5B4MC

Crystal structure of an fab against human influenza a
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
221
Chain Sequence
DVKLVESGGGLVNLGGSLKLSCAASGFTFSRYYMSWVRQTPEKRLELVAAINHNSGRTYYSDTVKGRFTISRDNAKNTLYLQMSSLKSEDTALYYCTRHPLIYHGNYLDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab heavy chain
publication title Crystal structure of an Fab against human influenza A
rcsb
molecule tags Immune system
total genus 44
structure length 221
sequence length 221
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5b4mC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5b4mC01
2HTKC 3KJ6H 4I3SL 1KB5L 3RWFB 4QRPB 1F4XH 4U3HA 2XZQH 4HS8L 4V1DA 2ENSA 4K7PY 3PG2A 4ZFGL 3O6FB 4QNPE 1I8MA 2WWKT 1WFUA 1A7QL 3T04D 1H9VA 3PDOB 1UB5A 1ES0A 2H41A 1OPGH 1TQBC 1QSVA 3QDGA 4JO3H 3MV8D 3Q5OA 3LKRB 4IHOB 5TQ0L 1ADQA 2RJMA 4WU7B 4Y5YB 3V4PH 4X6BB 5HY9B 2DS4A 3VFNA 2ZOLB 4M7KH 5D2LF 2QLVB 5DD1H 1JGEB 2OP4L 5J1AB 1WUNT 2H32H 5C0BB 1RJLA 4L3AA 4PTUB 5GGVL 2I9LA 1LDPL 3PGCA 4OCSL 3EAKA 4LK4A 4B41A 1FE8L 3O6MH 4NQCA 4UAOC 5IV2A 5BXFA 1G9EA 4EDXA 5KJRL 4NOBA 3CVIL 3ZE1E 2OCFD 4I3SH 4XVUC 1KB5H 2FR4B 1JWUB 4L1HA 4M1CD 1G7QB 4HS8H 3V7MA 1NQBA 1TVHA 3AAZB 4ZFGH 5C0CE 2ZG1A 5KVMC 1A7QH 4FRWA 2O5XL 1NDMB 2ZSWA 2HKHL 1IILE 3CH1A 1MCWW 2FYYA 4DVRL 1HQ4A 3UBXI 3T0BA 2WNGA 3LDBC 2P5ED 2QJDA 1J8HB 3O2DL 4PJ8C 1GOHA 5TQ0H 1F6LL 3GNML 4LLVB 4ODHL 4LSUH 1IEBA 3CFEA 5F9JA 5FCSH 3QUKB 2OS7A 4ODXA 3EUUA 2EE6A 1JHLL 5EBMB 5ALCH 1VFOA 1EVUA 1J12A 1QHOA 2H26B 5DT1L 5GGVH 5HBBA 1LDPH 4OCSH 4WV1C 5B8CB 1JK8A 2G9HB 5D7JC 3QEQA 1FE8H 5MEQA 4OLYL 2P1YA 2VAAB 3W11C 4FQCL 5KJRH 1P6FA 3CVIH 1CGSL 4EXKA 3RUGF 3TIEB 1QBLL 3VFWB 1QPXA 2I9TB 4IRSB 4WU5A 4PJHE 3DVGB 1H0DA 2FHCA 4LVNC 5GRVK 2O5XH 2HKHH 3AM8A 2LVEA 5HHMD 4YH6A 1MSPA 4DVRH 4U0RB 3EDKA 4JCLA 1P2CA 3ABZA 4N9OB 3EYQC 3W9DB 4AJ0A 4U6TA 3GZKA 2H2SC 2OI9C 3K4DA 5C0EA 3O2DH 1ZANL 4GRLC 1NKOA 4PTTB 3TN0A 3GNMH 4ODHH 1G7PB 3TFKD 2DQCL 2R56L 3DGGA 4NQDE 1T22B 3GM0A 4NP4L 4L1DA 2NXYD 1G6VK 1PQZB 2IBGA 5GGVY 1EGJA 1FN4A 1JHLH 4L29B 3V5KB 4M7JL 4NN6C 3CDFA 5GSRB 3D85B 1QA9B 5DT1H 1ERNA 2P7TA 2BC4A 3FL7A 3DUUA 3V6OE 1J86A 4WDIA 4MJIE 4WFGD 3ARVA 3AVEA 1DN0A 1HDMA 3LKSA 4OLYH 1S7QA 3U4EA 4N1HB 1B6DA 3DBXA 4FQCH 1U3YA 3ARYA 1CGSH 2LE9A 3EKCA 3G04A 5IBUG 2NY3D 4P2QA 4MAUL 5A16A 1QBLH 1I1CA 1P4BH 4JLRB 1KXVC 2IPKB 4JPIA 4P57A 4CAGA 3ARDB 4KI5F 2Q6WB 3BZ4A 4KKLC 3DTXA 3D87B 1AGBB 5D7IB 3VFTA 3BMVA 2CDGB 4A2LA 5JHDD 4Y16D 5BV7C 4NNXB 5EB9A 1BFOA 3RVWC 5HYJB 5DEGB 5FUCC 5CEZE 4ODSL 1N7ML 1XGPB 3CSPA 3UBXA 4X6FA 3VE0A 3WHXB 4XBGA 4RWHA 1X5KA 5T3XE 2EKSA 1D5IL 1ZANH 3HNTL 5T1KB 5E8DH 4IDJL 3LKOA 5HVHB 5D93B 1QSFE 4HPYL 2DQCH 4R0LA 2R56H 2UUDK 4E42B 4U7KA 5KVGL 1FVDA 1T1XA 5CZXC 4NP4H 4XNUL 2F5AL 2R2EB 4H26B 3O2VL 1KT2A 3TVMD 3PV7A 4M7JH 4N0RA 5F7MC 3VA6A 1OB1A 3V52L 2I25N 3KJ4B 4HIIA 3GGWA 1UWEL 2XKNA 1ZHNA 4Y2DD 4JFDE 4MAUH 2WBJD 1MUJA 1F02I 4Y4KC 1NC2B 2V7NB 1YUHB 3SE4A 3WD5L 1ONQA 3PWPE 2VLRE 4APQD 3CFJA 5KS9E 5DO2D 2EXWD 4JG1L 4PJDE 2O61B 1Q9KA 4ODSH 1N7MH 1BEYL 4JFYB 3VXUB 2DLIA 5DYOA 3FT2B 3ZKXB 3TH3T 1D5IH 4MAYC 3HNTH 3S97C 3K8MA 4IDJH 5DD5L 1OY3B 1EFQA 5E1AB 2V9RA 4HPYH 4WW2C 1U95B 2GT9B 3M17A 5KVGH 3B2UD 4XNUH 1EHXA 2F5AH 4GRWF 1IGYB 5HHOD 5BW7C 2HFFB 3O2VH 2WANA 2E9WA 5IB5A 1CL7I 1AO7A 2OTUA 4Y5XB 2A74B 3RTQD 2AERT 1G7HA 3V52H 1MCNA 4G8GB 2V7HB 1J0KA 3OV6A 1JHKL 3OJ2C 4GW5B 1SMOA 1UWEH 3PQYD 2BERA 1I9IL 4GMSL 1UGNA 4NO0D 4S10A 4X6CE 4NO3B 2W0KA 4JFQA 1PDKA 2QSQA 4R90L 4WO4A 4CN4A 1D5BB 4ONFL 3QFJA 3WD5H 3GIVB 3S4SB 2QADC 3F7VB 4KXZH 3BX7C 4JG1H 4L4TB 1E4KA 4JHWL 3OR6B 3QIWD 3FFCD 2AXHA 4Z7NF 1BEYH 2WWMD 5HHNB 4Y1AE 1KOAA 1T1ZB 3QISA 4M7LL 4LPUA 4GRWH 4PJ5B 1S9WA 3TNNB 4YZFF 3RWEA 3HMXL 3MTRA 5F1IB 4BSVA 3MJ6A 1LP9E 1LWRA 2MQCA 5DD5H 5DGQA 1II4E 3QQ3A 1A22B 1P9MC 5IB1A 4JM2F 2X70B 3MRQB 1M71A 4AL8L 5HPMA 3WO4B 3L6FA 3K46A 4ZSOE 2AKRB 1NEZG 3TZVB 3C60B 3MV8A 1S7RA 1IAII 4K3GA 1S8DB 4PJ7F 4Z7VA 5E0QA 1KJVA 1BPVA 3BDYL 1JHKH 5I8CB 3HA0A 3SGJA 1FNSL 4ZOBA 1OP5H 5E00A 4KROD 1I9IH 2ESVB 4GMSH 3UZEA 1GHFL 1CFNA 3GMOB 5JNYA 4UQ2A 4MMZC 3PIQB 4R90H 5C08E 1C12B 2X4OB 3IRPX 4ONFH 1NBVL 3EOTL 2RFXB 1P84K 1QPPA 1T66C 5CHNB 3LV3B 3OAYK 4PP1C 1BP3B 3BDXA 4LCWE 1YPZF 2R4SL 1H15A 4JHWH 1D9KD 3R4DA 5CP7B 1YA5A 3SDCC 4F9LA 4M7LH 4LHUB 4KRLB 4LRNL 3HMXH 4EI5C 1SEQL 3IKKA 1U8OA 1HHKB 1VEOA 4V2BA 5A3ID 5I73B 3HC0B 1OTSD 4AL8H 4QRPE 3RL1A 3BFOA 1FRGL 1X5YA 3RWHA 4M93B 4BFEA 1QR1A 4LVEA 3SGDI 1C1EL 2RCSL 5TGBA 4GG6B 1NBZB 2P5EA 4OBSA 1JRHI 5E9DD 3CDGB 1RIUL 5TFSL 4LQFL 1OQOA 3BDYH 5FGRA 4KAQL 4Z7UA 1FNSH 4CW1B 1GHFH 1MVUA 2GITA 3AS0A 4G8FA 2EC9U 3C5ZC 5HYIA 1O7VA 4ZFFB 3EYFB 5GRUL 5FUZH 1BX2A 1NBVH 3EOTH 4NM4L 5EU6E 5DHYA 2R4SH 2VLMD 2NY4D 4YBQC 1A9BA 4Q6IA 3ES6A 1BGXL 2GHWB 3O3UN 1A3LL 2BFVH 3JTSB 1PZUB 1MCIA 1AR2A 4LRNH 4PYGA 4YBHA 1SEQH 4MB4A 1DFBL 2Q76B 1CXIA 2SEBB 4PJAA 1DTUA 5I76B 2GTWA 5DJYB 3IDNB 3C8KA 3HE7B 2L7UA 5EIVA 1T89C 1MCLA 5CEYA 5J12B 3ARRA 1A7NL 3FT4B 5C0CD 1FRGH 1FVCB 5HXMA 5GRZA 1C1EH 2RCSH 4Z76B 4IS6B 2XKSA 3QIUD 4H20L 3CVHA 3FQUA 1G7MB 3KLAB 4RGNB 1RIUH 5TFSH 4LQFH 4RQQB 1Y6NR 1AHWC 1XGUA 3S36L 1JZ4A 5DURB 2E9IA 2PKDA 1Q38A 1ZK9A 5CGTA 1X5AA 4HWNA 3WUZA 2LAAA 5H94B 4C55A 4PBVC 1UZ6F 3K0WA 3HE6A 5EZOL 3N1PC 4JFHE 4YHPA 3DVNA 5GRUH 1U8MA 1X4ZA 3EO1B 2VL5B 5KSBB 4NM4H 5CD5D 2EDHA 3DRQA 2HVKA 4G9FB 3JZ7A 4E41E 4ZXBC 4LEXL 1C7TA 1ZE3C 1C16B 4M43L 3RDTB 1CD1A 1BGXH 2YWZA 1A3LH 3L3HB 3O2WL 1F2QA 3CU7A 2ADGB 1LGVA 5HI5C 5EUOA 4IDLA 3UJJL 4GQ9L 5JHDA 1QRNB 4PRPD 4Y16A 3MPCA 4YBLC 3RVXD 2BSSB 1A7NH 4KK5C 3N0PB 4NQUA 5I71B 3LPFA 2FX8L 5EC2B 5J13C 3LN9A 3U82B 4H20H 5IG7B 1W72A 2NY6D 3ZT5A 3D1MC 5IEHB 2Z8SA 1YNLL 2DQFA 5J4MA 4FMKA 3S36H 5CIPH 5HSFA 5E5MB 2PYFB 3MRMB 2YMXL 4DZBB 4O02L 4NKMA 1Q9OB 5EZOH 3TVMA 5BRZD 2FEDC 3FQTA 4PB9L 1DQQB 3BZEA 4KTEL 1FSKC 4MDJB 3A0OA 1TVDA 5B3NA 4MS8C 3L7EB 4KUCF 4LEXH 4Y2DA 1F13A 2W07A 2V6HA 3ILPA 4M43H 3TO4B 3QH3B 5ACMA 3ZKND 4CMHC 2WQRA 3O2WH 3VFGL 3HR6A 1JFQL 1S7VA 5F7UA 3UJJH 1TNNA 4GQ9H 5CINL 5I1DB 4X7EC 1ORSA 4APQA 1GCFA 4PRIE 4MHHG 1MLBB 2BHUA 1MCRA 5FGBC 1HK6A 4ENED 3PHOB 4HK3J 2DDQH 3ROLB 1MHCB 4NQVB 3DECA 2FX8H 1K2DB 1I1AA 5TDOB 1K9TA 5CEZD 1MCFA 1CI5A 1L6ZA 4NC1C 1LK2B 3T4AB 2HRPL 5L2KB 5HYJE 1SYSB 1YNLH 4OF5A 4HGWB 3GKWL 1RURL 4KJYB 4XCEB 3UJTH 3GSWA 4ZNEA 2IPTH 5DJAB 5T3XD 4ISVB 3QNXA 4KY1L 2YMXH 3T4YB 3QUXD 4MD5B 2XWJA 4O02H 1RUQL 4L4VB 1OGAE 5F1NA 2F9BT 4PJCB 2R1YA 4YC2B 4QRQA 1F11B 4JY6B 4PB9H 4KTEH 3EFFA 1D5MA 3VGBA 4YK4C 4LHQB 2QSCL 4I5BB 5GZOD 1JZ6A 4J3SA 3WIHL 4NN5B 3I75B 1CFTA 4JGUA 3DV6B 3PQYA 5IVOA 2GSIA 2CRZA 3L3KA 3HZYA 5I9QB 4NO0A 3X12A 3D69A 2AJZB 1JV5B 2H45A 1XF4A 3CUPB 5DQDH 3VFGH 5E5UB 1JFQH 2CKBB 3MRIA 4JFDD 3RNKB 5CINH 1BIIA 2ZUQC 2NW2B 3QSKB 2NXZB 1AP2A 2VERN 2XA3A 3FFCA 3OX8B 3QIWA 1X5JA 3EO0B 3HC3L 1TZIB 5SWQA 3HZVA 2VLRD 5MEPB 3BPOC 3BMWA 4HWZA 2OL3L 2HRPH 2QSTA 2ATKB 5BVPL 3QJFB 3GKWH 1RURH 4LF3B 3ZT6A 4AQOA 1PGRB 5B21A 5D1XD 4KY1H 5CCKL 1ZVYA 1T4KA 5I6XB 5DXWA 1RUQH 3GMPB 3P30L 1G7IA 3WN5C 4QEGA 3MLTA 4QHUA 3WS6A 4EUPG 5HDBF 4LFHG 1CT8B 3LZFL 4CU8A 2UZIL 3WIHH 3RVUD 3IKCA 3MJ8A 2J1KA 2YBRB 4M5YL 4UDUB 1NANI 1KLUA 1S5IL 4OFVA 5FV2A 1IL1B 1J9CT 1NBQA 3B9KD 3WUWG 4JN2B 2PR4L 1UJ3A 3E3QE 4PREA 3MLXL 5EO0B 1G7JB 4UT9L 1WIOA 4J3XA 4XCNA 2XKUA 3O3BB 2KZWA 1D9KA 4H88H 3IF1A 2CH8A 5F9AC 4LLAA 4DZ8B 1U41A 3HC3H 2W91A 5AZEL 3SJVE 2OL3H 3VG9B 3LIZL 3UPRB 3QO0A 4ELKA 1U2HA 1VADB 4L4TE 5D6CA 5BVPH 4Y1AD 4DGYL 2XNAA 4LSPH 5BV7L 5CCKH 4PBXA 2R9HC 3KPLA 5ESVA 2YD1A 1BVKA 4IOSD 2NZ9D 3AU1A 1KB9J 5D1QB 5KSAC 3P30H 5HGGS 2X4PA 4M8QA 5E9DA 2Q8BL 3LKNA 3LZFH 2UZIH 4X9FA 4Q9QL 4M5YH 2A0LC 5CJ8A 2H1PL 1S5IH 4WFFE 4LHJB 5D1ZD 4DK3A 3KS0H 2PR4H 4J4PD 4YQXL 4U1MA 1G7LA 2ZUYA 3MLXH 1HN1A 3RNQB 4UT9H 3IS0X 2ARWA 3RFZC 2ESVE 4FMFA 4K3DL 3RPIA 2DQGL 1F58L 4I0PC 4KFZC 2ZSVA 2E7BA 3CPLB 3D25B 5C9JA 1U3HB 2IFFL 3TJEL 2CR6A 4Z7OF 3MRDA 5AZEH 4LCWD 2Y5TA 1HHJB 3BPLB 1JPFA 2CXKA 3LIZH 1ZSDB 1HI6A 3FRPA 3B5HA 5T3ZE 4DGYH 1KJMA 3PL6C 5HYEA 3P9LA 5E7FA 5JLZA 5JDJA 5MEOA 5BV7H 3CZJA 2CIIA 3TA3D 3DVFA 4R26L 1Y18B 4YFLF 5D2LB 3QIUA 1S3KH 3GEWB 2Q8BH 1T7WA 1FL3A 4P2OD 3P0YL 3UTZB 3X13B 1M4KA 2A83B 2WW8A 3HS0B 5E8EB 1G9MC 4Q9QH 4HX1B 2H1PH 4KU1A 2YPLE 2PN5A 4S1DD 2H32A 3UXFA 1HSAB 4PJ9C 3OKDB 4YQXH 3MRNB 4GKZB 4ODWB 1X5HA 2VZ1A 3NCEB 4U1GC 2OR7A 1JHTB 5AAMA 3VMOA 1J5OL 4MD0B 4Y8AA 2H8PB 2XZAL 1K4DB 3HI1A 3AS2A 4K3DH 1KB5A 2J3SA 4WW2F 2ZWLT 1I7RA 2DQGH 1F58H 2IG2L 1I7ZA 1JNHA 3UPAA 1EEQA 2BK8A 1RK0B 5DS8A 5BS0B 5I1LA 3TJEH 2IFFH 5EU6D 3DO7A 1JUFA 1GGCL 3D5OF 4OZ4B 4DGVL 4DAGL 5B39G 3F7YB 2KZ1B 3U9UB 5FF6B 2W0LA 3NZHL 4PRPA 2G75A 3IXAB 3G6DL 4PJHA 2CMRL 2F5BL 1G1CA 4UNUA 5GS3A 4P4RA 5IMLA 2AI0L 3KVQA 1BBJA 4HUWB 5F7YC 4R26H 1ETZB 2WMPA 1R3HA 2WUBL 4NDMB 4X6DB 1ZLWH 3R06A 4NN7B 3OBAA 3P0YH 4LVHC 3SKMB 3R0NA 2WIMA 2HWZL 1HHGA 2VJXA 1XIWB 4D8PB 5EOTA 4YFDB 1T03L 5DUBA 1NFKA 1UYWL 4RX4D 1NUGA 1JP5A 3LKPB 4RAVA 4Y19E 4RGNE 5BOPA 5BRZA 2VQTA 5INDB 2NPLX 1IM3A 1MAKA 3MRJA 1P4LB 1QLRB 1DE4B 5SX4H 1R3KB 1KCSL 3BPNC 1J5OH 1MREL 4X0KA 2VL4A 4TNWK 5EIIB 2XZAH 4HS6A 1H8NA 1JVKA 3MO1A 1MJUL 3V6OA 3BD3A 5EO9A 4IJ3C 3DYOA 5KSBE 3FAWA 1GGCH 4E41D 5L6YL 4DGVH 4G9FE 4ZUVA 4WHYG 2ADFL 4DAGH 4F7TA 4F33A 3P73A 2WINA 2BOBA 3NZHH 4PRDB 1QEWA 1R5WB 5JO5A 1LE9B 5F9OL 1W0VB 2CMRH 2F5BH 4LNVA 2AI0H 3VRJB 4E5XB 3E6HA 3O2DA 4Z7WF 4O2FA 2WUBH 3FQRA 2P5WB 2IPUK 1QRNE 1UVQB 4DGIL 1SVCP 1I8IA 5T1MA 1Z5LA 3MV9B 2R0KL 2HWZH 1EK3A 3IDJB 5L0QC 3NBNA 3RUGA 1T03H 3ULUE 1A21A 1KELL 4GXVL 4R7DA 3GI8L 1UYWH 3QUXA 3BP7B 4U49A 1H3WM 5ALBL 4KRMB 3WL9B 1I7UB 5E6IB 2XWTA 2Q86B 1DEEB 2DYPD 1KCSH 4ZS7L 1R3LB 1MREH 4NKQB 4X4YA 5HHQA 4G9DA 3KPOB 3OKYA 5E1HB 4D0BB 1MJUH 3AY4A 3BESR 3MFFA 3RWDA 5LQBL 4JO4L 1MCKA 4LBEA 1I8KB 3NFPA 5L6YH 4KI1A 5FYLE 4PJXF 2ADFH 5TDNB 1KYOJ 4JFDA 4MA1C 1UZ8B 3QJHA 1X5XA 1N5YL 2ED9A 5F9OH 4XRCB 1E27A 1XF5B 2E9JA 1FZMB 5GGTL 2BVPB 1NJ9A 1YMMB 4HFWB 3RWJB 1DUZA 1T3FA 2C3VB 2VLRA 3SKNB 5KS9A 5L2JB 4PRID 4P59L 2FX7L 4BQ9A 4HD9A 4U6VL 2HVJB 1NCTA 1ZEAL 4DGIH 1JWMB 2FD6L 2LU4A 4WRLA 2E7LA 3MMEB 2R0KH 3ARDD 4BYHA 5DHVA 5IHZB 4DVBB 3VDAA 2BNQB 1KELH 5GS1C 4GXVH 1YN7B 4ZQKB 3GI8H 5HYJD 2PETA 1ZGLA 4WTZA 2C5DC 2VABB 3HN3A 4WWKC 5ALBH 1DCLA 1YNTA 3ZDZF 4ZS7H 4M62L 2FLRT 4RAUA 5IQ7L 4WUKL 3G5ZA 1OGAD 3IXTB 3WJLC 4L4VE 4L8SC 1UEYA 1XR8B 3B9KA 4RRPA 5LQBH 2QKIB 4JO4H 4M7ZC 5JORA 4ODUB 2NNAA 1NFDE 1EIBA 5IOPA 1BD2E 2A9NL 3GUTA 3BP4A 3EW3B 1FL5B 5ILTL 3BUYB 4R4NC 4X6CA 5BQ7B 1AGDA 1N5YH 4F7CB 1VGKB 2H9GB 1Q1JL 5GZND 3T0WA 5GGTH 2ICWJ 1I7TA 5I18L 2UWEB 3F7RA 4FN0A 3E8UL 2FX7H 4GRWB 4U1HA 4U6VH 1BZ9B 1ZEAH 3LSOB 2XV6B 2FD6H 1IQDA 3VFPA 3W5NA 4OLZH 4PJEF 3VD7A 5IR1B 4KKBC 3QXVA 3QO1A 3T2QA 4OLVL 4OUOA 4OUUB 5FA4B 4PY8J 1A1MA 4X7CC 3JVGC 4UB0L 1LP9A 4UUJA 1HINL 5GRYA 3P77B 4HQQL 5K59F 3V4VL 5ANMA 2BCKB 5FKPA 4M62H 4KJQD 5IQ7H 5JDSB 4ZSOA 2A6IB 3OXRB 4WUKH 4NKOA 3REVA 5M7QA 4X7TB 3OR7A 4XHQA 5DVKA 3WIIL 5D1ZA 5IEKA 3U30B 1MWAL 4U6HB 4J4PA 1J0HA 2QQNL 1HNGA 1EAJA 4HBCL 1SJXA 2A9NH 1U8JA 2D4DA 4KRPC 1NGPL 4M48L 5ILTH 3VWJD 1TDQA 3C6LC 1X4YA 4RMUA 3T2OA 5IROC 3D0VB 3S5LG 1Q1JH 4JM2B 3L3OB 5DUML 3QFDB 1L0XA 3FJTA 2NZIA 5I18H 4LCWA 5MERB 3E8UH 1K5NA 3WEXB 2XTJC 3DROA 1AY1L 2PW1B 3T1FA 2Q20A 2V5RA 4B7IA 4OLVH 3SJVD 4HJJL 4BZ1L 3PUCA 1RD6A 3B83A 4UB0H 5MENB 3CMOL 3FQXB 3PWJB 1E28A 4L4TD 4L3CB 1HINH 4HQQH 3RWFA 4NNPL 3V4VH 1ZMYA 4NOFA 4P2OA 4WI7A 2OBGA 5DWUL 2JIXB 2Q1EA 3ZDXF 1KUMA 3WIFB 2NR6C 1SYVA 3WIIH 1N5AA 4PJBB 4OGAD 5DMYA 1MWAH 3O8XC 1C5DB 4X4ZA 2BHYA 2QQNH 1IM9B 4ZFZA 4HBCH 3C9NA 4WFFD 4JZNA 4M9OA 5F7HA 1NGPH 1E4WL 5J11C 3HZKA 4NO5A 4M48H 5D7JD 4IHOA 4NNYA 3PNWA 5T1LB 1BBDL 4M9PA 5DUMH 2G60L 5HY9A 1KIRB 5L8JB 5DRNA 5EU6A 3HMXA 4ZO6A 4LLYA 1IARB 2ESVD 2XXMB 1QO3B 3QRGL 1AY1H 4P99A 2X4TA 3MNVA 3VXTB 3DARA 3QPXL 1X6LA 3LS4L 3RX5A 1X3DA 4HJJH 4BZ1H 2FJFB 4Z0BL 3ZDYF 1UWXH 1T80A 3CMOH 4KUZL 5T3ZD 4OLXH 2GY5A 4NNPH 1S7SA 3ARQA 4GBXC 5IW1B 3AAZA 3RBGA 4NT6A 5EO1B 1CQKA 2I07B 3VFUA 4P9ML 1YPZA 2VDKL 3RP1A 1S7WB 5J57B 5D2LE 3BPCB 5CJBA 3FRUA 1IAIM 3MROA 4HHAA 5E94B 3OZ9L 3BJ91 3A6BL 5KZCB 2YPLD 4A6YB 2FB4L 1E4WH 4OF8A 5FECB 3G6JF 1T04A 2D31A 4NSKA 1BBDH 1J11A 1KTLB 3NCMA 4JY4A 4PS4L 2CQVA 4WNQB 2G60H 3QCVL 2K7PA 2VUYA 4RGMB 3NTCL 4JRWA 1NDGB 4E41A 2BVOA 5F96L 1AGEA 4QHMA 4HUUA 5EN2A 3QRGH 3QPXH 5F8RC 1FFNB 3C2SA 3S37X 2H26A 3FMGL 2UZYB 4GXUM 5IK3B 3LS4H 2HT3C 3FB7B 2G9HA 1FCCA 2CO7B 1R3IL 3LAFA 4Z0BH 3HNVL 8FABB 2D7PA 2PW2A 4G6FD 3SDDD 3FOMB 2GUOB 2Z8WC 4KUZH 3L9RB 4PGBA 4MSWB 5CWSA 4MD4B 3SE3C 2I9TA 4PV8A 4K9EC 3L95B 4QHKI 1EMTL 4ZUSB 4P9MH 3QEUA 2VDKH 4XZUA 5DTFB 4S1RL 4X6DE 5GXBB 4RNRB 2JTDA 3QZWA 1IMHC 4F3FA 4UINL 3OZ9H 4WI2A 3HAEG 2DYPA 3FO1B 1OT1A 4H1LH 4XVTL 4O5LL 3UCRA 4WEUD 1YC7A 4YIQA 5FA3B 3QUMB 1YEGL 4Y19D 2ICCA 4RGND 2BY3A 4PTTA 3H7BB 2BMKA 4PS4H 4LLUA 3AREC 1IGTA 1RV6X 3FKUS 3QCVH 4P9HC 4D9RD 1F8TL 4TULL 2Z35A 2AQ1A 4W81A 3NTCH 4PJFF 5F96H 5C8JB 3PWLB 4OIIL 2OZ4L 4I48B 2DQJL 1AE6L 3FN0L 1BFVL 1SBBA 3BE1L 3KLHC 1R3IH 3PHSA 5ISZB 3QUZC 1T7YA 2Z93B 3HNVH 4W6WB 3VFRA 2P8LB 1J10A 4QRUB 1IEAA 1U3JA 4PRIA 1AXIB 4M6NL 4CVWA 2NY5C 4PG9B 1OTUC 1JZ5A 2YD6A 3DRTB 3OWEA 3O41B 5CIPA 2EICA 3ZKMD 4I2XE 1JGDA 3ARDA 3LCYA 1EMTH 3QXAB 4K71C 4LRIC 3WFBL 5HGBB 4S1RH 3NACL 4OFYD 5JPNA 2CDGA 1QRND 1EEZB 1I9RH 5EU7E 4ZAKB 1VFAA 2P5WE 4KMQA 3QI9A 5KSUB 1H8SA 3SKOA 5F6IC 4UINH 5E7BA 4U2ZA 1A14L 3BEWB 1BAFL 1TFHA 5IMKA 1ITBB 2XFXA 3MLVL 3VXQA 1Z6JT 3KLSA 4XVTH 4O5LH 5E2UH 4ORGB 1YEGH 4ESKA 1OGAA 3HKFA 5DF0A 4GT7A 3BQUB 1MCJA 3P4MA 2DICA 1G9ML 2OSLA 3MA7B 3FB5B 4G7VL 4YR6A 1F8TH 5DGRA 3AMLA 4TULH 4IEFB 4KPHL 1YNKL 4OIIH 1N59A 2OZ4H 2DQJH 2GCYB 1AE6H 3FN0H 4WHCA 1BFVH 2QADD 1OWWA 1IT9L 2GK0A 3C6SB 4R3SA 4OZIF 5FYLD 1I3RA 4UAOB 3MNWB 3GJEB 3GSQA 4LVOC 3ZE0F 4X4MA 1ZT4B 1N6QL 4MJ5B 5JQ6L 4M6NH 2R0WL 1KEML 3OSKA 2V7NA 3WFBH 3WLWC 5IIEB 5I2IB 2F54D 1YMME 2JF1A 3NACH 3OKMA 1DANT 2X6MA 2B7DT 4X99B 3S96A 4X4XB 1A14H 1A9EB 5A2LH 3O11A 3L7FB 1BAFH 4G6AD 2XICA 2IANB 3LDBB 3MLVH 4HWUA 1KEGL 3HHRB 3R1GL 4HUVA 5B22A 3VMNA 4PJ8B 2EDNA 4XBEL 3T1WA 2DWEA 4HMDA 3DX6B 2XQYG 5TH2A 1G9MH 4G7VH 4JKLA 5DDHB 3RIFK 4MB5A 2YC1B 2HLFC 1CE6B 4OCNC 1FZOB 3T0VA 2EIEA 2DIJA 1BVZA 4KPHH 1VFBA 1A1OB 2HFFA 4EVNA 2P48B 1YNKH 1WISA 3H9HA 2VITB 4MWFB 4FP8L 2Z31D 4U05A 3VWJA 2NY2C 3CFKB 3E1F1 4WV1B 4F2MB 2MTPA 1IT9H 1TZHA 3GSVB 1BD2D 3GB7B 1WCBA 5F1SA 1WBXB 3IFPB 1N6QH 5JQ6H 1WC7B 4Z78B 2OL3B 3QG6B 1RAMA 2R0WH 1KEMH 2BRQA 4MGXA 3I6KB 1D5BA 5C0GA 3SJVA 3VFSA 2QL1A 2UWEE 4MJ4A 1VKXA 4I77L 3DO3A 1GVIA 4L4TA 4LKXA 3KDMA 4JGMA 3RI5K 1KG0B 2VKWA 3GMRA 3WIHA 4DKFL 2B39A 4RDQF 4H0HB 1KEGH 3R1GH 1LEGA 3TBSB 4QTHA 2YD2A 4XBEH 4GRLB 2YA1A 4R2GC 1A6TB 1UT9A 4CGTA 5DEFB 3W5MA 3IDGB 1SQ2N 3OKNB 3HR5B 3GMMA 4QXGL 1VENA 5D7JA 4NN6B 4FP8H 3UROR 4BKLA 4J6RL 5ICZB 2EDKA 5C0DA 2ADJB 2YN5A 5FDWA 1J1XL 1T21A 1GRWA 1JNJA 2AK4E 5ESQA 2W65B 2ZOKB 3AM8C 1KTKE 3U2SB 3PF2A 3TCLA 4JFOA 1MLCB 3R8QA 3QRFM 4JKMA 1EX0A 2EDRA 1FH5L 2HT4C 3GSUA 4P5TC 2MCG1 2OJEA 4CMMB 5J1TC 4OCXL 1EVTC 5T33L 5DMGD 4I77H 4HIJB 5GRJL 2JK5B 4ZS6C 1CU4L 1LO5B 5CD3A 3FOLB 1MCPL 5SV3A 1QFWI 4DKFH 4OI9A 1AD9B 3MRLB 5DQ9B 4PLKD 4NQXA 1FNFA 4U1KA 2XXCB 5MENE 3WE6B 3STLB 4MVBD 1JF1B 5JW4M 5J9PA 2VKXA 43CAA 4PR5A 3SPVA 4YHNA 4I18B 4OZFB 4FTVB 4JJ5B 4KMTL 1CLOL 2YPLA 5CGYC 3BZFB 2HMIC 3GO1L 4PJBE 3O4LD 5GQBA 2AXJA 4J6RH 2Z8VC 2G5RA 4P2RA 5IHUL 1J1XH 3WS3A 5E8NB 1AGFB 1AC0A 3OKEA 5HI5D 4U1SA 4AM0A 1FH5H 4Y4KB 2ZNXA 4ZFFA 4P5MB 4BQCA 5KANI 4AMKL 4XC3L 5T33H 5GPRA 2B4CC 1DDHA 1UM6L 1HE7A 3UC0L 4PRHE 5JA9A 5GRJH 3FO2B 1CU4H 1S78C 3L5HA 3CC5B 3SDDA 3VG0L 3CAFA 1MCPH 3MRBA 1CTNA 4OD3H 2YPKB 4N0FA 3SDXF 3BKML 1R24B 4JDVA 4MXQD 4XX1G 4Q2ZB 2R2BA 1EDQA 3W9EB 1YMHB 2AV1A 3K81A 3U0WH 5IW6A 1NGWA 2EDOA 4WW2B 3QEHA 3THML 4Z9KB 5DK0A 2F53B 3X3FL 4KMTH 4Z76A 1U8QB 1CLOH 4MNHB 3FT3A 4J3VA 4MQSB 3GO1H 1BQHB 4X5XB 4Y19A 3VD9A 3BKYL 2EE3A 3CX2A 4POZD 1HH6B 2DL2A 2FRGP 4PFEA 2DIAA 5IHLB 2UVFA 3SE4C 5IHUH 3VDBA 3MOBL 3SE8L 5F3BB 3OAZK 5H2BA 3RGVB 4LP5A 4QXTA 2JELL 3T8XB 4ETQA 1JN6B 5CJXA 2NLJA 3ULVE 5FKAA 4LCUB 1A6ZA 4AMKH 4XC3H 4F80A 2FO1A 1UM6H 3WNLA 3GDBA 3UC0H 2AVGA 3U1SL 4RIRA 1IC5L 5KN5B 4Y8DC 3VI3E 3WNNA 3VG0H 2RBLA 4IRJB 4W70A 2GFBB 3F5WB 4JHAL 4MAYA 4XCFL 5TDPA 3BKMH 2VMFA 4LGPB 2YRZA 1KJ2L 5JHLL 1RPQA 3PV6B 3KHOA 1PKQB 3I84A 1MAMH 2NCMA 3MNZA 3BYYA 3MODL 3IAGC 1MFDL 3SY0A 1AR1D 4NC0B 4AIZA 5B3JF 4ZUUB 3THMH 6CGTA 3NZ8B 2V2TB 4PBWD 3X3FH 3G5VB 3S4SG 1HILA 2D7OA 4OSUL 3LPGA 3L3GB 4W4NA 4G6JL 2FO4B 5IESL 3U6RA 3Q5YA 3FFDA 3BKYH 1NH6A 3GK8L 4WO4C 1S9XA 3U83A 1PVHA 2IBZX 3MOBH 4G3YL 4QCIA 5HD8D 4M3JA 5I15L 4W6YB 1E4KC 4UIMB 5DJZA 3CFDB 2FHBA 5EA0L 1VERA 3FB6B 5JIHA 2JELH 1DQTA 4XP9L 3T77A 4PPTA 2GJZB 3TESA 1ZA3B 3VH8A 1OTTD 1FC1A 4I3GA 3WV0A 3BD4A 1NMAL 4LU5L 1BZ7B 3U1SH 5DRWB 1IC5H 1B0WA 1NCDL 4PRNA 2GY7B 3SDCB 1MFNA 1TMCB 1INQB 4JHAH 4XCFH 4NQEE 1YDPB 1KJ2H 5JHLH 4JCMA 2JLLA 4WGVB 3LHPL 2F54A 1CG9A 4G42A 4MJ6A 4EI5B 4U6XB 4FHBD 4HW6A 2CUHA 2F74A 3MODH 1MCDA 4CVXA 1MFDH 4N90D 5SWZD 1G84A 1CDIA 1YN6B 3MR9B 3SGJC 1IVLA 1C08A 1KPRB 1JI1A 4OSUH 1F42A 1R3JB 2HJFB 3T3PE 4G6JH 3G08A 4RFNB 1YEJL 5GJTL 2P5WD 4PJXB 2X05A 2PO6D 5IESH 1ZGLM 3GK8H 4LHUG 2HFGL 3OQ3B 1CBVL 3RL2A 3CLEL 4Z7WA 2YD8A 2HA1A 4C54A 1UB6B 4G3YH 1FVEA 5I15H 1T5WA 5EA0H 4XP9H 4F9LC 2D0FA 1VA9A 1RZKC 1F11A 1W8NA 3C5ZB 1T1YB 1S9VB 2Z31A 4M1CC 4OIAA 5ETUA 5A2JH 1NFDA 1Q94B 1X5IA 2YKLH 1BD2A 3B9DA 3ARPA 4LU5H 1NMAH 3BUTA 2X1QA 5CSZA 2CDFA 5I16A 1T20A 1NCDH 1MJ8L 2LU3A 4S11A 4HC1L 2RIKA 3BXNB 1DQJA 3NIGE 5C07D 3W0WB 4DUVA 3LHPH 3SKUD 4YEEA 1MHHA 1T7ZA 3MJ9L 3BO8B 3ISWA 3A6CL 1Q9LB 5K9OA 4LGRB 3TGXA 1CDYA 2FJGA 1QLEL 5E2VL 3L3JA 4UZGA 3V6FB 4BUGA 3C5SB 4Y4FD 1NAMA 1YEJH 5GJTH 3I6GB 4XB7A 3PDGA 1I1YA 2ATKA 1S9YB 5ACZB 2ATPB 1FZKB 3G5YA 4RISL 1LEIB 3B4NA 1AHWB 3QDJE 4P3CL 2HFGH 1CBVH 1XCTB 3CLEH 3OGOE 2Q8AL 1ZT1A 3V7AG 3FONA 1K3ZA 1AQKL 2IGFL 4FQQB 1IAOB 1OM3L 1HYSD 1U3ZA 3ZO0A 2EDQA 4L9LC 4WI9A 4OM1L 2VLJB 3U46A 4J8RB 2J8UF 3AXLB 3MJ7A 3LRSB 2YA0A 1DLFL 5I0ZA 1BWWA 1KCRH 2FHFA 4ZXBB 1MJ8H 3D48R 4P9HL 4HC1H 3RWCA 3KXFB 2W9EL 3DMMD 1WAAE 1UCTA 3MUGB 2APTA 4PP2B 1UXSA 2A1WL 1T89A 3PL6D 4NQSB 3MJ9H 1MI5D 4TVPE 5F21B 2BVEA 3TFKC 4GUPB 3RX7A 1GIGL 3A6CH 3GJFB 2ERJC 4YBLB 4PGEB 1PAMA 3KYMA 1B2WL 1FQ9C 5EG6C 1QLEH 2DMKA 2CKNA 5E2VH 4O51B 4G8IB 43C9B 4MQ7A 4EXPX 2NXYC 3HFML 1QLFA 3BVNA 3TT3L 1VADA 4HK0B 4RISH 4PGCA 4W4OC 4IOFD 2VLKD 4J1UB 4P3CH 1FZJA 4DQOL 3ZT7A 5MHSD 3DUHA 5IFJB 3EOAA 2DD8L 1AQKH 3QXTA 2IGFH 5ICYA 2NY3C 1OM3H 4PJEA 3QXDA 5LG1A 3O4LA 1P53A 4OM1H 4WJ5B 1FSKB 3MGTA 5CUSL 3S3PA 2R23B 2HT2D 4LLQB 4F7EA 1WTGT 1DLFH 3P4NA 3T2NL 2RHEA 1S5HB 3DNKA 4BH8B 4BZ2L 4KK9D 3JTTB 4Y16C 5DZOA 1K6QL 4P9HH 3S7GA 3ZKQD 3KYKH 5CEXA 1A6AA 1Y0LB 2W9EH 4CMHB 5JW3L 4R97C 3QWQB 4F58H 5EPMA 2AK4D 1Q0XL 2LQRA 2A1WH 4NBXB 5DJCA 1CDGA 1XR9B 3KYNA 2JE8A 3VJ6A 1XF3B 1GIGH 3TWCL 5CZVL 1B2WH 5GGRA 3MUY1 1FV1B 3P4OA 3QNZA 4MX7B 1VACA 1RZIA 4L8CB 3HFMH 2C4FT 3VDCA 5CAYB 3TT3H 3TVMC 1ZSDA 5ITFA 1MWAA 1FDLL 3ARFB 3ILQD 1UACL 4MXVF 4DQOH 3JSSA 4M03A 1JGUL 2Z0BA 1F3RB 1GC1L 5MEND 3QNYB 3BGAA 1F3JB 1FBIL 4Y2DC 5KAQF 1VHPA 4F7MA 1A1NA 3EGSB 2WBJC 1H3UA 4U6YB 2P24B 5E8OB 1FYTD 2PTTB 5CUSH 5IQ9B 1XH3A 5D2NA 1CGTA 4FTVE 2BNRB 2COQA 4RBPK 1DVFD 3OKOA 2NY0B 3T2NH 1BHGA 3L5WA 4BZ2H 4APQC 2Y36L 2EXWC 1K6QH 3BIKB 1U92A 1E6OL 2YR3A 4GKZA 5JW3H 3UYOD 2YS4A 5LCVL 4J2XA 1Q0XH 3K8KA 4QRSA 1KB9K 1ZGLP 2YXFA 2ZUQB 1CD0A 3FO9A 2YUVA 1EHLL 3U0TA 4X8JA 3TWCH 5CZVH 3L3DA 2IALB 3B2UC 2DTMH 4PRHD 4L4JA 4C59B 3BPOB 4MNGB 1LNUB 1S7TB 2Q7NA 4EKXA 4CU7A 3HG1D 1FDLH 4LDLB 3RTQC 1OAYL 5CJ5A 3G6JB 1UACH 1NGXB 1JGUH 1GC1H 5DMKB 4GLRH 4QXUL 1FBIH 4U1LB 4HBQA 4HKZB 4H1LB 2HTLD 3DX9A 3KWWB 3WN5B 4BJLA 4CNIA 1KIQB 1FGVL 5F7KC 1BM3L 2FCBA 4D0CB 4QHNB 3RJQB 2F53E 2Y72A 2X42A 3ETBF 5JPMB 2Y36H 4XI5D 5EULV 3QXUA 3HI6L 3QIWC 1A2YA 2V9TA 2IBBA 2WWMC 1E6OH 2Z4QB 4NC2B 2YZ1A 5EBWA 4BFIA 5LCVH 4M3KB 3NIFE 1KIUA 1XGTB 2D7TH 3G5XB 5HYFA 5IJVA 3N1GC 4LLDB 1M7IB 2W1NA 3AUVA 1EHLH 3ULVD 1CGVA 1HSBB 3IDYC 4U33A 2FGWL 3O45B 4Y2OA 4KHTL 3S37H 5HYSB 4XGZA 4OCWL 4J3TA 1JZ8A 5IB2A 1OAYH 3WS6C 2WZPD 5SWZA 2HJLA 4I2XA 5AWNL 1F97A 4WWKD 4QXUH 5FO8A 3MRKA 1N6VA 5KSAB 4PJFB 1G6RB 1XGQB 5F89A 2PO6A 1X5ZA 1UJ3C 1FGVH 1B3JA 1OF2B 3T2PA 3B8SA 4LLWA 4S2SA 4PG2A 1B4RA 3BP5B 5FUOL 1D9KC 3HI6H 4NZTL 3GSRA 3BIBX 5INCA 1MOEA 1V3LA 2OTPA 1VESA 3MSPA 1NL0L 5DFTA 3IU3A 2JJSC 1SEBA 1R0AL 3I3DA 3KPOA 3SCMD 1CGWA 5A3IC 5HDQL 2YWYA 4I0PB 3GMNB 1OTSC 2H6PB 1AH1A 4QF1A 2FGWH 5C07A 2GAZA 4KHTH 3EJJX 1I8KA 4J23A 4AH2B 3PXJA 5L8KB 2FSEA 4KKBD 4JG0L 5DJ8B 5KOVC 4JE4B 1RHHA 4QXWA 4ZUTA 4XP1L 4YJZL 3I6LD 3LVEA 4OCWH 4ONGL 2HJKA 4HH9B 3GSOB 2B4CL 4NQED 3RVTD 5AWNH 1JPGB 1N8ZB 1MFEL 3WLBA 5I66A 2E9BA 5F70A 5JIIA 3FHAA 1LD9A 1AQDA 2OQJA 2BSTB 2C1PA 5JOPE 4M02A 5IT2L 4Y4FA 1EXUB 1XF2B 1JE6A 5F6HI 1EA9C 2HVJA 2VDOH 4X8XA 2XN9B 4P46D 4ALAL 3VD4A 2N7AA 3BW9B 4PJIF 5GRWA 2NX5B 3CCHA 2PTUA 1S7XA 4UOJA 5KG9B 4WW1B 1RZ8A 1U93A 4Z7QF 4YDKL 3O6LL 4LKCB 2B5IC 4ZAKD 2ZUVA 5FUOH 2OZ4A 1LMKA 3K2UL 4NZTH 2NY4C 5DJDA 5CBEB 3CGTA 4PJ9B 1QTYT 2A2QT 2UZXB 4JN1L 1IAKA 5K9QG 5C09B 2ILLA 4U1GB 1NL0H 2IMNA 3GSXB 2VSDA 3MV7B 1R0AH 4XNQB 5EUKB 3BQUD 4F7PB 5HDQH 5BOZG 1U8PA 3JUYA 5TE4L 1XZ0A 3DMMA 4OV5A 2P45B 5T5NF 4GW1A 3CZFB 1S7UA 5BZDA 4FFZL 2K7QA 2R1XB 3QIUC 4YUEH 4JG0H 3PL6A 3QG7L 4XP1H 1MI5A 4ONGH 3ESVF 5GS0C 2B4CH 1MFEH 5F7NC 2IWGA 3TO2B 3MRGB 2PCPA 3W0WE 4N9GA 5HI3D 1CGYA 5IT2H 4BQBA 4QYOB 1KPUA 4ALAH 4OZIA 4LVHB 5B38A 4J3WA 5ENWB 3OKKB 1OAXL 4PRBB 5EU4A 2VLKA 3P4LA 5MI0C 3EJYD 2EECA 5CD5C 3NCFB 5C0FB 1OW0A 4PUBH 1HHIA 2ICES 1KYOK 3O6LH 4YDKH 1D5ZA 1FFPB 1ED3A 3K2UH 3QDJD 3G9AB 1U8KA 2WIIB 1NC4B 3QUYB 4JN1H 3H3PL 2R1WA 4ORZC 4TTDD 3BPNB 1AIFB 2A73B 4C56D 2BRRL 1ZHKB 4X7SL 3DV4B 2A6KB 4GW4A 3U79A 3OHXA 1TTFA 3SEPA 3C87A 3L3IA 3QWOA 1WFOA 4N8VB 2BSRA 4P4KB 4XPBL 3RVXC 3MLUL 1R5VB 1AJ7L 5TE4H 5F44A 4K3JL 1JZ7A 2AK4A 4FFZH 3WHE0 2CIKA 3QG7H 1UH4A 2NY6C 3D3VD 2VXQH 2EC9T 2OK0L 3ULSB 3FTGB 3KXFE 2IPUG 3GSNB 3OF6D 5C0AD 4XBPB 3JWNC 4TVPD 2FLBT 2OX5A 3MACL 4NRXB 2DQTL 5D7LB 1KTDA 5DJ6A 4L3EB 1CWVA 1N2RA 3RVVD 5GGUB 2PW1A 3WNPA 3HPLB 1OAXH 2Z92B 1HXMA 1TNMA 1UXWA 2H3NA 3V2AR 5CMAA 5E8PA 3T0DA 2AXFB 3AROA 1KENL 5F71A 4LLMB 5DSCB 4R7NB 3V6OC 4HIHB 3H3PH 3MRRA 3MYZA 3ZKNC 4Y4HD 1BOGA 1G1YA 1FYTA 2JCCF 5CJQL 2BRRH 1CXKA 2VUOA 1DVFA 4X7SH 4WCYL 4OAWB 1JMZA 1NGZB 2HFEA 4XPBH 3MLUH 4I9WD 1K4CA 5EFIB 4EI6A 2IQAA 2XIDA 1AJ7H 3PHQB 4ENEC 4NHUA 1WICA 4K3JH 3OTTA 3ECBA 3OGCA 3TLRA 1KPVA 1QZ1A 4Y5VA 3EOBB 4QHLA 1RZKL 1T1WB 1VCAA 2R2HA 4MA1B 3BN3B 1RUKL 3K7UA 2OK0H 4WTZG 3WFCL 4F15C 1CVRA 4ELMF 1NUFA 4JFED 1JPTL 3MACH 4PRHA 3V6ZB 1RULL 3OAUL 3QUXC 1QO3A 2DQTH 3SDAD 5EZJA 3HG1A 1OHQA 5I75C 2QHLA 4XVJL 1QOKA 1JZ2A 1EBPA 1CL7L 5GZOC 2UYLA 2B1HL 4L8DA 1P1ZA 5D7SL 1KENH 1D6EA 1REIA 4GKSA 4I4WB 3AY4C 1RJYA 2AXGB 1BLNB 4P2YA 5BCAA 3MREB 5CJQH 1AGCA 2V2WA 4WCYH 1TCRB 1JWSB 3NFNA 4P5KB 3D39A 3NA9L 4FFVD 1FNGB 4OKVA 1CGXA 4Z7UF 3FCTB 2GSGB 4U4BA 4FTVD 4M7ZB 3QWRD 3CJJA 3SDXB 2BNRE 3U0PB 1RZKH 1XCQA 5DJ2B 1CFBA 2CLVB 1EJ6A 4D94A 1U8NA 2E7LC 1H3TA 1QUNA 4NJAL 3WFCH 3T3MF 2HLAB 4FXKB 4OLEA 3TNMB 5D1XC 3IFLL 1JPTH 3MGOA 4XCYB 1RULH 3OAUH 3PGFL 2LTQB 1ORQA 3QP3A 3EYVB 4JQIL 2X4SA 4M5ZL 2G2RA 3NCCB 4P23D 4XVJH 1UG9A 4YNYB 5GS1A 1IAIL 1CL7H 4G80B 3CVHL 1QFWM 2B1HH 4PJAF 1KIPB 1RZGB 2F8OA 5TF0A 4WWKA 5LJYH 5D7SH 5JXED 3B9KC 2VDRL 2MKWA 3BHBB 2P8MB 3IJYA 1E6JL 4L8SA 3LN5A 4KTYA 1HQRB 4JANA 2LV4A 1YEDA 4FFYL 1PBYA 1F3DH 3AB0C 1K8DA 2L7JA 4C83A 3NA9H 5GJSL 1IZJA 5J6GA 2F53D 5C0JB 1FFOB 3FB8A 5L8LB 4QO1A 1LO0L 4KRPB 2J8OA 3O3AB 4ZFOL 1IKNC 4FQXD 3SCMA 4NJAH 3C6LB 3H7BA 3KPSB 2EEBA 3RWIA 3PJSB 4OQ1A 5C0RL 1RIHL 4KJPD 4QRRD 3IFLH 4QY8A 4YPGA 4HWBA 3PGFH 1FNHA 1KJ2B 2NZ9C 3TF7C 2XTJB 4JQIH 4GAYA 4EUPH 4M5ZH 5GSVB 1Q9WB 2IH1B 1VB9A 3EYSL 1GZPB 4MNQB 1LQSR 1IAIH 4NQEA 1JRHL 3CVHH 4OCLC 4LCYB 1UQSA 4XP4H 4ZOCA 1CICD 5D1ZC 4IRJD 3A67L 1PYWB 2A6DA 3GBNL 5BJTA 6FABL 3WFDL 4DEPB 4OZHF 4OZGF 4P46A 4U1NB 2VDRH 4J4PC 1W2KT 5JW4Q 4IMLA 3KYOB 1E6JH 1FL6B 1P69B 3MRCB 3W39A 4FFYH 4LAJH 1GOGA 3CFCL 5K9JL 3O8XB 5GJSH 3MCKB 3S35L 4EJ1C 1FJ1A 3MRHA 4LSRL 2IAMD 3MBED 4E9LA 1WEJL 1QBML 1ZHLA 4HKXB 4LPVA 1D5XA 2UY7A 5IVXB 1WZLA 3IB4A 1HXYA 4AT6A 1YEFL 5LAXB 3H7LA 3QIBC 5FV1L 5C0RH 1QSEB 1RIHH 4OCRL 2YD4A 3TA3C 3RHWF 3UTPE 2AK1L 1UA6L 5FHAL 5DRXA 2GTZA 3SGDH 1MFAL 2E7CA 3WFEL 5HJ3A 4R4BA 4P2OC 3BKCL 4MCYA 3EYSH 3PWUA 5E2TL 4NZDA 3H0TB 4YHLL 4F8TA 4O00A 1JRHH 5DEZA 4F37F 1RUPL 1ZVHA 3TBTA 3BJLA 2VE6A 1MRFL 2VC2L 4S1DC 4YGVA 5B4MD 1E0OB 1R5IA 1IGCL 2BVUA 2Q7YA 3A67H 3GBNH 5HYQB 6FABH 2BSED 2J6EL 3L1OL 3O9WD 4GBXB 3K1DA 3RZCD 2X09A 4LGSB 1C5BL 4MB3A 5BVJA 5FOBB 1L0YA 2V17L 3CFCH 1MCCA 2ITCA 5K9JH 3H9SB 3S35H 2VOTA 1A7BA 3QDJA 3VFVB 2EH8L 4YDJB 3V5HA 4LSRH 4OGYL 3VFMB 2NX5E 3BRGC 1WEJH 2DKMA 4YDVA 1QBMH 3UTTB 3MX0A 4RSVA 2IBZY 4C56A 3HUJE 1YEFH 2N56A 3MJGX 2AV7A 3M1BB 2OLDA 5C09E 3WNKA 4JAMB 1X7QA 4KTDL 2PYEE 2AK1H 3QAZB 1UA6H 5FHAH 2VITA 1A47A 1MFAH 3WFEH 3BKCH 3D3VA 3DIFB 5FM5O 5E2TH 3QZWG 5D9SA 1WAAA 1RUPH 3F6LA 1HHHA 4DOHB 1MCOL 3OF6A 5C0AA 3Q6FB 3V0WL 1MRFH 2VC2H 1IGCH 3TBWA 2YD5A 2N4IA 2J6EH 3L1OH 4XH2A 3D0LA 4O2EA 4X9HA 4UT7L 5IBLD 1XGRA 4NRYA 2J8UB 2V17H 2F8XC 4X98A 4EQ2A 1SJHB 1T5XA 3G6AB 3DXAB 2EH8H 3QPQD 4OGYH 5HGHB 1FLRL 4Y4HA 4ETYA 3KPQB 4O2CB 3BEVA 4MA3B 5DJ0B 3LEXA 2KH2B 4HC1A 2CLZA 5JTWA 1NCNA 4NFCA 3EBAA 5B8CC 3AREB 3C8DA 1X5GA 4YO0A 1OSZB 2R69L 4KTDH 1UCBL 3MJ9A 3IJHB 5JQHC 3RY5A 1B0GB 2R4RL 3MYJB 3U7YL 5DFVD 3QYCA 1EO5A 1G0XA 4GRMB 4CADA 2FIRT 1I4FA 3VXSB 3FQNA 3OKLB 1MCOH 3QUZB 4FXGA 3PE9A 3V0WH 4JFZL 4JFEA 3PGDB 4HS3A 2BXYA 3KPMB 3OJMB 3SDAA 3MLZL 3OB8A 5IVZB 4NQTA 5BMFL 4UT7H 4TUJA 4K71B 4GKNB 1U8HA 2DWDB 1TENA 3WO3B 1A3QA 3VXRB 1K8IB 3NAAL 5ERWA 4YHZL 4NYLA 1RJZA 5D7LE 4L3EE 4IMKA 1GXEA 5F6IB 4QOKB 4WHTA 4QNPF 5CP3A 1FLRH 1IAMA 1A4JA 1XFPA 2GI7A 3GHEL 1RK1B 1DLHB 4NFDA 1PZ5A 4U1IA 1IGML 3M07A 4UTBL 3LOWA 3QQ4B 2UVEA 4JJ5A 4MDIA 1FO0B 3QWRA 5A2IH 4M61B 2R69H 2YPVL 4OGXL 4PJGE 2R4RH 3ALPA 3U7YH 1ZA6A 3ARDC 3UTQA 4HXAL 4HIXL 1I8MB 5FB8A 3UTSB 4JFZH 5AD0A 1M7DA 1J18A 2R2CA 4LRIA 1UB5B 1ES0B 3MLZH 4Q0XL 3BIAX 4P23A 4XNYL 5BMFH 3QDGB 2DKSA 3FO0L 3ZE1F 5GS0L 4YHZH 4OF0A 5HVHC 4HULB 5JXEA 2ORBL 4GS7C 3VFNB 1R24A 3X14A 2QHRL 2DN7A 3GHEH 1QFUH 3BN9D 5F7LB 1RJLB 1W0WA 2I9LB 3RZWA 3PGCB 3AS1A 4Z5RA 1RQ5A 1T2JA 2VXSL 1CDUA 1IGMH 1SHMA 1WZ1H 3IAQA 4UTBH 5GZNC 1I3UA 4NQCB 5IV2B 5BXFB 3MZTA 4EDXB 1YY8A 2YPVH 4OGXH 4QRTB 3VRLE 2YEZA 5D5ME 4FQXA 2NY2B 4GAFB 1TVHB 2Z8RA 4WUUD 3D2UD 4HXAH 3RIAK 4DUWA 4HIXH 4JRYE 4P3DA 4QRRA 1F2XK 5JIKA 4CVZA 2ZSWB 3CH1B 4AG4L 2FYYB 3T8XA 1HQ4B 4Q0XH 5SX5K 2W38A 1BQUA 4XNYH 4KJQC 4FNLL 4XWOD 4MQXD 3FO0H 5FFLA 3ZKXC 2EZ0D 5GS0H 3E6FB 5EORL 3LEVL 4IOIA 2B0SL 1CICA 4PJHF 4IRJA 1TITA 3JV5A 3JV6A 1IEBB 5EBLA 1NANH 2R0LH 3CFEB 2ORBH 4NZJA 2B1AH 4TN9A 3LB6D 2QHRH 1DSFL 5F88A 4ODXB 5CFHA 2DQDL 3TPKA 3VWJC 1KCLA 3IDIA 3E3QC 3SE9L 1JK8B 2VXSH 2A6JA 4U1JA 3QEQB 3VU2A 4H8WC 5CSBA 5MEQB 1QSZA 2IAMA 3MBEA 3E2HC 3VGFA 3ROOA 4UQ3A 4WU5B 5A40E 2NW3A 3VI4E 3JXAA 5KSVA 4OQTA 3SKJL 4WFEE 5E56A 1H0DB 5DVMA 1GJIA 4YDLC 5I1KL 1AD0A 4AG4H 1WQVT 3MUHL 3VXPA 1P2CB 2WLZA 2Y5EA 3EIFA 4FNLH 5CEZL 5FOJA 3VGDA 5C0EB 2ZKHL 3LEVH 2B0SH 2APBA 3TN0B 5GGQL 4OGAC 1HNFA 4S0SD 2XTJE 2FJHA 1M1SA 2XQYK 3DGGB 5T3XL 3WO4C 1QKZL 3O9WA 1INQA 5CJOL 2OP4H 4ODVL 3WHE1 3RZCA 3STZA 1DSFH 1MF2L 4UI2A 3TZVC 1FN4B 4CN6A 4HKJA 2DQDH 1BIHA 2P7TB 1AKJB 3SE9H 3DUUB 3ZHDA 4WDIB 3LKQA 1DN0B 1HDMB 3LKSB 1S7QB 2NY7L 3U4EB 1KPRA 1MCSA 1PKOA 1FAKT 3G04B 4OM0L 5A16B 4P2QB 4BH7A 1DBML 3VWKD 4KH2A 1PLGL 2AJYL 3QXWA 2MCPL 4JPIB 4OKDA 4P57B 1QBBA 3BZ4B 4HT1L 3NFSL 2DQIL 3DTXB 1NEZA 2VYRE 3SKJH 1WBZA 4KDVA 1BWMA 3VFTB 4RWYL 4FOMA 4P5TA 4GG8A 5I1KH 4LFHD 1F5WA 5I1IL 5IVXE 3UBXB 1I1FA 4OZFG 5E4EC 4X6FB 1T1YA 1CLCA 3ARBD 3NIDE 4XBGB 2D0HA 5CEZH 3Q6GL 2Q3AA 2C3WA 2EKSB 3UTPD 2ZKHH 4XP6L 5JW4N 4U3XA 2C26A 5I73C 3LKOB 3GMLA 5GGQH 5IMOA 3UYRL 4RAHA 4R0LB 4I0CC 3ESUF 5T3XH 1JGVL 1GZQA 1QKZH 5CJOH 1T1XB 4M93C 3SDYL 4ODVH 5KS9F 4HAGA 1MF2H 4PJDF 4N0UA 2P47B 3QB7C 1KT2B 2NY1B 2I5YL 2VZTA 1OB1B 5J6HA 1BECA 2X2YA 2BZDA 4HIIB 35C8L 2VLLB 2Y9RT 3STBA 2NY7H 2XKNB 4LL9A 1ZHNB 2DM3A 4OM0H 1DBMH 1MUJB 4GAJL 1F4HA 2V5TA 1PLGH 2AJYH 2CRMA 2MCPH 4HJ0D 4Z0XA 4HT1H 2DQIH 3NFSH 4EIZC 1ZHBB 4RWYH 5DRZA 1MIEL 5J56B 3CFJB 5I1IH 3SDDC 3MRPB 1P7QD 1IAOA 4PJIA 3KNBA 1M6OA 3TBYA 1ZVSA 4JZJA 4JDZA 5C09D 5DYOB 3DI2B 3ET9F 3Q6GH 2PYED 4W6XB 4G43A 3LRSA 2OJZL 1BQHG 4XP6H 5IHBA 4X6CF 3LD8C 3UYRH 5DHVH 4ACPA 2APVA 4K8RD 3QA3A 2Z9TA 4YHML 1JGVH 3M17B 1ZLUH 3MUJA 5HHVL 3SDYH 4RFOL 4XNMA 2PXYD 3VCLA 5IMMA 1P5VA 1AO7B 2OTUB 4NPYA 2I5YH 4RGNC 4Z18A 1G7HB 4ZPVA 4BFGA 1CZ8L 35C8H 1CDHA 1LP9F 1CDJA 2BY2A 4ZYKA 3WDHA 2C3XA 4MHHI 4GAJH 4PY7A 4QWWD 3IVKA 2BY1A 4K2UL 2F19L 2XWBA 3O4OC 4JFQB 5CJXC 1I8LA 2CGRL 2EXYD 4WO4B 5IB3A 1LK3L 3QFJB 4K94C 3HI5L 4NRZA 5D96C 1MIEH 2XPGA 2XZZA 4LDEB 5I74B 3GIZL 5D7KE 3ZKMC 1I1RA 1X9QA 1S9WB 2EEAA 3RWEB 4BSVB 1U8IA 2OJZH 4KDWA 3N06B 3CSYB 3QQ3B 5IB1B 4N0CD 1MPAL 4P4KD 1M71B 3BGMB 4YHMH 5HPMB 3HAEH 1YECL 2W0FA 4GAGL 2ZUSA 3DUSA 5HHVH 3CNKA 3L6FB 4CKVX 5I71C 1PG7L 4RFOH 3PABA 2Z91A 4R96A 1EHAA 3MV8B 1S7RB 4TSCL 4QGYA 4Z7VB 1KJVB 1OP3H 1ITCA 1CZ8H 5AG8A 5D8JL 2P8PB 3RGHA 2GW5A 5E00B 2YOCA 1CDCA 5IFAL 1KN2L 3FN9A 1CFNB 2GJ6D 4L3ED 4CRPA 5JNYB 4UQ2B 4K2UH 2F19H 1HOCA 2CGRH 4QOKE 3M45A 2HN7A 5BZWA 4D0DA 1LK3H 3TBVA 4HJGB 3T65A 2Y4SA 3HI5H 5JUEL 3ZKSD 1H15B 1NBYA 3GIZH 4HG4J 4LEOA 5LGJA 1BQSA 2MPAL 4WUUA 3D2UA 1M05A 2X89D 1TLKA 1U8OB 1OOAA 3VXMD 5EU3A 4EEEA 1MPAH 4Z77A 3WCYA 1G9NC 1YECH 3RL1B 4GAGH 2JCCA 3LY6A 5DQJA 3RWHB 1QR1B 4G6AC 1TXKA 5TGBB 1TTGA 2P5EB 2VR5A 5IM7A 3UTSE 4TSCH 1UH2A 5HGAA 4UBDD 1JPST 3IJSA 1QVOA 1S9KC 3IRZA 1A0QL 5HVFB 1DQLL 1MRCL 5D8JH 4Z7UB 3GHBL 1CFSA 4FQPA 5IFAH 1MVUB 1KN2H 5H35A 4YC2C 2GITB 4G8FB 2Q87A 2Z31C 1F6FB 1BX2B 4ELMA 4JFXA 3T0ED 4YAQA 3B6SA 5JUEH 1JJUA 5DHYB 2A77L 5FGSA 2C9AA 5E95B 4D2NA 3QDMD 5GRVL 5C0IA 5IF0A 1A9BB 4Q6IB 3ES6B 5TF1L 2EDWA 4HCRA 2FL5A 2MPAH 2DI7A 4PRAA 3ARGD 5JW5A 4PJAB 1NFIA 2GTWB 5DC9B 5ICXA 3C8KB 4G7YL 5I8OL 2CUMA 2ID5A 5CEYB 3NCJL 5K9KA 5HHMB 3KPNA 4JRYD 3LPWA 3EDEA 1H5BA 1VFMA 2VQ1A 4OD1L 3G5XA 5FYKE 1CD8A 3CVHB 3FQUB 4RFEB 2HG5A 4XB8A 1EAPA 1A0QH 1DQLH 1IC1A 3DX8A 3IDXL 1MRCH 1XGUB 3U48A 1HH9A 2AEIT 2GQHA 3GHBH 5I6XC 2NXYB 3B43A 1J0YA 4X5WA 2RGSA 3O3EA 5E2WL 3HE6B 2VQUA 7FABL 1AFVL 32C2A 4YHPB 3NGBC 3DVNB 1U8MB 3SHSA 4OI7A 4X9IA 4WI5A 4HLZH 3I9GL 3DRQB 4BM7A 2HVKB 2J5LC 5CLTA 2X5PA 5C0BE 3ELAT 2A77H 3O3DA 4L9LA 4RA3A 2X4RA 1XGQA 3QULA 1UKTA 3VWKA 2MQ3A 1CD1B 5TF1H 4OD2A 3IS1X 1OF2A 5EUOB 4UNVA 3SO5A 3CFBA 2Y06L 5DMGC 4G7YH 5I8OH 4Y16B 1IQWL 4EUPA 3NCJH 2EDDA 2CPCA 4AYFA 1XAUA 4R97B 5GS0D 3GRWA 2V2XA 3ARBA 4PLKC 2ZUXA 4OD1H 3OXSA 2AS5M 3WUWA 1W72B 4HUKB 4KAQH 4MVBC 4UOW1 3ORJA 1J8HE 2DQFB 4ZDHA 3IDXH 4RMRA 4HIEA 3BH8A 4YFEA 3RX8A 4W4OA 4NKMB 5E2WH 4TQEL 3VMPA 3TVMB 5C70A 2BJML 5DJXA 3BYTA 7FABH 3FQTB 1AFVH 4YHYC 2XY1A 3TPUA 3BZEB 2ICWI 2EDJA 3DSFL 1EFXD 4D3CL 1Z9LA 3UMTA 3WFHA 1P7KA 3I9GH 2X9WA 1TQCB 4H25A 4ZFOA 4Y2DB 3OB0K 3J7HA 1TVBA 5ESAA 3ILPB 2D3VA 3NN8A 4PY8I 4ODTL 1DFBH 3JBG7 2M26A 1S7VB 2Y06H 4BA8A 3FZUD 1YYML 3HUJA 1ORSB 2ZJSL 3CU1A 2D0GA 4IBLT 4OZHA 4APQB 5JOFA 1IQWH 4P2QE 2OYPA 3BKJL 4OZGA 4XXCC 1P7QA 2IFGA 1G0DA 5ADOL 4KGJA 5C09A 1TPXC 2UUDH 4AEEA 1I1AB 2PYEA 4MXQC 3ZE2E 1QNZL 2C7UA 1YC8A 4BQ8A 3GSWB 4YHIA 1XMWA 3U36A 3QNXB 1BJ1H 2AEPL 4NQDD 1LDSA 1LE5A 2PXYA 2XWJB 3LH2L 4TQEH 5F1NB 2BJMH 2R1YB 2RQ8A 4QRQB 2CUIA 3UJIL 4D3CH 3DSFH 3EFFB 1D5MB 4POZC 2YSSA 2FWOA 3MRFA 5D2NC 1CFTB 3MRGA 4HUXA 2WBJA 4MJID 3PQYB 5EU5A 5F7DA 1CLYL 2GSIB 4H0GA 4YX2L 3L3KB 4X6EA 1HIML 3HZYB 3X12B 3HB3D 3D69B 4ODTH 3NPSC 3D6GA 1A3RL 4KJWD 4XXDA 3MRIB 1AXTL 1BIIB 1YYMH 1LEKA 5H8DA 2ZJSH 3WDJA 2FZ3A 3BKJH 1AP2B 2D7QA 4H8WL 3QIWB 3FFCB 2V5MA 5EOCL 5D7IE 5IB4A 5ADOH 2DAVA 2F8VA 4F9PC 1Z0MA 5SWQB 3UAJD 3HZVB 2MJWA 4DKAA 4HWZB 5FK9A 4XAKE 1N0XL 4H1LG 2KBGA 1QNZH 3BWAA 2J6EA 3REWA 2KQMA 4N5ED 1AR1C 3IDYB 1QSFD 5HHOA 2AEPH 1YEIL 1T4KB 4D9LL 1CD9B 1Z2KA 3RTQA 1DBBL 3LH2H 1G7IB 2VB5A 3MLTB 4QHUB 3UJIH 2ICWA 1KXTB 4PV9A 3ZTJG 2EDYA 2BVQA 3NH7L 3ULSA 3X17A 3IKCB 2AEQL 5B39A 3MJ8B 4UTAL 4BQ6A 1WVZA 3V8CA 1KLUB 5HD8C 5EZLA 1CLYH 2QR0A 2DF3A 4KROB 1AO7E 2EDTA 2X7LB 4YX2H 1HIMH 2GJ6A 4L3EA 5IJKA 1UJ3B 1A3RH 4YXKL 2AQ3A 4PREB 2IC2A 5F7FA 1ZLVK 4XX1E 1AXTH 1OTTC 5HYSG 2D2OA 2JB5L 4ZPTA 3IETA 3PWPD 4H8WH 1YEHL 3IF1B 4O58L 5EOCH 3SGKA 3N50A 1HZHL 5H37H 5TE6L 5HHXL 3KYAA 1N0XH 2X89A 3HZMA 1DANU 3QO0B 4ELKB 3VXUE 5D6CB 3VXMA 4PJGA 1ZWIA 5D7KD 3S3JA 2XNAB 1UJTA 2P42B 3KPLB 5ESVB 2QQQA 4PGDA 4D9LH 5T3ZL 1BVKB 1DBBH 2X4QA 4U3CA 3AU1B 9CGTA 5EU7C 2QSCH 2X4PB 4M8QB 2PO6C 3P11L 5D71L 3PXHA 5E9DB 3V0VA 3LKNB 3EFDL 3IGAA 2ICEA 3NH7H 2G5BA 2AEQH 2VIRA 4JHBA 4UTAH 4PG2C 1JPSL 4G8GE 1YEKL 3OAYH 4KKNA 1KN4L 4Z7VE 2FIKA 4YXKH 4U1MB 4IM8A 1G7LB 4TPRL 3T0EA 2ITDA 2D9QB 1JYNA 4I3RL 2JB5H 2CDEA 2W92A 4YXLL 2B5IB 3RPIB 5CS7A 2I26N 2VO5A 1ND0A 2NY4B 1YEHH 4O58H 4QOKD 3QDMA 5IP4A 2XYCA 2JJSA 1HZHH 3ALWA 5C9JB 5TE6H 3MRDB 2WWKO 5HGDB 2Y5TB 5HHXH 5FYJE 1JPFB 3ARGA 4JZOA 3RWGA 4GMTL 1NGYA 2OTWB 1HI6B 2AAVA 3GI9L 1FGNL 5D5MA 4PJ5E 2BNUA 1FNGA 2Y7QA 1KJMB 1MJJA 3P9LB 4C57C 1MHEA 5JLZB 4OLUL 5MEOB 2NTFA 4JRYA 2CIIB 2JB6A 2DMBA 1N0LA 5T3ZH 1CN4A 4Y4FC 3QIUB 3P11H 5D71H 4DKEL 4NUJA 1FL3B 3EFDH 4K7FA 4UDTA 3F12A 4L8BA 5J3HD 2DM2A 2EYRA 2RB8A 3UTSD 2KUTA 2P5EE 1JPSH 1KLGA 1T0NA 1YEKH 1T0PB 3P2TA 4KKCC 2H32B 4Q58C 3DJ9A 3EYVA 4OJFL 1KN4H 2AABL 1HYSC 3TEUA 4YNYA 1L4IA 2XRAL 4TPRH 4Z7UE 5MI0B 5C08D 1I3VA 1GSMA 4YXLH 3HI1B 1PEZA 1KB5B 4FZEL 1I7RB 4W68A 4JR9L 1K3IA 1I7ZB 1JNHB 5GISL 1GGIL 5I1LB 5DS8B 3DMMC 1N3NA 3S8WA 3DO7B 1JUFB 5HI4D 3KPPB 1KNOA 4LSQL 4AZ8A 2DJSA 3QIBD 4GMTH 4TNVK 5F3HA 3GI9H 1FGNH 5C0CA 1YY9D 4PRPB 2G75B 4K94L 4PJHB 4YE4L 2EC8A 4OLUH 4P4RB 5IMLB 2HFTA 1FNEA 5E99L 4QRPD 1BBJB 4OF6A 1QFWL 1R3HB 5LWYL 1T2QL 1DN2A 4G8EA 4DKEH 2XY2A 3R06B 2VR9A 3O6FD 1BFSA 4C4KT 2NY6B 1QQDA 5KSBF 4E0RA 4GG6E 4M6OL 3GBML 3PJSA 4IOFC 2LVCA 1KLFA 3RKDD 1OW0C 1KULA 1LILA 3QQ9D 5EOTB 3ZL4L 4OFKA 1VFUA 5DUBB 2OMBA 4XHJD 3TIDA 5ID1A 1U91A 4Y0GA 4RAVB 1CFQA 4OJFH 4N8VG 2AABH 3PWNA 5BRZB 3GKZA 1Q9WA 3ULUL 1IM3B 3MRJB 3VXNA 4DCQA 1EFXA 2EYTA 2HT2C 3B9AA 4NHCL 4RDQG 4HAFA 4PIRF 4X0KB 3VFOA 3ZYZA 4LSTL 4HS6B 3ZLQC 4KK9C 4FZEH 3MO1B 4JR9H 5DC0A 3CD4A 3U30C 2BOCB 4CJ0A 4NKDA 5EO9B 1N6UA 5C0BD 2JKXA 3ULUF 4JFPA 3PWVA 4LSQH 3BP6A 4ZUVB 4F7TB 4F33B 3P73B 2WINB 2QQKL 1EV2E 2BOBB 5GGSA 2VDQL 4RZCA 1QEWB 5JO5B 4K94H 5FYLL 2ZUWA 4YE4H 4BSWA 4MJ2A 2MOVA 2ARJA 2C1OA 4HV8B 3V7AE 5E99H 3E6HB 5IKCA 5EUOE 1J8KA 1JYWA 1IEHA 4O2FB 1U8LA 1QFWH 5LWYH 1T2QH 4OFDA 3MZGB 3FQRB 2VZUA 1I8IB 5T1MB 1BJ8A 5I1CL 1XEDA 4M6OH 3GBMH 3ILQC 4LIQE 4F15B 3ZL4H 3RUGB 4ZUWB 4NQDA 2H2PD 2QQLL 4R7DB 2AP2A 4MCZA 3WDIA 3QUXB 1G9NL 1J8HD 4M8VA 4OI8A 3S5LA 3BRDA 2XWTB 5I75B 3ULUH 3CXHK 3V5DB 4JFHD 4NHCH 5C71A 1WLHA 2IG2H 4X4YB 4NCDA 5HHQB 5AYUL 2KDGA 1DVFC 1EEYA 2MKLC 4G9DB 4LSTH 2VWEE 4ONHA 4MJIA 3TN0D 4BK4A 3MUZ1 5HYQA 5FCUL 1MH5A 3B2VL 3MFFB 2AGJL 3H3BC 4AEIL 4KVNL 1G0YR 3NFPB 4IRZL 3B8YA 4Y5VC 5FYKU 5HDOA 3G6DH 4JFDB 4OT1L 2QQKH 5DZNA 1AKJD 3QJHB 2VDQH 3F8UB 5FYLH 3V8OA 1NJ9B 4GFTB 1EO8L 1DUZB 4IRSD 1T3FB 2VLRB 5KS9B 4HF5L 1QR4A 3LN4A 1NCWL 2D7MA 5DI8A 1QFHA 4XPTL 5I1CH 1NFDF 2CKBL 5DHVB 1DBJL 1QSFA 3AMKA 3JWDL 2QQLH 1G9NH 3GMQA 5DMJB 1WZMA 1UWGL 2HTLC 3A6OA 3MCLL 5AEAA 1YNTB 2FEEI 1CLZL 1NAML 1ZS8A 4RAUB 3MV01 5AYUH 2QEJA 3G5ZB 3L5XL 4TUOA 4KK8D 5D6DA 4LPYA 5A2FA 4XI5C 5FCUH 3B2VH 5C0ND 3B9KB 1BVLB 1ZLVH 5GIRA 3B3IA 4FQJL 4AEIH 1SJEA 4KVNH 2NNAB 5JORB 3D85D 3JV4A 2EIZA 4IRZH 5IOPB 2DLHA 2CLRB 3GUTB 3BP4B 3WMSA 3NVQA 3ARSA 3OJDA 2EDEA 2NY1D 4OT1H 4FQHB 2X4NA 4X6CB 3I02A 1AGDB 3ZZ1A 2JJVA 3ULVC 3PWPA 5I1AA 4PB0L 4PJDA 2VXTL 4K3EL 4RGMC 1I7TB 1EO8H 1EBAA 5EC1A 5I17A 2XT1B 1OARL 1SM3L 2D4FA 4HF5H 4U1HB 1F6AB 1NCWH 5GS2D 1IQDB 4XPTH 5D1XA 3V79C 2CKBH 3FFCE 1FG2A 3ZSTA 3QO1B 1DBJH 5IVNA 3HCVB 3JWDH 1A1MB 5L2KE 3VXOA 1LP9B 4UUJB 1WV7T 4P0DA 5FO9A 1UWGH 3MCLH 1CLZH 1MFCL 5ANMB 5T1KD 3VRIA 5FKPB 1NAMH 3TYFA 4ZSOB 4PJCE 3REVB 3OR7B 4FQLL 1UADC 5D1ZB 5IEKB 2FNBA 1BMGA 4QGTA 2EYSB 5DD6A 3SO3B 1RUML 4FQJH 2VZSA 3V9FA 3OL2A 4FFWD 3DX7A 1U8JB 2DWDA 5TQ2L 3D18A 3SCMC 3EYOA 1AXSB 1CCZA 4PB0H 4QOKA 4P59H 4LNRA 2VXTH 4UU9A 4K3EH 1A8JH 1IKNA 5E6ZA 2WP3T 2HYMA 1NC2D 4LCWB 4Y1AA 1SM3H 1K5NB 1DP0A 3VGEA 3DROB 5F9WC 1JCKA 5ID0A 3HAEA 5CBAA 5EZIL 3RVTC 4LCCA 3BT2L 4NBZB 1T0MA 3DVIA 3CXDL 1FO0A 3NPZB 4QLRA 4M61A 3VXUD 1E28B 5AUMA 1FFQA 1IGJA 3OJVC 4P46C 1L0QA 3HRZA 4IIQA 4HSQA 4P2OB 1MFCH 4HKBA 5A43C 3RQ3A 1QHPA 3FAXA 2IH3A 1MHPL 3X11A 3FQWA 1UM5L 3P3YA 4DTGL 3UTSA 1SYVB 5IFHL 1N5AB 4FQLH 1A7OL 4LQ1A 3LQZA 1URLA 4ZAKC 2ZPKL 2AW2A 1DUYB 4H5SA 5E9DE 2APFA 1J1PL 1RUMH 4NO2A 3S9DB 4ZFZB 2ADIA 3C9NB 4G8GD 4JZNB 4R9HA 5C08A 5K33A 5TQ2H 3HZKB 4NO5B 3KR3L 4WWID 2AJ3A 3BQUC 4NNYB 3PNWB 5DR5L 4EN3B 3I2CL 1I9JL 3Q3GA 4LSUL 1MVFA 2IADA 1HEZB 5DRNB 5EU6B 4QT5A 4LLYB 4S0TD 4Y88A 3J8F7 4JO2L 3P9WB 4PJ7B 4ZMAT 3DETD 3QIBA 5ALCL 2X4TB 2VISA 3MNVB 1OP5K 1B0RB 2VLME 5EZIH 5KW9L 4DFHA 3TA3A 3ZMRA 3C5JA 3BT2H 5FYJD 4OGZA 4J7RA 3CXDH 4QRPA 5HI3C 4HPOL 4PJ5D 4QRTA 1MQKL 1S7SB 3O6FA 4NT6B 3VFUB 1YPZB 1MHPH 3EJYC 3PDOA 1UM5H 4DTGH 2WSKA 5IFHH 1A7OH 2ZPKH 4DN3L 3FRUB 1MNUL 1EEUA 3MROB 4HHAB 3TZVD 3C60D 1J1PH 2XOTA 3LKRA 3P9MB 4TTDC 4OFIA 4X7DC 4WU7A 4Y5YA 3E6FA 3KR3H 4X6BA 4TNWF 5DR5H 1T04B 3I2CH 1I9JH 5C2UB 2D31B 4NSKB 1CXEA 2ZOLA 4JY4B 2NYYD 1JGEA 5J1AA 5C0BA 4X6DF 2YD9A 2BVOB 4PTUA 4E41B 1AGEB 4QHMB 4HUUB 4JO2H 5EN2B 1NMCB 3BI9X 5KW9H 5GGRY 1Z9MA 4X9GA 3EHBD 2FR4A 1JWUA 2C4FU 2PW2B 2YA2A 1HYRC 4HPOH 1G7QA 4LHUD 5DWUH 4F8QA 1V3MA 4PGBB 1MQKH 3JWOC 5CWSB 1YJDL 3RVVC 1P4BL 2E6QA 4PRPE 4PV8B 3MXVL 1T6VN 1NDMA 1RZJC 3QEUB 4RX4A 4XZUB 4MA7L 1Q0YL 5M94B 4DN3H 3QZWB 1J8HA 1MNUH 4F3FB 1U9KA 2ZP0T 4Y4HC 2DYPB 3INUL 4B50A 4LLVA 5FYJU 4YIQB 1WCQA 4XC1L 1NEUA 4I0KA 3LQAL 5E8DL 4J12A 1GGBL 3QUKA 3TH4T 3WKML 3MLRL 2BMKB 4LLUB 5BRZE 1IGTB 5EBMA 1V05A 2VDLL 2Z35B 4ZODA 5C6WH 5B8CA 3HE6D 5BS0E 4N5UA 1AKJA 2VAAA 5FAAA 3IFOB 5I1HL 3TIEA 3VFWA 4LPXA 3VFRB 1IEAB 4IRSA 1Z3GL 3DVGA 4PRIB 3SDAC 1YJDH 2WV3A 3MXVH 5CIPB 2ZG3A 1JGDB 3HE7D 1B90A 1FLTX 3TV3L 4MA7H 5JPNB 1Q0YH 3A6BH 1OD9A 1VFAB 4IMKC 3QI9B 3SKOB 3W9DA 1RJCA 2FB4H 5IMKB 2XFXB 1MCEA 3INUH 4JO1L 3VXQB 1G7PA 4FG6D 4RMVA 3RUGE 4XC1H 2K3TA 1OGAB 3LQAH 5DURD 4NM8L 1GGBH 1B6UA 3P4MB 3WKMH 1T22A 3MLRH 3WNMA 1PQZA 2OSLB 4FFVC 4I18C 4YR6B 1CXLA 1KC5L 4L29A 3V5KA 2VDLH 5GSRA 2YD3A 3D85A 1QA9A 4GS7B 3FMGH 1DQML 5KAQG 1N59B 4G9FD 2Y23A 4WI3A 4EDWL 5T5FL 4I13B 2GK0B 4R3SB 1BQLL 5I1HH 2VLLA 1I3RB 3GSQB 3RDTD 2DBLL 2KQNA 4JLRA 2IPKA 1Z3GH 4PGJA 1V5JA 2Q6WA 4JQVA 1HKFA 3DSNA 5HDLA 1AGBA 5D7IA 3TJHD 3O81A 4P23C 5DK2B 4LAQL 1O0VA 4NNXA 1MY5A 2DQEL 5HYJA 5DEGA 4PLJC 1ZHBA 5LXGL 1XGPA 3TV3H 3OKMB 3MV9E 3MLYL 3MRPA 5JXEC 1TQBB 3ULUD 3WHXA 3S96B 1GAFL 1F4YL 3O11B 5T1KA 4JO1H 1DL7L 1I1AD 1RHFA 4HUVB 1VSCA 5D70L 4E42A 4AK1A 4NM8H 2DWEB 5D72L 5C3LD 5TH2B 4KI5E 1CDBA 2R2EA 4ZG1A 4H26A 1KC5H 4BZYA 2UWEF 2BDNL 1DQMH 3BE1H 1VFBB 4V2CB 4EVNB 3H9HB 2O5ZL 4FQXC 4WEBL 3VWJB 1AI1L 5KVDL 4EDWH 5T5FH 1C8PA 4PLNC 1RI8A 1BQLH 1TZHB 1L7IL 1Z0NA 1PX3A 1WCBB 4GQPH 4KJPC 3TO4D 2DBLH 3E2HB 5JZ7D 1NC2A 3RGVC 1C5CL 1YUHA 4AEFA 1GC1C 4LAQH 4TYUA 5K93A 2DQEH 2O61A 5C0GB 3SJVB 3VFSB 5LXGH 3U7WL 4JFYA 1VKXB 3MLYH 4YDLB 3VXUA 4LKXB 1CICC 5EH1A 3KDMB 4IRJC 3EJZD 2CJUL 3FT2A 1GAFH 1F4YH 2LFGA 2BNQE 3GMRB 5L2KD 3V4UL 1DL7H 5E1AA 2R8SL 1LEGB 1U95A 1T7XA 4QTHB 5D70H 2GT9A 4LARL 4XMLL 1VPOL 2VAJA 3CSYA 5D72H 2W59A 1IGYA 4U0QB 3BGMA 1JZ3A 4L4VD 2CRIA 5ANME 2BDNH 2IAMC 3MBEC 4Y5XA 2A74A 2BHZA 3QEGL 4G8GA 2V7HA 2O5ZH 3GMMB 5D7JB 4BKLB 4GW5A 4WEBH 5C0DB 1AI1H 5KVDH 1L7IH 5FDWB 4LOUD 1T21B 2P8PA 4HGKC 3C09C 1Q8MA 4NO3A 3HNSL 3HLAB 5ESQB 1C5CH 4OV6F 3TCLB 4JFOB 1N64L 2AEWA 4XMKL 3GSUB 2OJEB 1OAQL 3GIVA 5FUZL 3F7VA 4JVPA 3S4SA 4LVNB 2NXZD 4GRWE 4HJGA 5F1KC 3OR6A 2X4UB 4PJBF 3U7WH 5HHNA 1T1ZA 1WIPA 5B4MC 2CJUH 3PP3K 5CD3B 2ZUUA 4PJ5A 4R4FL 3TNNA 3MOAL 3O9WC 5E4EB 2OI9B 2C3GA 5F1IA 2BFVL 3RZCC 3V4UH 4FA8A 2R8SH 4NQXB 4U1KB 2X70A 3IT8D 3MRQA 4LARH 5J9PB 4XMLH 1VPOH 43CAB 4PR5B 3SPVB 4YHNB 1NCAL 2AKRA 1KTRL 3TZVA 2EE9A 3C60A 5TJWK 4BUHA 2P4AB 2VRAA 4N1EA 3QEGH 1S8DA 2YPLB 1UFUA 4RFNC 3UBXG 4Z7NE 5I8CA 1GYAA 4P2RB 1TJHL 2ESVA 4YZFE 3WS3B 3GMOA 2DLEA 3PIQA 2EDXA 1E4XI 3HNSH 3OKEB 1C12A 2X4OA 4B53A 2PUQT 4U1SB 1N64H 4AM0B 2FECI 4XMKH 2RFXA 5CHNA 4YLQT 1OAQH 3LV3A 5DMIL 3BWUC 4A6YL 3NMEA 4HMCA 5BV7B 1UKQA 1DDHB 5CP7A 4G6FB 3ULVL 3SDDB 4PJ7E 4LHUA 4R4FH 4KZDL 3MOAH 3MRBB 1PSKL 2CK0L 4N0FB 1HHKA 4C4KO 5IBLC 5T5NG 4JDVB 3HC0A 2R2BB 4CVUA 3LD8B 3ULVF 2AV1B 5IW6B 1NCAH