4GAFB

Crystal structure of ebi-005, a chimera of human il-1beta and il-1ra, bound to human interleukin-1 receptor type 1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
310
structure length
306
Chain Sequence
b'DKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EBI-005
molecule tags Signaling protein
source organism Homo sapiens
publication title Design of a superior cytokine antagonist for topical ophthalmic use.
pubmed doi rcsb
total genus 58
structure length 306
sequence length 310
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13895 Ig_2 Immunoglobulin domain
B PF18452 Ig_6 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gafB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gafB03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gafB01
1T4KA 4NUGL 3U7AA 4N0FA 4RNRB 5IM7A 2EDKA 1YNTB 4A6YH 3DBXB 3BGFC 4RA0C 2DQCH 2B1HH 4QNPE 5D2NB 4YBQC 5IVXF 4NJ9L 2ADGA 1OLZA 3V0WL 3V5DA 5GS1C 5KSAA 1DBBL 3GK8H 3IDNB 3VDBA 3KYKH 3RVXC 2WBJB 1B4JH 4BH7B 1D6VH 2YPLD 4IIQA 1M6OB 1YUHA 5GXBB 1IGYA 4MA3B 4GLRI 3HNSL 4Y4FA 4HHAA 5EFIB 3SCMD 3KWWB 3VRJA 3T0BA 2D7QA 1AHWA 3GIZL 1MEXH 2C9AA 5LXGH 2WWKO 2BSRB 4Y88A 1BEYL 3SE9L 3T3ME 4GAYB 4NKQB 2WUCL 1R5IB 2XWJB 4B53A 4ETQA 3KLSA 4Y8DC 4Y7MA 5DVNA 4LEXL 1UFUA 4HIXH 5DSCB 1G7LB 3O2DL 4X4XB 5J57B 4Z77B 4P2RE 5C92A 3RVXD 5HVWA 3OGCB 1QYGL 4JR9L 2VXTL 4L9LB 3BUYA 4AQOA 1T2JA 2DBLH 5IB1A 4PB0L 5C07D 4F15C 5F3BB 2BSSB 2W65B 2YEZB 1NBVH 3ZZ1A 5DRWA 1RIHL 3DRQA 4YHZL 1JPST 2V9RA 1YEKH 2XZAH 1T0PB 3D39D 3QDMB 5DFVC 3BKYL 3EHBC 4LVHC 3P11L 4H1LG 2YD2A 4HIJB 4KRMB 4F2MA 1INDH 2DL9A 4DN4L 2Y72A 1QFUH 1N4XH 1F4XL 4Z95L 3Q1SH 5C0JA 5BCAA 5FYKL 2JJVA 4WGWB 3QCTH 1MUJA 1INEH 4J1UA 5FYLE 1OAUH 1EHAA 3RY6C 4R0LB 3VG0L 5J12B 1FNEB 1ZGLA 1HDMB 3BWAA 3I6LD 3GMLA 1XZ0B 5J9PB 1A2YA 1J0HA 1EDQA 3BQUD 3LS5H 4ZDHB 4WI9A 4CJ1A 1B2WL 4LPYA 1F4YH 4LIQE 3IJSA 2J8UB 1F13A 3FRPG 1SVCP 2J7LA 2UZIH 2V5SA 4IRJD 4PJGB 3X11A 2VERN 2IF7A 1OHQA 5L8KB 3TVMD 1R3LB 3OR7A 1J0KA 3F12A 5E0QA 3UTTA 1CL7H 2NX5E 4OZIF 5I71C 1IGJB 1QD0A 2ERJB 2A74A 2EECA 1FAIL 4OD1L 2ATPB 1HH9B 3DO3A 1WTGT 1T5WB 4JDZB 15C8L 4K7PH 4LEOA 4MA1C 1AR1C 2QHLA 4G8IA 3NH7L 2YPLA 2E7MA 1CFQB 3KPRA 4HGMA 4PJHE 4M48H 4Z76A 1IKFL 4KUZL 4NKMA 1Q94A 3B8SA 1S7TB 4NQDB 3OPZH 3RUGB 4F9LC 5I18L 5JXAH 4L5FL 3IFNL 3DX7B 3RVUD 1MCKA 3O8XC 5JHLH 1UXSA 1XCQB 3L3JA 2HJFA 3BZ4A 4UOJA 4JB9H 4XWGL 5FO9A 2GAZB 2HN7B 2P5WE 2CDEA 1DBKL 4RAVA 3SEPA 2NY3C 5E7FA 2FECI 1NGZB 3F7YA 1TTFA 3EOBB 2ZUXA 1JHTB 4UINL 4Q9CA 1LHZA 1UEYA 2E7HA 4PJDB 4MD0B 4TSBL 2V7HA 3WCYA 1QSEA 4MNHA 3GB7B 3D39A 3W0WA 4XCNA 1DDHA 3WUWG 5DMKA 3GMOA 1AXSA 4AH2B 4QRUA 3O4LE 1S7RA 1OSPH 2J88H 2DLTA 3Q6FB 4L8BA 2HJKA 3OB8A 4XBPB 1TZGH 5DJDB 4AG4H 2PW1B 4P9ML 4RMUA 3N0PB 5ACZB 1BFOA 2PUQT 1BQSA 1XR8B 2HG5A 1IM9A 2Z4QA 4TULH 3CXDL 5D70L 3QYCA 3U36A 2OI9C 3U9UA 1HN1A 2GJ6B 3FB6B 4H20H 4QRRD 4NNXB 3SKOB 2AABH 4LSQL 3U4BL 1EUUA 3AROA 1G6VK 1U8HA 4WUKL 3VXQB 2IQ9L 1IFHH 1B0RA 3ZSTA 4GKSB 3UTSB 2D31B 1JCKA 1FCCA 3Q5TA 5FOJA 5JPMA 2XPGA 1LEKA 5D5MA 2V9QA 4OKVA 1ZSDA 1IBGL 3QZWB 5BRZD 1I1RA 5DR5H 3BGMA 5T5FL 4UV4L 2WINA 1CG9A 3T8XB 2Z8SA 5I66B 1B4JL 3D85B 5LVEA 1AQDA 4DW2H 4YDVB 4KVCL 1E28B 4P2RD 3O4OC 3X13B 2XV6B 3WS6C 3MRPA 1AP2B 2XG4A 4XAWL 3WD5H 3L7FB 2A1WH 3BOVA 4J6RL 4J8RB 1EBAA 4QHMB 3FFCD 2EYRA 4APQB 4F7CB 3BP7A 3G6AA 1BEYH 3QIBC 1HSBB 2Q3AA 3G08B 1P69B 1R5VB 1KB5H 3BPLC 1F4WH 4N0CD 4AT6B 1JF1B 1BAFH 4M02A 1FZKB 4G42A 3U2SA 5C0IB 3G9VA 4POYA 3HI5H 2SEBB 2BZDA 2F58H 1AD0A 2IANB 3KDMA 4AZ8A 3ZKNC 2Q87A 1BBJB 2E3VA 4F57L 1RIUL 1YUHB 1UZ8B 3NTCH 2AJ3B 4LL9A 4Y4FB 5I16B 3QXAA 1NGYB 3W5MA 5DD0H 2BOBB 4X6FB 3BEVB 1KLUB 3RWIB 3DURA 3DVGA 4PV9A 1RZFH 4LASH 1ZLUK 3ZKQD 1U8QB 1NUFA 1F4XH 1OLLA 2H1PH 4LQFH 4UU9B 4LLMB 4GS7B 5K9JH 2JJSA 4HH9A 5ICYA 4KJQC 3SDAB 2VL4A 2VIRB 3IDMB 2HT2D 1XIWA 4I48B 4HUXB 3BUYB 3U1SL 1UJ3A 2X40A 3UEZA 3HNVH 3QO0B 5A16B 5IR1B 5D7LE 3B9VA 3MBXH 3NIDF 2XRAL 3WL9A 4PR5B 4ZFFB 1IC4L 5EZOH 3K1DA 3UTPD 5ACMA 2I27N 3ARDD 1RZGA 3K2UL 1WBYA 1RHHB 1CS6A 4RIRA 3QRFM 1D9KA 1S7WA 3QG6B 4OCWH 2AXFB 1PLGH 1MY5A 4ZUWB 5CLWA 4PYGA 2VLJE 4HLJA 4XPFH 1EAPA 3NPZB 2A38A 1OM3L 5JMRA 1UM4H 3WFDL 4JM4L 2B4CC 2G5RA 2R2HA 1UB6B 2D7MA 3K0WA 4Y2DC 1K85A 4TNVF 4ISVA 4GS7C 4JCLA 4GRWH 2AK4A 3V52H 1TDQA 1BPVA 4U1JA 5D7JC 1T04B 3MODL 4R3SB 5D96C 3ZLQC 2BSRA 3OKOA 5HHQA 1ZHLB 4E41E 4LHUD 1EFXB 4OFVA 5DK2B 4FQJH 1U92A 5D1ZD 4PY8J 2DQDH 3QWRD 5D8JL 4ZFGL 4U6HB 2WV3A 3BYYA 5F7EL 2V17L 4H25A 5TE6L 3CH1B 1EH9A 1HXYA 5FYKD 4D0BB 3OAYH 2F53E 4MX7B 4JKKA 4LLQA 5DO2C 4PG9A 3SOBH 1EX0A 1B3JA 5L7XL 2BSSA 1XR9A 3ARRA 4Q6YA 2Q3ZA 3TT1H 5E00B 2NY2C 1B0GA 2NY6C 1H3PH 4MNGE 5JUEL 3DXAD 2VABB 4QHKJ 3BVNA 5DHYB 1KUMA 3KPRB 1S7UA 5JDJA 1FORL 5FGCE 4AM0A 2AKRA 1NDMB 2GUOA 5JR1H 4QYOA 4R9HA 5LCVH 2HVKB 4JG1H 3LV3B 1KENH 2W0FA 4ZPTA 5CJQH 1KN2L 2DKMA 5MI0B 1I9IL 4QT5B 4Y19D 5DVMA 4WY7L 3QUML 2I5YL 5AYUH 4JM2C 5D93B 4NN5B 3GSNL 2EH7H 5IB3A 1ZHBB 3EDJA 3HUJE 3EJZD 3MLUL 2RCSH 4MXVE 4HH8A 5IKCA 4PP2A 3EOBA 3IJSB 3SDXF 1KIRB 4LCCA 1T03H 1VDGA 1DEDA 2CMRH 1AQKL 5IP4A 2DAVA 4MNHB 2D03H 1NL0H 4M1GH 4JRYB 4ZOAA 5ETUB 4ZMAT 4DK6A 2X1QA 2VN4A 3D25B 4Y5YC 1CICB 3W9EA 1MHPH 1MF2L 2NY7H 4NZUL 5H2BA 5IBLD 4ONFL 5DJ2B 1ITCA 5GRVK 4XZUB 3DECA 5DD5H 1J87A 5JHDB 2Z35A 1URLA 5IB1B 5CSGA 5D6CA 1WZLA 1Q0XL 5E5RB 1B4RA 3QEQD 1GGIH 2W1NA 2X6MA 1U0QA 4F57H 3UCRA 2GJ6A 3LVEA 3E6FA 2DQTL 5FGBA 1TVDA 3KPSA 3EZ8A 5DVOA 4GG6A 2CRZA 5CINH 3DXAB 2EE3A 4MNQD 1LK2B 3MRDA 4J6RH 2XZCH 3ARBA 3MRRA 4PREA 2GFBA 4AYFA 1XH3A 2QADC 4WHTA 1OP3H 2RHEA 5FO9B 3S8WA 2APXA 4CKVX 3O9WA 2YZ1A 1CR9H 2XY2A 3MRHB 5GQBA 4FTVE 4LSPL 4Z7VB 2AJYH 5H94B 3BEWA 4C4KO 3RWEB 2EICA 1DEEB 4N8VG 4XT1C 1RZ7L 4PJCF 4PS4H 1F58H 1WT5C 5KSAD 5CJ5A 3O8XB 1QSEB 1BQHB 3X13A 3W0WB 1YJDL 4HG4K 4OLVH 1FNGA 3O6FD 3GJEB 5FHBL 4M7LL 1QLEH 5IJVA 4RX4A 5J1SC 2XFXA 3HMWH 3SCMA 2PTTA 3UX9B 5EO1B 4KAQH 5AUMA 5DK0A 4IRSA 3ZE2F 2QEJA 4OCWL 4PRHB 4WGVB 2A74B 4XBPA 4YFEA 4JRYD 1FN4A 4R7NA 4FQ2H 1W72H 1OAXH 1PG7L 5JTWA 5IVXE 1D6VL 4OGYL 4A2LA 4QOKD 1UCBL 1EO8L 5F1IA 3TVMA 3B5GA 4WCYL 1BIIA 1ZAGA 4QO1A 3MV9A 4RFOL 3W5NA 3MV9D 3REVB 4YDIL 5BV7B 4R8WH 3ARPA 4PUBH 4HC1A 2RGSA 2NX5D 1G9MC 3LRSA 1MVFA 1YMHA 3DURB 3QXVA 5HVFB 4LOUC 3FB7A 5BMFH 4C83B 1KJMA 5C8JA 2AGJH 1FVDA 2A9NH 1S78D 4B7LA 4E41D 2CR6A 2UUDK 4L3ED 2A77H 4L3EA 4RSVA 5DF0A 1RAMA 4KKBC 4PLOB 2GJJA 5EN2B 3W2DL 3WNOA 5ITFA 4MZ3A 2X10A 4FG6D 3SJVE 4CVUA 2APTA 4QHNA 4MD0A 5MHSE 2XA3A 1DDHB 2ZKHH 4OBRA 4LCWE 4F7CA 3OAZH 4LOUD 1KPRB 1INDL 1AD9A 1N8ZB 3FKUS 3GSVB 3DSFL 4F15B 4XP6H 3BXNA 3RNKA 4AT6A 1FZKA 4ZS7L 5E5MB 2X4RA 4L8DA 4ONHB 5GIRA 2FHCA 2V17H 4KK9C 4LLDB 2JCCF 2PETA 5T1MA 4HWEH 2IAMA 3A6CH 5EPMB 1OTSC 1VERA 3PWNB 1MLBB 3W0WD 3TO4A 5FA3A 4RZCB 3GSNH 1OAZL 2FIKB 3U9UB 2FO4B 3ARSA 1JYNA 1KJ2B 2RCSL 5CAYB 1QR1A 4HIHB 3WLBA 5GJSH 1UYWH 3TESA 4KH2A 3HR5B 4XCYA 5L88H 3C8KB 1DN2A 3VXSA 1B0RB 3VDAA 3HMXH 5CP7A 3FB5A 1EERB 3QEHA 5F3BA 3MGOB 4PYHA 3CXHK 2VIRA 4NO2A 3VFGL 1MELA 2Z8WC 3MREA 3GSQA 4JQVA 3CU7A 4TVPD 5BRZB 4YBHA 5D1ZB 5I74B 2ADIB 4AEIL 3BESR 4OQ1A 3OKEA 1H5BB 4QGTA 4Y4KC 4JQXA 1P4IH 3JV4B 5C0JB 3HI6L 3C60A 3K74B 2WAHA 1YNLL 4UINH 4CU7A 2G5BB 4JCMA 4I0PD 1IAMA 1RHHA 2DQEL 2C3WA 1FFPA 3WS3A 5E6ID 1QFWI 1NBYB 2XWTB 4ELMA 3LV3A 1A6WH 3TBWA 1BECA 2AXGA 3BP6A 3LKPA 4DFHA 5A3ID 1X5KA 2NYYC 4KJYA 1KG0A 4U1MA 3R4DA 3ARFB 5DMIL 3VGHA 1OP3K 1C12B 3CJJA 2W9EH 3S36X 3NOIA 4P4KD 2W07A 4CL7A 1D6EA 3LB6D 4C54A 4KDWA 1AO7D 3IU3A 1A9EB 3EYFA 1P53A 1I3GH 2UZYB 3STBA 3SGDH 1NLBL 4JREB 3TWCL 4HS3B 1Y6KR 1YEFH 3I6KA 4FTVD 3BKMH 2WWKT 4HK3J 1G7IA 3GJFK 3R0MA 5BXFB 4NYLA 3BISA 4U6HA 1D5MB 3V0WH 3QJFA 3VFWA 1QLEL 4XMLH 1WICA 3CZJA 4PGBB 1DQLH 3JWNC 5JQ6H 3FQWB 3SDAA 4D0DB 4FFVD 1XIWB 4PJAF 4NBXB 2Z31A 3HLAA 2FGWH 2J8UE 3MRNB 1Q94B 3LHPH 5CSBA 4Y4HB 2VDPH 4OGYH 4CRPA 2WUCH 1SJVA 1ZT7A 3IU4L 3BH9A 1T83C 3MLXL 4U6VH 2NPLX 3S37H 2CQVA 3VGGA 4MAUH 3E8UL 3NA9L 1WFNA 1F4HA 3EGSB 5DD1L 1H8OA 3HI1B 4PRHD 4WUKH 2F54A 2IQ9H 1Q9WA 3PQYE 3LH2L 4XRCA 5D96B 2VXSL 4JZOA 5T1LA 3I02A 3UZEA 3MRHA 1XF5A 2BRRH 1BJMA 3SDCD 4OCRH 3CFKA 3G5ZA 4U1HB 4H0IA 1PQZA 1QHOA 1OAQL 4ZUVB 3P0YL 5T5NG 4RNRA 4F7PB 4OIBA 1PEZA 2DB8A 1RZIA 1MCEA 2VXVL 4Z95H 3H7BB 1JGUH 2VQ1B 1U2CA 5E70A 4W6WB 3A67L 1DZBA 5ESAB 1G7MB 4MQ7A 3MV8E 4JFYB 5A1AA 5L2JB 1M1SA 2Y5EA 4S1SL 2EKSA 3OKNB 1FYTB 4ZAKC 5AUMB 5SWZE 3TBVB 4MA8H 5DJ2A 3HZMB 3B5TA 4NO0A 4GXUN 4NNXA 3SKOA 2NY5C 5GRJH 3IFPA 1BOGB 5D2NC 3JWOH 4X99A 4HWEL 1RZJL 4XHQA 2VLMD 1T2QL 3DYPA 4PJEA 1OAZH 1OF2A 3GBLA 4N8VA 3AY4A 2CPCA 4AK1A 4UNVA 4PJBF 5E03A 4KQ3H 4AENB 5AG8A 4J4PD 3KLHC 4HJGB 5T3ZH 5D5MB 4Y5YB 3WFHA 3OR6A 2VL5A 5K93A 5KW9H 1QFHA 2A2QT 3DSNA 5IHUL 3MLRL 2Q6WA 3AMLA 3BGMB 2CUHA 4JFHD 1I3UA 1C16A 1YEGH 4U1GC 3CFEA 1GSMA 5DDHA 4ELKB 1H9VA 1PLGL 3C09C 1A7RL 4MJIE 2ZG3A 1MCDA 4XPFL 4LPVA 1K6QH 5B38B 2IGFL 3O6MH 4WI7A 5D7SH 3NACL 4LCIL 5C3LD 3D2UD 3EOAA 4HIIB 2X7LB 5IROC 3TP4A 4FXGA 1TTGA 3DVFA 4EXKA 2NW3B 1Q72L 5GRWA 3PL6A 1OQOA 4JZJB 5BQ7B 1I8MB 3BMWA 4P5TC 3BJ91 5J9PA 5DUMH 2NXYD 3MUZ1 4Q6IB 4ZDHA 5I30L 2ZSWA 1WWBX 3GHBH 2AJ3A 4KHXL 4KPHL 1K2DA 5LGKA 3WE6A 1X4XA 2I60H 3T1WA 4HKXB 2J5LB 4JRXE 2ZJSH 2VLKD 3RTQC 4K55A 5F6IB 2FIKA 1F8TH 4CN6A 4MDJA 1P4BL 1U93B 1TPXB 1QR1B 5F9JA 1YEHH 4LLMA 4MJIA 3VXTA 4H26A 3GI9H 4OI9A 4JEGB 1AI1H 3IF1B 2ATPA 1J18A 4HCRH 2MQ0A 4C83A 4M6OL 6FABL 3CMOL 4I13B 5HPMB 1X5FA 5T3XD 5AG9A 1MLCA 3V4PH 3BD5A 3G9AB 4ZOCA 4XP1H 1I9IH 4C59B 5H94A 5JQ6L 4F8TA 3W82A 1Q9LA 4TVPL 1I7UB 5FUZH 5IB5A 3M17B 2PNDA 3HRZA 5JW5A 3WXVH 2LAGB 1EEUA 4RIRB 5F44A 3E2HC 2CGRL 4ORZC 3S3JA 3G5XB 3EO1B 3K2MC 1W2KT 1U8JA 4KY1H 4N90D 4G7YL 2XN9E 1F2QA 3BRGC 2Z91B 2PTTB 2Z31C 1VESA 3TLRA 3G5YA 2Q8AH 4S2SA 4J3UA 1KIPA 4WO4A 3IAPA 1JHTA 2ZCHH 2YD8A 4JM2F 1DQLL 1KFAH 3TPUA 4QHUA 2AJSH 3QUMH 1P1ZA 1OPGH 1D6EB 2DD8H 2DM7A 3VGDA 5CGTA 3PWVA 2JK5B 2LU3A 2UWEE 5LWYL 2N4IA 2FYYA 4MXVF 4C56A 2YXFA 1Q1JL 2JJSC 2WM0A 5TPWL 1ZMYA 4K3EL 5FYLH 1CDGA 5HXMA 1A64A 3P0VL 2CDGB 2AV1B 4EDWH 3KYNB 1SMAA 2VB5A 3WO3B 1NFIB 3P73B 1CDCA 1HKLH 3QAZB 1UJ3C 3GMMA 4S1DC 1CFVL 4XHJD 2VABA 3RA7L 5TQ0H 4JFEA 3PWPB 1LEGA 1XGRB 1Z9OA 1U8NB 2R0WH 5CKAA 5E99L 1BJ1J 1K8DA 2P48B 4LSPH 3HLAB 4Y0GA 3ULVD 1A14H 3TJEL 4YXHH 1AKJD 3N1PC 3NCYS 2DM2A 2FWOA 1WV7T 2NY0B 3IGAB 4GT7A 4WDIB 3BGAA 4PJIA 3PUCA 3OKKA 1HEZA 1FFOA 3BP5B 1VB9A 3BH8A 4PJ9C 4UDUB 4PJ7B 1J88A 1VENA 2WSKA 1S3KL 1NAKL 1ZSDB 2QSVA 3EYSL 5DHXB 4OLVL 5DRNA 2VLJB 1PY9A 5FV1L 4XNMA 3Q6GL 2GY7B 1V7NH 1QFWH 2FZ3A 1KBGL 1MJJB 1YEGL 2D7PA 4YHKL 5F1OB 2VC2L 3ZKXB 3MRIB 4Z7WE 3PDOB 3PWUA 1RZKH 1I9JH 5LGJA 1A1OB 1OAXL 5MEPA 4YHNA 5DZOA 4JN2A 5LXGL 5KOMC 4JFDA 4PJ9D 2VMFA 1HOCB 3F65A 2OJEA 5B3JF 1UCBH 1VSCA 1RZJH 5J12C 1FFNA 5IIEA 3ZKND 4CBPA 3DV4B 1RUKH 5C86A 1IC5L 4JPIB 4JFZH 3CCHB 2BSED 4ODWB 4IRJC 1LE5B 2YBRA 2EDNA 3LSOB 5DSCA 4DZ8A 3QUMA 4MJ5A 4P3CL 3OAUH 2EDHA 4X7SL 4KRPD 3UTSD 2G2RB 1IEAA 2FLBT 5C0DB 1BF8A 4LFHD 2RIKA 4JO4H 1HQ4A 4YPGB 2HLFC 2VQTA 3VXSD 3KLHD 3C6LC 4RWHA 2V5TA 4H1LH 5HGBB 2DQDL 3MNZB 2YD1A 5C07B 3JTTB 5EO0B 4PJ7E 4FXKA 3TN0B 3HC3H 1MWAB 4M7ZB 5EDXA 4GW1B 1BJ1H 5GJTL 3I50L 5KVEH 1WWAX 5HBBA 3RL2B 4Y16B 1DBJH 4P9HC 4RBPK 1EVTC 4OZFA 3MRCA 3GMPA 2YXMA 2VKWA 5BVJB 3MGTA 1JPFB 3AGVA 4PJ5B 3CPLA 2HTLC 4U0RB 4XP4H 1UWXH 3NCFB 1DLHB 1RQ5A 3R0NA 4WV1B 3S7GA 4XVSL 4XB8A 3NCCB 5J56B 5HDQL 5KS9F 4HPYL 1FL3A 1LILA 4MQ7B 4IDJL 4MXQC 5BVPH 4X8JA 3OX8A 4FZ8H 1R6VA 1FAIH 4OD1H 3LQAH 2BVTA 3LQMA 3Q48A 5F1IB 3TVMB 4GG8A 2ZUTA 5ANMA 4NWUH 2YN5A 2X2YA 4LHQB 1GAFL 3NZ8B 4ODTL 3KPSE 4EXPX 5ERWA 4LAJH 4ZSOA 3BZEB 5E2TH 3UBXG 3B6SA 5B39B 2X4UB 1X5IA 2BC4B 5F7LB 5GS0D 2D03L 3FB7B 3CSYA 3MBEC 3UZQA 4UOW0 4AENA 1CT8A 1LDPL 1Y0LA 5TJWK 4JM2D 5A3IC 1HXMA 3BX7C 2X4SA 1HXYB 1KYOJ 3FO0L 2GQHA 5EIVA 3EDKA 3IF1A 4J3SA 1NGPL 5FYJH 4XVTH 3ZSSA 1UWEL 5J4MA 4Y4KD 3HMXL 4XXCC 4Y4KA 3ZTNL 5IHLB 5F7MC 3FQXA 1XMWA 2CK0L 4JJ5A 4RAVB 5ID1B 2ZUYA 3ARBC 1SM3L 3E2HB 5KVGL 1FO0B 3AY4C 1T22B 2B1AH 3CIQA 43CAA 3T2NL 3ARED 4OD3L 3F7VB 5F7UA 3UJIH 3OBAA 5JW5B 5DLML 1RZIB 4Z7QF 1I3GL 3CC5A 4YAQA 1X5AA 4Y1AD 3H7BA 4F33B 1MCOL 3VFPB 1KCRL 2DIJA 2ITDB 2R1YB 5E5MA 4GXVH 2J88L 4QRUB 4XTRC 4LPUA 1P4LB 1Q0YH 4PLNC 3QIWC 5GGQL 2R39A 2IWGA 5T1MB 3FRUA 1EV2E 3UJTL 3K8LA 1MH5B 4UAOC 2BRQA 1IAII 3V5KA 1NEZA 1MQ8A 1TJHH 1WJ3A 2W91A 3FQTB 3QG7L 1VFUA 4ZFZB 3KWWA 1G9NL 5F6IC 3AB0B 1YJDH 3HE7B 1I9JL 2BNQA 4HWZB 5CCKL 2W0PA 5CJOL 4DEPC 4N0UB 2PYED 4LBEA 1CFNA 2R23A 1IMHC 3RWGB 1KEMH 1PD6A 1YYLL 4FFVC 2VL5B 3IU4H 4U6TA 5EG6C 3S35H 3ZO0A 5BV7C 3WFZA 4OZHB 1ZTXH 3UTZB 1IC5H 5MEND 4N5ED 3MRLA 3W9DB 1H5BA 2HVJB 2KQMA 4W4NA 2HFGH 1SEQL 3P9LB 1U8LA 2LU7A 2MSPA 5FKAB 4JFEB 1IAIM 3ZTJG 3V6FB 1T83A 4KVCH 4F2MB 3AFLA 4X6CE 1FLTX 1NKRA 4LCWA 1M71A 3QFDA 2NY0C 2OK0L 5GS2H 3H9ZA 2XWTA 3TPKA 5DK3A 4MAYA 1KYOK 4PUBL 3KPMA 2MKLC 1WISA 4Z0XB 3X3FH 4YBLB 1KCLA 1DE4B 5F96H 4OM1H 2OJZH 5DTFB 3J8F7 2Q7NA 2NY4B 5BMFL 4K94L 1OSZB 5HPOA 3U46B 4OTXH 1ZGLB 4D8PA 1OGTB 3EJYD 2EKJA 5D1XD 5B8CC 3G6AB 4JJHA 2KZWA 4JFQA 1IL1A 4PJXE 4QWWD 3SKJH 3QWQB 4CADA 3HG1A 4DZBB 4PRDA 5ALCH 5JOFB 2VXSH 4NFDA 1TCMA 1W72B 4YDJA 1OP5K 4UIMA 3A6OA 4FQXB 2ZPKH 4NWTH 2ZKHL 3T0EC 3IDIB 3CFDA 1KTLB 1HSAA 4PJ8B 3VJ6A 5GGSB 4YHML 4G3YH 3MA7A 3ULVL 5E8NA 1YECL 4KRPC 2Z31B 1AGDB 3HPJA 3VD9A 5E94A 5AAWA 1B90A 3QULA 5D6DC 4LIQL 4U33A 3EDEA 2OZ4L 1IILE 3IDJB 3RPIB 2AERT 1A7RH 3DHMA 5SWSD 1DBJL 1J0YA 4J4PC 4XMPL 2QSQA 4BSVB 3SDAC 4NZJA 5D7SL 2ED9A 5CJXC 1VKXA 3GDBA 5E2TL 3PHOA 4N9OB 4E5XA 3L3JB 3DVNB 4WRLA 1WBYB 1GPOL 1JHKL 1QRND 2PYFB 2GAZA 2HN7A 1Q9OA 3FOLA 3GRWH 4RAHA 3WYRA 4XNMB 5D2LE 4PJHF 4LP4A 3FO0H 5EO9B 1NC4A 1OM3H 1YNKL 5LQBH 2VZTA 4WTWA 1BIHA 3QT2A 4LCUB 8FABB 5EA0L 2E9JA 3D69A 2VAAB 1AHWC 4J4PA 3MSPA 2A9MH 1XFPA 4W81A 2VDOL 4Z7NF 1K6QL 4WTXA 4LP5A 4ZTOL 4FS0A 1OCWL 4Q9QL 4AH2A 3BN3B 3UTTE 4LSVL 2XT1B 4OJFH 3FQNA 3OKOB 4X4XA 1XGQA 4MVBD 1NCCL 3LKSB 3PQYB 5F9OL 3T0XA 2B7DT 1T7ZA 3GI9L 1RULL 3VRLE 4EEEA 2PW1A 1HIML 2YPVH 1W8NA 2VDML 3RHWK 4DZ8B 1TIUA 3ULUL 4KWUA 3VGEA 2HFEA 3C2AH 1IGYB 2GJZB 4MA3A 2HT4C 4Q6IC 2NY6B 1J11A 1WBZA 1HQ4B 3V4PL 1GOGA 5IFJB 4I3RH 4XVUD 1X5GA 1SQ2N 2H2SC 4DGYH 3PV6B 1RUAH 4PY7A 5KVGH 4KRPB 1EEZB 4WWKB 5ABDE 1I8LA 5GRYA 1Q9KA 3HE6D 4NHCH 2EDRA 3SE3A 1G0DA 3WXVL 1K3ZA 1OOAA 4Z77A 2VR5A 3RVUC 5MEQA 2O5ZL 4HBCL 1T7WA 4LU5H 2JF1A 4GW1A 1A2YB 4QOKB 1S7QA 1HNFA 3Q5YA 5CZVH 1KGCD 1A3RH 1ZT1B 5JORB 3O0RL 1PGRB 5HYSG 2IALB 4M1DH 3TGXA 4IOIA 5CSZA 4ZXBB 1DBBH 3MGTB 2IMMA 4XBGA 4JPKL 3DI2B 4G8FB 2OZ4A 4GRWB 4U3XA 4PD4K 1KIRA 4LCCB 1QRNB 3E3QC 4K8RH 5I9QB 3ILQD 4ZTPH 4MAUL 4FQQA 2P5EE 1NCAL 4CDGC 1JF1A 1D5XB 2BHYA 5DWUH 3TZVD 3X3GL 5F7NC 3WLWC 1Z5LA 5IK3A 4JPIA 3PP3K 2YBRB 2XKNB 5K9KB 3C5ZC 4AL8L 5EOQH 1YY9C 1I1AA 2BRRL 2P44B 1FBIH 3JV0A 4NQUA 2Q8AL 3VA2C 3SKJL 4PJEE 2AJZB 3STLA 1J5OH 4MDJB 2HWZL 3L3IB 3BZFB 1KLGB 3LN9A 1DL7L 3BZEA 4JFFB 4YPGA 3AM8C 1EJ6A 2IFGA 5KVFL 3ESVF 1EJOH 4ZPVB 2ZUQC 3L5XH 2NY5H 4D0CB 4FOMA 5HGDA 2YC1B 4X7TA 3LZFL 2XN9D 1ZLVK 4JFOB 2P5ED 2YKLL 3RGVA 5LBSH 4OTXL 1NGZA 5C2BH 2OCFD 4PB9L 3MPCA 1P7HL 1MIEH 4J3OC 3OKDA 2FATL 1INEL 1E4XL 3L3DA 3ZT7A 3BZDA 5E9DB 4MQTB 4OZFB 5FGCB 1FNFA 2J6EH 2Y5TB 4NRZB 3T0VA 4UIKH 1NSNH 4YO0B 43CAB 3EW3B 4Y4HC 3ZDZE 3VU2A 5E99H 1XF3B 1HILB 1BD2B 4WU5B 5F3HA 1S7XA 5FHBH 4P4RA 1VEOA 2HJFB 1FNSH 3ARVA 3E6HA 1HHHB 5J11C 4QWWC 3TO2B 1JVKA 1U58A 1BFSA 2R2HB 1V3JA 1GJIA 3NCYP 4IRJB 4YXKL 35C8L 3VRIB 5C0CA 3CFKB 4ZXBD 5F8RC 5K9QI 1JMXA 2EEAA 4TOYL 1RFDH 3KLDA 1BQLL 1YN7B 1BQHG 4DZBA 5ANMB 2JK5A 5GZNC 4YHKH 2E6JA 3IVKA 1KLFA 1FG2A 2LVCA 3S34H 4KTYA 4L9LC 3ARDC 3LMJH 4PTUB 2HLAA 5EBWA 1WAAF 2BNUA 4OLXL 1QR4A 4UQ3A 4OKVB 3L3GB 5TDOA 4NQXB 1WWWX 4MXWL 4GMTH 3G04B 3QEQA 4KUZH 4I2XE 2NZ9C 1OB1A 1LO5A 4N1EA 1MOEA 1YJDC 3AC0A 2DYPA 2VLLA 3GHBL 3EO0B 3VFMA 4KJWC 2Z4QB 3SJVD 5HI5C 4JQVC 4CVXB 4YR6B 2R0ZH 3LIZL 4I5BB 2B0SH 4WUUB 2E27L 5J89A 3BIKA 1LMKA 2F53D 4KVNL 5I15L 1FZJB 4X7SH 3UJJL 3DVIA 1UM6H 1WC7A 1S7VB 1ZLSH 3U9PH 1CE1H 4HT1L 3RGHA 4P23A 2CKNA 1JGLH 4GKSA 4KTDH 4CU6A 2VLJA 3DXAE 4BKLA 5JW4M 4XP4L 5D1ZC 5FYKU 3U7YL 4YNYB 4UNUA 1L9MA 1OGTA 4ELKA 5DC0A 2V5RA 3BO8B 3LD8C 3EUUA 3MJ7B 3BGFB 1RI8A 5HI4C 4DN3L 2PYFA 3F8UB 4I4WA 4L3EE 1MIML 3M45A 4F7TA 3V5HB 1RULH 5IKCB 2EYTA 4PRID 1KACB 4PRDB 3ULUH 1CGSL 3WMSA 3DHJA 2UY6A 4E41A 1AH1A 2VZUA 1I75A 3LDBC 4LHUG 3QEQE 4J8RA 1UYWL 4ZFOL 1VEMA 1XGUB 4HIHA 2WWMD 5CGYC 4LBEB 1CDBA 5E56A 5SX4H 5SX4I 2WW8A 5E08H 5IMKA 4HUXA 4I48A 4FXLA 3GSOB 5I17A 1I4FA 2R1XA 5I1GH 1G6RH 4O58L 4KRNA 3VFGH 4KDVA 1UVQB 4HV8B 1QBLH 4MD5B 3BT2L 1OSPL 2GJZA 4HFWA 5CS7A 1GOHA 3MLYL 5DMGC 1BMGA 4RGOH 3MNVB 3C5SA 2HKHH 3ZYOA 3TH3T 3L5JA 1FPTL 3QIUB 4TPRH 2D2OA 4WU7A 3WIHA 2IAMD 3KPSB 2FLRT 3HZYA 4JPKH 4OUUA 5FECB 2X4QA 5T33L 1HKFA 5I2IB 3N1FC 4YC2B 1V3MA 3EOTL 1PBYA 3B2VH 3UJIL 5DXWA 4PJCA 2AEPL 3UPRA 4HPOH 4M7JL 3C9NB 4BA8A 3MJ8B 5FOBB 4R26L 2AXGB 1QPXA 3M17A 8FABA 2DQUH 1H8SA 4PBWD 5JORA 1UM5L 5MEOA 3UYOD 2EZ0D 1QVOB 1BAFL 1MJ7H 3UYRL 4O2FA 1EFXD 4I18C 2IC2A 2YRLA 4O2EA 4RMWA 5JOPE 3D2UA 1VFBB 1FNGB 3GSNB 1K8IB 4NQCD 4GH7B 5IJVB 5FM4A 4OI7A 4XMKL 1XCTB 5EO1A 1DVFD 4KMLB 3EYSH 5ESVA 1J0IA 3TO4D 1NUNB 4FQQB 2OTUA 1ROWA 3RHWF 4LSTL 4D3CH 4HWBH 4L8SC 3KXFA 4XMLL 2NY5L 3HZKA 4PRIB 3WFBL 3WNKA 4H88H 1A7OH 1ZHKB 4K94C 4ESKA 3NZ8A 4PGBA 4QTHB 3S35X 1ZGLP 1FVEA 5E9DD 5EUOA 2H1PL 2PKDA 3GMQB 1DFBH 2DWDB 3P40A 3QSKB 4HUWA 4LQFL 3HC4L 4F3FB 4O4YL 2GJ6E 4JG0L 4KI5F 3DJ9A 5JA9A 2ICWB 3TNNA 3MRNA 4QYOB 4YWGH 1K4CA 1PSKH 1SJHB 2QQNH 5L8LB 2FBOJ 3AS3A 3P77B 1SBSL 3LRSB 2QL1A 4JKLA 3B8YA 1NSNL 5E8EA 5FUOL 1RIUH 4M61B 2ZOKA 3OJDB 3L1OH 2FSEA 4ZPVA 5MEQB 3CDYA 1OGAD 1YMMA 5JW4R 4FTVA 2UZXB 1PG7W 3GO1H 4HWBA 3GGWB 3NABH 4ZODA 2NW2B 5E6YA 4P3CH 1MCWM 1T2XA 5CHNA 2R0KH 1CDJA 4XRCB 1QSZA 1YEDA 3MXWH 4UDTB 3LS4H 4PJHA 1E4JA 1MI5A 2R0ZL 3LIZH 3VCLB 3VI4F 2GUOB 3H9SD 4JPWL 1BFVL 4JO3L 3EKCA 1L6XA 5FYKE 1E4KC 1N7ML 4E9LA 3EDFA 3O3DA 1CVRA 3C6SB 5EU3A 3H2WA 4ONGL 2LU4A 2DM4A 5ESAA 4EJ1C 3FFCA 4OM1L 1PW3A 1RJYB 3RU8H 4NM8H 3U7YH 4ZUSB 5JHDA 4K7FA 5L2KA 3MCKA 3U82B 1YPZF 4Q74A 4PJFA 3VRIA 4BZ1H 4BELD 2BVOA 2EC8A 4R4FH 4NKOB 5EIIA 4F80A 3QWOB 3BJLA 1TMCB 5IQ9A 3LQAC 2J8OA 5EOCJ 3HR5A 1U8MA 1JZ4A 1FG2B 4HT1H 4WWKA 5F97E 5KN5A 3HAEG 4FQCH 4ODWA 1NBVL 3O4LA 1QBMH 1KOAA 1IGIL 1M7IB 5IHUH 2NXYB 3MRLB 3W9DA 4POZC 3DTXA 4IMKA 1KJ3L 3VXRD 3MREB 5BRZA 1YPZA 1RZ8A 1MI5E 4FQJL 4KJQD 1RJZB 3EFDL 3O9WD 3WJJA 1ZT1A 3RAJL 4B50A 2JCCB 4GUPA 2D7TH 2IAND 2JB6B 1WCBA 3AM8A 4K3GA 1FDLH 3QO1A 4DKFL 1BP3B 1KN2H 2P5EB 4YFLI 1NCNA 4YR6A 2BY1A 2G9HA 3DGGB 5EZIL 3U4EA 3UXFA 2VXQL 3BT2H 5C3TA 4LIQH 3CX2A 3LRHA 2H3NA 2HKHL 1AKJA 4K7PL 1NBYA 1ND0B 4BH8A 4PV8B 2WIIA 3CAFA 3UTSE 4Z5RA 5EZLA 1XH3B 4WHTB 4KTEH 5CBEB 1U91B 2KQNA 3MRBB 4JY4A 3O11A 4PJDA 4YNYA 3B9KD 1NDGA 4P2RB 4F58H 3RWDA 1CE6A 1GPOH 4KROD 1ORQA 2HH0H 4RQQA 4CVWA 1R0AH 5JHLL 3SKNB 1AGFB 3HAEH 1EMTH 3TBTA 3QIUD 3TJHC 3SKUD 1UKTA 4K9EL 4LARL 5DD5L 2I07A 3MOQA 2FD6L 3S98A 3IAGC 4IS6A 5FA4A 3BDYL 4MJIB 3ARBD 4TSBH 4YGVA 2DQGH 2OQJA 2KL6A 3PV7A 3AREC 5ISZE 3RPIA 4WW2C 4KGLA 2E6PA 4XX1E 1JPGA 3GSXB 1NMAL 2FR4B 4OZ4B 4BSVA 2OLDA 3UTQB 1R3HA 1T1WB 3UTSA 3L3DB 3VXRB 4DUWA 4BK5A 3ROOA 5DT1L 5FHAH 1CR9L 2VLRD 3ARDA 2V2TA 3BSZL 4LLWA 1IQWH 4G43A 3S96B 4HWNA 3ESUF 1YQVL 4WU7B 4AY0A 4MSWB 1H5BC 1I8IA 5GGTL 2BDNH 2XA8L 1AJ7H 4S0TD 3RNKB 4ZNCD 3TNMB 1V5JA 4KI5D 4KHTL 4H20L 5JZ7D 5E6IB 3D69B 3OB0H 4OBSA 3HPLB 4UUJA 2JKXA 1FRGL 2BFVH 2ARWA 5T3XE 5C0CB 5ADOL 5CINL 5EN2A 5HYEA 1J1XH 4JY6B 1A7OL 5D7LA 2OR8A 4R7DA 1WTLA 1HSBA 4XVJL 1ZLWK 2OK0H 1UEMA 2F19L 5T5FH 3HE6A 2JJUA 3X3FL 2L0DA 3LKSA 1IJ9A 1P4LA 1CLOL 4PTUA 2NX5A 3MRMB 2VDNL 5D9SB 2FBJL 3CGTA 1EIBA 4K71C 2O5YH 3OG4B 4CVZB 5D4QA 2HT2C 4NKIL 1HZHL 1JNHA 3ETBF 4IHOB 4L8SA 4RWYH 1H3GA 3QPQC 4X6FA 3T0EA 3PWNA 3T0ED 2VUYA 1ZHKA 5H8DA 1J8KA 3BPLB 5KS9E 4RZCA 4GBXC 5DJ0B 1KJ2A 4Q58C 3PWPA 4G6JL 1FZJA 3RX5A 1N0LA 4OIIH 4OI8A 1S7VA 3NFPA 1RY7B 2F5AL 2HWZH 3LOWA 3L5WA 2EE6A 3GUTA 2X1WL 3TV3H 1ZANL 1S3KH 3UAJC 2VLME 3R06B 3NTCL 3QI9D 3ISWA 1CICD 2VE6B 4QRRE 1KG0B 2F74B 2P5WA 4NC1C 2R69L 5GGRA 4ZO8A 3QUZD 3PXJA 3P9LA 2F53A 3C9NA 3H9HA 3I9GH 2YKLH 1KJ2L 3OKEB 3U0TA 1CN4A 2X7LA 1Z0MA 2A9NL 5JLZB 1QSEE 1P7QB 2G5BA 4I3SH 2JJTC 5J6HA 2RB8A 5A2LH 1U6AL 2OR9H 3QPXL 1I8MA 2LV4A 4GBXB 1MCSA 4WJ5B 1YEIH 3TBWB 4P3WA 5EBLA 5JDSB 4PGDB 1I1AB 3S97C 1HH9A 3Q5OA 3QDJB 5IW6A 3VFTB 4KTEL 4BUGA 3Q3GB 5I17B 2AJZA 1Y6NR 1XGPB 5L88L 5JOFA 5MENB 4Z7WA 1QHPA 4LHUB 2H26B 1AXTL 1T1XA 5EUOB 1JWSA 2H41A 3C5JA 4HV8A 4CUCA 5ISZD 3DX9B 3RDTC 5HYQA 4OZIA 2LAAA 1IE5A 1VFOA 4HS3A 4NNPL 2BVOB 5C6TL 4NQDD 2B2XH 4DUXA 1AGBA 2CIIB 3DIFA 1S9WB 4NQSB 2DRUA 3G6DL 1IAIH 5SWSE 3GZKA 3HNVL 4Z7WF 1UXSB 5CD3A 4HAFA 5FB8B 5EBMB 2FD6H 3HC3L 3MNZA 4EN3A 4HUMB 2X1XR 4FXKB 4LMQE 5IW1B 1BJ8A 1I8KB 5KVEL 2MNUA 3JVGC 1RZ8B 4U1HA 4HK0A 1ZOXA 4V2CB 5EORL 1MRDH 1SEBB 2VNCA 4X80H 1HILA 3MA9L 2P5EA 3KPOA 3QEUA 4RDQG 1CGSH 2H45A 4HXBL 4ZD3H 1G7JA 3GSNA 4TUJB 1ZEAL 3PGDB 1WGOA 1EGJL 5ACLA 4X98A 1IGTA 3MR9B 4X6EB 4Z7QE 4WW2B 5HYFA 5L6YH 1T0MA 4OZIE 1J1OH 2XACC 1YEFL 3MRJB 4NQEE 5IEKB 4FZ8L 1RJYA 2APVA 1I1AC 3OX8B 2JIXA 5C09A 4P23D 3OJVC 4X83A 3RVWC 3MBEA 5E08L 3G5ZB 4M1DL 4O02L 4JG1L 3EFFB 1BX2B 2PCPB 1CD1B 3INUH 1AGFA 4EOWL 1LD9A 3TFKC 2ZUWA 3ARXA 3S36L 1AC0A 1WZKA 4H8WL 2CKBL 3MLYH 4H1LA 5C6PB 5GRVL 5CZXD 2ZG2A 3BAEH 5HD8C 5CEZH 4G8GA 3G6JF 2BC4A 4UV7L 4OV5A 2HRPL 4Y19B 4XPHH 1QNZH 3FRPA 3CLEL 4Y2DA 5IW3A 3BKCH 1ACYH 2VDPL 2FH8A 9CGTA 2EZ0C 4OCSH 1UWEH 2AJXL 4MCYA 4MJ2A 4HK3N 3DROA 1AC6A 2X1OA 1Y18A 2IPTL 2ZUQB 5I19L 2OBGA 2YK1L 5IVXA 5ADOH 1ES0B 2MPAL 3MRPB 2VTFA 5DRXA 1HEZB 3O9WB 4QHMA 4A6YL 3I84A 1ND0A 1SY6L 2B1HL 4BH8B 4P5TB 3MUHL 3PWLB 3BEWB 3SO3B 2QADD 4L3CB 4WWID 1QLFA 1I1YB 4NFBA 4F7TB 3V7AE 5HDBF 5EU7C 1I1CA 5T33H 1G9MH 4IDLA 2YMXH 2FCBA 1AQKH 4Y8AA 5IFHH 1UADC 1U3JA 3K81A 3QHFL 1TJHL 3PDGA 2OL3L 3MCLH 4O9HL 2OR7A 4RWYL 4UQ2B 3MO1B 4X4YA 3KNBB 5LJYH 2A6JB 4JLRA 2F8XC 3ORJA 5IVZB 2J6EL 2UWEA 4U05A 2K1MA 4UIKL 4HUNB 4FXGB 5IT2H 3IKCA 1HOCA 4EUPG 4R7DB 5LKNA 4MA8L 3ULVC 5FF6A 1GGUA 3WEXA 2QADB 1DJSA 2B39A 5GZOC 2BJMH 3WNMA 2FX9L 3GSOA 4O51B 1SJXA 4HH9B 4BYHA 1C08B 1M7IA 5D9SA 3T2QA 3CFJA 2OQJB 3MLSL 4CAGA 3VD5A 3RWGA 1UVQA 3RJQB 1BOYA 1VFAA 2G60H 2YD4A 4XC3H 3WNNA 1GGBL 5CMAA 5CWSA 3ZDXF 2IQAA 4MLSA 4OZHA 4BZ2L 1A8JH 1L7TH 1PG7X 5D6DA 2MCPH 1MCJA 3GSUA 3NAAH 1EO5A 1A47A 5I73B 2NNAB 5B3NA 1U8LB 2MKWA 3Q1SL 3FONB 3JTTA 4FQ2L 1DVFA 2IGFH 3TN0A 3QG6A 1P84J 4L3EB 4QY8B 4P2OB 1S9YB 3R1GH 3KPMB 4P46A 3VXSE 3ROLB 3G6DH 1MI5D 3J7HA 3DX8B 3TT3H 1AE6H 4JN1H 4Y2DD 1KPVA 5E4EB 1DQJA 3KHOA 4P2RA 1YEEH 4XNZC 4NFCA 5T3ZL 5EUKA 1P1ZB 2EEDA 1IL1B 4LKCA 5I15H 3HMWL 4HLZH 3U0TB 4WEBL 1X6NA 1C5BL 1B6DA 4FNLH 4YH6A 5CKGA 4PRPD 1ZVHA 4AQ1B 3QNXB 2ADJA 5EC2A 3LS4L 5BO1H 4U7SA 4X8JB 1U36A 1ZHNA 3QDAA 3KXFB 1I7ZA 5HHME 1OGAE 2BCKB 2QQQA 3AVEA 3VI4E 4DK3A 3FN3A 4E0RA 2F8VA 4FQCL 1J0JA 4NDMB 2E8YA 4PG9B 15C8H 1MIMH 4K23H 4YDIH 3QIWB 4GG8B 3H9SA 2RJMA 1AI1L 3UZVB 1K4CB 2P4AB 2Q86B 4GAFB 1FGVL 5IB2A 2ZSVB 3UTQA 5I8OL 5DYOB 1MCPH 2AKRB 5DVLA 2MJWA 4KV5E 3ROOB 1M7DA 1ZVSA 4PJ7A 3S5LB 2FYYB 1NGQH 1KEGH 4EOWH 3IETB 3MJ9H 5CIPB 1RURL 3L5WB 4H8WH 1HHJA 3CVHA 5C0AA 3OF6D 3EO0A 4MXQD 3SDYH 4LCWD 4EN3C 1ERNA 1PYWA 1PY4A 2XWBA 5MP6L 5LGHH 3WIHL 5F88B 3N9GH 1IGIH 2XZZA 1I8KA 3ZHLA 5IB3B 2NY6D 3FQXB 3LQZB 4XCFH 5E6ZA 5EULV 3ZTJH 1DBAH 2AJXH 1EA9C 4NC2B 3FMGL 3RWFB 1DSFH 2YPLE 1MUJB 2D7TL 4UT6H 2IPTH 5I19H 1GCFA 5GS2D 2APFA 4FMKA 1PKQE 2QBWA 3INUL 3L95B 5GPRA 3H42H 2IH3A 3BO8A 4OF6A 4QLRA 5BS0D 5DMJB 2NX5B 3WN5B 4IIQB 4C57C 3CVHH 5SV3A 1SY6H 3ARGB 3FRUB 3K8KA 1BZ7A 3A6BH 3WUZA 3RVWD 3CLEH 3PQYA 1OL0A 1QSFB 4G9FD 1G9ML 4JDTL 1EAJA 3QUYD 3T0EB 3KR3L 3X11B 4XP9H 1OWRM 2Y7QA 1HE7A 3P9MA 3MLWL 1R5IA 1KN4L 5C07E 2BMKB 2UYLA 3QH3B 2F5BL 3KLAB 4HGWB 4U49A 4XMKH 4M7LT 2W9EL 5H35A 1TVHA 2DWEB 1IQWL 4RGMC 4N0YL 3CCHA 1HHKB 1TCRA 1ADQA 1J10A 2BJML 4Y4HA 5DUPH 2JB6A 2UVFA 5HGHB 4HC1H 4FZEH 1MCQA 4FABH 2NY4C 3MRCB 4HK0B 1NFDB 3O2VL 2G9HB 3ALWA 4MCYB 1DEEA 4YBLC 1S7TA 4NQDA 2OP4L 3IRZA 1YDPB 3DROB 1NJ9A 2GCYB 2E5EA 2VZ1A 3ET9F 1QUNA 5A43C 2ZWLT 3CZFA 1QFWL 3CXHJ 4JO2L 4U7KA 2YHGA 1NCTA 4XC1H 4ELMF 4RGND 1DE4A 3PHSA 1D3CA 1P7KA 5ESQA 3PGDA 3QUZC 1OSZA 4MJ4A 3O11B 1LNUB 1FG9C 4X98B 2YN3A 2FGWL 2COQA 1JRHL 1MFCH 1WF5A 1S9VA 1UH2A 4IOSD 4KC3B 1TVBB 1GYAA 1MCFA 3HI5L 3TC9A 1MFEH 1XIWD 5BOPA 1H8NA 3QIWD 3VD4A 1FN4B 5IQ7L 1XF1A 1UCTA 2IPUG 1WFUA 4KHTH 3F7QA 4NIKB 5E8PA 2ITCB 4XC3L 1VFBA 3OB0K 4JFZL 5C0RH 2FO1A 5T5NF 4UQ2A 4N8PA 2HMID 3T0AA 1JGVH 7FABL 4I18B 4JFFA 1C5BH 4PJGE 1WIPA 4L8BB 1INQB 4HX1B 3ZKSD 2PO6C 4FRWA 3WIFA 5ACZA 5DEFB 2AEIT 1KULA 5BZDB 2K3TA 4YHIB 4D0CA 1QRNE 2P47B 3DNKA 4KKBD 4Y5VC 5IMLA 1P7QD 3D0VB 1T20A 1ZV5A 5J11B 1DBMH 3V5DB 5F9WB 4BH7A 3QI9A 2NZ9D 4JQIL 3S96A 3MXVL 4GSDL 1MPAL 5HGAB 1NFKA 2Q6WB 4JRXA 4NZDA 4MSWA 3CC5B 5HY9B 3OAUL 2DLEA 3C60C 4DGVH 4LVHB 2FSEB 3MLTA 4LLYB 1XGTA 3QZWA 1G1YA 2WINB 4WUUD 1G6RA 5F1NB 3DETC 2HKFL 2X4NB 1I85A 4Y5VA 3E6HB 2DMBA 1WBXA 1T2QH 4YDVA 1KB9K 1F5WA 1T6WA 4F7EB 1ZANH 2GEEA 4G9FB 5D1XC 1J8HB 1DQJB 2IAMB 1KC5H 4JFFE 2VH5H 3MV7E 5ID1A 2GK0A 3D3VD 3MBEB 1FO0A 5FIEA 3RGVD 1T3FB 1T0NB 3EFFA 3HE6B 3I50H 3SGJC 3WUWB 4N9GA 4P59L 2H8PA 3BD3A 2P5WD 1OTUD 2ZSWB 1R5VA 5MERB 2JB5H 5D8JH 4RISL 3WO4C 2Y36H 3F5WB 1G84A 1JPTH 2HJKB 2SEBA 3SBWC 3FOMA 1NGQL 3VG0H 2L7JA 4OLUL 4Y19A 4L9DA 3NZHH 1U3ZA 3VFVB 1OGAB 2CLVA 5F7FA 4FFYH 1IAIL 1U95B 1N6QL 4X6BA 1JPSH 1CGWA 4TRPL 3VXUB 2ADIA 1A6ZA 3QIWA 1TJGH 3RGVC 5I76A 1NCDH 2R2BA 1E4WL 2IBZY 2NZIA 2ATKB 3MLRH 4MA1B 4M8QA 3LKOA 1FQ9C 1JUFB 1C5CL 3C60B 5SWZD 3HE7D 4ZS6D 4QEGA 1ZLSL 3U9PL 5FM5O 2AK4E 1MJUL 5GS0L 3SY0B 5JIIA 3DMMC 3QDGA 4AEHL 1WIOA 2P5WB 4P5TD 1LO4H 5CIPA 3HB3C 4HXBH 5IVNA 2XQBL 3JBG7 3G5VB 4CGTA 4NRYB 4OD3H 4P9HL 1NAMB 2KDGA 2XKSA 5F70A 3E3QE 3HG1B 3LEYH 3LEXA 5JW3H 4KKCD 5C0BD 1E28A 5E24E 4JY5H 3IS0X 2IALA 5EUKB 1P7QA 1GOFA 3M1BA 4GXVL 4JFXB 5C0NC 2GITA 5GISH 3RP1A 4MWFA 5TFSH 2DYPD 5DEZA 2VJXA 1JZ6A 2Z91A 2ZCKH 1S5HB 5DJYA 3I6KB 2HTLD 3N85L 3VXRE 4EUPB 5FF6B 1G7IB 4LSRL 1ZS8B 3DV6B 4Z0BL 3B9EA 3MA9H 4CDHA 2IJ0C 2NXZB 1IT9L 1I7TA 1RZJC 2B1AL 2EO9A 4OGXL 3GBNH 2HRPH 1U41A 5K9KA 3TJHD 2X09A 1DBKH 3BKCL 4GOSA 5KSBB 3QNYA 1A21A 2QQKL 3TZVB 3RVTC 43C9A 5CMAB 5CWSB 1C7TA 1I4FB 2ORBH 4P2QE 1RJLA 1CDYA 4UIMB 2RBLA 3QXDB 5JZ7C 4NO3A 1WZMA 2YK1H 5IHZA 1LO0H 3IETA 1SEQH 4K71B 3DX6B 4PJXF 3SE4C 1HYSC 3NCJH 3EOTH 4PBVC 3HZYB 4BSWA 2VLKB 1C5DB 4XTRD 4JM2A 2CD0A 1UJ3B 5HI3D 2ADFH 1B0GB 1TZGL 2AEWA 4G80B 1ACYL 3G6JE 1AO7E 4GQPH 4R26H 3VXRA 3RWHA 2I9TA 5JA8B 3C5ZA 1RZGB 4ERSL 1X5XA 5DRNB 3U0PA 5HHMB 2OL3H 1FLRL 3MCLL 3MMEA 1UB5B 3O2DH 5TH2A 5ILTH 4OB5L 3WKML 3ECBB 2VQ1A 5ELIA 4CMHC 4JO1L 2ZCHL 3KYKL 4EIZC 5ESQB 3RVVD 5T3ZD 4DGVL 4ODUB 3T3PF 3UP1A 4MNQE 2X89D 4XXDB 5JPNA 1JF5A 2ZPKL 3V6OC 1BX2A 4FQXD 4HQQL 4BFIB 1LEIA 4HKZB 3MYZA 4JGJA 3S3PA 4B7IA 2FEEI 3PXHA 4PY7B 5IVOA 1MHEB 5SWSA 5I75B 2UYLB 2A1WL 4PJEB 3AREB 3RTQA 3D9AH 1UWGH 4HGWA 1T7XA 1D5ZA 4QHKI 2OSLA 3BQUB 5D1QC 4LGPB 1INQA 1KELL 4HMEA 2AK4D 5C0DA 2BNQD 3EYVA 4NSKB 1AGEB 1A14L 4JDVA 3KXFE 1CU4H 4L8CA 5E00A 3BKYH 3PIQB 3LAFA 2BX5A 5FUCE 3ULUC 5DHYA 4JN1L 3QWRA 4AM0B 5GS3A 4G8GD 4XBGB 5EWIL 2X44D 2ARJB 1WFTA 2K7QA 5GSVB 3QI9C 4M7KH 3FO2B 3DO7A 2B2XL 3MRDB 3WS6A 4HF5L 3MRQB 3PWLA 3R8BB 1ADQH 1KJVB 2GYSA 2IFFH 3THML 2MCPL 3SCMC 5I16A 3F58L 3PL6B 4HWUA 4XNUL 4M5YL 4LLUA 3CSPA 4ORGB 4PTTA 4NQEA 4UTAH 1LNUA 3BEVA 4Z7NE 2KH2B 3IJYB 3BPOC 5C0CE 3KPQA 3S37X 3DYMA 4NM8L 2A73B 4S0SD 4YEFA 4NQCA 3FT4A 5CEXA 5D1XA 3BZFA 4U2ZA 3DARA 1ZLUH 2V2XA 3RKDC 4YPJA 1QKZH 4NN5C 1NC2B 5DJCA 4G8GE 1BGXL 2P8LB 1U42A 1LP9B 4ZOBA 2XFXB 3SCMB 3PABA 4NJAH 4PJBA 5ETUA 4OZGE 3B9KB 2DTSA 4WFHE 3ZL4H 3CU1A 3UDWC 2PYEA 3UO1H 3KLAA 4WEBH 3GNMH 5FXCH 2NXYC 3NCEB 3H9YA 3QQ3A 5JO5A 3I2CL 3TYFA 4PGZA 1BQUA 2CLZA 3AU1B 4OIAA 1JV5B 1NEZG 4F9LA 2ZCLH 3QIUC 4X4ZA 3SGDI 5BZDA 5KN5B 1HHKA 1TCRB 3NH7H 1O0VA 1CLYH 4JM4H 2XTJD 4ODSL 5DZNA 2HYMA 1H3XA 12E8H 5H37G 4AEIH 3FQUB 4HUUA 4OZIB 2IPUK 5JQHC 4G6KH 4Z7UB 1TETH 4P48A 1P4IL 1T21A 4HBCH 5D1QB 2QQKH 3BQUC 1VPOH 1PZ5B 2BERA 4MMXC 3ES6B 1YMHB 3MODH 2VXQH 3VGAB 3CZFB 4QY8A 1N5YL 3DXAA 1V7MH 4O2CA 3U4EB 1PKQB 5I2IA 4Y4KB 1VHPA 1W0WA 4NQCE 2YC1A 4X7TB 1K3IA 3QDGB 3C09B 4Z0BH 1Y6MR 4KJPC 4Z5RB 3P4NB 1RUAL 1DQDH 3VI3F 1MCCA 2BVPB 5T3ZE 1OVZA 3TH4T 4ZAKB 4F58L 3CFCL 3CH1A 4NM4L 2HT4D 5D7KD 3ZHKA 3ILPA 4R4ND 1EUTA 2FJHA 3PP4L 4JAMB 5AWNL 1NLBH 3PL6D 1RHFA 2A6IA 1ZVYA 5I1KL 3WNPA 1A3RL 5D7JA 2Q1EA 5DI8B 1XCTA 3PWJB 3B2UC 3GRWA 3FO1B 2CJUL 1DSFL 4RGNB 3PNWA 1UG9A 4HIEA 4BQ8A 3VRLF 1W0VB 4PJAA 1NAMH 5KVFH 1FYTD 4ENEC 1QLRB 5I1LB 4D9RE 1X7QB 2QHRL 5IMLB 5IB2B 1I7RB 1UXWB 2DLHA 4HXAH 4PJXA 5I1CL 3HFML 1UWXK 3MLUH 5I76B 1BIIB 3LZFH 1KCUL 1WC7B 2APWA 2R23B 1KCVH 4IRSD 1GGYA 1OT1A 3RJDA 5EU6A 3SBWA 3JV6B 3BKJL 1A7QL 1WZ1L 3S37L 2FATH 3IDUA 2R4SL 4HAGA 2ZOKB 1FVDB 1FLRH 2ERJC 3ILQC 3MJ7A 1X6LA 1XGTB 2HAZA 1I8IB 3GGWA 3H7LA 4NRYA 4M5ZL 4W4OC 4BSWB 3WLWD 1KELH 3ZDZF 2EIZA 1JRHH 3ARUA 4Y4FC 4L29B 5CCKH 4YHOH 2FX8H 4M93B 3TN0C 3BIKB 2J3SA 3PWUB 3QRGH 1Q0XH 2WZPD 1MFBL 5I8EA 4KKAD 4XZUA 4D8PB 4JHAL 4JY6A 4YZFE 1A6VH 4CNIA 5DJYB 4P5MA 4LCYA 2KUTA 3U0PB 5E9DE 4JFQB 1I1YA 4CADB 2NR6D 1UKSA 1U8OA 3ARFA 4XC1L 3ARFD 5GGVL 4YC2C 1A1MB 1AE6L 1F3RB 3KYOB 1PZUB 3ALPA 3VFVA 1LK2A 4X6BB 2PXYD 1ULVA 2EYTB 5HYJD 1WAAE 1UQSB 3BP4B 4E41B 2YUVA 5DJ0A 5E4IA 4AIOA 4M6ML 3TH2T 5C0AE 3QJFB 1S9XA 3VFWB 2NR6C 3WFDH 1J05B 2N7BA 3PHQB 4KVNH 3ARFC 4WHYH 5CBAA 3D39E 3W0WE 4FMFA 4POUB 1DN0A 3STZA 4HKJB 4X5XA 1NFDA 2IQAB 2P46B 3AMKA 3U0WH 2MHAA 3NVQA 3I9GL 2EDOA 1TNMA 2GCYA 5SWZA 2I9TB 5KS9A 4HFWB 2C26A 1VKXB 2FL5A 5HI5D 1KJ2H 3C5ZB 1KXTB 5DO2D 2GITB 3PWPE 4GRWE 5J6GA 4DN3H 1YECH 5LG1A 2I24N 1KC5L 4ZFGH 3VD3A 1WFOA 2XTJE 2YWYA 1Z2KA 4S11A 1YY8A 5I9QC 4L1HA 4NJAL 5D72L 2K9UA 2Q8BH 5IF0A 4PJCB 5JNYA 3FFCE 1CIUA 4IRZH 3TVMC 4PGCA 3O8XD 1YEIL 3BPCA 5KG9A 1I7TB 1DTUA 5IJKC 4N68A 3OKLA 5FUCC 3JV5A 3GMQA 3B83A 4HMCA 1E27B 1CLYL 3VFTA 4H8WC 4L4VA 4WVRA 4Y89A 1X5JA 7CGTA 5EC2B 1A02N 4KROB 5B39A 5BV7L 3QCTL 1N59A 2I07B 2R15A 5E8EB 1FV1B 3WNLA 5LAXB 5TE6H 1VPOL 4RFEA 1VGEL 5FA4B 1D5MA 2BSTA 4OCYH 4YHIA 2KBGA 2FJFA 3EYOB 4KKCC 2H9GB 4D9LL 3FT2B 2A6KB 2XTJC 4YGVB 4Q9RH 4H5SB 4N0FB 1IGFL 4I77L 4RISH 5I1IH 3LKNA 1MREL 1YYMH 1RV6X 2DICA 5CZXC 4X9IA 2R9HD 2JTDA 4KUCD 2ZSVA 4PRBA 2V7NA 3MV7D 4P9HH 5JW4Q 1HQRB 3AUVA 3T3PE 2UZIL 3P30L 4J3VA 4X6CA 3MV11 1PX3A 5E1HB 4NKMB 3DO7B 4GQ9L 5ADPL 1KCUH 1TJGL 1HNGA 1KCVL 3FTGA 3IXTB 1NGWB 2L4OA 3REWB 2NY7L 4KJPD 3ZDYE 3EOYG 1FO0H 2BY3A 1G7JB 3CUPA 4LQ1A 2P43B 3B3IB 1RUPH 3BWUC 3EJJX 3SQOH 5E6IA 3I02B 3RI5K 1GGCH 4OQTH 3MR9A 3O2WL 1ITBB 3EOAB 4FZEL 4XCEB 1OCWH 4Q9QH 1HH6B 3V4VH 2Z93A 3FAWA 3T4AA 4ZFZA 5I1DA 1B9ZA 1N2RB 25C8H 3FCTA 5IB4A 4OLZL 1D5XA 2FJHB 5SWSB 3KPPA 2QTEA 2W9DH 5T1LD 1CD1A 3NFSL 2HRLA 2DMCA 1MY7A 5K33A 1S7RB 5DJ6B 3QQ3B 4OAWB 4P57A 3VMPA 3MUJA 1JV5A 3MV8B 5FM8A 4WWKD 1BVLA 5DGRA 3EYVB 4JDVB 2VO5A 4NO0B 3ZDYF 5L2KB 2A83B 5GHWL 4I9WE 1RVFL 4U1KB 3DUSB 4J1UB 3NFNB 5TGBB 4HJJH 1VADA 4R0LA 2GTWA 2B5IC 4RAUB 2WANA 3DUUA 1PZ5A 1MFAL 2MPAH 1JGVL 4J7RA 1FNLA 3TWCH 3FO2A 4KAQL 1CXKA 1ES0A 1U8MB 1TITA 2AQ1A 3ARTA 3G5VA 1EEQA 5J1TC 4G9FE 4WI5A 1IBGH 1U3HA 2D4FA 4NQEB 2DKSA 4GRLA 5IMMA 4X9GA 3RBSA 1CE6B 1PSKL 4V1DA 5D2LB 1JFQH 1UA6L 1AR2A 1SBSH 5GGVH 1QLFB 1YY9D 5J13C 2ICEB 4OZGB 3IJHA 4R4BB 4HIIA 3K7UA 2W59A 3JWDL 4PLJD 5KOVC 1K9TA 5CEXB 1E6OH 3ILPB 4DGIH 5FCUL 1CF8L 4NO5B 5DJCB 5J6HB 3QHZH 5KTEH 4HS6A 2VR9A 2Y23A 3UBXA 3WXWH 3MLVH 4FQXA 4PB9H 5C0GA 1AO7B 3G08A 2QQLL 4R4FL 2XOTA 4XNYH 3QQ9C 4UV4H 5I6XB 1W0VA 4QXWA 1A7NL 1MRFL 5IW6B 1JWUA 3FZUD 2DLFH 4QTIL 4DW2L 1LO2H 1CICC 1EO8H 4XP5H 5KVDH 1KT2B 2R29L 1U8IB 2VDQH 5MI0C 1VFMA 4Y1AB 3DWTA 1DUZA 3NCBB 1DANU 4YIQA 3V0VA 4W70A 4IEFB 1VFAB 1QQDB 4R8WL 5IMOB 3QDJD 4ZOEA 2QR0A 4YDLB 3RBGA 4P46C 4NZTH 4U1SB 5D1QA 3RU8L 5BJTB 1S9WA 4NQSA 1BM3H 4LVOC 2VLRA 5EWIH 2MQ3A 3PE9A 1SHMA 1KB5L 2AI0H 5EH1A 1F6AA 1CCZA 3DVNA 4TOYH 1S9XB 1FDLL 4JM2B 5D93C 5EZIH 5ICYB 3D39B 1J7VR 4P2OA 4P99A 1T89C 1D5BB 3I3EA 1U8NA 4JFYA 3L3KA 4IRZL 1YN6A 3I6LE 1K8DB 3CMGA 5L2JA 3S34L 4WFGD 1UJTA 3QI9B 4XNQA 1IGFH 1KCKA 5I1IL 2Z0BA 2VWEC 1TQBC 5C6WH 3CK0L 3RX8A 5SWZB 1T1YA 2J4WL 4U6XA 1JTPA 1FP5A 3QNZA 3G5XA 4LLAA 5JMOC 2HG5B 5I1EL 5D7JB 1S7WB 2HH0L 4LRNH 1R0AL 4I4WB 2OI9B 1IGTB 1RFDL 1M6OA 3FB6A 4Y2OA 1QO3A 1R24B 1YY8B 5DC4B 5HI4D 4QRTB 3P4OA 3KXFD 4PJCE 4XNUH 3HPLA 5K59E 5E2WH 1I7ZB 1JTTA 3OGOE 4X7CC 4R2GC 1NC2D 2VYRE 1EPFA 5LGJB 1C16B 1T0NA 1T3FA 4I77H 4PJXB 5IESL 2YD9A 3N1QC 3D18A 4N9GB 2X70A 4G7VH 4PJEF 2ZG1A 1CGYA 2H32B 1VCAA 2ZCKL 1CI5A 4HD9A 1K4DA 4U1NB 4MVBC 5TE7L 1EEZA 4BUHA 3U30C 1UH4A 2R1XB 1IGCH 4Y2DB 3KYNA 5LAXA 5K9OB 2D0FA 3A0OA 1JYWA 2PXYA 5C0ND 2OS7A 3DRQB 3UO1L 3GNML 4N0RA 4HIJA 2ENYA 5I1HH 1N3NB 1RUPL 2MHAB 1T7YA 4OLEA 2NTFB 5BW7C 1PYWB 1OAYH 2C4FU 2YD6A 4XCFL 5K9QG 5DUBA 2DQGL 5F9AC 2RFXA 5LCVL 3P9WB 2PTUA 1FRGH 2BFVL 4OCXL 4GBXA 4DKAA 4G5ZL 3FTGB 1J1XL 3L3OB 1U2HA 4MNQA 4WJ5A 2W0FB 3VWJD 2EH8H 4JGUA 2HA1A 4NRXB 4NPYB 3MUGB 5DMIH 4PGCB 2X9XA 2F74A 1GIGH 4QRRB 2A73A 3CMOH 5FHAL 2EH7L 5ENWA 3BPCB 5KG9B 3VW3L 1A4KB 2DL2A 3KJ4C 5MENA 2GSIB 5GRZA 4TPRL 4OKDA 4GO6B 3LN4A 5AZ2H 1A5FL 2BDNL 2XA8H 4WO4D 4XCEA 5D5MF 3RI5F 1DLHA 1S5HA 3B2UD 5F71A 5TE4H 2EDJA 4IMLB 4ZFOB 2APBA 3NGBB 4TUKL 4RX4D 3S3SA 2C3VA 5EBMA 1NBQA 3GIVB 4FQLH 4OFYA 4P2QD 3SJVA 5KSBF 4KY1L 1UM5H 5HGDB 3QDME 3TEUA 1CFQA 4PJGF 5CBAB 3EO1A 4DEPB 4R4NC 3VWKC 1C1EL 4XCCH 4Z7UA 2Z35B 4HQQH 5JHDE 1SJHA 2AXFA 2M26A 2A83A 3MZTA 4FQIL 1RJLB 4R90H 1IC7H 1NAML 3NFNA 3PJSB 5TGBA 2DQTH 3BMVA 5KJRL 4UAOB 1XCQA 4Y16D 3S6CA 3VRJB 4CW1A 4HXAL 5IEHB 3KPTA 5IWLA 3N1GC 3EZJB 1DVFB 4H88L 4C55A 4OFIA 4FFZH 1AFVL 1S7XB 4MA7H 1H0DB 1IAOB 3ROLA 4HUKB 5BZWA 3TO2A 2OL3B 4JG0H 4P3DB 3SGJA 1IZJA 3VWKD 2JIXB 5A2JH 5GRJL 1CGTA 5FYLD 2QQNL 1TVBA 3GMPB 4NBZB 2J1KA 4JAMA 1JJUA 2Z93B 4NQDE 3T4AB 2W65A 2YEZA 4U3CA 1E27A 4OZGA 3VFOA 4U2YA 1IM3B 4OCNC 3FJTA 2R29H 4Y4HD 5D7IA 4DCQA 1FYHB 1K5NB 4H1LB 1ZA6A 5FGRA 3GO1L 3FO1A 1F02I 3CK0H 4HKBA 4WENB 3WFBH 1FE8H 4NZTL 4MS8C 1J8HD 4RFNB 3TCLB 3KPSD 1OY3B 1S7UB 4PJFB 3MXWL 3DUHA 5DA4A 1KIQA 4QRPE 1MQKL 1V7NL 4UOW1 3BIBX 2DYPB 4OZHE 1F4AA 5C09B 3DUSA 2WP3O 3LD8B 4ELME 5C9JB 4ZPTB 2YR3A 4I5BA 4WUUA 1MFDL 2V7NB 3VH8G 4BJLA 1HQRA 3L1OL 4H0GA 5F1SA 4GRMA 4KQ3L 5HYSA 3SGEH 4E42A 3EJYC 2E7LA 4OGZA 3F62A 1UACH 2QR0B 4LFHG 5TF1H 2J6EA 3GMNA 3MOBH 1AXTH 4TSCH 4PP2B 3MNWB 1RUKL 2JCCA 4GUPB 4JFDB 3UTZA 5GSRB 1WCBB 5HDBE 3OXSB 2IH1A 3W39B 2F8OA 4P5KA 3IS1X 4K8RD 2O61A 3NPSC 4NN7C 3V6FA 3W2DH 3RWJA 5HYJA 1D5BA 3LEVL 2JLLA 5ISZA 4R4BA 2ARJA 1Y18B 5KSUB 4G6KL 3V7MA 3T0WA 1FIEA 2E7BA 3QUMB 4XGZB 3K80A 4RFOH 3BP7B 2A9ML 4RFNC 1IEAB 4UT9H 3ZE0E 2BP3A 3QNZB 4LSVH 4OJFL 3RUGA 1TJIL 2Y25A 1CXHA 1ETZB 1JNNL 3KDMB 4RCAA 3WDJA 5I18H 5JXAL 5MERA 4BZ1L 1NBZA 3F5WA 3GHEH 3IXAB 5EO0A 5F7YC 4HFUH 1O7VA 3H9SE 4GG6B 5DMYA 4Y1AA 3U7WL 4JPVL 4X4YB 3GI8L 3C8DA 5EU6E 3ME0A 1MREH 4MQXC 4I3RL 2UWEB 3FAXA 5ID0B 3D18B 4JGMA 4UU9A 1J1OL 1OAYL 5C0BA 4Z9KB 3MA7B 4FQPA 5EU4B 5JO5B 5DHVB 3C8KA 4H0HB 1KIUA 4LPTA 1MCLA 5I1JH 2YRZA 1MCRA 2ZOLB 1R3JA 1BLNB 4G6AD 4XAKD 4EKXA 1CFSA 4PGEA 2OMNA 1KCSL 4WW1A 3S36H 2DTML 1YN6B 4K9EH 1XGYL 3V9FA 1JGEA 1MCBA 1IC1A 1TXKA 3FL7A 3H3BC 5IBLC 5FKAA 4XNQB 2NQCA 4DOHE 4EN3D 3MACH 4OCLC 4IRSB 3DOSA 1DP0A 5CUSL 1YNLH 3OJ2C 3QFJD 1T1YB 3OZ9H 1R3IH 3DRTB 3UTOA 1RJCA 1JN6A 1EAPB 4NO5A 3D2UB 4RRPG 3FONA 1W0WB 1I3RB 2Z8VC 1K8IA 3I3DA 2RFXB 3OQ3B 1A7QH 1WZ1H 3WFEH 4PRPA 4JZJC 4UUJB 4ZSOB 3QUZB 1NC4B 2Y4SA 5ADPH 3CNKA 4O5LL 3T1FA 5IFAL 3DX8A 3QJHA 4MA7L 4OZFH 4NDMA 4HS8H 4PJ9B 5FYJL 4QRRA 5GS0C 3NMEA 4MQSB 1CGXA 3MRGB 1I9RL 4M4PA 3O3AA 1EFXA 3K46A 3QUXC 5C8JB 3EYFB 5DYOA 3ULUF 3H3PH 1SM3H 3QNYB 1QQDA 8CGTA 1EHLL 1SJEB 3MFFA 2DQEH 3QFJE 4XHJC 4EI5D 3CFDB 2YMXL 1A6VL 3T2NH 3QQ9D 5TF0A 3TA3A 4GAGH 1JNHB 5DEGA 4NYLB 1LDSA 1U8KA 4NO3B 3LKNB 2VDKL 2W9DL 5CP3H 3UMTA 2HFEB 2FHFA 3HPJB 1KPUA 1T80A 3E0GA 1YPZE 4PRBB 1WBZB 4G42B 3CVIL 1F42A 1KPRA 1QFWM 2EE2A 3LKRB 3QUXD 3EO9L 3FT3A 3QCVL 3SKMA 1CLOH 3RWFA 4EI5C 2NY1C 3MLXH 3FQTA 3HS0B 1WWCA 2R0LL 5HY9A 3PHOB 4KQ4H 5I8KH 2VE6A 1ZT7B 4M6MH 3SDXA 2ESVB 3IAQA 4Q7DA 5JW4N 1J86A 2BVQB 4AMKL 3C6LD 3KPNB 5C0AB 4HWZA 1A1NB 2EYSA 2MFNA 2OTWA 4PJDE 3WLBB 4OF0A 2RQ8A 1YC8A 3F6LA 1KSRA 1O7SA 4F7EA 2GSIA 4OCRL 2Z8RA 4ODUA 2QQLH 4NJ9H 3VXSB 1N64L 2LE9A 2C3HA 2X4PA 3NBNA 4P2CG 5JPNB 3LY6A 5E2UL 3P9MB 3KPLB 5J1AA 2DJSA 4NO0D 4F7PA 1JGUL 1IM3A 2VDQL 1NANI 1M05B 4LPWA 4FG6C 1A9BA 2D3VA 3E8UH 3NA9H 5DJ6A 1MAKA 1RIHH 5IJKA 5EZOL 3GKWH 2YA1A 2HMIC 3P11H 1MEXL 1UENA 1MJ8L 5GZOD 1GXEA 5KTEL 3WN5A 1JZ8A 1XF4A 1MCNA 3HHRB 3ZE0F 1BM3L 4WI4A 1BZ7B 2AJVL 4FNLL 4ZQKA 3SDDA 3ZYIA 5E8OA 5C0AD 1JZ5A 4FQHA 4PD4J 5ITBL 2GTWB 2D4DA 1UQSA 4PJ7F 3DETD 1EZVY 2MCG1 2XN9A 4ELMB 2CO7B 5IFJA 1GHFL 5C09E 1F3DJ 4M1CD 3LKOB 2DBLL 3F7PC 5C9KA 1CFBA 4K7PY 4UBDD 4WFED 3D85D 2BMKA 4U1IA 5HHQB 5D5ME 5IW1A 4KDTC 2H3NB 4HJGA 3THMH 1G1CA 3O6KH 4Z7VA 2NY2B 4M5YH 3LQAL 5IMMB 3C60D 1X4ZA 3FMGH 5EIQA 3QXUA 3ZDXE 1MRCH 4LRNL 2UV3A 5C6TH 1CGVA 4C56E 3OXSA 3W39A 1P9MA 2IEPA 3EHBD 4P5KB 4X7FC 1IVLA 1LK3L 3O3BA 3X14A 4JFXA 5FKPA 4TUJA 3RPKA 4JFPA 2XTLA 2D7OA 4G8FA 2DQFA 2H2PD 3CSBA 3QUYA 5D7IB 1XF3A 4WU5A 3WV0A 1Q72H 4P4RB 2EXWD 5KSVA 5DS8B 3VXMB 4HKBB 1KTRL 4WFEE 5FCSH 3VXPB 2J4WH 5K59F 2GT9B 4O00A 3KHQA 3BPNB 4Q2ZA 3RWCA 4R2GD 2X5PA 3SJVB 2X42A 1KT2A 4A2MA 4KPHH 3V0VB 1YNKH 1F11B 1G7PA 4OLWL 4JKPL 2I60L 2AW2A 1QBLL 3VA6A 2QSCH 1M4KA 4OQTA 1AGCB 5EU7E 4M4RA 4P4KC 3QUYC 4HKXA 1T1WA 5HGAA 5AYUL 3TYGH 4KK6D 1F6FB 3H3KA 2CUIA 1MNUH 1OD9A 4LNRB 4HBQA 2YA2A 4JZOB 5TQ2H 1KCRH 2HLAB 5DUPL 1GL4B 1XF5B 1S8DB 2QKIB 2VITB 4G7VL 1GGIL 1Q0YL 2WP3T 3QP3A 1QP1A 3HRPA 3BUTA 3IDYB 4JVPA 1HK6A 2Z92B 1FH5H 2WLZA 3D25A 3W9EB 4CJ0A 1VEPA 5BZWB 5FDYA 1T7VA 3FQNB 1KN4H 5IVXB 3OKDB 4Q0XH 6CGTA 2CR3A 4PLKD 2F5BH 1RVFH 2NY2D 3BHBB 4ZD3L 1GIGL 3HAEA 4D2NA 1WSST 2NY4D 4XH2B 5CEZL 1JGEB 1WCQA 2OMBA 4S1DD 3P2TA 5CIPH 2CGRH 3QR2A 4OM0H 4U7MA 1YNTA 3PP4H 1NGWA 4OF3A 5F3HB 3EYUH 3VFNB 1QFOA 5DHVH 4HCRL 4M6OH 2LTQB 3O2VH 5J7CC 2A6IB 4HEPG 4NHCL 4LLDA 3UJTH 1TTUA 3I85A 3TO4B 3IYLW 5F21B 4WHDA 3VXMD 5CEZE 4GJTB 1EK3A 3T1FB 3VXUE 1NMCC 1KIQB 2E9IA 2JELH 4GAJL 2C4FT 4IHOA 4L8SB 3MUY1 3UYPA 1Z9SA 2DD8L 3BAEL 4YHPA 3LB6C 4QOKA 4O4YH 2AXHA 2VLRE 3TZVC 1CF8H 3E1F1 3KPPB 4MB4A 4AG4L 4ETQB 3RVTD 4EQ2A 5F96L 4LDEB 3GMRA 3SY0A 3FB5B 2YUXA 4K94H 4PS4L 1ZT4A 1G7LA 4N0CC 1QBAA 3RIAF 4IOIB 5CSZB 4ZXBA 1RUQH 2M2DA 1NCWH 2NXZC 4HIXL 4I0CC 5F7DB 1ZTXL 2ZOLA 4OF5A 1T89A 5FK9A 1A7PL 4U6YB 1MRFH 3G6JA 4PRHE 5EC1B 4QNPF 5D2NE 1JGDA 4Y5XA 3VXUD 1OPGL 4J23A 4XPAL 1Z5LB 5IK3B 2EIZB 1E6JL 4D9QE 4G6ML 2X4QB 4YHMH 5DFTA 3QIBA 1IC7L 1KJVA 3DV6A 2V5MA 5IFHL 1U3HB 3REVA 2DQJL 4PTTB 4PRIE 4AIXA 5FV2A 3QHFH 1A3LH 2EIBA 2VH5L 4WNQA 4KZEH 1MCWW 5C09D 3LDBB 3GMLB 3SDAD 1OAUL 4A6YB 2Y6SC 4DJMA 5JDSA 5C71A 5F9JB 4JFDD 4PJ9A 1U8OB 4K07A 3RUGF 2HFTA 2VDRH 1YEJL 5I0DA 4Z7WB 2FEDD 4ZS7H 3VXNB 1T1XB 4IMLA 5F7WC 1T5XA 5GRUL 3R1GL 3DX9A 5HYQB 3NZHL 2F58L 1LWRA 2EO1A 1JZ7A 1R3LA 3V4UH 1N6QH 3PABB 4PJBB 3V95A 2ED8A 3ULVH 4LNVA 5E9DA 1SYVB 1IC4H 2G60L 3FQWA 4FQ1L 2VLKA 1CL7L 1S78C 1JWUB 1U3YA 1Q38A 5F6HJ 4HEME 1CD8A 1KPUB 4GKNB 1A3QA 1UZ6E 5EA0H 3LSOA 4MJID 4WFHD 4NHUA 4X4ME 5DURD 5E2WL 1UH3A 2O5XH 3VWJB 1MJUH 5GS0H 1JK8A 4AEFA 5GS1B 35C8H 3U0WL 1WAAA 2VDOH 3RDTD 5IV2A 3T4YB 3PG2A 1IKFH 3AS0A 4PJFE 3EDDA 3TT3L 3LEYL 2DQHH 2F54B 1MFDH 1H0DA 1IAOA 1MFNA 3TPUB 5J6GB 2BXYA 5C07A 3IFNH 4FTVB 4PJ8D 3Q0HA 4XAKE 4TNWF 1NCDL 4DAGL 1F00I 3UPRB 2Q8BL 4CMMA 5CHNB 3O6FB 3L3KB 4MXWH 4NBYB 5GRXG 4XXDA 3F7YB 1NMBL 4YHYB 1MWAL 3UPAA 3KYAA 1U3HD 2HJLB 4NUJB 1OTSD 4Y16A 4G80A 4UQ3B 1RSFA 2YPKA 3MFGB 1H3TA 3RWHB 3G04A 3QEQB 1HHIA 2WWMC 4MB3A 5CGYD 1DR9A 1G0XA 5E1AA 3RRQA 5DVKA 4DGYL 4O2FB 3L95A 2CDGA 4RA3A 1IT9H 4JKPH 4LSUH 1LE9A 1EMTL 1TENA 4FFWC 3RZCB 4XVSH 1UB5A 4CVXA 1YC7A 1CE1L 2E8ZA 4HPYH 3BN9D 3QDMA 3ECBA 3CFBB 1II4E 3D3VA 1J1PL 4OM0L 1PVHA 2OSLB 3BQUA 4JY5L 5DZLA 5ESVB 3WIHH 1GC1L 2P1YA 2OTUB 3PNWB 4LRIC 1FCGA 2H32H 5DJDA 4OCYL 3PGFL 3HZKB 3TIDA 4GKZB 2FWOB 3IGAA 5L9DL 4PJAB 2H6PB 1I8LC 4Z8FL 3EYOA 4X99B 3BI9X 1CLZL 5I8CA 3UBXI 1Z3GL 1JYXA 2BHZA 1GAFH 1A6WL 3OTTA 4KK6C 4BFIA 1LEIB 1KCSH 3IDNA 3LKRA 4E42B 1KB9J 2XTJB 5AAMA 1TVHB 2DWEA 3B6SB 3HMXA 1FL6B 3UTPE 5AZEH 4LSQH 3WHE0 5CUSH 5E6IC 5DDHB 5DWUL 3X3GH 4KFZC 1AIFB 1YMMB 4YXLL 3EYUL 4PJGA 1YPZB 4L4JA 3IJYA 3IXTA 5JR1L 4PLKC 4WTZG 3KPNA 2J12B 1NL0L 4ZNEE 4OFPA 1ONQB 1IM9D 2AVGA 3IDYC 1GGCL 4OQTL 4L29A 5DD1H 3B3IA 1A7PH 3U48A 2AEQH 2FJGB 1KF9B 4L9LA 1OARH 4LEOB 3OSKA 2A6JA 4JLRB 4JZJA 5BQ7A 5KJRH 5J1AB 1FYTE 4NZRL 4RMSA 3S4SB 3MACL 1FHGA 4OLZH 3QZWG 2ADFL 1FC1A 1E6JH 4YAQB 3FN0L 4LLUB 4ORGA 4FABL 5IB4B 2CLZB 3AU1A 2CMRL 3FFCB 4APQD 4D9QD 4YDKH 3ZTNH 3WSQL 3BE1H 4KMTL 1HINL 1BBJA 3IDXH 1MH5A 1UC6A 4QRPB