 4Y2DC 4P59H 3QDAA 4XBPA 3UYOD 3LS5L 3HNTL 1SMOA 4NKOB 4R8WH 3ULSB 1J11A 1A6TB 3AB0B 4M5ZL 1ZHNA 5DZLA 1DBKL 2EDYA 4FQ2H 4LPVA 1WFUA 3GMNA 1SJEA 5DJZA 1S7XA 3BKCL 4B50A 1M4KA 1CYGA 1U42A 4RDQF 4OKDA 3VU2A 1P7KA 4X0KB 1T66C 3KPRE 1HHGA 1IFHL 1Z0NA 1T21A 2HP4A 1QRKA 3PL6B 3UXFA 4YBQC 3PWNB 3OKEB 2E7MA 3NPSC 4JDTL 3QEHB 2O5XL 3CFKA 5HHNB 4G8EA 5I1KH 3C09C 3EFDL 4P23D 4PLJC 3RY6C 1BEYL 4MQXD 4LRIC 4LSPH 3RY5A 4OZFB 3BUYA 2R1WA 3LZFL 2QBWA 4PRAB 1M6OB 3BRDA 1PYWB 1FO0A 1NC2D 4NQXA 3WHE0 1TCRB 5HJ3A 2AJZA 2H8PB 5I6XB 3VFGL 2QR0B 3U4BH 2KL6A 5FGRA 1XGUB 1QLFA 3ARDD 5I1IL 2C4FT 2P8PA 3I75B 2C4XA 4PJDA 1M7DB 2IALA 2A6JB 5IGXL 1S7VB 2CR3A 4WW2B 4MAYA 4JZOA 4ZQKA 1J1PL 1YEJL 3FTGB 3MV7A 5TDNA 3AMLA 2DBLH 3KHQA 4O02H 2NW3A 1UM6L 4WWKB 4QXUL 1JWMA 5LJYH 1BFOA 1JWUA 5D7IE 3MJ6A 3MACH 5C0ND 3OR6B 2L7JA 3H9HA 1IAIL 5EU4A 2ZNWA 1A9EA 1B4JL 2VISB 5T1KB 3HHRB 4UT9L 4FQPA 4Q0XL 4M61B 2CUMA 4X6BA 1NUNB 3C08L 2FEEI 4JZJB 1ZHLA 3QIWC 4R7NB 1IRAY 3LDBC 5IHBA 4CDHA 1KXVC 1IC7L 4N0UA 2DKUA 4DCQB 1EXUA 3OKYA 3VWJB 5FO9B 4XNYH 1IILE 4XXCA 1GGUA 4KKLC 5IV2B 3V5HB 1KF9B 2IMMA 1DR9A 4KRMB 3HFMH 4LSSL 3HG1B 5C0BD 4UILL 3ZKSD 1F6AB 1DE4B 4TNVF 2Z93B 1ZWIA 3K2MC 2GCYB 1I1AB 3RNQA 5ICYA 4JHAL 5F3HB 3CPLA 1H5BC 4J6RL 1IEHA 3MX0A 5EUOE 1ORQA 5FM5O 5BJTA 4PG9A 2ATPB 3GI8H 1KIRA 5I18L 2DICA 3MLXL 2P7TA 4OZ4A 2ARJA 2X1WL 2YRZA 5ACZA 1QFUH 4I77L 2IG2L 1I8KA 5EOQH 3SO3B 2NY2B 3T0EA 4TUJB 5LWYL 4U1KB 1JV5A 3CFEA 2PYFA 3O3AB 5FB8B 2E8YA 5FYLL 1X6NA 2OTWB 5CSZB 2X4OA 4S1RH 4NT6B 1VGKA 3GUTA 5JOEA 3DV4B 2ZKHH 3EJZC 3BZ4A 4TUOA 5TPWL 5T3XD 2ZUXA 1LO0L 1ZT4A 3VFRB 1HSBB 1WBXB 1UJ3C 1S8DA 1KEMH 2EDDA 5LCVL 4JR9L 4O2EA 5HGDA 3FCTA 4U1SA 4DFIA 4YFLF 2J5LC 2YUZA 1GXEA 4M93B 4DKEL 3U4AA 4OFYD 3QNZB 1FCCA 4J7RA 3MV9B 4QRSA 4F7EB 4BFIA 1UYWL 3Q3GB 1UXSB 4W81A 3G5ZB 1XH3B 2P49B 2R56H 3FB7A 3SCMA 1Q0YH 4YX2L 3EOBA 4N5UA 1OF2B 1TZHA 3BEWB 12E8H 1EIBA 3NPZB 2Z31C 3O4LE 4F33B 3BQUB 4LGPB 5GQBA 2FNBA 2HKHL 2WV3A 4K94C 1LEKB 3VRLE 4K7PL 3QCVH 2IMNA 1CFNA 3LKOB 3QUMA 4WJ5B 4IOIA 1BX2A 1GCFA 2FLBT 2XKNA 4NHCH 3RVUD 1A5FH 3LV3A 4HWZB 5M95B 1FHGA 2JIXA 5GSVA 1QRNA 5IBUG 3F58H 4JM4L 4POYA 2W60A 4RA3A 2UY6A 5B38G 5T3ZE 3MXWH 1J8HD 3RGHA 1NAMH 1QBLH 5F6IC 5DGRA 2XZAH 1SJXA 1A6AB 1B2WH 1F2XK 1F6LL 4XNXH 3EO9H 4M48L 5F7DA 5I30H 2PR4H 1OAZL 1A6VL 2VIRB 3DURB 3LCYA 2BMKA 4OZIF 5E5MB 4X80L 4Y5YB 4IEFB 1D5MB 3O6LL 3T65B 4I13B 3R06B 4WU5A 5CEYB 1N7MH 3TPKA 3OR7A 3BFOA 3MZGB 4WVRA 1FL5B 3SKOA 3IRZA 1F3JA 1CDHA 1I4FA 3IDGA 3W2DL 3RIFF 3NZ8B 4MNHB 3WYRA 4JY6B 1NEZB 1LDPH 2UYLB 4CAGA 4BH8B 2GITA 4O00A 1NMCB 5F89A 5EZJB 1E6OH 4JDVB 4DEPB 1ZVSA 2PKDA 5I71C 1RFDL 2M1KA 4Z9KB 1IGFH 5HYEA 2QADD 4MJ2A 5HSFA 4WFED 2VUOA 3CSBA 4UQ2B 1E4KC 4EN3B 5IIEA 3WJJC 3H8NA 1YYML 2BHUA 4JPIB 4OLWH 1CDJA 3FQTA 4Z95H 4IJ3C 3KPSB 4J3WA 4MXVE 2VDQL 5EIIA 2A73B 4M7KH 2WIMA 2ZCHH 3GRWH 4C56E 3L3DA 2Z35B 4GOSA 3H7BA 3QJHB 4HS6B 3TA3A 1C16B 3UTSE 1A9BA 3HI1A 1GGIH 4PGJA 5ITBH 3RL1A 2FJHB 2APWA 3PG2A 4TNWF 4MZ3A 4BSVB 3QIUA 4MJIA 3X13B 3EYSL 5IF0A 5IFAL 4MJ5B 4KMTH 4L8CA 1U3YA 3MGOA 3HUJB 4L3CB 3ZHLA 3X12A 3IAPA 1ZTXL 3ARFA 2H3NB 1Q9OB 5K9QI 1CD9B 1EO5A 5CUSL 1AQKH 3LRGA 4S1QL 4UMGA 2BVOB 1J88A 4FTVA 3WUWB 3RWIB 1T7YA 4F58H 5HYJB 4CRPA 2FECL 4N0RA 3I9GL 1VEOA 2UZIH 1YY8B 4WU7A 3DTXA 1J0HA 3K4ZA 1OM3H 1YEEH 1CIDA 1A1OA 5IMKB 1MPAL 1DUYB 1G7JB 2VXSL 4JM2F 3SDYH 1ONQB 4L4TE 1F11A 4ZNEE 3DHMA 5C2BH 4YEEA 1OP9A 1FC2D 5D71H 1W72L 3WNNA 4PJHF 4OGXL 4KK8C 4KI1A 4KK9D 4KDWA 2EXWC 1G9NL 4FP8L 5DRZB 5I74B 4GBXC 4NNXA 4G8IA 4MCYB 3RHWK 1RIUH 2ADFH 1E6JL 3DYMA 4WDIA 3WFCL 3UTTD 3DUUA 4QGYA 5A1AA 2AJXH 3OPZH 4ZAKD 5EZLA 2YPLB 3CDGA 4ZO6A 4PJ5A 2HJLB 3TIDB 4F80A 4P2YA 1D9KB 5F71A 5ID1B 5IEHA 4L9DA 1A2YB 5F9OH 2R15A 4GRLB 1L0QA 3BPCA 3LQAC 1T22B 1NFIB 4JHZA 2XV6B 5AYUL 5GGSA 4XI5D 4LKCA 4R0LC 2JK5B 2CKBB 5DEZA 1FP5A 5EPMA 1JWSB 3TF7C 1LEGA 5I1LA 1BBJA 3ALXA 1JZ5A 3TBSB 3JTSA 3SQOH 3PIQB 2Y6SC 2X4QB 4PJ9B 3TWCH 1KC5H 1TNMA 2BP3A 4MVBD 4WHYH 5ADPL 2B0SH 2IADB 3MNZB 2FJFB 3S4SG 3C60A 3RWGA 2BXYA 3QQ9D 1JFQL 5E8EB 2ESVD 3U2SB 3F12B 4CW1A 3P73B 1FGVH 1HH6A 2HVKB 5D6DA 5EBWA 1NCBH 3QXVA 4WUKH 4N0YL 5SX4H 1AHWB 1ERNA 4OKVA 4K71C 5SWZA 5IM7A 4GT7A 4ODXB 4PG2A 4WNQA 1I9JL 3FQNA 3V6FA 4MDJB 1V3MA 4WUUE 2NPLX 5HHQA 2V5SA 2VSCA 5BRZD 1QSFB 4ZXBA 2QHRL 4YDKH 3V52H 3T1WA 3HPLB 2HA1A 5E2JA 1KJVA 3W0WE 1KB5L 3QZWG 5AZEH 2FL5A 3WNKA 1A7RL 3QDJB 1A3LL 2DJ4A 4PJFB 3RGVC 4PD4K 2AGJH 4ZS7H 4F7CA 1GOFA 2W92A 4I0CC 1H3PH 3SGJA 4Y4KD 1V7NL 3NCJL 3W39B 2R1XA 5BZDA 1JI2A 3QXDB 4PP2B 2ICEA 3IXTB 5L0QC 2AK4D 1RZIB 3I50L 4XVUD 4IM8A 3V8OA 5E8DL 1CQKA 4MA3B 5AZ2L 4OZIA 1XIWB 4HEME 4O58L 2A0LD 2MWCA 3P9LA 3TIEA 5IROC 2LAGB 2D7PA 3IF1B 5K9KA 4XNUH 3BVNB 4Y16A 3QEGH 4BQBA 3OKLB 4H0GA 2HT3D 1I9RH 4GMTH 4WI8A 4X9BA 2BNQB 4LRNL 2NQCA 3GMMA 1FZJA 4Z7UB 4RGNE 3ARGD 2EDBA 3QUXA 4G6AC 5E4IA 3C87A 3GDBA 2HT4C 1N3NA 1Z9SA 4E41E 5DJDA 2EIZA 1BD2A 3WFBL 1OOAA 3U1SH 3MNVB 3WFEH 2R39A 3GHEL 3HZVA 5D1QC 5KS9E 3MV8D 3QUZB 1PKQA 4PP1C 2R9HC 2H1PL 2XN9E 5BS0E 1CD0A 3KDMA 1C5BL 4OD3L 5AD0B 5KSAB 1CT8B 3LEXB 3QQ3A 3Q0HA 2X89D 3CJJA 1I7TB 1ORSA 1BECA 5HVGB 4LL9A 3S34H 5DC4B 4MSWB 1QVOA 3MREB 4KAQH 5HDQL 1SVZA 3ZLQC 4HK0A 2OS7A 4LCCA 3HRPA 4HBCL 1DQJB 3LY6A 4NO2A 2GUOA 4QHKJ 4HC1H 4YHLH 5EIQA 2V7NA 3EOAA 4PRNA 1OAXH 2MCG1 2DL9A 5ABDE 3REVB 3VH8B 5IR1A 4PRHD 1CLOH 4OCRL 4PJIB 2BVTA 15C8L 5C0EB 1CXIA 4WW1A 4LVOC 3TO4A 1WISA 2JELL 1AXTL 4QOKD 4FFZH 5FKAA 1U8OA 3DGCR 5JLZB 3ESUF 3TEUA 2BNRD 3VXSB 1JUFA 4U0QB 1DANU 5FUCC 4Y2OA 1H9VA 4H25B 1GOGA 1QACA 4U6YB 4YBLB 1FRGL 5D4QA 2X4NB 4OD2B 4QXGH 4D2NA 3HE6D 4LCYA 4DN3H 5I1JH 1W8OA 3UJJH 5EZOL 1N0XL 2UZXB 4YQXL 3MRDA 2QSVA 4I2XE 3QDMB 4QRPB 5H2BA 2W0PA 1MHEB 4HHAA 4JM2A 3HMWL 4X9GA 3E6HA 3WLBA 3FO0L 4PJHA 4ZPTA 4BQ8A 3MO1A 4LIQE 2IPTH 3RI5F 4WTWA 5IQ7L 3CFCH 2VZ1A 5E2WL 3IDYB 4LOUD 3THMH 5C0AD 3FO9B 2X05A 3TZVC 3AU1B 5IQ9A 1RZGA 1W0WA 5C70A 1SJEB 2VJXA 5ERWA 1TNNA 4DN4H 4W70A 2NY1D 3ZE2F 1P7KB 3B2VL 3PV6B 4PRDB 1CE6B 2DRUA 4WV1A 4QF1A 1T21B 25C8H 1QFOA 4Y4HA 4BUGA 3QEQE 3NGBB 2OSLA 4GRWB 1OARL 3RWJB 2ITCA 2BOCA 3TH2T 5K9OB 2H9GB 5F1IB 4C83A 3PE9A 4DKAA 2QLVB 5BVPL 4KWUA 2ICWI 4ODTL 1KTLA 3Q5OA 5LAXA 5I2IA 1QEWB 1FO0B 3P9WB 4X7SH 4JFQB 2AJZB 2WBJB 5SWSD 1MCCA 3BKMH 4PV9A 5D5MF 4Y2DA 4L8DB 3VGHA 1FV1A 4RWHA 1G1CA 4MA1B 1QLFB 2AKRB 3P0GB 2P8PB 2X9WA 4XMKH 3K81A 4KTDH 4AQOA 5HVHB 4JN1H 2APXA 1XGQA 1IQDB 3W5MA 3NCYP 4JZOB 4ZQKB 3ZZ1A 1BIHA 1NUFA 3MV7B 1HH9B 1IM3A 4R7DB 2MMXA 5DHVA 5GHWH 3OJDA 2WM0A 5F3BA 1BFOB 1WBZA 3BPOB 5F7EH 3QDGA 4KJWC 43C9A 5KZCB 5ESQA 4G42A 3BDBA 1HIML 3MSPA 3IFNL 4ZO8A 1A9EB 1YNKL 3RY6A 1U8PA 4Q6IA 4LRIA 1EMTL 1PX3A 1VESA 2IQAA 3HLAB 4HS3A 3L9RB 4I18C 4JRYA 4OZHF 4OZGE 4UINH 3T4AB 1XGPA 4NC2B 2XTJB 4JFEE 5D9SB 4X6BB 5C09E 4P2OC 3U4EA 3O2DH 1REIA 1D3CA 1OTTC 5CJOL 1OSPH 1J9CT 1OSZA 1FLRL 4N0UB 2VLJA 2P5WA 3SE3A 2X1QA 1AQDB 5D7LD 3S5LA 3KPMB 3SEPA 3U46A 3T0DA 4I5BB 1KENH 2ZJSH 4NM8L 4FOMA 2BVQA 4N5EC 4P46C 2WUBL 1ZWIB 1BFSA 5JOPD 3SY0A 1NBVH 2MPAH 1ORQB 5BJTB 1UWXK 1TZGL 4ZFFA 2CGRL 4PG9B 2FH6A 1KIRB 1C12A 2JB6A 2YUVA 1L4IA 4OF0A 2P7TB 2PW1A 4OZ4B 3RIAK 5E8OA 4M43H 3A6BH 3FKUS 5ICZA 4WO4D 1Z5LB 3IVKA 5IMOA 3PGDB 3NFPA 1Q9KB 3G6AB 1JV5B 2PYFB 1SY6A 3LEYH 2I25N 3O2VH 4XCCH 1OGAE 1U8KB 4G3YH 2VQ1B 2X4OB 2GTZA 3GUTB 2FH8A 4OQ1A 2BZDA 4YXHL 4XPAH 3QHZL 1DANT 3NIDF 4TUOB 3IGAA 2NY4C 4Q9BA 4PB9L 1XF5B 3IYLW 3M17A 5J12C 1ZT4B 3V5DA 5DZOA 2R0ZH 4G6ML 1NC4D 1S8DB 1Z9LA 4GAFB 1R0AL 3PP4L 2IQ9L 1MCIA 1JGLH 4HCRA 4KHXH 1AE6H 5K33A 3WIHA 2NXZD 4LASH 3SDDA 5LQBH 1UB6A 4X4MA 5HGBB 4AH2A 3TH4T 4ZFGH 3JVGA 5HI4C 4BH7B 5H35A 5IT2H 5CWSA 3QPXH 5IW6A 4NC1C 2ERJC 4BFIB 4TUKH 3QSKB 3L3KA 4KROC 1TPXC 4BZ2H 5I73C 5J6HA 1ZKAA 3IJSA 3VJ6B 1UACL 4FZ8H 3FB7B 3TCLB 1FZOB 4KZDL 5J9PB 4KJPC 5D8JH 1DQTA 3FQXA 2DYPD 1TZHB 2FLRT 3AVEA 3TCXA 4FQQB 4MNGB 1WZMA 3CH1A 4PD4J 1AJ7L 1LK3L 2R0KH 4NGHH 3VDBA 3K1DA 4WGWB 3WSQL 4HKZB 1CFNB 1ZSDB 2J8OA 3MRHA 1VEMA 4LFHD 4IOIB 5AG9A 2EKJA 1UXWA 2K9UA 5TE7L 3L3GB 3CLFL 3LV3B 3CVIL 4K3EH 4LPTA 1JGUH 1XCTB 4OF7A 1HWHB 3RX5A 2JIXB 1ZS8A 3KYKL 1XGTA 3OJMB 3BO8A 2W60B 1UWGL 2EICA 4J2XA 4KI5D 5I8OH 5GRJH 1FJ1A 4G5ZH 1G7IB 3MRRB 5CIPH 2PYEE 1NEZG 1QA9B 1SJHB 2Y7QB 2YHGA 1HHHA 5B39A 4XPHL 5B4MC 3SKJL 3K8KA 4WTZG 1EBAA 1NSNH 1MJ8L 3BMWA 1SBBA 3GSOA 1C08A 4F3FA 5GJSH 3ZE1F 2DQDH 2NX5B 8CGTA 5GRZA 4L5FL 4WU5B 4J3TA 4JO3H 2J4WL 4PJ8A 5GS0C 3C2AH 3K3QA 3SKOB 1HINL 3PHSA 3HE7C 2XT1B 2A38A 1BM3H 7FABL 2GJZA 4HIIA 3SE8L 4GS7B 2V7HA 2BY1A 2GITB 4P9HC 2HLAB 4E5XA 2OJEB 4O9HH 4HPOH 3IETA 4WENB 3RVVD 3UEZA 1P1ZA 2DOCA 5F89B 2B1AL 3ZKNC 3KVQA 2ICCA 1ZVSB 3A6CH 2XTLA 4ZODA 3ZT6A 3MMEA 3VI3F 2YK1L 4L4VA 1TTFA 4RGMC 1KCSH 1EK3A 3H9SD 1FVEB 3O41A 1YEGL 1J5OL 5H94A 5D5MA 1FAKT 1LWRA 4OLVL 2CRMA 2RBLA 4K8RL 2K7PA 3O3BA 5F8QC 1KBGL 2Q8AL 1G9ML 5E70A 4NKQB 4DGIL 5J1TC 1ED3A 4FQ1H 2VDMH 3WUWG 3HG1D 3CMOH 2NW2A 1ZLVK 5MENA 1XGYL 1RUQH 1A9BB 1D5ZB 5FCUL 5JXAH 5FOBA 2IFGA 3U7WL 5L2KA 3WDHA 2L4OA 4XHJD 3RL1B 2PXYD 5C0BE 3BGFC 1JF5A 1A1MA 4UDTA 5EU6A 5I8EB 1Z3GL 3QIUB 4HIXH 4MJIB 4P2RB 3OAYH 4QO1A 1WTGT 1U93A 4J1UA 4L3ED 4YHIA 4BZ1L 3MGOB 4MQSB 5MP6L 1BZQK 4OZHA 4CMHB 1INQA 3X12B 3U36A 3ARFB 1E4KA 4QEGA 5IFJB 3BWAB 1DN2A 3WJJA 2Q20A 3N50A 4FTVB 3IDXL 1HHKA 2OL3A 4Y4FC 3VW3H 4WU7B 2XY2A 3CVHL 3GSNH 4AIZA 4PGDA 3ZO0A 1V3LA 3DROA 3LPFA 5T3XE 4TNVK 4PJEB 1F11B 3N85L 4Z7QE 5DRNA 3BEVA 1CGXA 4XCEA 4NYLA 3VWKD 4G8GE 5MEOB 4JY5L 3U0PA 3ULUH 3BZEB 3PNWA 5DO2C 5I9QC 4R2GC 4PRPA 4GKZA 2NYYC 3GMRA 1WZ1L 4G8IB 4NNXB 1DBJH 2IPUG 5TE6H 4KKBD 1RK1B 2P4AB 3S9DB 1KCLA 3DUUB 2DWEA 4AM0B 3O3EA 2YSSA 4JGMA 1QFWL 5EZLB 3SGDI 1JZ4A 4PJ5B 1FG2A 4LP4A 1F4HA 4IMKC 1GOHA 5D2LB 5ITFA 4JVPA 3BH9A 4GUPB 3BPCB 1P2CA 4JFPB 5IEKA 3TPUA 4OGYH 1VADA 3TV3H 3MBXH 4I0PC 4JREB 2GJ6A 2DMBA 4JQXA 4PJ7F 2BJML 5D7SH 1LEGB 4OGAD 1BBJB 2GYSA 5I1LB 1LNUB 2X70B 4P2QA 3VXUA 3MBEC 4PS4H 3GMLB 2C3GA 3MA9H 3ARBB 3S7GA 4LVNC 1T5WB 3ULVH 3CK0L 2E3VA 4GBXA 5ADOH 4P9MH 4Y19B 1CD8A 1NGXA 2DTML 3C60B 3LPGA 3QBTB 5DJYA 3U6RB 1J8HE 4NQTA 5EBWB 4XMLL 4LVHC 5AAMA 4V1DA 1JGVL 1E28A 1MJJB 4OKVB 3ZL4H 5SWZB 1G7MA 3KWWA 4MZ2A 1HYSD 3V6FB 4PJCB 1FDLH 5HHQB 3WL9B 3QFJA 4XT1C 3L6FB 4R0LA 1TTUA 1TLKA 1EEUA 3B9DA 2AJUL 1OP3K 3CFDA 4YHML 3RVXD 4AEEA 2V2WA 1YMMD 4TYUA 3IJHA 1OAKH 3AC0A 2FL5B 2P8LA 4JFXB 3B2UC 2GK0A 5GRVK 3RPKA 4EI5A 2NY0B 4P3CL 3RFZC 5DJ0A 1MREH 1MFDL 1M05A 2R1XB 2Q76A 1FL3A 4HT1H 2ICWB 4HH8A 2G2RA 4YHKH 3RJDA 2ICEB 3LH2H 2IAND 2FGWH 1QBAA 3K7UA 5JHLL 3UAJC 4OCLC 1CGUA 2AXJA 1I7UB 2EE2A 1DQML 2RIKA 4FXKA 3AM8C 3BX7C 4OZIB 4XRCA 3WDJA 3KPLB 3P0VH 2D0HA 4NZUL 1UWEL 2EYTA 1KXTB 1AI1L 2Q6WA 5A2KH 4WFEE