2P24B

I-au/mbp125-135
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
216
structure length
194
Chain Sequence
RGYGGRASDYKSAHRHFVVQFQPFCYFTNGTQRIRYVTRYIYNREEYLRFDSDVGEYRAVTELGRPDAEYYNKQYLERTRAELDTVCRYNYEETEVPTSLRRLEQPNVVISLSNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRAQSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new twist in TCR diversity revealed by a forbidden alphabeta TCR.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, A-U alpha chain
total genus 44
structure length 194
sequence length 216
ec nomenclature
pdb deposition date 2007-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p24B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2p24B01
2BK8A 2OXGA 3ZMRA 4WO4D 3MRQA 4PLJC 5KVEH 1BMGA 5KVDL 2GJJA 1IVLA 1YEJH 1NBQA 5K59F 3NFSL 4GW5A 2ZJSL 4OF6A 1ZEAH 4MD4A 1X5JA 3RFZC 2AJXL 4HBCL 4OBRA 4PBXA 4QRPB 5K59E 3G5XA 3DX8A 5KSAB 4WIQA 4CBPA 4WFEE 3SKMB 4LSTL 3OKKB 3H0TA 1S3KH 2CO7B 4PJIA 1J0HA 5B38G 3JTTB 3V4PH 4HW6A 3D85B 5EORH 3WLBB 1Y6KR 3O45A 2JB6B 3LN4B 3QFDA 5C71A 1XGQA 3CU1A 3DNKA 1TQBB 3EFDL 3KR3L 3SDYL 1T83C 3FB5A 1PG7L 2BCKA 2IH1B 1GZQA 3WUWB 5IQ7L 4L3EA 3F5WB 2D0GA 1GHFL 1CE6A 3T08A 3QPQC 3ZKSD 4JQXA 3ZDYE 2ED8A 3VFTB 4KZEH 4MZ2A 3WBDA 2Q3AA 2GJ6E 5DJZA 4X6CB 1BGXL 1KOAA 4ZDHB 2V2WB 4YXLH 3UTSB 1IM9A 3UTPD 4BFEA 2B39A 2MPAH 2ICWB 2QHRL 1CD9B 4LLMB 2DI8A 2E9IA 4BQBA 3BQUD 2YA1A 4UQ3B 5J13B 4JO4L 1NSNL 2EDEA 1BX2A 3BWAB 4N0UA 4G3YL 2CLVB 1KEMH 5HDLA 3VGAB 3QXTA 5IB3A 1QR1A 3FHQA 4XNUL 1N8ZB 2V9QA 4KI5E 3D1MC 4JFQB 4NZJA 3RIFK 1DBJH 4N1EA 4CN6A 1JNJA 3ECBB 3H9YA 4J7RA 4OQTA 3ZDZE 1MREH 3CD4A 1P84K 1PYWA 3MV7D 3BISA 1R3JA 4WGVB 5FHBL 5C0AA 1W0WB 4PJGE 3H3PH 2G9HA 3O9WA 2EXWC 3MRDA 3CFEB 1P9MA 3I6KB 5EZLA 3P4NB 5I1HL 1PKQB 5FF6B 1D5XA 1IGYB 4KTYA 1ITCA 4Z95H 4HGKC 4ZFZB 2GSIA 5EC1B 3H7BB 5I0DA 3EYOA 4MCZA 4U1MB 4IRZH 4YHOL 2MKWA 4MXWL 5SWZA 4H25A 3EYUH 4D9LL 4U1HB 3IJHB 3O8XB 2GQHA 4L9LA 1C5CL 4ZODA 4DVRL 4DUVA 1KTLA 4KRLB 4XP5L 4I18C 2AABL 4IRJA 1ONQA 1DLFL 2V5MA 4F7TB 5I1HH 2Z31B 1G6VK 3LSOA 5I8CA 3DUUA 4ZTOH 5D7IB 4NN5C 3RZCB 1CD8A 5DT1L 3C8KA 1RZ8A 3IJSA 1BVLB 3JVGC 1K5NB 1BLNA 1C5BL 1UJTA 4JRWA 4HSQA 2FNBA 4JFED 4Y1AE 4I48A 1QFWI 1VGKA 1BWWA 3U82B 1L7TL 4KY1L 1SJXA 1RK1A 3OKYA 5EUKB 1S7RB 5JZ7C 5C9KA 5KN5B 4MDJA 1PKQE 2MQ3A 1NCBL 2EE2A 2O5XL 4M7LT 4NN7C 5IW1A 1AP2B 3KJ4B 1UH2A 2J6EH 3U9UA 2JK5B 2VLRD 2HVKA 4JG0L 2FX9L 3D39B 4Z9KB 5FO8B 4LPUA 2WBWB 3O4LE 1HN1A 3TPUA 1CL7I 1FZJB 1P4IH 3FT3A 2EDXA 4M6MH 2YEZB 3A67H 5DI8A 1XGUA 1MVUA 4PGBB 3ARGD 1MCBA 1B9ZA 3GSWB 4XBPB 1QZ1A 5ADOL 1A6WL 4XCCL 3HMXA 2NPLX 3MV9E 3IU4L 3BP7B 1QBBA 4H26A 5D7LA 3MGOA 1RQ5A 1OQXA 2DQDH 2AJZB 3TJEH 5C6TL 4EEEA 6FABL 1OAUH 4LFHD 3PWNA 5DD3L 4Y1AB 3LRSA 1UEMA 3F12A 4HC1H 4U6VL 2HKHL 2R1XA 4WRLA 4EQ3A 5E4IA 3SE3C 4NQDE 1AD9B 1MQKL 1GL4B 5T5FL 4NQCD 5DO2C 3OKNA 5DYOB 1A1MA 1NGXA 1A6AA 5IEHB 3O4OB 5F1NB 1J0JA 2EDKA 4G8GE 4L3EB 2W92A 2BSSB 2XTLA 2BJML 1UWGH 3OJMB 3P9MA 4N0RA 2CDEA 3T2QA 1T2QL 3QO0B 1UACH 4JPKH 1JHKH 1YDPB 3VXUA 2HFEA 2VAAA 1AQKH 3LS4H 3N1FC 1XCTB 1IM3B 5T3XD 1T4KB 1D6VL 1QSED 1MIMH 3WFCL 1B6UA 1CLYH 4RGMC 5K9OB 1SEQH 1Q0XH 5HHOD 3BSZL 4L8BA 3BRGC 5HVGB 4HAGA 2GEEA 5EZJA 1Z6JT 4U1NA 5ANMB 3TYGL 3ARYA 5KSBB 3HZMA 2FD6H 5D2LB 1YMMB 1MQKH 1QFUH 4X5XB 5GJSL 2PW2A 5HYFA 3EYFB 4OLUL 4FTVE 5FXCH 4LGPB 2WBJD 3I6LD 4K7PY 1S7VB 3WEXB 4GRMB 3MXVH 2G9HB 2J5LB 3MRDB 3BMVA 4OD1H 4YZFE 4RCAA 4LSVH 5IMOB 4PPTA 4G8GB 2Z4QB 4QTIL 2DI7A 1IJ9A 1E0OB 4G9DB 5GGUB 3PGCB 5IMMB 5FHAH 5E08H 1JZ4A 1FG9C 4F3FB 3NAAL 2CLRA 2EDOA 1KUMA 3RP1A 4HJGB 4GW4A 4E41E 3PL6C 3JWOC 1RZ7L 1WAAF 3UDWC 4FMKA 1YEEH 1I7RB 3V5HB 1MHEA 2OSLA 2EH8L 3SY0A 3NFNA 4WDIB 5FM5M 1JGUL 3MRGA 3I75B 4OZFH 3RBSA 3H2WA 5LWYL 4Y1AD 1CDIA 4M02A 2UV3A 5CHNA 5ANME 5IB1A 1PAMA 2EH7L 2GK2A 2IADB 3BW9A 2MSPA 3MJGX 3C6LB 5EIIA 2LAAA 4JY4A 3K2MC 4KKLC 1YMME 5DZOA 1GRWA 3IJYB 2GFBA 1YNTB 1EFXB 1RZJC 4TSCL 1MH5A 1WICA 3IVKA 4MNQB 5I8KH 2ATPA 1JHTA 4PJGA 4TRPH 3CU7A 3BZEB 1R0AL 4CKVX 2VZOA 2GUOA 1FGNL 3PQYB 4PJ9B 3P4OA 3I02B 1AE6H 1SM3L 2VIRB 3DMMD 4JN2A 4Q9BA 2A74A 5IHZB 5CIPA 1EMTH 12E8L 1A1OB 1D3CA 2XPGB 4KHTL 5MEQA 2WSKA 4TVPD 1FE8H 5DUBA 5HYQA 1JGDA 3QIBA 25C8L 2NY0B 4K8RC 4QXTA 1JGLH 3O2DA 1FYTD 4Y16B 3KPNA 3U0WH 3MYZA 4HK0B 4R0LC 4JDVB 1Z5LB 4QXWA 3QDMA 4ETYA 3D2UA 4OQTH 4X83A 5EZLB 3QQ4A 1F8TH 1HSAA 2W65B 5C09D 4C4KT 1NMAL 4HUXA 4LVHB 3WJJA 5GGQH 3G6DH 5J9PA 2QKIA 4AENA 5GZNC 3QUZA 4HKJA 3AREA 1CIDA 4JM2A 1RV6X 5ETUA 4X4XB 1YMHB 4BKLB 5JTWA 3K1DA 5ESVB 1NC4D 4NHCH 1RJZB 3CSYA 3RWGA 4NRZA 3QAZC 5HHME 3MPCA 5F70A 4O4YH 4R3SB 3BH8A 1EEYA 5D7JA 1N4XH 2B1AL 4P4RA 4GW5B 1KPUB 1DQDH 4OIAA 3G5YA 5DK0B 4GAGL 4GMSL 3PV6B 4XXCC 4Q9QH 5DURD 5EZOH 3ZLQC 3T0AA 4ODVL 4EDXB 4C56E 1TQCB 5HGAB 1MFBH 5TQ2L 4P5TB 3WFZA 2PYEA 3UTOA 3STBA 4YK4C 1MI5D 1OLLA 1RHHA 2JELL 4XNXL 3IKCB 1JNLH 4XP9L 4YO0A 5INDA 3QZWB 5T3XE 4LMQE 2BRRH 4AEHL 5GRYA 3HFMH 3IU3B 4OZFB 4L4VE 4GW1A 3GSVA 1M6OB 3IFOA 5GRVL 4I2XA 1U8OA 1K4CA 1FZKA 1A02N 1W0YT 5D2LF 2XTJE 3DHMA 1N64L 1OAKH 5IW1B 2D7PA 3B9KD 1TETL 4ZFOL 1LK3H 4GRLB 4Q9RL 1NDGB 1BVKB 1X5AA 1H8NA 1IC7H 4ZTPH 1CT8A 2GTWA 4JJ5A 3SJVE 5DJCB 3KPMA 3ZKXC 1CFVL 1IKFL 3SBWA 2UWEF 4I3RH 2VDLL 4KXZI 3MBEB 4HK3N 5CS7A 4QRPA 3QI9D 3MRFB 4OGYL 1ZHKB 4XMLH 1G7PA 4XPGL 5F1KC 3BKMH 5GPRA 3BKCH 3P4MA 1TETH 1S7VA 3LVEA 1NUNB 2A6KB 5D72L 5B38B 4L9DA 3MRMA 5JHDB 5L0QB 3D9AL 1JZ7A 2Y6SD 2EYRB 4H20H 3QISA 5C08E 4JRXD 4Z5RA 3BQUC 4UINH 4AZ8A 4ZOAA 3BUYA 4XPHH 4MXQC 5EOTB 4HT1L 2DWDB 1Q1JH 2Z92A 5TF1L 3QCUH 4FN0A 5FYKE 2VLKA 3UJIL 3OKLB 3QUZD 3QH3B 1IKNA 2VLRB 4KDVA 2EC8A 3O11B 4Y5XC 4NUJA 5DK2A 3SE9H 1U3HC 2KUTA 1HHGB 3HAEB 1JTPA 3C09B 2VISB 3H9HA 43CAB 4Q9QL 1TZHB 2FWOA 2EKSB 2LU4A 2C4FU 3HPLA 4PJ5E 3F7YB 4Z7UB 5HJ3A 3WIIL 3SQOL 1BAFL 4RAUB 4F2MA 4U6TA 3W2DL 4P2OC 1T89A 4E0RB 4LASH 3QHTC 5F9AC 3RVVC 1U8HA 3VDBA 1A8JH 4G9FE 2AK4D 2QJDA 2ERJC 2EDDA 3ULVC 4OI8A 4JKLA 1X5IA 4Q6IA 1RULH 1WBZA 3H42L 2GTZB 4K7PH 3A6CL 2X1WL 3HE7A 4RZCA 4KUCF 4LCIH 4CAGA 2AJUH 4I18B 3B3IB 1JMXA 4P2QB 1YZZA 4PJXF 2X89D 3HC0B 2H1PL 4JLRB 1YY8B 4PRIB 3RUGB 2VJXA 1DN2A 2A1WH 4Y4KC 1QPXA 2VLJE 3RDTA 4J2XA 5I1GH 3OTTA 2DIBA 3GKZA 4NSKB 1Q94B 3GJFK 4K8RH 4MLIA 1Z2KA 3OR6B 1OT2A 2D4FA 1DBBH 2JJSA 2BOBB 12E8H 3TCLB 4R8WL 4L8SC 2JIXB 1OARL 4I0PB 3QHFL 3MUHL 2HTKD 4UT9L 3T4AA 2PN5A 2YPLD 1NBYB 1G9NH 3GGWA 3UTTA 3R8BB 1HHIA 4LOUD 1NCWL 4LCIL 4P9HL 1F6AA 1IEAA 1OP3K 5CP3H 5MENA 4ZUTB 3QP3A 3S6CA 1E4XI 2OI9B 2UVEA 4QOKA 4BUGA 5HHOB 4JR9H 2GJ6A 2FL5B 4OZHE 4R0LB 1FZOB 1BQLL 5C0BB 1QEWB 4Z18A 4JY6A 1C5DB 1RZIA 3OQ3B 1JPSL 3V4VH 1GC1H 4XP4H 2Y36H 5CP7B 1JTOA 4KUZL 4PJ8B 2BVOB 3C6SB 2Q20A 1LE5A 3IFLH 3T77B 4NKIL 4A6YH 2Y25A 1F11A 3GJEA 1DBJL 4MSWA 4XVJL 4M7JL 2UZYB 4HDIB 4M48H 2YUWA 2HLFC 3C6LA 4KJPD 5GS0D 5DGRA 1ZT7A 5DK3A 1XEDA 1KJVA 3LS5L 2WUBL 2A77L 4HLJA 2ZUQB 3QNZA 2Z31A 1KXVC 3UJIH 2AK1L 3AU1B 5EH1A 1U3HB 3D18A 2IPUG 1ADQA 1ZT1A 3NCCB 3O8XD 3MRIA 2VO5A 1A1MB 5KVMC 3BZ4B 3LDBC 4NQXA 3BZEA 2O61B 5E1AB 4DAGL 1C16A 2JELH 4XNXH 3QIWD 3HS0A 4LRNL 4QHUA 4QXGL 1CK0L 1LP9F 2HVJB 1MPAH 1FZMB 3OJVC 1P7KB 2CDEB 1FGNH 1RD6A 4P5TC 2WV3A 5FUOH 2O5ZH 3EDEA 1FZJA 3L3IA 1F4WH 1PZ5B 1V3JA 4U1IA 4OV5B 4G8FA 2Q1EA 1IT9H 4PJBF 1CFNA 3SKOB 2OI9C 5EUOA 2Z93A 1BVKA 3DX9B 5D1QB 1R3LA 2H26A 1IL1B 3ISWA 4ONOA 2D7TH 2GCYB 3PXHA 3QUYA 1IC7L 4ZTPL 5AAMA 1KLUA 1CIUA 4PJIE 5KSVB 3CDGB 5F96H 4LLQB 3UC0L 5BXFB 4XZUA 1RUPL 3ZKXB 1NDMB 5D6DA 5D2LA 4Z0XA 5IJVA 3GI8L 3MLVL 4PGBA 1Q9OB 1OM3H 4G6JL 3P3YA 1C7TA 2PW2B 2ZG3A 2FIRT 1ITBB 3MA7A 3MACH 2D3VA 4MDIA 4YDJB 3VXQA 1M05A 2I9LB 2WZPD 4DGVH 5CZVL 4QGYA 4BKLA 1YC7A 1CFTB 1QRNA 4V2CB 5ESVA 1VERA 4UAOC 2A6JA 5FYKD 4MJ5A 4OM1H 1V5JA 3D3VB 2Q6WA 3EJZC 5BZDA 2VLRA 5ALBL 5IM7B 4YC2B 5C0AE 5AAWA 3ZDXE 3TJHC 4YHIA 4HH9A 4G8EB 1QACA 2PO6C 5T1KB 3WUWA 3S34L 4MD0B 1Y0LB 1G9MC 1CDJA 1TZHA 4IDJH 1P4LB 4AQOA 3QUMB 4UTBL 4IMLB 4C57C 1ZHLA 3B5GA 4X6CA 4M7LL 3JTTA 5TQ0H 3DROB 4KPHH 2XTJD 2C3HA 1RVFH 5DF0A 4XVTH 3L6FA 2BVPA 4BELD 3ARFC 3B9VA 4FQ2H 1XAUA 4OF3A 4WHYG 2B0SL 4WY7H 3E2HB 5A3ID 3DWTA 1MCNA 4QHNB 4YUEH 4OIIH 3FTGB 4U1GB 5JOPD 5E8EB 3U0WL 3PWVB 3FO1B 2Q76A 1U6AL 1NDGA 1FVDA 4R4ND 1S7TB 1YQVH 3K46A 4G6AC 4BM7A 1FORH 3KYNB 4ZFFA 4LEOB 2NX5A 4XP1L 1U3ZA 5IT2L 1G6RH 1G1CA 5A2IH 4TVPL 1F2XK 1P7QB 1WTGT 3GIZL 4O02H 1EEZB 5C0AB 5DJDA 3RWFA 4L3EE 1RUPH 3JV0A 1KT2A 4Z76B 5HGHB 1OGTB 3UPCA 4GBXB 5B8CC 2HT4C 2YR3A 1GGBL 5JIPA 1GZPA 5CD5D 1AGFA 4Z7WE 4XWOD 1I7RA 4PFEA 1JNHB 2O5YH 3SY0B 3GO1L 3VXRE 4JDTH 1BIIB 1I3RB 2R0KH 3NZHH 3MGOB 2VNCA 4OLYH 4D9QD 1O7SA 3GEWB 1OP5K 2EDFA 3LH2H 1ORQA 4UDUB 5TE7H 2VN7A 3UCRA 4JR9L 4LQFL 1H3UA 4NO5A 1I3GH 2DB8A 3PWUB 3RWEB 2AERT 2AKRA 4R7DA 1I1YB 2W59A 4OCSL 3UJJL 2NY5C 3QXAA 5GGRY 2EKSA 2X44D 3LZFL 1MAJA 4G8GD 1FN4A 1DDHA 3FAWA 3PDOB 3BVNA 4NQEB 3AY4C 4FTVB 4D3CL 2VL4A 4N8VB 1YEKL 2VYRE 1TLKA 3MV7E 1OT1A 4NHUB 1QLEH 1S7SA 1MVFA 4J8RB 3W11C 5ABDE 5D1XB 1K85A 5E2VH 5K9QI 4UIKL 4L9LB 5C92A 4BA8A 2R8SH 2W9LA 4Y5XA 3LD8C 1KB5B 2W0PA 4QRSB 4WHCA 5IJKA 3RKDD 1UGNA 2DQHH 4C83B 4LK4A 4ZUWA 1BJMA 2FSEA 4KTEL 3LSOB 4JCMA 5HGGS 4ELKA 2FO4B 1FVEB 4Z7WB 3L3KA 5I8CB 5I76B 2HRPH 3BXNB 4RAVB 1PGRB 4WJ5B 3F62A 2PXYD 4OD3L 4QCIA 3BO8B 1RZ8B 3IJSB 3HCVB 4HK0A 2VXQL 1YMMA 1SJEB 3OX8B 4K3DH 3EDDA 3GSVB 3QEHB 4X99A 2R1WA 4CUCA 1CI5A 1CVSC 4X4ME 1FGVH 2C3VA 4JHAL 5JW3L 2F54A 2FJGB 4FQHA 4P59H 1LMKA 4WUUE 1MCDA 1BF8A 3GK8L 2FHFA 3RNKA 2OQJB 3OPZL 3BPNC 4GRLA 2AQ1A 4LCUA 5FYJL 3INUL 4YHPB 5CJ5A 3OJDA 3D2UB 3T0EA 4KKBD 5I8EB 5HYIA 1JV5A 3TCXA 2YN3A 3U46B 4PRDA 4MDIB 4PTTB 4UDTA 4P2QD 3DI3B 4GO6B 5IBLD 1KPVA 1D9KA 4QT5A 2Y7QA 1GPOL 2VC2H 3WL9A 4P3CH 3X3GL 3DV6B 5KSBF 4L9LC 2VQUA 4PLKD 3V5HA 3E6FA 3GHBH 4MVBD 1AIFB 3FOMA 1OM3L 5E6IC 4NPYA 5GS0L 1UJ3C 4P3DB 3VGBA 1UVQA 5FHBH 1PG7H 3JV6B 1HHJB 1FV1B 2H32H 3QDGE 4Q9CA 1HK6A 3FOLA 5E6ID 2HTLC 3RWCA 2Q86B 1VFBB 4OZIB 4OCYH 2R2EA 3F58L 4NUJB 2NLJB 4TN9A 5DK2B 2ATPB 2WBKA 3FN0L 2O61A 3OXSA 4NDMA 1F4WL 3NFPA 3V6OE 2X4OA 5DRZB 1MCHA 5F7DB 4A6YB 2I60H 3TVMB 1DQJA 3TZVD 1ZLSL 3MLSL 1NC4A 4AYFA 3QDJD 1JPST 4N68A 5DVLA 1TPXB 2Y06L 5FDWB 1KENL 1EFQA 2FDBP 5KANG 2NCMA 4P3CL 3QUZC 1DQQB 1Q1JL 1D5ZA 4ZAKD 1WEJL 5CILL 3U4BH 4AIXA 3LD8B 5CMAA 4H8WH 1OY3B 5L88L 4KMTL 3VWKD 3Q1SH 1ZTXL 2FX9H 5HYQB 4YAQB 5LCVL 2FZ3A 4M5YL 1YNLL 4I13B 4ZAKC 2WUCL 4HKXB 4FQLH 3Q6FA 1NUGA 3KPNB 3VXUD 3OB8A 3NABH 4XCFL 4G9FD 1P69B 4Z95L 3KPPA 3W9DB 4JFYA 4GSDH 1JTTA 2Z9TA 2F54D 3T0EC 1V7NL 4WFGD 2ITDA 2OJZL 1X5XA 3KPOB 3NCJL 4UT7L 4W68A 2H8PA 1IAOA 3RZCC 4GRLD 5JW5B 4L4VB 1XGRA 3C5ZB 5TDPB 1AR1C 1LEGB 3LKRB 2A6JB 3T4AB 2DQUL 5K33A 4JB9H 3WNNA 4ONFL 3GGWB 2RJMA 4IM8A 4HUVB 3PIQA 2YWYA 2NY4D 3DOSA 3IXTB 2AXFA 1W0VA 1DN0A 2LU3A 4S2SA 5EU3A 5KANI 4TVSa 1FCCA 1GGIL 1CQKA 3ZTNH 3TPKA 4U1LB 3VXSE 4PP2B 5C08D 3QDME 3AS2A 4FZ8H 3C8HA 3V52H 3D25B 2V5SA 2EEAA 2O26U 4PREB 5J6HB 4OUUA 2OL3A 1N6VA 4N8PA 1FVCB 3MYJA 3ZSTA 3FL7A 2P43B 1J0YA 2CJUH 3U0PB 2ZZUT 2GJ6D 2NYYD 4RAUA 4F2MB 5DC0A 5LAXB 1JPGB 1C8PA 2V7HA 5CZXC 4YNYB 2LABA 1HILA 5IFAH 3DMMB 1KF9B 3B9AA 4LIQH 1FQ9C 2X9WA 3VWJC 4QRPE 1FNFA 4MQ7A 1MI5A 5C0RH 2H1PH 1FAIL 1RUMH 4PJHF 3VRIB 3UPRB 4HIIB 3P0YH 3IDIA 4NGHH 3VJ6A 4JLRA 3MLYL 1XGPB 3CFBA 3CPLA 4JFPA 5E5UB 1E4KC 3WKNA 5GZOC 3WEXA 3GKWH 3ULVF 4AH2A 4YIQB 5JOFB 1HINH 5D7LD 5D71L 3AS3A 2H6PB 4QEGA 3VI3E 3TIEB 1P7QA 2Z8VC 1JUFA 4QRTA 3B2UD 3PGFH 1M7IA 3ARDB 3OKOA 2GY7B 1KT2B 4Z76A 5B3JF 2WWKO 3S4SA 4R4FH 4NCDA 2IC2A 1K6QL 5SWQB 1F13A 4E9LA 5TJWK 3IDXL 4OV6F 1CXFA 4JO2L 1UM6L 3RVWD 3PHOA 3KYOB 4Y5YC 4L8CB 2J4WH 5DHXB 2V17L 4P2OA 2J8UB 4XTRD 4Z78A 1KN2H 1ZS8A 1B88A 3PL6B 3IDJA 2R2BA 1DQLL 1L9NA 4ESKA 1CICA 1TDQA 3HR6A 1LO2H 4PB9H 2YBRB 5L9DH 1FL3A 5FYJE 4PRIE 4YUEL 2E9WA 2W0FA 4YDJA 5JPNA 2MCPL 2BDNL 1H5BC 2NY4B 5DJ0A 4YBQD 3QEQB 1FN4B 3EBAA 1I8KA 5DQJA 5IBUB 3MZTA 3ES6A 3V0VA 3KWWA 4N8VA 4L4TE 1HHHB 3EZ8A 4DN4L 1TCRB 2NTFA 4I77H 4OTXH 4MHHI 5MP6L 5HYJD 3DXAD 4LARL 1MCWM 1I9IH 3OBAA 1JRHI 4PBWD 1OTSD 3IU3A 4V1DB 3DX9A 1CGUA 1U0QA 2QSCH 3S8WA 1CVRA 1P1ZB 2DQJH 2PTTB 3V0AC 2X4OB 4G6JH 3LEYH 3I3DA 3TVMA 4RMRA 2CO6B 5H35A 2D7OA 1JF6A 2CRZA 4XP1H 1NC2B 3NTCH 2EYSA 3AM8A 4LSQL 4ODXB 4POYA 1A7OH 5BOPA 1WBXB 2XQBL 4M3KB 4YBLB 1MIML 5T1MA 3TBSA 1KULA 5FKPB 3DIFB 4JVUA 1AHWB 4P2RD 1FSKB 5DC4B 4PJ7F 2XKNB 3SO3C 4BFIB 2C3VB 4F9PC 3ULUE 1DSFH 1P5VA 2IAMB 4JJHA 2UYLB 4HZAA 1K4DB 4BK5A 2MKLC 4WEBL 1EGJH 5LJYH 2XTJC 1QFHA 4PJBE 3V5KA 1MPAL 3VFGH 5EOQH 4MQXD 3IT8D 2NX5B 4ELMF 4HWBA 1WV7T 1FBIH 3WSQH 4X98B 1VPOL 4UNUA 4JANA 3ESUF 5DK0A 5IQ9A 1F45A 1G7JB 1TTGA 5ERWA 4H88H 4OZGF 1T5WA 2JJWA 1WZKA 4JG1H 5FCUL 2PNDA 1CD0A 4FABH 2D7MA 4C4KO 2BVQA 2R0KL 1AFVL 1YNKL 2CMRH 3FQTA 4MA3A 3WIFB 1TJGH 4G6AD 3FKUS 5TDOB 1I3RA 2A9NH 2UWEE 4OCNC 1PX3A 1C12A 3HN3A 3MO1B 4J3SA 3TBYB 3X13B 5KSAA 4HWEH 1KJ2L 1QBLL 4PY7A 4HFUH 5C07B 3X11B 1J1XL 2P8PB 3DURA 3VGEA 4HXBH 4UUJA 4WI2A 3MR9A 1C1EL 2QL1A 4ODWB 2EIBA 2FEDC 2JJUA 4H88L 3GI8H 1KCKA 1NGPH 3BHBA 3WO4C 5CEZH 4HIHA 5DJ2A 4NKOA 1IGML 2JCCA 4KK5D 5IOPB 5I19H 1FYTA 2NR6C 4TNVK 4WUKH 1UB6A 2QR0B 1TJGL 2OMBA 1RU9H 5FDWA 3SE8L 5K9JL 1UZ8B 4R2GC 1FO0L 1KCVL 1S7XB 4H0HB 1NAKH 4ZUSB 3CPLB 2G5RA 3D3VE 5EOCH 5J7CC 4BSVA 5I30H 4Q6YA 3GO1H 4KPHL 4WFFD 3BGAA 4KWUA 3QUYB 5BS0E 4Y8DC 3E2HC 2W9DH 1FC2D 4QRRB 5CGYD 3QT2A 2FLBT 2IMNA 4XAKD 3O3BA 3QULB 5IKCB 4PRHA 3S97C 3UBXG 1YA5A 1TJHH 4JFQA 2XWTA 3FZUC 5F3HB 4JM4L 3WYRA 2AGJH 2VL5B 3TT1L 1MCIA 1UB5A 1Q9WB 4JKMA 4MX7B 4D0BA 2ZCHL 3P0GB 3L3GA 2VXSH 5I2IB 4WWKB 3QUXA 1YQ2A 2MQCA 2X1XR 4HS6A 4YPGB 4KRPD 1HQ4B 4JM2C 2LAGB 1A0QH 1NMBH 5DUPL 3V5DA 2MWCA 5JDSB 3ARFA 5EU3B 5DVKA 4KUCD 2ZNWA 4ZDHA 4NO3A 4KAQH 1CQYA 3QQNA 3G9AB 4K55A 3WDJA 4UDTB 4PG9B 2WWMD 5JMRA 2FJFB 2YC1B 5T3ZD 3DSFL 5DJ0B 3IF1A 1BZ7A 2DL9A 3UTSA 5DUML 3L5WB 2C26A 5SWSD 2R23B 1R6VA 1U2HA 4OFYD 4RMVA 4AIZB 5BVPH 3VFSA 5FDYA 4KMTH 3QG7H 4ZNEE 1ZWIA 2XRAH 5I66B 3E6FB 5GJSH 3HRZB 2YUXA 2VR9A 3BXNA 1S7QB 4I0CC 5C08A 2X05A 4HT1H 2WLYA 4LDEB 3U30B 3GBLA 3MUJA 1S7UB 3O3EA 2YD5A 1C5CH 1I9JH 3GSNH 1P4BL 2JJTA 3MXWL 3QEHA 3NMEA 2CR3A 1RMFL 3C60A 4DW2H 5ICZB 3TF7C 1SMAA 1NFDF 1RZGA 2NY3B 3WFBL 3RKPA 4R4FL 5IMLA 2LQRA 4P4KD 4DCQB 1I8LA 4PS4H 2B5IB 1CICD 4ONGL 1AXIB 3VI4F 1TENA 1AQKL 4YJZL 5HGDA 2FBJL 3EYQD 3R06A 1C16B 4KVNL 5BRZB 3EJYC 1K3ZA 3LEVL 5CEYA 1BFTA 4IOFD 2EDWA 2GCYA 1NGWA 3LEYL 5EBLA 1GHFH 1K4DA 4FFZL 3EJYD 2WWKT 4XRCA 3VGGA 5FOBB 4ONFH 3NCFB 5JNYA 1A4KB 2IPTH 4N5ED 3MV7B 4Q2ZB 3ULVL 2H2SC 2R56L 3LKPA 1VFOA 2DQTH 1GPOH 1N2RB 2AXHA 1CXLA 1U8QA 3MCKB 1D5MB 4IIQC 2BX5A 2FHBA 1BQLH 2P47B 5JR1L 1MVUB 3FOLB 2CJUL 1Q9OA 3KYMB 4S10A 4CW1A 2X40A 5FYKU 3AS0A 4RMTA 2WNGA 4I5BB 1SHMA 3X14B 4FG6D 2L7UA 2ITDB 3BIBX 3MRNB 3LEXB 3BP7A 3VWKC 2ZUXA 3ZHLA 1QFPA 1IQDB 2R0ZH 4R96B 5C0RL 4L8DA 3U4BL 1R24A 1PG7X 5C09A 3U6RA 3QG7L 3HE7C 4JKWA 5KZCB 3DROA 5D5MF 4BZ2L 3O3UN 5HHVL 3ET9F 3W0WE 5JDJA 3MODH 2HH0H 1S9VA 4KDTA 4YHKH 5KG9A 1EHLH 5ISZD 1EH9A 1QHOA 2C9AA 3RZCD 3X17A 3DVGA 4DKAA 4Y19D 4NKMA 1TVHA 4OQTL 2V5RA 1B3JA 2E5EA 2WINA 4ODXA 1JPGA 3DRTB 2EXYC 4H1LH 1OCWH 1XCTA 4JKPL 1SEBA 2AV1B 5EIVA 4TOYL 2NY3D 4LSSL 1U8JB 5GXBB 5J12B 1MAML 2QADD 5JHLH 2XA8L 3TVMD 2DQFB 1TFHA 3PHQB 2PXYA 3S35H 2OJZH 3MA7B 5LGJB 1PX4A 3D48R 1IAOB 3FO9B 4Z7UF 4N1CA 4U1NB 3H9SA 1VSCA 1FO0A 2C1PB 3TVMC 3VXMB 1YEHH 3Q6FB 1YEDB 4DZBA 3MLSH 1RURL 1A3QA 3FN3A 4I0KA 5DDHA 3MUGB 1E27B 1WVZA 4EUPB 2YRZA 5K9QG 2PETA 4MXVE 1FE8L 1IGYA 5DD0H 5BV7C 1OL0A 1LP9A 3L3GB 3SO5A 2HLAB 5JIIA 1IEBB 1JGVL 2ZUTA 1YEIH 3TNMA 4IIQA 2VABB 3C09C 3MROA 5SWQA 3RTQD 4YPGA 4D0DA 1C7SA 1T83A 3QDAA 3X3FL 3IKKA 4P2CG 3CH8A 5FYLL 1FFOA 1S78D 4KZEL 2I9TB 3GI9L 4J4PA 1HILB 2XA8H 3FO0L 3ZHKA 3DMMA 2R1YB 2ZCKL 4PJ9C 1TZIA 3SDYH 1PY9A 4U6YA 2ZUSA 5GGSY 2G5BB 5JW4N 3FQRA 1JBJA 2I5YH 2EE3A 2OK0L 1N7ML 2R2EB 5EO0A 3CFDB 4CJ1A 1F4YH 2X4PB 4JFFB 1BIHA 3CFJB 15C8L 3NAAH 5CSZA 4CU6A 3OR7B 2XIDA 3H3KA 3B6SA 5C08B 3S37H 5I1JH 5IESL 1JK8B 4KDTC 1IAII 2NY0D 2BXZA 4EZMA 4WEUD 5DLML 1QRNE 1FYTB 2AJXH 3MGTA 5DVNA 3KPSB 4JY4B 2VQTA 3WFDH 5CJXA 3KWWB 5TPWH 5JPMA 1ZGLB 1JGUH 4B7LA 4O51B 2EH8H 1MJUH 5GRJH 3VG0L 4ZS7L 1I9JL 1OGAE 4NC2B 4XVTL 1MFCL 3D87B 5CJQL 2AP2A 1INDH 4V1DA 5CJ8A 1KB5A 3S35X 3WDHA 4MAYA 2Y06H 3OF6D 4UQ3A 2HVKB 2YPVL 2Z4QA 4YBQC 1KSRA 5E8OB 3KHOA 2MMXA 3KLAA 5CIPH 3UTSE 2ZOKA 2OQJA 3G6JE 2HRPL 4O2CB 3L1OH 4NNPL 1XZ0A 1ZHBB 4HCRL 2BNRB 2A74B 4GMSH 2DQCH 3QFJD 1CGYA 3WE6A 4RISL 3UZQA 4U1SA 4HXBL 4P46C 4WI4A 5EU4B 4BFBD 4GLRH 5I75C 1FNSH 4NZTH 4OFVA 5HYJE 4PTTA 2J88L 5C0GB 2B2XL 5DFTA 2NXZC 1M7XA 1IGJA 5E7FA 1I7UB 4P5MA 4WW2A 2CGRL 3ZKMC 5KSUB 3QEQA 1SY6L 3P9LB 2YD1A 4Z7VF 3FRPA 5DFVD 5KS9A 4JDZA 4PJ8A 2OYPA 3RUGF 4I3SL 1NGQL 2VDQH 1NMAH 1A6VH 3UYPA 3N0PB 3RGVC 5IEKB 1MUJA 1FNGA 1JMZA 3MC0A 1UEYA 5FM8A 3SQBA 4U6HA 5I71B 2IFFH 4PJFF 3ZE0E 3MCLL 2MTPA 1EK3A 4WTWA 5EU7C 5MEOB 4HBQA 5ACZB 3CLFH 2LE9A 3MRPB 5IVZA 3BH8B 5I76A 4YNYA 1QKZL 2VDPL 3I9GH 3QXDB 1YDPA 4HPYL 3QZWG 5KOVC 3IB4A 1HXYA 1UVQB 5H2BA 1IFHH 2AK4E 2AEWA 1JZ5A 1SJVA 4MQTB 3SJVD 5IVXF 1X4YA 2VLME 2Q86A 3CVHL 3MNWA 5DS8A 4PV8A 1N0LA 4RSVA 3ESVF 1CTNA 2B7DT 3QQ9D 5J13C 1JZ3A 3A67L 3KJ6L 4NYLB 1L0QA 4TVPH 3NFPB 4FFYL 1IL1A 3T0EB 3DIFA 3ZTJG 2ZPKH 4GOSA 3OAYK 4JZJB 1K8DB 1G7JA 2YEZA 2BRQA 1MWAL 4JRYA 1WWAX 1ZK9A 1XGYH 2GIYA 4TSAH 5L6YH 3IFNL 3ZDYF 1JN6B 2L4OA 1BD2A 2ICWI 5LGHL 5LVEA 3D85A 2BNUA 4M43H 4YHNB 5J89A 3PUCA 4WV1C 4OF5A 5E6YA 4NC1E 1EO8H 3SCMB 4I8DA 1IC5L 2VXTH 4I4WB 1CICB 4HJGA 1CGSL 4F9PA 1AE6L 2XWJA 3CDFA 3M1BB 5FGRA 2KQNA 3PJSB 5ID1A 5INCB 5BRZD 4K2UL 4PJAF 2E7LA 3BEWA 2Y4SA 3D39D 5HY9B 4WEBH 3O45B 5E00A 3BUYB 1KC5L 5E56A 4FQ2L 5IR1B 1R3KB 35C8L 1AGBB 4Y88A 2ICCA 4DFIA 3KDMA 4XCEA 5C07A 3X11A 5F7DA 1RK1B 5CBEA 2HRLA 3ARFB 2XZAH 2H9GB 3MV9B 1J1OL 4M1DL 4GQ9L 3H8NA 1XGYL 3FRPG 1NBVH 3BP5B 4HMEA 1KPRA 4JHWH 3OKNB 5A16B 2BC4A 3DV4B 4HKBA 2BP3A 4XX1E 3C87A 1HEZA 1TPXC 3FFCD 1T0NA 3VFWB 5IFHH 4NQDB 3LOWA 3G9VA 2Q7YB 3SE4A 5DA0B 2DQGL 2X41A 2OTWB 4O51A 2EYSB 1KCUH 1HXMB 4LKCA 3BN9C 3O3AA 4LL9A 4LP5A 5ENWA 5DJ8B 1F00I 2C3GA 1MREL 4JO3H 3CFEA 5A1AA 4AT6B 5HVHC 5H94A 4DOHB 3BESR 4XI5D 4D0BB 4LHUA 4LSVL 4LPWA 1G7QB 3ZSSA 4D0CA 3HC0A 3WJLA 1EEZA 3P4LA 2IPKB 4PRIA 3T0XA 1MQ8A 5EU7E 3O0RH 3GDBA 1KNOA 3OHXA 4NM8L 1PJ9A 2HWZH 4UQ2A 4HUVA 1OTTC 4WI6A 3I6KA 4XBGA 5FKAB 5F7EH 2A6IB 3QUYD 1LE9B 3SKNB 3TBWB 4F3FA 2D2OA 1GGTA 3U0TB 3WS3A 4ETQB 2VABA 4UT9H 4FQJL 1SYVB 3P9LA 5TFSH 3CZJA 4U3XA 5JDSA 2P5WD 1Q0XL 1DBBL 3UBXI 1JRHL 5KAQG 1NMCB 3WLWC 3KYOA 3RDTC 3MRLB 4IHOA 3BT2L 3CFCL 4AMKL 4X6BB 4DGYL 1BHGA 2E9BA 4ZQKB 5CWSA 1MRDL 1EV2E 1RJLA 1SY6A 1U58A 4X6DB 4RMWA 2GTZA 3ARBD 3SKUD 4LQ1A 1S7RA 2QLVB 4WFED 1OAYH 2SEBB 3MSPA 2FGWH 4ODWA 3L3JA 4KZDL 4W4OC 5D1XA 2VZUA 4E42B 1REIA 3HE6A 3E6HA 4NJ9L 5I16A 2APFA 3RGVB 4ELMB 1A7BA 4RAHA 5AYUH 4YHKL 4E41B 2B1HL 4JB9L 3A6OA 4Y2DA 4BQ9A 4Y4HA 4OTXL 5I71C 4L8SB 3GSOB 1FVEA 3CSPA 4A6YL 1JVKA 3HFML 4KVNH 2IAMD 4YGVB 1MH5B 2FJHA 3TO4D 2HFEB 4AEIH 1MRDH 2FBOJ 4D8PB 4FNLL 3VWJA 4IS6B 4U31A 5IUSA 1CT8B 2GTWB 4JJ5B 4EKXA 5CAYB 4M62L 5IG7B 3V2AR 5J06A 1IGCH 4HF5H 4YX2L 3NPSB 4FHBD 3M17B 5EUOF 3INUH 2CH8A 2P42B 2VDKH 3W0WD 2QSQA 5T1MB 2VWEC 4ONHB 3E3QE 3AREC 3V5KB 3L3OB 2GKIA 2APTA 4L4TA 4U1SB 1GGCH 1PKQA 4X7FC 1DEEB 1UKTA 3WDIA 3EYFA 1L0YA 1E28B 1T66C 2YKLH 5E2WL 5IMKA 1H3PH 2OL3H 1Q0YL 2ZCKH 3SDXA 4NUGH 1MHPH 4XP6H 2ICEA 1S7WB 1W8NA 4XHQA 1YUHB 1RZFH 4R3SA 1AIFA 2WANA 1YNTA 4Z77B 4MAUL 4JZOB 1OPGH 1YEIL 4P3DA 1ZT1B 3MFGB 1Q8MA 2X42A 3MRIB 3V4VL 1H3XA 3DGCR 1PDKA 2XICA 3UBXB 5L2KB 3KLHC 3ARSA 5FO7A 4RMUA 1TTFA 3ULUD 1TJIH 3CSYB 4YDLC 1YYML 4OJFL 4PRBA 1MFDL 4WNQA 3CH1B 3MREB 3QCUL 1LEIB 1S8DA 1IZJA 2B8OT 1HIML 2CR6A 1BQHG 2YD7A 3C8KB 1UH3A 3K8MA 2ADJB 4KQ3L 3U1SH 5EBWA 3FQWA 1AGDB 3PV6A 3PXJA 4PLJD 4OKVB 2JCCB 5IOPA 1U8JA 1KCSL 4LKXA 5HHMB 2GSGB 5F6HI 1X4ZA 5DUBB 4MXVF 1RZGB 2OJEA 4KRNA 3BKML 1LK2A 5JR1H 2G75B 5CINH 3FO9A 3UYRH 4J3VA 2R4SH 1E6JL 5HGDB 4GS7B 5IVNA 4Y4FD 4AK1A 1RUKL 3GUTB 5BQ7A 3B9EA 3MRBA 1L6ZA 5EZIL 1LO0H 3P30H 3MV8B 3L95A 1IC4H 1U8NB 1WK0A 4RNRA 2C4XA 3LKNB 1WFUA 2I9LA 4HIEA 5JIKA 4MGXA 5D7KD 1XGUB 3VXMA 1KLGA 2Z8RA 3GHBL 3W0WB 5EPMA 1MHHA 4G80B 2HJKA 1DBAH 3GMPB 4X8JA 4OF7A 4HFWB 5D7SL 4LCWB 2A6IA 4HLZG 1FH5L 3MRGB 4FXKA 4WI5A 1YJDC 2B4CH 2KQMA 1BQUA 5FEBA 2QADB 1JPTL 4CRPA 1BJ1H 4FXLA 5C0BA 1FIEA 1IGCL 2VOTA 4UUJB 1SBSH 1YNKH 2CMRL 1NBZA 2PO6B 4RBPK 3OAYH 2D7QA 4ENEC 2FJFA 1GAFH 1TNMA 3ILQD 3VFUB 4IHOB 3QZWA 4MNGE 3QUKB 3GMNA 3JWOH 3MBXH 1BOGB 4JHBA 3SDCA 5KAQF 4HV8A 2GUOB 2DTSA 3MFFB 3V5DB 2YOCA 1S9YB 2UVFA 4EUPH 5AZEH 3T0DA 5AWNL 5AYQA 3UX9B 4P4RB 1AXSB 1S9VB 3DHJA 5HSFA 1ZLWK 4KXZH 3LQAL 4PJCB 1CL7H 3RTQB 1BPVA 3QIBD 1G7HA 3S37X 3ZE2F 5E4EC 1OHQA 3PP3K 1KIRA 1SVZA 2YPKB 4LSRL 5IMLB 2R0WH 3F58H 2NZ9D 1IKFH 1RHHB 2BNQE 1JGLL 2AJYL 2XY1A 3QULA 3L5HA 3HNTL 3TH4T 3UJTH 3I50H 2E3VA 3TBVB 4D8PA 1UACL 3TGXA 5AG8A 1X6LA 3QDMB 3CDCA 4IDLA 4RWYL 3QDGD 1RZJL 3TNNB 2AW2A 4HUXB 1UA6L 1D5XB 3FB6A 5C0IB 2DQJL 3WXVH 2VAJA 1F8TL 4DCQA 3BDYH 1ED3B 5DD1H 3L7EA 4G42A 4GQPH 2VC2L 5E2TL 3VD9A 1T5XA 1SJEA 3OX8A 4LVNB 1U6AH 3HKFA 5DDHB 5DVOA 4KJQD 4LSRH 1FCGA 4J12A 5E6IB 4JN1L 4LHUD 3HAEA 4L3CA 3BKJL 3OZ9L 4R0LA 3UEZA 4U1HA 2D7NA 5C0GA 2B0SH 3LN9A 5DRXB 3FHAA 1U91A 1C5DA 1YEFL 5B38A 4HCRA 2OR8A 1RJYA 4MJ5B 1KELH 1BFOA 3T4YB 3DUUB 1F11B 1KCRL 2V5YA 4J8RA 4MB3A 2OZ4H 4PB0L 3MZGB 2J7LA 5DMGD 1IC5H 5E94A 2YD9A 4ZS6D 4LNRB 2A0LC 3F7VA 2LTQB 5JZ7D 5C09B 3PWNB 3C60B 4FQ1L 3M1BA 5F7NC 3U7YH 3V0WL 1A22B 1OP5H 1KJMB 2APWA 3LRHA 5I1AA 1MCWW 3X14A 3AMKA 3HE6B 1XIWD 2R69L 4X5LA 4B41A 1SY6H 1JHLL 3V95A 4QWWD 1K8IB 3RHWF 3UTPE 1T1WB 2J8UE 2FIKB 5D2NE 3H9SE 1P6AB 4QO1A 4XNMB 3B8SA 3D39A 1ZLWH 2YD3A 2J8HA 2DLTA 3C2AL 5TGBB 1KIPA 4D2NA 3W5NA 2GYSA 2Q76B 2H41A 2ILLA 4HEPG 3BZFA 4P5TD 1T21B 3HE6C 3QUXD 2BVYA 4O58L 3QXUA 5HI5C 4Y4KB 3OKMB 5IROA 1J8HB 4NQDA 1P7KA 1QSFE 3B3IA 4U2ZA 3AUVA 3T0WA 2XG4A 5D9SA 1NEUA 3QUXC 4LVOC 5D5MA 3AGVA 4L3ED 3RWFB 1CFNB 3U7WL 4XVUC 2J2ZA 3ZL4H 2RCSL 3SBWC 2R4SL 1FIGL 1MFEH 1I3VA 2V2TA 3W0WA 1IGTA 4JN1H 2HJKB 3UTZA 3GMMA 4KTDH 4NQSA 1DL7L 3QWRA 4HKJB 1GJIA 1AD9A 4HWEL 5SV3A 5F21B 1B2WH 4D0CB 1P6FA 2A1WL 1IEBA 1FFPA 4EJ1C 4JFOB 5I1IL 4XVJH 3FT4A 2DLFH 5D7JD 2DL2A 3LQAC 1HCFX 2DD8H 4UNVA 3MBEC 4OCMC 3OKKA 4HXAH 4M1GH 4OZGB 5C3LD 5ID1B 4YHMH 4X4YB 1PLGH 1YYMH 3BRFA 1CGVA 5D7JC 1T80A 3R0NA 4QOKB 5HHOA 4NQTA 1FNGB 4L3AA 1IAIM 5EB9A 2HLAA 3OAUL 3EFFA 5HDBF 3B2VH 1ROWA 2HYMA 4P9ML 5C6PB 1LNUA 3MQIA 5GIRB 3S88L 4PRBB 4GG8A 3CLEH 4EBQH 3TJHD 2X4RA 4OB5L 2X7LB 4OM0L 1OAZH 3RWDA 5EZJB 1IT9L 5EBWB 4X6BA 4R8WH 3IFPB 4ZQKA 1F58H 2Y07L 1GC1L 4P23C 1N5AA 5D1QA 2BVTA 3BGFC 5DRWB 2BY3A 4ZPTB 3BPOB 1E6OH 2VXVL 4GXVH 1OSPL 5I1GL 5JW4R 5DR5H 2OTWA 2YS4A 1B0GB 4B7IA 5HPOA 3TZVB 3OKDB 5DEGA 4U0QB 5DJAB 5JA8B 1CDBA 1KN2L 3VFGL 3AAZB 1X6NA 2W91A 4NC0B 5FGBA 1GGIH 4G7VL 3WNPA 4JG0H 4LVHC 1MCRA 3S35L 2HKFL 4JE4B 2BSTB 4K3GA 1FZMA 2GY5A 5TPWL 2OR9H 4HIIA 3FFCE 3HZVB 1FRGL 2FL5A 3DVFA 4O5LL 5IBUG 2IPKA 1J8HD 5EO9B 4QKXB 1XGTA 3KLDA 2P5ED 3CNKA 1DLHB 3BGMB 4GW4B 1SYVA 4I3RL 5LXGL 3E0GA 1A2YB 4HS3A 5FB8A 1HHIB 1SYSB 2W60B 1Z9OA 1UT9A 1F3DH 3QXVA 4LCWA 5EA0L 1MHCA 3T8XB 3GJFA 3NFNB 4HHAB 4WDIA 2FHCA 3D69A 5M7QA 1E4XH 4MSWB 3U46A 4TUJB 5ECJE 3TM6A 5CD5C 4APQB 4EI5B 5JORA 4L1HA 2VE6A 1BWMA 3LHPL 5AZEL 1G7MB 5GGVH 1F02I 1BM3L 2ED7A 2LFGA 2FGWL 3DMMC 5FYLH 4JQVC 1W72B 3VFNB 4KRMB 1E28A 5TF1H 1ZLVK 1U3HA 3D18B 1MUJB 3QHFH 3T1WA 5HD8C 2IG2H 3PWPE 4KY1H 3IJHA 4YGAB 2Q87A 4L29B 4X4XA 1KJ3H 2D9QB 3LQZB 4ZFOB 2BVPB 4DOHE 3EW3B 2O5ZL 1AJ7L 5L2JB 5FK9B 4ZO8A 1A5FL 2AJSL 4ZUUA 4L5FL 3AU1A 4U7SA 4JFZL 1J87A 4ELMA 3VW3L 4PJXB 4G6KH 1P4LA 4KKCC 5FO7B 3ES6B 3V8OA 2PTVA 5E8OA 3IRZA 1SJHB 1XR8A 4XPFL 2RB8A 4H20L 1JF1A 3IKCA 5IW3A 4JZNB 1TZGH 1A7NH 1KIPB 3WD5H 2AQ2A 2HA1A 4Z7NF 1Z9SA 3M8OL 5DD6A 5F1IB 3F7QA 1M6OA 3ALXA 3ULUF 4OGXH 5GZND 5EZIH 4FTVD 2MOVA 3ZDXF 3MRKB 4EN3C 5C1MB 4X6DE 1Q9KA 1UXWA 4PJ7A 4AY0A 1ORQB 1CS6A 3PWPB 4C56A 4YHLH 1N6UA 4Q9RH 3SGEH 5FKPA 1DVFB 1RJZA 4XBGB 4X9FA 1K9TA 1CLCA 2VLLA 4OF0A 2YXFA 1U93A 1HZHL 2MPAL 2QHRH 4H8WL 1I1YA 5DRNB 2VDRL 1XT5A 4ORGB 1NCWH 4QXUH 3V4UH 1RUML 2GAZA 4WO4C 4KKBC 1OD9A 3SGKC 2DYPB 4GBXA 5EU6A 3G5VB 5BZWA 2RFXA 1U8LA 3BKYL 4NJAL 1U92A 4RMSA 3PGDA 1EJ6A 4P9HC 5IBLC 4G3YH 32C2A 4FXKB 3HG1B 1G84A 1NKRA 5D2LE 1A4JA 3ROLA 3BP4A 4KKAD 1CGTA 1QSFA 2F58L 3V7MA 4CU8A 4XNQB 5D1ZD 3FTGA 5TE6L 3E6HB 1HHGA 1AHWC 1SQ2N 1MCOH 2BC4B 2WBJA 5E2VL 3GIVA 2JE8A 1EO7A 43CAA 4OCRL 5CLTA 5KVDH 5D96B 4QNPF 3MRBB 5LCVH 3F5WA 5JW4Q 4LCCA 1G6RL 4MXQD 5CBEB 4AG4L 2CDGB 3UTTE 5EORL 3G6DL 1YMMD 1TXKA 2X4TB 1TJHL 4HFUL 4OLZH 1J05B 1EEUA 1P84J 4JHWL 2A6KA 5A2LH 4S1DD 1MCFA 5JHDA 1A6UH 4DQOH 1G7LB 2N7AA 4OSUH 1T7ZA 3MRQB 4GUPB 1UB6B 3V6ZB 3GMLB 1G6RA 2BY2A 4ZUWB 4NNXB 4PJFA 5HYEA 4MD4B 1JZ6A 3SCMA 4UIMB 4FXGB 3MRRB 4FFVD 3N1GC 3EKCA 4PJGF 3F8UB 4XVSH 1CXHA 5KW9L 1T03H 3W82A 3E8UL 4R7DB 4F58L 1KB9J 3NIDF 3VXQB 4M5ZH 4O2EB 3NIDE 3PGCA 5DUMH 4AM0B 4CU7A 1T7YA 2M2DA 3O9WB 3LKSB 4ZUVA 4NZUH 2WIIA 1NEZB 2XA3A 4OLVH 5J1AA 3X3GH 1CLYL 3EYSH 5HHNB 3HB3D 4HWBL 3O3DB 4OCXL 2IFFL 2R8SL 3I75A 4TUKL 4GKSA 1A6ZA 5CZVH 4DGVL 4JFEB 1JHLH 4NN7B 5EO0B 2RGSA 2A6DA 3RVXD 4NZUL 3VFTA 3GM0A 4Y2DD 2NY1D 3PE9A 1AXTL 1WCBA 2APXA 4LOUC 3LQMA 5TE4H 4KJQC 4YQXH 5ENWB 5HDOA 4KHXL 3O2DH 1LWRA 3UC0H 1I7TB 3MGTB 2NY1C 5DJYB 3VGAC 5CUSH 3O2WL 3MYJB 4R4BA 3TBTA 4OCXH 4K94L 3LN5A 4WTXA 3RU8H 5TE7L 4LLWA 4OBSA 1A1NB 4RMQA 4PRHB 1F3JA 3HUJF 2A9MH 1GCFA 4Y5VB 5GS1A 3TYFB 4OSUL 3VGHA 3MRCA 2XQYG 2NXYC 3TNNA 2EXWD 1MCLA 2EH7H 4KJPC 1N0XL 2D9CA 3QIBB 2CXKA 4L4VA 1PZ5A 1UWEL 2HG5A 3HR5B 3ZKNC 4DGIH 1HYRC 3DX6A 3WNMA 3K3QA 1T2QH 2DM3A 2FD6L 5FB8B 2LVCA 3QDGB 4AG4H 2BXYA 4U0RB 5EU4A 4JFEE 1OGAA 2QHLA 3MJ9L 3TV3L 5SWZB 1BFSA 3ZKND 2IBZY 2CIIB 4CVZB 4XPAL 1OWWA 4WUUD 5J4MA 3PL6A 1GOHA 1HDMB 3QA3B 5F96L 2UZIL 4IRJB 3H7BA 5ISZB 3C5ZC 3SKMA 4FQQA 3QNZB 3QR2A 2VLJD 4YE4H 3HTLX 1G0XA 2RIKA 2AKRB 1CGXA 4Q7DA 3O8XC 3KGRA 2ZCLL 2HN7A 5GS2H 3HZYB 1MJ7L 5CFHA 2DJSA 4KHTH 3C9NA 32C2B 3LKQB 4K23L 5D1QD 3U4EA 2F5AH 5DEFB 2GK0A 1MI5B 1QSEB 1S9WB 4PJ5D 4PUBL 2ICWJ 5GQBA 4J3TA 2YK1L 2CLZB 3TN0C 3QXDA 4KFZC 3EO9L 2R9HC 3WXWL 1XGPA 1YEFH 2NY2C 1JWSB 2WBJB 1A9EB 3LAFA 1BBDH 2J4WL 5J6HA 1QVOB 4OZFA 4F9LA 1CBVL 5DS8B 3FQUA 1Z9LA 3VXNA 4CN4A 5GS0C 3FT2B 5CJOL 2FR4B 2OCFD 2PW1A 1ZMYA 2DTML 5BXFA 3TBVA 1BREA 4XRCB 3TBSB 5EU6E 4HUUA 1R3IL 3PGFL 1T22B 4L4TB 1ORSB 4LLDB 4LHUG 1NUDA 2JKXA 5ESAB 3VH8A 4GKNA 3MLVH 4XWGL 1LD9B 3QWQB 5IMKB 4FQHB 4PJFB 5LKNA 4RWYH 4K3EH 1VFAA 1TVBB 5I18L 5IW6B 3FT4B 2PYFA 1IGIH 3FO0H 4B0MM 4I77L 4LDOB 3UMTA 1A7QL 9CGTA 5F88B 3P0YL 4JM2F 1S9XA 2AXFB 4FQCH 1CR9L 3WN5B 1LO0L 1MY7A 5IGXH 3VFRA 2IH3A 4UNTA 1FFNA 2VDMH 5SWSE 4XGZB 3H9SB 1KJ2A 3LKOA 4MD0A 4HPYH 5SWZD 1EAPA 3FFDB 4P0DA 3BYTA 3C6LD 3QUMA 3EYOB 3JZ7A 4MCZB 4ERSL 2BERA 5D2NA 4N8VG 1LO2L 2PTUA 3F12B 4BZ1L 3NN8A 5DD5L 4WWID 3VXUB 4PGCA 4L8CA 2Y23A 4LNRA 2VLJB 1QFUL 3PDGA 4S1RL 5KVGH 2D03L 3O9WC 3CGTA 4KV5E 1ZAGA 1INQB 3RVUD 1N5AB 4CVXA 4LKXB 5IEHA 2VE6B 4IMKA 1S9YA 4U6XA 4G8IA 2CXGA 2NZIA 1XF5A 1I75A 3SDAC 1AJ7H 3RVUC 1LK2B 4FFWC 5C0AD 5MHSD 3DRQB 4M7ZB 4TULL 4KKLD 1IAKB 3DLQR 1IILE 5H37G 1UFUA 5IB1B 4TUKH 4YIQA 5JOFA 3FQRB 1J10A 2CDGA 3TP4A 2XKNA 3SHSA 1N7MH 3FJTA 1UWGL 4Y4HC 2V2WA 2HT4D 3L1OL 3BQUA 1M7DB 1T1YB 4XNUH 1DFBL 1F3JB 4HBCH 5E2UL 2QQQA 4X0KB 2HH0L 4JFDD 1GZPB 3AB0B 2YWZA 4Y4KA 5FECA 5EPMB 1FC1A 3VD3A 5KVEL 3TO2B 1Q94A 5I1DA 4UTAL 1T0MA 5DHVA 4XVSL 5IMMA 3EJJX 3ARWA 1QR1B 2AXJA 1EGJA 3SOBL 3VXUE 4YZFF 3NIGE 4LVEA 3L3HB 4HUWA 1EO5A 4GRMA 1NCCL 1MF2H 2LVEA 3MV7A 4Q2ZA 1R5VA 1AH1A 4UILL 4NJAH 3RGHA 3GRWA 4JO4H 4AM0A 1QYGH 4JPVH 2NW3B 3P73A 3BRDA 1Q9KB 3FB5B 3GK8H 4FQIH 2Y72A 4QF1A 4F7EA 3OJDB 2PXYC 4BUHA 3KXFE 3W11D 4WW2F 5HBBA 2R29L 4QRRE 4HWZB 4UTAH 4JQIL 1N5YH 1WBYB 5MEND 4X80L 1UM5L 5BMFH 5DJ6B 4LSUH 4KRPC 4C58B 4UBDC 4PRNB 2X4SB 3QNYB 5IQ7H 1MCOL 2IWGA 5E8DH 1AI1L 2VQ1A 4UU9B 5I1AB 2Y5TB 3AROA 1LQSR 2F58H 4PJ9A 3I02A 4H25B 4JVWA 5DZLA 4NOFA 1UJ3A 5DQDL 3N1PC 4QCIB 3FCTA 1ZSDB 4PS4L 1V05A 3RAJH 2WLZA 4EDXA 4R4BB 5CEXA 4N5UA 5BCAA 3MJ8B 3N1MC 1CGWA 1D9KC 1RI8A 4GFTB 2QQNL 4ZO9A 2ZOKB 4HXAL 3CFKA 1DBML 5C0JB 2K1MA 2VB5A 2YD4A 5IF0B 3BAEL 4P59L 3P11L 1T21A 1MCQA 5HYSG 3G6JF 3MLUH 3T1FB 1MCSA 1A1OA 4C56D 1ZLSH 3RKDC 4GKNB 4DKFL 1OTUD 4WO4A 1UM4H 2E6QA 1GGUA 2E7CA 3RAJL 3TC9A 2IAND 3DSFH 4RBPH 1D9KB 4QT5B 2ENYA 1WFTA 3PWPA 4N90D 4XC3L 5A2KH 5DQDH 3U4AA 4LDLB 3MLTB 5F9DC 1CU4H 1EEYB 5D93C 4NO3B 1M4KA 3TPUB 1ZGLP 1K8DA 4NFBA 3A6CH 2VITB 3MCKA 2ARJA 4PGJA 1Z0NA 5IKCA 1FG2B 4ORGA 4X8XA 4UIKH 3CMOL 4FQXD 5JQ6L 4FXGA 3SO3B 1YMHA 5MEPA 1H15B 4YXHL 4FQQB 3O81A 3MROB 4KZDH 4I5BA 4FQXC 4MX7A 2QQKH 2D31A 3CK0H 1UENA 2Z8WC 2DM2A 5C0CD 3OWEA 4MA8L 5DEFA 2DKUA 4F33B 1VGKB 5I1IH 1GZQB 5CBAA 4XAWL 4S1SL 2G5BA 2VLKB 2WAHA 1ZHNA 3H3BC 3PIQB 4POZC 3GJFH 2WIIB 2JCCF 4KTDL 3LY6A 4ZUUB 5GJTH 4FFVC 5MHSE 5D5ME 4X5WB 4PRID 1Q72H 1IZKA 4KVCH 2IQ9H 3QFJA 4BSVB 1RUQH 3SKJH 4MJ4A 3KDMB 2A73A 1Y6MR 3B9KC 3DI2B 1T04B 3TWCH 4F7CB 3OJ2C 1J8HA 3BP6B 4LCCB 4XPHL 4PJBA 1G6RB 5F7EL 4LLUB 4PG2C 2WK2A 3PQYA 5DFWH 1X9QA 5IHLB 4YDIH 3ULVD 1CXIA 4LPXA 4WU5A 5IROC 1E4WH 4ZXBC 1J05A 2YPLB 4NOBA 2FEEL 1ORSA 4MQ7B 1EIBA 2DQFA 2YZ8A 5DJYA 4XBPA 5DJCA 1MJJA 2EYRA 3IAGC 1BQSA 1A3RL 1ACYL 1OAZL 1YJDL 2VDLH 4ZSOA 2X10A 4HKZB 5JW5A 2P5WB 4PJEF 2NY3C 3BZDA 1YPZB 5E99H 5I17A 1KLGB 4NT6A 5FHAL 2Q7NA 3TESA 4LPTA 4MNQE 1CXKA 5T3XH 3RDTB 4JPKL 3HMXH 1ZVYA 2VL5A 3P2TA 3CXDL 4K9EC 4AT6A 4XXDB 4OZ4B 5DRNA 3D69B 1R5VB 2YUZA 2WW8A 5HYSA 2EZ0D 5F7MC 3WXWH 3RNQB 1U3HD 5DMIH 2HJLB 3SE4C 3G08B 5FYLE 3TT3L 4E41D 2XKSA 1IBGH 4ZUVB 2PKDA 2EZ0C 1SYSA 5CZXD 2D7TL 2F54E 4QRRD 2OSLB 3SEPA 3ARPA 1OF2B 3S5LG 5C6WH 3ARUA 4HG4J 3TYGH 3O0RL 3ZL4L 1CD1B 3VXMD 3MFFA 3CC5B 4KTEH 1PKOA 5ADOH 2BSRA 3OKEB 1QA9A 1HH9B 2NY4C 2ZP0T 2A38A 5HHPB 4YWGL 5CUSL 2ZOLB 3J7HA 3S96B 3DUSA 1MFAH 5ID0A 4KRPB 3MGAA 3LKQA 1FL6A 3LIZL 1Z0MA 3RX5A 5C0CE 3VRJB 5LG1A 1JPFB 4F7MB 1A6PA 2QBWA 2QR0A 4W6YB 5T33H 2PXYB 1WIOA 4KQ4H 2BSTA 5CEXB 1F90H 4P2RE 4YHML 3SGDH 3KYAA 1OD7A 1CFBA 1FJ1A 3O4OC 4OCRH 5F9OL 2QSCL 1RZJH 5SX4I 1X7QB 3BJLA 4NP4H 2R0LL 2X9YA 4M48L 4YWGH 4PJAB 4RQQA 2YA2A 5DD6B 2ERJB 3IDGA 1DVFD 2F15A 4WCYL 4Y2DB 5BRZA 4NRYA 2QEJA 5ADPL 1BJ8A 1SJHA 4Y89A 4CADA 3SKNA 2ZUUA 2OK0H 2FJHB 2A2QT 2MCG1 5I15H 3KHQA 4Y16A 5LQBL 5CINL 2BMKA 1VADB 4G9FA 1FO0H 1KCVH 3ROOA 4XCCH 5FIEA 1NBYA 3R1GH 3QQ4B 1X5ZA 2R9HD 2P46B 3KYKL 3HMWH 4TPRH 5E6IA 5L2KD 4UOW1 2ZUVA 4OZHF 4ZXBA 3KLAB 3PHSA 3KJ4C 2HT2C 4DAGH 3DVIA 1S5HA 2UYLA 3P73B 3K8KA 3VCLA 2XTJB 5J56B 4R96A 2C3WA 5CHNB 3B2UC 5CWSB 4AIOA 4I0PC 1JGVH 1WIPA 2Y7QB 4KJYB 3VI4E 5E70A 3SDXF 2C5DC 5EOCJ 4BSJA 5IB2B 5FGBC 3QDJA 1X4XA 5ITBL 3VFPA 2JB5L 1A4JB 2V7NA 5T3ZE 2VMFA 1ADQL 1KFAH 4LBEA 4OLWL 3S37L 3PABB 2IBBA 1R3HA 3DVGB 1P1ZA 3BDYL 4NZRL 5EULV 4NKIH 3JWNC 3D3VA 4XPAH 1U92B 3WNKA 5H35B 1BF2A 3AMLA 2HFFA 2Y36L 2FATL 2CDFB 4YO0B 4X7TB 1A64A 1WITA 4RFNB 4U6YB 5IB4B 4PV9B 1WBZB 1EHXA 1ZV5A 5E08L 1EZVX 2BFVL 3FQUB 3VXNB 4WNQB 1FNSL 4NZTL 4MAUH 1DLFH 1XF4B 1RUQL 3SKJL 2Y1VA 3MOAH 2A83A 1G9NL 4XC3H 5ISZE 1IAKA 3MXVL 4V2BA 4WTZA 1KYOK 4Y5YB 3HAEG 1I9RH 1J1PH 2R2HA 3TA3A 4FQLL 5D7LE 3TN0B 2XZCL 3REVA 4M8VA 3G6AA 2E7LC 3PHQA 1MJJB 5ICYA 2QTEA 4G43B 3A0OA 5HHQA 1OVZA 2PR4L 2VR4A 1I8IB 2FX8L 1MI5E 1CF8H 3FO1A 2H2PD 2XN9D 3JWOL 4IOIB 4XB7A 2FEDD 4R26L 5D2NB 4L4VD 5GRJL 3VG0H 3W9DA 1RJCA 3FQTB 4MA3B 4GUPA 5B39B 2BNUB 4YBLC 4GAJL 3ILPB 3MRHA 5DMKA 1DUYB 3SDDC 5EOTA 1DE4A 1K6QH 1HDMA 3QA3A 2R1YA 3S7GA 1I9IL 4DVBA 4U05A 4X80H 1KJ2B 3LKOB 3WHE1 4GKZA 4WV1B 3BP4B 3GNMH 4TUOA 4PY8I 4G8IB 1QSZA 3SGEI 4JPIB 1GVIA 5LXGH 4MQXC 5C6TH 2DJUA 2R56H 2DMKA 1VFUA 3IS1X 1NAMA 4YHNA 3GIVB 2DWDA 4JFDE 2X1PA 3H6JA 5T1KA 1KXQE 3VXPA 4GW1B 3T04D 1CD1A 3DUHA 4NUGL 3WS6A 5T1LB 5EIIB 3IDUA 4KI5F 4W4NA 2XWJB 5IFJA 4UT6H 4YDIL 4JO1L 5ALCH 5BV7L 4FQJH 3DBXA 3Q1SL 3I84A 4PTUA 3VFOB 3FZUD 2AABH 3PWLB 4GT7A 3TIDA 2V7HB 3V4UL 1GGCL 4JCLA 4PRHD 4N8CL 4MNQA 3WHXA 1LO5B 2I24N 1A9EA 1I7TA 5C0EA 4LGRB 3DGGB 1A6TA 4UINL 2R23A 2VERN 3GHEL 1HQRA 4HUMB 5ITFA 4U6HB 4IRZL 3KPSA 1J0KA 4YHOH 3BPNB 1HH6B 2AEIT 4BH7A 4K8RL 3QJFA 1GSMA 4LFHG 2OP4H 4OV5A 3WJJC 5IV2B 3LPFA 3MRRA 3K1KC 4KQ3H 4Q6IB 2BY1A 4OGXL 1JYXA 3D2UD 3ZYOA 2WWMC 4HQQH 4YEFA 3LV3B 4HGMA 1BBJA 3DECA 2VLKD 1R5WB 2KKQA 3M17A 3VU2A 1FO0B 2C1PA 3RUGA 3RL2A 4IRJC 4YHLL 3L5XL 2ZJSH 3CUPB 4JFDB 3RX8A 2B20A 2Z31D 5LGKA 3L3OA 1JNNL 2XACC 3D0VA 4HAFA 2Z35B 3MUZ1 4AQ1B 1I1FB 1DEEA 5HDQH 4WTZG 1T20B 1E4KA 4W70A 5EC2A 1BIIA 1QFWH 1QFWM 2Z31C 4V1DE 3BPCA 4XMKH 1LEKA 3AREB 3OF6A 4PRNA 3QUKA 4JM2B 4MS8D 3MJ7A 4XP9H 3SDXB 2FWOB 4CVUA 1T5XB 5GISH 1A4KA 3DO7B 2ZKHH 5D70L 2Z91A 1Q0YH 5KS9B 3EUUA 3T77A 3NN8B 2EC9T 1CBVH 1UWXK 2Q8BH 5JA9A 1FYHB 4ODVH 3UYOD 4LPYA 3EYVB 5D6DC 3OPZH 4G8EA 4GAYA 4RFEB 3TEUA 4PLKC 1U58B 4X6DA 5CD3B 1JYVA 4U6XB 4HG4K 1J0IA 1NCUA 5DQJB 5CP7A 4C83A 1RK0B 2BVOA 1HH9A 4O58H 4E42A 5D72H 1EO8L 1D5BB 2OR7A 3EDFA 1A21A 4LRIA 4MJIB 5BVPL 1VEMA 4ODHH 4M7KL 3VRJA 2AAVA 3C5JA 4XC1H 2OLDA 2FLRT 4LLYB 3GSOA 2DLGA 2KZ1B 4GSDL 4NZRH 4WCYH 5JLZB 2FSEB 4OB5H 4JZJA 3P40A 4EN3B 1MWAH 2UUDH 5GGVL 2DBLL 4RFNC 4X7SL 1IGMH 4RA3A 1E4JA 4PR5A 1LP9E 4UQ2B 2F5BH 1KEGH 3O6LH 5KOMC 2FYYB 1FNHA 2F8XC 2YKLL 3U7YL 5I1DB 3VFWA 1BZ9A 3ARBB 5BW7C 2DLHA 5KS9E 4UMGA 4ELME 3IYLW 4POZD 4A2MA 4H5SA 5JOEA 4WO4B 4U1IB 3DETC 4JGJA 5E8NB 4DZ8B 5GS1C 1RPQA 4JPWL 2H26B 4ZXBB 4LEXL 2QKIB 4AENB 5I1EH 3GJEB 5GHWH 2YSSA 3DETD 1YN6A 1VKXA 4NQCE 5E94B 5IR1A 4JZJC 5KSUA 2VITA 5TH2A 1MJ7H 3LPGA 4NT6B 1YYLH 4YHZL 2OTPA 2CPCA 4J1UA 1ZANL 4JAMA 1P53A 2XI9A 4OT1H 5AD0B 4YE4L 2EXYD 3OAZK 1H5BA 4A2LA 2F8OA 4N90E 1UQSA 1AR1D 3K2UL 4QYOA 4UTBH 3KPLB 4PBVC 2N1KA 2UZIH 5HI4C 3NACH 2DRUA 4XHJD 2JB6A 3LN4A 2R0LH 3IAPA 2BHZA 1T1ZA 1DFBH 3S4SG 1BD2E 3VXPB 5I1CH 4IMLA 1U8PA 4UU9A 2P8PA 4XHJC 1WT5C 2IPUK 1U8MB 2HFFB 2QV2A 3ARGB 1R5IB 3MLWL 3VD4A 3L3IB 1Y18A 4I3GA 4TSBH 7FABL 1S7SB 3GSXB 5GGRA 2R4RL 4C54A 4YDKL 3ARDD 3WHXB 1TZIB 1SVCP 3HI5H 3N1QC 1RJLB 3BEVA 1CFSA 1QLEL 1KCUL 1ZT4A 3MJ8A 4MYWB 4LPVA 3ZT7A 1T0NB 5DWUH 3FO2A 4PJCF 5LGJA 1PLGL 3VWJD 4D3CH 5T1DL 1JFQH 4I18A 5FYJH 4JM4H 2DD8L 1MEXL 4NQCB 3AS1A 1U42A 3DX7B 3GMQB 3HG1E 5F9JB 3T2PA 4K94H 5EN2A 4F58H 4P46B 5I9QC 4APQD 4EI5D 3BPLB 3KJ6H 2V2TB 1G7IB 1INEL 4RDQF 3ZYJA 4HC1L 4U6VH 3RWJA 2X70B 5KBNC 2EE6A 5CEZE 1TTUA 4Y4FC 5ICXA 2XV6B 4F15C 4HX1B 4U1KB 4APQC 4EI5C 3CFBB 4JFPB 2RCSH 1S7WA 4PRPA 1WCQA 1AGFB 3N9GL 4N1HB 2C7UB 4KAQL 1YUHA 1PQZB 3PQYE 3ZTJH 5HHMD 1BD2B 5DWUL 3RI5K 4LEXH 1EHAA 4RWHA 1X5GA 5C0DA 4PJ5A 3A6BL 5HHXL 1NGYB 4ZYKB 4QHLA 1GYAA 4QRTB 3MLXL 4MWFB 2NW3A 4ZMAT 4JO3L 3LS4L 1MWAA 4ISVA 1OGTA 4U7MA 3RNQA 3QEQD 4DN3L 1A7OL 1ACYH 2YRLA 3OGCA 2W60A 4KQ4L 5HHNA 5LBSL 2FATH 4IJ3B 4XWGH 4MB4A 4M8QA 4GXUM 5CSZB 1DVFC 4YDVB 1KEGL 3PDDA 5A40E 1ZVHA 3LIZH 4KJWD 2VISA 3H9HB 3GMNB 3DXAB 1NC2D 2DQEL 4QRUA 2ZUYA 1KCRH 1ADQH 1WQVT 1CE6B 3DSNA 4OLWH 4Q74A 5I1JL 1A14L 4KROD 3BN3B 5ITBH 5L8LB 1NBZB 5I30L 1ZANH 3CVIL 5D1ZA 3HZKA 1DP0A 4MMXC 1GIGL 1M7DA 1T1YA 5I15L 1A7PL 3HI1B 2GT9A 3QFJB 4JG1L 1K8IA 2CRYA 3O3EB 3S36X 1HSBB 4YC2C 5GHWL 4P5KB 1JJUA 1QSFD 4OLUH 4LLAA 4LLUA 1JIBA 3N85H 4G7YH 3WO3B 3NA9H 5E2TH 3E8UH 1J7VR 4NCC1 5C0JA 1DQLH 4PY8J 5I74B 4WW1A 2ITCB 3CK0L 3VWJB 4PR5B 5AG9A 4MNHB 5IFAL 4QRSA 3RWIA 1HZHH 2NY7L 1D5IL 3PHOB 3EOTL 4NWUL 3V7AG 1KCLA 5GRUL 3MOQA 3RWHA 4P5MB 4POUB 3W81A 4F9LC 4XMKL 3U9PL 2R2BB 3JTSB 4XTRC 1QTYT 3EYSL 2FX7L 3ZTNL 2JIXD 3RWEA 4N0YH 1W72A 4NQUA 3TO4B 4JQVA 3UTZB 1L7TH 5D71H 3KNBA 5EUOE 1M05B 3O4LD 5T33L 4F15B 2XWBB 1FFPB 3TA3D 1UM4L 2XN9E 1U8QB 1RZIB 4KK9C 5T5FH 4XPFH 3RL1A 4FTVA 4OF8A 3QRGH 1DQTA 4J1UB 4M7LH 2J88H 1CLZH 5DQ9A 4UI2A 4N9GA 1F6LL 4PJDA 5C0BD 1I4FA 4X6FA 3T2NL 1T3FB 3E1F1 4CMHC 4FQIL 5C3TA 4PYGA 1TVDA 3GMRA 3NBNA 4RDQG 1QSEA 4XAKE 3RWCB 4OLXH 4XCYB 4Y16D 3QB7C 2ZSVB 1BFVH 3CLFL 4DQOL 5DFVC 4IEFB 1LILA 3QPXH 3S3PA 1LEIA 4BQ8A 4NPYB 3STLA 3QCTH 4U2YA 4RRPG 3V6BR 5K9KB 3T1FA 5CJQH 1MJ8H 3QWOA 3FT2A 1XH3A 1NLDH 1MLBB 2IBGA 1VESA 2IPTL 1NCDH 2XZZA 3WUZA 4QWWC 5I1CL 3BMWA 4Z7OF 5EG6C 2WUBH 3I6LE 1KN4H 1XF4A 2WM0A 1A7NL 1AO7B 5BO1L 1AP2A 4XNZB 5EUOB 4Z7UE 3VXSB 1ZGLM 4OGYH 3ZE1E 1NCBH 1QRKA 3K4ZA 3GUTA 4NO2B 2I27N 4HQQL 2Q7YA 4G6KL 4M9PA 4CADB 3QJFB 5JUEH 1UZ6E 2AEQL 2DKMA 4RISH 4EXPX 1W8OA 1S7XA 1HXMA 2J6EA 3EDKA 4LKCB 3ARRA 3HE6D 5EU5A 1A47A 2PYFB 4U3HA 2YZ1A 5BO1H 4P2RA 3RIFF 4DZBB 1G9EA 3WD5L 4GG6E 1HCVA 4HEME 1BFOB 3V8CA 5DGQA 1I85C 3PWPD 2H8PB 2KH2B 5DMKB 3QBTB 4NNXA 2X4NA 3X3FH 4CNIB 2VSCA 3NCBB 2J8UA 1QRNB 5FV1L 3L7EB 4G42B 1P4IL 4PY7B 2FBJH 4KJYA 4K9EH 1HYSD 1J8HE 1KENH 4CMMA 3UYRL 1DN0B 4MZ3A 3PWUA 2V5TA 2J1KA 3LS5H 3WIFA 3VFNA 3IDMA 4U33A 4YHIB 1J1PL 5GISL 3WFHB 1LE9A 5DLMH 4GRWB 4X7SH 3MBED 1P4BH 4FRWA 5C0EB 2XG5A 3V52L 3QJHB 4LLVB 1CFQA 1L9MA 3DYOA 5F8QC 4MNQD 3B5HA 5HYJA 2BSRB 3CLEL 4YXKL 4KUZH 4XCNA 2VXUL 3BN9D 5HHPA 1BZQK 2ESVB 5D8JH 3QRGL 3KPRD 2IF7A 3H9ZA 1A9BB 2YD2A 4OKVA 4K3DL 3QIUD 5I18H 3CMGA 1UM5H 5BMFL 1G7HB 2DF3A 4EDWH 2OR9L 3S36L 5IFHL 1KG0A 1NCDL 1H8OA 1KIRB 2GI7A 3HLAA 3Q48A 5DTFA 3T3PE 4G7VH 4QOKE 3IDIB 4XBEH 4QHMA 3P11H 1OAYL 4Z7VB 4QRRA 5JOPE 3C60C 5IB3B 4N0CD 5D9SB 4XP5H 2EE9A 1NC2A 1NMBL 4DVRH 1FVDB 3DUSB 4JZNA 5ID0B 4H1LA 3IFPA 1ZE3C 5EU6D 5I8OL 1EHLL 4P46A 4U0RC 5FECB 4MMZC 1GXEA 3TO2A 3ZDZF 4S1QL 3QPXL 4RGOL 5HHVH 1CICC 1MFEL 4RNRB 1BBJB 4EN3A 4OLXL 5E2JA 5E4EB 4NWTH 2CK0L 3GSNL 3MLUL 2PF6A 1ERNA 5E5MB 1AGEB 2VDNH 3BFOA 4YPJA 3RA7H 3VWKB 1GOGA 2VDKL 5J1AB 5F89B 3S3SA 3WLWD 4PJ5B 2FO1A 5GGSA 3T4YA 3ARBA 3EHBC 1MFDH 1CN4A 3OAUH 2YC1A 1HKLH 5FOBA 4D9QE 5DRXA 1TCMA 5DSCB 4G9FB 1J12A 2PCPA 4P48A 4ODTL 5LGHH 3VGFA 4F7TA 3TO4C 5I1KH 3SJVA 3NPZB 4WI3A 1KLFA 1EZVY 3KXFD 1PSKL 3BD5A 3SPVA 1N3NA 2X5PA 4LVNC 2IGFL 4P2OB 5I16B 3NABL 4XCFH 4DGYH 5I19L 1NCAH 3QUML 2OBGA 2FRGP 1FRGH 3B2VL 4P9MH 3ROLB 4RGMB 1DBKL 2XY2A 2FB4H 3JWDH 4DKEL 4NHUA 2WMPA 2EDBA 4QYOB 2NX5E 3P0VL 3KS0J 1RHFA 1JHTB 4PJGB 4OI7A 3BHBB 4LRIC 1T66D 4PJDF 1IC1A 4X6CF 4PV9A 3MRCB 1QYGL 4JPVL 3IFOB 4FP8L 2YPKA 5ILTL 4PUBH 2CIKA 3P4OB 1S8DB 1DL7H 1BFVL 4JGUA 5B4MD 3SDCC 4M62H 3QO0A 4MDJB 3SDXE 2EKJA 3OKOB 3NCYP 1NJ9A 4OUOA 4K23H 3MXWH 4KKCD 5EO9A 2UWEB 2AEPH 3FAXA 1DQDL 2ZCLH 1AHWA 3RU8L 4LNVA 1CR9H 4ZNCD 3O6FC 5C07E 3KPMB 5ADPH 1NFKA 5HHQB 1D6EB 5TQ0L 4GJTB 4ZNEA 3CCHA 2EIEA 2NMSA 4WUKL 2H2SD 4B50A 1H0DA 1UG9A 1KB5L 2IAMC 2ICEB 4EIZC 5E2UH 5J1SC 3KPPB 4MAYC 3ALWA 1B6DA 1F90L 3SE3A 2RQ8A 4EN3D 5J9PB 4PRDB 4MJIE 1YC8A 3HZVA 1BEYL 2K3TA 4WEMB 3SN6N 5KS9F 4JFFD 5T3XL 2J8OA 3WFEH 1U91B 4MAYD 5B21A 5FYKH 5I2IA 2FX8H 2P5EE 3WL9B 1NFDB 4DN4H 3BT2H 3CFCH 5HHXH 5I6XB 3MLWH 4LU5L 2X7LA 3GMPA 4X8JB 5FK9A 1EFXD 1NAMB 3E3QC 4K7FA 1DE4B 5IBTH 1N59B 4U1LA 3RJDA 3FB8A 2VDML 3G5XB 4U3CA 4X7EC 3EFFB 3TNMB 3WNOA 3QG6B 4KV5F 2AJ3A 3T3MF 4PRPE 3HPLB 5CLWA 4FQCL 2YK1H 1YEGL 1OW0C 4XNQA 2UUDK 4FS0A 5CKGA 4JPIA 2WINB 4JY5L 4PJ9D 1IGIL 3U36A 2F5AL 3WNLA 4X4MA 3FFCB 4IDJL 5F7UA 1YYLL 1AKJB 3QDHA 4NDMB 1GAFL 1A7PH 2C1OA 1WZLA 1MCPL 1UM6H 5HDBE 2R2HB 1NAKL 3TA3B 3TN0A 1CG9A 3QO1A 2YXMA 3CVIH 3PP3H 3VXRA 5ICZA 1DSFL 3HUJB 5GGVY 3AY4A 2F8VA 2NY0C 5L2JA 2VR5A 1D6VH 4F80A 4OLZL 3RTQA 2GT9B 4YR6B 3VA2C 5GRUH 3BE1H 1SEBB 4P23B 2ICWA 3FONA 5I0ZA 4PGEB 1VB9A 1NL0L 2EYTB 4AH2B 3ECBA 3ILQC 4Y5VA 2ADFH 4UOJA 3MNVB 1JGEA 3QNXA 4OQ1A 1VA9A 5LBSH 4OGAD 3MRHB 2VLKE 1RZKL 2BOBA 1X5YA 3LQAH 1MIEH 1ZLVH 3VG9B 2IANE 2DYPA 4F37F 1HNGA 1WWBX 4HJ0C 4X0KA 1N0XH 1NBVL 4HPOH 3NIGF 3UTTB 3PV7A 4RGNB 5AEAA 4U49A 3BPLC 5D1XD 1NLBL 1YN6B 3Q6GL 3GJFB 1H9VA 5T3ZH 3HG1A 4J6RL 4PJ8D 1N2RA 3LKRA 4M93C 3U0TA 4P46D 3V6OA 5DURB 4ODHL 2XWTB 1MWAB 4ISVB 2NZ9C 4KGJA 3ME0A 5F7HA 2MCPH 5EBMB 5GJTL 4JDTL 1OLZA 4JVPA 3NZ8B 2NY5H 1U95B 1W2KT 1TNNA 1WTLA 4OFKA 1OAQH 5F93C 5BRZE 5F3BB 2CKBB 4F8QA 3QPQD 1JPTH 2HN7B 2BHYA 3U7AA 4O2EA 5GGTL 1KBGL 4R9HA 4W6WB 4MJID 3QDMD 1LO5A 5ETUB 4RRPA 2ARWA 3T65B 1YPZE 1HIMH 1BD2D 1HQRB 2GK0B 1RIUL 2F53A 3CAFA 4H0GA 3RGVD 4XCNB 2P24B 1XR8B 4N9GB 4PJDB 3HMXL 2VAAB 3QWRD 1KPUA 3QIWB 1BVLA 5IEKA 2MFNA 4P3WA 1JWSA 2OTUB 3QYCA 2AI0H 4XPTL 4NIKB 1AQDA 2IANB 1JI2A 4FZ8L 4TQEH 4MJ2A 5E1AA 5K9OA 1H3VA 1H8SA 15C8H 4Y4HB 2ZG1A 3Q0HA 5MEOA 4KK9D 1RUKH 1T2XA 3VMOA 1QO3A 1X7QA 4CJ0A 4FABL 4OD2B 2YN5A 3AB0C 4U4BA 2CK2A 2WUCH 4PJIF 2HP4A 1QLFB 3CUPA 4JFDA 2ZSWA 4NN5B 3VE0A 4DGIL 3QSKB 4X5XA 2QQLH 4JY5H 2NTSP 4W4OA 4PP1C 1VPOH 3BKYH 2P8LA 1K4CB 1LDPH 2ADIB 1WEJH 5CILH 4L3CB 4Y16C 5EOQL 1NANI 4JQXC 2JIXA 2X4TA 4U1JA 3VW3H 1VADA 3IRPX 5IW6A 1D7FA 3GB7A 1DBMH 4ORZC 2AJVL 5I75B 4PLNC 4OFIA 1U8KB 5L8KB 2CKNA 4N0FA 3PGDB 4R6UA 2A0LD 4X98A 1WGOA 4LRNH 2OMNA 2YPVH 4OCWH 3MBEA 4MB5A 1RURH 3ARGC 5ERWB 4XGZA 4QTHA 5DI8B 1BEYH 1KGCE 4S11A 1UADC 2DLIA 3RWGB 3OL2A 4ZOEA 3NOIA 4OJFH 4WWKD 4Y0GA 4L8DB 3GMRB 1UKSA 5J3HD 5TE6H 3VXME 3I6GB 2Q8AL 3FN0H 1KGCD 4M7JH 5L2KA 3WJLC 2DM4A 3NH7H 3W2DH 5C7XH 5ELIA 4CW1B 4YXKH <