2P24B

I-au/mbp125-135
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
216
structure length
194
Chain Sequence
RGYGGRASDYKSAHRHFVVQFQPFCYFTNGTQRIRYVTRYIYNREEYLRFDSDVGEYRAVTELGRPDAEYYNKQYLERTRAELDTVCRYNYEETEVPTSLRRLEQPNVVISLSNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRAQSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, A-U alpha chain
publication title A new twist in TCR diversity revealed by a forbidden alphabeta TCR.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 44
structure length 194
sequence length 216
ec nomenclature
pdb deposition date 2007-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p24B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2p24B01
5IBUB 4MNQD 2W65B 5EUKB 2B5IC 4HFUL 1BOYA 1ZGLB 4HPYH 5ICXB 1PEWA 2XTLA 4R7NB 3WD5H 3T4AB 5E9DB 3IF1B 3MROA 5TE6H 3T65A 5BRZE 5CD5C 5LKNA 2CSPA 3P0GB 1T1WA 2OTUA 4UNTA 5EOCH 4YFDB 2ITCB 4AG4L 2AK4B 3I02A 4OLUL 4EI5B 4RSVA 1A7OH 1ADQA 1KIPB 2HJLB 2V2TA 1PG7W 3W2DL 3PP4H 2GQHA 2A2QT 4TSAL 5DVKA 4GG6A 2A73A 4O5LH 4UT9H 3PHOB 4M8QB 4U6XA 2DQEH 1ZXQA 3SKJL 2A74B 4X99A 4QHKJ 3VGBA 3F62A 1BQHA 5ACMA 2YA2A 3HE6B 1CGVA 3RRQA 1FZJA 2MPAL 3AY4A 3MLWH 4M6MH 2EYTB 2VLLB 2WP3T 5SX5K 3L95A 2IANA 2PO6B 1ZHBA 5GZNC 1ZKAA 4J3XA 5LAXA 5I8KL 1CLZH 1HH6B 1T20A 1AGCA 4ZFFA 4N8VB 3OJVC 4OFVA 5DJAB 1BVLB 2YEZB 1C1EL 4LCYA 4JG1H 1WV7T 1DLHA 3BD4A 2VKWA 1CZ8H 1JGDA 1IEBA 1UZ8A 5CP3A 1JIBA 2GY5A 4K3EH 3K0WA 4PLJD 2CGRL 4I9WD 4K07A 2MSPA 3LEVH 1JK8A 3VFGH 4R8WL 3HTLX 1HE7A 4WY7H 5D2NB 1T5XB 1FZMB 1KXTB 4CU6A 1NSNL 4W4NA 5IMLB 5CIPB 1RJZB 1I9JH 5KZCB 2NYYC 1F3JA 3V7MA 4LSDA 3RU8L 3QRFM 3V4PH 3LB6D 3HC4H 3FAWA 5CKAA 4JDVB 3FT4A 1UADC 2EE3A 4EDXB 3V8CA 4K23L 4J6RH 1U41A 4TSBH 2NZIA 1UB5B 5HVFB 4ZFGH 2D2OA 1ZA3B 3NPSC 3R06B 4HUKB 4WW2C 2ADJA 4P23C 1BD2B 3EYQC 5KS9A 2DWDA 4MJ5B 3B8YA 4IRZL 4HJ0C 4F9PA 1FYTB 2YD7A 3A6OA 3DX6B 4LCWE 5E99L 1WCBB 4PS4L 1RFDH 4ALAL 2F5AL 4F58H 1U3HC 4NM8H 2X89A 5C09A 4KY1L 4TULH 1GGBH 3HN3A 3X12B 3V95A 2P8PB 3EOYG 3IDUA 4YAQA 1BWMA 4L3EE 2UUDH 5DK2B 2WP3O 3QUXC 2VISB 2EC8A 1ETZB 3QDGA 3VFRA 4DZ8A 5T33H 3IGAB 5FK9A 3D85B 3CDFA 3VXUB 3QA3A 2J8OA 3SGDI 4GG6F 1FNEB 3O4OB 5D1ZA 1ZHKA 2EICA 2UZIH 2FHCA 2Q87A 3VI4E 3LS5L 5TPWH 1ED3A 1JGVL 2X4PA 3D0VA 4WWKB 3OKNB 4YDIH 5EU6D 4XVSL 4ZUTB 4LMQI 3F58L 1JNLL 3KLAB 1A0QH 5DHVH 3O6FB 1MCIA 1X5KA 4NBYB 3W9EB 3L7EA 4L8CB 4OM0L 4QRPD 2OTWB 2WUCH 3REWB 2PW2B 1WBZA 2V7HB 3FN0H 3BAEL 2BNQB 3QEUA 4PRPA 4NQDA 1X6LA 3UTSE 2VN7A 1AKJA 4EN3A 4CJ1A 1AGDB 3VRJA 5GSRB 3O2WL 4QO1A 3FT3A 2O5ZL 4Q6IC 1UXSA 3VW3L 4M3JA 3EJYC 4PIRF 2FD6H 3C5ZB 2W60B 5DFTA 3QIUB 4XP6L 2IBZX 2H41A 4FQ2H 2FYYA 2YD3A 5FA4B 5DMJB 1ZA6B 1MJUL 5LCVH 4MAUL 3H9ZA 4LNRA 4PYGA 4X80H 5CP7B 4OSUH 1AP2A 3MV8E 1KB9K 1FCCA 2BVUA 5TDPA 5L7XH 3GSRB 1MH5B 4JANB 1LK2A 4I5BA 1I7RB 2LTQB 3QIWB 2K3TA 3BZDA 2BC4B 2SEBA 5MERA 3PJSB 3QO0A 3ARDC 1JPTL 2FJHB 5BVPH 4V2BA 4NKIH 4OCSL 5C0JA 2D7TH 4QTIH 3MXVL 1KULA 3TH2T 4JJ5B 5DO2C 1YEIL 4QTHA 2YS4A 1YEDA 3C6SA 1RIUH 5C9KA 1CLYL 4U6YA 2FZ3B 5ITFB 3V7AG 4G5ZL 3O3BB 4HPYL 2ICWB 1G9NC 1NAKH 3INUH 3WD5L 5F7DA 3TPKA 4FQ1H 2PYEA 3ULVF 3AU1A 3QG6A 1LO3H 4KJWC 3SGEI 3MRJA 4XTRD 5EOCL 1BJ8A 4K3DL 4HUUB 3LQAH 2ORBL 4RFOH 3OKLB 4I2XA 4UIMB 2UZYB 4I48A 4P46C 3C2AH 2ATKA 1KYOK 1P5UA 3QXTA 3J8F7 3KPOB 1UM4L 4LFHG 3T0EE 3VFSB 3JWDL 1U8QA 5E00B 1WC7B 5HVHB 5F96H 4JAMA 3P4MB 4JO1H 1UJ3C 1NMBH 2NY6B 4O02H 1BAFL 4LASH 1U0QA 1QEWB 3B2VH 5KJRH 1JZ8A 3TZVA 1Q0YH 3SDXE 3GMOA 1HN1A 1W2KT 3BMWA 5DVMA 4IRSA 3SDAB 3LEYL 6FABH 4ODWA 1GRWA 4D0DB 2GSIB 2PXYC 4DAGH 3K46A 2ZWLT 3TT1H 1SEQH 3U36B 5CWSB 3CFJA 1AIFB 5GSVB 4KK6C 1EAJA 5BO1L 2A6JB 1DP0A 1FBIH 3MRIB 4UZGA 5IP4A 3LEVL 3W0WD 4N0FA 4YHKH 4XPBH 4YWGL 4XC3H 2R0ZH 3REVB 1W0YT 1DQQA 4M6AA 3Q6FB 4OLZL 3S3SA 4C83A 3KLSA 2OP4L 4HF5H 4PJFE 4MAYC 5JHDB 1YN6B 4PJ8B 1KCRL 5FGCB 3DSFL 2Z4QB 1EO7A 3TFKC 3LSOA 3TO4D 1MLBA 3SDYH 3FOLA 4CRPA 4UOW1 4Z0BL 2JLLA 3RDTC 2E7LC 4OLVL 1XGYH 4I0PC 3NACH 1DL7L 4YDJA 5K9OB 4NQED 2P24B 2GHWB 3I3BA 1FC1A 5FCSH 5GGQH 4F7PA 3BXNB 2YN3A 2WUBH 4DCQB 1A6AB 2DQFB 3NIGF 1OARL 4F58L 4FQHA 1U8HA 1E4KA 5I0DA 4XBPA 3WUWA 4NO2B 1IC5L 2XA8H 4QY8A 2FX7H 5I71B 2ZUUA 4JVPA 4KRNA 5DJYA 4NNPH 4LKXA 2J8UA 4HAFA 2DLGA 5I17B 5BRZD 1QRNE 3X3GL 3MTRA 1A4JB 4EDWL 3SCMD 5I66A 2R0LL 5D1QC 4L4VE 1SY6L 4URTB 1YJDH 1BJ1J 4NJ9H 5A16B 4E9LA 3WS3A 5SWSE 4PJBB 1H3XA 1N3NB 3H3PH 5TPWL 1OSZB 1I1YA 1OAZH 1I7ZB 3U4BH 5I15H 4AQOA 2Z35B 4JRWA 3EFFA 3FQWB 3UJJH 5DD6A 3SDCA 1RI8A 2I9LA 4HWUA 3TJEH 5D70H 4JLRB 1A0QL 1G9ML 3IFNH 3LS4H 4PJAE 4YBLB 5MENE 2BVEA 4FZ8L 3RWCA 3P73A 4HHAA 5A3IC 4KK5D 3JWNC 1B88A 3RL1A 5CZKA 5IW1B 2WUCL 4UAOB 4OZFG 2F8VA 1IAIL 3RGVA 1Q9LB 5DXWA 4N68A 4WEBH 2R15A 4JPVH 4DN3H 4M03A 5TQ0L 5IG7B 1IKFL 3STZB 1WZ1H 2YPVH 3RNQB 1BQLH 3V7AE 3DETD 4L9LB 5FYKH 1XF4A 1A2YB 1T03L 4QRQB 5ENWB 4U0RC 4MXWH 2BERA 3MA9H 1T3FB 2DIBA 4GAJL 3DROB 2FJFA 4HZLB 2N1KA 3GSQB 3WFDH 4L8SA 1HILA 5C6PB 4ORGB 4H0IA 3L3JA 4NSKB 1GZQB 2VLRD 43C9B 4OSUL 4LCCC 1KIQB 1XR9A 2FJGA 5GRWA 4Y4HC 3JTSB 3MR9A 3WHXA 1VERA 4OCRH 4ZS7L 1BLNA 1E28A 4MQXD 4K2UL 3HMXA 3LN5B 4HJJH 4OFDA 2YRPA 4N0UB 3QG7H 3NFSL 4HSQA 5D1XB 3VDBA 3D0LA 2CDEA 4WU5A 2B4CC 1G9EA 4FQCH 3ORJA 4ZFOB 1WF5A 2XV6B 4LPYA 4QTIL 3GKWL 1FGVL 2X4OA 5DSCA 3QXWA 5JQHC 3PWPA 1X5HA 3RVVC 3TPUB 1VFOA 3AGVA 1QBMH 1RQ5A 3EO1A 1LE5B 1BMGA 5JOPE 2XQYG 1B4JL 1WFTA 3INUL 4L3ED 4U1JA 2V5MA 4PJ5D 5C0IA 5E4EB 5EOCJ 4R26H 1B2WL 3HC3H 3UTQB 1S7SA 1KB5L 4XC1H 1UXWB 3NFNA 4YHIB 2E3VA 1MRFL 5C0DB 5FO9A 4B41A 1H8OA 4OTXL 3BPNC 5HGAB 3EOAA 1U8IA 2AJYL 4Y4FB 4AMKL 4YFLF 4OCNC 4P48A 4NDMA 2ED9A 1S7VB 4PRHA 5KVMC 5JXEA 3IAGC 4ZOBA 4X98B 4P4RB 5DR5H 4AEHL 3ULUC 2IAMD 5F96L 3GRWL 3GMPA 3MV7E 3O9WC 3KWWB 4FXKA 4OZFA 1OF2A 2AV1B 1NDGA 3IKKA 5CJOH 5CBAA 2GKIA 2KZ1B 3M8OL 4LASL 3HLAB 1SY6A 5FKPA 4D94A 2L0DA 1U91B 2Z93B 2RJMA 4HEME 1QBAA 4QWWC 4LLUA 2AJZB 2YUWA 1KTDA 4LKCB 4TYUA 3JUYA 1ODAA 2CUMA 4RBPK 5FV1L 3TC9A 2E27L 2ED7A 4X4ME 1VESA 4XVTL 2A6DA 5D5MB 2NXZB 4M3KB 3GM0A 3KYMA 5H35A 2UUDK 1AY1L 1I85C 2FL5B 3I2CH 4LSVL 5IIEB 3I6GA 5DFVC 3NABL 4RNRA 4S1RL 3VXMD 5ERWA 3ETBF 1QVOB 4XI5D 3ZHDA 4M7JH 3MREB 4C59B 5BS0E 1QACA 1LO2L 4ZAKA 1P7KB 2EDQA 3IFLL 3DGGA 3DIFB 1YC7A 3MV8D 1F4WH 2PTVA 4HDIA 1EEZB 4L8DB 3NZ8B 4XBGB 3VWKD 1I75A 3HZKA 5F89B 1DQLL 3SKMB 5J1AB 3H9HB 1CFTA 4JFFE 4RWHA 1HXMA 3PGDA 1TIUA 3S5LB 3CK0H 5IROA 2CKBL 3H9SA 5JIPA 5FYJH 1QSZA 2VB5A 5CAYB 1MJ7L 3CFEB 2X4SB 1YQVH 3SJVE 4U6VH 5KAQF 2JJSC 2O5YL 4U1NA 3GHEH 5T5FL 1OM3H 3QHZH 3QNZA 4WI8A 4PJDB 3AS3A 4O2FA 5JLZA 1BHGA 3ZYZA 3AC0A 3GHBH 2Z91B 1SJXA 5TQ2L 4NZRH 3DI2B 1P84K 3HZVB 4UQ3B 4DFIA 3R1GH 5GGVH 1MAMH 3KLDA 3VFMA 4Y4KD 1M7XA 4OV6F 4ENEC 2NR6D 2F54E 5MEPB 3T0ED 2GAZB 1ZAGA 2IQAB 4R97B 2EO1A 4NC2B 4TN9A 3HE7C 1AD9A 1RMFH 1T1YA 1KB5A 1QQDB 4XGZB 4WI3A 3TJEL 1YNLL 2VL5A 5FYKU 3IFNL 1NCAL 1DFBL 5FM4A 1QSEA 3VRIB 3LH2L 2KH2B 2RIKA 1KTLB 1NC2D 1HCFX 4OI7A 4QHUA 3OAZH 4PJ7F 3KXFD 3RZCD 3RVUD 3GSXB 1CGYA 2HTKC 1MWAA 3GRWA 4YXHH 1VPOL 1RZJL 1AJ7L 3GSWB 4NP4L 4O51B 4TQEL 1G1YA 1AHWC 3BHBA 3QUYC 1BQLL 1WT5C 3DSNA 4MMZC 1DE4B 1MJJB 5D2LB 1EDQA 3LKNB 2OSLA 1T04B 1OTUD 2CDGB 2DYPB 2YC1A 5EBWA 3OV6A 5I1EH 4WGVB 4P5TD 4CVZB 1YPZE 4G6JH 2GTWA 2A83B 3QP3A 5TDOA 1U93A 1K2DA 5JXAH 2ENSA 4NQCB 1NBZA 1EX0A 2P7TB 2IH1A 4R96A 1K3IA 4BZ1L 3CMOH 2NW2A 2R39A 3CPLA 1EA9C 1C12A 5SWZB 2GITA 3GSNL 3RGHA 3QG7L 4QOKE 15C8L 1NJ9B 2BSTB 2R56H 4HKJB 4U6HA 5DJXA 4OF3A 5EIQA 4M43L 2P44B 2FB4L 3NA9H 2B1HL 4YDVB 5IB5B 3HG1B 1AH1A 1HNFA 1JYWA 2ZKHH 5CZVH 1FNHA 2ARJB 1P7HL 1F2QA 1FLRL 3PWNB 4HLZG 3GUTB 5IHLB 2XTJE 4X0KB 5KG9A 2RBLA 1RUKL 5A2KH 3ES6A 2APWA 2CKBA 2G75B 5E8OB 1PKQB 1CTNA 2IFFL 4XVUC 2HRPH 3U7AA 5C0AA 3BVNB 2APFA 1CK0L 3IAQA 1QRND 5C0EB 5JW5A 1KUMA 4Z7QF 5F21B 2ICES 4UTAH 3U1SH 4ELMF 1UM6L 2BVPA 3FONB 2DMCA 4KHXL 3LEXA 5MEQB 4R4BB 4FP8L 4UDUB 3QEHB 1R5WA 1KPVA 2Z31A 2NY4C 4JFYA 1BZQK 4PJCA 3ARUA 1WFNA 2XQBH 2BVQB 1IGJB 5INCA 2VLKB 3R4DA 3QEQE 2XIDA 2GUOB 4F2MB 1YEEH 3T4YB 1NQBA 4MD0A 5CJOL 1TZHB 4H25B 1A7PH 4OLEA 1S7RA 3UTTE 4UIKH 4WNQB 5C0CB 2PTTA 1JFQH 1MHCB 2FO4A 3V6OE 2VMFA 1AC0A 4Z7VB 5I18L 2NCMA 3OJ2C 2W07A 1OCWL 3NCYP 4L4TE 3QI9A 3WE6A 4ZD3H 2F8OA 1VCAA 4J4PA 5F1SA 1KCUL 1A3LL 2Q3AA 5FYJU 3UBXB 3O8XD 3RKDD 4Z7WA 3QWOB 2ITDB 5HYJE 2YSSB 5DJ6B 1V7ML 1KBGL 2R0KL 3MRMB 4MNGE 3CZFA 3QAZB 3WL9A 4GXVL 3TVMA 4NKOB 3UTZB 1CXHA 1F8TH 1X4YA 3W11C 3O4LE 4PJGE 5ILTL 1DANT 4ZQKB 4LFHD 3VFPA 1JHTA 3C08H 3O6MH 2OXGA 3F7PC 1LD9A 3M1BA 2DQIL 2VDKL 3G6DH 1JN6A 3IXAA 4HS8L 1CQKA 2HKHL 3KNBB 3QJFB 4HK3N 3WO4C 2HH0H 4KAQL 3TT3H 2W0FA 3S36X 4JN2B 5M7QA 3GSNA 5JOPD 3HPLB 2CDFA 4RX4D 5DZOA 2NY1B 3RUGB 3GHBL 3N9GL 4YX2L 1JRHI 4XXDA 5GIRA 4ODSH 4XHJC 2Q86B 1UEYA 2EXWD 4NN7C 2VH5L 5C07B 3EYSH 4OZGB 2AXFA 4G6KL 1D5XB 3BQUA 3WCYA 2XWTA 3CFBB 5GPRA 5TF1H 1XT5A 5D7LB 3B6SA 3LKRB 3ARFC 1F4YH 4F8TA 5HHXL 3H3BC 4JQVC 1WIOA 5D71L 1JMXA 3O45B 3Q5OA 43CAA 4YHNA 3QQ4A 3WLBA 2DLIA 1URLA 1CTOA 4OF6A 4FQXD 5KSUA 2LE9A 3QUKA 1A3RL 2OCFD 4POUB 2MHAB 4H88L 3L3KA 3S96A 1ZEAL 3WFEH 4ZUVA 2MQCA 1S8DB 5T5NG 3F7YB 2DWEA 3CLEH 3O41B 1HDMA 1FSKC 3LN9A 4JB9L 1WAAE 4LQFL 4X6DF 1JGUH 5TFSL 4GAGL 1FCGA 1RJYB 1TVHB 5F7UA 3NFPA 2UY6A 1P1ZB 1U8JA 2Y5TA 3DECA 4Z7WF 5C08B 2X09A 1K8DA 3ESUF 4HIHB 4CMHB 2R1XA 4OV5B 3MRRA 5C71A 1E6JL 1CGSH 4IRJB 1CU4L 5KANG 1C7TA 1WWAX 1MFAH 1NKRA 3MPCA 5BS0D 5JA9A 4F9LA 1CFVL 5TE4L 4X6BB 4XRCB 5J7CC 2PYFB 3QDMB 1VACA 3IYLW 3RX5A 3TBTA 3L1OH 5EU5B 1BFOB 4H1LH 3D18A 1Q8MA 1YY9C 4JFFD 1KLGB 3T04D 5BJTA 1CDCA 2VERN 4UNUA 1L0YA 1SJHB 4OQ1A 4LHUD 4OZIF 1JE6A 1ZVHA 35C8H 3IU4H 3SJVD 4GW5A 1HEZB 1UH2A 3ZZ1A 5E03A 3S97C 3IDIB 4C55A 4S11A 1DVFD 4JY5L 2ZG3A 4LRIA 1RZIA 2PR4L 1NUDA 1XGQA 4JFDE 2VDQH 1YMMB 4F7CB 3GMLB 4JKKA 3RJDA 2AEIT 3S88L 3D2UA 4NHUA 5ICYB 3OR6B 5HY9A 1OAUH 2RFXB 5IOPB 5B8CB 4Y19B 4EIGB 3AAZB 4Y2DD 3P3YA 2F54D 5J8OA 1MELA 1E0OB 1T22A 5DLMH 1M1SA 1WIPA 4M62L 4KRMB 4RMUA 4Y5VC 5CGYD 2FLBT 2FR4B 5HHME 4K55A 3ZSSA 4XCCH 3RNKB 3TBWB 4UBDC 1YMHB 2D0HA 4CMMA 3JSSA 3SE4A 4YE4L 5FYLE 3L3GB 3OGCB 3DX7B 4P4KA 4QXGL 3DTXA 3D69B 1KEML 4PJXB 4MNQB 3GBML 3TNNA 1ZV5A 3ZKQD 1IAMA 3TH4T 2EYRA 2CK2A 4ISVB 1VGKA 4FFWD 3RA7L 2R69L 4X9IA 3U4EB 1YECH 4PLKC 3O2VL 4NCC1 5IHUL 3VG9B 1C5BH 4NQSB 2DM4A 1AXSA 4JKPL 3EOBA 4GKSB 4Z7OF 4G80A 4Z7UB 4NO0A 1K9TA 4X4ZA 3B5GA 3MUZ1 5BQ7B 1YEFL 1G7MA 1ZLSL 1NAMH 1Z5LA 4A2MA 4APQB 4G7VH 2R8SL 4GKZA 4Y1AE 3CFDB 3ECBB 4PP1C 1YN7A 3SDDA 5B4MD 5F9DC 5EO1A 1H3GA 2V2WB 3L5WB 3LY6A 1N8ZA 2FLRT 5TJWK 4OF5A 3OKEA 4QOKD 5JO5A 3P0VL 4XAWL 4D0CA 1JPGA 5DJDA 1CT8B 1D9KA 4OJFH 3G6DL 5GJTL 4ELKB 3WKNA 1TPXC 4Y5XB 4YDKH 4OF7A 2VDML 2VXSH 3OAZK 1ZHLA 3CVHL 1MHHB 1TITA 4RMTA 2G5BA 3STBA 4NZTL 3HR5B 2XTJD 5CEZE 5T3ZE 1A9BA 1GCFA 1TQCC 2VXQH 5JOEA 2QSCL 1BEYH 3W5NA 1EIBA 5DGQA 5I8EB 3E0GA 5AYUH 1DBBL 3WV0A 1ZHNB 2QEJA 3O3EA 1EHNA 1OAKL 4JVWA 5H2BA 3EYSL 3SKOA 3TBSA 4HIJB 3VXOA 1HIML 3H3KA 4QXTB 3DVFA 5F7YC 4LSSH 5KW9H 2XFXB 3B2UD 4GBXD 2KQNA 3VXQA 2X4UA 2DQUL 4QCIB 3QEQD 2I9TA 3FQTA 3K2UH 3HPJB 5HJ3B 1OQXA 4QEGA 1YDPB 4QT5B 5CHNB 4BKLA 2ADGB 1S3KH 3UTTD 2AJVL 5FO8B 4WTXA 2A9NH 2D31A 2DQGL 4BSVA 4JRXE 4C57C 2IMMA 1U8KB 3QWRA 3ARGA 3CLEL 2C1OB 2HLAB 4L4TD 3BKCH 4HIEA 1EGJL 4EUPB 1I1FA 4OKVB 4IJ3C 3BJ91 3WXWL 5ID1B 1IKNA 4XP5H 4YIQB 5DJ8A 2GJ6A 5HYJD 1CGSL 3IRPX 5DEFA 4MB5A 4S1SL 4ODUB 1VFUA 4HCRH 5EU6B 5C7XH 3E3QC 5IBLC 5D7IE 5E6ID 3SCMC 1OGAA 4KKCD 1P4LB 4PRDB 1RUPL 4ZPTA 1P2CB 1EAPB 2AV7A 4XCYB 2BSSB 1FAIL 1Z3GH 5I8CA 4QRPB 3Q6GL 2DD8L 3D39E 4OB5L 3G6JA 3K2MC 2DKUA 2I5YL 4K7PY 5EOTB 1MHEB 3VMPA 1VEOA 35C8L 3RY6A 3MJ8B 3RHWK 2AQ1A 4AENB 4WTWA 5ACZA 3X11B 5CMAA 1A6TB 5KSAD 1E4XH 3TBYB 1QBBA 4NIKB 5B38A 1NCDL 2PKDA 4HKBB 3VD9A 2N4IA 4G43A 4HZAA 4G8GD 1UGNA 4FZEL 2YBRB 4I18C 2VDQL 3DVGA 2NY2C 4K94C 1V7NL 3IJYB 1T80A 4HGWB 5CGMA 4LIQH 3CVHA 2L7UA 3HAEB 1KJ2L 1UH3A 4JM2D 3Q5TA 5FHAH 1FFNB 4XZUB 2DJ4A 4KI5C 1MVUB 1JGLL 3GSUB 3WNMA 5DVNA 5C0FB 3L3OB 2OJEA 3D1MC 3TH3T 1LEKB 5HDQH 3BDXA 3C8HA 3GEWB 1U2CA 3LN4B 4M1CD 4F7MA 3RBSA 2HTLD 2V17L 4XNQA 3KAAA 3VGDA 3BT2L 1IARB 2GCYA 2VNCA 4WHTA 3P9LA 4HJGA 3ZTNL 1GH7A 1X5XA 1AQDA 1A8JH 1IJ9A 1NFDB 3QZWA 4KMTL 4M48H 5IV2B 3G5XA 1WQVT 2BDNH 1QOKA 1U9KA 1TZIB 1R3JA 2CH8A 1R3HA 3IDNB 1UA6H 1L9MA 4GQ9L 2B0SH 5IB1B 2J2ZA 5EDXA 1HKLL 3KYOA 1UZ6F 5I30H 2VTFA 3GJFH 2XY1A 2WANA 4DN4L 5E2TL 1Q9OA 4IIQA 1NCCL 4ETYA 5E8EA 3WLWC 2OX5A 3AY4C 1TZGL 4OLWL 4FS0A 1CN4A 5EUKA 5EZLA 3ULSB 3T1FB 4BQBA 3RKPA 4R4ND 3PGCB 5E9DA 5EC2B 3T4AA 3ULVE 2R0WH 3D9AL 1B0RB 3IF1A 3ILPB 1XIWC 4W6YB 1EGJA 5GGTL 1WIUA 4NOBA 4ZSOE 1JBJA 3NMEA 2ITCA 4N1CA 4Q0XH 2AK4A 4EI5A 3G6JF 1KIPA 2HJLA 5GS0D 2ICCA 2AGJH 3U0TB 2EIZA 1K6QH 3PHOA 4M8QA 3FQRB 3TN0D 5FUCE 4POZD 1XGTB 3ZHKA 1QBLL 1BIHA 1YYML 3S34L 1J0HA 2B8OT 2A74A 3IAPA 3S37H 3FO0L 4FG6D 4CBPA 4HPOL 1QPPA 1PLGH 4ODXB 1J5OL 1SM3H 2JTDA 3BKJH 2OZ4H 3GIVA 2HLFD 3CMGA 1GGUA 4BFGA 4IDJH 4JFDD 3WIHL 2VLLA 3W0WB 4OD1H 4K8RC 2PO6A 5F7FA 5J12C 2ATPA 1P6AB 4GLRH 4H26B 4KJQD 1HH6A 4J8RB 2Y06L 3QULB 5FUZH 4N8VA 3BGAA 1BVLA 2YEZA 2W1NA 1UWGH 3QBTB 1W0VB 3QJHB 5JNYB 2B1AL 2EDNA 3TO4B 3ARYA 4OCWH 4M93C 1EK3A 3G08B 4JFEA 2FCBA 3QUZD 3U0WL 1IGFL 5D2NA 4D8PB 3MOAH 2R29L 1T5XA 4NQEB 1G9NH 1KJ2A 2DI8A 4KJPD 5HGBA 5IMLA 1EEYB 1RJZA 2EIBA 5HHMD 2NMSA 3VXNB 5C70A 1S78C 3GMNB 1BX2A 5EWIH 1BFVH 4NRZA 3W39A 3D5OF 3VWKC 1N6UA 3O3AB 3EHBC 1RU9L 5FYLD 3VFNB 1L7IH 4OCXL 4HWBL 3U46B 5DGRA 4DKEL 5BV7C 1EJOH 5EOQL 3BEWB 3FJTA 1R5VB 4PG2C 12E8H 4KPHH 1UB5A 3I9GL 3E8UL 1ZA3A 4JHWL 3QIBA 5BRZB 2YWZA 1BD2A 3PF2A 1DSFH 4FFVC 4MJ5A 4YK4B 5GS2D 5DJ2B 1PAMA 3ZKND 2P5WE 1OTTC 1KYOJ 1HXYA 3H6JA 4ZFZA 1WCBA 4DUWA 5L2KE 5LWYH 3PE9A 3EYVB 5FECB 5GGUB 4JHAH 3G04B 4D3CH 3QXAA 4Z5RA 3X12A 3C09B 2P8PA 1Q1JL 5A1AA 4V1DE 5F9WC 1HINL 4MDIB 4Y1AD 2VISA 3BGFB 4NNYB 4CAGA 1ETZA 2C26A 1OT1A 3IGAA 4KV5F 1YQ2A 2OI9C 5DQ9B 3O0RH 1FNEA 1M7DB 4H20H 2VDLL 4J3SA 5D4QA 2A1WL 4DGVH 4MQTB 5EG6C 5DT1H 4WWKA 4YLQT 1A7NH 3OKNA 5GGTA 2AJUL 5INDA 3FZUC 2W59A 4MCYA 4M6OL 3ARXA 1Y6MR 4HWZB 5GHWH 3O6FA 5EU4B 5T3ZD 2Y7QB 5I1LB 1CCZA 3RWEB 4B7IA 3W9EA 1J05B 5IM7B 2VO5A 4MDJB 3EZ8A 4XP4H 5GRJH 5DUMH 4M9PA 3REWA 2UZXB 2PW2A 1RZ7H 1F4XL 3QUMH 4WFGD 3EDJA 3I3EA 3K74B 3QR2A 4W4OA 1OAYL 5B3JF 2V7HA 5TE7H 2LVCA 1LGVA 1A1MB 1MI5D 4HUWB 4PY8J 4NRYB 4O4YL 2VLRB 5IMMB 2VJXA 3TV3L 1JNNH 1AGDA 1OB1B 1GL4B 1RIHH 3DPBA 4P9HL 5I74C 4RGMB 5C0RL 5KVEH 1FYTE 3WIHA 4NBZB 2W60A 3QIUA 2V2XB 3CFKA 4HC1L 1N2RB 2IG2L 4GRWF 1RK1A 2BY3A 1A6WH 3F6LA 4ZUUB 3FO9B 5J13B 1ZA6A 5CP7A 1GPOH 2HMID 4NO5A 1QG3A 5LBSH 1KJVA 4JKLA 3BDYH 2FWOA 4TUKL 3ZKMC 3TIDB 3C6LA 4AEEA 2B2XL 3U6RB 4MA1C 5FCUL 1MH5A 4JANA 5J11B 1I7RA 4WFFE 5IB2B 1KEGL 3BH8B 3QIWA 4JDZB 3OR7B 5GRZA 2BC4A 3VXUE 4JRXD 3CDGA 5E56A 4L3EB 2PCPB 4PJ5B 3TCLB 3FB7B 2QADD 2DBLH 3MV9A 1B6DA 4GSDH 4YPGB 4JJ5A 1T0MB 3E6FB 2BNUB 2ERJC 1YZZA 3UXFA 1M6OA 3WXVH 4HWBA 1CL7H 3PWJA 1MIML 3DMMD 4TUJA 2FZ3A 3TZVC 1ZSDB 1XF1A 3K81A 4CGTA 4OQTH 4RMQA 1GGIH 2R0WL 2IAMB 3BOVA 4LQ1A 1FL3B 3MLZL 1T89C 4ODVH 2BNQE 1CDHA 1RZFH 4WRLA 4HUUA 3KDMB 3P4OB 5TDNB 4LVEA 4UIMA 3MRPA 4DVRH 3HUJA 4GXUM 2NLJB 1DTUA 3KPOA 3VFSA 1FNGB 5E2WH 5DQDH 1L4IA 4PJEB 5E00A 3HI5H 2AXGB 5AD0B 2H1PH 4HULB 2VXUH 1LK3H 3PV7A 1PFCA 4S0SD 3D3VE 1D3CA 2JK5B 3G5ZB 3VJ6A 2AJ3B 1FL5B 1QLFB 1NH6A 4M7ZB 4MD5B 3VXRA 4TPRH 3SDAA 3T0XA 3VXMB 2HRLA 4XPTH 4D0DA 1RAMA 5FUZL 2GSIA 1I1AC 4YBQD 4M7LH 5DD5H 2ZUTA 1NGZA 2D0GA 3MV8B 3U36A 5CWSA 5EBLB 1U6AL 3ROOB 2MCPL 3HZYA 3AMLA 3QFDB 2A6JA 1LO4L 3TJHC 3MRIA 3GI9H 4P3WA 5I19L 1I9RH 4NJAH 3B9EA 1C08A 1H15B 1G9NL 1H8NA 2BOCB 3Q6FA 2LAGB 2QTEA 4JFPB 1Q94B 1IBGH 1YN6A 4PJ8A 1ZWIB 1BFVL 3AS2A 1QYGL 4LEOB 4ZFOL 2VC2H 1UJTA 3K4ZA 2VDPH 2Z4QA 4RGNC 5B22A 5D8JL 5BZDB 4YHYB 4AK1A 5ESQA 4XNUH 5KANI 2IH3A 4P9MH 5I9QB 1ORQB 4HC1A 3I50H 1SBSH 4JFZH 5IFHL 2W9DL 5HBBA 3NCJL 2P24A 2C4XA 3NIDF 5F1IB 2J1KA 4I4WB 2DBJA 5FB8B 4BUGA 4IDLA 2XYCA 4IMKA 4DCQA 2DQFA 5C0BE 4Y4KB 3SDCC 3PL6D 4LAQH 4R6UA 5D72H 1JF1B 4JHAL 4LLMA 4LVHB 3CNKA 4MHHG 2FX8H 4NO2A 3T0EB 3TA3D 1ERNA 2X1PA 4BYHA 4E0RB 1GOGA 1T7VA 1WUNT 4FXGB 3ULVD 2OYPA 2UVFA 3JWDC 4G42B 1VKXA 4X5LA 1D5MA 4UT7H 1GAFH 4B53A 1A4JA 3V0VB 1DBAH 5D1ZD 3HUJF 5I76A 4C4KT 3CJJA 3SDXB 2VR4A 5D96C 1NC2B 1Q0XH 5DJ0B 1N3NA 3KXFB 2R1WB 3RZCB 5EC1B 2CLZA 2I60L 4P3CL 1I7ZA 5DYOA 2Z35A 5DRNB 2D7OA 4I3RL 4XWGH 2C9AA 5JHDE 2IBGA 3BPCA 3BWUC 4WJ5A 1S9XB 4P5TB 4PG9A 1Q9LA 1CDBA 4PJ7E 5JPNB 5D7SL 3CFCL 4AM0A 1G7LA 2V9QA 2F58L 4LEXH 1JWMA 4EN3D 3P9MB 3RNQA 4Q2ZB 3MODL 4M7KL 1N5YL 2DKSA 3EO0B 4RGOH 5J57B 3B9DA 5KVEL 4L9LA 1QLEH 1NMAL 3U7YL 4GRMB 4Z9KB 1Y6NR 3OL2A 5ENWA 1DLFH 1BBDH 3U2SA 4MJ2A 1T3FA 3QO1B 3DROA 5DRXB 1CD1B 3H7LA 4WW2F 3KJ4B 1OW0A 3UZQA 1A6ZB 4NSKA 43C9A 3F5WB 1GPOL 1T7WA 4TNWK 4X6CF 3O3DA 1J1PL 4DTGH 3QSKB 1T2XA 2QLVB 4X5WB 3T2NH 5C6TL 4YZFF 3NCCB 3JTSA 5GRXG 2J88L 1L0XA 1NANI 3B5TA 4PGBB 5F1NB 5BXFB 3MLVL 4BFBD 3LN5A 4K7PX 2OS7A 4AT6B 3HFMH 4PV8A 4N0UA 4C4KO 4HK3J 2RAMA 4PJBE 3DVIA 3I85A 3LMJL 4JEGB 1TVBB 4ZFOA 5JXEC 5KSVA 5CD3A 3BP6A 4GSDL 2P5WD 1I9EA 1QKZL 2HWZL 5L2KD 3S5LG 1XF2B 1PW3A 1XF5B 2X9XA 4R3SB 1FFPB 3WXVL 3TPUA 4P46A 1KPUB 4Z76B 2VABB 1LE5A 1AXIB 2X1QA 5F97E 4RFEA 2AK1L 4P99A 1UKSA 3BMVA 3OB0H 3KPNB 4V1DD 1JHKH 1PBYA 1KN4H 4N0CC 2QQKH 4ONFH 4A6YB 3GMQB 4JFHD 3LKSA 3UTQA 1UJ3A 1NUGA 3CH1B 1UXWA 4ODVL 4C54A 4Z7QE 3B3IB 2CQVA 3OKKB 4PJAB 3FT2B 1F11A 4ELME 2C1PB 3FB5A 1ZLUH 3C8KB 1G9MC 3HZMB 5HGAA 5MP6H 1KENH 4BQ9A 4HH9B 1J1OL 1RHHB 2FEEL 1PZ5B 4G7YL 1S7VA 3N0PB 3H7BB 3NCEB 5DQDL 1TCMA 1DBKL 4X98A 4IMLB 5HD8D 5IUSA 2R2HB 2ZCHL 3ZKSD 3KWWA 2AV1A 1EO5A 5A2FA 5I73B 2C7UB 4KDVA 3HLAA 1OP3H 1U91A 5DJZB 5CJQL 6CGTA 1T1XA 3VFUB 5C9JA 4IRSD 4P5MA 1IAIM 1AGBB 4FA8A 2OXHA 2AJZA 3O8XB 4TPRL 3QDHA 4LKCA 4MCZB 2EDOA 4JRYE 4PJ9D 5K59F 4ODTH 5IROC 5DA4A 1QO3B 2B4CL 4K7PL 3BPOC 5D5MA 1CLOH 3M07A 4KTDL 4NOFA 3OKMA 4R7DA 5DRZA 5HYIA 2D4DA 2GSGB 1TJHL 3RDTA 4I0PA 3F12B 3MJ9L 4I77H 2GT9B 3BIBX 4X6EA 5IIEA 3O11B 4NJAL 3MREA 1IBGL 5IVXF 3BFOA 3LHPH 1P7KA 1XF3A 3EOTL 2PNDA 2X44D 2VC2L 2ESVE 2ZUQB 4L8DA 5FOBB 3VGAC 3NZ8A 5F89A 3SKMA 1A3QA 3QH3A 3ZDYF 2I26N 4C58B 4WFFD 1B6UA 1BZ9B 2OL3L 3DUUB 4JFZL 3S5LA 2BJMH 2Q8AL 1D5IH 2QHRH 4M6NH 2I24N 4ZTOL 3CFEA 2X4SA 3ULUL 2DL9A 3RVXC 3MRNA 3RIFF 4J3UA 4BFIB 5D1QA 5L8LB 5IW3A 3UC0L 5SX4I 3VI3F 4NZDA 3MLXH 4XPHH 2DTMH 4LU5L 3ZTJH 9CGTA 1RURL 5DUPL 2FX8L 1RULL 5EZJA 5HYEA 5HDBE 3QEGH 4R0LC 2XZQL 5LGHL 4HFWB 5EUOE 3SGKC 5JHLH 1B0WA 4UQ3A 2V7NA 2E7CA 5J89A 5HGGS 4FQXB 1G6RH 3SOBL 2XOTA 5MEPA 3UPRB 3SGDH 2IQAA 3B2UC 2IPTH 2WAHA 1H5BC 3MCKA 1QQDA 3MYJB 4XWGL 3RVWD 4XGZA 3RWFB 4BH7B 5EU3B 4JN1H 4GRLC 4WUUA 2J3SA 5F9OH 1A02N 3MBED 1UVQB 4Y16D 3D3VD 4HIIB 3VRIA 3S4SB 3QDJA 3RGVD 2AQ3A 3D25A 3K7UA 2IGFH 1JTTA 1BZ7B 3LCYA 3WIIL 5C8JB 5BS0B 4XMPL 3GSWA 4LLDB 3QFJE 3QRGH 5A2LH 4LCCA 1HSAB 5D2LA 1INEH 1DE4A 1NGQL 1CE6B 1X7QA 2G60L 3E2HC 4OAWB 5MI0C 4WUKL 5ISZE 4X6DE 2CDGA 2DYPA 4PY8I 2R1YB 1CBVH 3HRZB 4JFFB 4M1DL 5T1DL 5ETUB 1DLFL 1NBYB 4Q9RH 4CVZA 1QD0A 1LO5B 1TJIH 1UCBL 4LHUB 2A83A 2WLZA 4ZPVB 4PJDE 1VFAB 4Q9QL 1BREA 4NWTH 2APTA 3SJVB 4QHLB 4WHCA 5FYKE 1RZKL 3E6HB 3KPQB 4NQCA 4AH2B 3UBXG 2P7TA 5JDSB 1GC1L 2X4NB 3RJQB 2VIRA 1I7UB 3UYRH 3BPLB 1DVFB 3MJ9A 4KKCC 4MZ3A 5SWZA 1S7UB 3PV6B 1CF8H 2VZVA 4LCUA 1NJ9A 2BSTA 2R2BB 1WLHA 3PWUA 2YUVA 4OZIE 2EDBA 4YDVA 5IB5A 2X9YA 4DKFL 2Z31C 3HG1A 4MD4A 4WI9A 3TYFA 3DV4B 4N0YH 4JO4H 2AJXH 4WO4D 1IFHH 2ARJA 4HX1A 5C0BD 1S9WB 4JO2L 4JZJB 4E5XB 3GUTA 1KC5L 1FN4B 2F53A 4X0KA 4Y2DB 2F54B 2OL3A 4WHYG 25C8H 5FA3B 2M1KA 2QSVA 1PKQA 2N7BA 2MKWA 1KLUB 3RIAF 5F7NC 4LSTH 5ADPL 3PHQB 3BVNA 4DQOH 1S7WB 3O9WA 4PR5B 4YC2B 5C0EA 4ZS6C 2ADIA 1DQJB 3PP3K 1AE6H 5LQBL 1H8SA 3FONA 3MRCB 5SWQA 4R4BA 2FH6A 3S35L 1JNJA 1H3UA 4UDUA 3QEHA 2DM2A 4Q9BA 4J4PC 3WDJA 5ALBH 1N4XL 2BVQA 5T1KA 2BFVH 1IGJA 3STLB 3ISWA 2OMNA 2VLKA 5LGKA 2GUOA 1MFBH 4UT6H 3T4YA 2QQLL 2JJVA 1TZHA 3IDXL 4H25A 1PDKA 4KTEL 5D7JC 3TVMC 4KGLA 1P6FA 5IGXL 2EDTA 3BISA 1DR9A 1E4WH 1YPZB 4PB0H 1LO0L 4ZOCA 2UWEB 5HVGB 3T8XA 3DV6A 3NN8B 1LE9A 1AQKL 5DC9B 1NFIB 3MLPA 1RZ8B 1N5AB 4XP1H 4W81A 1L9NA 4QOKB 3QWOA 1TJGL 2NZ9C 2ITDA 4ZAKD 2YSSA 4JREC 4AEFA 1ZVYA 1MFDH 4NKOA 4HG4J 3MJ7B 5ADOH 1WEJH 4GS7C 3HI6L 5GRVK 4ZQKA 2XTJB 1PG7H 2KBGA 3DUHA 3LKOB 1DBMH 4JGMA 3SE8L 1LEGB 5IESL 1EEQA 1FZOA 5DMYA 3BQUC 4TVPH 2EDFA 5GS1C 2BJML 3VXPA 4MA3B 4DWHA 4R0LB 4LLAA 3G9AB 5E2UH 2ICWI 4POZC 2Y9RT 2ZCKH 3QJFA 1F00I 3VGFA 2VSCA 3O6LH 4MNHB 5C2BL 3TLRA 2E5EA 2DTML 4YO0B 4EVNB 3S7GA 4JZNB 2WQRA 3PABA 4OUOA 3HPLA 3MNZB 5FYJE 4G9FA 1MRDH 2HJKA 5C0CE 3ULUF 4GBXB 3GB7A 5D6CA 4DGYL 4PRNB 4Z7VE 2Q86A 3QEQB 4B50A 4ZYKB 3NTCL 4YHOH 5JHLL 3FRPG 4P49A 4PRBB 3ZKXB 4QNPF 5C07A 3DRTB 2Y23A 4NZJA 4XAKD 5GS0H 4UV7L 3UTTB 1IGCL 1D5XA 2XKSA 4MSWB 5E2VH 2NXYC 3IDYC 2FBOJ 4U1GB 3CFBA 1C5CH 3K8KA 5D93B 3OHXB 2C5DC 2NTSP 4XMKH 5D7LA 4ZXBC 1GVIA 4JPWH 1AHWA 1A6VL 3Q3GB 4L4TB 3O45A 3QUYA 3UX9B 1WT5A 2OK0L 1C5DA 2J6EH 1E6OL 5I6XC 4NQXA 1G7QB 4KVNH 4AY0A 5T1MB 1G7IA 4J12A 2XXCB 3V52H 3L9RB 4KXZH 1DQTA 3ZYOA 1S8DA 5HYJB 5KOVC 3A6CH 3F7YA 4MLIA 4JRYD 2CJUL 4MNGB 1LP9A 4FNLH 1OPGH 3VH8B 3VWJD 1TQBB 3OB0K 1FORH 4YUEL 4MXQC 3IS0X 1S9YB 3A67L 5E6IB 1J1XL 1RIVH 1QRKA 1RJYA 1TVHA 5DRWB 3RPKA 5C08A 4UINL 1AO7A 5F70A 4LF3B 4LLYB 3BKYH 2AKRA 4OV5A 5CBEB 3MOBH 2ENYA 3AREC 1ZLUK 3FO2B 4GXUN 2IPKB 3RUGE 3WS6C 2A0LD 5DI8B 1U95A 4XRCA 2PYFA 3QDMA 3GO1H 4NHCH 1A22B 2H8PA 2ESVD 5EU5A 4CW1A 5KSAB 1QP1A 3SKNB 1BFOA 3T0BA 4GFTB 1A9EB 1JV5A 5I1CL 4KROD 3PWVB 2WWKT 1KLGA 4G8GB 4OZGE 2XRAL 4YNYB 4HEPG 3TM6A 5AUMB 4WCYH 3MSPA 2LQRA 5GS2H 1SJHA 1OP3K 4GAYB 5CLWA 1AXTH 2PW1B 1KGCD 4P5KB 4JM2B 5IW6B 1I8IB 5GRUL 5LG1A 4HAGA 1BGXL 5F7MC 3IDIA 5F6IC 4G8IB 3FRPA 2NTFA 2QR0B 4G6ML 5CSGA 3DJ9A 3LV3A 3LOWA 1CFSB 1OAQH 5GGRB 5C0AD 3EZJB 2AI0H 5GGSA 1YMMA 4J3TA 4LSTL 4F7CA 3GMLA 3ZL4L 3MLSL 3KJ6H 3SPVA 2YMXL 1G1CA 5ICYA 4XNZB 3KYKH 2XZZA 3OR6A 1CI5A 4MA8H 4OCMC 4UDTB 2RFXA 3P9WB 5IOPA 5B8CA 5LGJB 4ETQB 1CFQB 3KPRE 2GIYA 3LKQA 3MLYH 5DD3L 4YDLB 5ITBH 4XB7A 4QGYA 2HFFB 3Q1SL 4W6XB 4RAVB 1D6EB 1OP5H 4N9OB 2EEAA 4XP9H 1NL0H 3P77A 3NAAH 3U30C 3N1GC 5F9JB 1MQKH 5C0ND 2FR4A 1HHIB 1NCBH 4LSQH 5F9AC 5CEXB 1HHHB 4H1LG 3KLHD 2NY7L 2CIIA 3GGWB 3RNKA 3TBWA 1UB6B 1FRGL 2QSQA 1B4RA 1A5FL 4U4BA 1YMHA 3JVGA 4YGVB 4PJHA 1HNGA 1U2HA 3OGCA 4PB0L 4PJXA 5A43C 1OGTB 1YNTA 4X83A 1LP9F 1A6PA 4M02A 5HI5D 5T3XL 5KTEL 3QFJD 3S9DB 1F2XK 5J4MA 3KR3L 1X5LA 2DDQL 3QI9D 1D9KC 4ISVA 1I3GH 4KUZL 1P9MA 5ISZD 5HI3C 3D87B 3FQNA 4RIRA 4NQSA 4AL8H 4WDIB 2X4TB 5L0QB 4OZHB 4NCC2 1J0KA 1E27B 4JJHA 1U42A 1UWXH 4Z7UA 1T21B 5FHBL 2Z0BA 4ZUSB 4K94H 5BQ7A 3TN0B 3BW9B 5FYKD 3SE9L 2H32B 5GJSH 4Z0XA 3BUYA 2YPLA 2APVA 1WEJL 3CFDA 1S7QA 1UM5L 3FHQA 4KRPC 4YH6A 4MHHI 4LSRH 4J3OC 2BVOB 1B90A 1YEHL 1TCRB 2ZPKL 3DOSA 2V2WA 3L5WA 4JZOA 3OX8B 1V3LA 3G6JE 4Y19E 4XMLH 1WWWX 1XR8B 5IVNA 4DGIL 4X8JB 4JFXA 2WBJD 4HXAH 1CT8A 2IBBA 4Y5XA 1DDHA 2MCG1 4QRTA 4HT1L 2XZAH 1MHHA 1ZVSB 3HR5A 5FGSA 5I1KH 4JY6B 5CSZB 1CS6A 1W72H 5IK3A 1T2JA 3C60D 3P30L 2P45B 3SY0B 3QUZB 4Y5YB 3OPZH 4EKXA 4OD3L 4PJIF 3ZDXE 4MNQE 5IEKB 1X5GA 1F3RB 2XWBA 4FQPA 4TRPH 5HHMB 1FV1B 2IBZY 3RWJB 4HIJA 2Y36L 5E2VL 2WQ8A 32C2B 2YZ8A 3HAEG 2XFXA 1MCCA 4XT1C 2J5LB 2JELH 3RPIB 3RWDA 2FHBA 2XNAA 1IKNC 2G2RB 3HPJA 4KHTH 5HJ3A 1YDPA 5CHNA 3WEXA 2QQQA 2ADGA 1YEJH 3SBWA 4EOWL 1S9VB 3UAJD 3K1DA 4KVCH 4PJHF 5FO8A 4HUVB 2DQTH 4PJXF 1DN0B 4U6TA 4HIXH 2GK2A 4F15C 1WWBX 4N5EC 5CP3H 1U8KA 4F80A 1H3PH 4JG0L 1ACYH 4X4XA 2HLAA 5JUEH 4Y1AB 3NH7L 5CZXC 3RY6C 2DQJL 1PEZA 3TGXA 4EUPA 1IILE 2VUOA 1KJ3L 4OKVA 1YY8A 3KVQA 2ZOLB 1Y18B 3PL6C 2AXJA 4NKMB 5DMGC 5A40E 1MPAH 3BKYL 5F7EL 5EZIL 1ONQA 1GYAA 4K8RH 3V4UH 1KTKE 2ZNXA 5EPMA 4ODUA 1NLDH 3L7FB 1MREH 4KKBC 3MFGB 5EU6A 4NHCL 3BRGC 1M71B 2G5RA 4IHOB 2H9GB 4MS8D 2WIMA 3P4LA 1NKOA 4OGAC 1P4LA 4PRDA 1P2CA 1WICA 2C3WA 3RAJH 2BSSA 4QHNB 5DTFB 4JDTL 1FGNH 3BN9D 5IJVB 5ALCH 4KKLC 5E8NB 3UJTL 5EOTA 3L3IB 4MQSB 1AFVL 1AXTL 3MJ8A 1MI5B 4AENA 1JI1A 3OGOE 3V4VH 1UKTA 3EYOB 1PSKH 3ARBD 1A6TA 4X9FA 3MBXL 3IDGA 4HKBA 3V5HB 2HT3C 3DX8B 3WKMH 1NCWH 4EI6B 5EA0L 1JVKA 5GZOC 5FYJD 4ZNEA 4R90H 2YBRA 4D9RD 4YQXL 1FDLH 5HYSB 3D2UD 4PREB 5B3JE 5LVEA 2NX5E 5JTWA 1G0DA 5IFJA 2XACC 4HFUH 2YPKA 3HAEA 3QNXB 3IDMB 4WFHE 5MHSE 2KUTA 5F88B 5I1IH 4XZUA 2HT2C 4J23A 1KIUA 5B39B 3CC5B 1MVUA 3ZSTA 4LK4A 3BRDA 3GSUA 1FNFA 4E41E 1HYRC 2FEEI 4KQ4L 3L3OA 3OKOB 4AG4H 1UYWL 1QPXA 4JRXB 4OLUH 4OLXL 1NL0L 4KJYB 2VR9A 1JPFA 4PTTA 1LDSA 1LEKA 3W2DH 1NUFA 3LN4A 3BH9B 2H2PD 4TSAH 3KS0H 2QADB 3IJHA 5BMFL 2Y6SC 2HVJB 4NO3B 4WU7B 3VRLE 2R9HD 5BZWB 3SKJH 4P4KD 1EMTL 2FIKA 5CCKL 1NEZB 5IV2A 4HGMA 2N7AA 2DQDL 3DMMB 1SYSB 5K9QG 1TZIA 2MPAH 3V0WL 2H2SD 3VD4A 1KN2L 5JIKA 2D03L 3OZ9L 3MROB 4QRPE 3T65B 2JCCA 3ZE2F 2B7DT 2O26U 4OGZA 2BMKA 3LQMA 1I3GL 2CMRH 3QQNA 3S37X 3QXVA 5IMKB 2V2TB 4JFQB 4GG6B 1C1EH 3HE6C 1WZMA 5J1TC 4U6XB 1EHLL 4P2OD 4XHQA 1LDPL 2EDYA 4K94L 2CGRH 5EC2A 1AD0B 1F90H 5GJSL 2PO6C 1P53A 1B0RA 4R8WH 4RMSA 3ILPA 4KK8C 5JQ6L 1MAJA 2HKFL 1FZJB 4HXBH 5F6HI 3EIFA 3NIFE 1NSNH 4O9HL 3QB7C 5K9KA 1YNKL 4FMKA 1C16B 4X9HA 4FQJL 3Q2CA 4XMLL 1VEMA 5GS3A 2YD5A 5LAXB 3U0TA 1U8PA 4O2EB 1T20B 1OLZA 3A6BL 4ZFFB 2BRRL 3FQRA 2EXYC 4QXUL 2XWJB 4HKZA 5D2NC 3P0YL 4F57L 5ANMA 2A9ML 1JGDB 1UZ8B 3THMH 4RWYL 5L9DL 1EV2E 4IRZH 3PDOB 1W72L 1ZT4B 5TF0A 5E99H 4EXPX 4PS4H 1NFDE 3W0WA 4ALAH 2F5AH 3OPZL 4H26A 4KY1H 5FGRA 1F3JB 1L7TH 4J8RA 4G3YL 3QULA 3ILQD 5EFIB 3BYYA 5DZNA 1HHJB 1W0VA 3FFCE 3HMWL 5JNYA 4KDTC 3KPRD 5DQJA 4L1HA 2C4FU 4OI8A 4ZO9A 5IQ9A 1KG0B 1K85A 3TO4A 5DK0B 5AEAA 5DC4B 3VDCA 2JELL 4QRUB 3TNMB 2ADJB 4D8PA 2DWDB 2I25N 4NQEA 1RK0B 3LS5H 2NY3D 1BJ1H 1EEYA 1JGVH 3VXNA 2C3XA 3VFVB 1T66C 5IF0A 4XVSH 3QQ9C 3F58H 3JZ7A 3VFNA 5FFLA 2EYSA 4Q74A 3U46A 3VXSA 2LU7A 5KSBE 1MCWW 2JCCF 4WEMB 4LHJB 3TA3B 3BEWA 1R5VA 3O4OC 4OM0H 3UBXI 4K3JL 3NIDE 5BRZA 2NPLX 5FK9B 5DJ2A 3QA3B 3BAEH 4WWKC 4ZSOB 1OP9A 3SCMA 5D1ZB 5JPMB 5HI4C 3MRHB 3G04A 3O2WH 3RWGB 3O6FC 4KK9D 2X4PB 5FKAB 3UDWA 2O5ZH 3G5YA 3HCVB 3HHRB 2EZ0D 4MVBC 1XEDA 4XVJL 2YK1L 3VW3H 1K5NB 3U7WL 1NLDL 3RVTD 2EKSB 4KH2A 4MDIA 4XP6H 4Z77B 4W4OC 3GM8A 4NNYA 4RRPA 2Q76A 4OIAA 1Z2KA 3PQYE 1MJUH 1OP5K 2FEDC 1MLCB 4MAUH 4JCMA 1FIGH 4HS6B 3HUJE 5DQ9A 2EH8L 1ZLVH 4HMCA 2F5BL 4Y19D 5DK3A 1EXUA 1FGNL 4S1DC 3JV4B 1WGOA 3JUZA 4U1HA 1KELL 3C5ZC 4M5YL 1AKJB 1HZHL 4EN3B 3QIUC 1MCLA 2C3VA 4NN6B 1MCOH 3CSGA 4MJIE 5I1JL 4YFEA 2VXVL 1RUQL 1JPTH 5K33A 4HWZA 4OCSH 5EU4A 2Y7QA 3ELAT 3RTQD 1J05A 3MXVH 1YEIH 5ELIA 4MDJA 1RPQA 5BV7L 2OBGA 4N90D 1CLYH 2LTQC 1AP2B 3QIWC 3OG4B 4G5ZH 4HUWA 4CVXA 5IMMA 1WFUA 1KT2A 5I1IL 1UWXK 1RJCA 3OKDB 1OB1A 3MRQA 3V2AR 4RMRA 1W72A 4I5BB 5DDHA 4EEEA 4BM7A 4G6AD 5GGRY 3OMZA 2SEBB 4WI7A 3UP1A 3OXSB 4K3DH 4LIQE 2ORBH 1KIRB 4CL7A 2IALB 1LQSR 3QO0B 1N2RA 3WFBL 3QDAA 3FO9A 3IKCB 1F6AA 1UM4H 2XXMB 3OTTA 3JWDH 1A64A 4NWUL 3R0MA 1OL0A 3GFUA 4X6CE 4YXLL 3HS0B 4APQD 2P5WB 4NN5C 4LCWA 3CLFL 5L2KB 4UB0L 4YZFE 3TIDA 1HQRB 3U6RA 1DUYB 3X3FH 1R3KB 2ZUXA 3MRDB 1BAFH 3MNVA 3CSYB 1FO0L 5IB2A 3BH8A 2PYEB 4TTDD 2R23A 3AU1B 4L3EA 3QQ3B 4V1DB 2PCPA 1ZANH 3LEYH 1XIWA 3CD4A 3MC0A 2CMRL 1XGRB 2MWCA 5HVHC 3E6FA 1IT9L 1FVCA 1MY7A 2NY6C 2P8MB 1XAUA 4YGAB 4XCFL 1CICD 1GOFA 2KDGA 2Q7NA 4H8WL 3B9KD 2Y25A 3QNYA 5BO1H 1TTGA 4P2YA 4TSCL 1ZSDA 4RQQA 2XN9E 4RFNB 1F90L 3HMXH 2IAMA 2W91A 4I3SH 4YWGH 1AR2A 1IC7H 1FL3A 1NBVL 3SDAC 5LXGL 4HXBL 2K7PA 4OLZH 5AWNL 2OP4H 3BRFA 3U9PL 2VLRE 3GMOB 2Y5EA 4KI1A 1KCRH 3DSFH 5TDNA 3V5KB 3B43A 4IRSB 1XGPA 4ODWB 4GAFB 1FNGA 4Z0BH 2VAAB 4OLVH 3DI3B 4PJ9B 1DL7H 3CFJB 2AXGA 4IOFC 3UTSA 4KI5F 4LVNB 4KDWA 3THML 3IVKA 4X7FC 5DVOA 5DHYA 4PJ8C 4P9HC 1FL5A 1QLFA 4MD5A 1DQQB 1OARH 4AEIL 2FBJL 4WTZG 3NCBB 3HRPA 2NX5D 1IC5H 1JRHL 1L7TL 1ZT1B 5K59E 1PX4A 4WFHD 5MHSD 3LSOB 4PJ5E 3MV8A 4XCNB 1CGTA 1KNOB 1NMCB 3VWKA 1MFEL 5J3HD 3X3GH 4HQQH 4JFED 4OZFH 3QFDA 4E41D 4IMKC 4YDJB 4ZODA 4EDWH 3TIEB 2R0LH 3L5XL 4PG2A 1SY6H 5DJCB 1V3MA 2YXMA 4F7PB 2BOCA 1K8IA 1FFOB 4JFPA 3F7RA 5I71C 5IVXE 3MFFA 3NGBB 4UOJA 4LL9A 2VE6A 1ZWIA 3WMSA 4LEOA 4NYLA 1U3YA 4XBPB 5BZDA 3PDDA 3WUWB 4YEEA 3T1WA 1U8MA 2EC9U 3ZDYE 3EDFA 5C6WH 1G9MH 1MVFA 3FFDB 1Q72L 4FZ8H 4NQVB 5DJYB 1ORQA 4YR6A 3QIBD 1MCBA 3H8NA 4R4FL 1J11A 5HHNB 5BOZG 1IAIH 3EJZD 1DQDL 4A6YL 2AABL 4I4WA 3WDIA 5I66B 3QPQC 5FB8A 4BZYA 4PJEE 1YYLL 5TQ0H 2IQ9L 1IKFH 2OR9L 4PBXA 1VFMA 3FMGL 3VI3E 4WW1A 3VI4F 3S8WA 1FO0A 4NPYB 1JF1A 4YBLC 5HYQB 4Y89A 2J4WL 3T0EA 2H6PA 1T03H 4E0RA 4UAOC 3ALWA 2A77H 4FXGA 4GAJH 3DVNA 3MCLL 4G42A 3MMEB 2COQA 3VXME 5JMOC 1FIGL 3V0VA 4XCEB 2HN7A 3MBEB 4Y16B 3D3VB 3VFTA 4MA7L 1A6UH 1BFTA 3RGVB 3SDXA 4XX1G 1NC2A 1CDYA 5DJ0A 4ZS7H 4L9LC 5DD0H 2R4SL 5EC1A 4K2UH 4IOIB 3RZWA 3T0VA 5DURD 1DEEB 4M1GL 3NFSH 1MCOL 2RHEA 5KS9F 1OW0C 1XF4B 3GKWH 1REIA 1FGVH 1R0AL 2EKJA 3GBLA 4R2GD 5JOFB 4L8SB 1S9XA 1SBBA 2WBKA 4P5TA 3X14B 1JZ4A 5DMIL 3BESR 4GW4B 2PF6A 3WSQL 4PJFA 4FXLA 1B4JH 5D1XC 1NDMB 1MCFA 4JQXA 4NN5B 3FFCD 1BLNB 1B2WH 4NZUL 1W8NA 4ODHL 1KB5H 3BGMA 5HYFA 1MRFH 4GRMA 4DVBB 4OTXH 4OFYD 3KS0J 5DRXA 1CD1A 2ZG2A 2FX9L 3H9YA 2AJYH 4AMKH 1IM9A 3LPFA 3X13B 2FRGP 1OD9A 3C6LD 4WO4B 5E4EC 4X5WA 4AEHH 1MWAH 3GRWH 1T7ZA 3AM8C 5C0BB 5HHQB 3UTOA 3EO1B 4PGBA 3X3FL 2JIXD 2VDRL 1N7ML 3M8OH 5SV4A 4I8DA 4U1JB 4AT6A 2VITB 1I8MB 5CD5D 4Y4FC 2ZUSA 1ZANL 3GBNH 3HB3C 3KXFE 1T89A 1QRNA 2D7MA 3GI8L 4LCIH 4WI6A 2E27H 3EOAB 1XF2A 5DS8B 4R3SA 1FFPA 4L4VA 1N6QH 4XVTH 4Z76A 1KPUA 2VABA 5SWSA 4CVUA 4Y7MA 2BNRE 1AY1H 2O93L 4LSVH 1OF2B 3HMXL 1UH4A 4A6YA 4I3SL 3NABH 1IC7L 2V9RA 4Z95L 1MCKA 1QNZL 3DUSA 4S1RH 1U8LB 5FKPB 2R2EB 3PQYD 3GMMA 2IWGA 2Z92A 3GSVA 4QYOA 5AZ2L 1RSFA 4PJAA 3FT2A 5MENA 1LO2H 3RY5A 3QPXL 2C1PA 3IFLH 3C8KA 5HHVL 2WIIB 2XPGB 5GZND 2NXZC 3MRBB 1KTDB 1SQ2N 1RHHA 1PZ5A 2XG5A 1DQLH 4PJ7B 4M7LT 2DLFL 4YJZL 4M4RA 1I1AA 5DHVB 4IMLA 1DCLA 2CKBH 2R2HA 5F44A 2XT1B 3EYUL 3IFOB 3KYMB 4LP4A 4MJID 5L6YL 2FDBP 5IKCA 2C7UA 1MJ7H 3JXAA 3I6GB 4V2CB 3VXRD 4KZDL 2O5YH 4LLQA 4PD4K 3O8XA 1Y0LB 4LSUL 1WSST 4PJFF 4MCZA 5T5FH 1TETL 2VDOL 4ZAKB 2NYYD 3S3JA 3DYPA 4PY7A 3S4SG 1QO3A 3TBVA 2DL2A 2HT4C 3WN5B 1F58L 1K4DA 5IB4B 3HZKB 5TQ2H 2OJZL 3FO1B 4M61B 4DZBA 4HQQL 2JB6B 3ARQA 3QCVL 4UTBL 5EIVA 4MB3A 2GSGA 4NM4L 4DEPB 4WFEE 3H2WA 2GT9A 3LQZA 1QFPA 3O11A 4P23D 3SQBA 3MGTB 3EYQD 3VMNA 4HJ0D 1CGWA 5E08L 4HMDA 2AS5M 5EIIB 4QKXB 4U1NB 1AR1C 1T4KA 4Q97A 4XX1E 2AEQH 1U3HD 1QA9B 3RX8A 3SQOL 3QNZB 4LHUG 3HA0A 1YNLH 1JF5A 1MCQA 1NCAH 1DFBH 4MLSA 2NY0B 3EFDH 1BZ9A 4NRXA 4AZ8A 1OOAA 3LH2H 2WWMC 3DUUA 3QUXD 3BD5A 3LRHA 1EFQA 4NBXB 5SV3A 4XBEL 1J8HE 2JF1A 4R97C 5ICZB 2GJJA 4Y2OA 1VPOH 1OWRM 1RZJH 1AJ7H 4NP4H 4TQEH 1JZ6A 4ELMB 3GSOA 4BFIA 3RWIB 1F3DJ 2E6QA 4HV8B 1AD9B 2XN9D 3FB6B 3AS1A 4ONHA 2A77L 3BEVB 3F7VB 1G7HA 1XZ0A 2VL5B 2DIJA 3MV7A 4QNPE 2VZTA 1GXEA 4HMEA 4BQ8A 4QHUB 1A6UL 4FQXA 3L6FB 5F8RC 1PYWB 4U1KB 3HNVH 4BZ1H 3UPRA 5DD0L 3MXWL 1I1CA 2YZ1A 4JRYB 5FDYA 1NFKA 3GSNH 5IHZA 15C8H 4X4MA 3VD7A 4FABL 1GIGL 1NC4D 4M43H 2FB4H 2B1HH 5EU3A 2YC1B 3VWJB 5JR1H 5EO9B 1IAKB 2X4RB 3EJYD 3W82A 1FLRH 4KU1A 5TDOB 1U93B 1BZ7A 1C7SA 2BHUA 5BCAA 1RUKH 3L5IA 4P3DB 5C8JA 2W0LA 2DJUA 5BS0A 4FTVE 5IVZB 3WNOA 1NBZB 2J8UF 4LLDA 2IFFH 5EBGA 1LMKA 3ZYIA 4XPFH 3G5VB 1HSAA 1FVDA 2ESVB 2HAZA 3CPLB 1CK0H 1D6VL 2DM3A 2KKQA 4KROB 2R1YA 5DJXB 4JFFA 4U6HB 5ETUA 1DZBA 1NBYA 1UM6H 1ES0B 4KHXH 1LO5A 3ARDD 4PGCB 4UQ2A 4KQ3L 5DWUL 4FP8H 3TYGL 5E6YA 2IEPA 4J1UB 4PRIE 5DO2D 4K3GA 2HP4A 3CXHJ 3SJVA 4ERSH 1H3TA 1XMWA 3E6HA 3KPQA 5DMKA 5I1HL 3JV5A 1MWAL 1G7JA 5JDSA 5I1AB 5IB3B 4MS8C 2X4NA 1N64L 2CKBB 1DVFA 4ONGL 1HHKB 3PV6A 1FE8L 5C0AB 3GBNL 4KJWD 5HHPB 4ZO7A 5I18H 5EUOB 4A2LA 2ZSWA 4LCIL 3DV4A 3SO5A 3ARWA 5E0QA 3DGCR 4P46D 2G9HB 1A14L 4OGXL 1OCWH 4E5XA 1N6QL 4WV1B 1FN4A 4Y2DA 1R5WB 2F54A 1KPVB 1RZGB 1TFHA 1TNMA 4KKAC 1ZMYA 4BZ2H 5JMRA 2K9UA 1KCUH 1KLUA 4NUGL 1A3LH 3SHSA 4Z7NF 3UPCA 4YHML 1S7WA 4PR5A 1V7MH 1KBGH 2CIKB 2PTTB 5E6ZA 2R0KH 2FO4B 3BJLA 4GXVH 1PJ9A 3AXLA 5HXMA 5ILTH 4YHLL 2PXYD 3LD8B 4D9LL 4FQQB 1V3KA 3STLA 2X40A 4KWUA 2GFBB 3QFJB 4F8QA 4KK6D 2DQIH 3QI9B 3WE6B 2VDKH 3DLQR 2Q8BL 4GKNA 2EE6A 1B0GB 4CN4A 5I1GH 5ISZB 3QAZC 4X6DB 4HS8H 1I7TB 2HKHH 1PG7X 3R8BB 2DMBA 4Z7WB 1IAOB 1O0VA 4KAQH 4KUCF 2KL6A 1YPZA 2O5XL 4MAYD 3DO7A 3WL9B 3T08A 2HYMA 1XCTA 3U0PB 5F7KC 3N9GH 3NN8A 4FQIL 4YX2H 3TFKD 3DXAE 2P8LB 1BM3L 1RZKC 4F33B 2VH5H 4I0PD 5L2JB 1P4IL 3BP4B 1KCKA 1GC1C 1IL1B 4JY4B 3IU3B 4G6KH 3B4NA 4QOKA 3VH8G 4AYFA 1H9VA 1BPVA 3IXAB 3S3PA 2WBJB 4OZIB 5E8DL 2NW3A 2W9LA 3PIQB 2V9TA 2KQMA 2NY1C 3VA6A 3TO2B 4Q7DA 4NT6A 4XXCA 2AEQL 1NGPL 4P2QE 5HHXH 2ADFL 2K1MA 3GSNB 5CILL 5D71H 2CDFB 1LEGA 1EO8L 3EFDL 4XXDB 5GIRB 3P11H 3C60B 2ZG1A 5I8OH 1TNNA 1YEGL 3L3HB 1A3RH 4FFYL 4UMGA 1R3IL 2E6JA 2VZOA 4H88H 4R0LA 3SO3B 1ZEAH 3BE1L 3SGKA 1YEKL 3QISA 5EORL 4H5SB 1A7QL 4U1LB 2XZCL 2WINB 3GJEA 3IB4A 4YO0A 4CADB 4JB9H 4JZNA 5F3BB 4LQFH 3MNZA 2BNRD 4JO3H 5TFSH 4GAGH 4GBXA 4BELD 5JW4N 2BP3A 4PRNA 4RAUB 3QEQA 4K7FB 1H5BA 4PJIE 3ET9F 2VQTA 1E6JH 2UWEE 4PRBA 2Q7YB 1CU4H 5A3ID 4GRLA 3DRTA 5DUBB 3UTTA 1ACZA 1CFVH 4N8CL 4MSWA 5TE4H 1JYNA 4LBEA 1GGTA 5E1AB 4ZUVB 3V6OA 4PP2B 2AJSL 3HNVL 3LDBB 2DI9A 4GUPA 3Q0HA 4HBCL 3MO1B 2GY7B 1CVSC 3OHXA 1HKFA 4CMHC 4I0KA 4WUUD 4L4TA 4IRJC 4Q58C 5JR1L 3QDJD 2FSEB 3OJDB 3C5JA 3NFPB 1U8JB 3VFOB 1CFBA 4YHPB 2HFGL 1K8DB 5T1MA 2DQCL 5A2IH 4LOUD 1IRAY 4JY5H 5HYJA 1M05A 2PR4H 1HYSC 1WBYA 2Y72A 4L29A 3TBTB 1VACB 4MNGA 4Y4HD 4XPFL 1WCQA 3N1QC 3IETA 3ZYJA 1H0DA 3O4LA 3D18B 4PJGA 1HSBB 3S88H 5E6IA 1FG2B 5BJTB 1VFBB 4WFED 1X5IA 3OF6D 3MLUL 3UJIL 5KVDL 5JZ7C 4LF3A 1BFSA 5CBEA 5KVGL 3FO2A 1JNHA 2YKLL 4DW2L 4ERSL 2IPKA 4HBQA 4GMSL 2RCSL 4M62H 4P57B 5DI8A 5F71A 3ARBB 4DOHB 3EO9L 3SKNA 4WENB 3PG2A 1JP5A 1RZIB 1A9EA 3EJJX 5CSBA 3PWVA 2DF3A 3MACL 1RY7B 5B8CC 4OFKA 4P2RE 2WW8A 2DMKA 1LILA 4X7SL 4NUJB 2LABA 4MXVF 5EN2B 2MFNA 2BY1A 4QGTA 4YE4H 1J8HD 3D2UB 3QCTH 4QXGH 1OY3B 1KEMH 2PW1A 3GBMH 4P5KA 4JM2A 5IW6A 2I07B 2IMNA 2F53D 1RUAL 3WJJC 4XNXL 1MF2L 2X42A 4XWOC 3Q48A 4OLYL 3RA7H 4J3WA 1UWEH 2R69H 3O2VH 1CFSA 5FYLL 5IHUH 1KXVC 2OR7A 4BZ2L 1OSPL 3O9WD 3JVGC 4JKPH 5HGHA 4OIBA 2EO9A 5E70A 1QFWL 4IM8A 1YEFH 4CUCA 1ZLSH 4U1IB 4UDTA 2HFEB 4F37F 5D7JA 5LGJA 1BVZA 2AVGA 2YOCA 2R8SH 4ETQA 1CFQA 4P4KB 4G9DB 1P9MC 3MOQA 4O00A 3FRUB 3TNNB 5T1KD 3WFCH 3B8SA 3VG9C 2HFFA 4RAVA 1D6EA 3BO8B 3BP7A 4U0QB 2EYRB 3P0VH 3ZE0E 4XAWH 4Y8DC 4N0RA 1NCUA 1CL7I 1HHIA 5I1GL 1WAAA 5GJTH 1Q9KB 4APQC 1AXSB 4LGPB 3GGWA 3EOBB 2VDMH 4KMLB 1P4BH 1UB6A 5DFVD 3CVHH 4G80B 1FNSL 1S5IL 4YGVA 4NZTH 2DAVA 1Z9MA 3PNWA 4P2OB 1OGTA 1IGMH 1G7MB 1Z5LB 2P49B 1J0JA 4G8GE 2QSCH 4FTVD 3VA2C 2X70B 3CSBA 5FV2A 4PJGF 3SDDB 3ZE2E 1DBBH 1IC4L 1IGIL 1I9IL 1UACL 1OAKH 3ZT5A 2B20A 1BECA 2C3GA 4Y5XC 5JO5B 5CEZL 4WDIA 5FXCH 4HKXA 5T3ZL 4D0CB 2X4TA 5DJDB 3MA7B 5T3XE 1HIMH 3C9NB 5GS1A 1E27A 4PJCF 1T21A 4GMTL 4YEFA 3ARVA 3AVEA 3FQUA 4PLJC 4ZUSA 3QXDB 4PRID 4KMQA 3BW9A 1X5FA 2H32A 2G5BB 3PHSA 2DQUH 4DFHA 4NC1C 5J6GA 1A9BB 1FH5L 3HNTL 2BVOA 1TCRA 4CKVX 1MNUL 1JL8A 3OX8A 1FAKT 4X6FB 2AJVH 3P11L 7FABH 3RI5F 5I8OL 4BSWB 4JFDA 3LB6C 2FGWL 4X8JA 2DQGH 1MRCL 1OHQA 1LHZA 5IEHB 2HVKA 3MRFB 4J2XA 2HJFA 1MCWM 4ORZC 3VXOB 4ENED 1W0WA 4ZDHB 2EDWA 4TVPE 3N50A 3KPRB 3UEZA 5AZEL 2CUIA 3SBWC 3B9AA 5CSZA 1U8OB 1EGJH 5EU7E 4U1SA 3VXQB 4JO3L 5SX4H 3HE7D 1T6WA 1ZS8B 5HDLA 3IFPA 2I9TB 3FQTB 3WXWH 3QUZA 4Y5YA 4ZXBA 1I4FA 2E7MA 4BKLB 1CG9B 1J7VR 5F7WC 3MQIA 4TOYL 5ID0B 2NY3B 2PN5A 4ZOAA 3CUPB 5BOPA 3S36L 1SHMA 4PFEA 4S1SH 2D31B 1R5IA 2ZJSL 2X4QA 3FTGA 4KRLB 3HR6A 5HYSG 32C2A 1UFUA 2HTKD 4UV4L 4M8VA 3ARGB 2V5YA 1RUPH 3RPIA 4JPKH 3UROR 1FAIH 3OXRA 3QUYD 2YD4A 3Q6GH 2DD8H 2G2RA 4OZHE 3PGFH 5B39G 1WVZA 4OB5H 5HTSA 2I5YH 2MMXA 1FG9C 1I1FB 3GNML 1RUML 1PY9A 4OCYL 5C1MB 1S9VA 1Z0MA 4HUVA 1N0LA 4LPUA 5FEBA 4YHZH 1DN0A 1MEXL 2GJZB 1NCDH 4G8EA 1LWRA 1ZTXL 3ARPA 2WZPD 3AREA 2UYLB 4FZEH 3WHE1 3WS6A 1NEZG 2P5EE 3DXAD 1V7NH 3EJZC 4Y1AA 1CXLA 5IFAL 4XPAL 2CR3A 3FHAA 1QSFE 4ZPTB 1N6VA 3MX0A 1KJ2H 1AO7D 5H37H 4KZEL 4GRWH 3BSZL 3BIKA 3G6JB 5EZOL 1U8NB 1JGLH 1N0XL 1OWWA 1VGEL 4LARL 5ACZB 5CMAB 3BI9X 5B38B 5E8PA 4G43B 4P2QD 2H9GA 5DEZA 3VGHA 2V17H 3BT2H 3RTQB 4ZNCD 4YBHA 1QSVA 4QRRE 4XVUD 3MYZA 4OGYL 4QHNA 5HHOE 3ZTNH 5IJVA 1V5JA 2GTZA 4KMTH 5E8NA 3QCTL 3KPPB 1JHLL 1GZPB 3AB0B 4EQ3A 3EYOA 5FGBA 2JB5H 3KPSE 4OIIL 4GQ9H 2VLJE 4EI6A 1HOCA 3LIZL 4FFZL 1UWEL 2NY4D 4OT1L 2V5SA 1HKLH 5DD1L 3BKML 4X8XA 1CR9L 1R24B 4R2GC 4LGSB 1OTSD 4DN4H 5E2TH 4XNQB 1NCCH 4PREA 4UILL 2CRYA 2GCYB 1TZGH 4OLWH 5IT2L 4RISL 3P9LB 4HJGB 3QNXA 3IDMA 1L0QA 5J1SC 5F88A 3QZWB 3D9AH 3G5XB 2ZCLL 3UMTA 1JZ2A 3VFWA 5GGTH 1RVFL 1WFOA 3GZKA 5IMOB 4OFPA 4XTRC 1U92B 3DX9B 4NKQB 3WFCL 4LDLB 4HD9A 1IM3A 1DEDA 4Q9CA 4K71B 2DLEA 5EO0A 3ULVL 4CNIB 5IJKC 4NKDA 1R3LA 1QBLH 2HVJA 1YYMH 3QXUA 1P4BL 4WU7A 3S34H 4BH8B 5BZWA 4IIQB 5K93A 1IEHA 5E8EB 3FO0H 4HPOH 5EZLB 1CICB 3FOMB 3DMMA 1SYSA 3B9KB 1J5OH 1IGML 4RZCB 3G9VA 4Y88A 4L4JA 4F7EA 3E3QE 3W11D 3WIHH 1F45A 1TTUA 4WFGE 5KVFL 2Q3ZA 4BFEA 3WIFB 1IQWL 5D7IA 2Y06H 1MI5E 3I6KB 5IMKA 1MCSA 4WHDA 4JFQA 4GW1A 2EIZB 5TGBA 4MZ2A 1JUFA 2B1AH 3D39A 3PXJA 3MLRL 4C56E 1AGFB 1GHFL 3U48A 1CE1L 2YPLD 4H1LB 1AD0A 1CD9B 4MWFB 3U0WH 1IGFH 2R29H 5T5NF 1IQDA 1D5ZA 2FATL 1RHFA 2H3NB 1BQSA 3GIVB 3MUJA 1C16A 3NZHL 3D48R 4U2ZA 2AQ2A 4P59L 4P2RD 7FABL 3J7HA 1HH9A 4XHJD 2ATPB 1LEIA 3TO4C 4O2EA 1RU9H 2XKNB 3GIZL 4OCXH 4RMVA 4G6FD 1OAXL 4HWBH 4TNVF 4DKEH 2NX5B 2D7QA 3VG0L 5EOQH 2XWJA 2ZZUT 4Z8FL 2ZSVA 3I9GH 4KI5E 3E8UH 4JHWH 4CVWA 3BUTA 4LVOB 3PDOA 3HI1B 2CO7B 3P40A 4JFEB 4E41B 1ZT4A 1HI6A 4YXKL 3N85L 3ARFD 3QCUL 1KJ2B 5HGBB 4GRWB 4EJ1C 1I3VA 3T2QA 3KPMB 2H26B 1BX2B 4NRZB 3EW3B 3W39B 4PGJA 4XPGL 1Q1JH 5EFIA 1KXQE 4GJTB 1HHJA 1WZKA 3ROLB 1HINH 1AI1L 2C4FT 1L6ZA 5CINL 4YK4C 1KG0A 5DK0A 1P7QA 4K9EL 5E5RB 1MJ8L 3O2DA 4QRUA 3FQXB 4JPKL 3TNMA 4GG6E 3ALPA 3QIBB 2D3VA 3PGFL 4X7TA 4JFOB 1RK0A 2CRIA 2VDLH 3UDWC 3C09C 1HXYB 3DYOA 4ZFZB 2A1WH 3VFVA 3H42L 4RBPH 3MRGB 5KN5B 4YHZL 1MCNA 3BGFC 1KOAA 3PL6A 2AJUH 3QXAB 4Z5RB 1EBAA 1OVZA 4M6OH 2BSRB 1T2QL 4LLVB 4ZTPL 3DO3A 1NGXA 4KK5C 3TA3A 2IANE 1S5HA 5E94A 2DKMA 1FJ1B 2W0KA 1HWGB 5D7IF 1F4XH 1MCHA 1OAYH 1YY9D 2CRZA 2YHGA 1YUHB 4ZSOA 4O4YH 2F19L 3TV3H 4JM4L 1FPTL 1SJEB 5JPMA 1I3RB 2O61B 5T3XD 3MRHA 1NAMB 4P9HH 4S10A 3RWGA 3JV6B 1JPSL 5C0RH 5FKAA 3L3DA 3DETC 3HCVA 4S1QH 1HHGB 5L88L 3DURA 4PGEB 1QUNA 1FFRA 1K5NA 1I8KB 5INDB 2EKSA 5DURB 1T6VN 4Z77A 4MCYB 4HC1H 2IG2H 4L5FL 5K9JL 1MLCA 5I75B 2DOCA 3I3DA 4HS6A 1F6FB 4HWEH 1Z0NA 1FZKB 4TUKH 2B2XH 4R2GB 4RGMC 5FCUH 4U3CA 3JV4A 1DQMH 4OM1L 1X5AA 1FL6B 1EFXD 5ESVB 3MV11 4MQXC 3O6KL 3MUY1 1KEGH 1NPUA 3DHJA 4CU8A 4OFIA 2JB5L 3FKUS 1MIEL 2Y07L 5KS9E 3FFCB 4TVPD 5J13C 3PWLB 1MFCL 3DNKA 3BZ4B 1MCPL 5C92A 1JZ5A 1K3ZA 3CFKB 1RK1B 3UO1L 3VXTB 4W70A 5C09E 5J11C 1MIMH 2VQ1B 1G7PB 2W65A 4NO5B 1KJVB 1KCVL 1ZGLA 5ICXA 2FWOB 4R7NA 3C6LB 4UBDD 1F13A 3OKDA 3QDGE 3MLZH 1X5YA 4RCAA 2R4RL 4TTGA 1KJMB 1PQZB 2JIXB 2B5IB 4LDEB 5KSBB 3CDGB 4IOSD 3OXSA 1U58B 2KZWA 1KIRA 2W9EH 5GGVY 2IALA 5B21A 3LZFL 2K7QA 2LAAA 1IEAB 3MV9B 3IKCA 4PLKD 3DRQB 3HS0A 1DBJL 2P5WA 1M6OB 2IAMC 2BY0A 5L2KA 3PWJB 1HQRA 1JZ7A 4TUJB 1DUYA 3HE6A 1R3KA 1CIDA 2E8ZA 2AEPH 3MRDA 3CSYA 2D7PA 1CXEA 5TE6L 4BJLA 4GOSA 2EYTA 3QQ3A 4V1DA 4PP1D 2P5ED 4PRAB 3WUWG 2VN4A 2E9WA 2Z8SA 1OQOA 4NQDE 4PRPE 1QSFD 3PQYB 1KB9J 4NNXB 1XGRA 4JE4B 1A7OL 2E7HA 5DJAA 3MRPB 3HUJB 3PP4L 2BK8A 2P8MA 4O5LL 3JWOC 4UT9L 1U6AH 2HG5B 1IE5A 1EERB 3S98A 2MCPH 2DQEL 1T7XA 1LO4H 1SYVB 4M7ZC 5I19H 1INQB 1FZMA 4MJIB 4XI5C 2BOBB 1ZE3C 3MLWL 5CIPA 3VJ6B 4M6ML 4QRRD 1IZKA 1QYGH 3V5KA 5HHOD 3VXRB 1CLZL 5D8JH 2ZUWA 1CD0A 4JDVA 3BZFB 1ZGLP 4PTUB 4EDXA 2VAAA 1NGZB 1EBPA 4PJ9A 2FNBA 4JG1L 3KPSD 5IFHH 2W9DH 2BXYA 3NCJH 1CZ8L 3R06A 3HZYB 4K3EL 2VLJD 4KDTA 4AIZB 2BCKB 3CVIH 2P48B 1FYTA 1XCQB 3VCLB 4LPXA 2C3HA 3DX6A 5CGTA 5CUSH 3VFGL 3NIGE 4WY7L 5JW3H 1JYXA 1C08B 3O81A 3NPSB 4YHYC 4WW2B 4P23B 1I9JL 5T1LD 5I9QC 1ZT1A 3OBAA 2PYEE 2ZOKB 3KHOA 4X6CB 3V4PL 1CLCA 3HC4L 5DK2A 1NUNB 4XCNA 5ESQB 1U3HB 1KNOA 4JFHE 2IH3B 5F7HA 4DUVA 4X9BA 4J6RL 4TSBL 4I2XE 1TENA 3TIEA 3D85A 4Y4KC 3VXUA 4ZFGL 3QUXB 5DJCA 2NR6C 4LVHC 3VE0B 1FFOA 3T0EC 4NC0B 2I60H 4P3CH 3WBDA 2WBWB 1RFDL 4I3RH 3FL7A 4LLMB 1VB9A 4NM8L 4ZUTA 3VXSD 2EC9T 4TULL 1GGBL 2PETA 3EBAA 1G84A 3KLAA 4IBLT 1EZVX 2YN5A 2JJWA 5ECJE 3VGEA 3FFDA 5KAQG 4NQVA 3FCTB 2XN9B 4H8WC 2CRMA 4N9GB 4L8CA 2OTWA 1VKXB 5IBLD 1D5MB 5HHNA 5F7LB 5AAMA 3OB8A 3RZCC 5T33L 5D7SH 3CFCH 3GJFB 3RVUC 4B5EA 2F58H 5I76B 2BNQA 4CN1A 2UZIL 3ZE1F 1KLFA 4HS3B 4NPYA 5GSRA 3MODH 4M7KH 1N5YH 2F8XC 2CLZB 4PGDB 5HYQA 1OTUC 4C56D 2VUYA 2YA0A 4S1QL 5DYOB 1BVKB 1NMAH 5FUOH 3U7YH 4YDIL 3C5ZA 4P5TC 3MMEA 1NC4B 4X4YB 3NCFB 5FA4A 3BPCB 1HQ4B 4WJ5B 4Q6IB 4KXZI 4PD4J 4XCEA 4B7LA 3MBEA 4Y16A 3D3VA 1J1PH 4JQXC 4HWEL 2NY2D 4PG9B 5C6TH 3FN0L 3GSRA 1DQML 2J88H 1G7LB 4AM0B 1JWMB 3MLVH 4IOIA 3ZMRA 3N1MC 3BD3A 3MUGB 4Z78B 1DEEA 3KJ4C 3PJSA 2XA3A 4KI5D 3LMJH 2FJHA 1CDJA 3U2SB 3PDGA 2FD6L 1QKZH 3LVEA 2HWZH 4FQ2L 4KTYA 3T2OA 5JOFA 4JPIB 4L8