4J39A

Crystal structure of p19 in complex with double-helical 19mer rna p(cag)3c(cug)3
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
124
structure length
122
Chain Sequence
MTSPFKLPDESPSWTEWRLHNDETNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Procrustean bed of RNA silencing suppression
rcsb
source organism Tomato bushy stunt virus
molecule tags Rna binding protein/rna
molecule keywords RNA silencing suppressor p19
total genus 39
structure length 122
sequence length 124
ec nomenclature
pdb deposition date 2013-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4j39A01
4J5VA 4KQ0A 4JNXA 1R9FA 4JGNA 4JK0D 4KNQA 4J39A 4KTGA 1RPUA
chains in the Genus database with same CATH superfamily
3NCYP 3RGVB 3WFDH 1A02N 4W9LC 2X4RA 2EXTA 3HUJA 3WXVL 3HE7A 4ZO6A 4XX1G 1CDBA 2ZAHA 5HDBE 2R29L 3R8QA 3BI9X 2GSGA 5TFSH 4LPUA 3UBHA 3W0WD 1M05B 4AEFA 2BPBA 2NUPA 1RZJC 4GXVL 3MGAA 1FAKT 1TZHA 1IT9H 4QRPE 4FQXC 1GZPA 3IFLH 3T3ME 4JREC 4ICWA 4JPIA 4WFHD 4DAGH 4UAHA 2JJTA 2BNRE 2EDXA 2J88H 4HOXA 4LKXA 3TM6A 1A4KA 4B96A 1G9EA 1ZS8A 3D2UD 1FC1A 3TEWA 4PN6A 2IBZY 5BZDB 5JQIB 1T1YA 2HFTA 2X4NA 5CP7A 4Q9BA 2C1OB 5C09B 1KIRA 2L0DA 4GQPH 2O5YH 3HE6C 3O81A 4G3YH 3HRZB 5GISL 3ARFB 5D5MA 4G9FB 3RVTC 1L9SA 2NPLX 4ES9A 4Y8AA 1A66A 1JD7A 1HYSD 3LZFH 3VFWB 4ELMF 1HE7A 1LILA 4X50A 2GC7C 2CLZB 3EYFB 5D7IB 1RULH 2DQUH 4IU3A 5E5MA 1ED3B 5K33A 5D55A 1ES0A 1E4KA 2XJLA 1A47A 2F5AL 3CUPB 3FTWA 5J6GA 4A67A 3E2HC 4Y16D 1MFDH 1YNKH 2VM9A 4IKKA 4B0MB 1ACXA 1UXMA 2BCMA 5JA8B 2EDQA 5B4MC 5AQ0A 3L7EB 3EYQD 4RLDA 4UQDA 3PIQA 4XAWL 3RVWD 4HKXB 5KVEH 1INEL 5F7LB 3TBVB 2JTYA 3ELAT 3BMWA 1OGTA 3PWPA 4PJ8A 3B9KC 1CIDA 4RGNB 1X5MA 1U92B 1SOKA 3GZKA 3HI6H 5C07A 4DPCX 2WWMC 1IL1B 3OR7A 1XDTT 2X4UA 4IU2A 3T1FB 5B8CA 2X2YA 2HUHA 4MQXD 1E4KC 3SD2A 4LLYB 1HH6A 2ZKXA 1V27A 3GI8L 4FABH 1ZSDB 1T5WB 2GTWB 3JWNG 4P8QA 4QHPA 2ZG3A 3FONA 4LHUG 3D18B 4LP8A 1A4CA 2EECA 4E41B 4YFEA 2BY2A 3U46B 2ITDB 4U1SB 4G43B 5K1VA 5IHWA 2HJKB 1VADA 2ETWA 3B9KA 2DMCA 1KGWA 2O5XH 3RVXD 3WE6A 5C7ZA 1W16A 1SDDA 1SXNA 1MHPH 2FZ3A 2XWCA 2AERT 3G6JF 4HJJL 4OGAC 4L4TE 3PP3H 3COOA 3MYJA 3AUVA 4N8VB 5B8CC 3QUXB 1FG2A 4M6OH 1P5VA 1CQYA 2R0LL 4Z7OB 2VLJE 1MWAL 3BCFA 3DVGB 1AOHA 4F7KA 3BD3A 1KPUB 2OP4H 3EH4B 1TYRA 1EHLH 1Y6MR 2D0GA 3MRMA 2QV4A 4KUZH 1ND0A 2KZKA 2XTJC 4CMHC 1S5HB 4P48A 5ACMA 1D2OA 1OAUH 4QT5A 3UL4A 2CPCA 3CU1A 5IW3A 1X5ZA 4Y1SA 1YNTB 1TQVA 1MELA 2YMXL 1V54B 2XQYK 1YHPA 4O5LH 5E9DB 5FYLE 4H5SB 1XXDC 5G4MA 4ZNEE 1AMXA 3LN9A 2Q7YB 3T9WA 5DTFA 4DNLA 3VE0B 1BEYL 1KZYA 1NM4A 2WQAA 3J8F7 3QCVL 5B1JA 1PFOA 2KQMA 1UH3A 4KJYA 2EE6A 4N2DA 3NCWA 2UWEE 3RFZC 2HVBA 2NY2D 3U0TA 1USQA 4YHKL 3HKZA 3BIKA 1KYOK 1U8QA 1YEFH 5DZVA 4N2GA 1NOAA 2CUHA 1A1MA 2GIMA 1CL7I 1D5XB 1JF5A 4JVUA 4YOKA 1MCNA 4BUQA 1N3NA 4TVPE 3GMOA 5FWQA 3HCVB 1WO2A 3LH2L 1NIEA 4KZCA 2BSCA 1LK2B 3PDGA 5FW6A 5G5DA 2WNKA 4IMLB 3V4VH 2F53D 2W81C 2YD8A 1R0AL 4O2CB 4F9PC 1QSFB 4IKNA 3SKJH 2ZUQB 2BIQA 4UTCA 2AXGB 2X1OA 1K3ZA 3H6AA 1HQ4B 4DQOL 1TTFA 4MRBA 1ECYA 2EUZA 3BZDA 3MV7E 1UFGA 1ZEAH 4JKMA 2ALAA 5E94B 3PWLA 5ESAA 3SDYH 3CDZA 1MIEL 2BOCB 4TVUA 2DH3A 3UTPE 3REVA 4X8XA 2B8OT 2DQEL 2HFEB 2J43A 4FKEA 1LWHA 2EDNA 1QO3B 3OKNB 3HRZC 1HDMB 4MVBC 4OLYH 4I4WA 4XP1L 3ARFC 1FBIH 1JGIA 3GHEL 3O9WD 1N6UA 3IDIB 4XPTH 4F9PA 2EVHA 1FL6B 4KVCL 4KK8D 4NO5A 3VYNA 3AREB 2G9HB 1ZHNA 3KWWA 4O58H 4FLQA 4Z95L 5IF0A 2GTZA 2NY6D 1B3IA 3PDOA 1QPKA 3RHWK 4MNQD 4JY4B 1X5JA 4AZ8A 3OHXC 2CHDA 2UXVA 1YEHH 1NGPL 5F88A 1EZSA 2W07B 4HSAC 2BVOB 2H0EA 3MJ8B 4AOFA 4GRLD 2AP2A 2VC2B 3NFNB 1S7RB 1KWGA 2JB6B 5ICXA 1JZHA 2E27L 2JKRM 5H94B 4MWFA 5CMAB 5HVFB 5DR5L 4X6EB 4KKLD 5C86A 4N28A 4Y9BA 5E6ID 4LGRB 2ZUWA 4PPTA 5TPWH 1NGWB 2ZX6A 5E6YA 4Y9GA 4DP2X 3TL5A 4XMXA 3FU5A 1ZK9A 3D5OF 4P5KB 5I19L 4OZIE 3RDTB 2WKOA 4S2SB 1AFVH 4EQ2A 2A9NL 2F74A 3N85H 4I0PD 1IGIL 5DVLA 4R4NC 3CDCA 3MLRL 4YSAA 4JFEE 1R5VB 4LLWA 4HCRH 4B9ZA 3UG5A 5C0DB 4FQIH 5CSBA 1I4FB 1FAIL 3BVDB 3KM1A 5H35A 3LAFA 4JMNA 1H9DA 3ZY7A 5C7XH 1FDLL 4W70A 5IGXH 4WI0A 2CJTA 1A7OH 4KROB 3GI9H 4YHIA 4KVNH 3HBPA 2Y36H 4IRZA 2XWJA 3VRJB 1UYWL 3KM2A 4FXLA 5SWSA 4RSYA 3VD0A 1NIDA 3Q9QA 3K6SA 5DEFB 2JJUA 5BRZB 1AZUA 4QOKA 1CC3A 2VSCA 2NY7H 4EUPA 3CFJA 3L2NA 4PLKD 2I9LB 2ZPKH 2FQGA 1MNUL 1NKOA 1F4HA 5EBMB 4QMEA 1NMBL 4KX8A 3NYKA 2YUZA 3KG5A 5EDSA 1YMME 5AAWA 4J2QA 3T6QC 3L45A 3CXHK 3EJQA 5JPMC 4UOZA 1KXHA 1QBLL 3CFEB 3SEPA 2XRAL 4MNHA 3ZPDA 3WDHA 4CC4C 3IU3B 5K1NA 5DJ8A 4OM0L 2EH8L 2YFNA 3HHSB 5BZWB 4DVBB 2FB4L 4IDLA 2HG5A 4PWGA 4PWKA 5HHOA 5T33H 4QJ5B 3ZT7A 2BO0A 1TNMA 4DUVA 4B53A 4MFHA 1UM4H 3MRHB 3NSCA 4YHNA 2GKIA 3PUCA 1OCRB 1N12A 3CSBA 1Q9LB 3SDDC 3OHMB 4CJ1A 2NY0D 5B7MA 5HDQH 2AS5M 2FGZA 2X40A 3UTZA 5F3BA 3P4OB 1WIPA 3HG0A 4L9DA 3QEQB 4NIKB 4P2QE 4Y1TA 3TYGH 1KLFB 2OR8A 3EO0A 1OTSC 3O8XC 2MCMA 3CH1B 3NZ8B 4UQ3A 5JIDA 5C2BH 4PREA 3PQYA 3UTTB 5D5ME 3VXSA 2RD0A 3P0YL 3NIGE 3SYQA 4JM2A 4MMYB 1L0PA 4EOWL 2L7UA 2F15A 2ZUXA 2NDFA 1FNEB 5IVZB 3JYCA 3HIZA 1VEMA 2CZNA 1FHGA 4GQZA 1XF3A 4KUCD 1SUJA 4PV9A 3GMPB 4NQDE 3B5TA 3MRNB 2EE3A 4OIAA 4AM0B 5DJAB 5L8JB 5GZOA 4OUOA 1AD0B 2I26N 1W72A 2VJ0A 4XWGH 1RJYB 3P4NA 2XN1A 4EIUA 3MCLH 3QO0B 1J5IA 2VLRA 1CYWA 2RCSL 5E7FA 2PPAA 1JN6B 3SE4A 3NJVA 3ENEA 3HN3A 2A73A 4XPAL 3S48A 1XGQA 3FSAA 3NZSA 3WKYA 4F7TA 4X9FA 1JK9A 3KPMA 1S6NA 3QFDB 4HWBA 6FABL 2XVKA 5JO5B 3U4KA 4XC3L 1RZJL 5FHAL 3GS7A 4M5ZH 4LPWA 1KB9K 1E3ZA 3E38A 3QUYB 1TJHL 1BREA 1FL3B 3S96B 2I24N 4UYPA 3V9EA 3ETBF 4NQSA 3UEQA 1TU2A 2NSQA 5HVWA 3IDJB 3SDAB 3TWCL 3V0IA 1A21A 1PIGA 1RUAL 4OQTL 4JFDD 2D8KA 1S5IL 3TBSB 2I60L 3B2XA 3HC4L 1OAXH 4BXSV 1QP1A 3QEGH 4JO8A 4Q52A 5IREA 3GINA 1HHJA 2KT6A 5BZXA 4JGUA 5BUGA 3OB0K 4LU5L 1FGVL 4N2HA 3WNKA 4XNYL 4RIRA 1SHWA 2K0RA 3C2AH 3NEEA 2V3DA 3H55A 5KYXA 1GGUA 3EJSA 2OMBA 4BH8A 4YNYA 5DMGD 2DEXX 1HIML 3MA9H 5FM4A 5D9SA 3BKMH 3FUIA 3LV3A 3GKZA 1UKQA 2DEWX 3IDXH 4I9WE 3WSQH 3ZMRA 5JPMB 3K4AA 5KYUB 5HJ3B 1PYWB 2ZWLT 2BMKB 4JZNB 5I18L 4XMTA 1ZSDA 3KR3H 3ZHKA 4TNVF 4AI7A 3WEOA 3PS6A 1IT9L 4P2QB 3ARRA 1A3LL 1VA9A 2BHYA 3BP6A 1QLFA 4IJ3C 1QLEH 1OK8A 3DVGA 1U8CB 4QCIB 1Z5LB 2VR7A 2ZTBA 5DHDA 5FO7A 2ATPA 1FIGH 3ALXA 5D7IF 3RURA 2HX8A 1BD2E 4U2ZA 3SZ6A 1SMDA 4P5MB 5DZ9A 3NAAH 2HPTA 3QA3B 1MEXH 2G2NA 3QAZB 3KYMA 3L3DA 1FFNA 1QRNE 1QZNA 3KWXA 5E2JA 3QEHA 4JG5A 3IMUA 3GJFA 5BS0A 3PWUA 2F5BL 2KDYA 4ANUA 4ODSH 1VFAB 4AQ1C 4U31A 3NBNA 1PZSA 5I2IA 3FYEB 2LTQB 3NRPA 4IYKA 4PG9B 3HLAB 4DZBA 4ZFOA 5CIPH 3K0WA 3PL6C 3VXPA 3ZDXF 4DTGH 4DFHA 3L4XA 1BFSA 2RFXB 4Q0XL 2CH8A 4UBDC 3JWNC 1JF6A 3STLA 4ZD3H 3EG9A 2MSPA 2WXRA 3MV9B 5KG9A 1RI8A 1EEQA 1UGKA 3M8OH 2L8AA 3ASWA 4FG4A 1WZLA 4PY7B 1B0GB 1P7BA 4MJ2A 1KJ2A 2WIMA 3LN4B 3T4AA 2JIXA 1JTOA 3HBZA 4HIPA 5CEXB 2EEFA 4EXKA 4O2CA 1AHKA 2KL6A 1HSBA 3ZT5A 3GI8H 2P24B 2DQCL 4CADB 1Z9OA 1KJMA 1TITA 4KJQC 5GRJH 2D2CC 4C83A 1F4AA 3EADA 2YD6A 4C59B 4KDVA 3WN6A 1A6UH 4L3FA 4PJXA 3MKKA 5FCUH 4OZHA 3GBML 2WW8A 2QDWA 4CW1B 4TNEA 5KVFL 1CGVA 1CQKA 4OVVA 4N0UB 2FWOB 2CUMA 5TH2A 4XB3A 1SUHA 2GCYB 3D87B 2VRKA 1TETH 1NCTA 1AZZC 1A22B 1WFNA 2VLLB 3UJIH 1LTXA 2RJMA 4Y16A 3CFQA 4JDVA 4G6AD 1FWXA 3FQNB 5CR1A 5INCA 2WUCL 4DP4X 1WQVT 4PRAA 5D4HA 1KT2B 1ORSA 4L05A 4P23C 5GPRA 2BOBB 4OKVA 1IM3D 1EDHA 1OAUL 3PV6B 4GRWH 3MFFA 2UZXA 2X42A 5C2UB 3GHBH 1UEYA 4OM1H 4ZXBB 3VI4E 1BJMA 1ZXKA 3BDXA 5I1AA 3SBWA 4P46B 3MBXL 4HWBL 1DJSA 3L7FB 2LABA 3W9DB 4POUB 4MWFB 1VESA 5A2JH 3B9DA 4NQTA 1DO6A 4MJID 4N3TA 5I5IA 1UWGL 3BT0A 4U1IA 4UMGA 5E95B 1CXIA 3BFQG 3N43F 2UY6B 1R5WA 3AXHA 4KJQD 3HZ3A 2DMHA 2X4OA 3M88A 1BQUA 4OCSL 4F2MB 5FEBA 3IVKA 4KRPC 2CR0A 1UB5B 3MRRB 1VADB 5J06A 1HHKA 5LDSA 1A9EB 3KLHD 2WZ5A 1R46A 2XTSA 2X41A 3WKNA 1BWMA 5J13B 4PJIA 4PW3A 1O75A 1PG7W 2WB1A 4LSSH 3U7YH 1LJMA 1AC0A 1VZGA 1A2YA 5KSUA 4PGEA 1FYTD 1XB6A 1EZUA 4F93B 4NQXA 3RY6C 2AEPH 1CK0L 5I5MA 5D2LB 1GKOA 3SODB 2AHIA 1E8XA 5DURD 1PLAA 4HUMB 1MW3A 3F6IA 1UWXK 3MX0A 3IDYB 3F5WA 3UO1L 1RPQA 3ARDC 5LO7A 1MHHA 2OPCA 3UTTD 1NAMA 4L1BA 3P02A 4W6WB 4L4VD 3T2NH 5B38G 3K72B 5HJBA 4P2RA 4Q4EA 3EYUH 4GRWE 4XP1H 2GUYA 2Q7YA 2BVYA 3OKEA 4XCEB 2H32A 2UYLA 8FABA 4L1TA 4G82A 1A8JH 5EU6A 1WGOA 5A2LH 2QTVA 1KCUL 1BAWA 2ZCLH 2UVFA 1YJDH 1TJIH 3TA3D 2OW6A 5DDHB 3TASA 1XH1A 4LOUD 4M9OA 3RWDA 1ONQA 5MHSE 1TJXA 4D8PB 1A1MB 4EJ1C 2XVBA 3B6SB 1TXKA 3S88L 3Q2WA 4JVWA 1DUYB 1IGYA 3JZ7A 1ET5A 4AL8L 4XPGH 2IFFH 4XCCH 4G6FB 2W5PA 3HMXL 1A6ZA 2VXQL 5CJOH 1WBXA 3W5MA 2CWRA 3KGRA 2OFQA 3BW9A 1SYSB 4ZJ9A 2PW1A 2HLFC 1NBVL 5CN2A 4FL4B 3RWGA 1ZS2A 2G5UA 1CF1A 3JVGC 3D30A 2GI7A 4J3WA 3MLPA 1KG0A 4DGVH 4Q8BA 2F18A 4DCQA 1WPCA 2DQ6A 3CFJB 3NZUA 1RPUA 2SODB 3US1A 4YZFF 4IRZH 4QEGA 5KYYB 4E0RA 5FKAA 5DMGC 2DEYX 2NX5A 2EXWC 5EUOE 2PYFA 5ENWA 4D0CA 3MRFA 4S1SL 3MCKA 2CBOA 4JM0A 3CSGA 4ZG1A 3H4FA 1JHLH 1MNNA 1QI3A 3GM0A 4QHKJ 1BFVH 1NTDA 3V6OE 4KQ0A 3O6FB 1MOEA 5ISZD 3VXQA 3A23A 4G8IA 3F65A 5DFWH 4EI6A 3KJ6H 3FRUA 3IJHB 3ZIMA 3GGWA 3DC0A 1NCOA 4QOKE 1PNCA 3MREA 3QE5A 3GI9L 4JFFD 3VNZA 1H5BB 4QCIA 1CL7H 2R4RL 4MXQD 2IIJA 1W15A 2HRGA 3QFJD 4KZDH 4RCAA 5HYQA 3U30B 3VG0H 5DD5H 2AK1H 1CD8A 1EEYB 2XC8A 4WY7H 5EZOL 1G5AA 3T0VA 5IHLB 4QTIH 1OM3H 4MS8C 4NWUL 3NPZB 3SPHA 2ROYA 1ZLVK 2EJ1A 5F7YC 3UTSA 1KN4L 1BXXA 3D85A 4WI5A 3BESR 3JUZA 4P4RA 2J8UA 3IJYB 4EUPG 3QQ4A 3E6HA 2VQ1B 5KJ4A 4R3SB 4GINA 5J6HB 1CDCA 5LGKA 1HXYA 3Q3GB 3MU3A 4OFPA 1GC1H 1NUFA 5GRUH 2VRQA 2YPLB 1KEMH 1IIIA 3QDHA 1ID2A 4DETA 4XNDA 4TRPL 1AS7A 4ICXA 4KX7A 1CB4A 1E28A 2AJYL 1WWWX 3DGCR 2XVLA 3F05A 3L6FB 1HNGA 2ZXAA 4BGLA 2OI9B 3O4LB 4DT2A 1CUOA 1IKNC 2JKLA 3EGDB 2DM2A 2J6EL 4R0LA 2QLVB 2DI7A 2P1YA 5MEND 1T1XB 2EVIA 2VDLL 1QACA 4ZOCA 4IRSC 1U3HD 3TV8A 1AY1H 1EFXB 3LSOB 5ANHA 3BDYL 3BH8A 4Y2DA 5DA0B 5ICYA 1D7FA 1FL3A 2GBTA 1CVSC 1UM5H 3CGTA 4ACTA 4CU7A 4CU6A 2BVEA 2EIKB 2J5LC 1IBHA 2NY3D 2ZAGA 2AXFB 2NLJB 1D9KB 3V55A 2PWHA 1ZA6B 2BSSA 5DRZA 2OMXA 2BHFA 1KC5H 1ET8A 3SDCA 4BELD 1E4WL 3RFZA 3AS1A 4LSRH 5FGBA 1IC1A 4FFWC 4AG4H 1C5DA 4KC3B 2NY5L 1DBAH 2CO1A 3LIZL 1GGIH 3H3PH 4JB9H 2F53E 5F9WB 1QSFD 4HS6B 4FHJA 4N9GB 3HZMB 5C0IA 3M17A 1L4IA 1MPAL 5E0QA 1NMCB 2XT1B 3GWJA 4WFFE 3BZ5A 1UCTA 4S0TD 1A6AB 2PYEE 4KXCA 3EHBB 4ZXBC 3AAZA 5F9OH 1IARB 4JCMA 5D4IA 2Z65C 4OLEA 3V4PB 4YSCA 3RA7H 5C0CA 3QUHA 5EU3B 1TQTA 3V8OA 3MRHA 1ETZB 4BRJA 3BP6B 4DPAX 5J89A 3JV6B 1KV7A 5E8NB 1S4IA 2NY2B 5FB8B 4APQD 3LKSA 3OKMA 1QTPA 3V9FA 2K8QA 4HIEA 4TL5A 5KVMC 1QSVA 4XX1E 3IJ8A 4KFZC 4ZODA 3NJGA 4M29A 3X17A 2XLLA 4F3FB 1E5YA 3EO0B 4GKZB 5D1ZB 4ZI8A 3KCWA 3CZGA 3VX1A 1HQRA 1LO5A 1NGYA 5LBGA 2UZYA 3O6FC 3GSNA 3WEXB 2ADJA 4JKNA 3OX8A 3V4VA 1D5BB 1VSCA 3G7TA 3JTSB 2DQHL 1MAKA 2YLHA 4HKJB 1JXKA 1IAOA 1AKPA 1OSYA 3FB7A 1B0IA 4N8VA 5FKPB 1SHMA 4JGMA 4B7IA 4MX7B 2NW3A 1NAMB 5F93C 1RULL 2ZNXA 3OMAB 3V5DA 1OP4A 3OHXA 3VD1A 4DOHE 2HJKA 2B3IA 2VDPB 1GPOH 1RJCA 3MHZA 1YDPB 3PU7A 3QEGL 4ODBD 4WW1B 1JDAA 1IGCH 5IVXE 5KS9B 1HJBC 3EFFA 1EGJH 5B3NA 4QJ3B 1DBMH 2WPGA 3KVDD 4XNYH 3SKNB 2FO8A 5AVWB 5LDUA 1NUGA 4GO8A 1RUKH 1FFPB 4Z3GA 4I0PC 3QXVA 2XN9A 4HKZB 2A73B 1RJLA 4I87A 3LEYH 3H8NA 1QFUL 4KI5C 3ULUL 2ADYA 1YYML 1VFOA 3MA9L 3IXTA 5JTWA 5FM5O 3M1BB 5JORA 1Q9KB 1N5YH 1V3LA 3S5LG 4JX0A 4UOW0 4WK4B 4EPSA 2FEDC 5D2NE 5E6SB 3RGVC 3IAQA 1JFQL 2FTAA 3P73A 4M7LL 3FH8A 4JFZL 4ZUSB 2WZPD 3D48R 3DUUA 4XX5A 4NI6A 2WWKT 4X5PA 4OGXL 1TQSA 1NBYB 1KENL 2P5WA 3NJMA 2W9LA 4ZW6A 2BERA 2WOYA 1I3GL 3FQYA 2JH2A 3FUNA 4IOIB 2XBTA 1JZ7A 4HALA 4CGUB 4J2XA 3UJTL 4IDJH 2XFGB 4XVJH 2Z8RA 3Q7JA 3S2AA 2C9VA 2HVKB 1XF2A 4XNQB 4KGLA 2CCLA 3VI3B 1CXFA 5CBAB 2HSIA 3ARFD 3RVVD 2XNAB 3B1TA 1OGAA 2D9CA 1Y1DA 1PJWA 4I1NB 3FRUB 3IJHA 5C6WH 3QJUB 2Z92B 4LL4A 3QQ9C 3QJSB 3X13A 2EIZA 1QSFA 3QQXA 2XA3A 4HFWA 3IAPA 5TQ0H 4OLVH 4X5XB 4FFZA 3D2UB 5DI8A 3MR9B 5E70A 1VGEL 1IUZA 4Z7NE 4TMPA 1PKQB 3IYLW 3AXLB 5AB2A 4YBQD 4TYUA 4OLUL 1D6VH 2Z1PA 2ICWA 1PD1A 4P99A 4O02A 5LQBL 3IXAA 1CICA 5JPNB 3NCBB 3NJJA 2HRLA 1Z9NA 3EJTA 3TF4A 1EWHA 2WZAA 2X0VA 3VXNB 5EPMA 1XR8B 1E3XA 2ATKB 3CPUA 4JN1L 1NDTA 4JGJA 1OGTB 2NY3C 3QG7L 3MJ8A 4QRAA 4IQHA 1R5WB 1JP5A 4LCIH 5TD4A 1AZBA 2X4OB 2HB0A 3EFDL 1XBDA 1XD0A 4OCLC 3ZUNC 2OSYA 1B2WH 4PB9H 3FDWA 2GJ6D 1N10A 3OSVA 4MA8L 1OHQA 3EDKA 3B2UC 3H9ZA 2OKMA 1A7PH 2LR4A 3OWRA 3VJ6A 3EGXB 4F7CB 3OKDA 4Y1AE 1BAFL 4MMZB 3BWUC 2ENSA 4PJCE 4N0UE 3GSOB 4NP4L 1EX0A 2WBJC 3G5YA 3WKML 4DEPB 4WV1C 1KGJA 2QKIA 5E6RB 2NQCA 3RZCD 5B8CB 3PWUB 1MIEH 1QUPA 3U83A 1HZKA 3K2IA 1IAKB 3LRSA 2D4FA 4LXFA 3V6OA 1FVDB 2YGVA 4BKLB 1PL3A 2UXFA 1I4FA 5LWYL 1H19A 1TZAA 4GKOA 2WXJA 2P45B 3DSNA 4Z77B 4K94C 4DN4H 4L18A 1MQKL 1JNHB 3MRGB 1IQDB 5AKSA 5KG9B 2H26B 3G6JE 1B6DA 4WWOA 1ZLUK 3BUQA 1JRHI 2LU7A 4OM1L 1DLFH 4RQQA 1R5VA 4MCYB 4HG4J 4OGAD 3OPZL 4UAOC 5T5NG 3FFCA 1DQJA 1TR7A 3RVXC 1U8PA 3PPSA 4ZS7L 4JZJB 1IC5L 1IGTB 1V8HA 4TSCL 5E9DE 1X5FA 5LN4A 4LARH 3RWJB 2X44D 4WWPA 4KV5F 3UBXI 5KSBF 2WNXA 2YXFA 1CXEA 2A4CA 4FZ8H 4NQCD 1DBJH 1KTDB 3N42B 4UDTA 4XC1H 1YJDC 43CAB 4X9YA 3BWAB 4YO0B 5EA0H 3ZRFC 5TK4A 4XOCA 5HPMA 1EJOL 3I6GA 1Q72L 5F3HA 1E4XL 7TAAA 3DI2B 2X4QA 1IFRA 1QRND 4UQ9A 7PAZA 1JF1B 5T1JA 2RALA 2AEPL 2XQ0A 2DN7A 3GXIA 4NZJA 3FPXA 1M53A 4XP9H 2CR6A 5FYKD 4NRXB 4R7NB 3SYCA 3ARBA 4EN3D 5D71H 4ZW7A 3MACH 1FCCA 2VABA 4XP5L 5JW4N 3QW9A 5C7XL 4PYHA 3ROLA 5E2VH 4ZS6D 1AZCA 4ELKB 1I9JH 3D06A 1YMHA 4QRQB 1S7TB 3CSTA 5KAQF 3ARTA 4OF5A 4YHZH 4MZRA 1LO4H 5DD6B 4FS0A 1JXDA 2BOCA 1L3NA 2J2ZA 3BN3B 2HLFD 3DBXB 3BAEL 3RGHA 3MRBA 1MCOL 4KV5E 5KSBE 3DUHA 4PRDB 3QDMD 4G9DB 3BGFB 4N1EA 1UWFA 2BY1A 5DQ9A 2VL4A 5AVXB 2PO6C 4LVHB 5A7BA 2CNYA 1U8MB 2HTLD 4JG0H 2JB5L 4L23A 4RGOH 1NCNA 4V1DB 3RL1B 4MYWB 3UZVA 1JGEB 1ZDQA 4K9JA 5AENA 5AVUB 1AGEB 2HYMA 2Y7NA 4UT7H 2EQDA 5I71B 1CU4L 2J4WH 1O6SB 5CZXD 2R15A 4IKLA 4PJ6A 4Y2OA 5KVGE 5HP5A 4NFCA 3N91A 4PJ9D 3T08A 1A4AA 4GAGH 3IU4L 4FQPA 1VPOH 1BAGA 3L9BA 3UH8A 1PGRB 3M1BA 2BVUA 2DQJH 3KXFE 5J57B 5C0CE 4NFBA 4XXCC 4ETQA 5C0ND 1J1XH 1HHGA 3GSQA 4NBZB 4U1LB 2HUEA 3X3FL 4Y4FC 4BWWA 4F7EB 1EXHA 2VDNL 1RZ7H 1AO7B 4ZNCD 4ZAKD 4X6EA 4GW4A 1YEJL 3HLKA 2C5DC 3RVUC 5AWNH 3C6LB 2VLRB 3APCA 3DV4B 3OF6A 1P9MA 3QFGA 3S5YA 2XY1A 2F54A 2GABA 1HESA 4N1HB 2XY2A 4W81A 1DBKL 5GGVY 4KRPD 3CN0A 1A4KB 3THML 4QXGL 4URKA 4Q9RH 2CG9X 4DK6A 3FFCE 3VI3A 5BCAA 4X4KA 4XBGB 1OIOA 5EZOH 2WLNA 1TTBA 4PVBA 2EIEA 3BW9B 4E5XG 4P59L 1EFXA 5ICUA 5AKTA 3WS6C 4FD0A 1N64L 1OP3H 4NWUH 4GXUM 4G6KH 1NA8A 3E8UH 4JCLA 4F8NA 2JJVA 3IGLA 3PNWA 2G5RA 4NCC1 3O6MH 2YAQA 1KJ3L 1XBRA 5EBWA 2VOTA 3TVMA 1ZLVH 1AHWA 4YDLC 3GBLA 4IGBB 4KDWA 3H56A 4X5LA 1DQMH 4NUQA 3WHE1 4OGYH 4HULB 1TOXA 1ZGLA 5D96C 3B7SA 4UIKL 1QSEA 1A6TB 4XPAH 1T21A 1YYCA 4JRXB 5EC2A 3AGWA 4PBWD 2FECL 3U1SH 2C9RA 5MEQA 1ROCA 2VTFA 3ARBD 2GFBB 1XIWA 1CFMA 4L8DA 4LPXA 1TQCC 4RIRB 1KJ2H 3K74B 4UB0L 4M02A 1RUPH 1ZE3H 2XZQL 5PAZA 3R4DA 4LCCC 2LT9A 4MD5A 5GHWL 4GYBA 1T80A 3VFUB 3P3UA 5E4EC 2DTSA 5A16B 3KYKH 4DKDC 4C4KT 3TPUB 2D0HA 2CMRL 3BP7A 3H1ZA 2EYSA 4GLRI 3V7MA 4ZX3A 4GLRH 1EEYA 3TWCH 4NC1C 4DEPC 4XO8A 4G2AA 2DDQH 5FB8A 2R1YB 2UUDH 1U8NB 2WD0A 1S78D 5DJZB 1S5IH 1OQOA 4ODUB 2HH0L 4H8WC 4OIBA 4QRPD 5F6IC 4JFXA 1U4FA 2XJKA 4YHYC 1I1AB 4J3OD 4Z3EA 2J8UB 4A37A 2X87A 2IAND 1I3VA 2FT6A 2R39A 2NY5H 3GTTA 5JW3H 2GSMB 4UBDD 2VXUH 4JZOA 2V33A 2X70B 5F7BA 5HHPB 3RLSA 4HWNA 1P7QD 1NCJA 5CP3H 2UUDK 3E9UA 4ZAKC 1SRDA 5AEAA 1OCCB 3CXDH 1GYCA 2VW6A 1CLVA 3DUUB 1JI2A 1IGML 4X6FA 1E30A 2BIIA 4NBXB 4PCYA 5D5MF 1HN1A 4EIZC 4NENA 3GJFB 5TE6L 4Q56A 4XP6H 5AVSB 4KQ3L 4ODHL 3VFSA 4FC3E 2E6QA 3MLSH 1AGBA 4EI0A 5HHQB 1NPUA 4OD1L 3V0JA 2EXYD 4YO0A 4DK3A 3M1CA 4Y2DB 5DEGA 1RZGB 1RJLB 5DS8B 1OW0C 3LMJH 3N9GL 3LPGA 3S36X 4N0CD 1KDIA 5HYJA 1GGCL 5CO1A 5IW6A 2CK2A 5GZOD 4F2ME 1JK9B 4PJFB 5CGMA 2VUOA 2IF7A 1LK2A 1UXSB 2IQAB 4OUUA 3VM7A 4FLOA 3VRLF 2BDNH 1J9SA 2NYYD 1QHOA 3BSZH 4HAFA 3ZMEA 1IKOP 1AJ7L 2AK4B 3AU1A 3PJSB 4NN7C 1UJ3C 2XVGA 4LSQL 3ECVA 5DI8B 2Y22A 3OM3B 4RBPK 2B4CH 3V52L 4DP0X 5FECA 1ACYH 4ODSL 3UG3A 5IMOB 4CUCA 2FX7H 3FO2B 2WVVA 3GMMA 3H3BC 4BWTA 3VWKC 4DZ8A 4UF7C 3D2TA 3KGTA 1GPOL 1XGTB 3DMMA 2A9BA 2EC9T 1CYGA 3AUWB 4X7CC 4FI8A 1WCBB 4QNPE 4MSWB 5ITBH 2FHCA 3ZKXC 3O8XB 4RAVA 1ZLSH 4J3OH 5D6CB 4BKSC 2P8LB 3ZO9A 4F15C 5D2NA 3UBXB 3AT0A 4I18B 4YQXL 3S35L 1BJ1H 1A7RL 3I9GH 2CK0H 3D25B 1NFDB 3A6OA 3FOLB 3MODL 4JKPL 4QHLB 4Z7VB 5E24E 4LAQL 4H20H 2HKHL 2VITB 4YDKL 5ISZE 3C5SA 3O45A 3C8KA 3BMVA 2BVPA 4N5ED 4MCMA 3RB5A 4MNGA 3L4ZA 4GUOA 2VN6A 2AZUA 2XWBB 2JCCB 4IOFC 4JQXA 2DWDA 4PRNA 1XGRA 4OGXH 5TFSL 3KMDA 5BRPA 3TNMA 4JN2B 3ARXA 5FCUL 4HH9B 3QUZB 4R26L 4FX5A 4PSPA 4DAGL 4F27A 3TCLB 5FWRA 3TCXA 2V7HA 4HIQA 4JG1H 3MMEB 3UJTH 5ESVA 3VFPA 1HINL 1UXLA 4ZQKA 2ZXWB 3H9HA 3NSJA 3G5YB 3PHOB 4CDHA 4OZFA 2ESVA 1QSFE 2X1WL 3EJJX 3DYPA 4FN0A 3KWUA 1CF8H 2CE6A 5LG6A 4ATTA 3SKOB 1MFCL 3IGAA 4PTUB 1DEEA 4J8QA 4QF1A 1S9VB 3AGVA 3GJEB 2ARJA 2XN2A 3QA3A 1J05B 2C9SA 3KLAB 1WFOA 4TUJB 5C8JB 5FYJH 1UOWA 3MBXH 4PJGB 2BIMA 1GS7A 5FOBA 4MZ2A 2VXSH 4RGMC 4TM9A 5HVHC 1O6VA 3RPBA 3VFRB 4YEFA 3VCLA 2HJFA 2D7TL 2XZAH 2IANB 3FW6A 4WJKB 1INQA 2CJSA 1F58L 4QLRA 5EU5A 1VEOA 4R90L 3DX6B 2HWZL 4OF8A 1OE1A 4LPVA 5EU7C 2M8XA 3INUH 4Y1AA 4AYDC 4LCIL 2CIKA 2BFGA 2XXMB 3MNDA 4FABL 1B2WL 4K3DL 4M5TA 3JWOC 3WS3B 1LP9E 1JDDA 4EF3A 2NT1A 5I75B 2R7EA 1GJWA 2B59A 1G7IB 4XXDB 1M6UA 3K4DA 2HVKA 1NBZB 1IEBA 3CX5J 3WNMA 1A7PL 2RB8A 3APFA 5HYSA 1CR9L 1T6WA 1QR1A 1LEGB 2DPKA 2W0LA 2DMKA 3ZZQA 1IM9D 1U21A 3MTXA 2BCKB 4PLJD 4J4PC 4EZKA 3I50H 3HOGA 3HPLA 4FQJH 3D4YA 3WU1A 2ZXEB 1CT8B 4D0CB 1U36A 3SGKC 5FYKU 4L0PB 1A4BA 2HLEB 2CO6B 3LEVL 4OLZH 1KJMB 1PZ5A 1GGBH 2V7NB 4YL9A 2UVEA 4CN4A 2A1WL 4AEHH 1UJ3B 4ZPVB 1ROWA 4X4YB 2PYED 5E00A 4IGBD 2VO5A 3O6LH 35C8L 43C9B 5IEHA 4JFED 2FX9H 4UT9A 4DGYH 2EKJA 3IS1X 3P4MB 1DLFL 2HVJB 3C8HA 2FHFA 3BEWA 2XG4B 2Q5BA 2ATKA 1RERA 2GEQA 4UT6L 1P7HL 5FW7A 3VB8A 3UDWA 3HMXH 5MEOB 4ZSOB 2P9RA 3QZOA 4KNUA 2ORBH 1KWKA 1YVLA 1BLNA 2C4FU 3QULB 4KTGA 4UTBL 4WNQA 1CBVL 1EIBA 1PX8A 1R24B 4YHYB 1ADWA 4RDQF 4DGWC 5L0QC 5FUOH 3N5AA 1S46A 5E9NA 1MJ8H 1JZFA 2J1WA 3H2WA 3SE8H 4YXLL 4D8OA 4G9DA 1G9MH 1S7XB 4XCNB 3ARWA 4CKQA 1SXBA 4HXBH 1T0NB 4IK6A 4JGNA 5KSVA 3GMPA 4WCYL 5CM1A 2FVNA 3E6HB 1DEDA 5E99L 1E43A 4XGZA 4S1SH 2WINB 3L13A 3W39B 1OPGL 2IDQA 5IQNA 4JPWH 1H0DA 5H37A 4OCWL 2A9DA 1ZTXH 3DXAA 2P8PB 3ZKMC 5MI0C 4FKKA 2OX5A 4PRIB 4KOCA 4R4ND 5LXGL 1LE5A 4X9BA 3VVWA 2O5NA 1ZWIB 3LRKA 4HLZH 2MJWA 3DIFA 1KYDA 1ZLUH 3BKCH 5E08L 1VKXB 1IKFH 2JTDA 3FMGH 1CBJA 1FYTE 3HS0C 4Y4KA 1I9JL 1JZJA 5ID0A 1CL7L 4KDTC 3JWNE 4FOMA 2AEIT 2EYRB 2ID5A 4NM4H 5IV2A 5B21A 1T83C 1FGNH 2XYCA 1GIGH 3O2DL 5FA3B 2VR8A 3GIVA 4YGVB 2R1XB 1FQ9C 2BSED 5F44A 2OSLA 3BSHA 2A74B 1GZQA 1PDKB 3IJSA 3QR1A 4KMLB 5CLTA 1OANA 4OFYA 1NSNL 1UQSB 2G2PA 2EDKA 5CEYB 4JG0L 32C2B 1JFHA 5LGHH 3DI3B 4CN1A 1CFTB 5JZ7D 2ZSVA 1IBYA 2PPEA 3T8XB 4QRPA 2WP3T 1HOCB 3BZFA 3V0FA 1BXVA 4AXWB 1CFVL 3OJDA 5JOEA 3TJEL 3KPSB 2B9BA 1MVUB 1EGJA 1KEML 1U30A 2D0FA 4PBDA 4C4BA 4GO6B 1DFBL 1RIVH 1MFVA 3GEWB 4FYTA 4JFHD 4HUWA 4KBPA 1IC7L 3SZKC 1VPOL 5SWZB 2WVUA 4DOHB 1MN4A 1R4XA 3EFOA 2V5YA 4LNRA 3ISWA 5EUKA 1A9VA 1KG0B 3GKWL 1AFVL 2SEBA 1X9QA 3N85L 5I76B 3R0NA 3ATFA 4ECNA 2JCCA 2NR6D 3APDA 2NX5D 2FSDA 2BK8A 3ZDXE 2C3VB 3CUPA 2ITDA 3R4RA 5DHVB 1G7HB 2Q3XA 3DX9A 1U8NA 3FTYA 3C5ZB 3SKMB 1FNHA 1FZKA 3QHFH 4AV4A 3MVSA 4OR1A 5F7WC 3NFSL 1H5BC 2FATH 5DEZA 5ESVB 1BG9A 4G7VL 4RISH 4RWYH 3E1F1 4X6CB 4NKOA 1J0JA 4ACPA 2XYBA 3M7OA 4HG4K 1IBGH 1L5GB 4Y5YA 3TCTA 4M93B 1LYQA 3O6KH 5DHYA 3Q2VA 5IESH 4H8VA 2WXHA 1P1ZB 1H8SA 2Y23A 2F7QA 2EKSA 2FSEA 3IN0A 4OF3A 1E8WA 1J7VR 2IDSA 4RMVA 3QFJE 2WWOA 5DZJA 3IF1B 4GW1B 3E8UL 1NFAA 1Z7JA 4WHYG 3GSNB 4ZOBA 3OR6B 1NEUA 4U3HA 4WTWA 1TZIA 3VE0A 3N55A 2O6CA 4PJAE 1I7RB 4Z7OF 3TEUA 2LQRA 1IFHL 2Y2TA 1QABA 4JRYE 3SKNA 2X05A 1XL4A 4ETQB 2QMJA 1OSEA 2IANA 3DOSA 3O11A 2W59A 2IDUA 3SPGA 5ERWA 3BEVB 3CV5A 5DO2D 1D2PA 3QIBD 3Q5OA 3QT2A 2I9TA 3OXSA 1KUMA 4AC2A 2WBJA 3ETSA 4NDMB 4JFTA 2XZZA 5F70A 3LKRB 3S4SB 5C3IA 4E9XA 1SFHA 1KB5L 1QWNA 1ZLDA 2XZQH 3GHPA 2L3BA 3WNLA 1BQSA 1EEZA 2GYSA 2Y4SA 4TUOA 4ZBJA 3O3BB 3VFVA 4NENB 4HEME 3BPLB 2Z64C 1CVRA 4LQFH 3LNIA 3CFDA 4KRNA 3FCUB 2C3HA 5HDQL 4DN3H 2IJ0C 1EHXA 4P3CL 2WQSA 2A9MH 4M6NH 2ZUSA 2O26U 1BV8A 3FT1A 1UT1A 3CZUB 8CGTA 1VENA 2DL2A 2HH0H 3JYBA 5HHXH 1C9SA 4LOEA 4B9CA 3JV0A 3N42F 1FRGL 3BUYA 2WGNB 2IH1A 4A7GF 1R5IB 2W9DL 2WMPB 2X3AA 4K5OA 2VLLA 2QMKA 5E94A 43C9A 3U9PH 3WHXA 2OL3H 1DO5A 5EF3A 1T3FB 1YEIL 5ICYB 4FCHA 4CVUA 1MCCA 1BF5A 3RRQA 4LLMA 4RGNC 1MQ8A 1B2YA 3WNIA 4HDIA 2XBZA 4PJDE 4PCKA 3MV7B 3KS0J 4HS6A 3CXDL 4GFXA 3UADA 1NFDA 3GXPA 1RHHA 2H6PA 4H26A 2ED6A 1H3WM 2H2PC 3HPJB 3MJ9A 2OV0A 2GW5A 4W6YB 2DYPA 4FERA 1PG7H 3NCMA 3UYPB 4HKXA 3UAFA 4KI5E 5EZPA 1W2KT 4WFFD 4R2GC 2FJSA 1VEPA 3IDGB 5EU3A 1LDPH 3F7RA 2XV3A 2BRRL 2D7MA 2WUBL 1T7YA 3FQTB 3JTTA 3MLZL 4K07A 4LO9A 4M5ZL 4PV1C 3SE3C 3VFOB 4CRPA 2WXLA 3QUXC 4FFTA 4H0HB 4FAAB 4ODVL 2VO8A 4JY4A 3B3IB 3ZTNL 2ZF9A 5ESQA 5EG6C 4AZ8B 3BZ4B 1PPIA 1IAIM 1QPPA 2MTPA 1DP0A 4RDBA 3BSZL 4P57A 2GHZA 1DHKA 1UOKA 1X7SA 2JXMA 2WLZA 1IM9B 4X4XB 5DRNB 3RG1C 5H8DA 1AI1H 3EIFA 4NZUL 5LXVA 5FOBB 5EZJA 1XF4A 1R9FA 1FJ1B 4J6RL 5I0ZA 2YQ2A 25C8L 4JO4H 1I7TA 1YEEH 4YZWA 4XN2A 2CKBL 3HI1A 2LU4A 1MLBB 1RZQA 4N8UA 4FA7B 4JUTA 1EVTC 1IGFL 1NJ9A 4HPHA 2F8VA 2Y72A 4X5WA 5DFTA 1JOIA 3KXFD 3VSUA 4B5EA 4BFIA 3UC0H 3V4VB 1KZQA 1INEH 2GG1A 1TG8A 4GP5B 4YGVA 5LQBH 3UBGA 3IGAB 4PTUA 3VXME 1FZMA 3W81A 4XNAA 2ZAIA 3ZGHA 2PABA 1K9TA 1Y18B 2R69A 2ZOLB 3BAJA 3HI6L 5T3XH 3V6BR 5JXEC 2Z91B 2EDJA 3Q13A 2XETA 3BKML 3RWDB 2L7JA 4D8PA 1NC2A 4KKRA 1IGTA 1SVZA 2B08A 2R0WL 4WW1A 1WAAA 4G7YH 1B6UA 2A0LC 3OWEA 4O00A 4Z3HA 4U7MA 4YSUA 5CJ8A 5T5FH 4EBQH 5AYUH 2DQDH 5EEUA 5AB9A 4AKPA 2V2WB 4WUKH 43CAA 4X7DC 4V1DE 5JA9A 4AT6B 1H6FA 4OD2B 4MJJA 3HN8A 3R06B 5A2BA 1JZ6A 3KPPB 4B0MM 5I0DA 2NY5C 3J2PA 1W9XA 5AW7B 1HQ4A 3MO1B 5EBLB 2ZXDA 4U33A 2Y07L 2NY1C 3DXAE 5HDLA 5MEPB 3RY5A 3UTOA 2DD8L 1KTJA 3EUDA 5L2KD 1CF8L 2IMNA 3TV3L 5I16A 1MFCH 1TVDA 2NY4B 4Q7DA 3MCKB 5DJ8B 4EQ3A 3KYNB 3VXSD 4ONFL 2JI2A 2A6JB 2OJEB 5CWSB 5EORH 3U6RA 4FULA 1JHTA 1HAWA 3CPLB 3TP4A 2YUWA 3EBGA 4LCWA 2AJ3B 1DYZA 5I26A 1A9BB 4L48A 5J0BA 5EEWA 5D7LA 4MD0B 3L5XL 2X2HA 3QUMH 1NDGB 1SXCA 2YIHA 5GGUA 5C9JA 1TTAA 1MZZA 5T3XE 1N59A 2LVCA 3QEUA 4L4VE 1GZHC 5DHYB 5DMKA 4LARL 3RBSA 2E7DA 4W9CC 4M4PA 4WDIA 4UIMB 1MRCH 4ZFZA 3QJFA 4QRQA 1XF1A 4XCNA 2ICCA 4ZUWA 2ZQKA 2Y6SC 3ZLQC 1CICB 4DVRH 1BX2A 1LP9B 2AXWA 3B2DC 4HJ0D 2JKJA 2VT0A 4BFOA 5HPOA 5IJKC 2IDCA 3QH3A 1DN0A 1E4XH 3PRZA 3BXNA 2B5IC 3KPQA 1B0WA 3I02A 2F7IA 3GUTA 1JN6A 4J3OG 1W8OA 4E9LA 5H94A 3DETD 4KY2A 3ZTDC 4XMWA 4PY8J 4X7SL 1L3WA 4GMSL 3ECBB 4YWGL 4LOVA 2IAAC 1MFBL 4NDMA 3T4YB 1JV2B 1MFAH 2LFEA 2AK4D 2HRPL 4P9MH 1M7DB 2YN3A 5E2VL 3JT0A 1UB6A 5A6LA 4PJGE 1KBPA 4GRMA 1NLBL 4FQLH 1YMMB 1B4RA 1LK3L 2YA1A 3TBYA 5I6MA 3BPOB 1LO4L 1GGBL 1M1XA 3O4LA 3VRIB 2YD9A 3TU6A 4NJ9L 1NC4D 1DVZA 2ZKWA 2RH0A 5LHDA 1RU9L 2JI1A 3G6DH 4F33B 3OAYK 3T0XA 5GGTL 4BFFA 4UUJB 1J12A 5CXPA 3WXWL 2OA9A 1E9PB 4GIOA 4OJYA 3I84A 4YHPA 3STZA 1JNHA 4TUKL 4X6DB 1XD1A 1XSJA 3ORJA 3ESVF 4UT6H 1MCPH 4AMWA 1DJHA 1HWWA 1S3KH 3D0AA 3CFKA 3LNHA 3POHA 3V7AE 4H44C 1MVFA 1CU4H 2P5ED 3FSZA 2EC8A 3Q8CA 1A3RL 1PZBA 2Y6TE 3VXTB 1C5DB 2I7SA 2XTJE 3PNWB 3MUY1 3ZTCC 3NIDF 1LDSA 4DP9X 2W9EH 3TESA 4C54A 4JRYA 3VW3L 2Y5EA 2JJSA 1XFPA 3CMOL 2V9QA 3C60D 5FO8A 1FFTB 2O5ZH 4HEPA 4ODXB 4JRXA 3X3FH 1MXDA 5L7XH 2SEBB 3LS4H 4L8SA 4XTRD 4D0DB 4PJ5E 1CFNA 2OTUB 1NBCA 3P11L 4MLSA 2EADA 3KPLB 1EXUB 2YRLA 2FBJL 1RMFH 4JJOA 4G70B 1RZKH 4IS6A 4OD3L 2I32A 2OSXA 2IPUG 4FNRA 4KVNL 2P5WD 4MMZC 2E46A 4CMMB 4EXPX 1FA4A 4F8TA 3ROLB 3D0VB 1U95B 5L8KB 3FFOA 4PVLA 3ULUE 5HVGB 2ERJC 3DURA 5EO9B 2XOTA 4TLTA 4FTVB 4P57B 4PGDA 4GSDH 2ZCLL 3B7RL 4PV8A 5DHVA 1VZHA 1IL1A 2XV0A 4F20A 1FFNB 5KYUA 3K8KA 4QPEA 3H9SA 1ZV5A 4N6QA 5ANMA 3ZRSA 1IAOB 2X9XA 5GZNC 3NQKA 2UXGA 4UILH 5CZVH 2D9QB 2QVMA 2VMDA 3K1KC 1I1AA 1NMBH 4I3SL 4U7KA 5D1XE 3BUPA 1UD8A 5D93C 1F4YL 3ME0A 1T0NA 3U2SB 3BP4B 3EOAA 3P30H 3Q0HA 5ERWB 4U1SA 4J5VA 4AEIH 2EH7H 2IAMD 4EDXA 4X99B 2ZCHL 5F6HJ 1QBLH 4UIKH 2Z93B 1A3QA 1AD9A 2XRAH 4FQ2L 3QO1B 3IFOB 5T1DH 5IFJA 3MRCA 4LKCB 3ULVL 3SDXA 4M4RB 3SQRA 4L4VB 4QGTA 2LLLA 3VSVA 3DGGB 4BSWB 1QLRB 2FL5B 4NQDA 1LE9B 1G7QA 2YA0A 4FXKC 4I0PA 3V0EA 1LMKA 4HPOL 3MDJA 1PEWA 5DURB 3MNWA 1RL1A 2CLVA 4ISVB 4RRPG 4XHJC 4PY7A 2GJ6A 4YSRA 2WM0A 4JO5A 3K1DA 1VACA 3QNZB 5DZAA 4AT6A 5L9DH 3W3BA 3KJ6L 4H1LG 1AR2A 1TJGH 8PAZA 3TXAA 1D5IH 4UU9B 3QFDA 4J3BA 1O0VA 3SGDH 4YGAB 3GMNB 4JO1L 3UAJC 1N8OE 2VLKE 4AV5A 5FGCB 3T77A 1EEZB 3RILA 4JHUA 1DVUA 1OSPH 1X9LA 3VD9A 4PJ9B 1PY9A 1UACH 5I8KL 1T1YB 2AF2A 1TU2B 3BP5B 1HHHA 1TVBB 4XNZC 2XNAA 2FUTA 2KC0A 4P46D 3V0VB 5E5UB 2GUOB 3UBFA 4Q6KA 4HUWB 4WFED 4G7SB 4Z6AT 2ED9A 1MH5A 4KKCD 3G08B 5I1CH 2AXGA 4TVSa 2Y9RT 5KVFE 1PQZB 1XAUA 4K3GA 5D7IA 5E1AA 2X6MA 2YO3A 4G1MA 1EDYA 4MCZA 4M61B 5D96B 5DQJA 3GQFA 3MI6A 2P4AB 5HDOA 5A2IH 4LESA 2GSIA 4BQ9A 2JCWA 4FTDA 2FO4A 2H6PB 5B22A 1XB3A 1ITCA 4NQEB 4OD1H 1G0XA 5HJ3A 1ZIBA 3SGJC 4PRAB 2ODIA 1DVFA 1UZ6E 3I6KB 2IVFC 1V55B 3O8XA 3Q2CA 4RAVB 5D6CA 4D2NA 5A3ID 3ULVD 4HDIB 3RVVC 2EO9A 3L3OC 1IMHC 2FWLB 3CN1A 3S37L 3HW7A 1EHAA 5L2KB 2ZUUA 4PRNB 1TJHH 3DA0A 1IRAY 4RNRB 1ZVHA 4BEIA 2OTPA 4L29B 1L7IL 1A6TA 2P80D 3KEHA 3R1GH 4W6XB 3UYPA 1UM5L 2A9ML 4NP9A 4PLKC 3S36H 5IW1A 2HJLB 5T1LA 2D7QA 2IV8A 1A2YB 5KSUB 3W38A 4TKWA 4GQ9H 4FYRA 5F6IB 3CFCL 3ARYA 3NG5A 3OR6A 5CEZD 1Q9WB 2CQVA 4U6XA 4TN9A 5CD3A 1SJHA 1BBJA 1WCQA 1FGVH 3CDGB 3BUIA 4P5MA 2RACA 4LEOA 1Z0MA 3QPXL 4MA3B 1J05A 3KLAA 4TQHA 4UOQA 2WHVA 4CBPA 4X5WB 1I1AD 3MODH 3ZYZA 2ZOOA 3LD8B 4WZ9A 3O3DA 4FE9A 1YZZA 2WVTA 5DHMC 4GUQA 1J5CA 3DTXA 2R2HB 3MBEA 5FYJU 4PG9A 3UGEA 2IH3B 3HLAA 4JM2C 4DZBB 1C5BH 1CZ8L 1MREH 3V5HA 4HHGA 3S8GB 1HVXA 3CX2A 2XQYA 3GT6A 3MROA 5D1QE 1YUHB 1QD0A 2BNRB 3O3BA 1K8IA 2YKLH 1Z0NA 1LO2H 1Q0YL 4X80L 3CSPA 2XWJB 4XBEH 3PWPE 2R9HD 5ADPL 5AFAA 4KKLC 5C08E 1SYSA 2N56A 3ULVF 4CSSA 1U8QB 2V8MA 5K59E 1HINH 4ODVH 5D72L 5HPMB 3JWDL 3ZKND 4AV0A 1S7SB 3QZPA 5EC1B 2X4SB 3MRDA 1DUYA 1IGYB 4KOBA 3NCCB 4JRXD 4I5BA 1AQ8A 1NCAH 4MJ4A 4Y1AB 2GCYA 4WI4A 5IB5B 5AZ2L 5D7KE 3MLUH 3QQ3A 5IJBC 1TKWA 4GG8A 2R23B 4NRXA 4R7NA 3Q1SH 4JRYD 1F45A 1SDAB 1J0YA 3WMPA 4F2EA 4U6VL 3GMOB 2JQMA 1LEGA 1BZOA 2B15A 4ZFZB 1UC6A 2MKWA 1YEWA 3O9WC 4NRZA 1F1AA 5E6UB 1JGUH 1ZHLB 2NXYC 5EF0A 2FLRT 3UZQA 5IMMA 4I13B 3DMMB 5CR8A 4K8RL 4ZD3L 3RB7A 1LEKB 3K3QA 4YDJB 4W1TA 2ERJB 3H0TB 3HC0A 2NX5E 4NOFA 3O3EA 1WFMA 3X14B 1BWWA 1MJJA 3VXQB 3D85B 3M6DA 4G8IB 4EI6B 1PY0A 3GMQA 4G83A 4A7GA 1FV1A 4K9EH 1U8LB 1SEBA 4LSPL 4EVNB 4J39A 2DI8A 2NXZC 1MCBA 2NNXA 3C6LD 3CXHJ 3T6WA 1NANH 3WXVH 1BX2B 5KN5A 4F57L 2FQFA 1RLBA 4G5ZL 5F2FA 2DQDL 2BSEA 1DSFH 5KSAC 3MCYA 4QDGA 4BE5A 1OWWA 2YD5A 4WUKL 1KLFA 4NGHL 4HT1H 1F1DA 1Z5HA 1E9QA 2R0KH 4UT9H 5CU9A 1XMWA 3HC3H 1M57B 2D4DA 2BS8A 3IPEA 3FCTA 3L3OB 3OLEA 4XN8A 1PCXA 3FN3A 2DOCA 3Q3GA 4QRUA 5CHNA 2X2JA 3LOWA 5KVGH 5EZIH 3BAKA 2ZD0A 4JRWA 2ATAA 2ZOTA 3BXNB 4UV4H 5HY9B 3A4FA 5GISH 2KUTA 4WRLA 3T0BA 4YDIL 4HS8L 3U9WA 3W2DH 1OSZA 2XTJB 4FNPA 3MLTA 4P5KA 4JG9A 1F3JB 2UX6A 2BWDA 1EJ6A 2DQUL 3NEOA 1K4CB 2CO2A 2ZOLA 2QVKA 4B9YA 1J9TA 1ZA6A 5HHVH 1LEIB 1KLUA 2FH6A 4W9EC 3I3EA 1UFUA 2DKUA 5FA4B 4WI0B 8FABB 1UWGH 5FA3A 3S6CA 3A5VA 5HYEA 2O1AA 3EJRA 4PJ7E 2DRUA 1WWCA 4WKZA 4J3OC 1FN4B 2ZOUA 4B9JA 3VWJB 4LLWB 5DHVH 3GC3A 2AKRB 1MJ8L 1K4DB 3N44F 4JN1H 4TXVB 1YAZA 5D7LD 2OXHA 1OE3A 4AENA 3QG7H 3H7LA 5EDXA 2ZP8A 4N1CA 3TH2T 4JY5H 3HI5H 2DLGA 5C0RH 1T0OA 3ARZA 3BSGA 5F7NC 1HS6A 4QRBA 1KXTB 3AS2A 1DFXA 4MCZB 5DQJB 5JR1H 1JNNH 4HQQH 3UMNA 3T71A 3QZWG 4ANKA 1R3HB 3F6JA 1ZTXL 2BSSB 2WAQA 2VAAB 3TC9A 4RRPA 4MXQC 2QQKH 3JUYA 3OXRB 4IBSA 4MA7H 2CCVA 3FSWA 2CRZA 3FUDA 1MHPL 1QRNB 2C7UA 1RSFA 2VR5A 3WKMH 3QUKB 1FNAA 1KFGA 4ONGH 1KB9J 3B9KD 4NPKA 3ARBC 3ATBA 4A7SA 1KCVH 3NCFB 3RZWA 4PGDB 2WB7A 1N8ZA 3FH7A 3FF8A 1XIWC 3CVBA 1T4KA 4LCUB 5JDSA 4Z8FH 1KIQA 2XXCB 3CN4A 2EEBA 1PZ5B 5A16A 2L7EA 4LCCA 5AKVA 4BCXA 4WTZA 3OKYA 5T1LB 4ZUWB 3ZR6A 5I0XA 4ZZFA 2JKNA 3TEYA 2GY7B 2WWKO 2VDML 3KPSD 4MJ5A 4MMXC 1ZHBA 1FZJA 2E8YA 3GS0A 2IFFL 3KPRB 4XNMA 5LCVL 5AW0B 3AG2B 3DOIA 5DUJA 4DGUA 2QPDB 1KBWA 5LBSH 4GIAA 4LEOB 1CXLA 3I02B 5F7UA 3BE1L 1NGYB 3ZE2E 1DBJL 5HYJE 4NUMA 3ZE0B 4ES8A 3RIAK 1QLRA 4HF5L 1F90H 3QUGA 4PBXA 3RL2A 2N01B 4LEBA 1S7WA 3WOVA 4AYID 2QZQA 3EFFB 3RX7A 3ILQD 1FNEA 4Z3IA 4TOYH 3ABGA 3QZBA 4K15A 1J86A 3CMOH 4PGBA 2QHLA 5B1KA 5G4NA 1FYTA 4KJPD 3D9AL 4Y4FD 1KLGB 4XVTL 5L7XL 1M2OA 1FLTX 3L3JA 4WHTA 2I07B 5DVMA 2X89A 5AW4B 4N2OA 2GJ6B 4ODWB 1FORL 1GW0A 2IOMA 3ESNA 3H85A 4W4NA 1GA2A 2R4RH 4J3UA 3L4YA 4RWYL 1ZVNA 4XPBL 3Q2LA 3STLB 2OYLA 2FQDA 4BHUI 2D3LA 4L5FH 4UM8A 1THCA 5IQ7H 2XV6B 2ZXCA 5IESL 1RK1B 2YOAA 4RWHA 2EUXA 3JVFC 2R23A 1FNGA 2ROXA 5EOCL 1G7MB 4KAQL 5F1IA 3GLZA 4MQSB 2P24A 1AGCA 2PXYC 2A9CA 3W0WE 1CO1A 4MDJB 2YBRA 2VERA 1X5AA 5FPIA 1ZT4A 2JB5H 4RGOL 1PDKA 3D05A 3IJSB 4W4OA 1F4YH 3SDAA 1HEJC 4M48H 4W9GC 2NTFA 3B37A 4H1LB 4JANA 4LPCA 4JFWA 3CFMA 1GCFA 1K5WA 2EH7L 2EDTA 4AMKL 1IFGA 2V17L 3VXSE 1RK0B 2HP4A 3BPCA 5CCHE 3NUKA 3TVMC 4FQ2H 3ERXA 4XVUC 4DKTA 1GYUA 2VISB 4WLCA 2WXPA 1JPGA 5AVVB 3ZZLA 1AQHA 3N1MC 1KEGH 1DE4B 1GAFH 3KPSA 4J7RA 1GH7A 4NO0D 1Y7VA 4FG0A 4PP1C 4L8SC 3WN5B 3AB0B 1WJ3A 3D33A 2E74C 4HPOH 1ORSB 5E51A 5J4MA 1VB9A 3KLKA 4D9LH 3QWRD 1AY1L 3OKLA 3LZPA 5D9SB 3C5ZC 1NIBA 5CCJA 4YE0A 1GW6A 2GJZB 3Q8AA 1PZUB 5SWZA 1MCRA 3SN6N 4ZFGH 5CD3B 1SN0A 2VMFA 4CL7A 1KTCA 3SJVD 2VJ8A 3G04B 1GY2A 4LFHG 4BM7A 1N7MH 1SLUA 1KC5L 5B3JE 4QTHB 2YPVH 4KNSA 4JAMA 1UCBL 2ICEA 3PXHA 1G7JA 1DBAL 3C5ZA 3SKMA 2O6DA 2G9KA 4JKLA 3V0GA 5CU5A 1KYOJ 3QJXA 4P2OC 4X9GA 4N0RA 1P1ZA 2EKSB 3GXMA 4ZTPL 2IV9A 3ALWA 1OTTC 4Z77A 1FVEB 5C8JA 3WTUA 3RIFK 4BFIB 2MH4A 1Q38A 4G6FD 3UPRB 1DQML 4Z7VF 3RA7L 2YEZB 5TJWK 2H9GA 4JFDE 3INOA 1PAZA 3GD1C 3P40A 4HEPG 3H2PA 3AWGA 1XCTB 4YHLH 2QADB 2QQNH 3CLFH 4QRTB 2PWEA 3MRQA 1YEGH 4P49A 1H6EA 3RZCC 3RIAF 3KPNB 1XGPA 4LEXL 4BUGA 2Z4QA 4OQ1A 4WJ5A 2QQQA 3ASOB 1QNZL 5EU7E 2ZG2A 4W9HC 4OFIA 4IOSA 3WCYA 4AIZA 4L37B 3ECUA 1I8AA 3QUYC 2DYRB 5I24A 1EAPB 3LTVA 4F1SA 1A1NA 5I8OL 4KK9C 3QUKA 5IHUL 3V79C 3MV9A 1FSKB 1PLBA 2ZX8A 1XF5A 5ICZA 3EHBD 4OAWB 5DUBA 2P5EE 4H25A 4MHHG 4GQ9L 2YJQA 3F6LA 1OD7A 4I88A 1B90A 3VAEA 1IKNA 3DOHA 5AD0B 4E9TA 1CFBA 1DJYA 1QVOB 2CKBH 2CBMA 4QYOA 1CXKA 1IGCL 2A6DA 3HFFA 3KYNA 4K3HA 2ZP9A 4KKPA 3UC0L 3ALPA 2X4QB 3EF7A 5CD5C 4Z7AA 4ZT1A 4JNXA 4LNVA 4Y16B 1H3GA 3TBBA 3QDMA 4IRJD 4R4FH 4X0NA 3B4NA 3MRLA 1CMOA 2HRHA 2OLDA 4PRPD 5GGUB 1I9IL 4XWGL 4JL2A 4MJIB 4GS7B 3VD5A 1QQDA 3SDCC 3MCLL 2VXVH 4K7PY 5EPMB 5DFAA 4CVZB 2LLGA 2IWFA 4FKHA 1JI1A 4XP6L 1DVFC 3UTPD 4NRZB 4XCFH 4YAQA 4LOFA 1EFXD 3PFQA 5FK9B 1LO2L 3ULUD 3BWUF 3QXUA 1R24A 4FG2A 3IFLL 4XWOC 2V2XB 4LPYA 4R8WL 1IM3B 3G6AB 3VFNA 1K2DB 4ZMAT 4LLMB 1U0QA 3FZUD 2ARWA 5HYQB 3NIDE 2B16A 3SCMA 1JWSA 4E68A 4IDJL 5L2JB 2DKMA 3NMEA 1L9TA 4YX2H 3IDNA 1N0LB 1MUJA 4H1LH 4JPSA 5FLUA 1KYUA 3D12B 4QRUB 2VC2L 1A7QL 2PWDA 4P3DB 4NUJA 4LSQH 4IBTA 3KPQB 1E9QB 1NGQH 4X2UA 5CKAA 1RD6A 1TPXB 2FX7L 1UWEL 2WQRA 4K7PX 4EO5A 4WJG3 3L9YA 1VGEH 3L9EA 5B1AB 3EH3B 4HPYL 4HXAL 4JM2D 1MRDL 4RSVA 4L9LC 5DGRA 1T20A 3QIUA 5KSBB 4YQXH 1KMGA 4ZMLA 3ULVE 4S10A 3PE9A 3QI9B 2F58L 4FI6A 5IQLA 4ELMB 3NCYS 5BPPA 3DNKA 5E2TL 5E5RB 3RWHB 1KB5A 3GIVB 2XCMC 3FHEA 5IZ7A 3WTYA 2CBQA 2Y0SA 3GMLA 1TLMA 2BSTB 1RZIA 4LIQL 1KY7A 3AM8C 2JKXA 4ZFFA 5D7JA 4AC4A 2VAAA 4HV8A 1NKRA 1M6OB 4TLUA 1ONQB 3IDYC 4JZJA 3ARDB 5H2BB 2FR4A 3O6FD 4QRPB 3VGHA 1L9NA 2AI0L 1GHFL 3NT0A 2FQEA 2CLZA 1JE6A 4U0RB 5C6TL 3GSRB 3HC3L 5CJBA 1X5GA 2G5BB 5GJTH 1G9HA 4GG8B 2OXHB 3FU3A 1HT6A 4AENB 1RIHH 3S5LB 3TN0B 4ZMPA 4M6OL 4G9FE 4PW4A 2NY0C 4TF4A 4G42B 1ZVSB 1Z9SA 4R2GB 1RZFH 5EOQH 4D3CH 1BIIA 3L7EA 2DBLH 4FLRA 4BFNA 4YNYB 4GG6F 4U1HA 2WCSA 2Z8VC 3U2JA 3RY4A 5AL0A 4RZCB 4MAYC 4NJ9H 4WENB 2A77L 4FQ1H 5FDYA 3T09A 1MJ7L 3GMRA 1JS4A 4Z7NB 4WU7B 1FFRA 2AV1A 3GFUA 3J27A 3DX8A 1V3MA 2R1YA 4LT7A 5DO8A 5ACZB 4YSPA 4QD2E 1LLAA 3MRPB 2YMXH 2A6JA 1TO5A 2OJEA 5CWSA 3WXWH 1K6QH 4DTGL 1P4IH 3QISA 3BIAX 4PJ7B 3WLBA 3BDBA 2K9UA 1J8KA 1FV1B 1CGWA 4IIQA 2J8OA 4OI8A 3WLWC 3I9PA 3T1FA 1GMEA 4XPFL 1NFDF 3L1GA 1YY9C 2FZ3B 5TQ2L 5IB2B 2F68X 3C6EA 2HWZH 4AGNA 3IDMB 4HX1B 2R2EB 3VSQA 1H15A 5C0FB 2HTKC 1WC7A 1OGAD 4E41A 3HI5L 1CGSH 4K3DH 5C0RL 4X6FB 2X0WA 3VX0A 4NT6B 1R0AH 2DLIA 1IAIL 4IRSD 3VI3F 2BOLA 5F1NB 4PJHA 1WZ1H 3DPBA 1T1WA 5FIEA 2WQVA 4MA7L 5IFJB 4YPGA 3L3KB 4Z5RA 1OSZB 1ZEAL 2DLEA 4PJIF 4XP5H 1QI5A 4NZTL 4X5RA 5DZPA 3HS8A 2ZG1A 4KO5A 1J1PH 3AVEA 2BM3A 4XB7A 3QNXA 2YPLA 1U8IA 4JPKL 4N2NA 6PCYA 3LZOA 4NLAA 4OLYL 3CBRA 1FBIL 2XUWA 3GHEH 1U4EA 1MI5B 4NNPH 3L48A 4TQEL 1MCOH 4GSDL 3BYYA 2JE8A 1Q1JH 3OZ9H 1OGPA 2MTAA 1NFDE 4PH8A 5KJ7E 3DX7B 2P44B 4KQ4L 4K23H 3VUAA 1C1EL 2Z7UA 1QVOA 1B4LA 3MFGB 3NCJH 3PWPD 5C1MB 1QASA 2C9QA 1F1GA 3UGUA 1DLHA 1N6VA 1J9RA 2I5YH 2VLKB 4D7BA 4Z7OE 2JVUA 5LBSL 4TQ8A 2YD3A 2AITA 2AQ1A 1YN6B 2C1OA 4OSUH 5C09A 4QUOA 1AP2A 4WFGE 1TJMA 4KVPA 2WIIA 4JK0D 1A1OB 1TZHB 4POZD 3RDJA 3HG1E 4JRXE 3MV8B 4JS7A 3QDMB 3BH8B 1OAYH 2J25A 3HZVA 2BWIA 1E4HA 1OARL 1NWOA 2O6EA 2OYKA 4O2EB 2WXNA 2AXJA 1MAMH 3NEXA 5E99H 3HJ0A 5B3JF 4PWJA 3MBWA 3OGOE 1PBYA 1BXAA 1UUNA 1WS8A 2CA3A 3FO0H 4HCRL 2J5LB 3FFDB 5TDOB 3WUWG 5I1AB 3AY4C 5GRVK 4BINA 1FDLH 1YEJH 2GJJA 3AC0A 2YXWA 4IBUA 4FFYA 2QELA 3D2UA 2Q76A 5DVOA 2CA4A 4XNXL 2NY0B 4JFFA 1CTNA 5JLZA 1PVHA 4HIHB 5KYWB 3LB6C 5IB3B 3TFKD 1EXUA 1NM9A 1G5GA 5ANME 2W60A 3TNMB 5F9WC 2DMBA 4MJ5B 4XO9A 1GYWA 4Q9RL 3WE6B 4QLWA 2VW4A 1R3JA 2P7TB 2CJUH 3QDJA 4KHTH 3F7QA 3MV9D 1HKLH 4R97C 1N26A 2Y1VA 1SOSA 1EPFA 4FG6D 4ERSH 3FT4A 5K9JL 1H3PH 4G6KL 4NQXB 2NCEA 3S88H 1FE8H 5CGYD 4RFEB 2YGQA 1MCFA 4K3JH 3ZMNA 5E8OA 1IEAB 5IMLB 3UYRL 1VCAA 4ZOAA 1QFWL 3GSNH 4IOSD 2V0AA 2ZCKL 3C09B 3DHUA 2YPKB 3GUFA 4Y7MA 5E5LA 4HP5A 1MFEL 1II4E 5I1HH 3I74A 2DYSB 3QJRB 3SHSA 3FTZA 5HGAA 1MSPA 3CD4A 1DTUA 1U8OA 2C9XA 3CWGA 5JIKA 3X2QB 5DCCA 4QGYA 4AWJC 2YK1H 3UO8B 1DANT 4BQ8A 3WJLC 3WJJC 4M3HA 1IAKA 3ARDD 2VKWA 3LRSB 5INDA 3F7VA 3PAVA 3RTQD 3CHPA 3S37H 3K5SA 1X4XA 1FL5B 1OTUC 5DD1L 1I8IB 1MHCB 5HYSG 3ARDA 4XCYA 1JWUA 2R56L 3FTVA 4D9LL 4WO4B 5BXFB 4HK0B 1E6OH 3WS6A 2FJFB 4H25B 4C55A 4EE2A 1MFUA 3CK0H 5JYLA 1JV5B 1P4LB 2QGBA 3FB5B 2MEJB 4DPRA 3ABKB 5DD0L 1AC6A 1DSWA 1VACB 4MBRA 1ZTMA 3FRPG 2G3NA 1E5CA 5E0FA 3A4EA 3KH3A 2WKOF 4OZHE 1NDMA 2YD2A 1ZHKB 3MXWH 4ZMWA 4I0PB 2ADFH 2YBRB 3RDTD 2YPVL 3ZX1A 3F58H 1T0MB 4KKAD 4E36A 3VH8B 4NRYA 4W9ZA 5E6IB 1L9PA 3LRHA 3U36A 1N2RA 4UQEA 1KPRB 4MJ6A 4F7PA 3KBFA 2ZXBA 3QRGL 5GGRB 1MWAA 4OGQC 4UINL 5ACLA 2YD0A 1LP9F 2QR0A 3A47A 4JFDB 3PWLB 1B88A 2F7RA 2AMUA 4ETYA 2MCG1 4GRLB 1ZTXE 2GUOA 3M1OA 5GRUL 1C5BL 1CZ8H 1MREL 2BC4A 4DP5X 3RUGB 5JXAH 2R4SL 5ETUB 1N59B 3FO1A 2BVPB 5D93B 5AVQB 4MNQB 2BINA 2EAEA 5AOLA 3ZSTA 3HB3B 1KTLA 2NY6B 2P42B 4ZPVA 4Q6YA 6FABH 1ZHLA 3FOLA 1JGDB 5ADPH 2Q7NA 4I77L 4GT0A 4PREB 2VITA 3RWCB 4PJ8C 2J6EH 1C08A 2B20A 3TJPA 1WBZB 5DZOA 2IBGA 2KZBA 3FCSB 5BMFL 5E9AA 3RKPA 4PRPB 2XHNA 3VTAA 1UJTA 4A7QA 3FF7A 4MNGE 4OKDA 5I8OH 2OX5B 1CGXA 3NTCL 3G5WA 3MGTB 2PUQT 4NUGL 4PRIA 5FM8A 2AJUH 4M6NL 3QQ4B 3K2UH 4PS8A 1PX3A 3W9EA 3WIIL 3DHMA 5DWUH 1DCEA 3ECBA 3BUBA 4FMKA 4M1CD 5HYJD 2WLLB 3LHPH 1JMZA 3QIUB 2VH5H 2ZYSA 5IV2B 3KW7A 1MCWM 5C6PB 4P2OA 5LG1A 3TOPA 3W5NA 2CO7A 1Q0XL 5HI5C 1MWOA 1F3JA 4K8RH 4GOSA 4OZGB 2Z9TA 3ROOB 4Y4KB 1FHNA 5LAPA 3DK0A 2FX8H 4ZMZA 3BVVA 4MTMA 3MUZ1 4JKPH 3OKDB 2ZNWA 4R4FL 2DQIH 2X9YA 3JZYA 1BHGA 3JQOB 2PR4H 2Z7ZA 4WHYH 1KB5B 2Q8BL 1H3XA 3QEQD 4JPQA 3SDXF 3TIDB 4U1MA 5C08A 1KPVB 1VHPA 4F57H 2KDGA 1PG7L 1PD0A 4I9XA 4KTYA 1T20B 1YYLL 3C2SA 3NA9H 2QADD 5T3XD 4ONHA 5I6OA 1WAPA 2DB8A 5DD3L 2V2TB 3IKCB 4YVUA 3WGVB 4IEFB 2DQTH 4BK8A 3WFCL 1GSMA 1KXTA 3VRJA 1C12B 4L5FE 4GAJH 3RNKB 1TIUA 3ULUF 1ADQL 4DK5A 3OMZA 4UV4L 2DICA 3AS3A 4ENED 5KTEL 3RIKA 3HUJF 2ZX7A 1NBZA 3WY2A 5KBNC 5GGQL 5KBDA 4MRCA 2IQ9H 3IE9A 2JKWA 3TFKC 4GNKB 1AXSB 4RZCA 2X28A 4M7LT 4XI5D 1ESOA 1UWEH 1F4WH 2R0ZH 4XMLH 3IMWA 4BK5A 1DANU 5FHBL 1AS6A 4Q4IA 5T5NF 4EDWL 4WEBL 1OPOA 1U2HA 2Z35A 3LNGA 1IJNA 3KBEA 3RAJH 2CGZA 3D39B 1TT6A 2R1WB 5JPNC 4TQPA 3EF4A 1CXHA 1IEHA 3GIZL 1J0HA 3ZE0E 4LHUB 5F9AC 2HVJA 2OS7A 4JY5L 2NUTA 5CN1A 3OLGA 1KTKE 3JWOH 5GRZA 4JFZH 3RDTC 2XA8H 3GSVB 4Y19A 2OQJB 2AW2A 4NKOB 2E7CA 2KI6A 1JCVA 2IPTH 2FT7A 1A6UL 1TNNA 5DD6A 2QQKL 3X3GL 1AAJA 3RX5A 3L1FA 3GB7A 3MRKA 1CDGA 3QXDA 4PQXA 4LL9A 1QHPA 2DAVA 4LLVB 2MQGA 3KLQA 2BY3A 2J57A 1QW9A 2WN2A 1KCVL 4AQ8A 3OF6D 3S4SG 1U2YA 1X4YA 2APSA 2DBLL 4EVNA 5CJQL 5IBUG 1CWVA 3V7AG 4GQQA 3TV3H 1W80A 2A1WH 4AEHL 2G75A 3OGCA 1M1SA 5DFVC 3DX4A 3QNFA 4ISVA 3O6LL 1CG9A 1SJVA 5BUPA 4PWHA 1OK0A 4OTXH 2FH8A 1ZSHA 2IPKB 2QZ5A 4NX0A 3QIUC 5FGSA 2YPLD 5ALBH 1I8MA 1NFIB 4K94H 3TIEB 2Z6FA 3VI4B 1P4IL 3DRQA 4M8UA 4R7XA 3LDBC 1BQ5A 4B9KC 4CJ0A 4E5XA 1NCCL 1QLEB 4UTBH 1SXSA 3TTSA 3AY2A 4V2CB 2WWNA 5ECGA 1BYPA 4U6YB 4TSAH 5H2BA 2FR4B 3O9WB 2CM6A 4NUPA 3HHRB 4YDNA 2NT0A 4BSVA 2OSLB 4CADA 2HTKD 5BZDA 4WQOA 3VGBA 1KYFA 4PJHE 1FN4A 3MLWL 3VWJA 1W8NA 4Y4FB 5J9PB 2EYTB 4PJAB 4PB9L 1JNLL 3P4LA 4XOEA 3CLEH 4Z7WF 1UT2A 2L04A 5C71A 4FNLH 5E6ZA 5IQMA 2EABA 1Z9SB 3AU0A 3DVNA 5TF0A 1CK0H 3CLWA 1WZ1L 3VFWA 4OU3A 2GI0A 2KH2B 1U41A 2OL3A 4HJJH 5EBWB 3VFMA 4HUVB 2V9UA 4WUUB 1NAKL 2FO4B 3DIVA 3VGAB 1IKFL 3QDGE 3O41B 3ZN6A 3FBQA 3FQWB 3QR2A 1X7TA 3SPJA 3B3IA 4B9PA 1IILE 4NAMA 3V0DA 5SWQB 2VISA 2C4XA 3A4AA 1JPFA 1BVLA 5LWYH 2FJGB 3UAAA 1IJ9A 1XIWB 1AO7E 4PJBF 3ZE1E 4I7ZC 3O2DH 4O2FB 4R96A 1TJIL 4ZTEA 3FT3B 3GLDA 3BH9B 3MZTA 4BSJA 4EKJA 5FO7B 2GIXA 3CZJA 3QB7C 1XF4B 3QAZC 4Z7UF 3S34L 4TUKH 2AJXH 5IJVA 1E65A 4B6ZA 1HEHC 2K7PA 3VD4A 1QLFB 3NCJL 1LHZA 5CEZH 3QC5X 3OR7B 5IG7B 4BIKA 5JOFA 4OZGA 4AMKH 1F2XK 3OAZH 4EI5D 1YRKA 4Y19E 1FZMB 2B2XL 5ESQB 4G59C 5FYKL 2Z31C 4JO3H 2WO3B 4FYQA 1UWXH 4K0OA 4PTTB 1SM3H 3HS0A 4Y4KC 5PCYA 3TA3B 3FFCD 1OARH 2ZSWB 3VW3H 5IROC 1EJOH 3MSPA 1U8CA 3VXRB 4N2CA 1FNLA 3MBEC 2Z1KA 3MNVA 1BLIA 1YEKH 4EZJA 5IOPB 2ZUYA 1NEZB 5DJXB 4PGBB 4NC1E 3BPLC 3DOSB 2K9FB 3HKFA 3O11B 4PD4K 3CVHL 2G60L 5CZKA 4OZIA 3MROB 3AADB 5CP3A 1C8PA 5B1JC 1MJUL 3SBPA 1BYNA 5E8EA 4LP5A 4QHNB 2JI3A 2XWDA 3PP4H 4Y4KD 1U6AL 1SBBA 1BXUA 5E4IA 3WUWA 1A4JA 4BZ2A 1B0GA 1JRHL 3ES6B 2Z31D 4ZMQA 1E27A 4XPTL 1IBGL 4N86A 3PXJA 4OD2A 3H9YA 3NJHA 1ZGLP 1YECL 4LVNC 2R2BA 1AG6A 5GGSA 1H6UA 4QTIL 5GXBB 5GGRA 4A7UA 5I1GH 4L37A 3UIZA 1U8HB 4NSKA 2VJXA 2AJSH 3BAIA 3KPRE 1FE8L 4P23B 4JM4H 4YLBA 1TEGA 3MRFB 1BPVA 1AOZA 4A1RA 2VABB 2ZCKH 3BSZA 1KIPA 3ZYJA 5T1KD 2BP0A 3PV6A 3CBKB 3MFFB 1J11A 1GC1L 4G9FD 4MMXB 1DBBH 3B9AA 2WAHA 2X53A 4Z18A 4DO4A 1T0MA 1UOVA 2BCKA 3NZHL 4HU8A 2P46B 3SDCD 3ZIYA 4FQHB 4ZXBD 5ESAB 2QFRA 3K4ZA 1FH5L 2A3TA 1TZGL 5INCB 4F15B 2FO1A 3HZYA 2DQJL 1XVSA 4YDVA 1KGCD 3DROB 2Y7OA 1P2CB 2CDFA 4B5ZA 5I9QC 2V7NA 4U05A 1IGIH 3AB0C 3LKOB 4IHOA 5AVYB 4ZX4A 4P5TC 4WTQA 4B9GA 2BW4A 4AVKA 4RA3A 5CD5D 3QUMA 1L9OA 3IRZA 4LCWB 5DD1H 1KELH 5ABAA 3NCEB 4PJCF 5EIIA 5I1JL 5C97A 4H26B 3L7FA 3RUGE 1KCRL 4LQFL 3PXLA 4Y89A 2OXGA 4B3EA 1U8MA 3RL1A 4MYPA 1WBZA 1GS6X 1USZA 2V2XA 3ZDZE 3GB7B 3CHQA 3QXDB 4H8WL 2CLRA 3FU6A 5D1QD 5DD0H 1NIAA 3LS5L 3DMMD 4GRMB 5LCVA 4ZUVA 5F0PB 4HUXA 3MRRA 3KBPA 4DFIA 4R3SA 4X98A 5C0BB 4DP1X 3PJNA 4S0SD 4P59H 3OKLB 3VNYA 1NUDA 4GSQA 3HR6A 2ZOKA 1JWSB 1S7XA 2QSCH 3MGTA 3POCA 3SJVE 3FU8A 4HETA 1WG3A 2WK2A 5J56B 4Y5XC 4Y1AD 4F37F 3QRGH 3SKOA 4F7EA 2YEVB 2JFCA 3FSVA 4LLQB 3TBCA 1YN7B 4C57C 4HLJA 1OOAA 1KV3A 3VA2C 2OMYA 1QA9A 4ONHB 5JXAL 2AC0A 4N2KA 4M7ZB 3GTVA 1HEZB 3IPFA 4G6ML 5BVPL 3PJLA 2CGYA 4QRSB 4GEIA 2WLHA 4HJSA 1OCWH 1QFHA 4PJGA 4WSKA 5FF6B 5JQ6H 1DQVA 2F54E 5CZRA 2G30A 2OCJA 4HIIA 3A6BH 3FB5A 1XAKA 1V7MH 4PGCA 4PYGA 3B2VH 1ULVA 1HC1A 4MS8D 3MV9E 5DVPA 2X2IA 1E50A 1OLLA 1XGPB 4XAKD 2ZCZA 3C08H 2NOYA 2H2SD 1CLOL 1WBYB 5LNEA 1JZ8A 4P3WA 2DDQL 4P07A 4JQVC 2GB2A 4KK6D 1UQSA 2FBOJ 3S98A 1M2VB 1HSAA 3AROA 5EHFA 25C8H 2CGRH 4UMSA 1XEDA 2GK0A 3P0YH 3FK3A 1G84A 1RP9A 3QWQB 2N7SA 5JHBA 1WBXB 4QHKI 5DQDL 3X1EA 5JHLH 4HC1L 5JW3L 1UH4A 3U6XS 2HN7B 1X4ZA 4G42A 3D0LB 1CS6A 4PLOB 1SVCP 3B9EA 4JQVA 4Y16C 3SO3C 4AE0A 3VFUA 1E42A 4PHXA 2Z35B 1T5WA 4F3FA 3KPOB 3GSXB 3BP7B 3SYAA 2O93L 4JPVH 2Q6WA 3TLRA 1HYSC 3I6LE 4GS7C 15C8L 1L0XA 3IFNH 4M7LH 2ZKYA 2B5IB 4WI3A 4LEEA 5MP6L 2EE0A 3OKOA 1MY5A 5F3BB 5EU4B 3T8MA 4GBXA 3SPVA 4GXVH 2N3JA 2AI0H 3ARSA 1IZJA 1P1VA 2IGLA 4AITA 1FP5A 4P2RD 3QUZC 5A40E 1TQBC 4N85A 5GJTL 3SDAD 1PZCA 2VN3A 5AZUA 2NYYC 2VZSA 5HGHA 4GAJL 4J3SA 4Y9FA 3QUYD 3TA3C 4D3CL 2IWEA 2IH9A 1XH0A 3B2PA 1WIOA 4GP4B 5F1SA 1T1WB 3S0PA 1JTPA 5GZOC 2PN5A 4ZX5A 1KJVA 5IMKA 1JIBA 4HBQA 1BLNB 3QULA 5DUML 1WHOA 5EORL 5FFGA 3QDGA 1JZ5A 1YDPA 4U1GC 4WW2F 3II1A 3QYNA 1HXKA 4GUCA 1INDL 3RY6A 1W72B 1JV2A 2I60H 5B7EA 3D3VA 1A6WH 2YLKA 1MFDL 1U33A 3UABA 3T0EB 3L2MA 4KHXL 4GI8A 1TF4A 3LHAA 1D6VL 4PV9B 4JDTH 3BEVA 5DJ2B 1U2CA 4ZAKA 2CU9A 4BSVB 3ET9F 4K7PH 3VA6A 3UIYA 1RK1A 4LAQH 3P3YA 5G5DB 1E28B 4RVBA 1NCWH 5I28A 3EO9L 2AQSA 2CDGA 3IDXL 5I6XB 1Z2KA 2EDRA 1I8LC 3EFDH 1TUPA 3BQUA 3PWVA 4IRSB 3GDBA 3K6IA 3QWRA 4TLKA 2P28B 4N2FA