5B4MC

Crystal structure of an fab against human influenza a
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
221
Chain Sequence
DVKLVESGGGLVNLGGSLKLSCAASGFTFSRYYMSWVRQTPEKRLELVAAINHNSGRTYYSDTVKGRFTISRDNAKNTLYLQMSSLKSEDTALYYCTRHPLIYHGNYLDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab heavy chain
publication title Crystal structure of an Fab against human influenza A
rcsb
total genus 44
structure length 221
sequence length 221
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5b4mC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5b4mC01
4GJTB 5F7NC 2WWKT 2H2SC 2O5YH 3BH9A 1CR9L 2PYEA 5KVFH 1QFWI 2XKNB 4YHIB 5C0EA 3S3JA 2OBGA 4PB9L 4RGMB 2WK2A 3ZKXB 3DXAA 3KPNB 5MENA 4MAYD 5HVWA 2FH8A 5HPMB 3AREA 4LRIA 2CDFA 4X9IA 2P43B 5DHVA 5HHMB 1UG9A 4M7LH 2MWCA 3L7FA 4MA3B 5DUBA 4R26H 4K7PY 5I2IB 3AS1A 5E4IA 3ULSB 3ROOA 1EFXB 1RAMA 4PTUA 1L7IL 2CLRA 4O5LH 4WTWA 1EXUA 2CMRH 2LU4A 4Y2DA 3G5XB 3TNMB 2GFBB 2XACC 3SJVD 4Y19D 4PJ5D 3WSQL 4K3GA 4LPUA 4L8BA 4I0PA 4HGKC 1UXSB 5IESL 4YHOL 5C6PB 5JQ6H 2APFA 1TJIL 5FV2A 1NAMH 4LASL 3GBML 1E27B 4WI8A 4Z95H 4L8DA 5B3JF 3U0TA 3C5ZC 1L6XA 5FM5O 4YH6A 4QRRA 2YRPA 4FG6C 2X70A 5K59E 3TA3A 4JQVC 3B9DA 3MBEB 3NCEB 3VFSB 1FN4A 2WZPD 3MLPA 3SO5A 3X12B 4K94H 3QI9B 2H3NB 1MHCA 1G6RB 1UJ3C 1GRWA 4LLQB 4CJ1A 1P84K 3KLSA 3D0LA 3FRPA 5KTEL 2OCFD 5DD1H 3QIUD 2X4NB 1KIRB 1ZEAL 4DW2H 4LSRL 4G7VH 4Z7VE 3HHRB 3BKYL 1U91B 3SDCC 4L4TD 1GZQA 5JR1H 1RZGA 2IQ9H 3ETBF 1T1XB 5I1AB 3VXRA 5SWZA 1HKLL 1RZKH 2EYSB 1TIUA 1W72A 1WZKA 2AJUH 3ZTJH 3QNXB 4P9HH 4YXKH 5DR5H 5E6IC 1KCKA 4ZO9A 3NCJH 3O41A 3O4LA 3C6SB 1RULL 5KN5A 1F8TH 5KSVB 4YK4B 1T22B 1BWMA 5D1ZA 2BSSA 3SDAD 4Z8FL 3H2WA 4JDTH 2JJTC 4OIBA 2PW2A 5DGRA 3Q5TA 4N8VA 3MCLL 3NIDF 4ERSL 2D7OA 2ED7A 4FQ1H 2B7DT 3RDTD 2DTML 1NFIA 1NCTA 3SBWC 5HYEA 1JNNH 1P7QA 4G6JH 1I7ZB 1FYTD 1VA9A 3MNWA 3EFDL 5FFLA 3ULVH 5I30L 4WFEE 4GXUM 4EI5D 5FGBA 1IGJB 4X80L 5JXEA 4BJLA 2BX5A 1QSFA 4AYFA 4U2YA 4JQIH 1G9NC 2DL2A 1U8HB 3HPJA 5I1GL 3U9UA 4XP4H 1G9MH 5EBWA 4RFNC 2HA1A 5HHPB 5E4EB 1N6VA 2X2YA 4TPRL 2XWJB 5F9AC 1F6AB 2IWGA 3ULVF 5FCUH 5GXBB 5MHSD 4NRXA 1FJ1B 3PGDB 4H1LH 2BNRB 4S2SB 5EBGA 3MRCB 4J3UA 1IRAY 2CRIA 5CJ5A 2QKIB 3OR7B 5I1EH 1Q9KB 1H0DA 4PJXE 3P30L 1XCTB 3QDJE 1FAIL 5C8JB 3Q3GA 3T0EA 1R0AL 4DGVH 3RVTD 1WIUA 1M7DA 3WIIH 3UTOA 4QCIB 1CVRA 4F58L 3CSBA 1YEJH 5I16B 3EYOA 4RFEA 2BSED 1NFDB 1QEWB 1XIWC 3GMLA 3L95B 4FFYL 3VXME 1KELL 4ZOEA 3DO7A 1BLNB 3TGXA 1M71B 4BQ9A 3F7YB 1JL8A 3DX7B 2F5BH 3GMMB 4O00A 1INEL 1BJ1J 3ZYJA 2Y1VA 1BIIA 3MRMA 3SKUD 5DURB 1ZSDA 3BMVA 1MWAB 3QIBA 3NIFE 3D9AL 4R7DA 1M6OA 4Y4HC 1EA9C 4NO2A 2NR6D 5E94A 3GGWA 4N90D 4PJIF 2Z91B 1LK2B 1U3HC 1XF2B 4PRIA 3SCMB 2F53E 2MSPA 5DEFA 3JWOC 4F7PA 4RISH 3DARA 2CRZA 3ARBC 5C07E 4ONGH 4F15B 4MXVE 1CK0H 3D69A 3TN0C 4GFTB 4M3KB 5FKAA 2BXZA 3FB6A 5KVGL 1BQHB 4ORGB 2YK1H 4X6EB 3T8XB 4X5WB 5JOFB 4RA3A 3JTTB 2IADA 4ZFOB 3HC4L 1HHHB 4GKOA 4KK6C 2A77L 5B21A 4OZGF 2OSLA 43C9B 1DN0A 1DSFL 1R5VB 5E5MA 3NCCB 3BZDA 1NCCL 5F3BB 4L3AA 4R4NC 2FLBT 2EIDA 3HG1A 3WYRA 5HHOA 4UNUA 1CL7H 3QDAA 3MLSL 4DN3L 1AKJA 2ZKHL 4HIIB 1MLCB 4EDXB 4R90H 3FZUC 1G1CA 1KCRL 3GJEB 5BS0E 2R8SH 4CVXA 3UTZB 3OAZH 3NN8A 5DD6A 1AGCA 3KPLA 4OCSL 5CGYC 2X4UA 4P4KB 3D6GA 3KS0H 4PJEF 1FVDA 2YUZA 4MD5B 1XH3A 5D7IE 3DGGB 1SQ2N 3DX8A 5J12C 4JFOA 4M7JH 1NAKH 1NPUA 4LCCA 2F58H 2BCKA 3C60C 1NBQA 5AD0B 4M6OL 1FIGL 2FL5A 1ZWIB 3HC3L 3TP4A 4H1LA 1OP3K 1OTSC 1R24B 5F7KC 5F6HJ 3CXHJ 1K8DB 4DTGL 5A43C 2UZIH 4RGNC 3TNNB 5IIEA 2APTA 2GAZA 4CN6A 2JF1A 3I85A 1C16B 4Q9BA 3MNZA 5D2LE 2AI0H 4Z18A 4HH9B 2Q3ZA 4BZYA 1K4CA 2A6DA 1QYGH 3SDDD 5F9OL 1FPTH 1FSKB 3MRPB 4WNQA 2X4SB 2IH1A 4PJIA 4MQ7A 4TNWK 1KJMB 4ZFZA 1MVUA 1AGEA 1OAZL 5IMOA 5C0GB 5ALCH 1MREH 4IDJH 4WWKD 3HR5A 5FYKU 5ITBL 4OLWL 3RWEA 3IVKB 3GHBH 2KL6A 3G04B 4FXKB 3UZVB 4X6DE 5JHLL 5I71C 2R1WB 4K23L 1EV2E 1OT1A 4XXCC 2IANB 1GHFH 2AK1L 1JE6A 2BHZA 1IAKA 5IVOA 3U9PL 4OZGA 2EDYA 4B7IA 2DDQL 1NCWL 3RPKA 3BEVB 4URTB 3WKNA 1PEZA 5DK0A 2X4QA 4P2RE 4PGDA 2RIKA 3PL6A 2CLVA 1SJVA 4ZYKA 2WIIB 1CDGA 1N4XH 4XPGL 3UZEA 1RIUL 4YFEA 1U8NB 5HJ3A 5HYJA 2ZUUA 5LWYL 4FNLL 2CIKB 1EMTH 3SY0A 1QRND 1N5YH 4QEGA 2FDBP 3Q0HA 2A73A 3CFKB 5I17B 5F88A 1KTLA 3C9NB 3P4OB 1B3JA 1KN4L 4R4BA 5C0BE 4D8PB 1GOHA 1GGBH 3L7EB 4OCRH 4HIXL 4QXUH 4KHTL 4HH8A 4TUKL 2ORBL 4PJCF 3RWCB 1VADA 4ZXBC 3L9RA 2P42B 3IYLW 3C5SA 1BEYH 1FGNL 2W0PA 3GSNB 1XF1A 2VH5H 3VFNB 1Q38A 4V2BA 4ODXA 3KVQA 2DLFL 1NC2B 2HT3C 3DXAB 1A7BA 2RHEA 2X7LB 5BRZE 5GGQH 4BUHA 4KH2A 3H6JA 5CZXD 1JWMB 5DJAB 1LE9B 3QO1B 1SBSL 5MENB 3EW3B 1DBJL 3MBXH 1ZEAH 5D70H 3DRTB 3DTXA 4ZQKB 2GJ6E 1V3JA 5T33L 2NY2D 2DQHL 3JV4A 3KGRA 4EBQL 1K3ZA 3TH4T 4G6ML 1E4XL 3EOAB 3MRLB 4OB5L 4JVUA 5T1DH 1T83C 4WHTA 3RKPA 4ZS7L 3BH8A 2ZOKB 1J5OH 1J7VR 3MROB 3OKMB 2DQUL 1KTDA 4PY8I 2VIRA 4KMLB 4QRSA 3X14B 3HRZB 1IAOA 3MJ7A 3UTPE 2Q3AA 3O9WA 3OZ9H 3JV6A 1RULH 2X9XA 3IFOA 1G9EA 5HHNA 1S9XA 3V52H 4Z8FH 2V7NA 3U48A 3HMXH 5E9DB 5C0IB 1OTTD 5EBLA 4ERSH 4MQTB 4N8CH 4UQ2B 3HE7D 3TO2A 3CVIH 3BEWB 3TA3B 4B50A 2LE9A 2BMKA 1WITA 4XPHH 3CDGB 5CJ8A 4ZNEE 2ARWA 4OGXH 4GRMB 3OAUH 3LEVH 3OPZH 2C1PA 5DRWB 1S9WB 4Y16B 4TTDD 5I19H 1H3PL 5D7JC 1VGKA 3NOIA 1BFVH 4X83A 1YMMD 2G75A 1ES0B 3RL1B 2YRZA 5DLMH 4UV7L 3C6LC 4LLAA 4PYHA 2WBWB 1KJ3L 2CIIB 3T0BA 1L7TL 4TPRH 4YO0B 4LGRB 3R8QA 5ID1A 3B8YA 4JKMA 3L6FA 2UUDK 1VGEH 1MJ8L 5IMLA 3OAYH 2MPAL 1YEEH 3GB7A 3WNOA 2I5YL 1KCUH 3T1WA 2R2HA 4HV8A 1DE4B 5JW4N 3STBA 4PJCA 5T1KA 4FQQB 2A9NL 4Z7WF 4OZFB 2HJLA 1G7QA 2KDGA 4CJ0A 3BGAA 4F58H 3O4LB 4QXWA 4NHCL 1HXMB 1RJZB 2BSSB 1KT2B 3LRHA 4MCYA 1BX2A 5F1NB 1S7QA 4D0BA 1PBYA 1R3KB 2BNQD 2NY6B 3B9KA 5E6YA 4AIZB 1P9MA 4WVRA 1ZT1B 3NCMA 2XFXA 4GAGH 1PKOA 4DQOH 4CU6A 4HUUA 5M95B 4JFHD 4F3FB 4YQXL 3VD7A 1A3LH 2EXYD 1MFCH 2F54E 1IM3A 3FRUB 5DQJA 3FJTA 2KBGA 3EOTH 5TQ0L 3BP5B 3U9UB 1QOKA 4WI6A 3VFGH 2NX5B 1BOGB 4I3SH 5LQBH 3O45B 2CK0H 3REWA 3WS3A 3HZKA 1FL5B 4JRYD 4XNQA 4MS8C 4KVNL 2Q8AH 2AJXL 3LKSA 4ZAKD 4GAJH 3MMEA 4R2GC 3BDBA 1QG3A 3D0VA 1QFPA 5J3HC 4K8RC 1SBBA 3D1MC 2BHYA 1JGLL 2Q86B 5F9JB 3D39D 3OB8A 5D96B 3TZVB 2AQ1A 4HFUL 2E9BA 3ZDYE 4XVSH 1RZIB 1L9MA 1PYWB 3HMXA 3LMJL 3C08L 5I8KH 1QBAA 5IM7A 3BD4A 3OGOE 1KCRH 5CCKL 5E8DL 4NJ9L 1HSBA 3CFDA 1ZLWH 3EDDA 4I5BA 3DO7B 6FABL 4HKXA 1J1PH 1SJXA 4XGZB 3ARDC 2DI8A 5F1SA 5CEZH 4EDWH 3DSNA 5JA8B 4O51A 2Y4SA 4NN5B 2VN7A 1T7YA 5DJ6B 2EE9A 2H1PH 1BIIB 1Y6MR 1YMHB 1VACA 3T1FA 3QP3A 1PGRB 2AEPH 4NN6C 4JLRA 3QIBB 2BY0A 2PO6C 1FIGH 3CX2A 5D1QD 4MNQB 1MI5E 3BGMB 4R7DB 4NO2B 4UOW0 1E4KA 3RWDA 3UP1A 1MCNA 3QDGD 1Q0XH 4Z7WA 2EH8H 2VABA 2EYTA 1A7PL 1J1XH 1EGJL 3DI3B 4DOHE 4JFZL 1OQOA 1IC4L 3PV6B 2FD6L 3RBGA 1OGAD 1P84J 2ZUXA 1V3LA 2JJVA 5JIPA 2A0LC 4KUCD 1FGVL 4QRUB 4RWYL 2QQKH 3PGFH 4X99A 3MLRL 3QT2A 1DN0B 4WTXA 2FO4B 1YNTB 2EC9U 3EYSL 2R69H 4JQXC 4N5ED 3UPRA 5LVEA 1OT2A 32C2A 4E41B 5E8EA 4PREB 5HGDA 3NTCH 4BZ1L 1EERB 3OKLA 1MAKA 5C08E 4LU5L 1SYVA 4NKOA 4CVXB 1N5AB 1MQ8A 5IHZA 3ZMRA 2LAAA 3VRIB 3W82A 5FF6B 4CMHC 1ZGLB 1BZ7A 1FVDB 5TDPB 1TTUA 3TT1H 4WV1C 5DD0H 3VD3A 2R29L 4EOWH 3VRLE 3C8KB 3FONA 4QHUB 4D0DA 3MLXL 4ZFFA 3HA0A 4HGMA 4R96A 4JN1L 4W6WB 2E9JA 4MAUH 1HOCB 5I1CH 2HKHH 1BIHA 2FL5B 3RFZC 1R3LA 1X5FA 2R0KH 3QB7C 3VXUA 1Z6JT 3ARRA 5EIQA 2V5RA 1HQ4B 3O8XA 1ZHNB 1I8MA 3BOVA 3B6SB 5E2UL 2B20A 3C09B 3PWLB 2ZCKL 4GXVL 3N85H 4S1QL 1NDMA 3AU1A 5IGXH 2OQJB 5JW3L 1P7KA 3QEHB 4RGOH 4MD0B 3GSUB 4L5FL 4HZLB 4FMKA 4IEFB 1LEGA 3FO0H 2HN7B 4MAYB 4P3DB 1EUTA 4TUKH 2EDRA 2NY3D 1LDPL 4I48A 4L8SA 2IALB 5CINH 1VFMA 5ANMA 1CIDA 3VGFA 1XGTB 2ZUYA 5C86A 1Z9MA 2ZCLH 4WNQB 1FG2A 1MIML 3O81A 3OKEA 5GGSY 3GI8L 4XB8A 2ESVA 2Y6SC 3EGSB 3PIQB 3WN5B 2EDKA 4KV5E 5JW4R 1T3FB 3MXWH 1F2QA 4J6RH 5EU5A 3VFWA 3WXWL 2NZ9C 1DBJH 2AQ2A 4POZC 1FH5H 1CLYL 4IHOB 4N1CA 3V7MA 3GNML 1AO7D 2VAAB 4G80B 2JB6A 4Y19B 4PJ5B 3U30B 3OHXA 4R8WH 1LO0L 3BAEH 4CVWA 2DQHH 4OF3A 3NPZB 4QNPF 3LH2H 2BNUB 1DANT 4GG8A 3SGKA 4G6MH 3TBYB 4NO5B 4OB5H 3QHTC 4I9WE 1MAML 1WBYA 2HT2C 1MJUH 3QEQE 2DI9A 2V2TB 1KTRL 1A14H 4KI5D 3AFLA 3HAEG 4ZS7H 4HQQL 2FIKB 3FN0L 2Q6WB 4NO3B 2OTWA 2NW3A 4V1DD 3T08A 1LP9F 4HZAA 3HCVA 3QRGL 4N0UA 1S7TA 1WJ3A 1RUKL 4HF5L 4RMVA 1QACA 4IRSA 3CLEL 3KPMA 5E7BA 3PHSA 2GY5A 1F4YL 4PJEB 1X5GA 3BUYB 5LKNA 5IBLD 3LAFA 4L3CB 3DUHA 3LV3A 3QIUB 2Z4QB 4NHUB 3TYFB 5DEGA 3S88L 5LXGL 1FORL 5IEHA 2D03H 4K7FA 4WI5A 1I85A 2A1WH 2GHWB 4RSVA 3QG6A 3BZEB 4XTRD 3MREB 3W0WA 1L7TH 2E3VA 1HSAB 3DTXB 5IR1A 4UAOB 1J05B 1KEGL 4HUXB 4I77L 1FL6B 3I6LD 3NFPA 4OSUH 3JZ7A 3N1PC 2UZXB 4TVPE 1WV7T 3O4OC 3SDAB 2VXVL 5ERWA 1GL4B 3BQUC 3QXDB 4I18C 4Q6IA 3KYAA 4TUJA 4KUCF 3L5HA 3WNMA 4HLZG 3LN5A 2DAVA 1R5IB 4G42B 4QRSB 2WV3A 1V7NH 4XCNA 4QF1A 2Y36L 4HPOL 5D7LD 5GRWA 3O2DH 3RP1A 3IFOB 4EI5B 4HWBL 5IBUG 3MCKB 4P2CG 1WFUA 5C9KA 1JZ4A 1HHIA 2H2PC 4N68A 4M4RA 5T3ZH 5TF0A 1FBIL 1CD8A 3QWRA 4H25A 1BREA 1B2WL 2Z8VC 1SJEA 4WEBL 1EX0A 3MJ9L 4GRLD 2BMKB 1UYWL 5DMGC 4MA8H 5BVJA 3HMWH 4GQ9L 5CMAA 3VWKA 4OZHA 1GZPB 5DF0A 3RTQA 5EU7E 1N8ZB 4JFED 3ARGC 1XF4B 3FT3A 2X44D 3T77B 3HC0A 5KS9A 1PSKL 1LP9A 1S8DA 3N1QC 4OLZH 4MJIE 5C2BH 1PKQE 2EIEA 2ITCA 1Q9WA 3HUJF 1JTPA 1A1OB 1UA6L 2P7TA 2R2CA 4HW6A 4LSQH 1PQZA 4YFLI 1NL0H 2DM3A 5J1AB 3EYUL 3M8OH 4XB7A 4OF6A 1M7XA 2LVEA 3M1BB 1TQCC 4P5TC 4U31A 4MX7B 4DGYL 4M03A 1HQRB 3OJMB 5SWSD 4KKLC 4ZUWA 3IETA 1IGIH 4JZJB 3HR6A 2NY1C 4MD4A 1BBDH 1RJLA 1CFNA 2EE3A 2R23B 3UTSA 5EU7C 1U42A 2H2SD 2MHAB 4LVHC 4X4ZA 4PJAF 3FFCD 1P1ZA 2Y5TA 4UV4L 2OZ4L 5LCVH 4KTEH 3RL2A 1WICA 4G9FA 2Q8BH 1XCQA 4Z7UE 2P5WA 4PRBA 4NQEA 1CFSA 3E3QE 3KJ6L 4U1NA 1WAAE 4JDVA 3NA4A 4X9FA 4Y5YA 4OT1H 4TN9A 2UY7A 2JCCE 4X7DC 4POYA 1IM3B 5DQJB 3L5WA 2GKIA 4J3TA 4JFZH 1S7UA 1NEUA 3RIFK 3MRHB 5DUMH 1FDLH 1JNJA 1MFBH 1CBVL 5FYJE 3U4EA 4XNQB 5FEBA 4XP1L 1HWGB 1I4FA 2HJFA 1JF5A 5F8QC 1LO2L 1YY9C 5EZIL 3V5KA 1QBLH 25C8L 2N4IA 3D48R 5TE6L 4QTIH 4UDUA 4U6HA 1CFBA 4PBVC 4O4YL 4HSQA 1INQA 3FCTA 3O2DA 4LLWA 4WU7B 3D18A 5C6TH 3SGDI 1OPGL 2CUMA 1X5KA 2B5IC 4QXGH 1RIVL 3LEXA 1CI5A 3C5ZD 3CJJA 4R7NA 3N9GL 2YMXL 4OCYH 4OBSA 2DMKA 4P3CH 3E3QC 3HZYB 3PE9A 5J1SC 1ERNA 3F12A 3UJJH 3EJYC 3JWOL 2FWOB 4M43L 1UJTA 1CE1H 2MMXA 1VEPA 4OKDA 2WSKA 5J13C 1VACB 3O6FD 1BFTA 5HY9A 3WLWC 4Q0XH 5B39G 5JW4M 3MNVA 3BPCA 1J0YA 1A4JA 5K9OB 3UXFA 4Z7WB 1JNLL 4NQSB 3DI2B 2EZ0C 1U95A 3P40A 5DMKA 1RUAL 3MV9E 3VXSE 4NUGH 3SDCD 4M00A 4WUUE 2R2EA 4PJFF 3SDDB 3WD5H 4LKXB 1D5IH 1YEDB 1RUPL 5D8JL 4JFDE 4JREB 3UMTA 2M2DA 4PGZA 3ECBB 3GIVA 3X3FL 5JW3H 4WWKB 3F65A 2R0LL 3L3HA 4L5FH 4X8JA 1H3WM 5CJOH 5CZVH 5E6ID 2WQRA 1NGQL 2EKSA 2CKBL 5CBEB 5KVEL 4HPYL 4P2OD 1U8OB 5E5UB 3UZQA 3OKNB 3RWJB 4M5YH 4U1KA 1TJHH 5JIHA 3BDYH 1FFRA 5JDSB 4K3HA 1DQDH 1JJUA 4HKZA 2UWEE 4I4WB 5J8OA 1A6TB 2Z31C 3QA3A 4FA8A 1L0QA 2AV7B 3MA7B 4M6MH 3UPCA 4BKLA 2FX9H 3NA9H 2R9HD 3VFOB 1SVZA 1CTNA 3VU2A 1ZA3B 4OCWH 4BK4A 4UTAH 2VQTA 3QFDB 4WHYG 3FN3A 2KZ1B 3RY5A 5JPMA 1H15A 3EJZD 4F7MB 1QRNB 5C0DB 4R96B 1A0QL 3L5XH 3ZHLA 4LHUG 3QXUA 1JHKH 5E2WH 1I8MB 4PRHE 2D0GA 1KBGL 3BWAA 3TO4A 3V4PL 3MYJA 4P2QA 5D7SL 2GJZB 5LAXB 4H0IA 1I8KA 3W39A 3CLEH 4XC3L 4RAUA 2CDGA 1WSST 4HUVA 4L3EA 1CWVA 1QO3B 3FO9A 4D9LL 4M4PA 3PQYE 3CDYA 4CU8A 4X6CF 3A67L 5DRNB 1YC7A 4OFPA 3I6KB 5EC1A 1FLRH 2LFGA 2CRMA 3SO3B 1XIWD 2NY2B 3D2UD 4WFED 2OL3H 3R0NA 3K80A 1CZ8L 4KK8C 4LPXA 3RZCD 4JY5L 1GVIA 1TZGL 2ESVB 2ITDB 3OXSB 4G8GE 1SYSA 4M1CC 4MJ5A 1CT8A 2YPKA 1OGTB 1QSEA 4ZPVB 4PJFA 2PCPA 3NBNA 3MRGB 5I18H 1UZ8B 2EXWD 3CPLA 1A22B 2WWMC 1KB5L 3TESA 3WJLC 4MQXD 1AP2B 2YBRA 4LLUA 1CDCA 1U3HD 3T3PF 1A7RH 1BVKB 4NJAL 5DTFB 1QQDA 1DVFA 1I8LA 1FCCA 2J8OA 4XCCH 3LS5H 1IGTB 4GLRH 4JZOB 5D2NA 5KVDL 3WFHB 1MF2L 3QDJD 3HE7B 5GSVB 2NY5C 4KDTC 4S1SL 4Z7NF 2DRUA 3T2NH 5E99H 2EO1A 1E4XI 5GSRA 1QLRB 4WTZA 3VXMD 3S34H 1A3RL 5DGQA 2YSSA 3O3DA 3UBXA 5FO9B 2D7PA 4MSWA 1YMMB 2P8MA 3V5DA 1IQDB 4YK4C 3SDYH 3LV3B 5I15L 1NANH 3BPLB 5B8CB 4LSUH 4XBEL 1JGVL 1FFQA 5J11B 5E6ZA 3VI3E 3I3BA 4YXHL 3KDMB 5L0QC 3IDMB 3ARPA 3N0PB 5FAAA 4JDZB 1P4LA 2F53D 1R3IH 4TQEL 4D0CB 2B0SL 4LPTA 1INDL 5C07D 1IEAB 1T1ZB 2FBJL 5ICYA 2YD5A 2O93L 2F8OA 2VXTH 3TEUA 1HDMA 3PP3H 1RU9L 4FQLH 1R3JA 1CLOH 2AKRA 2CO7B 2FATH 5IG7B 4MB3A 2JB5L 1OTSD 3VXOA 1JI2A 4X6CA 4TUJB 5A2IH 4YHYB 2BNQB 3TCLA 4X7CC 2HVKB 3GMRA 1WT5C 4GG6E 1F6LL 3NABH 5E00A 4F7CB 4Z6AT 1D9KD 3IJHA 3ULUE 1XGPB 5A16A 3NIGE 3GRWL 1MFAH 4RRPG 1DL7L 2C7UB 1G0YR 4PUBH 3UX9B 5D5ME 1G9NH 2N1KA 5BS0D 1D5ZB 5TQ2H 2OTPA 2D9QB 4NT6B 8CGTA 5C0AA 5DFWH 2QBWA 2GITA 2OL3A 2VYRE 3IGAB 3UEZA 2ADIB 2VL5A 1U92A 2HAZA 4JRYB 4GMSH 4ZAKB 4KJWD 3U46A 2YUVA 4Z7VF 5KZCD 1RK0B 3FFDB 1A7QL 4M61A 4KXZI 2L4OA 4YDVB 3X3GL 3FT3B 4JG1L 5IMKB 4XNXH 3D39B 5EBMA 2AGJL 3CC5B 3LKOA 1T0NB 1BJ8A 3G5VB 1ZANH 4QHKI 1C5CL 4DZ8A 5H37G 2HTKC 1Z3GL 5EU3A 3SCMC 3DX9A 1OAXL 5BW7C 2C1OA 1U8IA 2X4RB 3MZTA 3FQNB 4G8IA 3AGVA 2ILLA 3ULUC 5EUOE 3C5JB 3O0RL 4JQVA 4XZUA 4JPKL 3ZDZE 4O4YH 5AG8A 3HI1B 5ELIA 2IAMD 1FO0H 4XP9L 4LVNC 2VITB 1UJ3A 2JELH 5CD3A 1AH1A 2VE6B 2VLJA 1RIVH 3B3IA 2ZSVB 1CVSC 1SM3H 1I9IL 3BKCL 5D1XD 1SMOA 3FAWA 5D1QB 1X5ZA 2R4RH 3LRSA 5T1LD 4N9GA 5EORL 3TBTA 4AL8L 3DGCR 3QDGB 4J12A 4W6YB 2EDDA 1B6UA 5D6DA 5F7HA 1KNOA 1OAQL 5IB5B 1FVCA 4F2MA 4M43H 4QXTB 4AEHL 1OGAB 1TVDA 4PJBF 4OGYL 2HT3D 1KG0A 4P4KC 3MRIA 4PRBB 1A1NA 2X41A 3FOLB 4K8RL 3BO8A 1IT9H 5F7WC 1A6PA 5ID0A 4PFEA 1LMKA 4HXBL 1E6JL 3NGBB 5HGBB 4OQTH 5F7UA 3LKRA 2VB5A 3LZFL 1KJVB 1HZHH 3K1DA 4O2FB 4ODWB 2BRQA 1N59A 2FEDC 3LQAL 2EYRA 4LRNH 3K2UH 5GGRA 2JJTA 1FNAA 2ADGB 3KLAA 1FAKT 3B2UD 3L3JA 3REVA 4WUKL 4ALAL 4YIQB 2R0WH 5TFSH 4KZEL 4A2LA 5E95B 4F7EA 4Q9RL 1QR1B 3MO1A 1GJIA 4AG4L 3SBWA 4ZDHA 1HINH 1J8KA 5C0BD 5HYQB 1QKZH 2H26B 2IPUG 4XPAL 1AQKL 5FDWA 1U6AH 5DD5H 3OR6B 4ZUTA 1INQB 4LLWB 5JNYB 4A6YL 5C3TA 3MA9L 3RAJH 2QL1A 4HJGB 2OXHA 5I8OL 1I3RA 3VJ6A 1ZT4A 3MODL 5EIIB 4C83A 4HFWB 5FB8B 3U2SA 2XWTA 4NGHH 1FSKC 4OV5A 4X4YB 4NOFA 4OM0L 1AD9B 3GSWA 2AEWA 2GJ6D 3HUJB 4JB9H 2AJSL 2ICWI 2YUXA 1I1AD 4MXVF 2ICEA 1RZ7L 4XCFL 1J8HE 1R5WA 4MA7H 1CD1A 4M93B 4CN1A 4OTXH 2GCYA 4QOKE 1S5HB 3IS0X 4FMFA 2O5ZL 3BPCB 2VZUA 1A4JB 1RI8A 3V0WH 1W8OA 4ZUUA 3PWNA 3VCLA 4OZ4B 2MKLC 5I1LB 5LGJA 3QXWA 4H8WC 2CDEA 1F4AA 4NQDD 4G6AC 3UTPD 1DEEA 3FT2B 4U6YA 3QHFL 2NY3B 3VGAB 4XVJH 5CP3H 2VDQL 4TSAL 1ZGLP 4JHAL 5EC2A 1YA5A 3T04D 2GUOA 3S96B 2EDQA 4XC3H 1UXWA 1Z2KA 1A4KA 3GIVB 2B4CH 3U1SL 4OLXL 3WL9B 2VUYA 1FO0A 3T65B 3J8F7 4PJAB 4K3DL 5ACLA 3BPOB 4WO4C 5JPNA 3SKNB 4BFBD 1NBZA 3CLFH 5A2JH 4PJBA 1AXTL 3O6MH 1AO7B 3IRPX 8FABA 4P5KB 1VDGA 2EEAA 4YX2H 2YOCA 3WNKA 5H8DA 5FM5M 4Y4HA 3WXVL 1EEYB 1XGQB 4ODBD 2IG2H 3VXPA 4FQ2L 3QXVA 1B4JL 2W9EL 5MEQB 3G6JB 5DEZA 3I02A 2B39A 4JO1L 3OG6B 3P0YL 4KRPB 3ARBA 4HBCL 3QA3B 4Q2ZA 2W9DL 3TN0A 3U82B 4WCYH 35C8H 1KB5H 1PZ5A 4V1DB 2AXJA 4Y88A 5CJBA 5EOCJ 3CFIC 3QEGH 2DTSA 4KMTL 4C54A 4E0RA 2DQTL 15C8L 3D3VA 1H15B 5INCB 4HC1L 4OQTA 3KYMB 1UM4L 2DWEA 2R39A 4HAGA 2ICCA 3EO1B 1X5LA 3MUGA 5I1IH 1F4WH 4NKIL 5KG9A 3WHXB 1NGWB 1RIHL 3L3GA 5C0CE 1U58A 4R2GD 5F72S 1XR9B 4BA8A 4K8RD 3ARWA 3UTTA 2UZYB 1DFBH 4DVBB 4PP1D 1Q72H 2FZ3B 1J87A 1WFNA 1FNFA 1I8KB 3QUML 4UDTB 3BKMH 5FA3B 2NZIA 5BZDA 4N0YL 4KDVA 1CGSH 4ONOA 5A3ID 3AAZA 4ZTPL 4PGEA 5E8NB 3CXDH 2ICWB 1JWUB 1U41A 1AFVH 1MHHA 1MUJB 2H6PA 3C60A 4X6DF 1YEHL 4KZDH 4KJYA 5BO1H 3HAEH 5EZOL 4L4VA 4Z0BH 5J9PA 3B4NA 3OGCB 2A6JB 1UM6L 3UYRL 2F54D 3ARDD 1MRDL 4XMPL 1BAFH 4KI1A 2HRPL 4MJ5B 3WLBA 1UM5L 1INDH 1Q1JL 1B9ZA 3P73B 3W9EB 4UT9H 1FFOA 4BSWA 2X5PA 5D7LB 1A02N 3TYGH 1T66D 3H9YA 5E03A 1ZLUH 5D93C 3DV4B 2YBRB 1MCLA 1PAMA 4EVNB 5F3HA 1KSRA 3O6LH 1MY5A 2BSRB 4XBPB 5D6CA 5CP3A 1ADQH 2NYYD 2BFVH 1EIBA 3SGJC 5CUSH 4GRLB 4WU5A 5FUZL 1T20A 1U8PA 4JPVL 2A0LD 4DUWA 4TSBH 1QFUL 2X89D 4JFEB 3VFMA 3EHBD 3TVMC 3OB0H 2YSSB 5C9JB 2VLRE 4XXCA 1IGYA 3NZ8B 4XC1L 4M9OA 3GSOB 1HHKB 2KPNA 4ODTL 1ONQA 4NO0D 3ARQA 1MRFL 1FE8H 4OD2A 3VRJB 3TBSB 3ISWA 4U6XA 3PJSB 1MI5D 4HLZH 2XNAB 1ACYL 4L1DA 4OCLC 1KB5A 1MCWM 5LGKA 2APWA 1MIEH 3BP6B 2AGJH 4O2CA 4XCYB 1KC5H 4TRPH 2AXFA 2IBGA 3GKWL 4U1IA 4XPTL 5IFAH 2FO1A 5EDXA 3ARFA 1OCWL 2E7BA 1JN6A 2Q76A 4NQCA 2RBLA 5SWSB 5C0RL 5IQ7L 1R3JB 5HI3D 2HVJB 4OM1L 1OAKH 3PABA 1CDYA 1JPTH 5EO1B 1ZVYA 3DSFL 4EI6A 4ZXBA 1YY8B 4X6CB 1HE7A 1IKFH 3FFCB 4HMDA 4X6DA 3SGEH 3TIEB 4XP9H 1G7PB 1WVZA 1BQHG 4ETQB 3U0PB 1AE6L 5E00B 4L9LC 5IK3A 5CBAB 1DQTA 1MPAL 3MXVH 2X9WA 5E2JA 3T0DA 5D96C 2SEBA 4YHKL 3TZVC 2X4PB 3TF7C 3UAJD 1G7IB 2QQLL 4AL8H 5C08D 4P2RA 2XRAH 4YHLH 4P23D 4Y1AE 1J12A 1ZHBA 1ZVHA 4E5XB 4TVPL 4EJ1C 4KAQL 4KPHL 3HAEA 1R3HA 2NXYD 4M1GH 1FZMB 2G60H 3CCHB 1U92B 3IKCB 2I07A 4PJHA 4RDQG 1MFEL 3C87A 1CXLA 1T83A 4BFIB 2FYYB 1MCPL 3KYOB 3QQNA 3SPVA 2P48B 4OUOA 4EEEA 2PTVA 4LSPH 1LE5A 1OF2B 3NFSL 1IFHH 1WBZA 2XICA 3INUH 3DIFB 3BZ4A 5E0QA 2H45A 5C0FB 2VQ1B 2XQBH 3F5WA 1P2CA 3CIQA 5TDOA 1AR1C 2HT2D 4R0LB 1YNLH 3DX9B 4AENA 1U8IB 2J8HA 3MV8A 3C5ZB 3G5ZA 1ADQA 3I9GH 3D25B 5F89A 5BRZA 1IM9D 3K4ZA 3RHWF 4M48L 5L9DH 2WUBL 3KLHD 3LVEA 1VHPA 1T4KB 4HMCA 1A6AA 3WNNA 1VPOH 5IVXE 3BESR 5GQBA 3BP7A 1F58H 1NGXA 5D7JA 3AXLA 4P46D 2PYFB 3KAAA 3O6FB 1IQWH 3MRBA 4KQ4H 5T3XE 3WFCH 3C6LA 1OLZA 2I60L 4IMLB 4G9DB 1VFOA 1JGEA 5DJCB 1QPXA 4ODUA 1KNOB 4XHJD 1FVCB 4LEOA 3SDCB 4F9PC 1MCCA 5JMOC 1I1YA 5DJ0A 2BY1A 5ISZA 1RK1A 1M4KA 2XPGB 3RX7A 4XP5H 2AK4A 4I9WD 2J2ZA 4JPWL 1VERA 1ZXQA 3BD5A 3Q5OA 4PD4K 2ERJB 4WI3A 5DJ2A 3VFTB 4OIIH 2DQEL 4N5UA 3BWUC 1DCLA 5E6IB 1CXHA 4HUWA 4U1GC 1T2XA 4P2OB 2NPLX 2C3WA 3MV01 4XPBL 4OUUA 1QNZL 1YNKL 3SJVE 1FL3B 4Y19E 3QUXA 4JHAH 1MCBA 3CSYA 1GGIL 3ARYA 3ZDYF 3KPOB 3S98A 3RU8H 3RWFA 2PXYA 4Z0XB 2JIXA 3ET9F 3JBG7 1F3DJ 4XNUL 1HXYB 4FQPA 5IT2L 4XH2B 5TPWL 3K81A 2JJWA 1YQVH 4YGVB 3UJTH 3HS0A 4K3EH 3NMEA 1AD0A 1MCKA 1WISA 3LY6A 2NLJB 2EH7L 3UYOD 4Z7VB 4JR9H 1OL0A 1C08B 4MAYC 3VJ6B 1K6QH 1CGTA 5C3LD 5T5FL 3WIFB 1D6EB 5FYJL 3KR3L 4HBCH 4RFNB 2GTZB 3FO2B 5DZOA 3OKDA 1OAYH 4RMTA 4XHQA 1DQLH 1DEDA 3GJFH 5ADOH 5GS0C 4PJDE 3SE9L 4D3CL 5FA4B 3ARGD 1XEDA 4XNYH 4ZD3H 3RNKB 2YPLE 1JGUH 5E70A 3U30C 4L1HA 5F1IA 3V4UL 5GS1B 1T89C 4XVTH 4TVPD 1OM3H 4JN2A 3VXQB 1JTTA 3SKJL 4L4TE 4FFVC 1KCVH 3KXFE 5GJSH 1KJ2L 4KVCH 4YXLL 4PY7A 1S7RB 3DV6A 3TT3H 3JWDH 3HI5L 4BFGA 3OF6A 3Q1SL 4O58L 5DJ8A 1BBJA 1YJDC 2CDEB 5CP7A 5SX4H 3SKMB 2FB4H 1XIWB 2RQ8A 3X13A 3D2UB 1XGRA 2P5EE 1BGXL 2FR4A 4QT5B 3RZCB 4HS6B 3ARDA 2BY3A 4WHYH 2H9GB 3TH3T 1Y0LB 2AJYH 1JF1A 1UACH 3JTSA 1Q9LB 3K46A 3KPSA 4AZ8A 3IAGC 2M8XA 4RAVB 3QCVL 5FXCH 1GSMA 2PO6A 4NPYB 1O5DT 1FFPB 4F9LC 2X09A 3VRLF 3B43A 1U3HB 4PP2B 3QIUC 1FYTE 4ELMF 5KSBE 3V7AG 4JY4A 3KYNA 2FJHA 2HRPH 5EN2B 1S9YA 4PJXB 5DDHA 2EEDA 3BZFB 4APQD 5DI8B 3KPRA 3QDJB 4LHJB 4BZ2H 3WUWG 4MJID 2B1AL 2DQIL 1JHLL 1RFDH 1I3GH 3QJHA 1TJGH 1JWSB 4K2UL 4W68A 3VXMB 4JANA 5DVOA 4R97B 5DMIL 3HTLX 5EIVA 3I75A 1YYLL 2FX7L 4BSVA 5IJKC 2V17L 3E8UL 1BMGA 3U36B 4GRWE 1XGUA 4FN0A 5L2KE 5F1KC 1P4IL 3GEWB 4FZEL 4NN7B 1YYMH 1EFQA 2W59A 2RGSA 1L0YA 2VDML 4AEFA 3RDTC 1T21B 5HXMA 2CKBB 4FZ8L 5EPMA 4C56E 3CFJA 5BZDB 3N1MC 4CVUA 3AAZB 3P4MA 2F53B 3G08A 4MHHG 5B39A 3OJVC 4EI5C 1AGDB 5C07B 5TE4H 3BSZL 1N3NA 5IF0B 3BPNC 3LQMA 3RA7L 1JZ5A 3IJSB 2W0KA 4YFDB 3IKKA 3SDXF 4KJYB 4LIQH 4YE4H 4ELKA 1TETH 1UKSA 1ACYH 1CU4H 1YEKL 4NRYA 5KSAD 4NDMB 3GJFA 1I9RL 3NPSB 1MJJB 3MFFB 4P4RB 2DYPA 4U1HA 3HPLA 1OB1A 2DJUA 5ESQB 2NY5L 1P4BL 5FYJD 2FJFA 4P59L 1D9KB 5DSCA 3MRRA 3MZGB 5AZEL 1QFWL 4I2XE 2IPKA 4P49A 1A6WL 3RVTC 4N9OB 3K2MC 4NM4H 5BS0B 4PJ8C 1F4HA 1M7IA 2F74A 4HHAA 4PB0L 3RUGE 2OLDA 5C09A 3CVHL 2Y06L 4PS4L 1H3VA 1JGDA 3LPWA 4M62L 5D7IB 1AE6H 3H9SE 3W5MA 4Y4KA 1X3DA 3S37H 4HIEA 4CW1A 4ELMA 2DQGL 4YHKH 3QEUB 3UDWC 5D4QA 1G7HB 1RJCA 1I7UB 3QDME 5KZCB 2QQNH 3OTTA 1KLFA 3FTGB 3L1OH 3MLWL 5I71B 3W11D 1P5UA 1ZLSH 2HWZL 4JZJC 2HJKB 2NR6C 4LHUA 1G7LB 3U0WL 5EA0L 3BE1L 4HT1H 1ONQB 5SWQA 2NTFA 2Z31D 2HLFD 5FK9B 1F11A 5J6HA 1OSPH 1EJ6A 5IB3A 1M05A 4DKFL 4PG9A 3I2CL 4JM4H 5D2LB 3VXSD 1T5WA 3MV9D 2IAMB 1IEBB 1ORQA 1NEZA 4WUUD 4M02A 1EBAA 4CN4A 2ZJSH 3GMPA 1A9BB 1PJ9A 1J88A 2Z93A 1KXQE 4Q9QL 1GGCL 1I9JL 1XT5A 2NQCA 4JFDD 3S37X 5DRXB 2APXA 3PWJA 5D1XB 2ATPB 1QLEL 5GRUL 3RIAF 3CX5K 5T1LB 4EUPG 1J0KA 1RZ8A 2IBZY 1RVFL 4MXWL 3ZDXE 4ZS6D 2AJ3A 4FTVA 2OJZH 4ZXBB 5CIPB 2W0FB 4X6DB 3R0MA 3SDXA 5I66A 3RGVD 3FT4B 5E2VH 5IMMA 2H32B 3IU4L 1Q9OA 2VDPH 4ZUSA 5I76A 5EOCH 5EU4A 4MQSB 4U6VH 1S78D 3QEQA 4HS8H 1HYSC 2R56H 1YPZE 3EYVA 4HK3N 4PJGF 1T1YB 3K1KC 2Q7YA 1FNGA 3IJYA 2P47B 5KSUB 5H37H 1UEYA 5H2BA 4PRPE 1YUHA 3WHE1 4NUJA 3DUUA 1MFDL 3O2WL 3RNQB 3S9DB 4QLRA 5DQDH 1NCDH 1ZV5A 2EC9T 3BQUA 3GSQA 5K9QI 2IQAA 4LFHG 3H3PL 4I18A 2JTDA 4RNRA 4XRCA 3KYKH 4GW4B 2FSEA 3ULUL 2DJ4A 2DQJL 4U7KA 2VO5A 4LF3A 5DWUL 1EO8H 3CZJA 2WWMD 5C0BB 5AZ2H 1UCBL 3OAYK 3THMH 4NKMB 4BH7A 3KPQA 1Z0NA 2R4SH 4G7YL 3ROLA 4PRHD 4YHNA 1JFQL 4F7TB 1NGZA 4AENB 1QSVA 2Y7QB 4YR6B 4BH8A 3MRNA 3P4NA 3G5ZB 4LLYA 1G7JA 1KCSL 3GMQB 3KJ4C 5BRZB 2A74A 2PTUA 1JPFB 1X4YA 4UINH 3BW9A 3RPIA 4YDIL 1VFBA 1BD2A 4Y0GA 1ZS8A 3PQYD 4LSTL 4WWKC 3FO1A 1PG7W 3PWPE 3CUPA 4NFBA 1H5BC 2GJ6B 2VSDA 4N0RA 1I7RA 1MLBB 1I1AB 3BP7B 2J4WL 4EN3D 3Q6GH 1IC7H 1F6FB 1LO5A 4Z7UF 3UJIL 3FHQA 2VISA 3A6BH 4G8GD 5JHDE 3U6RB 4YBQD 2XN9D 1FZKB 2DLIA 1I8IB 1DDHA 1UEMA 5EZLB 3MLVH 5CFHA 4ODUB 2DF3A 5BV7L 5F9WB 4K3JH 4OLYH 1KIPB 5JTWA 5JOPE 4X7SL 5L2JA 4JFQA 3IFPB 4BYHA 4RRPA 5L7XL 1LNUB 5ILTL 3U83A 3MSPA 4P5TA 4HUWB 4QRQB 3WE6A 1MJ7L 4X4XB 4X6FB 5DJZA 4UUJA 5MP6H 1AY1H 1RUMH 4OUUB 1YZZA 1S5IH 4YHMH 3CSYB 2FRGP 4PJGA 3PXHA 4XMKH 3WFEL 1A7OH 5B38B 2VC2L 4PRDB 2WBJD 1A7NL 3IFNH 2NW2B 5TE7L 3CFBA 5F96H 2DICA 1ZLWK 3PG2A 3QCVH 3AUVA 5EU6A 1S7VA 5F9DC 4LCIH 2D31A 5CZXC 5SV4A 5E8OB 4O02L 5ITFB 1WZLA 4M8VA 2R1XB 3QQ9D 4RMUA 5GGTL 4PJ7E 4W4OC 4N1EA 2D7NA 2YD1A 1Z5LB 3SO3C 4OI8A 1B88A 2NY2C 3P9MB 4QRTA 2WINB 5L88L 3B9VA 2VERN 1U36A 3P11L 4K7PL 1IL1A 4NP4H 4QRPE 4AH2A 4R2GB 1ZVSB 3CU1A 1JV5A 2AABH 1D5MB 2PF6A 5FHBH 5D7KE 3G6AA 3BP4B 2P24B 4NQXA 2WUCH 2VDLL 3QYCA 4Y5VB 2K3TA 1B0RA 1GIGL 3QG7L 3D85D 5HGAB 3CH8A 2VZVA 2PUQT 4MNGE 4X7TA 4EXKA 3FB7A 3QULA 5ICZB 2KUTA 1BBJB 4J3XA 5CJXC 2LTQB 3ULUD 2E27H 1CF8H 3H0TA 1DBMH 3M45A 3X13B 1I3UA 3VD5A 1I1FA 4MDIB 3HE7C 5FYLH 1DLFH 4JFFD 1ZHLA 2F54B 1BFOB 1BZ9A 1U8MB 3ARDB 3LRGA 1QA9A 4MJ4A 4WY7L 1LEKA 1EDQA 4KGLA 4A6YB 4NZTH 1G6RH 2VL4A 4HUNB 5IB1A 2QTEA 4I8DA 3L3DA 3NVQA 5DQ9A 3NCFB 2QV2A 4QHLA 3TBVA 4LPYA 1NCAL 4YUEL 2AJVH 3R4DA 4OD1L 4L29B 2AS5M 3K74B 3LEYH 2OTUB 5E1AB 5B8CC 3CFEB 2ZSWB 4JY4B 3WIHL 5J0BA 5J11C 4Z78A 3V0VA 3PGCA 4NYLB 3WKML 4GUPA 5J57B 1V7MH 1Z9LA 2EIBA 3QFJE 3DUSA 5HVGB 1RJYA 3O3AA 1FV1B 3QJHB 1CLZH 2VN4A 3DRQA 5JO5A 3V6FB 3QIWA 3LSOB 3FN9A 3IDNB 3IAPA 5MERB 5BQ7A 1VSCA 4PS4H 1HKFA 1BVZA 1UWEL 3F58H 2X05A 1M1SA 1ZTXH 4PD4J 1PEWA 2AEQL 2G2RB 1IGML 4NO0B 3BJLA 4Z7OE 2XKNA 3MLZH 4YHIA 5DJDB 3ZL4L 3S36H 2ZPKH 1MI5B 2D0FA 2WM0A 4MXQC 3SQOL 2W1NA 3KPNA 1GGTA 3RWHB 4WV1B 3S35X 2HWZH 1IAIM 5ECJE 3U0WH 2EXYC 4DOHB 3EZJB 5HPMA 3CH1A 3H7BB 1T03H 1N0LA 3T0VA 3GSXB 5IHUH 1C5BH 1DBBL 5D72L 4MA3A 1OAUH 5ESAB 4I1NB 1F3JB 5I2IA 3ULSA 4OFYA 3LD8C 3RQ3A 3BGFC 2FJGB 1NSNH 1KLGB 1EFXA 4ZAKC 1W0VB 1FNEB 2FLRT 3G5XA 5TDNB 3TNMA 1OARL 2GFBA 1S3KH 1WF5A 2BRRL 5GRJL 1E28B 4HS3B 4RX4A 3S6CA 3LHPH 2L0DA 3LB6D 3NZHL 1UXSA 4PRNB 3A6CH 2V7HB 3S36X 3GBNL 5C08B 3GSRB 4P23B 2VZSA 5F6HI 4G6AD 1E27A 3HI6H 3VG0L 4MJ6B 1IE5A 2DM2A 1MHPH 1S9VB 5IOPA 2NXYB 4YWGL 3I3DA 4OF8A 3S5LG 3QUMB 1KGCE 3MBEA 5J6GB 3MLUL 3VFSA 1Q0YL 5CLTA 3X12A 1UWXH 4HWZB 4WO4D 3TM6A 3QI9A 3W2DL 3WV0A 1JHTB 5INDB 5JUEH 2H3NA 3VI3F 3T09A 1G6RA 4P99A 5GHWL 4LLQA 4GKZB 1UKTA 5EFIB 1NFDF 1AJ7L 1MWAH 3QHZH 1IAIL 3EO9L 4H20L 2VXUH 2VDNL 5D1QC 1SY6H 4PBWD 1CGWA 4UB0L 5AYQA 2CJUL 2X4NA 1KIRA 3X17A 2AV1B 5HYSG 2Z0BA 3HFMH 4XP6H 3G5YA 1U91A 1KEMH 4QOKD 1MCQA 3JVGC 1CFVH 1CICC 4WW2B 1IM9B 7FABL 1T1XA 4KDTA 5I1AA 1KFAH 3LCYA 2EYSA 3KS0J 5ADPH 1UB6B 3OKOB 4H88H 2BJML 1NLBH 3MLTA 3E6HA 3QNXA 1MCIA 4GG6F 3GMPB 3NGBC 5D71H 1W0WB 4P46B 5DS8B 2QHRL 2Z93B 3C6SA 3CVHA 5FGSA 3ULUF 4GSDH 3WCYA 5KSVA 1UH2A 1IZKA 1MQKL 3R06B 4IMKC 1C5DB 1T22A 1WWAX 4YDIH 3WFDL 3VH8G 1MNUL 2QHLA 5D5MF 1UZ6F 1GC1C 3E1F1 4WFHE 5DJXB 1MH5B 5I66B 2RFXB 4UIKH 4HG4K 4WJ5B 3O2VH 1I7ZA 2BDNH 1A5FH 1KF9B 5EU4B 4WHCA 2Z35B 1IGJA 3V6OE 4RDQF 5I8CB 2Q7YB 3MC0A 2OJEB 1NCBH 1WZ1H 1U8HA 1FC2D 1E4WH 4G3YH 1DJSA 1DN2A 2J8UE 5HHPA 4ISVA 4XT1C 5FYKH 3O4OB 2XWJA 3HN3A 1F6AA 2IF7A 3UO1L 4M5ZL 2IQAB 1KPVA 1FJ1A 3PGDA 3EJJX 2BNRA 4S2SA 3PNWB 2C3XA 3MRCA 4EZMA 3QCTH 4EIZC 3X11A 2VR4A 5M7QA 1WT5A 5EUOF 2PYEE 3OR7A 2O61B 5FM4A 1Q9KA 3RJQB 1FRGL 3OQ3B 5GRVL 3ZDZF 5C0CD 4RZCB 1XCTA 1XZ0B 3MV7D 3LPGA 5C8JA 1L9NA 1CG9B 4FQCL 5I1HL 4X8XA 2VR5A 4QCIA 5I1KL 4KY1L 5I16A 3KPTA 1NFDA 3P4NB 1QEWA 2NY3C 5GGRY 4G6KH 3L95A 3GHEH 2R2BB 4C57C 5TE7H 3V6OC 1X9QA 1M71A 3F7YA 3BISA 4AEIH 2YUWA 3DX7A 2GSGB 4M7KL 1F90L 2D7TL 3ARGB 3JXAA 4IRZL 1CDIA 3TVMD 3NAAL 3QUYC 1MWAA 2X40A 1YECL 1SY6A 2NY0C 2Z91A 1LK2A 1PDKA 3QO0B 2V2XB 1XF2A 3GO1L 3SCMA 2IC2A 4JKKA 4H8WH 4RMSA 4GG6A 3EKCA 5I73B 4FOMA 4KI5C 5I74B 2VSCA 4YBHA 5A2FA 1PG7L 1GOFA 5SV3A 1BQHA 4ORGA 4X6EA 3T8XA 5JOFA 4QRRE 4X5WA 3DECA 1Y18B 3JTTA 5DUPL 4M8QB 4ZFOA 1E4JA 4OIAA 1A6VH 1A2YB 1SEBB 1HHHA 1C8PA 1VFAB 4AMKH 3QPXH 5AUMB 5T3XL 1TQCB 5FHAH 43C9A 4ODVL 1R5VA 3DBXA 1XGYH 5F3BA 3IDIB 5HDQL 3Q6FA 5I8EB 3VGHA 1XF5B 3U7YL 5CJQH 5HYFA 5IBLC 3WNLA 4NRZB 3VD9A 5HGHB 2NMSA 4MWFB 4HIIA 1MLCA 4EDXA 2VLRD 2CR3A 5GPRA 2MQCA 3GJEA 3GSNH 4APQB 3UTZA 4QHMB 3IXAA 5E08H 3H9ZA 2BVEA 2J88H 4JFPB 1ND0B 4P4KA 1JPSL 1YEFL 3FOMB 4MJIB 4NNXB 5GS0L 5IEKB 4WFFE 4MD5A 3BRDA 3DGGA 2VDOH 1PKQB 3VXRE 5SWZE 3CX5J 4KTDL 5HHXL 2IFGA 3SKOB 1GAFH 5MEOB 4HXAL 5AD0A 3WO3B 3WMSA 5HD8C 1ZWIA 2RCSH 4TUOB 1A6ZB 1U93B 1BWWA 5DT1L 4QKXB 5I1DB 3EDJA 4LKCB 3WS6C 1P53A 1YJDL 5CHNB 1AI1L 5GGVH 3U7WH 4P9MH 1R24A 2DWDB 1K8DA 3ZE1E 4E42B 2M26A 2Y07H 3TNNA 2A9ML 12E8L 2GSIB 3ZTNL 4HJJL 3CMGA 5F7EL 1LK3H 4OLVL 3MPCA 1ZA6A 1C16A 4FQHB 1AR1D 2B5IB 3VXNB 1KB9K 4RIRB 5LBSH 4HH9A 4XAKE 3OV6A 1QSFE 1RMFL 4Z7UB 2E7HA 5JXAH 4OKVB 2OR8A 3MRPA 2XZQL 4S0TD 4RFOL 3WFBH 2X4SA 5C0GA 1KJMA 5FOBB 5L6YH 5KSAB 3ZKMD 4Y1AD 2JCCB 1QVOB 5ALBH 1N0XH 2GEEA 1NJ9B 1KIQA 2DQCL 2ZCHH 4KHXH 1T2QL 1WZMA 4J3SA 2HFFB 3G04A 5EUKA 2IANA 4S0SD 1J1OL 1EJOH 3CK0H 5CILH 1UWGL 4LFHD 1QLFB 3BEVA 1NLDL 2MKWA 1Z9OA 2K7QA 3PGCB 2WIIA 5I1JL 4IRJD 3IDJB 1YEIH 3HE6D 4TOYL 1KJ2B 3DRQB 1U8NA 2WWKO 4OZFH 3SE3C 4U1LB 2E6QA 3F7QA 1BF8A 2YD6A 43CAB 2CIKA 5DD3L 1CGVA 5JIKA 3CFKA 3DOSA 5AYUL 4EQ2A 5I17A 4TULH 3P4OA 1E6OL 4D8PA 3RX8A 3B2VL 3L7EA 1JK8B 3SQBA 3QQ4B 3RWCA 3NH7H 5FYJU 1J8HA 2CRYA 2Z31B 1H8SA 4PRIE 3LQZB 2DQDH 5FGRA 3I50H 3VFNA 3GSNA 4NQVB 5T3XD 4Y8AA 3IFLL 3AB0C 1NC2A 1AIFB 2X7LA 3DLQR 3SE4C 3IS1X 4HCRH 1JWMA 5DJAA 2ARJB 1LE9A 3QO1A 3VXSB 3MV9B 1K2DB 4UB0H 3F7VA 4WUUB 4CBPA 4KJQD 4UU9B 3DRTA 3CH1B 3NIDE 3F6LA 4ZQKA 3C2AH 4OCNC 4FFWC 4KQ3L 4KK5C 2PNDA 4JFDB 4TTGA 4S1RH 4UTBL 3QCUH 2VXSH 7FABH 3EOAA 3MRLA 3HG1E 5GS0D 5HHOE 4O9HL 3U4BL 1RZFL 1K5NB 4MDJA 2BJMH 2VAJA 2ZOKA 3MROA 2R0ZL 3OKMA 1C1EH 3RGVB 3X14A 4Z77A 3HRZA 2WW8A 1JRHH 3P9LB 5IW1B 4FFVD 4XPFL 2ATKB 2UWEB 4Y4FD 5E2TL 5FECB 3HLAB 4HDIB 5IBTL 3ULVE 1DQQB 1FVEB 3AS0A 1VCAA 4R0LC 4R4FL 5E9DA 5C0IA 1QFHA 4K9EH 4LSSH 4MA1C 5GJTH 1MCJA 2QQQA 1JP5A 2VDRL 4UQ2A 5IOPB 5KW9L 3ZT5A 3BEWA 1RZKC 5GRXG 3WUWA 2QSCL 3CDGA 1SVCP 1JZ8A 4GRMA 1NMAL 4KRNA 5DRWA 1S9WA 3LKPB 4Y16A 4LEXH 2K9UA 2VNCA 1HEZB 4CADB 3O6FC 4AQOA 1ES0A 1UKQA 3RL1A 2VLLB 2F15A 1G0DA 3S4SB 4PRHB 3GK8L 2CIIA 2CGRL 2C4FU 4YO0A 4QGYA 2YPLD 3I6GB 2DB8A 3G5YB 4JFXB 1MCOL 2FGWH 5DVLA 1HIMH 4WI7A 4LP5A 4H26B 4FABH 1TVBA 5EOTB 3KXFD 2DD8H 1ZMYA 3PP3K 3SGJA 1SEQL 1EHLL 3VWJD 2O5XH 5GISL 2EDLA 1DE4A 2XZAL 2VDKH 3PQYB 2OR7A 3MGAA 4M7ZC 2ERJC 4FQQA 4JO4L 4OZFA 3T3ME 3GZKA 3MLTB 3AS3A 3E6HB 1H3GA 4KY1H 4FFZH 3TVMA 2MJWA 2P5ED 5B4MC 4EN3B 2E8ZA 3IDYB 3CVHB 4P2OC 5IFHH 1HXMA 1TTGA 4XMLL 4G8GB 1RJZA 4G8EB 1B0GB 1KT2A 5AAWA 1IARB 2XN9B 5F1NA 1AGFB 1R3KA 2H8PB 4OZGE 3IDXL 2AXGB 3BXNB 3GM8A 4AIZA 5L0QB 1DBKL 4ONHB 3PDGA 3BT2L 2R9HC 1ZT1A 4UT7H 4QHNB 5L8KB 4XNMB 4NWTH 4HCRA 2V2WB 4KUZL 5C6WH 4M6NH 2IFFL 4F3FA 3GMOB 4J4PA 4KGJA 4HKJB 1RURL 1NBVH 3OBAA 5TF1L 5BOPA 3FRUA 1DQJB 3BP5A 4KK9D 4YNYB 3EJZC 5HYJE 1X5AA 2NX5A 3P0VL 2PR4L 1BOGA 3O45A 4ISVB 5KJRH 1FL5A 1K3IA 1PG7H 5E5RB 1KPVB 2VZ3A 5IV2B 3X11B 3TV3L 2WBJB 1WQVT 5AG9A 4L9LA 2QJDA 4FQJH 4KWUA 1J0JA 5GS1C 5L2KD 1J10A 2Q86A 4UQ3B 5E56A 5F9JA 1U8QB 3TZVA 3U7YH 3SE8L 2OP4L 4CGTA 1RZIA 3EYFB 4PJ8D 1PYWA 4U6TA 5JOEA 1FFNA 2ZP0T 4C56D 1EHXA 5AWNH 3MOAL 4MVBD 2DMCA 2QSTA 3W9DB 2XTJE 5CEXB 3LDBC 3RZCC 4HWNA 4XGZA 3DHJA 3TPKA 4PJ9D 5I6XC 4JJ5A 5J1TC 4Y5XB 3ORJA 5DJ6A 4NZRL 1YMHA 3H42H 4DVRH 2EXWC 1LD9B 3MACL 4HXAH 3TJEH 3ZYIA 1WEJH 4OJFH 2VLKE 3D85B 4MNQA 3B9AA 3BGMA 4MQXC 3VXTB 2VLME 3VG9B 4G5ZL 1N2RB 2IPTH 4GG6B 1J0IA 1HHGB 3ES6B 3PV6A 3DMMD 4FP8H 5I75C 3VFUB 3QNYB 3T2QA 3WEXB 1DBAL 4MZ3A 12E8H 3G6DH 4JFFB 5D5MB 2J6EH 5HHVH 4YZFE 1XAUA 1B6DA 4ZMAT 3F6IA 4QRUA 3Q48A 4LVNB 4ZTOH 3V79C 2GTWB 5F70A 3ZSSA 3QZWB 3DBXB 2FO4A 1YNTA 1A9EB 4NNPL 3H9SD 4R97C 2GY7B 3Q6FB 4XAWH 3BMWA 1RHHB 2X6MA 4DAGL 2VXQH 3QDMD 3V6ZB 2Q87A 4E41A 3DURB 4PREA 2J5LB 4HULB 4NN7C 4C4KT 4JO2H 4RQQB 1GOGA 4F9PA 2DKUA 4XBGB 2ZG3A 3GIZL 1WFOA 1LO3L 1N5AA 1CGUA 4MB4A 3IXAB 3VRIA 5FF6A 1ZGLA 4YPGB 5TDPA 1HYSD 4OD3L 1F4XH 3C8KA 4KFZC 4NCDA 2FX8L 4ORZC 4XWGH 4PJCE 5F97E 4QHUA 5EUOB 3V9FA 3DVNB 1RUQL 1DQML 4ZODA 5BV7B 2ED8A 2DIJA 1HOCA 2XIDA 2NY7L 4HG4J 4TSCH 1DUZB 4GBXD 5LGHH 1HQ4A 4QHKJ 3NPSC 3S35L 3MGTA 1ZHNA 2GJJA 3U79A 5C7XL 3MTRA 1AXSB 3B6SA 3PWLA 4HWUA 5DHXB 2A6IB 5BJTB 1AQDB 2OQJA 1D9KC 4LK4A 2HH0H 1T5XB 3QEHA 1JYWA 4MD0A 3GSUA 1ZA6B 3IRZA 4HZLA 5JA9A 1CE6B 1VKXA 1LHZA 4R3SB 5BMFH 2HN7A 4MAYA 4P3DA 1K4DB 1CR9H 2IALA 1BM3L 3ESUF 3VI4F 1XGTA 4PB9H 1XF3B 2GW5A 4LQFL 2Z8WC 3KLDA 3WN5A 4KRMB 3B8SA 3EGSA 3PIQA 5KSBF 4YDKL 3OMZA 4PRPD 4KJWC 1T3FA 1KIQB 4OCXL 1V05A 2N56A 3R1GL 4IHOA 4JRXE 1OQXA 2VAAA 4G80A 3SJVA 4Y19A 2D4FA 4PJ5A 4X7FC 5H35B 3VFRB 5EUKB 3QDHA 4UT6L 4JM2D 2BNUA 3TBYA 4NO5A 2V2TA 2NTSP 5C0ND 2YRLA 1L7IH 4JZNA 2Q6WA 2FIKA 4PGCB 4NO3A 1IGCL 3IDUA 3WSQH 1AR2A 1P7HL 4JY6B 2J6EA 4IJ3C 4Z76B 5IESH 2IAMC 3V4VL 4YHOH 4WO4B 5JLZA 1V3MA 3MJGX 4UBDD 5TGBB 5CEYB 1TJIH 2AERT 1HNFA 5KAQG 4LASH 3GBMH 4OGAC 4PJEA 3BVNB 3GMNB 3TC9A 3BUYA 4GS7C 5D1XC 4F9LA 3PWPD 4GKSB 4L3CA 3UC0L 4O2EB 3QIUA 2Z4QA 4NHUA 1LO4L 4N0FB 3TYFA 4X98B 2C3VB 3CD4A 3ALXA 1J8HB 4MHHI 2XI9A 4QOKB 4L4TA 3FQRB 3ZKSD 1NMBL 5JHDD 3BZEA 4JO3L 3GSVB 2G5BB 4NC2B 5GZOD 3FMGL 2VKWA 3MREA 5CZKA 4W4NA 5KTEH 4UIMA 4ZNCD 3F7VB 1HSAA 4LSRH 2HMID 3O6KL 2B8OT 1J05A 4HUXA 5JOPD 3ARUA 3BKYH 2BC4B 4F80A 1FL6A 3IDGB 1MAJA 3N06B 1ZLUK 4U7MA 1ZT7B 2HG5B 1OOAA 3SDAA 2HTLC 4D94A 1HKLH 3QXDA 3VGBA 1IAII 3B2UC 2V5YA 4I3RL 1CFTA 3MRJB 4GQPH 4MDJB 3RUGF 5L8JB 4ZG1A 3BHBB 2DBLL 3RDTA 1R5IA 4G42A 4LSVL 4WEMB 5I9QB 4Z77B 4F37F 4NQDE 5FO8B 3ILPB 3V8CA 4AQ1B 2FHBA 2HFGL 1NKOA 1FYTA 4L9DA 1E4KC 1EAPB 4EI5A 2PTTB 1CGYA 4H5SB 5CSBA 3PWVB 3PWUB 3H7LA 3TBWB 3VFPB 3MCKA 1TLKA 2PW1B 5HPOA 3MCLH 4LLDB 1RSFA 3TWCL 3OB0K 2DTMH 3GFUA 4ZPTB 1IBGL 4MGXA 1UQSB 3WUWB 3EFDH 5I30H 3VXUE 4LAQL 1GZPA 4X80H 1N8ZA 3LN4B 1KB9J 1XF4A 1I1AC 5B3NA 3T77A 5I1GH 2QSVA 3P0VH 5A40E 5C0CB 4QRPD 1CN4A 4PTTB 5D93B 2BOCB 1S7XB 2ADJB 3ARZA 4K71B 4ZUVB 2NY4C 3K3QA 2P8LA 3HRPA 5D7KD 1GPOL 3B5TA 1G84A 4YDJB 3MOBL 3JUZA 2UV3A 1A1OA 1HCVA 5F9WC 1GYAA 3IU3A 1TVBB 1GCFA 1BQLL 3CFCL 5ANME 4YFLF 1QBML 2F5AL 1U8KB 4LARL 1HILB 5J1AA 2OR9L 1GC1L 3L3IB 3P30H 3UDWA 1FAIH 1R0AH 3M1BA 4DK3A 5CEZE 3TFKD 3LS4L 4MX7A 1EH9A 4CL7A 1W8NA 3MYZA 3TVMB 1Q94B 5IKCB 3W81A 1HQRA 1DUYB 1MRCL 4FFYH 4JZJA 1YPZF 1KELH 5DC0A 2R23A 2MHAA 1ETZA 1FNSL 4DWHA 1JNHB 1IJ9A 6CGTA 4J3WA 4OQ1A 2XWBA 2E9IA 2YD4A 1INEH 4YBLB 4J1UB 4MXQD 4GMTL 1N6UA 3RZWA 1ITBB 3OWEA 1SHMA 5MEPB 3D9AH 5EOQL 3O3EB 4N0UE 4TYUA 5IQ9B 1MSPA 2B2XL 1N7ML 3RHWK 4PG2A 3QFJD 4Y2OA 4WW1B 5DC9B 3MRHA 1AGBB 4HKBB 3SGDH 1OTUD 1DTUA 3EYQD 1UVQA 5KVGH 1HK6A 4PRAB 2A83B 3RX5A 3HC4H 3KNBB 1HI6B 2BSTB 2A77H 2VLRB 5A2KH 2YEZB 4PP1C 4DN4L 1DSFH 4L9LB 4ODSL 1NCCH 4Y5VC 4IIQC 1PLGL 2BVPB 4WU7A 5A3IC 3LQAC 3W0WE 1F97A 3MLSH 4DN3H 3FL7A 3EUUA 2ZKHH 1FFNB 3ZE0F 2CUIA 2LTQC 2C3GA 4JAMB 4JHWL 5GRZA 3HZYA 3M17B 4OCSH 3GI9L 4PR5A 4RA0C 3QPQC 3T2PA 2ADFL 3P77B 2FWOA 4UILL 4JJ5B 4UNVA 4QWWD 4OLUL 4D9RE 1DQMH 5GIRB 1CXFA 3PP4L 2CQVA 2F9BT 4M6OH 5HDLA 1T66C 1XMWA 2CD0A 5K9OA 3H3BC 4NQSA 3HC3H 4EUPB 4YHZL 3SDDA 1CICD 2J3SA 5IJVB 4LKXA 4DTGH 4YHPB 3D5OF 4HMEA 1YEDA 2NYYC 4F33B 3QXAB 2A2QT 3ECBA 4WWKA 4NM8L 4Y1AB 1NMCC 1NGPL 4NWUL 3MGOB 3CSPA 5H94B 4OZHE 2Y5EA 1S7SA 5CBEA 2EDBA 2AP2A 2P49B 3EHBC 1U8OA 1KGCD 4UOW1 4QYOB 3OKNA 5F9OH 1BM3H 3RWJA 4L8CB 1BVLB 3GM0A 5KS9E 3VGDA 5JDSA 1LP9E 1OAZH 1OSZA 4I4WA 4NZUL 4CDHA 3HNVL 1A6TA 4PJ7F 4Q6IC 3O3UN 4JKPL 4OZIE 2AV7A 3MA7A 1X5YA 2F19L 5ITBH 1NC4D 4OLWH 3VFOA 4AJ0A 1JPGB 4PGBB 2G5RA 2VZOA 4IRJB 3F7PC 1ZA3A 5FUCE 5JHLH 3QFDA 4K23H 3HE6B 2HKFL 1P6FA 3DVGB 3GJFK 5T5NG 5BCAA 2AK1H 3STZA 3FQUB 3AROA 3U9PH 1F2XK 4U1GB 4PLNC 4NBZB 1TVHB 2DDQH 1QRNA 1NCWH 5C0DA 4F7MA 1C12B 1YEGL 2YC1B 4XPGH 5HI3C 4EIGB 5IVXB 3SOBL 3MGTB 1IC5L 1RIUH 3UTSE 1EHAA 1MY7A 2GJZA 5LAXA 5JORA 4HX1B 5LWYH 4FNLH 5F44A 3LKQB 4ONFL 2YPVL 1QTYT 5DA0B 4G9FE 5BZWB 5T1MB 3K8MA 3MR9B 2B1HL 3FB8B 2P5WE 1W72L 1KN4H 4X0KA 3RI5F 4WFHD 1QO3A 2OK0L 5DHYB 3UAJC 5DMJB 1VKXB 4HIXH 4KHTH 4P23C 4ACPA 3HB3D 2ORBH 4W4OA 2L7UA 5DRNA 4PLKD 3I6KA 1FGNH 1HH9B 3W5NA 2NXYC 4DKAA 2DLFH 2O5YL 5IROC 2ITDA 4QY8A 4RAHA 5KVFL 3OXSA 2I9LB 1OGTA 1SBSH 4ZPVA 1ZKAA 3MRDB 3MRGA 1UZ8A 2LVCA 3MRFB 1CCZA 3QUYD 3SJVB 3GUTB 3U4AA 5T33H 1DP0A 5GS2D 2NY0D 2YZ8A 4Y4FB 4EBQH 1OVZA 2WP3T 1AP2A 1WWBX 4U49A 3FQTB 4YGAB 1BVKA 5DTFA 1E4XH 5F6IB 2Q7NA 2PYED 4BQ8A 3ABZA 5CJXA 2DOCA 5EO0B 4M7LL 4JZNB 2Z9TA 2DI7A 1IGTA 2DQUH 4JZOA 4R26L 3WFHA 3MV11 4KKNA 5K9JL 3HE7A 4WW2C 5GSVA 5T3ZE 4XWOC 1MHEB 4O5LL 5MEND 2CMRL 4PJ7A 3KLHC 4Z7OF 3ARED 5A1AA 1HN1A 5JLZB 1QLRA 5TH2A 5AAMA 4P46C 3MRQB 5FO9A 1YMMA 1OW0C 1IQDA 5JQ6L 4PJDB 2O26U 1NAML 3FQXB 5B8CA 2IH3B 4Z95L 2YPLB 2Q1EA 4Y2DD 4XHJC 2BY2A 4LOUD 1KLUA 3FB5B 3EIFA 4L4TB 2A6KB 3KDMA 3KXFB 1H8OA 3IDMA 4JJHA 4JGUA 5ENWA 2W92A 1H3PH 1LQSR 2XG4A 4I0PD 3VWJB 2JJSC 4JDZA 4K94L 3RWIB 4UV7H 5EZJB 4UIMB 3T4AB 4D0CA 2IBZX 3S7GA 3OX8B 1KJ3H 2BVOB 4MCZB 1IEAA 1T1ZA 1T0MB 2P5EB 4HK0B 4QRRD 5HD8D 5DD1L 1MJ8H 3TA3D 2MPAH 2XOTA 3I84A 2LU3A 2W60B 4DW2L 4G7VL 4EXPX 2I5YH 5IG7A 4P57B 2YA2A 5CD5C 2XY2A 2VKXA 3RJDA 1CFTB 2BNQA 2A9NH 5JR1L 2IQ9L 3RDTB 2HVKA 4F7CA 3BX7C 1RZKL 1T7XA 1XGPA 4NHCH 1FYTB 1KV3A 5KSBB 2AJUL 2PETA 4P9HL 3H9HB 5DR5L 2C7UA 1X5JA 2XKUA 1D5ZA 3BPNB 4NT6A 1F8TL 4WFFD 3IGAA 2UVEA 2ADIA 2VZTA 3VXRD 4JDTL 5SWZD 4JRYA 2BVQB 4ZAKA 4F57L 5B38G 4FQ1L 1RK0A 2C5DC 3FFDA 3S97C 3VW3L 4YQXH 1FZJA 4YDVA 5LJYH 1JNNL 4G6JL 5TQ0H 4GRWB 4P2QE 4JPIB 3ULVL 5K9QG 5IMKA 5L2KB 1QFOA 1ITCA 3RIAK 3D39A 5D1ZD 3CC5A 4LLVB 3HNSL 4NC0B 1T0NA 4JQIL 3G5VA 3IF1B 4L3EE 4KVNH 1G9ML 2P8LB 4PJ8B 2AJXH 4XP4L 4NSKB 2X4RA 2JLLA 3FQNA 5I73C 4C56B 5I74C 3IU3B 5B22A 1P7QD 3C5JA 1JGLH 3MX0A 5FCUL 1T04B 2WANA 4PV8A 1WCBB 3HI1A 3LOWA 4XAKD 4IOIB 5JXED 3EZ8A 1QSFD 4PJ9B 1PW3A 4HFUH 2VITA 3KPPB 5I1EL 2VE6A 3LMJH 1QSEE 3C08H 2ZSVA 4PJFE 3F8UB 4DGVL 5D1QA 5CCKH 5E8DH 4NJ9H 3WIIL 4QGTA 2N7AA 2NNAB 3QDGA 2XQYG 5JDJA 6FABH 4X4MA 2ZUSA 1YEJL 1ETZB 3CU7A 1KPUB 5IB5A 2XWBB 5HSFA 4QXTA 1ORSB 3JVGA 3DMMB 3A6OA 1OGAA 5E8PB 5F7DB 4APQC 2DLHA 5FKPB 4I2XB 5D2NE 3T0ED 2F5BL 5D9SB 3FOLA 5CWSB 3RUGB 3G6JF 4U1MB 1Z0MA 4LAJH 4LLMB 1A7PH 4FFWD 5HGBA 4KK5D 4KI5F 4P5MB 1EGJH 1KJVA 3TIDB 3H9SB 1RPQA 1JYXA 4O2FA 4ODWA 1IC4H 2FD6H 4IMKA 1UVQB 2YD8A 2ADGA 4LBEB 4XCEB 3QDMB 3S5LB 4RISL 3FAXA 3CSGA 4YIQA 1KPRB 4ONGL 1MCRA 4HIJB 1QR1A 1NUNB 3BRGC 1FGVH 1CK0L 2GK0B 4NKDB 2G9HA 4RWYH 2EIZB 1WBXB 3MLRH 5J89A 2YK1L 5MI0B 3IXTB 5HYQA 3QIBD 3MUZ1 2H26A 5BXFA 3EYSH 1A3QA 3OR6A 1X6NA 3ZZ1A 5JNYA 2ID5A 4PRID 4HJGA 3QUKB 1I8LC 5HYSB 4BZ1H 3K0WA 2FBOJ 5EIIA 5IW6B 2BVYA 4LCYB 5D2NC 4HFWA 5FB8A 4LU5H 4QTHB 1CL7L 1TZHB 4X4YA 4GBXB 4PR5B 5KSAC 4R90L 1AD9A 2R29H 3HUJA 2R8SL 1OD7A 2WAHA 3MLXH 4NC1E 1UB5B 2FNBA 1S5HA 4JN1H 3HG1D 3QBTB 5HHOD 2IPUK 4NQTA 2BHUA 4WFGE 1AKJD 4M7JL 4OZ4A 1NAKL 4HIHB 3VH8B 5I1LA 2F58L 4F8TA 4GO6B 1IC5H 3FT2A 5E2UH 2Y9RT 2ZCKH 3KJ4B 4GXVH 2F8XC 2ZNWA 1UFUA 5C0AE 1IKNA 1YPZB 4Y7MA 3ULVD 3V6OA 3S96A 4S1QH 1KULA 3Q5YA 4W81A 2PN5A 3QXTA 3WL9A 3T65A 1H5BB 4PJAA 4PRPB 2UZIL 4LNRB 3SKNA 4U0RB 4M1DL 4ZFGL 4U2ZA 2GQHA 2JK5A 1S7SB 5B4MD 1AO7A 5HYIA 4P5KA 3ARXA 1V8HA 1EO5A 1LDPH 4K55A 3W11C 1EEYA 1XGQA 4G8FB 5DJYA 2NXZC 2AI0L 5MEQA 1MIMH 3G6JA 1OSZB 3GI8H 1QYGL 1SJHB 5GGSB 1A1MB 2HLFC 1FPTL 4MLIA 4NC1C 5GZNC 3WXWH 2HFEB 2BXYA 3V5HB 1CLYH 1VEMA 4Q6YA 3GNMH 5ALCL 1MREL 1T80A 1IILE 5CSGA 4IDJL 4LMQE 4V1DA 1LO0H 4N0CD 2E7MA 3STZB 3L3OB 3N1GC 4P48A 3ZE1F 3GHBL 4IS6A 2MQ3A 1KYOK 1MAMH 5INCA 3KYMA 4RBPK 1EGJA 3EO1A 1GHFL 4X5LA 2VLJE 4HQQH 3FN0H 1KENL 2JE8A 3WHXA 3CZFB 1NGWA 5K9JH 3PWPB 3TJHD 4Z5RB 4MYWB 4FXGB 4ZO7A 2FHFA 1TFHA 5IVZB 1DLHB 4B7LA 1XR9A 3SN6N 4ZS6C 3QRGH 4DEPB 3EDFA 4DVBA 1RUKH 1A6UL 2FZ3A 5JORB 3RGVC 1N4XL 1CIUA 4HF5H 4UDTA 5FA3A 3E6FB 3ZHDA 5JHDB 1F4YH 5E8NA 4LCWE 1S78C 2BZDA 4X0KB 2ICWA 1EMTL 1JWUA 2X4OB 1MUJA 5M94B 4WDIB 1N5YL 3OKKA 3S88H 5LXGH 3PL6D 1FORH 3TPUB 1P69B 1GGBL 3OGCA 4OCRL 4PYGA 2A6JA 5IWLC 4QXUL 3WS6A 5GGUB 4QY8B 1BEYL 5HYJD 1OP5H 2VH5L 1CFQB 2XN9E 3DYMA 3P73A 3W9EA 4FHBD 1S7WA 3PDOB 1WC7B 5GGQL 1KEGH 4I77H 5D7LA 3KWWB 2CLZB 3DV4A 5HDBF 3MBXL 5D70L 4DZBA 4EVNA 3N1FC 5D6DC 3RVWC 2VXVH 1N6QL 2BSRA 4XBPA 4HUKB 3EAKA 1ZE3C 5GGVY 5T1DL 5KAQF 1X4ZA 2Y36H 4GRLA 4HPOH 5DO2D 1J5OL 4NBYB 4PJ7B 3PHQB 4HWBH 4JFEA 2XTJD 3OZ9L 5TH2B 4XXDB 3WJJC 5C9JA 3T4YB 4EN3C 3IDYC 3NZ8A 1FBIH 4QRPB 3V52L 2E6PA 3GSOA 4FRWA 1B2WH 1HHKA 3HMXL 3MJ9H 4NCC1 4WEBH 4YBQC 3VMNA 1UYWH 4ENED 1HHJB 4GQ9H 3QJFB 4F57H 3VRJA 3TBSA 3VW3H 4N8CL 1KLUB 2I24N 1AHWB 3CVIL 3C2SA 2VLKD 3MLYL 3PJSA 4CMMB 2XNAA 3O9WD 4MNGB 2IEPA 5ENWB 2VLMD 4FQXC 4NOBA 4PIRF 4XPHL 5I0DA 4OGXL 4C58B 1PSKH 3OAUL 3LEVL 3OPZL 3BP6A 4GAYB 4XCYA 1T1WA 3HNSH 3SE3A 3HZMB 5I19L 1BFVL 5JW4Q 1D7FA 5DLML 4OF7A 5SWSA 4PJBE 5FM8A 1JMXA 1UA6H 1HYRC 2VJXA 1REIA 2HVJA 5EO1A 5DRZA 1VGEL 1YY8A 3BIBX 2BVTA 3FFCA 3EYUH 3TIEA 1LEIA 1YEEL 1G7PA 2I27N 2WBJC 4KKAD 4ETQA 3PDDA 3U0PA 1KCUL 5K59F 5CBAA 3FKUS 4DGYH 1CYGA 4MNHB 2MQ0A 3SE4A 5FCSH 1MCWW 1QSZA 4KJPD 1I7TA 2X4PA 1G7IA 3PF2A 3DROB 5CGTA 1J86A 1NAMA 1UWXK 4JFFE 5E7FA 2H41A 4CVZA 3QQ9C 4E5XA 4UV4H 3D3VE 2OZ4H 3QFJB 1FZMA 3CCHA 3IKCA 1L4IA 3LD8B 3BGFB 2EDFA 5T1KD 2FYYA 4BFIA 3KYOA 3LPFA 4HGWB 3KJ6H 1KUMA 3KHQA 4Y5XC 1FZJB 3UTTE 1OF2A 4GAGL 4JEGB 4DQOL 3DIFA 4JKWA 5K9KA 4U1JB 3EBAA 1A3LL 1MFCL 5C0FA 2VQ1A 1CBVH 3O3BB 3T3MF 3VG9C 3EOTL 4BSJA 4R0LA 4XP1H 4J8RB 3VFGL 2M1KA 3B9KD 4X5XB 4I3SL 3C5ZA 1LO2H 5LQBL 5EZIH 3D25A 3V2AR 2CK0L 25C8H 3QUZC 4XVUD 5TE6H 2Q8AL 4GAJL 1NGYB 4PV8B 1BPVA 4L4VE 3EFFB 1T4KA 1OPGH 5DK2B 3QAZB 1EEZB 4HWBA 1JZ6A 2X1QA 4OGAD 5F93C 2PYFA 3O6FA 3WDIA 3OG4B 4RGNE 4PV9B 1FLTX 3N9GH 2YMXH 5ACZB 4GW5A 4IMLA 4XVSL 3S3PA 4G9DA 4HLJA 5C70A 3MRKB 4CNIB 1X4XA 3MJ9A 5EB9A 5DJCA 5I8KL 4JRXD 4BUGA 2J5LC 3JWOH 3VDAA 2AAVA 3VA2C 3SDCA 4JVWA 1CICB 2XA8L 1J1PL 2XPGA 4OI7A 3VFVB 2W65B 5CEZL 4EDWL 1OLLA 3EOBA 3VE0B 3VFTA 2EE2A 3STLB 4WTZG 4X7EC 2H1PL 3VDCA 4IOSD 5E6IA 1JNLH 4AT6B 5CSZB 5J56B 2AEPL 3UBXG 4ZSOE 1RUAH 4P2OA 5BV7C 4PJXF 1YDPB 2OS7A 4B41A 1FL3A 1Q0XL 2EH8L 2EDJA 1H3UA 2HTLD 4X6BA 1PZUB 1RUPH 3JV0A 3KPOA 5D8JH 2ZOLB 2XT1B 1J1XL 2E6JA 2P46B 4NBXB 5ESVB 1IZJA 3X3FH 2C26A 2R0LH 4Z0XA 4GKNB 3P2TA 2G9HB 1NGQH 2CKBH 1HXYA 1NC4B 4M1DH 4ZFGH 4XH2A 5BXFB 4HPYH 4YGVA 5KVEH 1E0OB 4ZOBA 1K8IA 2NLJA 3RWGB 2GI7A 2QQKL 4Z7VA 3PGFL 1TCRB 1XR8B 1C08A 5HI5D 2R69L 4U3HA 4S10A 3WIFA 1D6EA 1G1YA 4JFYB 3MOQA 5J7CC 2OZ4A 1FZOB 3NIFF 2GTZA 3FO2A 4DCQB 4NQCE 3ME0A 3NTCL 2BVUA 2B4CC 4AM0B 2DL9A 2A38A 5FA4A 3RNKA 2ZUQB 5GS1A 2GT9B 3UTQB 1WFTA 3VXQA 3LB6C 3TT1L 5KVMC 2W0LA 5DD0L 5IB4B 4I3GA 4EOWL 1A0QH 3G9AB 1KENH 2OI9C 4YZFF 4J3OC 1ZHKB 2KQMA 2NY4D 5F21B 1S7RA 3S3SA 4YJZL 1EK3A 3PHOB 4MAUL 5I1CL 1WIOA 3SKMA 1KBGH 2HKHL 3V4PH 3HZVB 1XIWA 2R0KL 5D7SH 5FGCE 1A6UH 3D2UA 5FO7B 1U8JB 1PX4A 1EAJA 5F8RC 4QT5A 3RZCA 4HS6A 2W91A 4WGVB 2H9GA 4PJHE 1Y0LA 5JIIA 1D5BB 4YEFA 5SX5H 1PVHA 1Q9LA 3N85L 4D9LH 2J8UB 2JK5B 3ARFC 3RKDD 5IGXL 3QUYB 4RAVA 3A67H 2P45B 4RGOL 1YN7A 4NPYA 2FECL 3NFNB 3VXUD 2NY0B 1FFPA 5D7IF 5HBBA 3FO0L 1U3HA 3QWOB 4PP2A 1CZ8H 5DJYB 3O8XD 4JY5H 3BH9B 1TZGH 4K07A 5CINL 2ED9A 2PYEB 5T5NF 5C0EB 5EN2A 4LVOC 4PJXA 3BZFA 2ZCLL 5DI8A 4TNVF 3MV8E 3ZYZA 3QDJA 2EDTA 3MXWL 4J6RL 1JTOA 1JWSA 2CH8A 1TQBC 1X5XA 1FH5L 4NJAH 4N8PA 3AREB 4IS6B 2CDFB 2EDXA 3VXMA 4R8WL 5DHVB 1N6QH 3BAEL 1LVEA 3L7FB 3LH2L 5DUBB 3U36A 5KVDH 3S4SG 1MF2H 1MCSA 3ROOB 2ESVD 1MJUL 4S1SH 5CEZD 5D2LF 1A14L 4PTUB 3MV7E 2CLRB 1EXUB 5CIPH 4Y2DB 2YZ1A 2C4FT 1T21A 3UCRA 2CKBA 2VLKA 5I9QC 2H32H 1A3RH 4L8BB 4I0PB 5ISZE 2F53A 1AGDA 2AK4E 1BOYA 2UY6A 5C07A 3AVE