2P24B

I-au/mbp125-135
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
216
structure length
194
Chain Sequence
RGYGGRASDYKSAHRHFVVQFQPFCYFTNGTQRIRYVTRYIYNREEYLRFDSDVGEYRAVTELGRPDAEYYNKQYLERTRAELDTVCRYNYEETEVPTSLRRLEQPNVVISLSNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRAQSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, A-U alpha chain
publication title A new twist in TCR diversity revealed by a forbidden alphabeta TCR.
pubmed doi rcsb
source organism Mus musculus
total genus 44
structure length 194
sequence length 216
ec nomenclature
pdb deposition date 2007-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p24B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2p24B01
1FL6A 1CR9L 2V5TA 3RGVA 3MYJA 4P46C 1JGDA 1HILB 2ZSWB 5FM5O 4LKXA 3QWOB 3MXWL 5D5MB 4QNPF 5CP3A 3VW3H 2Y4SA 3MRKB 3REWA 2FX8H 4CKVX 3B8YA 3LH2H 4IMKC 5CS7A 1OAUH 3VA6A 5LQBH 4PGEB 1NMCC 1IAOB 4QTHB 5DFVC 5EA0H 4F58L 1WC7B 3QSKB 3OR6A 4K2UL 1DL7L 2BCKA 5DMJB 1LO2L 1BZ7A 3PL6D 1MWAA 1G7JB 4JRXA 1EO8L 3HI1A 2CIIA 1HI6B 2O5XL 4UQ3B 4APQA 5CBAB 1NAMA 1J1XL 1UQSA 1SJXA 3QEUB 1VFOA 4OFVA 1I7TB 2DBLH 1EZVY 2UYLA 1MFCH 2A83B 2BSTB 3P73A 4KJYB 1EEYB 3QQ4B 1KFAH 5IMLB 5D2LF 3PWPD 5JNYB 3QH3A 5DJ2B 4S1RL 2IQAA 5CMAA 3MOBH 5IB2B 1BEYH 1ZA6B 1JHLL 4R8WH 5HD8D 3NIFE 4AK1A 3OHXA 2AGJL 5DTFA 4XVJL 5DZOA 1DBBL 2GK0A 2VOTA 3QUZD 4PP1D 3MLWH 5EU6B 5CLTA 1DEEB 3U4AA 5KSAA 3GSWA 1RHFA 3QXDB 5LXGH 3RWGB 2J7LA 4ZUTA 2YZ8A 4LSUH 5HVHC 1YQVH 4JHZA 5T1KD 2A1WL 3T0XA 1N4XL 2GITB 1CE1L 4U0RC 1UFUA 3GK8H 5EOCL 5DQDH 2FECL 3S35L 2F54D 3UTSB 2JJWA 4JO2L 2HFFB 4M7ZC 4N8VA 3REVA 4ZTOH 1BD2E 2MFNA 1UCBL 3WCYA 4UB0L 4G6AD 3BD4A 5EWIH 1KLFA 4Y4HB 2WBJD 3VGGA 3V79C 2ICWA 4DKEH 2XWJA 3H9SD 1HNGA 5JO5B 2RAMA 3LEXB 2QJDA 2YMXH 2BJMH 4L3EB 3WIFA 2F53B 1RZJH 1TXKA 3F7YA 3P9LA 5D1QB 1WWBX 3PWLA 2KZ1B 1RIHL 1RVFL 1CFNB 1F4WH 3BD5A 1JPFA 5IMKA 5BO1L 2X6MA 1J1PH 3HB3C 2VC2H 4P3CH 3LPGA 3WL9B 5DC9B 3RA7L 3FHAA 3L5JA 3MRRB 4A6YB 4JPKH 4YR6B 2BNUA 4PRIE 3VXRB 3FOLB 1EJOH 1WWAX 5D7IB 1FNGA 2EIBA 3ZKNC 5IVXA 5F7NC 3L3HB 1TENA 3HUJE 3MLXL 3TV3H 5L8LB 4X83A 4WHYG 3QDMB 3AFLA 3QUXD 4JPIB 4CADA 5A43C 2YSSA 1YQ2A 1TJHL 5DEGB 4I2XE 5C07D 1MHEB 4HKBB 1JWSA 2HVKB 1S5HB 4MA8L 4P2YA 2R2BA 4IRZH 5JXED 1K5NA 1P7KA 5T3XE 4TOYH 3ZYZA 4BZ1H 1SEBA 2B4CC 5DQ9B 4X6EB 4Y19B 2EDLA 1XF5B 1EXUB 4YDLC 1BBJA 4HGWA 4UNUA 1K8IA 2ZPKH 4HS3B 1LO3L 4LEXH 5I18L 4TUOA 3SPVA 3VFRA 4Z7WB 3BSZH 3DIFA 3QPXH 2FDBP 4C4KT 4JVWA 2DB8A 4YBLB 4ELMA 2ZUVA 3I50H 4XCNA 2D4DA 3G04A 4CMHB 1FL3A 1JGUL 2HG5B 1FGVH 2FGWH 4EUPG 4R97C 4U0QB 2ITDA 1IC4L 1SJHA 5FEBA 3MLUL 4U6XA 2D0FA 4XPHH 4G6ML 1LE9B 3IDYB 2UY7A 2DWDA 4LSDA 2OYPA 5EOCJ 1N0LA 4D3CL 4WV1B 4R4BA 1JGVH 2PR4H 4P23A 3ALWA 4PYHA 5IBTH 3WIIL 2CMRL 1PG7L 5ICZA 1LEGA 4L3CA 4M1CC 5LG1A 1KIUA 4U7SA 3W82A 1M71A 4Z7UA 1NC2B 5C0GB 4U1HA 4LIQE 1ZLWH 4FQCL 1A3RL 1NUDA 3G9VA 3ULVH 2OP4L 1S7XB 4HEPG 4LCWA 3O3DA 5IWLC 3GBMH 5MEOB 4OCYH 1E4XH 5CP3H 5CZVH 3K1KC 3O2DA 4FTVB 1NBVH 1TJGH 2ZUWA 2FEDD 4LMQI 4POZD 3QEGH 4JG0H 1G9ML 1LDSA 2BC4B 4WI7A 3RVVC 2DQTL 1YPZE 5DVLA 5BS0E 1T5XA 1A0QH 3HMWL 1CDCA 3E3QC 1NLBL 3I84A 5FM5M 1PDKA 2Y23A 3X14A 5FYLE 2VLJE 1MFEL 4N9OB 3H3PL 3K8MA 2OXHA 3V6FB 4CVXB 5L7XH 1R3LA 3U7YH 3ZTJG 5I2IA 1NAMH 4I5BA 3CU1A 4ONFH 3I75B 4OV6F 4U6TA 3WS3B 2WMPA 3JTTA 4OCWL 1XIWD 4NM8H 1BD2A 2VH5H 3L3JA 5F6HI 4RCAA 3O3EA 3KJ4C 4N0UB 4NKIL 1FZOB 1JWMB 2DMKA 2CO6B 3KLAB 4GLRI 1H15B 2WSKA 3QYCA 5SWSD 5AWNL 4FHBD 4UTBL 4LEOA 2DD8L 1NCTA 2FEEL 3VWJA 4JPWH 5HYSB 1A64A 1F4YL 1A6TB 1UJ3B 2NXYD 4LBEB 2FO1A 4R2GC 2NYYC 4BH7A 1T7ZA 2H26B 3EO1A 2HJKA 2J6EL 5HI5D 4PRHD 4FQJH 4YX2L 4XP1L 4AEIH 4GAFB 1HZHH 5E4EB 1P7QD 1WQVT 4JO1L 3NAAH 2G75A 5D7KD 1K3ZA 2GSIA 2XPGB 4WU5B 3R8QA 1S7RB 1NGWA 5FHBH 2FO4B 1T4KB 1MJUL 4YHML 1CE6B 1AGEB 4LCYB 5E5RB 5JHDB 1IGTA 1CDUA 4PJGE 5GS0L 4BUGA 5KOMC 3MBED 5C08B 5FYJH 4JO3H 4JB9L 1VGKA 4JHAL 4D0DB 1TMCB 3SGKA 2MQ0A 2D03H 4UU9A 3IXAA 5AZEL 4K55A 3CFJB 4C4KO 4OIBA 3QIWD 1I9IH 5J57B 4MA1B 1CGSH 4LSSH 5B21A 1WVZA 1LK2A 3HRZB 3MR9B 5F3BB 3OTTA 3DTXB 3FB8A 1EBPA 4A2LA 2QQLH 4JKWA 4CN6A 2H8PB 1JZ5A 4J4PA 5IJKC 4L9LA 1PZ5B 3MJ7A 1YNKH 4U05A 3V0WH 4YFEA 1MCOL 3KR3L 4O51B 4M6AA 2ZP0T 3PDOB 4XRCA 1F6LL 2YBRA 1HEZA 4F15B 1QPPA 9CGTA 1FVCB 1YEJL 4PYGA 5GS1B 2P44B 3DLQR 1AIFA 5I1AB 3DVIA 1WV7T 4PJBE 4WW2C 5ESAA 4AIZB 3TVMA 1NMAH 4PUBH 1YNLH 1BOGB 1TTFA 1UB5B 2X70A 1IBGH 2AJVH 3B6SA 1HYRC 2V6HA 5B38A 4D0CB 4PLOB 3NZHL 4Z7OE 3MV9A 1AY1L 1FVEA 1H5BB 1TLKA 5DRXA 3LRSA 3ZDYF 3QXAA 5CLWA 5CSZB 4YGAB 4K3DL 1KGCD 2VWEE 4KKBD 4OCXL 5HGGS 1W0WB 3STLA 4Z95L 1KJ3H 3T1FB 1R5VB 4FQLL 4PGBB 1TTUA 4LSTL 2EIZA 1FFQA 1FLRL 4OIIL 1HSBA 1HXMA 2P47B 4FZ8L 5E6IA 3WLBA 5F71A 4NQDB 4L4TE 4PREA 1WFOA 2AS5M 1KJVA 2E3VA 4XX1G 4ZTPH 5CD5D 5JOFB 2EDNA 2YD8A 1HHKA 5C6TL 3OF6D 5H37G 5JIHA 2D4FA 3WHXB 1QQDA 2QKIA 2DQGH 1UB6A 1N26A 2IGFH 4LQFH 3IVKA 2G9HB 5DMGC 5HBBA 1EAPA 4OQ1A 1D9KA 2A0LC 4NQEA 1DLHB 1LP9B 1QACA 2H45A 3HPLA 4Y5XC 5E9DB 5F9OH 5DMIH 2AK4D 5D1XD 4U1KA 1M7IA 4EIZC 2F15A 1BWWA 3ARBB 1Y6KR 2V7HB 1JMZA 1N3NB 3PWUB 2A6KA 3HRPA 4MNHA 4DGVL 4UQ2B 1RZJC 4G6KL 4RGNB 5HHOE 2IPTH 2LAAA 3MODH 4YDKL 2KUTA 3O2DH 1ZVSB 5I71B 1MRDH 2WUCL 4P4KC 4QRRE 1AXSA 5J1AA 2V2XA 3C9NA 4K9EL 3WIHA 1ZWIB 2DTSA 4X80H 3KNBA 2D7QA 1JRHL 4NRZA 2QBWA 4QOKE 3NIGE 1P7HL 3V4UL 4YH6A 2IANE 2DQCL 3NN8B 4JRYE 3DUSB 3JWDH 3A67H 1T83C 1XGPA 4WFHD 4WCYL 1G7IA 1UXSB 4R96A 1MH5B 4JAMB 4EDXB 3QXTA 5DUBA 3SJVB 3MNWA 3MRDB 3LZFL 4WO4C 3D2UA 3VXQB 3L5WB 1MHPL 1CFQA 3BGFB 5DT1L 4JREC 3NA4A 2C5DC 1DBAH 5IB4B 3O6LL 5CP7B 1MQKL 4G43B 5I8KL 3WEXB 5BVJA 4HLZG 2MPAL 2DQIL 5F1OB 5EO1B 1MAJA 1IGCL 5DFWH 1AO7A 1ZS8A 2VDKL 3PP4L 3WNNA 2CGRH 4KXZI 4I0PA 1QFWL 4GQPH 4NNPL 4XNQA 4XHJD 5GJTH 2YS4A 5DK0B 4OCRH 5CD3A 1D6VL 2I07B 3SKOA 2DI8A 4YHIB 3WFBL 4LF3A 3GIVB 5FUZH 1LO5B 3O3AA 3HMXA 4P46D 4YHLL 1XR9B 2R1XA 3VD7A 1OY3B 4N0YH 4WJ5B 1QOKA 3SO3C 4CW1B 5MENE 2E7LA 2Q3AA 2ZJSH 2VZSA 4NKDB 4DKDC 4U2ZA 1DQDH 2OZ4H 5L6YH 1ZEAH 1FDLH 5GJSL 3P9WB 1KB9J 5DUMH 4EXKA 2P5WD 5DFVD 1IQWH 1LVEA 1R3JB 4R26H 4HK3J 3VGFA 4UUJA 1F4AA 1HDMA 3RGVC 1N64L 3VXUB 1I1AB 2X1WL 3ULVC 4HXAH 5I8OL 4UNTA 1Z9LA 2NMSA 2R2HB 2GJZB 1T0NA 1ZLWK 3ZO0A 2BDNL 1AKJA 5T3XH 4WIQA 3TNMA 1NMCB 3MRGB 4NT6B 2AJSL 3GSNL 1A6VL 1F3RB 2Y72A 5TQ2H 5IK3B 1V05A 4ETQB 3KYOB 3TFKD 3BYTA 5EOQL 3UJIH 2DQHL 2G2RA 3P9MB 2IALB 4M62H 4J3XA 4XVTL 5DVKA 1F3DJ 1FSKB 4APQC 4JFFB 3THML 4G5ZH 4JQXC 1CICB 1MPAL 3ILQD 3MJ8B 4TTGA 4XXCA 1U8JA 5GRJH 3IDGA 3P30L 3V0VA 1I1FA 4F7CA 1DTUA 2GT9B 3HE6D 2FL5A 3TBSB 5EO9B 3OG4B 4OBSA 1UWXK 2GTWB 1G9NH 3HA0A 3V52L 2Z91B 4I13B 1DQQA 1UXWB 3ZE2F 4GRWF 4QEGA 2VISA 5SX4I 1P84J 2E7HA 5MEQA 1F8TH 5GGSB 1CGWA 4BJLA 3PV6A 4LVNB 3S36X 1JPGB 3QFJD 2A9MH 3HAEG 3FO1B 4WI2A 4TQEH 3MZGB 2HKFL 1OAXL 5C0FA 3O4OC 4OD2A 2F58L 3QXWA 5HHOA 4HUVA 5JUEL 1IKFL 5KSAC 2J8UA 1U8LB 4JFPB 2FHFA 3AY4A 2NZIA 4JVPA 5HVHB 3N1FC 1ZOXA 1MCSA 4JHWL 3CSPA 4X5XA 3M8OH 5KVMC 1KBGL 1GZQB 3QG7H 1KCVL 4LOUD 2Z92A 3RNQB 1JZ8A 2BSED 2A38A 3B9KC 1YDPA 1GGBL 2OMNA 3JVGA 2XWTB 3G6JE 1CG9B 1NC4A 3B3IB 2CLVA 4OZGF 3QPQC 2HLFC 1HQ4A 1I3RA 2FX8L 3HI6H 3MRCA 1BQHG 3OR7A 1QHOA 2YR3A 4OCLC 1MRCH 3W39A 1FFPB 4O00A 4Z7NE 3JUYA 1IVLA 1J10A 3UYOD 1U41A 5C0RL 1JZ2A 1BQLH 2O5ZL 2Z31A 4JN2B 4YHNB 5EBMB 3FO2B 4KKCC 1RFDL 4K3GA 3MA7B 3EFFA 4BSWB 2F5AL 2YD5A 2OI9C 1FV1B 4JFEB 2FYYB 3BPLB 1R5WA 3R06A 2AQ2A 2ADGB 3MLTB 1T22A 1CZ8L 5BRZE 3BVNB 3L3OA 4JG1H 1IM9B 3RZCD 4L29A 2BVPB 3HE7D 4TUJA 2Y07H 5BOZG 5JXAL 3KXFB 3EKCA 5FCUL 3AREA 1WAAF 2YN5A 4KPHH 4G7VH 3MLZH 4X7CC 1QO3B 4I3SL 3RU8H 4NZRH 5L8JB 2EDQA 3C87A 5JORB 2CDEB 4OJFH 5DC0A 2Z8RA 2DLEA 3QIUB 3GHBH 1T1YA 5ESVB 5J06A 5EG6C 1MAKA 3ESUF 3O6KL 4XTRC 4NDMA 3GUTB 4NYLA 4JY4B 2R23A 4FG6D 4GRMA 3LEYL 3B8SA 1LEKA 1KTLA 1NFKA 4PTUB 2CDFB 4S10A 5DJYB 3DROB 4NKOA 5AUMB 4J6RH 1U92B 3ZT5A 5BJTB 3W9DB 1WWCA 5I15H 4XNZC 4MA7L 5D6CA 1WIUA 3D0VA 1ES0B 3FN0H 3DV4B 3VD4A 3SOBH 3TT3H 1N2RB 4M1CD 4P9MH 1NDMB 1TZIB 3LN5B 4FQ1H 4GXVL 1S9YA 5KVEH 3HMXH 3LKQA 4LASH 3SKNA 1QSFB 5T1MB 1FCGA 1WBZB 3PWNA 4QXGH 4IOIA 1YEHH 4JY5H 1J05B 1B0WA 5ADPH 2RCSL 5F7EL 5IG7B 3HLAA 3OJMB 4P23C 4YPJA 1I4FB 2ID5A 5D7LE 5J89A 1FH5H 4G3YL 4QRUB 2BJML 1JYVA 3BQUD 4PGDB 5INCA 2H1PH 5GISH 2L7UA 4PJEE 1MHCA 4YQXL 4QKXB 1K4DA 1NMBH 4MXQD 4DKFL 3H42H 4AH2B 4GG6E 3RJDA 5HHVH 1P4LA 3L3DA 2VLRA 3IDIB 1A1NA 3QIBD 3SDYL 3N50A 2YZ1A 1CTNA 4F33A 2VXQH 4OUOA 3FQRA 3MZTA 2Q7YA 4KROC 4O2CB 4ZUVB 4RGMB 5EU7E 1FORH 3GNML 4P57B 1VFUA 5B4MD 1G0DA 4P4RB 3GSNB 5F7MC 1KN2H 1FRGH 3S9DB 2BK8A 5I1IH 5HHPB 1AGFB 1M05A 2YPVH 1P1ZB 2JJVA 4M6ML 4K71C 3JWDC 2JIXB 2P7TA 4WUUD 2QSTA 4H1LG 5DGRA 3OL2A 4MMZC 3CH1B 4Q6IC 5D2NB 1MCHA 1OLLA 4MNQA 3V0AC 5B3JE 5CINH 5I9QC 4XCYA 3KJ4B 3PJSA 5L8KB 1KJ2A 3VXME 3MLPA 2FB4H 5DSCB 3JV6B 3LKPB 4S0TD 5D93B 5AYUH 4N8CL 4QRPD 5B22A 5MHSE 3BPOC 2C4FU 4R2GB 5MERA 3RX7A 3TBWA 3QCVH 5CCKL 4J3WA 4JGJA 2ZCLH 1KXVC 4V1DD 2GSGA 3L7EB 1T1WA 1QZ1A 1UWEL 5DJDB 5LGHL 4OCMC 1RU9L 1QEWA 2XXCB 4HH8A 4ZXBD 3QI9A 3MV01 4Z5RA 1KPVA 3DRTB 4LU5L 4ZG1A 4FQXB 4Y4FD 1NFDF 3BN3B 4LCIH 1DUZB 2MQ3A 4JZOA 5I6XB 2ZSVA 3SGKC 4MDJA 4J3OC 1TZHB 5DQJA 3F58L 1AP2B 1PBYA 3VFOA 3Q0HA 1LDPH 5F7WC 1E4XL 5HYJB 1KIPB 4F7EA 4MHHI 2A6IA 1MHHA 2JLLA 2QTEA 2AV7B 2A6DA 2NTFA 3M45A 1CFBA 2AP2A 2WUBH 4GBXA 3FB6A 4J4PC 1OP3H 4Y16A 2AJ3A 4QRSB 2NX5D 5ENWB 4IOFC 4W81A 1MWAL 3Q3GA 4OB5H 2APFA 4E0RB 5JW4Q 1A3LH 3UAJC 3KHQA 3TZVD 2QHRL 5D7JC 2IH3A 3PWVB 4LLUA 1MCLA 2AJZB 1DN0A 3BW9B 1N0XL 4CVUA 3QDJE 3V4VH 1ED3B 15C8H 3E6FB 2EDYA 4ZFGL 1KTRL 2YD7A 2PW1A 1T2QL 4OF8A 3ZL4H 5GGRY 5FB8B 5JDJA 3TVMC 1DQJB 3AM8A 5EZJA 5I73B 4U1MB 4IRJA 1X5YA 5DJ6B 3ZLQC 4XGZB 3BJLA 1G9NC 5IW6B 4Y5VB 4MAUH 4Y2DD 4GKSB 3PGFH 5IHZB 2XXMB 3S35X 4PFEA 4JR9H 3ZHLA 1GHFH 3U0WL 1TDQA 2HMIC 4ODVH 3RGHA 3ORJA 3RVUD 3PQYD 4AEIL 1HZHL 1UH3A 1OF2B 4QXUH 1JZ3A 3D3VD 3LMJL 5GZOD 4OSUH 5L2KA 4GG6A 4M7LL 2NTSP 4P5MA 1JFQL 3ZT6A 3VI4E 5K9QI 1X3DA 5E6IC 5E8NA 2A0LD 5CZKA 5FYJL 3QEHB 1B88A 4IRSA 4YZFF 1UZ6E 1IGJA 5JQ6H 4OGAD 1H0DB 1JPTL 4NUJA 5CZXC 4FZEH 5FIEA 2H41A 2BFVH 3QWRA 4PJXF 5IFHH 1JTOA 1DQMH 3ZYIA 2EZ0D 1CGSL 5CJ5A 3VE0A 2IQ9H 3VMOA 1X5XA 2MJWA 4LLMB 1CD0A 5C0CE 1D9KC 4WW1B 4Y5XB 1XEDA 4RMWA 4YHOH 1IC5L 1CGXA 1PKQB 1FP5A 1MLBB 3AXLB 1ERNA 1NCWH 2MMXA 3FO0L 1G7LA 4P9HL 4XNUH 3GHEL 4BH8A 5HGBA 5E99L 4PJIE 1OGAD 1XH3B 5CUSL 5IR1A 3FT4B 1FIEA 1ZT4B 2X4NA 1YEKH 32C2B 2FJGA 3V6OE 5BVPL 5KTEH 3KPSB 3N9GL 1L6XA 4P4KB 5INDB 3E6HA 3QJFA 4NO3A 4ZMAT 4O58L 4XWGL 4P2RD 1W72H 4PR5B 4NN5C 3VXSE 5KVFH 1P69B 1B0GA 2I60L 2FATL 1CK0H 1U8HA 3GSUA 1CDGA 4Y88A 2ARJB 2Z93B 4P2QA 1BF8A 2VXVL 4MAYD 1X7QB 3LDBC 5FV1L 1MUJA 4X9IA 4MQSB 4YUEH 4C83A 2XZCL 1T21B 3ULUE 2FNBA 4IHOB 3SKJL 1FAKT 1S7QB 2O61B 4TPRL 5EUOE 2VZTA 2RFXB 4MJ5A 3QUYB 3EJZC 1I3GL 4IDLA 3N85H 1E27A 1VB9A 2QR0A 2YEZA 2ORBL 2I25N 2LVEA 1KEGH 1IAII 2P8PA 5I8EA 4I0PC 1AE6L 2NLJA 3CFKB 2GFBA 2JELL 3O3BB 3QXUA 4RIRB 5C0NC 5LBSH 4QGTA 5TFSL 1KT2A 2VDPH 1QLRA 4EDWL 4HUUB 3FFDA 4YXKL 1F45A 3RWIA 1BGXH 3NFPA 3B43A 3D18B 3SO3B 3ZDXE 2E7LC 3EYQD 1GGIL 5JW4N 3DVGB 2GHWB 4M00A 5C09E 5C0AA 4XAWH 4KMLB 25C8L 2YPLB 1BIHA 2DIAA 2FJFA 3NCMA 5I17A 3W0WB 3KPPA 3NOIA 3DHJA 3T4YA 1FL6B 5IBUB 3T8XA 3RGVB 3K81A 5SV4A 3MYJB 1X5GA 1K4CA 4U1SA 4PGCA 3P11L 4RGOL 1JGDB 4KK5C 1YC8A 3ZDZE 3LKOB 1JVKA 1EIBA 1HOCA 4IJ3B 4LKXB 5HHME 5B8CA 1PG7W 1REIA 1XT5A 3N1QC 2VWEC 1V3KA 1PAMA 3REWB 3K4DA 2FLBT 5HSFA 2GJ6A 2VXTH 3ROLA 4M1GH 2Q76A 1TZGL 3OKMB 2BCKB 4OZGB 3WD5H 4OZIF 1BZ7B 4PRAA 1PYWB 1MWAB 2CRZA 2P49B 1EGJA 3HI1B 1IGML 4HXBL 2CIIB 3HG1A 3CFDA 5F7HA 2NY1C 3EHBD 1Z3GH 3MLSL 5J11C 4AEFA 3MRFA 1K9TA 4K94H 3SBWA 1DE4A 5CBEA 4XXCC 3IDNA 4ONGL 2HH0L 1MY5A 2FGZA 5DO2C 2UYLB 4CRPA 1DBAL 3MV8E 3P73B 4MCZA 3O0RH 4O4YH 1YMME 4JZNA 2HT3D 3QH3B 3MA9H 2IQAB 2OJZL 5CMAB 3U7WH 4U6HB 4NQCA 4OCRL 5DTFB 3B9KD 1OGTB 3HZYA 3QUZB 3G5ZA 2GK0B 4M7KH 3WV0A 4WWKD 3FT2A 2VDML 3O4OB 3VXTA 1MLCA 4WFED 3L5XH 4PD4K 3HNTL 1EUTA 5ISZE 3GSWB 1CIUA 2DYPA 3WJJA 3O4LD 3AY4C 4HKXA 4ZUTB 1PVHA 1DUYA 4NM4H 4QRQA 4Q9QL 4U1NA 5ID1B 3MLYL 3DMMC 4QXWA 3TO4C 5FYKD 2X4SA 4HPYH 3T2NH 4ZSOE 2EE9A 4LLWA 3JVGC 2R8SH 3S5LA 1KULA 3E1F1 4N8VB 3SDCA 1KC5L 1FO0A 2YK1H 5FOJA 4XVUC 1MCQA 3WJLA 2VABA 1X9QA 4NNXA 1HWGB 2ICWB 1EMTL 3MRMA 5DJAA 2XWJB 1K8DA 2NY0C 2W59A 4NFDA 5K59E 2X41A 3QNYA 3UX9B 4XC3H 2Z31C 3WIFB 1HQRB 2AI0L 3OX8A 2H9GA 5E08L 2B1AH 3F7YB 5HJ3A 3P9LB 2OI9B 3VG0H 1OP3K 5FHAL 3PWLB 3NACL 2DJSA 1DEDA 1JPFB 3UPAA 5FCSH 4R4ND 1MCFA 5KW9L 2MCPL 5EORH 4RMVA 3X17A 2X05A 6FABL 3KPRD 4GMSH 4OV5B 3UO1H 2ARWA 3WFDL 1YYML 2R0KH 2ZZUT 2IAMD 4ZODA 4RA0C 2ZG3A 3QO0A 4FRWA 5IVXB 1QR4A 3GSVB 2IPKA 3OZ9L 2QQNH 5C09A 1FLTX 3Q5OA 3LQMA 4E5XB 5EOTA 2J4WL 3QUXB 3I3EA 1OTTC 2ICEB 2X4UA 5KSVA 2YSSB 4HDIA 1AC6A 1FZKA 1JWSB 3RHWK 4H20L 2R2BB 3Q2CA 4ELKA 4PJ7E 4QF1A 1P7KB 1I9JL 2DS4A 4QWWC 1SEBB 1WGOA 3GSXA 3MUJA 1NGXA 4YDJA 5BMFH 4XP4H 1TVDA 1K8IB 5EU3A 3SDXF 2YD3A 4GW5B 3ARWA 3CVIH 3VFRB 3SPVB 4P23D 3DIFB 4I48A 2ZKHH 3WSQH 5FDYA 4ELMB 4LSRH 4XCNB 2Y06H 3G04B 1FL3B 5CGMA 4HQQH 1S9WA 3VWKD 2VSDA 1ZMYA 2ITDB 4X7SL 4U6XB 3I6LE 3ARRA 4HFUH 3HI6L 4GS7C 5C7XL 3X13A 2DWDB 4XH2A 1S7TA 4R4BB 3WDHA 3VMPA 1MRCL 1JN6A 4ALAL 4IIQA 4J3SA 1LEGB 4FQQB 4U31A 3GGWA 4L3CB 4X4MA 5IHUH 3R0MA 5F9DC 4OFIA 2BMKA 1H3GA 1VFMA 3QQ9C 4Z7UB 1RZ7L 1H3VA 4U1HB 4X4XB 1IC7H 3G5VA 4JFZH 4LCWB 1SEQH 3O3DB 4MWFA 4NO5A 1JPSH 2ZUYA 1QFWM 3HC3H 5KVGL 3TIEA 4Z8FH 3MCLH 3WIHL 2HA1A 4H8WL 4TNWK 4XMLH 1A6ZB 4PJ8A 4KROB 3ZE1E 3RUGA 5ISZA 5B39A 1T5XB 4FFVC 2FECI 4LPTA 1S5IH 4N68A 3KLHC 5SWZA 3X14B 1EA9C 4OF0A 1UH4A 1JMXA 1PEWA 2CD0A 3BEWA 5E8EA 3D0LA 1EGJH 2XQBL 5GRYA 4AG4H 5JMOC 4Y1AA 4FXKA 1R3LB 3BXNA 1OB1A 3X3FH 5I2IB 1OM3H 4I5BB 3RX5A 2Z8WC 1MI5A 3BN9C 1QNZL 5GRWA 5IB3A 2D7MA 1XMWA 1JF5A 1Z9SA 3L3JB 4YE4H 3O3EB 4CL7A 1SMOA 3INUH 2A74A 3VI3E 3RWHA 4N5UA 4YXLH 4OKVA 4LEOB 1H3PH 4OTXL 4WHTA 3VWJB 3FFCA 3MRPA 4PRID 5T5NF 3I02B 3QZWA 5ANMA 2GK2A 1J0ZA 4MD4A 5BOPA 4BH7B 3P0YL 4HS8H 3EO1B 1B90A 2OL3H 4XP9H 4M7LT 4O5LH 4G8FB 3VRIA 2G75B 5AG9A 3H9HB 5FDWA 5FYJU 5GRVK 3EOTH 1NGWB 1QTYT 1CF8H 5T5NG 4JFHE 3ARZA 3FMGL 1J8HE 4MSWA 1LO0H 3QI9C 2SEBB 2YD4A 1P9MA 2QQKH 2E5EA 4WTZA 4NSKA 1VGKB 4J4PD 1OPGH 1ZVYA 4UU9B 3IXAB 3L6FB 1A6PA 3RRQA 1H3WM 2UZYB 5HHVL 1AI1H 1LK2B 2W1NA 4ZFZA 3PP3H 1MFAL 1HXYA 5D7JD 3MGAA 4MQTB 3P4MA 4JDVA 1FFRA 35C8H 4PJ7A 1IFHL 4GBXC 4L9LB 1N5AA 4N0FA 4UV4H 3TVMD 4DW2L 2ED9A 2VZ1A 4YBQC 1CU4L 3KPOA 1CD1B 4WHCA 4XRCB 2YBRB 1EEQA 2W07A 3O6FD 1CXHA 2BRQA 5DFTA 1NGZA 3OXRB 2ADFL 3BGMB 4L4VA 2HMID 4FQHB 2XZQL 5D72L 1AIFB 4UIMA 3T0DA 1MY7A 2PYED 5D5ME 4OZHF 4K94C 5CINL 3T1WA 5ESAB 4OGXL 3NTCH 4KY1L 1BX2A 1FGNL 3O8XA 3OPZH 3HN3A 4XXDA 3AM8C 3JV0A 2DM7A 2X70B 3B6SB 4IRJC 4OZ4A 3PHOA 1B4RA 5E5MA 5B38B 4LARH 5D7SH 4J12A 1U8KA 2R0ZL 4D2NA 1UWGH 1T7XA 3MV9B 1FVEB 5BS0D 3LRSB 3QXAB 1C16A 3QCVL 1AJ7L 4NCC1 4ODSH 5FYLD 3STLB 2ZCLL 4TSBH 4MJ4A 1BAFH 2VLJD 4MX7A 3MUGB 2WIIA 5DWUL 1A47A 1V3MA 1WFUA 1N5YL 3AS1A 2EIZB 4XB7A 1I9RL 1RIUH 5DMYA 1HSBB 1HXMB 3WLBB 5E6IB 1DVFB 1D9KD 5DDHA 1J86A 4IRSC 1KJVB 4GW1B 2D7TL 5ALCH 4X9BA 5EU7C 2FBJH 5ACZA 1ACZA 1AR1D 1HHKB 2KL6A 2ZNWA 1U93A 2EH8H 3OAUL 4XMPL 4AY0A 1QQDB 3EFDH 2QKIB 4X7EC 4OLXH 1T2JA 2YXFA 3IVKB 3WUWA 1IMHC 5EU6E 4P3DB 1EAPB 2VXSH 1GXEA 4MLSA 2Z9TA 3D39A 4NQEB 1P4IH 3HPLB 4OLYL 5D1XB 4TULL 4U1KB 5EC1B 1M7IB 5T3ZL 1DQTA 1C5BL 3BUYA 1EO7A 1Q0YH 4ENED 3F8UB 1WT5A 1CD8A 3BDXA 1KACB 2XKSA 2A6KB 4KGJA 4MNHB 3UTSE 3RPIA 3SKUD 1RZFL 2YD9A 2ZUUA 1MIMH 4G8GA 3QUKB 3TT1L 1DDHA 1PQZA 3KDMA 5L9DL 5J1AB 1AXSB 1RUMH 2V2XB 4K7PL 1KELH 3F6LA 4ZO9A 3KNBB 4NRZB 1WISA 3FAWA 2I9TA 5CHNA 4NN5B 4J3UA 3M17A 3ZKSD 4MAUL 1TITA 4L3EE 3T08A 3G6DH 2V2TA 1XGPB 2F53E 3EAKA 1G7IB 2JCCF 3N06B 5F97E 4R96B 1FYTD 5DUBB 1NANI 1QLFA 1HIML 3V5HA 2BVOA 3D2UB 1Z9OA 4NPYA 4OSUL 1CFQB 3O45A 5J7CC 4GAGH 2DLFH 3BDYH 4KUCD 3MMEA 2PTTA 3VXRE 5DJ0A 4K23L 5BVJB 5D7IE 1LHZA 5I19H 1GOFA 3RL1A 1SYVA 3RWJA 1AO7B 3UBXA 3O2VL 1BM3H 2FD6H 4I0PB 4RBPH 4GXUM 4XNQB 3FKUS 3QDME 1WCBA 1QA9A 5CD3B 2CXGA 4G42B 3IJSB 1UVQA 2UWEF 3SKOB 5SX5H 1JGLL 1YY8B 1LNUB 1QUNA 5IGXH 3W11D 1RAMA 2R1XB 4FXGA 2VYRE 3BPCA 3QWOA 2QL1A 4Y19E 1ADQA 1KCLA 2D9QB 1FC1A 2D7OA 4Z7WE 1S78C 1IAOA 5I1GH 1DBMH 1WC7A 4MZ2A 4UUJB 2HFEB 1HDMB 3FCTA 3ARYA 1YEKL 4WFGE 5HVGB 3QHFL 4L4TD 4X6CA 3VH8G 4N9GB 1BWMA 4RRPG 3RDTD 1H3UA 5KTEL 3A6CL 2H2PD 4ORGA 3CFBA 1DQLH 1FNSH 4KHXH 1HI6A 3TGXA 1KN4H 1T0NB 4HULB 5GGVH 4KV5E 1Z0NA 4N1CA 1AKJB 3TNMB 1RK0A 2FSEA 4NHCL 5DO2D 3RWFA 2IMNA 3A0OA 4PJFF 5LCVL 2DQFA 2VITA 2A83A 5JLZA 2OTUB 1CK0L 2G2RB 3MRNB 2K3TA 5J11B 1RZKH 1ACYH 1CGUA 4B41A 3SBWC 2HT2D 4DGIH 2PO6A 4FTVE 3IDGB 3V0VB 2VZOA 1KJ2L 2NNAA 1PGRB 4KFZC 4U7KA 2FL5B 1D5IL 5KSBF 3ARDA 4WUKH 3IU4H 3IAGC 3TBVA 4J1UB 4XPFL 5IM7A 1OSPH 4JQIL 4S2SB 4QRRD 3RWGA 5JHLH 1DR9A 2VISB 3VGAC 1SJEB 4BM7A 2HP4A 5F88A 5MEQB 3DMMD 3TO4D 5GRVL 3PV6B 4PGJA 4QOKD 3EZ8A 1J18A 2IAND 1RJZB 1VADA 5C0FB 4OD2B 3KJ6L 4HUVB 4JRYD 1HINL 3V6OC 3KS0H 2J8UB 2VDOH 4N0UE 1RK1B 3QDGA 1ITBB 3WJJC 3UTTA 2MWCA 4X5XB 2K7QA 1OVZA 5JW3H 4F7TA 2RGSA 3H7BA 4M48H 2EO1A 1A7PH 1T7WA 4BSJA 4S1QH 4X6DA 1YDPB 4NN6C 3NBNA 5CIPH 4LCCB 3LEXA 3CH8A 1UM5L 4B0MM 1NC4B 4L3EA 2CLVB 2FR4A 5D1QA 5D70L 4X9GA 1SHMA 3WJLC 4UZGA 3LIZH 1I3RB 3MRCB 2NY0B 3OR7B 5JHDE 1Y6NR 1SBSH 2QQQA 4K3EH 5C08E 3HKFA 4Y89A 3EJJX 2VLME 1FAIH 2AEPL 5L88L 2Z31B 5D7IA 1LD9A 1A5FH 3GSQB 3SE9H 5MEND 3EFFB 2CRIA 3C6LA 5C3TA 1LK3L 3LQAH 2EDJA 3OWEA 1NFIA 3JSSA 5GGQL 1R5WB 4KRMB 4HGMA 4OZFH 4MCYB 5IIEA 1T22B 2AV1A 2XG5A 3QDMA 5HHXL 4LRNH 3TEUA 1YEEL 5LGJA 3L3OB 4KJPD 1IT9H 4HKBA 3O9WD 1CLZL 5AZ2L 1X5HA 4ODTL 3O0RL 3GRWA 4G8IA 3CZFA 3AREB 2X44D 4O4YL 3ROOA 1FIGL 5IHBA 1MJ8H 2EYTA 5DQ9A 4NJAL 5DUPL 1CLYL 4Y19A 5HI4D 1EXUA 3MA9L 4OQTL 1QFPA 4PJCA 4EIGB 3W5NA 3CXDL 2IWGA 4UINL 2DQDH 5EULV 2PYFA 2W91A 4HIIA 1T1YB 4KRPD 5E2WL 5I74B 3G5XA 2AXJA 1URLA 2DL2A 4NDMB 4J3VA 4NYLB 2R23B 4HF5H 5I1HL 1U8NA 4TUKL 4GRMB 4H26B 2ENSA 1LEKB 5E8OB 1KTLB 1F4HA 3DO7A 3LN4A 1X4XA 3S37L 4NKOB 1CYGA 3C8HA 5C9KA 5GQBA 1CVRA 5D6CB 4ERSL 3D0VB 4HPYL 5CILL 2HTKD 2IFGA 5FUOH 3T0EA 2VDNL 4NJ9H 4KKLC 1T6WA 1U8PB 1S9YB 1NC2A 3LKQB 2JK5A 3SKNB 1RIVL 1TNMA 2DTML 3JV5A 3PWNB 2GTZA 1MEXL 3S36H 3OGCB 4OUUB 1BLNA 4FTVA 1YYLH 2HFGL 1ADQH 2A77H 3MTRA 3HLAB 1J1OL 2BC4A 4NQDE 4IIQC 4LPCA 4JKPH 4XC3L 1A1MA 3K46A 5KVDH 1E4WH 1ODAA 3PGDA 4XBEH 3DOSA 3F7VA 1MHCB 3PDGA 3JXAA 4MNGB 1K4DB 1T7YA 4KQ3H 1MFNA 2IPUK 5ETUB 4YHZL 3DXAA 1P4LB 1SYSB 1F4XL 4HT1L 4M5YL 3L3DB 2VLRB 4CVXA 1A1NB 1C1EH 3WYRA 2BXZA 2H32A 2L4OA 3BN9D 4M43L 3N1MC 2NZ9C 3FQRB 1IAIH 4HAFA 3I75A 4U6VH 1WZ1H 4PJ8C 2Q7YB 2EEDA 2R0KL 1LP9E 4PJDA 5E9DE 1AH1A 1C5CH 2D31B 2F5BH 4KKAC 2AEIT 4N0UA 4LDEB 4ODBD 5CSGA 1GC1L 1CL7L 1H15A 1M05B 3DSFL 3S4SA 4KMTH 2R39A 4LHUA 5HYSA 3ZSTA 2P7TB 4WUUB 2UY6A 4LBEA 4OGYL 4RGNE 5F9JB 4EN3D 3SCMA 4MNQB 1TCRB 2B20A 4WI4A 4XCYB 1CQKA 3PJSB 1KJ2B 5IFJB 3UPRB 4FFYL 3A6BL 4QHLB 4OM1H 1NCCL 5BMFL 2XPGA 3FAXA 2A6JA 4IOSD 4LLYA 1NUGA 5BRZD 1INEH 3NIFF 1AGEA 1YJDL 4QRPB 2HKHL 1B2WH 3SO5A 3H7LA 1T80A 4CJ1A 2OR9L 2UZIH 4QNPE 3ARFA 2EYSB 5DZLA 1J87A 5ABDE 3TBWB 3D85D 4NZDA 4UAOC 1F3JA 3SJVE 2OCFD 3CD4A 3TA3A 4M6OL 1V7NH 3V95A 4V1DB 2F8VA 1C08A 1S3KH 2GSGB 5TQ0H 1OAQL 1T1WB 4G9FA 1RPQA 3BKML 4HIHA 1QEWB 5TE6H 3QDHA 3QI9B 2XTJC 1KPVB 5JIIA 1J5OH 1P9MC 1KCRH 5IHUL 3OV6A 4JZOB 1MFDH 5FM8A 6CGTA 4MDJB 4ZAKD 2BVUA 4YBQD 5DQJB 1Q0XL 3L95B 2VDQH 4WEMB 5C0EB 1IGIH 2EDWA 1QFUH 5ICYA 2FX7L 1IJ9A 3CFCH 1JPSL 5TF1H 1NBYB 4F7EB 2P8LA 1FVCA 1FNEA 3S3SA 4XNYH 4DUWA 4OM0H 1B4JH 1IE5A 2CH8A 2NTFB 3SDDD 1CGVA 2EE3A 1D7FA 4GBXB 5I1AA 3FB6B 5D6DA 1RJYA 4JO4L 4Y16B 4AIZA 2AJ3B 4U7MA 1GPOL 1ZANL 2G60H 4NBXB 1UB5A 3MOAH 5ESQB 3Q3GB 3S96A 3VFGL 5E2TH 4YFLI 4KK6D 2CJUH 4QCIA 4K8RD 3T2PA 4JM4L 3KYKL 4LLUB 3VXUE 5D7LD 1H5BA 1RY7B 1T04A 1DBJH 1NEZA 1RZKC 4NQXA 2PW1B 1W0WA 2GI7A 5BV7L 2D0GA 2YN3A 1HH6B 2B1HH 3O8XC 3T1FA 3LB6C 3HUJF 3O2WL 4IRJB 4PGBA 4YXLL 4E41D 1CBVH 2B2XL 3ALPA 4ZOBA 1Z2KA 2X4OA 2AERT 5KS9A 3RI5F 4C58B 3U4BL 5FF6A 5I1KL 3GMNA 4JFFE 4JM2A 3MO1A 5DLML 5L2KB 5KG9A 2APTA 2VLKA 3PV7A 4FQ2L 4KJQC 3T4AA 3RVTD 4P5MB 3CDCA 5E8NB 2AJXH 3CSYA 3WNLA 5FYKL 1IGJB 4ZUWA 1OPGL 1LP9A 5E9DA 5A40E 4NUJB 2KH2B 5ALBL 4HWNA 3VXMD 3B9VA 1FG9C 1U8OA 1DLFH 1GGTA 3DO3A 2V7HA 5IBLC 1CLCA 3KG5A 4H5SA 1FO0L 4NQTA 5DHVB 3VE0B 7FABL 1PD6A 1J0HA 5MHSD 4NO0D 3MV7A 3ARGA 3UDWA 3MXWH 2RR3A 4M5ZL 5EBWA 2EKJA 2WLYA 4MJIA 4TTDC 1XZ0A 3QR2A 3F7PC 4KJWD 3QXVA 2UWEB 1WT5C 4W70A 5HGBB 4BH8B 4F58H 1A22B 5IR1B 3VCLA 43C9B 2XN9A 4Y8AA 4K2UH 3D69A 2X4NB 1LO2H 3LQAC 4XB8A 3DUSA 3O11A 2FJGB 5FXCH 2AKRA 1KENL 4GOSA 1EO8H 1PLGL 2G5RA 3ZHDA 4DGYL 4FABL 1YPZF 2O5XH 3RKDD 3SJVA 4IDJL 3MRIA 2CR3A 3E6HB 3IKCA 4WNQA 4LCUA 4JGMA 4KI5D 1J1XH 3VXQA 3L5WA 4NO3B 1FPTL 5DD3L 2IBBA 3HPJA 4JFDA 2JJTA 3VXPA 4G43A 5EZLB 1B0GB 4KVNL 5EO1A 1E4XI 1U8HB 3GSUB 2WANA 4RX4D 5HDQH 1I8LA 4P2QB 3NH7H 4MAYB 4JFEE 1XGYL 4S1RH 1KIQA 1MAML 2C3GA 3U0TB 4EJ1C 4Q0XL 1JHLH 2J5LC 2WWKT 5ITFA 1MUJB 4TYUA 4OF5A 3HS0A 4C83B 3AB0C 2AGJH 4PJFB 5DK0A 4NRXA 4XVJH 2GEEA 5I75B 2J6EA 1DBBH 2I07A 4ZNEE 3GIVA 2R4RL 4MJ5B 1XR9A 1NCDL 3KXFE 3QDJD 5IKCA 4YNYA 5D2LA 4CW1A 5BZDA 4JEGB 4O2FB 1E27B 3VFUA 4NOBA 3MGTA 2M8XA 1F11A 1GGCL 3GMPA 2P8PB 5I8EB 2JTDA 3OKEA 5C0DB 2GFBB 2EH8L 1N4XH 1QSEA 3BZ4A 5EOCH 1OLZA 4B7LA 4Q97A 4JKMA 3S35H 1JL8A 1KT2B 1ZLVH 5F7LB 5JA8B 1QLRB 2FH6A 4JO2H 2K9UA 2PXYD 3EDKA 3FFDB 4PJGF 4I8DA 2VXSL 3VXUA 3RWIB 3NFPB 1UGNA 3OJDA 1UCBH 4WGVB 3G5YA 4UB0H 1R5IA 5FGRA 4F9PA 4F2MB 3MRLA 2VLLB 5C0AB 5K33A 3IRPX 1ZA3A 5E4IA 5DA4A 4NBYB 2FJFB 5I17B 3KPPB 3SGEH 3T4YB 3T8XB 2CKBL 1Q9KA 1K4CB 3BKCL 4PGCB 4U1SB 1DANU 3MFGB 2FZ3B 1HOCB 2OX5A 1QSFE 1RIHH 1RVFH 5B8CB 2W0KA 1NSNL 1X4YA 5BO1H 4JFFA 1CICA 2RB8A 3TJHC 3MJ8A 4BYHA 4PJAF 2GJ6B 4DQOH 3RA7H 3ROLB 4C56E 2R29L 2Q76B 3BH9A 5I1CL 5JR1L 2XV6B 4DZ8B 1FVDA 4KUCF 1P2CB 3GSOB 5C0CD 4LNRA 3GI8L 5F21B 5FO8A 3CFDB 3BIAX 3HG1B 3TBTA 4PJBF 2CR6A 3MLXH 2VXUL 1EUUA 5HHQA 3MRFB 4KK8D 1DE4B 1ONQB 5CBEB 4LGSB 1W0VA 3IDNB 1XGUA 3ARPA 2ESVA 3B5GA 3PHSA 3QT2A 3FO1A 4Z76A 4MA8H 2VSCA 1ZHKA 4HS6A 3ARDC 4MCZB 3ZYOA 1FC2D 2Y5EA 1A14L 1U8LA 3HCVA 3VGAB 1TIUA 1BM3L 1D5ZA 2AJYL 2E9IA 1LO3H 2YKLL 1EK3A 1MJ7L 4NQCB 5I18H 5CJXC 5TDPA 3HZYB 2R9HC 2DBJA 4M1DL 3G5ZB 3KPNA 3FT2B 2WWKO 3VXSD 5D2NE 1MLCB 3VXTB 1V7ML 3JWOL 3TPUB 1JGUH 2WINA 1H3TA 4ACPA 4P2OA 2DYPB 3BZEB 4EUPA 1FN4B 4HKXB 1WTLA 3MLUH 1DUYB 4QRQB 4G6MH 5D1ZA 4U1NB 3TO2A 3ULUD 1F5WA 4D3CH 3RPKA 4NN6B 4YHYB 1FFPA 4Y4KA 3WIIH 2CMRH 1PG7H 3BMWA 5EZOL 3S5LB 4YHNA 3ARXA 3FO2A 3SDCB 1FO0B 5TH2B 2OMBA 1NGQL 5D1QC 4KRLB 4FQCH 1A3RH 1FNSL 2VABB 5F96L 2OP4H 5GRUL 4NNXB 4RWYL 5GGVL 2Z8VC 4HJ0C 3ES6A 5DJAB 3BVNA 2P46B 4ZNEA 1SJVA 1K6QL 1J12A 1IQDA 4EI5D 3B2UD 4NZJA 3QNYB 1X44A 2DQTH 4DOHB 2QSVA 5F1NB 2YUVA 3HMWH 2H9GB 3OX8B 1NLBH 3WFHA 5HJ3B 1OTUC 4WFFE 1II4E 3C6LC 4R3SA 4DEPB 5AD0A 1QO3A 3BHBA 1MFEH 1ACYL 4AL8L 2WP3T 2BOBB 3H3PH 5HYJE 3QIUA 4DGIL 4LIQL 1IEHA 3KPRB 3NIGF 1ZLSL 4X7TA 4DVBA 2WM0A 4OCWH 4S1DC 2B0SL 3QEQA 4CBPA 3U7AA 3QO0B 5T5FH 2V9TA 1CFVL 4NKIH 2IPKB 4XAKE 4XP5L 3UJJL 4PTUA 4R7NA 1B6DA 5DJYA 5AWNH 3DROA 4UTBH 2XA8H 5EOTB 5AUMA 2DD8H 5DD1H 1U92A 1A7OL 4PIRF 1F4YH 4V2CB 5FYLL 1LO4L 2X4UB 3BGAA 1FZKB 2AQ1A 5EO0A 3BD3A 4N1HB 4YBLC 2J6EH 4ELKB 4O9HL 1CN4A 2AVGA 1IKNA 1JP5A 4QF1B 4YX2H 4GRLA 4CMHC 3LN5A 1T6VN 3GSXB 4JO1H 5GXBB 1NGXB 1XGRB 3O81A 1NGYA 4YDJB 2NW2A 1WBZA 3NA9L 3CU7A 2NY3C 4MB3A 5EUKB 2E9WA 4YHMH 1MJUH 1GH7A 3LKSB 3Q6GL 5GS0H 4C56A 1A7BA 5IG7A 1CIDA 4I48B 3MV8D 4JB9H 4JHAH 4F37K 3T0EC 2OK0L 1EHXA 1YMMD 2J1KA 3L1OH 2BNQA 1GCFA 5C0BA 3QCTL 5I1EL 3NCFB 3WNKA 4R0LA 3SE4A 3IDIA 3X13B 3ME0A 1V5JA 4XH2B 3OJVC 2VZVA 4AT6A 5E70A 2NY4C 4QTIH 1QLEL 2Y25A 1QD0A 3X3GL 5ISZD 4ZUVA 2X89A 1JNLL 1MCOH 3KR3H 3G5VB 2CKBB 1YY9D 4MWFB 1KOAA 4U6YA 4P5TD 1FYHB 4LRNL 1U58A 3TIEB 1YEJH 1RUQL 5GZNC 3FJTA 4JGUA 1WJ3A 1S9VB 2HTLC 1DP0A 3RUGB 1JNNL 1OD9A 2R4SH 5B39B 5GS2H 3O6ML 1PKQE 4X6FB 4QT5B 5SWZB 4JY6A 3JV6A 2NY6B 1CDJA 4HC1L 2BVQB 5E8EB 5I1DA 1ZHNB 4OLWL 3NFNB 3D0LB 4PRPA 3VFSA 2G5BB 4N8PA 2FCBA 4I4WB 4Y1AB 3NZHH 3BXNB 1OB1B 4G6JL 4CVWA 5DJXB 1AY1H 5CJQL 3SDAD 3SCMC 1MI5B 2WP3O 5IB3B 4MGXA 3KPSE 3MOQA 4K3DH 1F97A 4OCXH 3I3DA 5E4EC 4Z95H 3V7AE 1L0YA 4FQLH 2VDLL 4LSTH 3RVWC 4X5WA 2LAGB 3R0NA 1HCVA 4WHTB 1T66C 2EC8A 1FLRH 2W38A 4OIIH 4RFOH 4ZS6C 3FFCB 2DF3A 3DRTA 4HMEA 3MRPB 1BBDL 4ORZC 4Z18A 3VFMA 4FQXA 3MJ6A 5ANMB 3X11A 3ARFC 5IJVB 2BNRA 1L7TL 4NJ9L 4FFWD 2XQYK 4UAOB 2D0HA 5HDBE 1TZHA 3TA3C 5J6HB 5FDWB 3LQZA 4MA1C 4KH2A 1EVUA 4ZPTA 1D5XB 2EXYD 4PJ5D 4YDIL 1Q72L 3SQOL 4EUPH 1OAKL 2XTJB 1ADQL 3GI9L 2AV7A 1ZLVK 4NSKB 2DQUL 1CXLA 1TFHA 3NFSL 3BWAA 3G6JF 5KVDL 4LSVL 4XBEL 1TJIL 1NCBL 4BZ2H 3G08A 2QSCH 4ODWA 3B9AA 2E7CA 4BZYA 1RUPL 4LLQA 4L1HA 2BY3A 2AK1L 4ZFZB 4F15C 4DGVH 1MF2H 4KTEH 1C1EL 1B9ZA 4YFDB 1G7MA 4F80A 3P4MB 5GS1C 4YDKH 2AJZA 4Z7NF 4JDVB 3UROR 4N5EC 4U6VL 3VU2A 2ADJA 3E6FA 4NQSA 3HZKA 4KAQL 1N5AB 3C5ZA 4CDHA 4DN4H 4K9EH 4N0FB 2WLZA 2FH8A 4HUNB 3LB6D 3T65A 3I6LD 1EHAA 3CLEL 3KPOB 2YPLE 1JRHH 4HKJA 5DJ6A 5A2JH 4DUVA 3W0WE 2DL9A 3V4UH 3L3KA 2CK0L 3U1SL 4Y5VA 2DQCH 1MFBL 4WI6A 3CMGA 5C9JB 2JE8A 1G6RA 4L4VB 4FN0A 1H5BC 4WCYH 4UIMB 3S7GA 2PYEB 1P5VA 3L3IA 3B9EA 4LK4A 3LZFH 1BX2B 5AAWA 3O8XB 4XXDB 1U3HA 2AABL 1H8OA 4OZ4B 4LPUA 5DT1H 5E5MB 1JI1A 5DJCA 3UEZA 4JFXA 1MQKH 4OZGE 5I8KH 4DFHA 2ICES 2MPAH 2DQIH 2X9WA 1IGCH 2VDKH 3PP4H 4S11A 3B83A 3C09B 3HR5B 1QFWH 4NNPH 1N6VA 1V7NL 1WICA 4JM2C 1VFBA 4KQ4L 4MX7B 3AC0A 2WIIB 2XKNA 4XI5C 5B3NA 4KI1A 1EHLL 3HZMB 1D6VH 3WFBH 3ZT7A 1R3KA 2DI7A 1F2XK 1VHPA 1KTDA 1IM3A 1PSKH 4IS6A 2AAVA 4YHLH 1UM6L 3U79A 5DDHB 4YHPA 3ARSA 1MFDL 5CEXA 4TTDD 4FA8A 1YA5A 5GJSH 3AXLA 1ZVHA 3C60A 4MS8C 3OKDB 4EI6B 4YHKL 1QFUL 4F8TA 5TF1L 2BHUA 2AJUL 32C2A 1N64H 2C3WA 2OSLB 1WAAE 3ARGC 4XHQA 3D39B 3UDWC 1R0AL 5H2BA 5INDA 2DAVA 3CCHB 3WN5A 3KAAA 4PJEF 2BDNH 3BUYB 3IS1X 5E03A 5FYJE 4ZDHA 2NR6C 1XCQB 2KPNA 1JZ6A 2AJSH 4FP8L 2J88L 3GSNH 1A6VH 4JFHD 4TN9A 4PR5A 1J8HD 4AJ0A 2FIKA 3RPIB 5EOQH 4BA8A 4GO6B 2DQHH 2PW2A 4G8GB 1KNOA 3KDMB 1PQZB 4XVTH 3LRHA 1KEMH 3RTQA 3U6RA 1MPAH 1G6VK 3S37X 3GRWL 5MI0C 1T21A 1A6WL 3BGFC 3TN0D 1S7QA 2O61A 1WTGT 3TWCL 3OKYA 5IW1B 5JPMB 2JJTC 1FL5B 5T1LD 3V52H 4B53A 5DRNA 3QUYA 3BOVA 1TVBA 2V2TB 4Z7VF 4F7MA 1QRNA 1FYTB 5B3JF 1I8LC 4K7PY 1XAUA 3UTOA 1QLFB 4PJAB 2BVOB 4NPYB 2O26U 3O45B 1J9CT 5HHNA 3NPZB 3KLDA 3HAEA 2HKFH 1OAXH 2EDBA 2F58H 3MMEB 4HUUA 4R90L 5JUEH 4XNMA 1IKFH 4DVRL 3RL1B 1SYVB 3RWJB 3UBXB 5IVXE 4ZUUA 2ADIA 3DVGA 4N0CD 4HUXA 4JHWH 1M1SA 5GS0C 5LJYH 2DQEL 1KBGH 2YPLA 1KCVH 1WCBB 1YEDB 4LSPL 1QA9B 4FOMA 1UVQB 2APVA 3GBNH 3WMSA 1K2DA 4XPAL 4FXGB 1I1AC 3LKOA 3BPCB 1A1OB 1F02I 2VNCA 5HPMA 4F9PC 3TJHD 3IETB 3WFEL 3H8NA 1FE8L 4KI5F 2IBZY 1HKLL 4JE4B 3DETC 3OKMA 5C0RH 3FCTB 3PL6A 4OZGA 4E42A 3C8KA 2O5ZH 3VA2C 4ELME 3TNNA 1PYWA 4X6CB 2HRLA 1RFDH 4Z77A 5KJRL 2F5AH 4ORGB 3CFBB 3ULSA 1FSKC 3KPLA 1IZJA 2YC1B 3EDEA 1CICC 1CZ8H 2CXKA 1MCDA 1E6JL 1RK0B 2FSEB 4JPVL 4Q58C 2R1YB 5ELIA 1JK8A 3RWFB 1W8NA 1R24A 2DQFB 2VITB 5EU6D 5JLZB 3KYMB 5JXAH 4LL9A 1T89C 2FWOA 1OAYL 4KU1A 5FCUH 4H0HB 3PWPA 4Z7UE 4JQVA 5EIIB 3NPSC 5HDQL 3NH7L 4LAJH 2QV2A 5GSRA 4I3SH 4LCWE 4U6HA 3CX5J 3FQXB 4UDTA 5DC4B 1NGPL 2R9HD 2H2SC 2PO6B 1OGTA 4UT9L 3WS6A 4LVNC 3QUZA 3UTSD 2NNAB 2XY1A 5C86A 1WAAA 3ARDB 2H3NB 3O6KH 2JKXA 3TBVB 2HT4C 1X5JA 3LEYH 1WBYA 5IM7B 1JHTB 5D9SB 2GY5A 4Y4HD 4HLZH 3TH2T 1N6UA 5T1KA 5F88B 4M8QA 5ID1A 1KYOJ 2D3VA 4R7DA 5E2JA 4MA7H 4Q9BA 3D1MC 2F54A 3MCKB 3DGGA 1HHGB 1A7NL 1VADB 3QAZB 4H0GA 2N7AA 2F53D 4GXVH 1GZPA 4AMKL 2PETA 1UZ6F 1ZSDB 4P2OC 3J7HA 1VPOH 3QDGB 4HFWA 4YLQT 3UTTB 4PRDA 4F7TB 1KB9K 1ZE3C 3FO9B 3H7BB 3H9SA 2RCSH 4KDVA 5EBLB 5F7EH 4G7YL 4X6DB 4TRPL 5DZNA 4Y4KC 3VXRD 5GGTA 4G3YH 4QHNA 3BP5A 2EYRA 4GG8A 1HQRA 5T33L 3KWWA 2FR4B 3R8BB 4YQXH 3CLFL 1YEIL 5D7KE 3SQBA 3BPLC 4DKFH 1A4JB 4WTWA 5D71H 2P5EB 3DECA 1LILA 4DQOL 2YPKB 3SDYH 3VFVA 1AC0A 3ZMRA 4I3GA 1UA6H 3PGCA 5DEFA 2GCYA 4OLVL 4PJIF 4W4NA 4OV5A 4OLUL 2C7UA 4K9EC 2AEQL 2RHEA 4NZTL 4TSAL 4BFGA 3CXHJ 1LD9B 3GNMH 1KF9B 1AQDB 1WZMA 3C6LB 3GSVA 3GMRB 1NFIB 4K8RL 3I6GA 4E5XA 1NCNA 2Y1VA 4M6MH 5IIEB 2AV1B 3QUXA 3MLVL 2ICEA 3B5HA 5FV2A 4DN3L 1YN7A 5LGJB 5C07A 3QIUC 5IEHA 1BOYA 4H1LA 3O9WB 4YZFE 3SGDH 3UPCA 2DJ4A 2NY2C 4WFGD 4XCCL 2YUXA 2NXZD 5JXEA 3IS0X 4G8IB 2DLGA 3CZFB 1QBML 3ROOB 2EYTB 4AQOA 7CGTA 1T1ZA 1P84K 1PZUB 4N8CH 1MCPL 4PJCB 5EZIL 3Q1SH 4GW5A 3HC4L 3ULUF 2PYFB 3UZQA 4YDVA 4HIIB 3HC0A 1DCLA 3CK0L 3G5XB 4U1LA 5EUOF 5HPOA 3BP4B 4N0RA 1WZLA 3E8UH 2EKSA 4GRLC 5CCKH 1U8NB 3VDCA 4TVPD 3F12A 4PV9A 2NY3B 3DO7B 4PY8J 3LN4B 1UWEH 1I75A 3TM6A 5LGHH 1RU9H 4FTVD 3D6GA 5F6HJ 5ITBL 2EE6A 4LU5H 5EH1A 3MV9E 1L0XA 4FQQA 3T0EB 3LHPL 4BSVA 1KB5L 3RQ3A 4UDUA 5FOBB 1J88A 4ZS7L 3ZDXF 3EW3B 2JK5B 3F58H 4X4XA 1ORSA 1VEOA 3IFNL 2DIJA 4XWOC 3QO1A 2GTZB 1N8ZA 4R0LC 1YEFL 1KIRB 1BLNB 3SE4C 3TYGL 5GZND 1NFDA 3KPTA 1A6ZA 2NY4B 1TTGA 1A1MB 1MCIA 3QJHA 4RGMC 3PGDB 3ZDZF 3QRGL 4CAGA 2O93L 3F7VB 5TGBB 1WBXB 4CN4A 5DD5L 1MWAH 3MUHL 4O2EA 2JJSA 1WCQA 3DXAB 1OTSD 2ERJB 5F1IA 2QHRH 2H32B 1N0XH 1UWXH 4Q7DA 4PB0L 4C54A 4PY8I 1D5BB 4NQEE 5D2NC 1DN2A 1XIWA 5EB9A 4PJDB 4ZFGH 5HYIA 1T2QH 2J8OA 5T5FL 3C2AL 1F90L 3EO9H 3RVWD 1Z9MA 5D93C 5SWSA 3S4SB 2XA8L 2VRAA 4F57L 1BREA 1L7IH 5E00B 3B4NA 5JHDD 4LHUB 5DD1L 5ACMA 1XR8B 5C08D 4U4BA 3DJ9A 4ZPVA 3I02A 1AFVL 3SCMB 1GOGA 5IW3A 3U0WH 2Z35B 5A3ID 1SMAA 4PRHA 5D4QA 4YC2B 5I8CA 1NEUA 5EIQA 4M02A 4M61B 2OS7A 1P7QA 4RFNB 3LMJH 1XF1A 4G8FA 5HGHB 3BKYL 3H9HA 1IAMA 3I2CH 2A6JB 4LLYB 3TIDA 4UV7L 4WVRA 4M7LH 4OLZL 4Z6AT 2XI9A 5FK9A 1MREL 1JFQH 1ZHBA 2SEBA 3MBEA 2ED7A 4G6FB 1I1YA 4DJMA 4FQXC 3QG6A 3ARFB 1LE5A 4PRBA 1ZHLA 2B5IC 4GAYA 1JPTH 4XPBL 1NH6A 3D85B 3WXWL 5I6XC 1HYSD 3ZE0E 1F3JB 2WWMC 3TA3B 3L1OL 3L6FA 3QIWA 3NCCB 5F3HA 4UNVA 2X2YA 1C08B 1NCAL 2WZPD 3ZKQD 4G9FB 1IAKB 3CAFA 4HIHB 4AYFA 4HK0A 5A2KH 1C5DB 2W60B 1QP1A 3SKMA 4XNXL 1AO7E 4QTIL 3VGBA 5TF0A 2HJFA 1IC5H 1D3CA 4PJXA 4HH9A 5H35A 8CGTA 5IV2B 3NVQA 3FO0H 1CD1A 4PJ9B 4P9HH 3VFWA 3GHEH 5E99H 5ICYB 5CUSH 3ZKMD 2P8LB 1FNEB 1I9EA 3OXRA 4HHAA 2I5YL 3WXVH 3BGMA 2Y6SD 5K59F 4FQHA 5BVPH 1AXIB 3OMZA 3IFOA 3N9GH 1RJYB 2R4SL 3C5ZC 2EDFA 1MNUL 3L7FB 2VDRL 3QDAA 4O58H 3OKOB 3EZJB 4XWGH 5FA3A 5I73C 5L0QB 3S96B 1Y18A 3U30B 3QZWG 4Y5VC 4NQDD 4QCIB 2I60H 1WZKA 2FATH 1T04B 1U6AL 2LVCA 4CU6A 2GUOA 4WWID 2FHCA 2IH1A 1NEZB 2WW8A 4NQXB 2VXVH 2CLZB 1G0XA 4UIKL 1GAFL 1ZTXL 3MUGA 2L7JA 1A9BA 2XZCH 3C5SA 4I9WE 4E41B 3HI5L 3SKJH 4ESKA 3V6ZB 3WDIA 4QYOA 2BRRL 3NZ8B 1NBZA 3HNVL 4TPRH 4RFOL 4DTGL 2X4OB 1DVFA 5IMMA 1ZGLM 5KS9B 5DD0L 1I3GH 1T20A 4PLJC 1TVHA 4LVEA 5FF6B 4GW1A 5H8DA 3EYOB 3DBXB 2ORBH 4KDTA 4OLEA 3GMNB 3ARBD 4JM2B 3MO1B 1AE6H 3OF6A 2CPCA 2NY7H 2JELH 5KG9B 2I9LA 1UYWL 2VLKB 4KZDL 1MCKA 5TFSH 4HIXL 4RGND 3T4AB 4EDWH 2VQUA 2YA2A 4YXKH 2WNGA 4P3DA 4Z7VB 3ULUL 3CSYB 2VQ1A 3OKKB 4ZUWB 3GFUA 1GGIH 2AK4A 5D1XA 4NWUL 2Q8AL 5JZ7C 3ET9F 4PJHF 5EC1A 1AD0B 4BZ2L 2QSCL 1C7SA 5E2UL 4HPOL 2NR6D 25C8H 1U8OB 4DFIA 3C60C 4POYA 4RAHA 1Q8MA 4H5SB 4J2XA 4UT6L 4WGWB 4NO0B 1SVZA 1MF2L 4KTEL 3MV7B 3ARGB 3P11H 4RGOH 3RP1A 3DX9A 2Z0BA 2J8UE 3QUKA 1MVFA 2EC9T 4TNVF 5EBWB 2C3VA 4GUPA 4MJIB 4DN4L 5IFAL 1XZ0B 2ATKB 5E94A 4AEEA 3I85A 2IADA 4GKZB 3I9GL 1TZGH 3VCLB 2XN9B 3T2QA 1TQCB 4MHHG 3D69B 1YUHA 3FQWA 5J12C 3O11B 1KLUB 3DVNA 3OQ3B 1KXQE 2AKRB 3ZE1F 3NMEA 4NP4L 1IGMH 4HXBH 4U49A 2RQ8A 1EPFA 4UOW0 3MRIB 3IKCB 3MLSH 5CEZD 4WNQB 4EQ2A 4LCUB 1MCWM 3RTQC 1GJIA 3IF1B 5MI0B 1EBAA 4ONGH 4B50A 3IRZA 2HH0H 4QHUA 3MRQA 4HGKC 4OZIA 3HPJB 2XRAL 2IMMA 4JFDB 3EUUA 5T3ZE 3VXPB 5IP4A 3QUYC 5F72S 4HWZA 4F9LA 5EDXA 3FQNA 1HH9B 1XFPA 2OJZH 4YWGH 3RNKB 1KIQB 1XF3A 3GKZA 2YRPA 5ITFB 3HS0B 4C55A 3T3PE 1DSFH 5CFHA 4NRXB 4G42A 3IJSA 4D94A 3VI3F 4X8JA 3WUWG 2W0FA 1YY8A 2VDMH 4XZUB 5HY9A 3BP6A 4P46A 1LNUA 4KC3B 1F42A 2EEAA 5GHWH 3VXUD 1PSKL 1I1AD 3HNTH 1KCKA 5IKCB 4YNYB 4NNYA 5D2LB 1FNFA 4H0IA 5BZDB 1AGBA 3FB5B 3VFUB 3MGTB 1F11B 5DVNA 4Q9QH 3GMPB 5ADOL 1I85A 2V5RA 3OKEB 3U2SA 3MLYH 1QSEB 2P5WA 4ZD3L 1RZIA 1HCFX 3BZ4B 1I8IB 3EYUH 1A9EA 5F6IB 2HFEA 4OZFG 1L9MA 5K9QG 5IT2L 4N9GA 3OJDB 1KC5H 3VMNA 3G5YB 4IJ3C 3H3KA 4CDGC 4MYWB 1R5IB 3MRLB 2VN4A 1NCUA 2VZ3A 3MACL 1JE6A 5JPNA 1WITA 1ZA3B 1EMTH 1MCWW 1WK0A 1KPRB 1ZXQA 3BDBA 3UYRL 5GS2D 1ULVA 1BECA 4CJ0A 4MD5A 4P59L 2LABA 4N90D 2OTUA 1Q9KB 1C8PA 1KTKE 3PL6C 2AI0H 2V5YA 4OF3A 5E08H 4V2BA 4RMSA 2VJXA 3IFLL 3MRNA 3CVHA 5FHAH 2DLTA 3U9PL 2APXA 3NACH 3OBAA 4RZCA 3CJJA 1AHWA 3LOWA 1KEML 5KW9H 2H2SD 3CUPB 5IOPA 4BFEA 2MCPH 4ONOA 5JW5A 2C1OB 3MREA 6FABH 3HE6A 1O7SA 3BH9B 1KXTB 3BESR 3WFDH 1YYMH 3QP3A 1FVDB 4OFPA 4QRTA 4J1UA 4LNRB 3P0VL 2NCMA 1AQKL 5F8QC 1BQUA 3NPSB 3DURA 4S2SA 5D5MF 1Z6JT 4JQVC 5FO8B 3OZ9H 4MNGE 4AEHH 3TBTB 4HWBL 1SJEA 3GIZL 5HHQB 5HD8C 2J4WH 5C6PB 3F7QA 1W0VB 2VLRE 1XGUB 3QFJA 3WS6C 2ESVB 3QUZC 3VG9C 1RJZA 4PP1C 4M4RA 3TLRA 4NCDA 4Z76B 4H20H 4XT1C 4PV8A 1ZHKB 4HS6B 1RI8A 3RIFF 1I9JH 2Q1EA 4NIKB 2BP3A 3HCVB 3BZFB 1RK1A 4M6NL 5BZWB 1CDIA 3HHRB 1D5ZB 4F3FB 3EYSL 1BZ9A 5TDPB 3MNVA 4WUUE 1UCTA 3KPNB 3GBNL 4L8SB 4OT1L 4LCCA 3CC5B 4RQQA 4MNQE 4NC0B 1I7UB 5DJ8B 2WINB 1NQBA 3LD8C 3N0PB 1A2YA 4P2OB 4JFED 5E7FA 4G6AC 4EUPB 3SDXA 4UILL 4X7SH 2IF7A 3HB3D 5D1ZB 5C0JB 5C7XH 4OFDA 2XFXA 3JTSB 3TO2B 3V7MA 1YECL 4NGHL 4QRPE 1IM9D 3BIKA 3S34H 4Y4KB 4ALAH 5DS8B 4ZO7A 3KXFD 3GSQA 3ZKND 3CIQA 4P9HC 1RZ7H 4LKCA 4V1DE 1AGCA 4Z9KB 4MCYA 4K3HA 4LAQL 3QULB 5IQ7L 5KVGH 3QIUD 3ES6B 4RDQF 5FGCB 3WIHH 3RZCA 2JJUA 4H8WH 1IQDB 1UJTA 3HE7A 4QY8A 4Y2OA 4QHKJ 5DJZB 1SM3L 4KHTL 3WFHB 4Y8DC 4UTAL 5F9WB 1GYAA 4R3SB 5GGVY 4RMRA 5AD0B 1G6RL 5I76B 1HNFA 3GMLA 4RDQG 3BHBB 1EFXB 2DM2A 2XQBH 4PRNA 1NJ9A 3QUXC 3LCYA 3C08H 3TBYB 3S8WA 2OJEA 3R1GL 4HZLA 3KVQA 1X6NA 2NY2B 1QNZH 1RZ8B 4X7TB 4DVBB 2Z4QA 3QEQB 5JXEC 1BQSA 1UM4L 1OCWL 1KPUA 1QSFD 4H26A 5E8OA 4R7NB 4Z78B 3WO3B 1TQBC 3WE6B 3T04D 4OTXH 4U1GB 2D7PA 3FHQA 1CXEA 5EO0B 2EDOA 3P0YH 1T1XB 1UENA 1N6QL 4GRLB 1U8PA 3P4NA 1L6ZA 5IWLA 1VPOL 1NGYB 2ZOLA 2NW2B 4KVCL 4HCRL 1IARB 3Q5YA 1TCMA 3OGCA 2E6PA 4QHKI 4OUUA 3FMGH 3MFFA 3T0VA 4C56B 3RVVD 4WI9A 5E8PA 3BQUA 3T0BA 4HEME 5E0QA 5LAXB 4HIEA 2BNQB 4MNGA 1IGFL 1RHHA 5C0BB 5FFLA 4M93B 4AQ1B 5EU5A 5D8JH 4Z7QE 5L2KE 5ETUA 3SE8L 5C2BL 4MA3A 4R0LB 1SYSA 2JIXD 5D71L 3V5DA 3QIBA 4HWUA 1MFAH 4P5KB 2FEDC 4Z7WF 3AS0A 4POZC 1UA6L 1A7RL 1LQSR 5DYOB 2EXWC 4AT6B 1IFHH 3ETBF 2D31A 2X4TA 4HJJH 5KAQF 4DW2H 4ZUSB 1CU4H 2FX9L 1P53A 4KV5F 2JJSC 2LU4A 4U6YB 4DUXA 4FFZL 4WUUA 5FO9A 4MD0A 5IB1A 1U58B 4R2GD 2ADFH 2NYYD 5F9JA 2QEJA 2XZQH 2UVEA 5D72H 1Q9WA 2F8XC 5C0IA 5KAQG 1YMHB 1TCRA 3GM0A 4I18B 5EFIA 4OGXH 4KY1H 5IFJA 1FGNH 1PX4A 3UPRA 4JY6B 4QHLA 1GGYA 3BFOA 2UWEE 5I1DB 4PRPB 5EU4A 3VFSB 2VE6A 3Q1SL 4DCQA 4QRPA 1TPXC 3VWJC 5TPWL 2R0ZH 1EZVX 5JOPE 4OZHA 3GO1L 3TH4T 3BEVA 1OW0A 2EYSA 3KS0J 5HI5C 4OBRA 3KLSA 5T1DL 3E8UL 4EXPX 1AJ7H 4WFFD 2ZG2A 4MXWL 4YBHA 5DWUH 3FT3B 1DFBH 4V1DA 2VB5A 5C8JA 1N5YH 2XZAL 5FAAA 4X5WB 5HYJD 1A4KA 1I9RH 1NBQA 1RUAL 1XGTB 4H88L 4ZXBA 1CFTA 3K0WA 3MBEC 4Y4FA 3VFMB 1ZT7A 1L4IA 3X11B 5IJKA 2B5IB 3I3BA 2BNRB 2D7TH 4P2QE 4E9LA 2MQCA 3L95A 3VRJA 3OAUH 5C0EA 3PIQB 4PJFE 4XMPH 2VL5A 3LQZB 4N1EA 1RMFL 4ZPTB 4PJ5B 2J12B 1NBYA 1ZLUK 1JNJA 3BWAB 4OLYH 4PP2A 4TULH 3DSNA 4L9LC 3B9DA 1RJCA 3G08B 5T3ZH 2UV3A 2DMCA 1C5BH 2NX5A 4ODWB 2ATPB 3WO4C 5KBNC 1U42A 4BFIA 4HAGA 4LLQB 5ESQA 4I1NB 1J8KA 1N59B 1MSPA 1UH2A 3TZVA 3DX7A 1G7MB 1YEGL 3BPNC 1RZFH 1NAKL 5JW4M 2ADJB 4PJHB 4NQSB 3HZKB 2R56L 3TT1H 5L9DH 1AXTL 2OLDA 2V9RA 3C5ZB 5C0AE 4CMMA 4K7PH 2XACC 1HH6A 3EO9L 3T65B 2X4RA 4HKJB 1QBLL 2PUQT 5H94A 1L7IL 3L3KB 2V5SA 4Y2DA 4OI8A 5LWYL 1G6RB 4OQTA 3HNSH 4PBXA 2NY5L 4XVSL 3L3IB 2R0LL 3PQYA 4KKBC 4OI7A 1HIMH 3DUUB 3D3VA 2HRPH 2CSPA 2GJ6E 4PBWD 4D9QE 1U3HB 3I2CL 4Q2ZA 3B5TA 4D9LL 3ZHKA 5DMGD 1FBIL 3CDGA 3VDAA 5DJCB 4JFXB 3T0AA 4F7PA 3GMOA 4K23H 2MCG1 1DVFC 2JCCA 1Q1JH 4HIJA 4RAVA 1TETL 3WBDA 1HHIA 2GAZA 3BRFA 3HG1E 3O2VH 2W9EL 1S7UA 4KDTC 3T0WA 4BQCA 1VFBB 4R4FL 4GAJL 2XKNB 3FONA 1LWRA 3WKML 5DHVA 1JGLH 1JGEA 1R3KB 1KTDB 1IM3B 4IS6B 2CUIA 4YHPB 3KPSD 3MRHB 1ZAGA 2XA3A 2CRMA 4MQ7A 4PS4H 4P4KD 2GW5A 1PEZA 5CEXB 4YIQA 5D1XC 1E28B 5AYQA 5GGTL 3UP1A 3C60B 2UWEA 1U95A 4NQCE 4WY7H 4JJ5A 1U91A 4GJTB 1OGAA 1R3HA 1VACA 1OP5K 3UTQA 43C9A 1XCTB 2LV4A 3FZUC 4LFHG 3QHFH 3WXVL 1JCKA 2QADB 3QUMA 4RRPA 4OFYD 3A6CH 2JB5H 3S88L 1KCSL 5H2BB 4ZOCA 4WO4D 3DI3B 3WN5B 4UT7L 4H8WC 3OXSA 4ZDHB 2IFFL 1CLOL 4P2RA 4NHCH 2DKUA 2A9NL 5FYKE 2DMBA 5BQ7A 2ZNXA 5LCVH 5LGKA 2FIKB 3DARA 2YUZA 2AXGA 1CGYA 3PNWB 5J12B 5EZLA 2MOVA 2PW2B 4Q9RH 5J0BA 4GW4B 4MAYA 1KNOB 4I77L 1JYNA 4CNIB 3RIAF 3RTQB 3U0TA 4OD3H 3U6RB 1VKXA 1EVTC 4PJFA 1SY6L 1KJ2H 3TN0B 2DIBA 3OB8A 4ZNCD 1D5IH 4DOHE 4K7FA 4XPFH 5DRNB 8FABA 4XBGA 1TVBB 3T3MF 4JQIH 1QRNB 4F7MB 1WFTA 4O2FA 4I3RL 4RISH 3RBSA 4F9LC 2P8MA 5I30L 4XHJC 4JRWA 5C0DA 2RBLA 2X7LB 2NY7L 3EOYG 5HYQB 3W0WD 3KPRE 4GH7B 5HHNB 5KSBA 3BRGC 1KCUL 2LQRA 3HAEB 3RGVD 4TVPL 1ETZA 3KJ6H 4NC2B 1HINH 3PF2A 1UACH 3ULVD 4XNMB 3O41A 1INQB 4GRWB 2BOCA 3RWCA 1FJ1A 4ZUUB 2ADIB 2HJLB 4U2YA 4J8RB 4F2MA 2W65A 2VLLA 4HUXB 2LTQC 1I85C 2ZCHL 4WU7A 1U0QA 3P77A 3RFZC 3DRQA 3DGCR 5HXMA 1K2DB 1UM5H 2YD1A 4DAGL 5GGRB 2FZ3A 4JRXD 4RNRA 5D70H 4YPGA 1IZKA 4APQD 4XPGL 4JQXA 5HPMB 4MMXC 5CWSA 4Y5YB 4L8CA 1HHJA 1BQHB 5IUSA 1BF2A 4EOWH 3P0GB 2AEPH 2P1YA 2GIYA 5F93C 4DZ8A 5F7UA 3PL6B 4E42B 5L88H 1P2CA 3C8KB 3GSOA 3TFKC 3PABA 3TNNB 4Z77B 1E6OL 1LK3H 5GGQH 3CMOL 2NW3A 1UZ8A 3ULSB 2DKMA 1AHWC 3CDYA 3KPLB 4XMKL 3ILQC 5HHXH 4NN7B 1ONQA 1R3IL 3TJEL 1T0MA 1YEEH 3EYFA 1JK8B 4NZUH 1CLZH 1R24B 5AZ2H 3HE6C 4IBLT 4X4YA 1MRFL 3OAYK 4X99B 4X4ME 4ODTH 5KSAD 1QR1A 2FWOB 1FIGH 3AS3A 2XYCA 3PWPB 4NJAH 5DUPH 1CLYH 4YXHL 4YO0B 5GSRB 4OQTH 4OKDA 4YWGL 5FYJD 2XOTA 4UDTB 3CXDH 3B9KA 1DSFL 5IMOB 4UINH 5E2WH 4OAWB 4WWKA 5J3HC 4B5EA 3VG9B 1QSZA 1QKZL 2R0WL 5GHWL 5D96C 2V7NA 3RUGE 3FN3A 3QPQD 3TPUA 1A3QA 5I1HH 2HLFD 4TUKH 4GFTB 1WBYB 3LSOA 3BZEA 3O4LA 5SWZE 1FN4A 3U0PB 3S37H 2YRZA 5T1KB 4M8QB 1A21A 4AIXA 1S8DA 3I6KB 4OD1H 5J13C 4LOUC 4R7DB 4Y1AE 2OM5A 4ERSH 5DEZA 5CILH 5L2JA 2F54B 3WDJA 3DGGB 3EYUL 5IQ9A 1MI5E 1D6EB 4LCCC 2XWBB 2VDNH 4KKCD 5DHVH 1T3FA 3BX7C 3UZEA 3LD8B 1GZPB 5TH2A 4X5LA 4HG4J 1RIVH 2DTMH 4HFWB 4FQPA 4JLRA 1E4KA 3LRGA 3UXFA 2WBJB 1MEXH 4PRDB 3SN6N 5IVZA 3H9SB 1H9VA 3IDXL 2HFGH 3FFCE 1J1OH 3FQTB 5ANME 4QHNB 3BP5B 5F1NA 2EYRB 4KWUA 4GG8B 3KWWB 3MROA 4LNVA 5BCAA 5TE4L 5ERWA 1VGEL 3QUMH 5DRZA 3RY4A 1MQ8A 4YHZH 1LMKA 4HT1H 1F4XH 4M5YH 2BOBA 1F13A 3H9ZA 3VFVB 2XTJE 1QHPA 3KPRA 4M43H 3PGCB 5DEFB 3RZCC 4OIAA 2GCYB 5E6ZA 2C7UB 3GJEA 3WHE1 3FQUA 3HE7C 4M3KB 4XTRD 2IAMA 2W9DL 5KSUA 3AREC 5AEAA 1GC1H 3PG2A 4U3HA 1CL7H 4P2CG 4AEHL 3I6GB 1F58H 3DSFH 4JANB 1YN7B 2YHGA 4OGYH 5C07B 5IEHB 4H1LB 5DF0A 5I74C 2P45B 2NXZB 5K9JL 2D9CA 2X4PA 3NCJL 4NRYB 2O5YL 4FG6C 1XGRA 3A6BH 1T1ZB 3NABL 4FFYH 1KLGA 1NCCH 3NIDE 1X6LA 5EUKA 1TQBB 4BUHA 1YJDH 4LHJB 2HKHH 3KPMA 3LKSA 1W0YT 3U46A 4YDVB 3RVXC 3G6AA 1L0QA 2OR9H 3HC0B 4L4VE 3GKWL 3LEVL 4U1LB 1INDH 2PTVA 2PYEE 4W6YB 3F7RA 1VENA 2VR5A 2EKSB 2VUOA 5J56B 5JDSA 3DX8A 4CUCA 3NCEB 4M6OH 4NC1E 3VWKA 1U3JA 5DI8B 3PXHA 1FQ9C 4LCWD 3F12B 4OCSL 4PV9B 1OAQH 1RULL 1GVIA 3BKMH 4CN1A 1XF4A 3LV3B 3QFDA 4CVZA 3S34L 2EXWD 4X6BB 2AXFB 1Y0LA 4KROD 1DBKL 3LS4L 2P24A 4BSVB 4YAQB 4BKLA 3BQUC 2VAAB 4UDUB 4HWEL 3U9UA 3FN9A 1ORSB 1Q0XH 1VSCA 4MXQC 1N7ML 2CKBA 3QO1B 2EIEA 2DM4A 1FZJA 2FX7H 1N8ZB 3VFPA 3QIBC 3RAJL 1FG2B 4Q6IA 1NFDB 1U8IA 1CD9B 1S9VA 1NLDL 1BD2D 3QJHB 2WQRA 4JO4H 5B4MC 4X6FA 4QT5A 1GPOH 2BVQA 1ZANH 1BJ1J 1ZHNA 4O2EB 1NL0L 3NFNA 3VFGH 4QO1A 3VWJD 2G5BA 3C08L 1G0YR 4I4WA 5F1IB 5CEZL 4KK9C 4RWHA 4JM4H 3KYKH 5DJXA 12E8L 1UC6A 3D39E 1CFSA 1XIWB 4D9RE 1GRWA 4FNLH 3SGEI 5JOEA 3AGVA 1S7WA 3BIBX 5BV7H 1Q9OA 3O2WH 1BFVL 2DRUA 5SWSB 1J0JA 1JUFA 1TPXB 2NXYB 3UC0L 2B2XH 4PRIA 2OZ4A 4ZPVB 4JDTL 5IESH 5IJVA 3U4BH 1OW0C 3QHZL 1B6UA 4G8GE 4HUMB 4PRHB 5I8CB 5I1KH 1P7QB 5DLMH 3HUJA 2UZXB 5J6HA 3CPLA 4FMKA 1F6AA 2ZCKL 3UMTA 3TIDB 1QBBA 1TNNA 1D5XA 1GL4B 2F19L 4Q9CA 2CQVA 4FQ2H 4I2XA 1I8KA 4ZXBC 5FK9B 3TYFA 1ZHBB 1I7RA 3QQ3B 3MBEB 5FO7A 4FQIL 1P4BL 2W0PA 1I1YB 2P4AB 2I24N 1RUKL 4Y4FC 1BVLA 1EJ6A 3QG6B 5FYKH 1LE5B 4PRBB 1ZHLB 5IROA 5T3XD 4GAYB 1FYTE 1G1YA 3BH8B 5ALBH 2YA0A 4PJAE 4MDIA 1EX0A 3QIWB 4IOFD 3F65A 4WEUD 5F3HB 5D8JL 4KZEH 5EC2A 1FO0H 4QXTA 4DK6A 1J7VR 7FABH 3UAJD 3PHQA 4HK0B 5D7JA 2MSPA 4B7IA 4TSCL 3EIFA 3MSPA 3SKMB 4M5ZH 3MGOA 5EN2A 4M7JL 2X1OA 4XC1L 2HJFB 4PJXB 4HH9B 5H35B 4HJJL 1ZGLA 4Y16C 4HJGA 3WO4B 2XY2A 5E1AA 3EYVB 3VFWB 3CVHL 3O6FA 1MCRA 2H6PA 3TZVC 1H3XA 5C9JA 3D48R 4HHAB 3MV9D 3BPNB 2W92A 2X1QA 3ZTNL 3RWDA 1VEMA 1KENH 2PYEA 1BIIA 1PLGH 4FABH 3IFOB 4DGYH 3FB7B 1MIEL 2D7NA 4IDJH 3IU3B 4ZYKA 2F74B 3F5WA 4LGRB 2B8OT 1FPTH 4HBCL 5DD3H 5FA3B 4P49A 1Y18B 4GMTL 3WKNA 4PTTA 5E6ID 3FRPG 1DVFD 4Y2DC 4LSQL 1MCCA 1CXFA 4C59B 1B3JA 4X6CE 4GQ9L 4KVNH 2EEBA 2Q87A 1YPZA 2GUOB 5CZXD 5BS0A