2P24B

I-au/mbp125-135
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
216
structure length
194
Chain Sequence
b'RGYGGRASDYKSAHRHFVVQFQPFCYFTNGTQRIRYVTRYIYNREEYLRFDSDVGEYRAVTELGRPDAEYYNKQYLERTRAELDTVCRYNYEETEVPTSLRRLEQPNVVISLSNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRAQSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, A-U alpha chain
molecule tags Immune system
source organism Mus musculus
publication title A new twist in TCR diversity revealed by a forbidden alphabeta TCR.
pubmed doi rcsb
total genus 44
structure length 194
sequence length 216
ec nomenclature
pdb deposition date 2007-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p24B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2p24B01
4D9QD 2FB4L 4NNPL 4YXKH 2ICES 5IQ7H 2P5WA 4P9ML 3T3PE 1U95B 3TJEH 3VXSA 1MQ8A 1BGXL 4Y1AA 5LCVH 4AEEA 5EU6D 5EU5B 1BD2D 3WJJA 1I3UA 3HMWL 5EULV 3KYNA 3VD4A 4K2UH 5D93C 3ZKNC 2AI0L 4XWOC 1ZKAA 4EQ2A 4MGXA 3WE6B 3O3DA 4J3UA 2BNUB 3DMMA 2DBLH 2WBJC 3DO7A 1IAOA 1GSMA 1I1RA 4LEXL 1OSPH 2W65A 3WFHA 2ENYA 4ZYKA 1J8HB 4FZ8H 1S7XA 1X5IA 1HH9A 4NM8H 4BFEA 3AGVA 4PLJD 1T20B 1IQWL 4ODXB 1NLDH 1YY9D 2BERA 1FG2B 3SPVB 1K2DA 4WEMB 3SKOB 4JPKH 4Z95L 2C1OB 3VFTB 4NP4L 4L4TB 2B4CH 5DSCA 4S1QH 4J1UA 2EYRB 2QQKH 5E70A 1T7WA 5B21A 3TH3T 1AGDB 2FYYA 4ODSH 4NQXB 1S7RB 5ICZB 2E7BA 5A1AA 4G6FD 1JVKA 25C8L 2I9TB 3ZE1F 2GIYA 3TA3C 3OGCB 2FHBA 4L3EE 3PP4H 1YMME 3V5DA 2A83B 8CGTA 5EBMB 3MV01 1BP3B 2DQCH 1CFTA 1KJMA 4KGJA 1ZSDB 5IEKA 1FYTB 2Z4QA 4G6KH 2O5ZL 1UM4L 4MAYD 2AXGB 3JSSA 2WQRA 2BVTA 4XC1L 3Q6GH 4O5LH 3ZHLA 1NGPH 4PRBB 2AVGA 1FNEA 3FFDB 1NQBA 1DBBH 4PRHE 3QIUA 3QNYB 3O3EB 3F7YA 2V5RA 3GBMH 5C0AD 3U4BL 2XYCA 1WUNT 5AUMB 1ZVSA 4JFZL 3RTQC 1J86A 1MFAH 5MENA 5DTFB 3T8XA 2CUMA 4IRJA 1J18A 2VDLL 4XXCC 3VMNA 4NT6B 4O2CB 5FYKD 5AZEH 1B4RA 5DJAA 3D2UB 4KC3B 3GHBH 3MLVL 4M1GH 1NCUA 3H3KA 4M6OL 4KKCD 3U0TB 2VWEE 2GYSA 4OGXL 4QRPD 5KANI 1AXSB 5EZJB 3VFMA 2Z8WC 5I9QB 1F3RB 3LB6C 3QISA 3L5XH 4QTHA 1U58A 4XVUC 1DSFH 4UMGA 3OF6A 2Z8SA 4PJ9C 4JFXB 3LKPA 1MI5A 5KS9E 1NBZA 3O3BB 2AEWA 4HWEL 3P0YL 1SMAA 3GSNB 4FFYL 5IIEA 1CDJA 4R4FL 2EDXA 1PZ5B 4OCMC 4XP4L 4XTRD 1HK6A 5LG1A 1CD1A 3LKRA 4HS8H 5IB3B 3BZ4A 1ZT4B 5K33A 4F9LA 3ELAT 5SWZD 4J7RA 3LZFL 5I1DA 4ELMA 3UAJD 4HFUH 3FB8B 4BQCA 2NZ9D 1MCEA 2YPLE 1C7TA 2E9BA 4S1SL 5ADOH 1KCRL 3F6IA 1MCLA 4O9HH 1QFHA 3G6JF 4Y5VA 3ET9F 3AM8A 3NCYP 2ATPA 5EUOE 1R3LB 4KQ3L 3I3DA 5AG8A 4M5ZL 3PWVA 2WM0A 5CGYD 1MAKA 2FL5A 2UWEA 4JHBA 1KPRA 3CX5K 1YQVL 1UENA 3B8SA 2QSTA 1F02I 4FG6C 2V5YA 3T4YB 3LV3A 5F1IA 3UTQB 1UXSB 4C56E 5F96L 4DW2H 1HWGB 1I85A 4GAYA 4Z7UF 5LXGH 4XNZC 3EYOA 3Q3GB 5CBAA 1H8SA 3G9AB 4QRRA 3TVMA 4G43A 1X5YA 4JRXD 5DVLA 4MLSA 1NEZA 4NGHL 2JKXA 2PXYB 3QPXH 4KROB 4Z7OE 4D0DA 3U83A 2CDGB 3RBSA 5HDQL 3QDAA 4MZ2A 3K4ZA 4RIRA 1SJEB 1QYGL 2EYSB 5E99H 3PIQB 4M7LH 2B20A 1INDL 2JCCB 1N6UA 3D85A 1Q9WA 1FL5B 1CXIA 1IEAB 3P0YH 5DR5L 1QUNA 3TM6A 2H2SC 4F7PB 5I6XC 1P7KB 3UBXA 3VD3A 3RWEB 3GBNL 4P5TA 4YXKL 2HP4A 3QUML 1MQKH 3QIWD 3SDDD 2VR5A 4FQLH 1OOAA 5D96B 1JN6A 4Y5YA 5IESH 4KK9C 4G8GB 2NY6B 5CJ5A 5FFLA 3ILQD 2FO4A 4PB0L 5D2NA 3A0OA 3EDDA 1C12A 2UVFA 3KPPB 4RWYH 5IHUL 5I8CB 4BKLB 1KLGA 3ZKXC 5MEPA 3MLTB 2GJ6B 4X6DB 4PJEE 1NJ9B 1R5VA 1JPGA 5I1GL 4JANB 4ESKA 1D3CA 4ODVL 3FQUA 3WNNA 4WO4C 5J0BA 4MJ5A 1LP9A 4C54A 5DMGD 4XPHL 2VSDA 5C0JB 1JZ2A 3WL9B 1Q72H 1UVQA 1Q9KA 1JNHB 3WEXB 3KXFD 1U8KB 5JOPE 5C09D 4DVRH 5DRZA 4WV1C 4GKNA 2OZ4L 2M1KA 3QPQD 1KB5H 3MRGA 4XCEA 3MJ9L 3MNWB 3MRBA 4F2MB 2C4FU 2EH7H 2P8LB 4IRJD 2AP2A 5IBLD 2R0ZL 3MUGB 1A6WL 4G9FA 2AERT 3BEWA 1OQOA 4AL8H 3NTCL 4XXDA 5L8KB 1F4AA 4K71C 4XH2A 3M17B 2J4WL 4PRDB 4PGDB 1OAXL 4J3TA 1UWXH 1P5VA 4HX1B 5IVXE 2JJUA 3S9DB 1XCTA 2NY1C 4U6HB 1XH3A 2H9GA 4LCWA 5E8OB 2I5YL 2VISA 5B8CC 1JNJA 4ELKB 1U91B 1RHFA 1AGDA 2VABA 4EUPG 4HV8B 1BBDL 5E1AA 5FUOH 1R5IB 4LCYA 5F9WC 3E8UH 3PDGA 4O2FA 1JF5A 3WIIH 4NWTL 4I77H 3PDOB 1CLYH 3CNKA 3FZUC 5FECB 1UWGH 2R56H 3ARVA 6CGTA 1RZJC 5HD8D 3ZYIA 3EOTL 3DX7B 1FO0L 2X44D 4PJDA 4JPWL 5J3HC 1MIEH 3NCFB 1YEFL 5DD1L 3SO3B 3PHQA 5AD0B 1RJCA 3B6SB 5CEXA 1A6ZA 5GRZA 1DUZB 4RX4A 3P9LB 4AM0A 1UEMA 4JFOB 3GJFH 4RAVA 3QCTL 4Y4HB 3FJTA 2FLBT 4LSSH 5CHNB 4PB9H 1U8LA 5HHNA 5IBUB 5E8DH 1VB9A 4N68A 3UTSD 2HT2D 1ED3A 3FCTB 3U9PH 4UDTB 1IQDA 2SEBB 5MI0C 3RL1A 1YEEL 2P44B 5K9QI 1U42A 4OD3L 1WSST 3EKCA 5FYJD 2PNDA 1A6AB 5ICYA 2VLRE 4HF5H 3I6KB 4LRIA 1XIWB 2FR4B 3S3JA 1EHLH 4ODBD 5GJSH 1DVFA 4PY7A 4OFPA 5E2VL 1KPUA 3DX9A 4PGJA 1UACH 3VXOB 3ULUL 1FL5A 4B50A 4YDLC 1ZWIA 3D18B 1S9KC 1NBZB 3DIFA 3ES6A 2FH6A 3JV4B 3WFZA 2BVUA 4G6ML 5T33L 1FL3B 3QUYD 5IFAH 3GJFK 1NEUA 3KJ6H 3VG0H 3UTTB 1W72L 4EI5D 2RBLA 4OLVH 1G7LA 4OFDA 3V7AE 2ORBL 2DQEL 2A6DA 3RKDC 5JA9A 3UTZB 2PYFA 3ARGC 4WHTB 4U6VH 2PTTA 3KPRA 5I2IB 4NRYA 3C09C 4QF1A 3N06B 2YA0A 2WBWB 4UNUA 2R23A 2Q1EA 4HUVB 4UOJA 2R1YB 5D9SB 2DM3A 3IDGB 3UJJL 1FO0B 1YEFH 5D70L 1EXUB 5E95B 4ZO7A 5DC4B 3IDXH 3H3PH 4FP8H 2D0HA 4HZAA 1ADQA 4XMKH 2NR6D 3DHMA 5F88A 2JJSC 1JYWA 4O4YH 1IE5A 4G8FB 3OGOE 1DFBH 3ULUF 1GHFL 3F5WA 1RJLA 3BH9A 2VLRB 1AC6A 4GFTB 5FM5M 3UJIL 3K8KA 2BNRB 1LO5A 4FNLH 1CG9B 4K23L 4UI2A 1VESA 3MFFA 3EYVA 5T1LD 3CH1A 2R1WA 3W11D 3ZLQC 3BKJH 3KPLA 2JJVA 4ZTPL 2W60A 5C0FA 2IAMA 2VN4A 2XN9D 1OTUC 1ULVA 4JFZH 4HWUA 4C58B 3B2VL 5DDHB 4MLIA 5E8EA 1YMHB 4CNIB 2R0LL 2VDNL 2YN3A 4PJIE 1JYXA 2IAMC 3C08L 5EU4A 4Q9QH 3QUYB 1UM5H 4YDVB 2H6PB 4KAQL 4ZNEE 3D2UD 2YUZA 1L7TL 3EYUH 2AABL 4OJFH 3BP4A 2E7CA 4QY8B 1UA6L 3T2QA 2ORBH 2H41A 1R3HA 3FN0L 1KGCD 4UOW0 4LKCB 5BMFL 4XP9H 2IADB 2ZG2A 4BQ8A 5EG6C 5BS0A 1FFOA 3T4YA 3IKCA 4JFEE 1ONQB 4LAQL 4YAQB 3D3VA 5BS0D 4YZFE 3ZT7A 2N7AA 3VGAC 5DUPH 1W72B 4ODTH 4LNRB 3HZMB 5KVGL 5IFJB 3QIBA 4FTVE 3G9VA 5I1IL 2AV7A 5F9DC 5FB8A 1NAKL 4MVBD 1JZ8A 2D03H 1A1MB 4OD1L 5HYJE 1J5OH 5T3ZE 4U1IB 2PR4H 1D7FA 1VFBA 4LLVB 3HE6C 3JTTB 1CFBA 3ARGA 2Q76B 1F11B 2YSSA 1A14L 3BN9C 3UZVB 5HHXH 3W9EB 5L0QB 1Q0YH 3BSZH 3LRGA 2VUYA 1LO4H 2VZ3A 2P1YA 3RWFB 4P2RA 4OLWL 2B1HH 4ZNEA 1FZOB 1XGTB 2HFFB 1Q9LA 4CVXA 5GS1A 5ID1B 2B5IC 1JF1B 4LCIL 4Z6AT 3ZKMD 2WUBH 4NCDA 5I1CH 3F7VB 4R7NA 4D0BB 5DO2C 3WKNA 3K8MA 1K3IA 1QEWB 1M7XA 4JN2B 1J88A 3MV7E 4HIEB 4KVNL 3UAJC 4LRIC 1L7IL 1H5BB 4W4OC 4LPYA 4KPHH 3MRKB 2Q8AL 2Q7YB 1G0YR 2ERJC 5LGKA 1NBVH 1WZMA 5JDJA 1A1OB 5KN5A 3S5LG 1OLLA 1XF4B 3CVHB 3C09B 3ME0A 5HDQH 5HGGS 4Y5XC 1WICA 3V6BR 1D5BB 4U2ZA 4XWOD 2VXUH 5DJ6A 3T0ED 4GAGL 1JE6A 5FKAB 4I9WD 4DCQB 1OAQH 3NFPB 2VJXA 1V7NH 1T04B 4XNZB 2NY2C 3DECA 2Q6WA 1NGPL 5KG9B 3BD5A 1NH6A 2C3GA 2HVJB 2BFVH 2NXZD 2CLRA 3MOQA 2Y5TB 1RMFH 3MROB 2EKSA 4LLYB 2UVEA 5IHLB 3IDJB 1MJ7H 3RHWK 4WI3A 4OLXL 3QQ4B 3I50L 5ESVB 2FATL 3F7PC 2F54A 5L88L 4MB5A 2H6PA 1LDPL 3MJGX 2DQFA 4IS6B 1I8MA 3CZJA 4KKLC 4QRQA 5CJ8A 4A6YB 1GAFH 2OTWB 3MZGB 3RI5F 4YHPA 1KG0A 4NQSB 4FA8A 1PG7X 4LARH 4WI7A 3UTOA 3GSWA 3WNPA 2Z31D 5T1KA 1G84A 1ZHKA 3LEYL 4KVNH 4QXUH 1CGWA 2VLRA 1D9KC 1TZHB 2CKNA 1P7HL 2XZQL 4HIHA 2JF1A 1T2QL 4OZGF 3VXQA 5JW5B 2XWJA 5EOQH 3ARFA 3IDMB 5IFJA 2DI8A 3UYRL 4PJGF 2F53A 1QBBA 4KJYA 3V0VB 4NYLB 4I0KA 1B6UA 3KXFB 3O41B 1MPAL 1JTOA 3C8HA 5J1TC 1G9MC 3GMNA 3H9SA 4HT1H 1ZGLM 1GGYA 2B0SL 4M7JL 1Z9OA 1S8DB 4H20L 4KKCC 1BJMA 3CCHA 3WJLC 3S34L 4N0YL 1KELH 4O2EB 4M9PA 4MJIA 3WNKA 5AWNH 3FQRA 2R2BB 3QWRA 1Q1JL 5C70A 2FBJH 3HCVA 4ZPTB 2XIDA 4F9PA 4MB3A 2WV3A 3MRFB 4HKBA 4WHTA 5GRJL 3KYMA 5CZXD 3GSRA 5I71C 1SEBA 4KRLB 5BXFA 3O0RH 4CU7A 5HYFA 3NACH 4PP1C 4V1DD 4LSVH 4TSBL 5TDNB 5JXAL 2DQIL 1MUJB 3NGBC 3NABL 1VGEL 4P2CG 2QR0B 3FO0H 1A6VH 5EU6E 4NKDB 1RIHL 4KY1L 3MO1B 5JXEC 1J11A 1CDBA 1P4LA 2X4UB 5LWYL 1FPTL 5I76B 4NPYB 2XTJC 1FFNB 4HBCH 3D87B 4OZHA 5KVDL 2YBRB 5ILTH 3OJ2C 5KSUB 1T1WB 1X4YA 1PSKL 2B7DT 1CTNA 3L3HA 1RUKL 4Y16D 4OV5A 4X7TA 2BRRL 5MERB 1T2QH 4S0TD 4KKAD 2CDFA 2RGSA 1A7QL 5I1AA 1XGYL 1OTTC 1QLRB 3EFDL 1MEXH 1TVBA 4XCYA 3D0VA 3SKMB 3RU8H 4HFWB 3PNWA 2NY4C 1F6FB 1CIUA 5FDWA 3WN5B 5E8DL 4QF1B 4JY6A 4FFWC 3SDCD 4PJ5E 2NY7H 1A7RL 4XPFH 3OAYK 3RVTD 1EEYA 2YUWA 4U1GB 1G9EA 1TXKA 3MODL 3JVGA 2WUBL 3BXNB 2G75A 3F7QA 3P4MB 1PAMA 1FL6B 1UXSA 5MEOB 4ZUWB 5F6IB 4PJ8D 4FFZL 2OS7A 4LCWE 4ACPA 2X40A 4PJBB 4XNUH 1D5MA 2XTJE 5I15H 4ZUTB 1A0QH 3M8OH 3HNSH 3CVHH 2Z93B 2ITDB 3SDDC 3SE9L 1EZVY 3A6BH 2P5WB 1U8IB 2EXYC 5EA0H 2P48B 3IDJA 4KK9D 3LPFA 3BVNB 1PSKH 4PGBA 4ERSL 3CLFL 4R97B 4K8RC 5IV2A 1ES0B 4R3SA 4LMQI 5IW1B 4NJ9L 3PQYA 1I9EA 2OR8A 3X13B 4RRPG 3DRQA 4OSUH 4LSQL 5F7WC 4GT7A 1QD0A 1MCDA 2FJFB 2Y25A 3BRGC 3G6DL 2AJXL 1A1NB 3FQXA 2NLJB 2CMRL 3JWDH 3TEUA 1X5AA 1OAXH 3RKDD 2CIKA 3RDTD 4XPAH 5IW3A 4WV1B 4GSDH 4Z76B 4WO4D 4F7MA 4KHTH 3OAZK 5EO9A 5JNYB 3QH3A 1IT9H 2OZ4A 4JO1L 5FYKH 5H35A 1S7XB 3P2TA 2BC4A 4LKXB 4TVPE 5IR1A 3C2SA 3TBSB 4NRZA 2GJJA 1UB6A 4F8TA 4TNVK 1J1OL 2NTFA 1HILB 3THML 3BN3B 4L1DA 1JPSL 4K8RH 4EI5A 4PJBF 4XCNB 4YK4C 2IPKA 3WFEL 3RTQA 3PL6B 3V8OA 3Q5TA 3E6FA 2B4CL 3C8KA 2AK4D 1CFQA 4HFUL 3RWHB 3E6HA 3TYFB 1XGQB 9CGTA 4UILL 4UB0L 5DEFB 4BK4A 4MXQC 4F7TB 1ZT4A 4K3JH 5IMOB 4W6YB 4HG4J 2GAZB 1IM9A 1R3IL 3W11C 1CZ8H 4Q7DA 1HEZA 2OBGA 1JMXA 2CRZA 3C87A 4GRWB 5T1DH 1C5DA 3AFLA 4M3JA 4YE4L 5DFVD 2HFEA 2A9ML 5FOBA 3NPSC 4O5LL 3FB5A 1VHPA 2R9HD 3FAWA 4DGIH 3MRHA 2NW2A 4U05A 2ESVA 4X0KB 5EC2A 1U41A 3KPOA 1BQLH 5D1QB 3BGMA 2E8ZA 4HCRA 4X9GA 4M8VA 3WDIA 3OKNB 1WK0A 1Z0MA 5GRJH 1BEYL 2EEDA 1HQ4A 3BP7A 1I1AB 4HKXB 5TGBB 1XR9B 1EVTC 3QEUA 2Y5EA 4C56A 3OZ9L 1NJ9A 4E0RB 4K3HA 2O93L 3FT2B 1GOGA 1YMMD 2CKBB 3CPLB 5D6DC 3EYOB 3BDXA 4ZFGL 3WD5L 1NBQA 4NZRL 5F97E 4MNHA 4NJAL 4DN3L 4PP1D 2GK0B 4YPJA 3EDJA 4BJLA 5LWYH 5I1LA 3FQNB 1HCVA 3CMOL 1B2WH 3G5ZA 4Y4KC 4HUWB 4Z5RA 1GGCH 3DETD 2PF6A 5MENE 2YD8A 1DQJB 1W0YT 4AJ0A 2X5PA 1I9RH 3GMPA 1KOAA 3X3GL 2D7MA 4S10A 4K94L 3ZE2F 2VQ1B 5J8OA 3VXUB 1NEZG 3OKKB 4NZJA 1QHOA 4OI8A 1K4DB 3NGBB 4GKOA 4DZ8B 1TCMA 3GUTB 3TJHC 4Z7VB 3BW9B 3C60A 3ZTNH 3U4EB 3PWJB 2FSEA 4FMKA 2ICEB 3ZDXF 4G7YH 4M7LT 3MRNA 4MXVE 4OUUA 1QFWH 4H26A 3U82B 4PJBA 4DFIA 1KLUA 1EEZA 3GI9H 4YUEH 5DS8B 1YEJH 4DGYH 3CMGA 5CD3A 1Y6NR 5FO7B 4FFWD 3SDCC 2UZIL 1SEQL 4NNYB 4NO0A 3T1FB 3IAPA 1U8NB 1QBML 4Z7UA 5JOFA 3EGSB 4MNQE 1RULH 4GAYB 3RUGA 5FM5O 5CP7B 1KB9K 1DQQA 1XMWA 3NZHH 3ZE2E 5KZCD 4N9GB 4P3CL 4BZ2L 4H25B 4J2XA 2Z0BA 2FH8A 4HIJA 4YBQD 4NBXB 3K7UA 3O2VH 3TNNA 3UTZA 4DEPB 4OCRL 4M00A 2X1OA 3SDAA 5IF0A 1M05B 2WIIA 3HAEH 3UJTH 1T7VA 1B2WL 5D1QD 3D39B 4DGVH 4U1GC 3MGAA 5ALBH 3JV5A 1H3VA 3KS0J 3Q5OA 3VXRA 4TQEH 1JN6B 2IQAB 1UWEH 3WHE1 4MXWH 5JOPD 3O6LH 3OXRA 4HCRL 4K9EL 2QQKL 3L5WA 4GRLB 3DI3B 3DX8A 2SEBA 1I1FB 1F2XK 1OGAD 1MHHA 1NUFA 1AXTL 1C08A 2GSGA 3ORJA 4P5TB 5E2WL 3WFDL 3UZQA 4IOFC 2AJUL 2DLEA 1S3KH 4XCCL 5KTEH 1PZUB 3KYKH 5K9KA 2FECI 4B41A 3QUYC 4XC3L 2AXJA 5HHQA 3HMXH 4LASL 3I6KA 4KKLD 2C3VA 3QEHA 5MP6H 3C6SA 1A6AA 4XP5H 4S11A 2NTFB 1FCGA 1EK3A 4M61A 4LSSL 4JZJB 1OSPL 2C9AA 4WFGE 1KT2B 5AYUH 1UM4H 5E56A 3VGEA 5IK3A 2AJZB 1KJ2H 1MH5A 1X5XA 4NCC1 2P8MA 1J0HA 1UC6A 4MX7A 5BRZB 4DWHA 1CQYA 1MCPH 1JFQH 2RB8A 4H88H 2G9HB 3WSQL 1TIUA 4BYHA 8FABA 2BSRB 4OZIB 3VMOA 3DVNB 5IB2B 3LPGA 1JRHI 2OK0H 3BYYA 1X5FA 5D7IE 5E2TL 2H1PH 3BH8B 1DE4B 4KJPC 3GIVA 3D0VB 4X83A 3V95A 5HI4C 2D3VA 32C2A 4UU9A 3ZT5A 4XT1C 3BVNA 5LVEA 2CDEA 5AZEL 1JZ5A 4CJ1A 4CAGA 1QSZA 2W1NA 1PEWA 1RK1B 4NQTA 3NZ8A 5F1OB 5JMOC 4FXGA 4OFKA 3VFSA 3GUTA 2EDYA 4QHKJ 4ZOBA 4R26L 3M45A 2BXZA 2XA8L 1NFKA 1X6LA 4DGVL 4RGNE 1S78D 5EWIH 4OZ4A 5HVHC 2HRLA 1JPTL 1YYML 3OPZH 4K55A 4ORGB 2Q86A 4XNMB 4ZTOL 5KVFH 4MNQD 4KI5F 1MFCH 3ESUF 4X9HA 2IH1B 4MD5A 1FNSH 2W0FA 3CFEB 2H2PC 3M07A 1UWXK 4K3EL 1A6WH 4CVZB 4R96A 4G8IB 1E4XI 3BIKB 4OIIH 3SY0A 1P1ZB 1RZ8A 5D7SL 4KRPD 3SKNA 4P9HH 2VXSL 4ALAL 3OR6A 4L4VA 4Q0XH 3DROA 5EBWB 5GISL 1DVFB 3FN9A 3TZVB 1RUAL 1FYTD 2ATKA 2HWZH 5TDOA 2Z91B 3VG0L 4R0LA 4X4XA 3VMPA 5BV7H 3BPOB 1A7RH 5F9JB 5KS9F 1I9JH 3SDCB 1MFBL 2P8PA 2DDQH 3K80A 3MCLH 5DD0L 1MI5D 5JIPA 4P5TD 3TH4T 3WFHB 5DK0B 3LHPL 1LGVA 4LP5A 1CTOA 3AVEA 4GKSB 1KTRL 5B39A 3VFNB 1YUHA 1RAMA 4Y4FD 4Y4HA 4XBGA 2K7PA 1YEDB 2J6EA 1MJ8L 2IF7A 2Y06L 1C5CL 5TE4L 4JQIH 4ONHB 3SQOL 4OBSA 5GS0L 1ZT1B 2PYED 3HE6D 1NCTA 3B6SA 4RFEB 5KVEH 3HI5L 2JELH 4DEPC 2EDBA 2XN9E 2Y7QB 3GJEB 4WTWA 5C08E 3LKQB 4JN1L 3LQZB 5CD3B 12E8L 4WWKD 3UBXG 3GIZH 3O3AA 1V7ML 3RWJA 5HI5D 4JFPA 1P9MC 1DUYB 5DD3L 1PKQB 3MCKA 3VXOA 1BGXH 5LCVL 3RQ3A 1CFTB 4HC1A 5JMRA 3CLFH 3EIFA 4LGRB 5D7JD 3DUUB 2ED9A 3PGFH 1FL3A 5AZ2H 5SWSE 3JV4A 5C07D 4RZCA 5E4IA 4FXKB 3PXHA 4Q97A 5H8DA 2W0LA 5AWNL 3IU4H 1CR9L 1V3KA 4PY8I 4Z7WF 4ZPVB 1ZLUH 3CC5A 4DFHA 3HAEB 5J9PA 1TJHH 5C0BE 4HXBL 4LEXH 2NY1B 3QZWG 2MJWA 4OZFH 5GSRB 5C0ND 3RVVC 1BVLA 4YH6A 3E3QC 5TFSH 3G08A 4EOWH 4F9PC 4OTXL 2V5SA 1N0XH 1II4E 3GMLB 3TN0B 5HPOA 4G80A 3QUZA 3JBG7 2JE8A 2OXHA 1PFCA 1JWUA 2V7HB 3U2SB 6FABH 5J6HA 4RX4D 3ARYA 4WU7A 3FMGL 4QXGH 1LWRA 2AXHA 4X99A 2AEQH 3A67L 4GW4A 1S9XB 3ARRA 4OCRH 1IEHA 2W38A 3S8WA 5D2LA 3VA2C 1FPTH 3ZO0A 1OTSC 1IEBA 1LNUA 3PP4L 2N56A 3CVHA 3NVQA 1G0DA 1CVRA 2BVPA 2PYEB 2FD6L 4J3WA 1ZA3B 3QDME 3U1SH 2D9CA 4ENED 1KJVA 1NANH 3JUYA 1NUGA 3SCMA 1P1ZA 1T22A 1VGKA 4UILH 4D0CB 1K8DB 2YPLD 3OWEA 3MUY1 1JI1A 3RX7A 4M6ML 5EBWA 2M26A 1KJ2A 4PJGB 4R8WL 2X10A 4XMKL 5CAYB 5CJOL 1WZ1L 3PUCA 5EO0B 3O81A 3VXUE 4H5SA 2JB6B 5B4MC 4PGCB 4R2GB 1AJ7H 4YBLC 1PYWB 5GRXG 4CNIA 1NCWH 1IAIL 3KLSA 2GJ6E 1ZHLA 2ZNWA 4E42B 2YK1H 1MJUL 1AIFB 2GFBA 2BK8A 3MMEA 5CJXC 3TO4B 2VQ1A 2K3TA 5C0AA 3DRTA 5JXED 3KR3H 4CKVX 4OZFA 4GMSH 4FXGB 5DD5L 3GZKA 2FWOA 2J2ZA 3QRGH 3MODH 1J7VR 2N4IA 2R29H 4LNVA 1FZJB 1O7SA 1EERB 1QKZH 2L0DA 4OFYA 1LE9B 1QNZL 2F15A 3U9UB 3U0PB 5FYLH 5BO1L 1W72A 2ZUYA 5FGRA 4WUUB 1YMMB 3LN5A 4HWBL 2O61A 4HWEH 2A73A 5ABDE 4MJ6A 1BZ9A 5E5MB 3FQWB 4O51B 4P46B 2X4RA 5JOFB 4PG9B 4D9QE 3PL6C 3BO8A 4LVEA 2FZ3A 4FQXA 4HUXA 5K9OA 4JLRB 1YN7A 4HZLA 2VQTA 5J13C 3KNBB 3O8XB 4PRPA 1C5BH 5DJYA 4M93B 1KEML 4ZXBB 1QTYT 1AO7D 3P4NA 4OIBA 4X5WA 4AENA 1T0MB 1KIRA 1IM9D 3JV6B 1Q9LB 1UB5B 4OB5L 2BCKA 1RU9H 2OMNA 1FZOA 4P2OC 4OLZL 2CK0H 5IEKB 3W39B 3I75A 3CIQA 3HR5A 3LDBC 1MCJA 3MLZH 4Y4KB 4PJ8C 3O3EA 4XNXH 4S1RL 1YY8A 3ILPB 4IRJB 4J23A 2IQAA 3LD8C 1RZIB 3W0WD 5KSAA 1T21B 3U7YH 2DRUA 4DGYL 1T3FA 3PE9A 2XQYK 1S9WA 3IJSA 3O9WD 2O5XH 2VL5A 4M1DL 5I8EB 3BDYH 3W0WA 1I1AC 2O5YH 3OKYA 1BVKA 5T1MA 3QR2A 5I74B 1AQKL 1NCNA 3F62A 3T0EC 2LTQB 4AYFA 2VO5A 2DQUH 4L8CB 4HJJL 2CH8A 1QSED 3KDMB 3RA7L 1KTLA 5CEZD 3KPSA 4HEME 1L7IH 3D69B 4U1MB 2X1PA 4UINL 1QSVA 1G7JB 3QXVA 3DV4B 4XPHH 4D0CA 5DGQA 1N4XL 1SBBA 4L1HA 4ZG1A 1F3JB 2GSIA 1OAUH 2KBGA 2QKIB 1FNFA 4CN6A 4EXPX 5C6TH 4S2SB 2JIXA 5GQBA 1H0DB 3LY6A 4KUZH 2YC1B 4ZSOE 1P4IL 1U3HA 3DSFL 1TFHA 5I75B 3E2HB 3OKLB 4KI5E 4KU1A 1G7QB 5IBTH 3KYKL 5CCKL 4LVHC 2KPNA 2AKRB 1OGAB 4PRDA 4MQTB 1WT5C 4A6YA 3V7MA 1W0WA 3O2DL 3PWPD 1C16A 3EO0A 5C9JB 4LAJH 4XMPH 3HC4L 3HMWH 1HI6B 5ISZB 1P53A 2R1XB 1DFBL 3D25B 1ZHKB 3GSQA 5C7XL 1ZA3A 3RWIB 3JWNC 1ODAA 1FJ1A 5KVDH 2MMXA 1AO7B 2JJWA 1W8NA 1H15B 3GJFB 2YD1A 3S36L 1T5WB 1JGUL 4XRCB 1SJVA 4RRPA 3HMXA 3F12B 1VCAA 3TT1H 2WUCL 2HG5A 2DQTL 4HS6A 4QLRA 4LPUA 4RSVA 3MRBB 3LEYH 3QEGH 4WUKL 1BWMA 2ID5A 4WHDA 4PJ5B 5DJCA 3P4NB 3VGFA 4PJFB 3GB7A 3MRLA 1N4XH 1FORL 4KZEH 1T2XA 3W5MA 1QZ1A 3HAEA 1U93A 4NWUL 4QCIB 5IHBA 5FHBH 3RWGA 5DQDL 4JM2A 1U92A 4NNPH 3IF1A 1F4WL 1FN4A 1UCTA 1A1NA 3QUXA 5GZND 1EBPA 3BUYB 5F7DB 1MCRA 3O4LA 3HG1E 3OR7A 1MWAH 2BZDA 3K46A 2HKFL 5B38G 5DR5H 1W0VB 5C6PB 1JWUB 4FABH 4HUUA 2AV1B 2B2XH 1IGMH 4JO2H 4X6BA 1TZIB 5DMKB 1Q1JH 5D2NB 2H8PB 2COQA 1BVKB 4R9HA 3GBML 5T1MB 1LDSA 3NIDF 3T0BA 4HF5L 2H3NA 4DTGL 3NCYS 4OD2B 5DWUH 2HWZL 5IUSA 1HH6A 1HSAB 1TLKA 1QPXA 1R0AL 4Q74A 1MUJA 1LE5B 2G60L 1CLZL 3MV9A 4GRMA 4LSVL 1GGIL 3EFFA 4JKMA 2A74B 2EICA 2AK4A 4IJ3C 4WCYH 3UCRA 2W9LA 2XN9A 5T1LB 3WCYA 1UYWL 2JJSA 1Q38A 5I76A 4KMTL 2YMXL 1G9NL 5E5RB 3DUSA 3GSXA 3I75B 2VQUA 5I19H 4IMLB 2QL1A 5LGJA 2APWA 3PABB 4P9HC 2AGJH 5C71A 1ZLSH 4D2NA 1HIMH 2G5BB 4GRWF 4LPTA 3QUMH 1RVFH 5DEGA 3M1BB 3BPNB 4KK5D 4HKJB 1WEJH 1JNHA 1HWHB 3REWA 1IKFL 5FO9A 2X4SA 1GGBH 3BZFB 4PJ7A 4P4KC 2QADB 2E7LC 4QHKI 1BREA 2NLJA 3VWJA 4HS3B 2JK5A 4KTDH 4NWUH 1T03L 3LEVL 3QXUA 1SMOA 3X11A 3MLXL 5D7IA 1T1ZB 2BSTB 4Y4FC 3I02A 1GC1C 5J1AA 1NBYB 1KLUB 4Q6IB 1RUQL 3LEXB 4YWGH 2VITA 1B4JH 2NY6D 1AFVH 2J8OA 3U0PA 2FGWH 3IXAA 1KIQA 4PTTB 5IJVA 2W59A 4QTIL 1OF2B 1NMCB 2DM4A 1CGSL 1PDKA 1UH4A 3BAEH 1MCSA 5L0QC 3SJVD 4HGKC 2NZ9C 5EFIA 2HT2C 2IAMB 2X4QA 4FZEL 4WWKC 1MIMH 3O6FC 2ED7A 4A6YH 4JY4B 5ERWB 4L3AA 5I1LB 2A38A 1N0XL 1YMHA 3BISA 3LQAC 1INQA 4LDEB 4NKQB 3E1F1 1A6TA 1M6OA 1RY7B 2EH7L 1BFOA 1JZ7A 1MHEB 1EEQA 1U3YA 4OJFL 1NGYA 4HK0A 3EJYD 3W39A 1RZKH 3HZVB 5ITBH 2EECA 4NWTH 1Z6JT 4ONFH 4FP8L 1WBYA 3DLQR 3MYJA 5ETUA 2BVEA 5DHVH 4WV1A 1I8LA 4G8FA 2R1YA 5GPRA 1ZV5A 2W07A 3BOVA 4HMCA 3VWKB 2FJGA 3LZFH 1TETL 1TJGL 2F74B 1WFOA 3N85H 4Z7WB 2A0LC 1JBJA 1NGWB 4WO4A 1B0GA 2YA1A 4WW2B 2AJVH 4OFYD 5BVJB 1VFAA 5DVKA 3T3PF 4CMHB 1IL1A 2XXCB 3UPRA 1MRDH 1TZGL 2W9EL 4OBRA 4OI7A 3VGDA 1A02N 4G6KL 4IMKA 4QHMA 4ZAKA 3QFJE 4LIQE 1AFVL 2ADFL 2ADIB 2GT9A 2R0KH 5I8CA 4EZMA 3E6HB 1N0LA 2HKHH 5D2NC 4I3RH 1RI8A 1CFQB 4N0UA 1GZPA 1JPFB 4ODUB 2EDKA 3SOBL 4OT1H 4PY8J 3F7VA 5JPNA 1FC2D 3ILQC 4XCNA 1BQUA 4ISVA 1MFAL 5LGHL 3DIFB 5DQ9A 3WHXA 4H0IA 5I0ZA 5GS2H 1MWAB 1NCAH 3CDGB 4UT9H 1OAYL 4JN2A 1C08B 4TPRH 4X5LA 1JWSB 4S0SD 4LCCC 2I9TA 4FTVD 4GRLA 2F5AL 2HT3D 4JN1H 2UYLB 4PJXA 3S35X 4HS3A 3SJVB 3NIDE 1J1PH 5DRXB 1SY6H 4PRHD 1IRAY 1WIOA 3E0GA 4NQEA 5KVGH 1CZ8L 5ESQB 3WNOA 4GRWE 3IETB 5EBLB 3U30C 5CBEA 3RWDA 1DQTA 1ORQA 3OX8B 5FM4A 5L8LB 2MTPA 4KXZH 1ACYH 1EEZB 5SWQA 2NW2B 5HHOE 1Z9MA 1OAQL 2Y1VA 3HZMA 3QPQC 4JM2D 4J4PC 3QWOB 1DBKH 4MD4B 3BESR 3TV3L 2CO6B 2FB4H 4ZXBD 4U6YA 5C2BL 5T3XD 3UPCA 3I9GL 3EFDH 4TNWK 3GSXB 1IGCL 4MS8D 2RQ8A 5DVMA 2FX9H 2ZUXA 3FOLA 1MCQA 5CILH 3RUGB 4YFLI 4HC1L 1PY9A 5HJ3B 2YN5A 4KZDH 1ZVSB 3TBTB 3P0GB 1TQBC 4GRLC 5DA0B 3HNVH 5DC0A 2CJUH 1U8JA 1BFSA 3GSUB 3VI4E 3GFUA 4Y5YC 5EU4B 4CMMA 5A2LH 3AAZA 4TSCL 1D5ZA 4U1KA 2XXMB 2ICWA 5D5MB 3BP4B 4F58L 3PWJA 3VFPB 43C9B 1X5HA 1A6PA 2IBZY 5F96H 1N2RB 3A6OA 3MLYH 4DVBA 5FKPA 4WJ5A 5AYQA 3VXPA 2ARJB 3N1GC 1JGVL 4N8CL 4JPWH 5KAQF 3N1FC 4O4YL 3VGGA 3QDGD 3RIFF 5D72H 1LEKA 3A6BL 2D31B 4IMKC 2KH2B 2R8SL 4CVWA 1I1YA 1CT8A 1KENL 4NNXA 3FT4A 2JCCE 2PO6B 2X9YA 4JDVB 1HSBB 3TVMC 3G5XA 1DQQB 3QULB 4KRMB 5LJYH 4KKNA 4Z9KB 1X7QA 4OLXH 2VL4A 2E7LA 5IBTL 3JWDC 1XT5A 3PJSB 3FHAA 1U8PA 4PLJC 1OL0A 1XGUA 2BY2A 1FNEB 5JZ7D 3VFNA 5HGBA 3PGCA 4HHAA 2D2OA 1J5OL 5AUMA 4GW5A 4MSWB 2F53D 3IYLW 5IESL 5T1KB 1QKZL 4NC2B 4PJEF 1TMCB 4LIQH 1NFIB 1T7XA 1IC1A 1Q0YL 5BVPL 5KJRH 2VLRD 5CIPA 4QRQB 4JHWL 3W9DB 3L9RA 43CAB 2NYYD 3G5VB 5C0BB 4HLZG 4OGXH 5H37G 3QDJE 4GG6A 3HZKA 5DUPL 5C0CD 5IWLA 1A9BA 2OL3A 1JRHL 4GXVH 4Y19D 3LKSA 2DD8L 3O6FA 2MPAH 4L29B 2DBJA 4ODVH 1I9IL 1GPOL 2BHYA 2E7HA 4JAMA 3MTRA 5EOCL 5FDYA 5A43C 1AKJA 4D9LL 5KSVB 4XX1E 1MAMH 1ORSB 5IVZB 4MA8L 4IRSB 3ARPA 4Y19E 4DKAA 4UTAL 1KEGL 4U6YB 3O45B 3TIEA 4G9DB 5DYOB 5HDBE 1MRCL 4GKZA 3MJ7B 1T5XB 1FZMB 1LO4L 1H3XA 1OWWA 1IKNA 2AEIT 4RCAA 4R4BA 3LN9A 5C08B 3MRIB 2G2RA 2HMIC 1BZ7A 4X98B 2A6KA 2NR6C 5J13B 3DVNA 1NMAL 4OCSL 4XXCA 4YC2C 1MCWM 5C8JB 4TSBH 4X99B 4PTUA 4LOUD 4NKOA 3CAFA 3V4VH 2FECL 5DUMH 5ECJE 1R3LA 2EH8H 1CD0A 4EN3B 1I7RA 3MREB 4PG2C 3DGGB 1VFUA 2BNUA 2D7QA 5EBLA 2VLKE 3MRCB 1AKJD 5D7LA 1FSKC 3IJHB 3SO5A 1SHMA 2A77L 3PWVB 4YHML 1RZJL 2HLFD 4DOHE 3M8OL 5C0BD 3ESVF 1G9NC 1CD1B 3KPNB 4ZD3H 3SGEI 2GHWB 1FRGL 5C6TL 1WC7B 2VE6B 4ZAKB 5E99L 2FD6H 1G6RL 3EO9H 2Z31A 3PP3K 5T1KD 4BSJA 3C5JA 1CS6A 2XWTA 3C6LB 4Y2DC 5E0QA 1CFSB 2P24A 3FRUB 3MUGA 5IB3A 3I6GB 4NM4L 5IW6B 4YXHL 5J3HD 1BQHG 3CLEH 2LQRA 1TENA 3M17A 4R8WH 3BZDA 2CGRH 4UDUA 4JM2C 3N1PC 3P4MA 1CLOL 5I1HL 4XVJL 1HCFX 3QH3B 1EO5A 4KZDL 5FGSA 3MRQA 1ZE3C 1NSNL 1YYLH 5C7XH 3U9UA 4MVBC 5GJTH 4CL7A 4FQCL 4QXTB 1UZ6E 1KN2L 2WW8A 4L9LB 2C7UA 3H9SE 4QRRB 2APXA 2BY1A 1CDUA 4X9IA 1UM5L 3CXDH 3TP4A 4OF5A 4UV4H 1QEWA 4WNQA 5DK2B 1EJ6A 1XF1A 2VLMD 3MV9D 3PDOA 4PRIB 3KPMB 1LO0L 5K93A 3T0EA 2XQBL 4NKMA 3DX9B 2VC2L 1UQSB 2X4OA 2XRAL 3HE7C 1CFVL 4PP2B 2A77H 5FYJL 5SWZB 5EU6A 2QQNH 4JFYB 2ADJB 5E6ID 1QLFB 4YNYB 2O5ZH 1A6VL 3I2CH 3FO9B 1N5AB 2V7NA 4YDIL 4PREA 5JHLH 1EIBA 2C4FT 4F7TA 2OZ4H 3N9GH 1A6UL 3WS6C 1MCCA 1WT5A 4HGWA 3U4AA 3QCVL 4PRPD 5I30L 1BJ1J 4NZTL 1N7ML 1T0NA 3Q6FB 1D6EA 1UADC 4MWFA 4YZFF 2IH3B 1ZEAL 4LVOB 4P4KB 4F57L 1ZLVH 1NGXB 4KTEL 2APFA 4PTUB 5FYKU 3ZDYE 2XZZA 4F3FA 5H94A 3RX5A 3TYGL 4U1NA 2YWYA 1QSFA 3ULVF 3DGGA 5GHWH 1UCBL 4BA8A 3HLAA 4XAWH 3B5GA 1NGZA 4C83A 3H9HA 2DLHA 4LCIH 2E27H 2PYEA 4LLMA 2NXZC 1HQ4B 4LF3A 3UJTL 2E6JA 2HJLA 3V5HB 1RZ7H 4WTXA 3KLAB 3IU3A 1DSFL 1CYGA 1WIPA 1G7JA 1QLEL 1FVEB 3TIEB 6FABL 3KDMA 4XZUB 1C5BL 1R5IA 2H26A 2GSIB 3K0WA 5E2WH 2WANA 4IDJH 4WDIB 1FGVH 3IXTB 5DI8B 3QJHB 1DBMH 5HHME 2V2WB 5TH2B 1S9YB 3QYCA 3MJ9H 4OKDA 1WEJL 3ARFB 3IDMA 5INDB 4LVHB 2GUOA 1S5IH 2PCPB 4V1DB 5JQHC 4LHJB 2BCKB 1MCNA 3LPWA 5KSAC 1U8MB 3BZEB 4JVWA 2AEPH 4TULL 5E9DD 5IB4B 1UXWB 3CDCA 5DJZB 4GUPB 1YY8B 4Y19A 4PJ8A 1J05B 4JFEB 5HHNB 1BQLL 4KUZL 5CMAA 4DZBB 4NUJB 3BMWA 4P3DB 1HXMA 2GJZB 2VMFA 3AROA 4NZUH 1OY3B 3MV7B 5DMJB 5DD6A 5IHZB 4X6BB 1MCWW 5IB5A 4CMHC 4ZFGH 1ZGLB 4WNQB 5DK2A 5DFVC 2IC2A 4AH2B 5M94B 3JWDL 3LQAH 5GHWL 1RUML 1G9MH 4F7EB 4ZFOL 2JTDA 5E5UB 1FNHA 4OFVA 1IILE 3B9AA 5JDSA 1BM3H 4R26H 2X1WL 4PRPB 3JTSA 1ETZB 4OQ1A 5ENWB 1BOYA 1K6QL 3D3VE 2W65B 4YHMH 3B43A 4P49A 5HYIA 5DJ8A 4LRNL 1CU4H 3SDYH 5CEYB 4M3KB 3TNMA 4YHNB 5FHAL 5F7NC 3BW9A 4CU8A 4JVUA 3SDXA 1AH1A 1CBVL 1NCDL 1PW3A 2EYTB 5DGRA 5ISZE 1LQSR 2IADA 2GTZA 2IALA 5DJAB 1AP2A 3BP6A 1A7OH 3AB0B 1K4DA 4HIIA 5CJQL 4PJIA 2DQDH 3J8F7 3HMXL 4LASH 1PGRB 3QEQB 2JB5H 1KJMB 5IHUH 4RWYL 2J5LC 4LSRL 2I60L 3IDYB 3DURA 3VFWA 5T3XL 3EZ8A 1SYVB 2MFNA 4MQ7B 1P9MA 1OTTD 3BP7B 1UQSA 1H5BC 3LN4B 4X8XA 3RL2B 3P9MA 5EZIH 2CUIA 3TF7C 5F9AC 2UY7A 3SOBH 3MUZ1 1JF6A 2HVJA 4Q9RH 1CGXA 3HB3D 3BDYL 2ZKHH 4HDIA 5TGBA 2ILLA 1HH9B 2ZCHH 4H1LA 2BSRA 5JORB 4MDJA 4OZIA 5E2TH 4P5KB 3O2VL 4E0RA 4X6EB 2PYFB 2EIBA 5BS0E 1CICA 4HH9B 2F19L 4JFED 4U2YA 3U6RA 2IPTH 1DBAL 5FHBL 3HPJA 1VKXA 4FHBD 1BFOB 4IM8A 4TQEL 4K07A 5JR1H 3TBVB 2QQNL 1F45A 3O3DB 1RUKH 2R15A 1M7DA 1T20A 1F4YL 3QCUL 3WS3A 2VNCA 4HQQH 5C0EA 2C1PA 2ZWLT 5LBSL 4ZYKB 4Y4FB 4FOMA 1N64L 4TNWF 3QUMB 1J05A 2OI9C 5HI3C 4ZO6A 2IJ0C 1IC5L 4LKCA 4HS8L 2CLVA 1TTFA 1BBJA 1FO0H 5EU3A 4QY8A 4KGLA 2ZOLA 3HNTL 4MDIA 4L8DB 5SWSD 1GGBL 3HE7B 1K4CA 1ZK9A 2R69H 1MY5A 3G5YB 4JJ5A 4C4KT 1R3JA 3S5LA 1YNKH 3IFLL 3OGCA 3FHQA 1RK0B 3D3VD 4XPGL 2BC4B 1KN4H 4X9FA 3P11H 3QWQB 5ESVA 2NW3A 1MRFH 5CSGA 1F90H 3EGSA 2PYEE 4MJIB 1DR9A 3MRFA 4HKBB 3ZDZF 3JTTA 5FA4A 1HXYB 5LXGL 1OD9A 2WSKA 1TVHB 1MIML 3HZVA 4X7SL 2X42A 4KUCF 4Y4HC 3S37X 2KZWA 3BFOA 4ONGH 4NO5B 3MNVA 5F1IB 3UTQA 3EBAA 2Y06H 2IPTL 5IBLC 3BUTA 2GQHA 3AREC 3FB6B 4EDXB 3IGAB 1UKTA 3WFBH 2UV3A 4PJDE 1XF3A 2M8XA 4PRIE 3NABH 4IIQA 4Q9BA 1S5IL 5FV2A 4L8SA 2V17H 2FJHA 4TSAH 5I1KL 1YJDH 4Z78A 4WI9A 4E5XA 3VXQB 2R4RH 1IGJA 1XIWC 1FLTX 3DSNA 1JZ3A 5ALBL 4U1HB 1QQDB 1BOGA 2BVQA 2CUHA 2RJMA 1FFNA 3GBNH 1JV5B 4I2XA 4X9BA 4APQA 4JJHA 3ULVD 3TCXA 3MJ8B 4X4YA 4QHLB 3MQIA 4MMXC 4YFLF 2YS4A 5F7HA 5IOPA 2D0FA 4JZOB 1NGQH 2WAHA 4RZCB 3GO1L 3V4PL 1XZ0A 2IBBA 2I25N 1HYSD 3H3PL 4HBQA 3RZCB 3OR6B 4L4VB 2NXYC 3TNMB 5TF1H 4KKAC 4M02A 3W81A 1C8PA 3WO3B 2H2PD 2HH0H 3AUVA 1NFDF 3IJYA 1RIHH 2IMMA 3S98A 3K81A 3LIZH 3UDWA 1A4KA 4PD4K 2BDNL 4HUMB 4JRYB 3VH8B 2XNAA 1EO8L 1MJ8H 4Y2DB 2F53E 4IOIB 2ED8A 1A2YA 4FQCH 3QIWA 5ADPL 1MRFL 3RVUC 3BEWB 3MACH 3OTTA 1DL7H 4LRNH 1REIA 2D7TL 5J6HB 3UTSA 4QGYA 1IGTA 4GW4B 4YHOL 3EDFA 1T1ZA 2BSTA 1P6AB 3KYAA 4LARL 4CVUA 3WN5C 2BVPB 5J11B 1UWGL 2R56L 5JUEL 5KSUA 3RDTB 1LNUB 2DLIA 5EOCH 5DJ6B 5IJKA 1LP9E 2R39A 4GRLD 2MCPL 1YN6B 2ZCLH 4OV5B 4HIHB 3RIAK 5D5ME 1H8OA 4JDTL 3SE9H 5C0JA 2DQDL 3QQ9C 4PJ9B 5F89A 4BSVB 2PW2A 1RJZB 5I17A 1LILA 3MLXH 1FIEA 4I8DA 1P4IH 2IGFH 4FQ1L 4G8IA 1RUQH 1WGOA 4YWGL 3O4OC 3B2VH 3EO1A 5HI5C 3DNKA 4P2YA 4G42B 4PIRF 1FFPA 1LD9B 5EORL 4BKLA 5E4EC 1U8OA 1ERNA 3D85D 4YDJB 1MELA 3T65B 2W92A 2P47B 2ICWB 4LCUA 3QQ4A 1X3DA 2HT4D 3GSRB 4XBEL 5TE6H 3NCJL 2EXYD 2EXWD 5F7EH 1P84K 2VRAA 3O0RL 4QKXB 4LLDB 2WNGA 2P46B 5GZOD 4JO1H 5FYKL 5MEQB 4ZOCA 1J8HA 4K8RD 3F65A 2AJ3B 3FRPG 4XPTH 4K3DH 4NRZB 5E9DE 1YEDA 4V2CB 3P30L 5D6DA 5GGRB 4RFNC 4UV7H 2A73B 2NX5D 1KPRB 3L3KB 4Q2ZA 1AGEB 4UT6H 3P9WB 1LK3H 4LHUB 3MLPA 2KUTA 1EGJH 1IC5H 3VFWB 2K7QA 1FDLH 3QG7H 4NKIL 3OF6D 3EO9L 1CI5A 1MPAH 1VFOA 5EPMB 1QA9B 4LCWD 2GY7B 3L3HB 1KTDB 4PB9L 3K1KC 4MNQB 3KHQA 4P2RE 4OZHB 1MJUH 3IAGC 4MA1C 5SX5K 5ITFB 3VXNA 3S37L 1G7LB 2FDBP 1ZLWK 1KENH 1FYTA 2Z4QB 3RWEA 4GG6E 1A4JA 2XG5A 3V52H 3CGTA 4G3YL 3IFLH 5BOPA 5E94A 3IS0X 1F6AA 5D4QA 2ITCB 5DZLA 2FNBA 3WXWH 1UACL 4ODHH 4DGIL 4P23B 1L9NA 2OL3L 1RFDL 3L9RB 3OMZA 2XG4A 5CD5C 5EOTA 1S7TA 5FYLL 4MMZC 4EN3A 5C0IB 5DLMH 4YDKL 3NFNB 1XCTB 4U0QB 4O51A 4P46A 4PGDA 3H7LA 4I13B 4YO0A 1XF2A 2YD2A 1EEYB 3GIZL 3I50H 2J7LA 5E2JA 2ZPKL 3S4SG 1ND0A 3BEVB 2I5YH 5J89A 1NCAL 2NY2B 1WBZB 5T5NF 3VRJB 1EHNA 1U3JA 3KYOA 4QRTB 3WUWB 3INUL 4OCXL 3WEXA 1I8IB 3FQNA 2HN7B 3MJ7A 3VE0B 5GGSA 4XCCH 1RU9L 5BRZE 3BWAB 5SWQB 3VDAA 1NCDH 3QULA 5CP3H 1T4KB 1KXVC 1OCWH 4Y4KD 2E7MA 5DA4A 5JW5A 4QRSA 3SN6N 3RY4A 4JFQA 1UVQB 4G43B 5JQ6L 2VYRE 4RFOH 2DWEB 3TO4A 1ZEAH 3CX5J 1S78C 2Q20A 4YDVA 5CKGA 3GSVB 4IHOA 5ACMA 4ODTL 3TV3H 1GOHA 4Z7VE 2R4SH 1I7ZB 1F58H 3ETBF 2J8UB 3IS1X 1PYWA 4JEGB 5IMMA 5ICXA 2L7JA 1LDPH 3O11A 2ZJSL 4Q0XL 5DRNB 1Y0LA 1FC1A 2ZUQB 2A9NH 4FZ8L 3LSOA 3HRZA 4QT5A 1NFIA 4PS4L 3EJZD 3O9WA 4BH7B 2AXFA 2JJTA 5E6YA 2H9GB 4LCWB 5E8OA 4R7DA 1D5ZB 3QHTC 1A7PL 4X5XA 2BNRA 1I9RL 3MRMA 3H9ZA 3W0WE 4Q9QL 4G8GA 3WMSA 3O2DA 1ADQL 4XVSL 5I9QC 4CN4A 5GGQL 1GYAA 2F19H 4K7FA 5L2KB 2B4CC 1TTUA 4K8RL 3KPSD 5EB9A 4NQDD 5DHXB 5CP7A 2LFGA 1A22B 5IR1B 5E8PB 5C09A 3FO1B 3DO7B 2BOCB 5HHOA 2OTUA 1G7QA 5IFAL 4QHNB 3TNNB 2X09A 5EUKB 4X6FA 1KGCE 1P2CA 2EIZB 4YBQC 5EZLA 1KULA 1RZKL 4WWID 4QRUA 4ZO9A 2BSED 4NRYB 5CEXB 2N7BA 3HZYB 3BAEL 4PGBB 2C1OA 3NIFF 5IB1B 2VXSH 4ALAH 4PRPE 1HDMA 7FABL 1IGYB 5TQ2L 2XNAB 1ZLUK 4GAGH 4IEFB 1MFEL 3DRQB 4E41B 1OM3H 4NZUL 1KIUA 2EDJA 5EOTB 5FO7A 2BOBB 3KPQB 2WIMA 3MYZA 4HXAH 3NZHL 2IMNA 2J5LB 4PB0H 4W6WB 4W81A 4YO0B 3OAZH 1QQDA 5H2BA 3D6GA 3KJ6L 4TUJB 2YZ1A 1H3PL 5LKNA 3MRCA 4LCCB 5KOVC 1LE5A 3FFDA 2HT4C 2ICWI 2YSSB 4HD9A 4NZDA 4J3OC 1A5FL 4ZS7L 1YPZF 1WIUA 1K6QH 4MXQD 1CF8H 5CEZH 4OT1L 3OXSA 3VFVB 1GOFA 1GC1H 4BSWB 3CFBB 3GHEL 4L8BA 2WP3O 3VWJD 2CKBA 5F3HB 5IEHA 3UZEA 3GIVB 3L6FB 2V2WA 5TDPB 3O2WH 3DOSA 3MLZL 1IFHL 3KJ4B 4UNTA 3X3GH 1T22B 5FYJH 1FO0A 2X4NA 4Z0XA 3T4AB 2DLFH 3ZKSD 3JWOH 4J1UB 3U46A 3SGJA 1UA6H 4XI5D 1F97A 2UZXB 3G6JB 4QOKD 4NGHH 3MXWH 1ZS8B 3KPOB 1I7UA 1OD7A 3BKMH 4ENEC 2B2XL 4PUBH 2NNAA 1FP5A 1N8ZB 4RBPH 4G6FB 4P9MH 3VH8G 4Y4HD 5L2KD 2CRYA 3X14B 3FL7A 4G6AC 3HLAB 4P5MA 5DJ0A 3UYOD 2XKNA 1MCFA 4LK4A 2EDLA 5HVWA 4OTXH 2VLKA 4PGZA 1WBXA 3STBA 2CKBH 3MSPA 5TQ0H 5C86A 4G8EB 5E00B 1D9KA 5I15L 4FQLL 5A3IC 5D7LD 4V2BA 3CH1B 1XIWD 1L7TH 3EYUL 5C0DA 2AK4E 4DKEH 3H42L 4Y16C 3ARDA 3VG9C 3VA6A 3C5JB 3N9GL 4MA7L 4N0CD 3QG6B 2DWEA 2B1HL 4W68A 5C07B 3FO0L 4Z7VF 1EFQA 4KUCD 2PCPA 4JFHE 4K94H 4XCFH 5FUZH 1AR2A 5I1CL 3WFCL 5IMMB 4NHUA 2QADD 4ONFL 2FHFA 1GVIA 3DMMD 1V8HA 1U93B 5J1AB 3GEWB 2AQ2A 3QUZD 3IDIA 1K2DB 1T1XB 5M95B 1NAKH 3QCTH 3QXDB 2HLAB 4HC1H 1CL7H 2FYYB 3HHRB 3LKQA 3P4OA 4QNPF 4XAWL 3T0XA 2KQNA 3DYPA 1I8LC 1Q72L 4B7IA 2PTTB 4OKVB 5DFTA 4OF8A 3SKOA 5IQ9B 3HN3A 4OLYH 2X89D 4OZGB 5DD0H 3FO2A 3DURB 3OKDB 3P40A 3SKJL 2VDKL 4YHLL 2OLDA 1XGRA 4P2OD 3TZVA 3MGOA 3ARFC 4OAWA 5DHVA 1VPOH 3DYMA 3S3SA 1AD9A 5IG7A 4Z8FH 4N1CA 3MLYL 4H88L 1F90L 4BZ2H 3MLRL 4NOBA 4W4OA 4OCYH 4QWWC 1NCCH 1JGEB 3K3QA 1VEMA 1MHCA 4GS7C 3P73A 4TRPH 1RUMH 2R2HA 4WVRA 2ATPB 2C26A 4WWKA 1N3NA 4H1LG 4TTDC 1S7SB 4FQJH 3MNZA 4GQPH 3R06B 3V8CA 1V7MH 3VFUB 4PGEB 5EU6B 5TE7H 1EZVX 5HTSA 3CFKB 2EKSB 4CUCA 2NY0C 1D6VL 1F8TL 3F7RA 5B3NA 3SE8H 1MWAL 2DWDB 3L5JA 3MLWH 2JK5B 2VKXA 2IBZX 4P3WA 4XC3H 3RVWD 2X9WA 2DQFB 4IS6A 3RWJB 1JHTB 2YD9A 4I18A 1CXKA 4JANA 1Q0XH 1N7MH 2AJZA 1SJHA 3QUXD 3CCHB 4R6UA 1J0JA 1GHFH 3IDNB 5CJQH 1YEKH 2J6EL 1XCQB 1AXIB 1EFXD 3TPKA 3WUZA 4JGJA 5D7SH 5I8OH 1HOCA 3FTGA 4PJGE 4ELME 3HR6A 2IFGA 1RJYB 3REVA 1PG7L 4QXWA 4Z7OF 3MA9L 1VA9A 3EYFB 3R0MA 4UUJB 1J9CT 4ONOA 5CFHA 1FVDA 1CE1L 3HI1B 4R2GC 4YBLB 4MQXC 3RJQB 4KV5E 2Q87A 1F4XH 4JY4A 5DURB 5DD5H 3QFJD 1R24B 1WFTA 4Y1AB 1TPXC 1MI5E 5F71A 5KS9A 1RIVH 2EDHA 4XH2B 4ELMB 1WWAX 2P42B 1YDPA 2E3VA 4PRBA 4FQQB 3LOWA 5F3BB 2HTKD 2VLJE 3WDJA 5B4MD 4WW1B 4JY5H 5FKPB 4LSPL 4WTZA 1BIIA 3ARBA 5JHDE 1A7BA 4K3GA 4P5MB 4DAGH 1OTUD 4OM1L 3G6AB 1F8TH 1YEHH 4JG0L 4MD5B 5IIEB 4G7YL 3MO1A 4YEEA 3MV8B 3V6ZB 3QDJB 4FQPA 3UO1L 4JM2B 1E4WH 3H0TA 4EEEA 1N59B 2EZ0C 4XMLH 4GKNB 4MB4A 1KCLA 5JO5B 4OZFG 2FZ3B 1K8DA 2W9DH 4YAQA 5D2LF 2X4RB 5EN2B 5IVNA 2UZIH 3PHSA 3U4BH 4PJDB 3HC3L 2EIDA 1AXSA 5EZJA 4OD1H 3K4AA 1FNLA 3Q3GA 3TPUB 4YHIB 1IJ9A 1RULL 2VAJA 2BXYA 4PJHB 4F8QA 4D3CL 2CRIA 3KJ4C 1OP3H 2EIZA 2R4SL 2Y9RT 4N0RA 2DTSA 3FOLB 2F5BH 4G6AD 3TT3H 4LLUB 2GITB 4NYLA 3MCLL 4KKBD 5C0RL 1DDHB 4RA0C 4RGOH 1FZJA 4KDVA 5IEHB 2ADGA 3QNXB 4PLOB 1HQRA 2HJFA 1X6NA 1HHIB 4QYOA 1A2YB 5DQ9B 1NANI 1U36A 4L3EA 1O0VA 4P2QD 1T66D 2X7LB 1DJSA 4Z7UE 5I8EA 3QFJA 4X80L 3SDXF 1H9VA 5E1AB 1RIVL 2BRRH 5ALCH 5A2IH 4N8VA 4FFYH 4K7PL 1G7PB 5EUOB 4U1HA 4QHUA 2GTZB 2LU4A 1XGRB 2CK0L 5ISZD 1S7UB 1HHHB 5JW3H 1AD0B 1ZXQA 2XACC 3L3IA 2HTLC 5IOPB 1A3RL 3FT2A 5CEZE 3BJ91 2EE9A 4G8GE 5DO2D 1FG9C 3WLWC 5IVXB 4LSDA 5MEOA 1D5IL 5I18L 1Q9OA 4KI1A 3NCCB 4FABL 4NO0D 1U8KA 4Z7QF 4M1CD 4Y5XB 3LEVH 4HFWA 5I73B 5CBAB 4UQ2B 3RP1A 1CD8A 2VDOH 4G7VH 3L3GA 4HWZA 4X6CB 1G7MA 4XCYB 4JRXA 2XZCL 3L3OB 4I18C 5HI3D 3WIHA 5I1JL 2X89A 1YY9C 3QQ3A 1NAMA 1T7ZA 2EH8L 1I1AA 1OGAE 2YR3A 2AEQL 3GMLA 2MQ0A 1H3PH 3QXAA 4PFEA 4Q6YA 1J1PL 1NFDA 1IQWH 4P4RA 1RZ7L 4WJ5B 5BOZG 3ARBC 2MKLC 5EWIL 2GCYA 3BSZL 2B8OT 3TA3D 2GJ6A 5IMLB 2R0WL 3ZDYF 2VN7A 1GC1L 2L7UA 4BZ1L 5DJXB 2OJZH 4HUNB 1KEGH 1IVLA 2ESVE 1DVFC 2OX5A 4HPYL 1RJZA 4HAFA 4OSUL 5IKCA 4P2OA 3O2WL 3NIFE 5E8NA 4EI5B 2K1MA 5D1ZA 4NC0B 1ZWIB 3D18A 3K1DA 4ZFZB 3AXLB 4C56D 4WY7L 1XGQA 3RKPA 3CFIC 3HNTH 3ARGD 5CZVL 5GZOC 3NPSB 1INEL 3EO1B 1NDMB 2QSQA 1IT9L 5C92A 5IP4A 1HHJA 3L3JB 3MOBL 3PL6A 1DDHA 3AMLA 2WIIB 4CGTA 2CLZB 4LPWA 1QFUL 5C08A 1IEAA 5EIIB 3CFJB 3F8UB 1CLOH 1E4XH 1HHIA 5I1HH 3EW3B 4RNRA 1HYRC 3IGAA 4JFFA 4YE4H 2OSLA 4PRNB 4JDZA 4XGZB 3IDGA 3OHXB 4MHHG 5KAQG 1FBIL 5GS0H 4DK3A 1YA5A 4NQED 1BVLB 4NO0B 3T1FA 2Q8BH 4HXBH 2D0GA 1W72H 3BQUA 3STLB 4DKEL 5FA3A 5TFSL 1BZQK 4K3JL 3KYNB 3UPAA 3W82A 4U3CA 43CAA 1FAIL 2VAAA 3I3EA 5SWSA 5B38A 3LKNA 3MX0A 5FGCB 3SJVA 5CIPH 3FRPA 2QSCL 2GKIA 4Y16A 5EC1B 1HKLL 2IAMD 3DUSB 5C0FB 5IFHL 3GMOB 3RRQA 1VADA 2ZSVA 1HEZB 4WEBL 1JRHH 3MFGB 4AIOA 1A7NL 1RIUH 4NHCL 3BUYA 2YC1A 1WF5A 5DJ2A 1FV1A 3CFDA 4DN4L 2EZ0D 4CW1A 3RVUD 1VENA 5L6YH 4P5TC 2XTJD 5DRZB 4N8PA 5AYUL 4UDTA 5A16A 2X7LA 3V0AC 2BHUA 4NKOB 4R4ND 2VH5L 1TVBB 3SKMA 5BV7B 2H32A 4HXAL 2LU7A 1AI1H 1RHHB 3NIGF 5CHNA 2LU3A 1IBGH 1D5BA 3HPLB 5CILL 3MNWA 5JOEA 4H8WH 4WUUD 3CXDL 3LEXA 1AJ7L 2QADC 1B88A 3ARUA 2XV6B 4XHQA 2YK1L 3CMOH 2OM5A 1LO0H 3QUZC 3MV7D 4JE4B 2CJUL 3PF2A 4C56B 1PX4A 2MPAL 2G5RA 3QDMB 3QO0B 3UTSB 1NDGB 2P8MB 1KACB 4WU5B 3LHPH 2D7TH 4F7CA 5HHPB 3BGMB 2P5ED 2XWBB 4L3CA 3GHEH 3F7YB 5E6ZA 4WEUD 2ZUTA 3RWCA 4NQCA 3I2CL 4YDIH 4YHOH 4F33A 1FVCA 3BPLB 4X4XB 3QNZB 2ARJA 5DMYA 1WVZA 4PJ5A 1T5WA 4G42A 1AQDA 5HSFA 4BQ9A 3ARDC 4KTYA 3V6OE 1MHHB 1NGYB 2DL9A 1QRNE 3VXRD 2PW2B 4JQXA 1KB5A 5DHYA 5LBSH 1JF1A 2QSVA 5ITBL 4JHAH 3EJYC 2VZTA 3PWNA 1OGTB 2WP3T 4DUXA 1YDPB 1DBBL 2FBJL 3TYFA 4AIZB 4UAOC 2W91A 1H3TA 2EYRA 4OZ4B 4PJHF 4DN4H 4F9LC 2JIXD 1KSRA 3QDGE 5EIQA 3IXAB 3VFTA 2WWKO 2QJDA 4JPVH 1LO2L 2Q3AA 1KBGL 4U33A 3P9LA 4AT6A 1FG2A 5HGBB 3SPVA 1MLBB 1S3KL 1FNGB 4RAUA 1C16B 1NLBL 1HHKA 4HJGA 4MZ3A 1OF2A 1DN2A 3IKCB 1DN0A 3FQTB 4YPGA 3QIBB 4L9DA 4XP1H 1QBAA 2YA2A 3FCTA 5F7UA 2CDGA 3SGJC 1MVUA 1J0IA 1IZJA 3BD4A 1ND0B 4KMLB 4TYUA 1QFPA 4L4TE 4Y2OA 1BM3L 3THMH 4M93C 1JCKA 3X3FL 2PETA 4ZFZA 3ZL4H 4AZ8A 1TCRA 4XI5C 3RFZC 1I85C 4R0LC 3MPCA 1NDMA 1Q9OB 4QXGL 4NO3A 4F15B 3B5HA 4XCFL 4NQSA 1P4BH 2BX5A 1MH5B 3WHXB 4ETQB 4GBXB 1KYOJ 3RHWF 4IRJC 4R7NB 2EC9U 2UWEB 2XN9B 3GI8L 1FDLL 3QG7L 1XGTA 2R1WB 2DKMA 2ZJSH 2F54B 3K8LA 2WWKT 2RFXB 3UTPE 1X5JA 2DQGL 4TPRL 3VG9B 5E8EB 3EOBA 5SX4I 1UXWA 2OP4L 3T0VA 3OKMA 5ADOL 2GTWA 1A4JB 3HUJA 2YBRA 4K23H 4PRAA 3QI9D 4GMTL 3BQUB 1A1MA 4P23C 2P7TA 1CR9H 3J7HA 3QEQA 4M62L 3QCVH 3S6CA 3BKCL 4YX2L 5T3XH 3O4OB 2XKNB 4GJTB 4P4RB 2WINA 5DQJA 3R1GH 1NDGA 3WKMH 5DMIH 4U6XB 2J88H 3GSNA 4FFZH 1UH2A 5BZDA 1I8IA 1FBIH 2AI0H 3GBLA 1SYSB 3D5OF 4EUPA 4M43L 3RUGE 4JFXA 3C08H 2NTSP 4WCYL 4P9HL 4IRZL 2HYMA 4BFGA 4GXUN 3G04B 3KYMB 1QSFD 4FQHB 5TPWL 3JTSB 5DK3A 4MX7B 5BRZA 1AGBA 4HPOH 3MRJB 4HH9A 5C2UB 1KNOA 1K9TA 1T1YA 5HDLA 4NQDE 1CF8L 3EOTH 3QIUB 1A6TB 1RZJH 3MLTA 1A1OA 1VERA 2UYLA 2ARWA 1BHGA 2HG5B 4PJXB 4S1QL 2CIIA 3GM0A 1MIEL 1RHHA 4X7FC 2FL5B 3RNQA 1N2RA 3MOAH 1JNNL 3GI8H 4P2RB 2HLFC 2ZZUT 3T09A 1CFSA 2P24B 1KJ3L 5E24E 3O2DH 3VJ6A 2JJTC 3DVGA 5T3ZL 1JGVH 5EU3B 2DJUA 3ULUD 4GSDL 5D71L 2D4DA 2EE3A 3O3AB 1JNLL 3QHZL 4HKZB 4YXHH 3O6FD 3MRMB 4H20H 4HIEA 1Y18B 4HEPG 3S36X 5D7KE 4GXUM 1MCIA 3SDAC 2DMKA 2VZVA 2NXYB 1MREL 1Q9WB 1MRDL 1TZGH 3BZ4B 4JRWA 1JI2A 4TSCH 4FZEH 1MHPL 1ZHNA 4QEGA 1S5HB 5IJVB 3VXTA 2IGFL 4F7PA 5HJ3A 1FYTE 3QT2A 1RQ5A 4ZFFB 5ACZB 2VZUA 2PO6C 3GSUA 3ULVL 1MJJA 4IRSD 1SJEA 2EYSA 4KI5C 2XKSA 5DJ8B 4NO3B 4WU7B 3F6LA 4YFDB 5HGDA 3FT3B 2BHZA 4XNQB 4BFIA 1JZ6A 3BPOC 1NCBL 3UMTA 3TIDA 2CR3A 3MR9B 1GZQA 3NA9L 5IB1A 2OTUB 1WV7T 2RR3A 2DQUL 1KB5L 1QSEA 3ISWA 2WBJA 2YRZA 1F4WH 5ILTL 3VD7A 1MWAA 4AQOA 4EIGB 3QIUD 3V6OC 2NQCA 3QXDA 4TNVF 3DV6B 3CJJA 4ODXA 1J8HE 5LQBH 3VXMA 5D2LB 5I8KL 5I1KH 1ZGLP 5D70H 5JHLL 5KSBF 3U7AA 2D4FA 3WJJC 2LVCA 1ZOXA 1T0NB 3LV3B 4XWGH 4TTGA 4YEFA 2JCCF 5A2KH 2BVOA 5KN5B 2DKSA 2DF3A 1E28A 1A9EA 1AKJB 1DQDL 1XZ0B 2Q7YA 4MA8H 3H2WA 2PTVA 3IFPA 5CKAA 4PJDF 3IRZA 4EOWL 2ZSWA 4XPGH 2NY7L 2AJSH 1IL1B 5J4MA 1D9KB 5I73C 4Y4KA 2AAVA 3VRLE 2VZ1A 1F3DJ 4TVPL 3WXVL 4NZRH 1G7HB 5C0DB 5B39G 2HFTA 1CE6A 4ZQKA 5E9DB 1DVFD 4HK3N 4IOFD 3P30H 4I9WE 2XFXA 3ZKND 3BIAX 2P43B 3B3IB 4GAFB 3WIIL 3HPJB 1VKXB 1JP5A 1CXEA 4R97C 3FOMA 1ZLSL 1XF3B 4PV8B 3C6LD 1LMKA 4JPKL 5FA4B 1L6XA 4W6XB 1F13A 3QO1B 1Q8MA 5H35B 4WFGD 2Z92A 1BZ9B 5F9JA 2VTFA 3D2UA 3TT1L 4O2EA 1ACZA 4RWHA 5DRWA 4RFNB 1MCOL 3BRDA 5H37H 1CICD 4FQXB 3LQMA 4F7MB 5CZXC 4PR5B 3RPIB 2X4PA 3QPXL 4JO4H 2BNQA 5CLWA 5CS7A 4P3CH 1A3RH 3MV8A 2FX8L 4HSQA 1PBYA 3OPZL 2DQHL 4NFCA 4J3VA 4U6XA 3EYSH 2VXVL 5I8KH 2V9QA 4HUKB 1PLGL 4EBQH 1OW0C 1IM9B 1JL8A 4DKDC 2AW2A 2D31A 3KPRD 1A3QA 4LHUD 3QEQD 2PUQT 4RQQA 5JA8B 4QHLA 4OQTH 4NHCH 1JUFA 1OCWL 1PY4A 1UKSA 3DETC 2Z93A 5GRUH 1TZHA 1VFMA 2DYPB 1K5NA 3VH8A 3E6FB 3EHBC 2Y72A 4Z0BH 5KZCB 2OJEA 3ZKQD 3BKYL 3HI1A 1B9ZA 4G8EA 2ITDA 1ZT7A 5ELIA 3ZDXE 1EUTA 3U36A 1I9JL 1MHCB 3KWWB 3P73B 2AJVL 1GL4B 4EVNB 3VFGH 5D5MA 2E9WA 4XCEB 3NFSL 4LQ1A 1D5XA 3BXNA 3QQNA 5C0GB 4M6NH 5AD0A 3LAFA 2ZCKH 4IDJL 1G1YA 2APTA 4KRPC 3FQRB 1M7IB 1FRGH 5IJKC 5KW9H 4IIQC 1TVHA 4LPXA 4ZUSA 2XQYG 4P4KD 1IQDB 4M8QA 4XPTL 4NC1E 3UTSE 4BM7A 3T2OA 3Q1SL 4WRLA 4OCWH 2I27N 2ZCLL 4LLAA 1UJ3C 1OHQA 5DUBA 1IAII 3PV7A 1YEKL 1T6VN 4X6DE 2AEPL 4RMVA 4UT6L 5JO5A 4PJ9D 2HA1A 4HV8A 4H8WC 1GGTA 1S5HA 3WE6A 1HZHH 1RVFL 4GG6F 1NMBL 1MY7A 2NY2D 4GRMB 4OGZA 1IKFH 2AQ1A 4UINH 1VACB 5ID0B 2F58H 3V6FA 2OTPA 4CJ0A 1INEH 1HINH 5SWZE 1YYLL 5IGXH 2GAZA 1LEIA 4CRPA 4JHAL 3TCLA 4MA3A 3KPRB 4JR9H 3BGAA 2PKDA 4HGWB 4LEOA 4OGYH 2BFVL 2F9BT 1IC7H 1T5XA 3VXSD 4LSRH 5FUCE 3L1OH 2CQVA 3GMQA 1JHKH 3C8KB 3OB8A 4G9DA 1T21A 4YBHA 1RZGB 2ZUQC 3H7BA 1E4KA 3PWUB 3VCLA 1FVDB 5CWSB 4I2XE 1WISA 1T0MA 2HTLD 4ZPVA 3EAKA 1PVHA 2GSGB 2IBGA 4C59B 3ARDD 1T83A 1Z5LB 4NQVB 4OIIL 3DV6A 2OMBA 3RJDA 4TUKL 2EDNA 3STZA 3PGDA 1UB6B 2MCG1 4MCYA 3JVGC 3V5KA 1HH6B 4M6NL 4PLNC 4X7DC 1A9BB 2OL3B 4PRIA 3VU2A 3ECBB 2OCFD 1FLRH 4L8SC 3VGHA 5C07E 3RIFK 5E1HB 3CSYA 3W9DA 2Q76A 5IBUG 1IGIL 1BD2B 1IAKA 4I3SL 2YD5A 1HNFA 4P99A 3BP5B 4H1LH 1I3RA 3MRDB 3VE0A 5IF0B 3RGVA 3OG6B 4MJID 4U7SA 3ULSB 2P49B 1ZANL 3P0VL 3C5ZA 3UEZA 1CE6B 4Q58C 3D9AL 3QRFM 1JTTA 2G2RB 4HS6B 3JWOC 1BIHA 3I6LD 4POZD 5GGTH 1YNTB 5C9KA 3LDBB 4U49A 3W2DL 5KVEL 2ZUVA 3Q0HA 1K4CB 4RMUA 3S96B 3VRIA 3PG2A 3L3JA 1H5BA 3N85L 3BHBA 5KANG 4YFEA 2IPUK 4I4WB 3DWTA 1OT1A 3VGBA 5DJZA 5JXEA 1U8HB 1LHZA 1SEQH 3GMPB 3L1OL 4NN5C 4TUOB 3SEPA 5JW4N 4IJ3B 1R3KA 1QO3A 3FFCA 3L95B 5I66B 2BMKB 2R9HC 5FIEA 2W60B 5T33H 3V5DB 4LLVA 3EYVB 4XVSH 2RCSH 4M4RA 4HUWA 4Z5RB 3A6CH 5CINH 1CG9A 5JNYA 1JUFB 5IROA 3B8YA 3LKNB 2D7OA 4IIQB 3WJLA 5K59F 4MNHB 5DD3H 1E4JA 4YXLH 3V6FB 3CVIH 4YHZL 3NPZB 3ZHDA 5EPMA 5CUSH 3HFMH 2A9MH 4OM0L 1S9VA 5EH1A 2CLZA 1JPST 5CEYA 3VWJB 4YHYC 2DOCA 5FHAH 1V3MA 1HHJB 3PP3H 15C8L 3D9AH 1IGML 4UU9B 1OP3K 4XBPA 1KJ3H 3D0LB 1HHGB 3ARQA 3CH8A 4JFEA 3RZWA 7FABH 4MNGB 4S1RH 4D9LH 2YD4A 4Q6IC 4QRPA 4HKJA 4RNRB 5IMOA 5F7EL 1R3HB 3RVXC 4M7KH 3X12B 4Y1AD 2X1XR 4QOKB 1JGDB 4LBEB 1G7IB 5HYJB 2EE2A 1A4KB 3VRLF 1IGCH 3V2AR 3ECBA 5HHQB 4OD2A 2WK2A 1KYOK 5D1XB 3WO4B 1QP1A 2ITCA 5MHSE 3CK0L 1S7UA 5J6GA 3FB5B 4MA1B 4TN9A 5C3LD 2CRMA 1T83C 4PJCA 4BH7A 35C8H 2ZOKB 3O3BA 5HXMA 5ICZA 4U1LB 4X4ZA 3AB0C 4QNPE 4NCC2 4JQVC 3DHJA 1I7RB 4GMSL 4CDHA 1CFVH 3CSPA 3K2MC 3HUJF 1UFUA 1EAJA 2H3NB 5IMKB 3EJZC 5GGSB 4R4NC 1M05A 1A7OL 3AY4A 1I8KB 4U1IA 2HJLB 5DD1H 1BECA 2V6HA 1MI5B 5EOQL 3OAYH 3BH9B 2ZPKH 2IQ9H 2AK1H 1ITBB 3BWAA 3BYTA 3OAUL 1BLNA 3RVVD 2VR9A 5IVOA 1XGPA 1J0ZA 3T4AA 4X6FB 1WWWX 3BPCB 1Z2KA 1NCWL 3VWKD 3SE8L 5MENB 2A6JA 4JZJC 5GIRB 2I26N 3NIGE 4Z7WA 4Y5XA 5F7LB 5B39B 2R8SH 4EDWH 2ZG3A 3T0WA 4L5FH 4HUVA 4NT6A 3GNML 5FV1L 3OX8A 5DT1L 3I9GH 4WFEE 1OTSD 2VLLB 5GGVH 4LQFH 1QSFE 5I75C 3LD8B 3BZEA 4XNYL 2E5EA 1V3JA 3CSYB 3FB7B 3U0TA 1YEIH 4MQ7A 3LRSA 4M7KL 1KFAH 3GSWB 4M03A 3VFRA 1IAMA 5CGMA 1OB1B 5T3ZD 3V4UL 2EDDA 5FK9B 2R1XA 3LSOB 1TNNA 4TUJA 3S5LB 4I0PC 3LMJL 5ERWA 1G9ML 2FGZA 3MRNB 2PW1B 3VFOB 3T77A 4ZUUA 4NQEE 4PS4H 2DQEH 2K9UA 3SBWA 1F00I 3SDDB 2E9JA 3MFFB 3T04D 3WBDA 5TE4H 1M6OB 2XICA 1BFVH 1QBLL 2DI9A 5C6WH 3MROA 3QEQE 4MA3B 2BSSB 1ZSDA 3WFDH 5A40E 1RURL 1S9YA 4PJHE 1QFOA 2WBJD 4DVRL 1OW0A 4QRUB 1ZT1A 5EU7C 2AK1L 2VERN 1KTDA 2UWEF 4AEIL 4LSPH 3L3DB 1IEBB 5K59E 1YZZA 3TBYB 1P2CB 4G80B 3TN0C 3OHXA 1IGYA 5FGBA 4AT6B 3OKEA 2LTQC 2YXFA 4GKSA 1KCSL 4EQ3A 3SE3A 2HVKB 4WFFD 5EORH 4JREB 4RGND 3VWKA 3REWB 3ZSSA 4AL8L 2ESVD 5I0DA 2HJKA 3EOAA 2OK0L 4JZNA 1XFPA 3N0PB 1I4FB 1U6AL 2QHRH 3ARED 5SV4A 1OM3L 4JKPL 2NW3B 2V5TA 4U1NB 3SKNB 4LLWB 4CADA 5GZNC 3P9MB 4JG1L 2Z8VC 1KCUH 1CGUA 4UT9L 3F58L 5D1XC 2NY3C 3WO4C 5F6HJ 4K3DL 4NSKB 4RGOL 2IH1A 4M61B 2YUXA 3OV6A 4NJAH 2YEZB 1KPVB 4PGEA 4UIKL 4N0UB 5MERA 3KS0H 4MJIE 1U8JB 1S7SA 4U31A 2AGJL 3AS0A 4LLYA 4J3XA 1BFVL 1RUPH 3BP6B 1EBAA 2R2BA 2CLRB 4G5ZH 1DL7L 1INDH 2FEDC 2Q7NA 4OCXH 1T80A 5BW7C 5E6IA 1FNSL 2DM7A 4RGMB 3NN8B 3PWPB 3UYRH 1NL0L 3H9SD 3RTQB 4J3SA 3N50A 4YR6B 2DJ4A 3NAAL 3RY5A 2QQLL 1SJHB 3MBXH 5DJYB 1P7QA 5FO8A 1BX2A 3CUPB 4ODWB 3LQZA 3V6OA 4PJFF 1ORQB 3MV8E 5L6YL 1ZS8A 1LP9B 3JWOL 5DYOA 1B4JL 1CK0L 1XAUA 1LP9F 4GG8A 4NQUA 3Q6GL 1F58L 5DJDB 1UJ3B 4ODHL 1OAKL 2EIEA 4JVPA 3GMMA 4LSTL 1IC7L 3RVXD 3ROOB 4N9OB 3QAZB 4WW2F 2ZCHL 3D1MC 5FYJE 3RIAF 2AJYL 4R3SB 2QLVB 1BQSA 4Y2DA 4HIXH 4LCYB 1J1OH 4JO3L 5IB5B 3K2UH 1MJJB 2DLGA 5C0AB 2F54E 3DTXB 3QB7C 5HY9B 4PJEA 2DLTA 2C3WA 1AIFA 1LD9A 2FJFA 2GFBB 2NCMA 4PJ7E 5CSBA 5DVNA 3GGWB 3ULUC 2DB8A 1KCUL 3AAZB 3X13A 3C2AL 3U0WH 1N3NB 2NY6C 3PWPE 2JB6A 4H5SB 4KQ4H 3MNZB 1D5IH 2R2EB 2J8UF 3QCUH 1F4YH 2BY3A 5IWLC 1XH3B 1JYNA 4ZD3L 5C0CB 1DLHB 3D25A 3MMEB 4QRPB 1AO7A 4G9FB 3BPNC 2LAGB 3O6KL 1YEHL 3QWRD 3KHOA 4JG0H 2C1PB 3U30B 2YKLH 2EE6A 4OFIA 3MNVB 1FL6A 3CZFB 5F21B 2F8XC 4OZGE 3LCYA 1BQHA 1AXTH 2EYTA 4K9EC 1KJ2B 4LHUA 3PWLA 3RY6A 4E5XB 3KLDA 4PRHB 3OQ3B 4KWUA 3VI3F 5HGAA 5DT1H 5GGTL 1CN4A 4OLUH 5T3ZH 1TJHL 4OAWB 3SGEH 5HHVH 3DX7A 5F44A 3WDHA 1LO2H 4J6RH 4ZOAA 1ZHBB 1OPGL 3TPUA 4IRSA 4B0MM 5GRVK 3DXAE 3GB7B 3OZ9H 1P7QD 1DANT 2VSCA 4HHAB 4DUVA 4I3RL 3V7AG 1JPGB 1UT9A 3LS5L 1YEGH 1JFQL 4MJ5B 4JPIA 4PJCE 5K9JH 2O5XL 3NH7H 4S2SA 5HGDB 1UYWH 2I60H 3B3IA 4H0GA 3MRQB 2OQJA 3B2UC 4WI5A 2OYPA 4Z18A 4PBWD 5ANMB 4D8PB 5FF6B 2WWMC 1H3WM 3IFNH 4POZC 4YHKH 3LKOA 3WUWG 5JHDB 1FSKB 1ZTXL 3CFBA 4KHXH 1CDCA 1AGFB 1CGSH 2CXGA 5K9KB 5HYSA 3U0WL 4OM1H 4GLRI 3TBWB 3B4NA 4QRPE 4YDKH 4QO1A 1JGDA 4LBEA 5HYJA 4DUWA 3KPNA 5ALCL 3QDJD 1KTKE 1U95A 4FQQA 3ILPA 2P7TB 4GW5B 3A6CL 5CINL 1F11A 1T89A 3DRTB 4FTVA 2J8HA 1CLCA 3EOYG 2YPLA 4M9OA 3TBVA 3OJDA 4O9HL 2IG2L 4H25A 5FYKE 3ZSTA 3RWHA 5C0EB 4CADB 1HYSC 3HZKB 3V52L 3BX7C 4NQCD 4M7ZB 3PHOA 3B83A 3G5VA 5F7MC 4D0BA 1EJOH 5MHSD 1YEJL 5EZIL 3IJHA 3O8XA 2X9XA 3D39A 1K8IA 3MRJA 3BD3A 2HT3C 1QRKA 1X44A 1T4KA 4QGTA 1SVZA 5EO1A 2HH0L 3JV6A 4GAJH 3QFDB 4NQDA 4LVOC 3FONB 3IKKA 5E03A 4I3GA 4MD0B 4POYA 4KK5C 4J4PA 5JLZA 3DUHA 3QIWB 1EDQA 1YC7A 3FFCE 1IZKA 1DTUA