4GAFB

Crystal structure of ebi-005, a chimera of human il-1beta and il-1ra, bound to human interleukin-1 receptor type 1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
310
structure length
306
Chain Sequence
DKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of a superior cytokine antagonist for topical ophthalmic use.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords EBI-005
total genus 58
structure length 306
sequence length 310
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13895 Ig_2 Immunoglobulin domain
B PF18452 Ig_6 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gafB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gafB03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gafB01
5ALBL 4V2CB 2PN5A 3B9KC 4K71C 3GI9H 5M95B 1H8SA 2FLRT 2XWTA 1NGPL 5TPWH 5GGQL 5I8EB 5DK0B 4WU7A 1NBYA 1UWGH 3HMWL 1QA9A 2VUOA 3HG1D 1A21A 2J88L 3PDOB 3QEQB 4WEMB 4XTRC 1T1XA 4ZDHB 5J1AB 4GG6F 3JWNC 3T1WA 5JIIA 1G7LA 5ABDE 4AEEA 5KZCD 3FO2A 1HXYB 3BMVA 3WFDL 4MNQD 1SM3L 3R8QA 3HA0A 1FVEA 1YEIL 2P8PA 1ZLUK 1MCLA 3QEHB 1INQB 3PWPE 3F62A 5DQDL 2ITDA 4U6YB 2Q86B 3WSQH 4YZFF 3TA3B 3ARWA 4NQSA 3MUGA 4PJ5A 3TYFB 2IG2H 1U42A 3CSYB 2H2SD 1KB9J 2R4SL 1DFBL 2AKRB 2FEEL 5E7FA 4RFEB 1EDQA 1MFDL 1T22A 5T3XL 2AEIT 1I3RB 3ARTA 4FQLH 2NY2D 4JDTH 5SWSB 3GGWB 1PQZB 2ENYA 4NZRL 4HLZG 5D4QA 1SEQL 1P4IL 1XGRA 8CGTA 1BQSA 4GRLC 5LAXA 1MCNA 3HG1A 5F8QC 1ZMYA 2L4OA 3QDGA 4NQCE 4YHKH 3LN5B 2HN7B 5B8CA 5GHWH 4RMQA 1HDMA 4V1DD 4FFWC 1AGCA 3K2UH 4HPOH 3F7QA 4ZO8A 2VERN 1ETZB 1F4YL 3JV4B 3V8CA 4W4OC 3SBWA 3GJEB 4LARH 2GK2A 3AREB 4LPUA 1FYTE 1RZ8B 3DURB 1I9RL 3LEVL 2IEPA 5D96B 4AIXA 2CSPA 2QV2A 2V2WB 2G9HA 5ANME 1G7PA 1OAZL 2AJYL 3QPQD 4UBDD 1S78D 1YJDH 4NBYB 3JV5A 5K33A 3WJLC 4B53A 5E8DH 3HMXH 2BFVL 4RRPG 4P2QB 3W39B 3SDXE 5CJXC 1OARH 2XRAH 1A1OA 1CZ8L 5D1QA 4OGYL 2R0LL 1A7RH 3CH1A 3DYOA 5DUPL 3BIAX 5E8PA 1K6QL 4QOKE 1ZVYA 4WW1B 4P99A 4XMPH 1U8LB 3BE1H 2OSLB 4R97C 3OKNB 1I1CA 2FD6H 3QA3B 2BERA 5KS9A 2ZZUT 1V05A 1QSEA 4KY1H 4OZIB 3EYSL 1NC2B 1MRDH 1KYOJ 4GRWH 1FSKB 3M17A 3TYGH 5F3BA 5EZLB 1AXSB 4M43L 1JTPA 4FABL 4IRZH 3RTQC 3DXAB 4P48A 3CFKA 2NY6C 2P49B 4XCEB 3VW3L 3H9HA 2YD3A 1J5OL 1MWAH 4RNRA 1YEEL 1S7UA 1FCGA 5HDBE 4KK8C 5C7XH 4U7SA 5FUZL 3CC5B 4R2GC 1OTUC 1N3NB 1H0DB 5IR1B 2VB5A 4YXKH 2AJ3B 3V7MA 5E2TH 4LSQL 4WNQB 4OCMC 3VXMD 2BSED 1HHJA 1GIGH 4XWGH 1F11B 4HIXH 1KCKA 5D6DC 4PRHB 4JB9L 4JKWA 4P23A 2DLHA 4DFHA 3Q5TA 1XT5A 2R2HB 4R4BA 3TIEB 2AXGA 2DL2A 1M05A 3RL2B 4KDVA 2GAZB 2LAAA 1ZOXA 4LLYB 1QBAA 2APVA 2H41A 4XMKH 5BZWA 4BSJA 3MRHA 4NRYA 1LWRA 3SBWC 3L95B 2JTDA 4JFEA 3GRWL 2WIMA 5INCA 5IV2A 4NQEB 2KH2B 4D0BA 4YXHH 3WLWD 5EIIA 3FB6B 1AGDA 1F3RB 4GW4B 5K9QI 4EUPA 3STZA 3LSOA 2X4SA 3N1MC 3NCFB 4PRAB 5MEPA 3RVXC 3L5JA 1QRNA 1VFBB 1AC6A 2XFXB 4FQ2L 3OXRA 1PG7W 1N5YH 5T1KB 4P3WA 3MNWB 2BNUB 1SEQH 5ISZA 4JQXA 4IDJH 3LS5L 4XPHL 1KCVL 3QEUA 5BQ7B 3WCYA 1JGUH 2VZVA 3MBED 2FATL 5MENE 4MA8L 1XGPB 2CQVA 4O2EA 4ZDHA 5J1AA 3G5XA 3U83A 1MJ8L 5CGMA 4J2XA 2H9GA 3WFBH 2J8OA 4P9ML 3L3GA 3O81A 2VDLL 1YEGL 1YUHB 2VC2L 4MD4B 4EEEA 3ZE2E 2G60L 1KCVH 2QR0B 3QDJE 1JNLH 2NPLX 4R0LA 3VXMA 2FZ3B 43C9B 3QIUA 4X7TA 4FQPA 2Z8SA 1S7WB 3ILPB 5HHNA 2F8VA 1YECL 3OKKB 4W4OA 1HH6B 5DJDA 3TT3H 3B2VL 4K3HA 3FQUA 1X44A 4HKXB 4X80H 3RUGF 1NGQL 4LDLB 1MFBL 1OSPL 5JXEA 5I8CA 4NWUH 2PR4L 4I0CC 4H5SB 2C7UB 2JIXA 4G6JL 4X5LA 5SV4A 3SKNA 1RY7B 4E42B 3WNNA 1HINH 3T2OA 3S5LA 1S8DB 1Z9LA 1I1AB 1CK0H 4IRJC 4UILH 4DVRH 4YFLF 2IAND 1DANU 4L1DA 3X14B 1AQDB 2ZOKB 2DQFA 5F89B 3E1F1 1KELH 3MR9A 5E2VL 1AH1A 2XWBA 3S96A 3BEVA 4PJXF 2W0PA 4IMKC 5HPMB 3G5YB 1QFUH 3DMMC 3X11B 4GBXC 4Y4HC 4MYWB 1GGIL 2KPNA 5GIRB 5E8EB 4C57C 4JY5L 4X8JA 3GJEA 1MREH 1LILA 5EUKA 4M61A 4KZDH 1T5XB 2XN9E 3NA9L 3K2MC 1JWSB 1GSMA 4X98B 3UJJH 5E70A 4H26B 4O4YL 1NEZB 1QPXA 3FQTA 3HE7B 4BH7A 1RK0B 5FYKL 2AI0H 3NIGE 1YEKH 5EZOH 1MRCL 1IAMA 4Z7UF 4ZUSA 3AU1B 5E9DA 5IW6A 2Y5TA 1F42A 4HZLA 2KUTA 1YNTB 5LKNA 1PKQE 1C12B 5ESQB 4GKSB 1ZV5A 4JZJC 4DAGL 2IBZX 4KK6C 4X4ZA 1OAKH 3BKCL 3FT4A 5E6ZA 1R5IA 1C08A 2PXYB 5C2BH 1U93B 4YUEH 2X05A 1JHTA 2C1PB 3SDXF 1RZKL 5B21A 1IGJB 4MWFA 3RY6C 3ARZA 4LKCA 4NKDB 3UPRB 4L8BB 2HT3C 5BVPH 1KLUB 3D48R 1J1OL 1IAOA 3WFHA 2E27L 1JCKA 4LSRH 4WFHD 1HWGB 1WCBA 4PP1C 4RZCB 1O0VA 5F7HA 4NBZB 4OGXH 3RWDB 5D9SB 5L8LB 2F5AL 3MYJA 3BPCB 4QTHB 3QSKB 4HWBH 5DC4B 3G6JF 4PGEB 4X4YB 3V9FA 2D3VA 4HS6B 1IRAY 4OQTL 4U2ZA 2XWJB 3SO5A 3O3AA 4RISH 3HCVB 4WRLA 1VGEL 2ADFH 3BDYL 3WIHL 4X8JB 1OQOA 4NN6C 4PG9A 1KNOA 2ATPA 4ZPVA 1RU9H 3G9VA 4P23C 5IGXH 1K4DA 3L7FB 2F53E 2EECA 2XFXA 1CU4L 1R3KB 1RK0A 4ODVL 4ELKB 2A73A 3O4LA 4L4VA 4JRYE 2KZWA 4NQXB 3KR3H 3V5DA 3QUKA 4JR9L 1H5BA 1W72H 1KULA 5ALBH 5FCUH 4KV5E 3IJHB 1N6UA 5IKCB 1QG3A 4D9QE 3D6GA 4JFEB 1D9KA 5IV2B 3KHOA 1E0OB 2C3VA 5DD3H 5C3TA 5GS2H 1FNFA 3FHQA 4LSQH 1FO0A 3BH8A 5IOPA 3HI5L 4NDMB 4DUVA 4F37F 2RBLA 1F45A 1VFAB 1G6RL 3KPLB 3TPKA 4I48B 4WV1B 3VFOB 5D70H 3U7YH 2Q76B 4WTZA 1RZIA 4ZNEE 3V52L 4JFDE 2AS5M 3QQNA 1W0WA 1XCTB 3DSNA 4NJ9L 4JZOB 4L4VD 3OG4B 4JFXB 1RZJC 1S7QB 4NHUB 1UM5L 4PJBA 3SJVD 3PL6C 1U6AL 3FFDA 1DVFC 4PLJD 4S1DD 3WNKA 3QULB 3JWDH 5DJXA 1YYMH 5I1CH 3AM8A 3O2WH 3RX8A 1U92A 4OCXH 2DWEB 2VR5A 5D7SH 1A7PH 4ODSL 3BP5A 1MIMH 1TVHA 3DROB 3P11L 4DQOH 4FQ2H 3VGDA 4QXTB 1KENL 2ADIA 2KL6A 2NYYD 2X89A 2ICES 3RWJA 4QT5B 5JO5A 1OLZA 2V2XB 4XVSH 4PJGB 2RCSH 2WNGA 5LGJB 2UWEE 4NWTL 4HDIA 2VTFA 1FYTA 4K71B 3Q1SL 4CU8A 3O8XC 2DM3A 5SWZB 2IQAA 4HEPG 4XP4H 1P6FA 1WWAX 3WN5C 5IB3B 3HUJE 1AFVL 1LP9E 2UUDH 2A6IA 3MRIB 4OQ1A 3OQ3B 3C2AL 4LLUB 5H94A 4YGVB 5D1ZC 1L6XA 4H5SA 1ZTXH 3S34H 3D0VA 4UT6H 1TJHH 3NFPB 3BUYA 4XP9H 2PTUA 1BJMA 3MLYH 3VGAC 5KVDH 4PJXE 4OGAC 3O3BB 3QNXA 2B39A 3ZKMC 4C55A 1MUJB 2PW1B 3ABZA 5ID1B 1FYHB 2X42A 4P59H 4WY7H 2C3WA 3QH3A 3MRMB 5DJCA 1KJMA 3H9ZA 3RKPA 3TIDA 5FKAA 4IMKA 1QFHA 1UXSB 2VLKB 2YN3A 3VW3H 1RQ5A 4RDQG 1P4LA 2AV1B 1HNFA 5IVNA 1RULH 3LKQA 3FN3A 2D7PA 2P8MB 4JDVB 4NN7B 4JPIA 3PL6D 1GZQB 4M4RA 5MEOA 2A6KB 1N0XL 4K7PH 4LRIC 3N1PC 4FQ1L 1OP3H 2UWEB 5DRNB 4KKCC 5DD6A 2X7LA 3GBNH 4IMLA 4XNMA 2BSTA 4RSVA 3CUPA 3IXTA 3HE7A 4BH7B 3G04B 4BQCA 4AM0A 3SDDD 3WIIL 3HFMH 1G6VK 3GSXB 3HC4L 3T2PA 5DEZA 4N1EA 4QXGH 4H25B 1FAIH 1ZANL 3M45A 4ZUUB 3P30H 2ATKB 2AEQL 1JFQH 1HHJB 1L9NA 1CE6B 1WCQA 2XTJD 3OR7A 4OZFA 4OUUA 1WEJH 2JJSC 5MHSD 5IVOA 4NZTH 5FYKE 1LK3H 3LH2L 3RTQB 3TLRA 3DPBA 3OG6B 4NT6B 2VXQH 3PWVB 3SE8L 2NY5C 1PGRB 2EKSB 2XKUA 5IB2A 1T4KB 2IG2L 1RK1A 3S37X 3WS6A 3T0EE 4XVTH 4IHOB 3LQAH 1DQML 3WFHB 5C2UB 2E7LC 4C56D 4FTVE 2EICA 2AI0L 4CW1A 5DF0A 4AG4H 5K9OB 5MENB 3AREA 1DQDL 2OJZL 3WNPA 2CR6A 3TNMA 1DR9A 4PJGE 3U7WL 1T7ZA 1CICB 3MLUL 4RMWA 3QPXL 3VD7A 2YOCA 4Y5YB 2XI9A 4PJ8C 4MA8H 1EAPB 2A73B 3IDNB 3FCTA 1J10A 1J12A 4MSWA 1K85A 2BNQA 1AQKL 4OLVH 5IIEA 4Z7NE 1PKQB 4QRSA 3C2SA 3RZCC 2IALA 2ZCKL 2CH8A 1JK8A 1KFAL 3BPNC 3QCTL 2QHRH 3MRBA 3ZMRA 4HH9B 3MRCB 3P4OB 2QL1A 3TCLB 1FNAA 3DO3A 4LSPH 4OLYL 3RA7H 2N56A 5DHYA 4OBRA 2XY2A 5D1XA 4XPTH 2CXGA 5C6PB 1EVTC 1HEZB 3V0VB 5JUEH 3ARFC 4IS6A 2VO5A 3BSZH 2QTEA 1X5IA 3BWAB 4Y1AB 1FAKT 4ODTL 4YHYC 4YHLL 4GKZA 5CZVH 2HWZL 3MO1A 4QHNA 2Q1EA 1INQA 4X99A 2CO7B 3CVHL 1FZJB 5IWLC 2VDOL 1S7QA 3QG7L 1A14H 2KKQA 1VACB 2F5BH 3E0GA 4CADA 5I30H 3SDAB 2F19L 5ACMA 1IC4H 4J12A 5E99H 1BLNA 3CAFA 3HMWH 1TNMA 4HK0B 2YKLL 3IAPA 4OCSH 3VI3E 1WC7A 2NW3B 2AEWA 1UWXH 3NABH 1WZLA 3VXPA 3GNMH 4D2NA 3CX5J 1ADQH 3HG1B 3R0MA 1RMFH 2D7QA 2YR3A 2F74B 3MRNA 1PZ5A 2AK1H 4HBCL 3WDHA 2HLAB 4JFDD 3PP4L 3CVHB 3BXNB 4ODWB 1F58H 2FWOA 1UC6A 3U6RA 1MCWM 2Q3ZA 1MAML 4OM1L 25C8L 3B9VA 4HWZA 3DSFL 1QTYT 4DKFL 5F1KC 5FAAA 4R6UA 1WBZB 4H1LH 4G8FB 3AM8C 2ED7A 2QADB 3T77A 4ZUTA 4GAYA 1B0RA 4YK4B 3EJZD 2J1KA 3DHJA 5FYJD 1EEQA 2CKBH 4NRZB 1VSCA 1LO5B 4XXDA 1IEBA 1ORQA 3MNZB 3V2AR 3WXVL 2GCYA 4P2QE 4LSVH 1J05A 3BN9C 2N1KA 3MREA 3LCYA 4L29B 3V4UL 1D5ZB 1I75A 1TJIH 2H1PH 4PJHB 4KRPB 3JXAA 4RFNC 3EYUH 3QUZB 1QLRA 3BFOA 3QI9A 4PJIF 5A3IC 4FQHB 3PV7A 3G6JE 1LEIA 3MOBL 2H6PA 1T03H 4K94C 4MJIB 3MRMA 5DJCB 2IQAB 4XNXL 1TZIA 2HKFH 5IB4B 4S2SA 3LH2H 4HJGA 5ALCL 1WVZA 3EOTL 4KROD 4PJCF 3T0VA 2ZG1A 3QUMA 4MA7L 2HT2C 1I8IA 5K9KA 2K1MA 1REIA 1ZVSA 4JZNB 2YZ8A 2F53A 2ID5A 3QNZB 3EYFA 4FS0A 4HJJH 5D1QD 4FQXB 3PWJB 3L3JB 1R3JB 3ZDYF 4X6CB 2C9AA 2IAMA 5EU7C 3QCUH 4LMQI 4ZAKC 3RVUC 4HUNB 3UMTA 2ZUXA 1KLUA 5HD8C 4XNUL 1ZWIB 3GKWH 2A9NL 1R3IH 1Q72L 4XB8A 3QUYC 3T0ED 4Q9QH 4O51A 1RUQH 2I26N 1FE8H 5IT2H 1Y6KR 5FM5O 5HYJD 3L9RA 4POYA 2ADJA 4NZRH 4Y5XB 4WWID 1PBYA 3W0WD 2ICWA 3ZE1E 5HJ3B 1T1ZB 1IQDA 4FZEL 5HDBF 1I9IL 5GGSY 2B1AL 2RFXA 4O2FB 4GBXB 3ORJA 3QFJD 1NGZA 1FFNB 4Q0XH 1TCRA 4XP1H 1N64L 1UXWA 1LO5A 4XXDB 4G8IA 4PTUB 3GHEL 3L1OL 3QXWA 5KSAC 4EKXA 1I8LA 2ED8A 4LIQH 1TPXB 5JW3H 4GT7A 4N8CL 4OFDA 2IFGA 2JB5H 3TEUA 4JPWH 2CIKB 4MJ6B 1VESA 2EDKA 1RJZA 4HCRA 3EIFA 3QZWG 4M9PA 5JA9A 4OIIL 3NCMA 3VXRB 3PGCB 4LSDA 1KPUA 3O6KL 2H3NB 3S36H 5EWIH 1N0XH 1DBJL 4DFIA 1V3JA 1BBDL 4MMZC 1PY4A 4G80A 1EHXA 3MLRH 5F6HJ 5J9PB 1F02I 1T5WB 4X6CF 4M6MH 2P47B 4XVUC 2PTTA 3EYVA 4IOIA 5FGBC 3CK0L 1QQDB 3J7HA 1KB5H 1ZA3A 2NY1C 3KYOB 3OGCB 3RGHA 4LQ1A 4Y5XC 5D7LD 1BHGA 5D72L 2OR9L 1VEMA 3QZWA 3KWWB 5BCAA 1U8QA 4QOKB 5HYFA 3MODL 3CC5A 4RMTA 1U3HD 3SDCD 3SKUD 1OLLA 1TDQA 2BY1A 4WU5A 3OAUH 3RVUD 5I71B 3MRQA 4NO5B 5EU7E 1A2YA 4LOUC 5ESQA 5HVHB 4J23A 5E9DE 4JFDA 1AGBB 3ZYOA 1ES0B 3DV6A 1OOAA 2V5TA 3ZDZF 4UZGA 4Q9CA 3KLAB 4FRWA 4ZFGH 3OKOA 4MWFB 1X6LA 4XAKD 4JM2A 2NX5D 5FYKH 3ZE2F 1RIHL 2GITB 4HGMA 2AAVA 3ULVF 3EJYC 4P9MH 3MNVA 3NA4A 4PRPE 2MCG1 1EIBA 3VFGL 5F8RC 4C83B 3VFRB 5ACZB 5K9QG 3VI4F 3EOAA 4NM8L 3DGGB 5EUOA 4PV9B 1FG2A 5K9JH 3PWUB 2ILLA 5DR5H 4RGNE 5C8JB 5A16B 1H3XA 5TF1L 2YD8A 4U0RB 1NCBL 4CMHC 1EPFA 4M7ZB 1TTUA 2HJFB 2R0KL 5T1KA 1V7MH 4M3KB 2VDKL 2AABL 5KJRH 4RGND 4JFZL 1SMOA 4Y19E 2VR9A 2Z91B 3SKJH 3QIWD 2ZCHH 5HDOA 4KZEL 4P9HL 2IC2A 4TPRH 2JLLA 5I1AB 2R1YA 3WO3B 3B3IA 1MI5B 2FIKA 4R26L 4K9EL 2APWA 4GQ9L 5SX4I 4XNQB 3UBXI 1SEBB 4HIIA 4L3EB 5SV3A 3NFPA 4FFYH 4X7CC 3PG2A 3FO2B 3NGBC 1HHHA 4MAYD 1QACA 4YBLB 3FO1B 1RUMH 2YMXH 3S4SA 3LOWA 4U1JB 1O5DT 3TIEA 2G9HB 4M5ZL 4D3CL 4LDEB 1SYSB 2VYRE 3FQTB 1KN4L 1SJHA 1K3IA 2IAMC 4G7VL 1DN0A 1RU9L 1GOGA 4YBQD 2VRAA 5KVFH 1CLZL 3A6CL 3HC4H 3F65A 3FONA 4JN2B 5I0ZA 3FO0H 4ZQKB 4R9HA 3QI9B 3RFZC 3MJ9A 3O4LE 4YAQA 2ADGB 3QUYD 3VH8B 5DUBA 5I1EH 3O6MH 5LGHL 1FG2B 1JN6B 5GZND 1Q0XH 5F6IB 4NSKB 2PXYC 1EEYB 4OLWH 4U0RC 1VGEH 4XWOD 5FYLH 4H1LG 5EWIL 1F2QA 4WWKD 4PB0L 3LPWA 2ADJB 4PJBE 2ICWB 3SDDA 4KJWC 2A0LD 1L9MA 2VZ1A 3B8SA 4GAJL 3T4YB 2G75B 1KB5B 3BYTA 2XACC 1NSNL 1TETH 4L4JA 1K2DB 1YEEH 4HS8H 4M1DH 1JTOA 1IAII 4KRMB 4GBXA 3MRGB 3KYNB 4CMMA 3U9UB 3R1GL 1DQLH 3B9KA 1ZKAA 5I1JH 5KAQF 1ACZA 4KJPD 4IHOA 2YS4A 1YN6A 4Z77B 3LIZH 5CMAB 3D9AH 5ESAB 1FG9C 4XAWL 3GSQB 5HHVH 1YQVL 1W8NA 2VQUA 3RWEB 3MFFB 5EO0A 4CNIB 5BVJB 3ZT5A 4OZGA 4QF1A 4P5TA 3PGCA 4MD0B 5F7KC 3VMNA 1ED3A 3QCTH 1PLGH 4YE4H 3T2NH 1T83A 3QWRA 4WFGD 3TFKD 1RZFH 3TGXA 3L5IA 2ARWA 1PG7L 2Z9TA 4FA8A 1JZ6A 1GRWA 4UINL 1V3MA 3CFCH 2XA3A 4PTUA 3VXOB 3OJMB 1AGDB 4YPJA 3UO1H 5EZLA 4Z7OE 1EXUA 1Y6NR 5HVFB 5DHYB 1RJZB 2NY7H 1M1SA 3WS6C 1RZGB 5EBWB 1KF9B 3C6LA 3GSOA 4R0LC 3C2AH 3O2WL 4JFPB 3DIFB 5FM8A 5EZOL 1I9RH 3JVGA 4PLJC 2M26A 4YXLH 3CFJA 3C60A 4ODUB 4B41A 5FOBA 3WKML 1XGYH 2CK2A 4GXUM 1U2HA 1P7QB 1JZ3A 3VG9C 3LRGA 3MBXH 5DRWA 4OD3H 1H3TA 1VEPA 1ZT4B 3AGVA 4OLXL 4MB3A 5HGAA 4ZODA 5T3ZD 1TTFA 2BDNH 3NCBB 2BVPA 1RFDL 3RVXD 4P2QD 5F7MC 4QYOA 3NZ8A 4OFVA 1OAXH 4PV9A 1GYAA 5CZKA 4M6NL 2ERJC 2YC1A 2YD7A 4Y4FC 1J88A 5BV7C 5L7XL 3DROA 1NQBA 4LVHC 1A1MA 4CNIA 2QSCL 4HUWB 3DX9B 4L3CB 2IMNA 3GBML 2XQYK 4TSAL 1HI6B 4X5WA 1B2WL 4U1GB 3FN9A 4WUKH 1MH5B 3KPMB 4CAGA 3V5DB 1F97A 2VXSL 4OZFG 3O6LH 3N1FC 3JWDL 1EHLH 1GVIA 4XP5L 3HI1B 5EBLA 5C3LD 4FQXC 2HH0L 2DLIA 5CILL 1OW0C 5F7LB 3QXUA 3T0EC 3ZYZA 2X5PA 2XNAA 3WO4B 1PY9A 1KIQB 3QPQC 3O8XB 2DQJH 5TDOA 3H0TB 3U1SL 2FO4B 3LQAC 3CLFL 2B20A 2P5WB 4PJFB 4DK3A 1RZGA 5EBWA 5C9JB 1P84J 1BQHG 2X4NA 1GHFH 1ZLVK 1U8KB 1CQYA 1YY8A 5CJBA 4G8EB 4GAGH 4IIQB 3AFLA 2XWBB 4BSVB 4LU5L 3QRGH 4R7DB 5HXMA 4NPYA 1UH4A 1PX3A 2VISB 4G7YL 4HS6A 3CLFH 4OFYA 1BPVA 4P5MA 4CN4A 1TQCC 3RNQA 3T3ME 2GSIB 5LJYH 3MRPA 3BVNA 3C6LC 1SEBA 1Z9SA 4YFDB 5D71H 3ROOA 5D6DA 3T0AA 1DVFB 1YDPA 4A2MA 3CH1B 2CLZB 4OLYH 4ZPTB 1UACL 5HI4D 2PXYD 3KPSE 3QRGL 1G7QB 1FC1A 3ZHDA 4F58L 4JY4A 4ONGH 3OGOE 5J57B 5I8CB 1HQRA 1KFAH 4YIQB 5C0EA 4DGVL 5L2KD 3SKNB 5C9KA 3QUKB 5GGVY 1UWGL 4GW5B 4YLQT 4N8VB 4PY8I 5J6HA 5I9QB 1RHHB 2P4AB 2RAMA 1QBML 4LPCA 5I9QC 3BPOB 3SGEH 4KHXL 3T4YA 2BNRE 3OR7B 4LAQH 4UTAH 1IC4L 4UAOC 5KG9A 3F7VA 3H3KA 4P0DA 4HULB 1KPVB 5BV7H 4XNZC 4NUJB 2D31A 5A40E 4U49A 4W70A 4XMKL 1N4XH 3QDJA 2VC2H 1ZHKB 4UQ3B 1OARL 1KIQA 5KOVC 5F9OH 2HT4D 4X83A 2VDNH 4QTIH 3HR5B 4YDLB 1G9NL 4PG2A 3DWTA 2FX7H 1NL0L 1JWSA 1AHWB 3VG0H 4Y5VA 4ZAKA 2BRRL 5ELIA 4MLIA 4WGWB 2X41A 1KB5L 1CIUA 1NCTA 3GFUA 1MLBB 2DWDA 3M1BB 2R15A 3RX5A 4ERSH 2XPGA 5AYQA 3MRJB 2NXZB 2D4DA 4KMTH 5DFTA 4HZLB 4BFBD 1RFDH 1INDH 4HUVA 1S3KH 5CGYD 5ESAA 1HH9B 2X4SB 2ARJQ 3EYQC 2W59A 1EZVY 3D0LB 4GW4A 4HUUA 3MLSH 4ONHA 5KZCB 5J8OA 1T22B 5HI3C 5I1IH 1H8OA 3LKRA 3DYPA 1W0YT 3OXSB 5ICXB 1HOCA 3ZKND 1CI5A 3L7EA 2E5EA 3BAEL 5JOPE 3FQXA 1OSZB 1GOHA 1CZ8H 2VZUA 4FQLL 4JRYB 5SWZA 5IB3A 5L2KB 3UTTD 4YUEL 2X4RA 1B2WH 3EDEA 2DQCL 2BVOB 4XMPL 5FKPB 1NMAL 5IFHH 2PYEA 5E2UH 1A7RL 4BH8B 1JV5A 3CFBA 1S7RB 1EFQA 3C09B 4QCIB 4R97B 2WW8A 5E2VH 1ZGLP 4IBLT 2YXFA 4PGEA 5L2JA 1OD7A 5CLTA 3QHZH 5I1DB 2WV3A 3CU1A 4YBLC 1YUHA 5GSRB 3ULUE 3HNTL 4JREC 3WFZA 4X0KB 1NCUA 3GSNA 3SJVE 1E6JH 4AIOA 3QJHA 3PP3H 3DGGA 4PJIB 5EUOB 1ONQA 1VGKA 3QDAA 4JY6A 2F9BT 5GSVB 5FKAB 5I73B 2HG5A 2VLME 2FH6A 4Y5XA 3UJTL 2W0FA 2A9NH 4Y5VB 4CU6A 4JFYB 4NKIL 4X6EB 1F4XH 1FGVL 4XC1H 2BY2A 1LDPL 5IQ7L 4MJID 5DFWH 3VG9B 3QCUL 1S5HB 4KJYB 1BJ1H 4E41E 1CXHA 1S78C 2GJ6E 2MQ0A 4QXUH 1KBGL 1UJ3C 3PWPA 2Z4QB 2VSCA 4QYOB 2NYYC 1F8TL 5FYJL 5ICZA 3LN4A 1N8ZB 5C08D 5IM7B 1QSED 1DBKL 5ALCH 3LV3B 3Q1SH 2XG4A 3VD4A 3B3IB 4MA7H 4TPRL 1N64H 3ULVC 2VL5B 5ISZD 4ZUUA 4AL8H 3VA2C 4MNHB 3SGDI 3KPNA 2EXYC 3U0WH 2QADD 1JPSL 4FNLH 4HDIB 3O9WC 5MEQB 3CDCA 4M7JL 1WAAF 5HYSA 4DTGH 3OZ9L 5D7LE 5IWLA 3TV3L 2HVKA 3NN8B 1RUML 3VCLB 4JGUA 4HKZA 5E08L 4JFFE 3TBWA 5DRXA 3MOAH 3QIUD 2DMKA 3BD4A 4ELMF 1OGAE 3VGAB 2PO6B 2A6DB 4FHBD 5JA8B 5IEHA 1N3NA 3BGMA 1A1NA 1JI2A 4YHIB 1UENA 2PYEE 4BELD 5IGXL 1MQKL 1CFTB 3VMPA 5K9KB 4U6VH 3NIDF 3VD9A 4XP6H 5FV2A 5F9OL 4MB5A 1DP0A 5C6TH 3SGKA 1N5YL 3U4BH 5DC0A 1JGUL 5GSRA 4Y5YA 2FSEB 3QUXD 1CDIA 4NQSB 1CFQA 4IDJL 1M7DB 5EG6C 4QRPA 1CXKA 3WFBL 3VWKD 5GRVL 3MLWL 2R0WL 1P9MC 4O9HL 2FJFB 5BJTA 3L3IA 2WUBH 2IFFL 3VE0A 1IC7L 3QP3A 2UYLA 5IQ9B 3HZVA 5FYLL 3BZ4B 4HGWB 1P7KA 5KG9B 1JPTH 2VN4A 3L9RB 3U46A 2VZ3A 3F6IA 5IB5B 5C09B 2ZNWA 1DBML 5DXWA 4QEGA 5JNYA 3KYNA 2UZIL 4NKDA 3V52H 3VRLF 3C8KA 2BCKB 3EW3B 3L3DA 1KJ3L 4X8XA 5DT1L 2DMCA 5HTSA 5DLML 3BEWA 3FRPG 4RRPA 4RFOL 2CKBA 2YD9A 3FOMB 3EFFA 2APXA 4P4RA 5L6YH 4RZCA 2O5ZH 1D7FA 3GJFH 2DQTH 1G9ML 4I77H 1RSFA 4OZGE 5BO1H 1LO0H 4XPTL 2DQCH 3MRDB 4N0CC 3HZMB 1S9XA 3P9LA 4M6OH 4MB4A 1CFBA 5CJOL 3PWVA 5SWQA 4XPHH 2BJMH 5DSCA 1ZHBA 1JGEA 3GMPB 3NCJL 2YEZA 4PY7A 3WEXA 1W72L 5ANMB 4I5BA 2Q87A 4N8PA 2XWJA 5DJ6A 3QAZC 1ZGLM 1T5XA 3QUXA 2M1KA 1FN4B 5DO2D 1AO7E 3QO0A 1KUMA 1BX2A 4LOUD 5JIKA 4TVPE 3VH8G 2EYTB 4LP5A 3GMOA 4KZEH 4OCSL 4NC1C 2NXZC 4WWKB 1ACYH 3G04A 3LQZB 3V0WL 1Z9OA 2ZUQB 1EHLL 2AQ2A 1G7HA 5IVZA 4PD4K 2Z8VC 1TZHB 2IPKA 1LP9F 4HV8A 2JK5A 3SOBH 3WLWC 5C0RH 4L8CA 2BNQE 4WFFD 5F9WC 5I15L 4LBEB 3TBSA 4OF0A 2ORBL 2COQA 3SDCA 4K7FA 3MRCA 3P4OA 3MBXL 4PGDA 1KLFA 5IHUL 4E42A 2VDMH 3MGTB 4HUMB 4P4KA 3BP4B 1SBSH 5L7XH 1R3LB 4WI8A 2R0ZL 1VADA 4ONHB 5IFAL 2NY4C 1XF3B 4ZXBA 3VMOA 5KVMC 3EOBA 2FYYB 4XH2B 4FXLA 4O5LH 1LO4L 2W91A 3VXUA 1IGFH 4JHWL 1EEYA 4XPGL 3B9EA 1ERNA 4QRUB 4MA1C 4M8QA 1KGCE 2FHCA 3WXWH 5KVFL 1J5OH 1FORL 3MLXH 4LDOB 3QEQA 3CVIH 3MXWH 3ARDA 2GFBA 3QDJD 4G6KH 5IROA 1KJ2B 2VITA 3TZVC 5I8KH 2DDQL 2H3NA 4O00A 1F4XL 4XC1L 5IG7B 1Q0XL 2F15A 1XGQA 3FB8A 5I71C 2NY5H 1CL7H 2DJUA 5HHOE 1IGIH 2JKXA 5EU4A 3GI8H 1H5BC 3ZSSA 3GM0A 3UBXG 4FQQA 2YRPA 1CIDA 4QT5A 1U58B 3WMSA 5C0CA 3OKEA 4N8CH 1VKXB 4FTVD 5MP6L 1BQLL 4QXTA 1FNSH 4E5XB 3UJJL 2CXKA 1BIHA 4LCCC 1AR2A 1JNHA 2FO4A 4Q9RH 1ZGLA 4IRZL 5JZ7C 1U8QB 4QOKA 4GUPB 1UYWH 4U2YA 5KVDL 1G0XA 3W82A 1JZ5A 1T0NA 1WBZA 3T04D 2LABA 5AWNL 2D2OA 4O9HH 4CVXB 2Y06L 1MI5D 1FVCB 3FB7A 1OCWL 5LGHH 3WS3B 2XTJE 4JM4H 4Y4KD 1M71A 3D3VB 3HNSH 3NTCH 1H3UA 4Q9QL 3RAJH 4FQIL 5KSAA 2FJHB 4RCAA 5GGTL 4EQ2A 4NQUA 3FQRB 3QIWB 3B9DA 2BK8A 3P4MA 3PQYB 2X6MA 1GXEA 4GKOA 1ZLUH 1UB5B 1G7LB 1I7RA 5JMOC 3DMMB 2R23B 3UO1L 4U6VL 3FQWA 3G6JA 3H42L 2G2RB 5HHMB 2YZ1A 4M8QB 3S3JA 1NMBH 3UYRL 1X6NA 3VXUE 4YH6A 4M5ZH 4ORGA 3K1DA 1H3WM 5EU5A 3TO2B 3MZTA 1AGEB 1MPAH 3G5VB 4V1DB 3HR6A 3OJ2C 3BT2L 3BKYL 3ZYJA 5IBLC 5EOTB 1NAKL 35C8H 3I50H 2J6EH 3Q6FB 1E4XI 2UVEA 2VZSA 3KPRB 3QI9D 5HGHA 5DQJB 5EH1A 5D5ME 2BNRA 5DHVA 2XN9A 3BSZL 5JXAH 3D2UB 5H37H 3BP5B 1T2QH 1OB1B 5D2NC 4ZOEA 2EEDA 4WEBL 5CINH 5MHSE 1FVDB 1LO2H 2VXTL 2JE8A 1YYLL 4DKFH 3JUYA 1C16A 1VEOA 2F19H 5TE4L 4M6ML 4RQQA 2FJFA 3TZVA 5BJTB 4P2RE 1IT9L 5TF1H 5F3BB 3K1KC 3L3OA 3HTLX 3EKCA 5EZJA 5F9AC 5ENWA 4PTTB 2FGWL 3W0WA 4M1GL 4JCMA 1EZVX 2JB6A 4EDWH 5CCKH 1HQ4B 2H1PL 4G8GA 2HFGH 3FAXA 4NOFA 2QHRL 3MUHL 1NLBL 3DX8B 1F5WA 3IU4L 4JFXA 1A1OB 4OIAA 1T2JA 1O7VA 5TE6L 4G5ZL 3SEPA 2DQJL 2W60B 3E6HB 5TF0A 4KUCF 4AIZB 4N1CA 4UDTA 3QO1B 2I60L 4R7DA 4OFIA 4PRBA 1KG0A 3BZFB 3MJ7A 4LRIA 1P1ZA 2AEQH 1BZ7A 2DI7A 5FO9B 2KZ1B 3C9NA 5HHPB 6CGTA 3OBAA 2NLJA 4K7PY 4S1DC 3UZVB 3MGTA 5DRWB 2DQHH 1ZA6B 1B9ZA 3Q3GB 3HB3C 3BIBX 4U4BA 1K2DA 4OCRH 3CXHJ 2BSSA 2L0DA 4PY8J 4IMLB 2EIDA 3O2VH 3K8MA 1MCQA 2AK4A 1CGWA 1IJ9A 3F58L 3OWEA 2WP3O 3VI4E 3UYPA 3WE6A 4JANB 5KW9L 1MCRA 4I3RL 5TH2A 2ARJA 1OGAA 1HSAA 3I6KB 4F9PC 3AVEA 4LAJH 3T4AA 5E94A 3TP4A 4PV8B 4XBGB 3MUJA 4M48H 4K94H 4FXGA 3N0PB 2PO6C 2VKWA 4HEME 4PTTA 3U4AA 3MQIA 5KSBA 3MYJB 4XNXH 4OKVA 1JWUA 1NANI 5C70A 1VADB 4JPVH 2L7UA 1B6DA 2GAZA 1JPST 4TSCL 2GJ6A 1YNKL 2VLJD 2Q86A 4ZS7L 3I6LE 3BISA 4IRSD 1N8ZA 4UTBH 4GRLA 2D7MA 5I17B 1WGOA 2V2TA 4JO3H 4IRSB 1FL3B 1MJ7L 3QDME 1U91B 1JNHB 1U3HA 2YUWA 1L0QA 3X17A 1MFEH 4X9IA 3S88H 3BOVA 2ZUYA 1NGYA 2W1NA 5IT2L 3WHE0 3KWWA 1X3DA 3PXHA 2X4OB 5GRXG 1Z0NA 1BMGA 4I0PA 5A2IH 3GKWL 3KNBB 3NCCB 2ERJB 1NGXB 1NLDL 1UB6B 1P69B 3GHEH 3L1OH 1B0GA 1YMMA 1WAAA 4HHAA 2Y36H 3RBSA 1AGCB 3WSQL 1N7ML 4G43B 4PP2A 4OCWL 3RVTD 2KQNA 5F1NB 4EI6B 4J7RA 1PW3A 3ARGC 2BSSB 3IB4A 4NFBA 4Z7WB 2GJJA 2GT9B 3CH8A 1GC1C 2R23A 5AG9A 1UJ3A 4OT1H 1MHEA 4LGSB 1YN7A 3FQXB 3O0RH 4NQCA 3MTRA 5L88H 2RIKA 3S96B 3CLEH 4FTVB 2DBLH 4EJ1C 1Q9LB 4ORGB 2IPTL 1HYRC 1TZIB 1N26A 1A1MB 4XNUH 3BRGC 1DBJH 2FEDD 4OBSA 4HIHB 4XVJH 4YWGH 4H20L 1LK3L 4NHUA 1BF8A 3A6CH 2AXHA 1P6AB 1QFWL 1CLOH 1GAFL 1TVBA 1Z6JT 3U7YL 3QUMB 1PSKL 4FXKA 1BVKA 1LEKB 5EBMA 4CW1B 4RAVB 5DEGB 1B3JA 5FF6A 1JF1A 4Q97A 4UBDC 5L2JB 4D0CA 3P77B 5CJ8A 5EIQA 4X7FC 1KT2A 3GMMA 2H32B 3ILQC 5FOJA 1JPTL 3QXTA 3SDYL 5GS3A 1FP5A 4I3GA 1BFTA 2P5WE 1GGUA 2VABB 3IS0X 2ORBH 4HWZB 4F9PA 4W6XB 3HR5A 3HRZB 1HCVA 1WZ1L 3RU8H 3RWCB 4KK9D 5HDQL 2IANE 4HJ0D 5DZNA 1LO0L 4TSBL 3NOIA 1ZHBB 3EYQD 1X7QB 1F6LL 1TZGL 5F71A 4WUUE 3JUZA 4G8GB 4ONFH 1T0MA 2CK0H 5EORL 4BQ8A 1T04A 1I8MB 1WAAE 3HE6A 4R96A 3ELAT 2ITCA 3I3EA 3VD5A 3ZKNC 4MJ6A 4K23H 5BRZE 4PRHA 4JN2A 5EU3A 4ODTH 4S1RH 4M61B 4Z7UE 4I4WB 1UH3A 1CFNA 3HNVL 4JVUA 3ZTNH 4UNUA 3B5GA 3JWOH 4WJ5B 4RAUA 3QUML 4FNLL 3RL1B 3QG6B 5INDA 5L0QB 3NCYP 5CUSH 3UTQA 2XZZA 2I60H 5IEHB 4KXZH 1ZEAL 5E99L 1G9EA 1T2QL 2WUCL 4G6AD 3ROLA 2P8MA 1FL5B 1F00I 4NM4H 4QGTA 3REWA 3VGFA 3ZE0F 4OV5B 5LBSL 3MJ8A 4XPGH 2F54E 4RBPH 3E6FA 1J1PL 2A6JA 1H3PL 5GGUB 1NGWA 3GBMH 3D69B 4P4KB 1ADQA 2ZJSL 3BGFC 4ZS7H 1JZ8A 1G0DA 5CGTA 3ME0A 2XIDA 2UY6A 4I3SH 2VR4A 2HMIC 2EEBA 3HZKA 2I9LA 5CSZA 5IQ7H 1JRHI 2P42B 3TJHD 4H25A 4OUOA 1FFRA 3IJHA 5FUOH 4OV6F 2P24A 1AKJA 1RI8A 2FECI 4P2RB 3MJ9L 4HKJB 4L8SA 3MLXL 2FBOJ 4KTDH 5F88B 4AQOA 5EFIB 3C60D 3KPQB 1BD2D 1EH9A 4HIEA 2EC8A 4U7KA 4JFOA 3VXSD 1Q72H 4OZ4B 3PDGA 3SE4A 2YRZA 4NN7C 1HYSD 4NNXA 1WSST 4M43H 3H9SE 5DK3A 1XF2B 4NUGH 5DI8A 2BSRB 2ITCB 4BZ2L 2XA8H 1NPUA 2E9JA 1FNSL 1I3VA 2GSGB 4LSSH 2CIKA 4NCC2 1X5ZA 4HF5L 4ZFFA 4NFCA 1IGTB 5EO1B 3HZYA 4YC2B 1GGBL 4PRHE 1JVKA 5IMKB 5DYOB 4ZO6A 2NXYD 3VGHA 6FABH 5I1KH 4KRPD 4L9LB 3S88L 1MVUB 1FPTL 1WT5A 2OJZH 3HAEA 5TFSH 2DWEA 3SQBA 3G08A 5I75C 5DQ9B 4AG4L 1EFXA 3WIIH 5HYSB 4S1QL 4JO1L 1MJJB 2YUVA 1JK8B 2HT2D 1MI5A 1U95B 2NW2A 2FIKB 2R2BA 2MJWA 4Y19D 1I1YA 4R90H 1UWEL 4EQ3A 4FP8H 4F3FA 5KSAB 1HHGA 5DMGC 2ADFL 3BDYH 4WEUD 2VQTA 3GMQA 4FQIH 4Y7MA 1R3IL 3SKMB 1AI1L 1MHPH 2H8PA 1BFOB 5L9DL 2R39A 4G8EA 1UFUA 3WDJA 1J1XL 5FYKD 5EC1A 4X99B 2A38A 2DLEA 3LY6A 4XPAL 1AJ7L 4OD1H 1QSEE 4LLDB 3MLRL 4N5ED 3C5SB 3DI2B 3TO4A 3TH2T 1NBYB 3IF1A 1CFQB 4TUOA 2V5RA 5FYJU 4O58L 4FZEH 1MY7A 2GJ6D 1FJ1B 3CZFA 4PB9L 3CFDB 4MNGB 5IBUB 3BPOC 4TQEH 3QUYB 1N59A 2NY3B 4XC3H 5FYLD 5DT1H 2DRUA 4LCIL 3QULA 2ZG3A 4YR6A 4JDTL 3TPUA 1RIUH 2NX5B 2R0LH 1BVZA 1L0YA 1AP2B 4LIQL 5JW3L 5E9DD 3OXSA 5FO8B 3MRFB 5KVEH 3EYOB 1CGUA 3NABL 4QY8B 5CJOH 2BFVH 4G9FB 2HTKD 3GJFK 4JKPH 4TULH 4LSUH 2O93L 1IE5A 1IMHC 2EDJA 3QT2A 1I3RA 2Y6SD 1IGYB 4XI5C 4Z7QF 5C09D 1GGCL 2GTZB 3VFTB 2RB8A 1MWAB 3O2DA 5IG7A 2BZDA 3I6GB 1OP5H 3VXRD 2FB4H 1JF1B 2DQIH 3NPSC 3KPOB 2BY3A 3IFPA 3UPRA 5JOFA 5E03A 1KCUH 5ID0A 4N5UA 2ZOLB 4Z95L 3V4PL 1NC4A 4X0KA 2YK1L 5DJ2B 3TT1L 2IF7A 4Q6IA 3WNMA 5ICYA 3MLTA 2VLKD 3MLYL 4LL9A 5DLMH 1IM9D 4I3SL 2VN7A 5CBAA 1EV2E 4X7DC 1MIML 4Y4HB 5E1AB 5EO0B 2CLZA 2A1WL 4N1HB 4I9WD 2R2HA 2F8OA 2AXGB 1MLBA 2DWDB 1RJCA 3M1BA 7FABL 3VFMB 3DO7A 3MJ6A 2OL3A 4J3UA 4HT1L 3H2WA 1I7UA 3CCHA 4KI5C 1UZ6E 5IHLB 4HBQA 5C0AE 5FO9A 3QNYA 4L9LC 4APQC 4F7TA 4AK1A 1U8IB 1GPOL 4NO3A 1NBZB 1FFOA 3TFKC 2WBWB 4UV4L 1DJSA 3BRFA 5IJVB 5DGRA 4PJHE 3VXSA 2YD1A 4UB0H 4KGJA 4UT6L 5E24E 5JW5B 1CFNB 2AK4E 5DR5L 2P48B 1UM5H 5IEKB 2D31B 1A6TB 1IGIL 2GQHA 4JM2D 5KS9F 4HWBL 5EU5B 4ZS6D 3QXDB 1A0QH 1Q0YL 5IIEB 1CD8A 4TNWF 3IGAA 1DN2A 3L3KA 4J8RB 4HH8A 1FNGA 4OCYH 4WHYH 1A7OL 4LSTH 1JTTA 4KK5C 2OP4H 4V2BA 1S7XA 1ZS8A 3VXUD 1M7IA 3I3BA 1W2KT 4O02H 5DUMH 2C1OA 5ITBH 1SJEB 2EDOA 4OLZL 2VE6A 4YZFE 3FN0L 4ETYA 1J0IA 5TQ0L 4CMMB 3RWGA 4HFUH 4ONGL 4M5YL 5DUPH 2ESVB 3O6LL 3STLA 4PIRF 5KVGH 2I9LB 3BRDA 1UYWL 5CSZB 12E8H 1IM9A 3AB0B 2YC1B 1RUAH 4ZUVA 1CGSH 4WEBH 3NIDE 3PV6A 4Z7VB 4JRXE 1XCTA 3S37H 3NBNA 5AWNH 3RHWF 1FGVH 3GRWH 4P5TB 4U1MA 3ZDXF 3OAYH 2XKNB 4HC1H 5MENA 1OWRM 4BUGA 4HKJA 4KY1L 2GK0B 4HK0A 3GMOB 4UT7H 4DKEH 3GHBH 4WO4A 3CVIL 4KDTA 2OMNA 1BAFL 4KJYA 3KPSA 4HQQL 4LKXB 3N85L 2X70A 3GBLA 1W0VA 2LAGB 4XHJD 4PRPA 1EEZB 1DBKH 1JYXA 1OGTA 4KGLA 4HG4K 3UYRH 2LTQC 4N8VG 2OS7A 3S36L 4WI3A 3O8XA 1IZKA 3VWJA 2AQ1A 3H0TA 5F1NA 1V3KA 3TBYA 2B2XH 5T3XD 1KV3A 1EHNA 4OFPA 4OT1L 2J8UF 2GT9A 1YEHL 2XY1A 5D1XB 3WIHH 3SGJC 3KS0J 1U8MB 2HYMA 4DGYH 1T7WA 3MNWA 5EC1B 4MJ4A 1TQBB 1WICA 3P3YA 3SCMA 3U0PA 5FCUL 3AXLB 3S98A 1T66C 3LQMA 5F21B 1VGKB 4TUJA 2IBBA 1ORSB 1WTLA 2DQTL 4ZFOA 1IGMH 2A77H 1YN6B 1KJ2A 1UCTA 2XRAL 5ECJE 1JZ2A 1DVFA 1SBSL 4Z8FL 4PG2C 4P5KB 1E6JL 3NZ8B 4P3DA 4QF1B 4HK3J 3BD5A 4X5XA 4MD0A 5ETUA 2NW3A 3NACL 1BQHB 3O6FD 3OKLA 1KIRA 5CWSA 3FHAA 1IGFL 1WBXA 1L7IL 4ZSOB 5I1KL 1NAMB 2JJUA 3RKDD 4NFDA 3PV6B 2EXWC 3H9YA 1DQQA 5B4MD 1OY3B 4KJQC 4CN1A 2W07A 3UTPD 1GOFA 3HS0B 5HBBA 4G6JH 4OTXL 4JZNA 4Q58C 3VE0B 3DECA 1G9NH 1CDUA 1FZMB 3WUWG 5FCSH 1UKQA 2DM7A 4J3XA 1OAQL 2BC4B 32C2A 4C59B 4HUXA 4NP4L 5BS0E 1A5FH 5A1AA 4ELMA 4ISVB 3WDIA 4AT6B 1M4KA 1WFUA 2C7UA 3MGAA 3V0WH 2GW5A 1MCEA 2EDQA 4WY7L 1JPFB 2A6DA 1I7ZA 3SJVA 2A83A 3I84A 5TDOB 5LXGH 1RJLA 4UQ3A 1CLYL 1IBGL 4KROB 1AXTH 1L7TL 2R0ZH 4WUUD 5IFAH 9CGTA 1A6ZB 4NZJA 3KJ6H 4M6OL 1S5IH 1T1ZA 2VDML 1BZQK 3T0XA 3P0YL 4L8DB 3VFSA 1WF5A 3PHOA 5T3XE 2D7TH 2MQ3A 3BP6A 4DGVH 2FJGA 3VFMA 3WV0A 5ERWB 1W0WB 3FB8B 5F7WC 3OR6B 5JOFB 1P5VA 1KG0B 5FM4A 1YMME 4OB5L 2AQ3A 4PJ8A 5FGSA 1FZOB 2P44B 5LBSH 2HJKA 3VXQA 3BQUD 4WFED 1F90L 1KTDA 1P7KB 1RUAL 2P8PB 3CXDH 3EAKA 3EYFB 5JW5A 3E2HB 4Y4HA 5E1AA 3FRUB 5JHDD 2EYTA 5DK2B 3ARVA 2DLGA 3GIZL 3NMEA 3V79C 2VIRA 4OLUL 5ADOH 3TVMC 4CVZB 4EBQH 3GIVB 3JTSB 2JIXD 4DTGL 1BAFH 2EXWD 5TJWK 4R2GB 3SDDC 5KSBF 1H9VA 3GNML 4JB9H 1UACH 5DC9B 3FT4B 4IM8A 3UJTH 3D3VA 2DM2A 4P46C 1D9KB 2JJSA 3HLAA 4PS4H 3STZB 5JR1H 1ULVA 2EH8L 2VAJA 4TVPL 5K93A 5SWSE 3BIKA 2FL5A 3RPKA 3IFNL 1LD9A 1HDMB 1LHZA 3OXRB 4JG1L 5I0DA 4BSWB 2G60H 3WIHA 4EN3D 3WUWA 4ETQA 1QFWH 1XF1A 5GISH 2X2YA 4YDIH 2OCFD 4H88L 4XMLL 4GAGL 4HPYH 3N1GC 3MV8B 2J88H 2ZUQC 1N2RA 3LDBC 5TDNA 5GJTL 3FFDB 3JTTB 2ZSVA 4LU5H 3L3GB 3KGRA 2B0SH 4YEFA 1A7BA 3RHWK 3HUJA 4PJ8D 5IVZB 3SGKC 1D6EA 3UX9B 4Y8DC 1D5MB 1A22B 4NJ9H 5IM7A 3UPCA 3SDAD 4OFKA 1FZOA 4LBEA 5D2NA 2V6HA 4NBXB 5H35B 2EYRB 1Y18A 2E9BA 1E27B 4BFGA 4PJ9A 3EDDA 4Z7VA 1BOYA 2CK0L 5EORH 3KXFB 4LPYA 1DUYA 2VLRB 4NNPH 2BOCA 1L7IH 1EMTH 1CICC 4WJ5A 3L7EB 4DKDC 1IILE 4E41D 4Y16C 2FYYA 4XH2A 1MAKA 4XPAH 4RX4D 3U7WH 2LTQB 3U0PB 1T1YB 1YN7B 5E4IA 3C60B 4ODUA 1JHKL 4R4NC 3AS3A 3G9AB 1HZHL 2JIXB 3GRWA 2OTWA 3U36B 4WHYG 4OD2B 1D5IL 4Z7WF 1IEBB 1ORQB 3MNZA 2HFFA 4XGZB 3QHFH 5DURB 5GXBB 3LEYL 3D3VE 3GMNB 4Y2DB 1H15A 1G1CA 3UJIL 3DTXA 2NZ9D 1CT8A 1D9KC 4Y2DD 1U8MA 1TJHL 4BA8A 5EC2A 5KAQG 1PG7H 4WVRA 2XYCA 3MA7A 1FIGL 3C08L 5IB4A 4HS3A 2M8XA 4FMFA 1F11A 5I8OH 4XBEL 4G9FE 1C5BL 3AAZB 1IGCL 3LAFA 5IUSA 1UXSA 3QEGH 4CJ0A 4PRPD 1IC1A 1T7XA 3R0NA 1MCJA 1GGCH 2F54A 2NY5L 5GIRA 4X6DF 4UILL 2HTLC 3RZCB 4XX1E 3X3GL 5T3ZL 3QUXC 1HH9A 1B4RA 1Z5LB 3HUJB 3T0EA 5CFHA 1LE9B 4KKLD 1OB1A 1S3KL 1RURH 4M93C 4K3JL 2BVTA 3M8OL 3NH7H 4JFHD 4JKLA 5I1IL 2BCKA 4KUCD 2YD4A 4JG0L 3EJZC 4JRYD 4GRMB 1J0YA 5C08B 4MNHA 2WUCH 4PRAA 3UC0L 1QSEB 3VWKA 3MLTB 2CLRA 5D7JC 4PJGA 4HJ0C 2OP4L 3NFNA 2ZUWA 1YECH 3ZLQC 3O6FB 4L8DA 5F7YC 3JZ7A 3NAAL 5IK3A 1R5IB 3S8WA 4MAYB 2MKWA 5EZJB 4D3CH 2Y23A 1WBYB 2C5DC 2F54D 2YBRA 1NMAH 2JCCF 1CWVA 5E2WL 3MCLL 5I2IA 3FQNA 2AGJH 3RUGE 5ITFA 4P2RD 2P7TB 4IRJB 4OQTA 4LHUB 3SOBL 2DBJA 1GCFA 4GRWF 5SX5H 1YEKL 1KJ2H 2X4PA 3WXVH 1EGJH 1M7XA 2PNDA 5E6IA 1AC0A 4KKNA 1FL5A 2HG5B 1IZJA 2IMMA 1SBBA 4P2CG 5D8JL 4EIZC 3P40A 2HFEB 1FN4A 5C0BB 4D94A 4KHTL 4LEOB 4P57A 2CRMA 3D39E 2X4QA 3EOYG 3QEQD 1NFDE 4Z76A 3IRZA 3IS1X 3O41A 1FFQA 5IVXE 3ARGA 2BX5A 1LVEA 1MCOL 5GRWA 2FEEI 3QUYA 3LN4B 3HZVB 4G42A 3NZHH 1JHLH 1YMMB 1ZEAH 5T3XH 2HJKB 1BREA 1MNUH 2J12B 3GO1H 2X4UA 5A43C 4UDUB 4OCYL 1CFVH 1NCWL 1GZQA 1I8KA 4G8FA 1MCPL 3TN0C 3C8HA 3PQYE 1XAUA 1IGJA 1SJEA 3ETBF 2LU3A 5KS9B 3MXVH 5MERB 4PJ9D 4MMXC 12E8L 4JO4H 2ESVA 4L4VB 2WBJC 3K2UL 4NQXA 4F33A 2Y4SA 5D70L 1CGVA 1P7QA 2NY6B 4EOWH 3IDMB 4P4RB 3V7AE 3FO0L 1V7ML 3PE9A 1CE6A 2VLJB 3MUGB 4PPTA 4Z78B 5J0BA 2E6JA 3ARDB 4JN1H 2OTUB 4J4PA 1CXLA 3DVFA 1NDMA 4ZFFB 3BGMB 1T0PB 4P9HH 5BW7C 4OAWA 4HKBA 4LSUL 3QQ4A 1AO7D 4GRWB 2FATH 1ZT1A 3DNKA 5IESH 5DEGA 1AE6L 4HJGB 3CDGA 2XPGB 5A2FA 5BS0B 1A6WH 1D5MA 4X4YA 2AJZA 3BH9A 2W9EH 1UM4L 1RIVL 2YPVL 4C83A 4LSRL 2HJLB 2EYRA 4FQQB 4UT9L 3GK8L 5C0CB 35C8L 3G5ZB 4MXQC 4R8WL 2BMKA 4PJEE 1T7YA 5IW1B 3K4ZA 1X5KA 2P8LA 4GLRI 4XRCA 5SWZD 3TT1H 1OAQH 1RIUL 1G7HB 3V4VH 3IDXL 2LU4A 4ELKA 5GGSA 4BK5A 3O3EA 3DO7B 5T1LA 1FPTH 3VFPA 5AZEL 4YDJB 1NFDA 4HW6A 4OQTH 1C8PA 5L2KA 1DBBH 1T1WB 3K8LA 5ADPH 4G8GE 5H35A 2PYEB 3CMGA 2PXYA 2AVGA 1RJYB 5D93B 3KG5A 4BFIA 3BH8B 3DMMA 5D1QB 1KN2H 4F7EB 1I1AD 1VDGA 3P4MB 3PQYA 4L29A 4LNVA 5MERA 2GIYA 3KPPB 4Y16A 5KSUB 1A02N 1AI1H 3UAJC 4YFLI 4Y19B 3WLBA 5CD3A 4OZHF 4NQEE 3N1QC 2NY3C 3L3KB 4J8RA 5T1DH 2NNAB 1MRFH 4M00A 1INEH 3LZFH 1PSKH 3EYOA 3TWCL 3DHMA 1KELL 4CADB 1FGNL 1T1XB 5HPOA 3KXFE 4KH2A 4KKAD 3REVA 5J56B 1WIUA 2IH3A 1Q1JH 2Q8BH 1XCQB 1AO7B 2WBJA 1DSFL 4JQVA 3QJFB 3TN0A 3D87B 4F7CA 1AIFB 3MCG1 3H9SB 4MCZA 2FH8A 4QRQB 4OI8A 1VKXA 2LVCA 2OM5A 1MRCH 1S7UB 2DQUL 1J86A 2YPLD 4HS3B 4ZTPH 4L8SC 4NWUL 4WDIA 1D6VH 4M7KH 2FHFA 1NCCH 1UG9A 1CF8L 5DUML 4MXQD 4F57L 4PJEA 1JFQL 1YNTA 4KVNL 3NA9H 1ACYL 3K80A 5E6IC 5LAXB 3JWDC 4JQIL 1QKZH 3T77B 5GGQH 1BEYL 3SE8H 4NO2A 4GRWE 2DLTA 2HN7A 1P5UA 4EN3C 2XTJB 4K8RC 1L4IA 3FO9B 3DVIA 4WGVB 3VRIA 1BZ9A 2EDWA 3CDFA 3ILQD 5CP7A 4Z5RB 4AEHL 4GS7B 4JRXA 1TCRB 4X7SL 4Z7QE 1S8DA 3GHBL 1BVKB 2IAMD 5EBMB 2E7MA 5EOQH 1LEKA 3VWKC 3RWEA 3FFCE 1KXVC 5B39A 3JWOC 1KEGH 1DVFD 1LNUB 1MUJA 5F72S 3PQYD 1XF5A 5A2LH 3P0VH 4F2MB 5B38A 1UVQA 4UIKH 3VRJB 1RZIB 5IBLD 3O41B 4Y4FA 3UZQA 3BPLB 5GS2D 5ITFB 2Z93A 4EVNB 4NCC1 5HI3D 3ULUD 3C9NB 4NM4L 4U1SA 5C0AB 1HK6A 1N6QL 6FABL 1RUKL 4LAQL 1BJ8A 4KI1A 1ZANH 5BRZB 2BOBA 1RUQL 5GRYA 4Y1AD 5TE7H 5B3JF 3CMOH 4P3DB 4DZBA 5FUOL 1I7TA 1RIVH 1JNNH 3GEWB 4URTB 5C0BA 5BMFH 4XCNA 1AIFA 2ICCA 1J0ZA 4BK4A 2Z31A 1X5XA 2C1OB 2OZ4A 3TNNA 1EJ6A 1MF2H 3IFLL 2DKSA 3UTTE 4BKLB 1OGAB 4I0PC 4JO1H 5DHXB 2I25N 5JOPD 1NC2A 1YEIH 3IJSA 4TOYL 4NJAL 4GW1A 1T6WA 2VDLH 3I85A 1HHHB 1DLFL 1C1EL 4XVJL 1S7RA 3FO1A 2Q7NA 3INUH 2FX9H 4QCIA 4UUJA 5E8NB 3ARYA 3UPAA 3QQ4B 3S35L 4GQPH 2FJHA 3QR2A 3U4BL 4DGIL 4NQTA 5GRUL 1FH5H 4U6HA 4ODSH 3ZKXC 1KJVA 5EBGA 3EZ8A 2QQKL 5D7LA 3CSGA 2WK2A 5D8JH 3KDMA 5GPRA 4BZ1H 3LEXB 2HJLA 4PD4J 2I9TA 5DS8A 5F97E 3P73A 4F33B 1UA6L 3BUYB 2Q76A 1FC2D 1I8LC 1A7QL 1FNEA 4LVEA 1X4ZA 4DK6A 5BZDB 4GRLB 5I17A 2HRPH 3RWDA 4ZFGL 3D85A 1Q9KB 4H0IA 2FX8L 4AIZA 5FV1L 3NCJH 4ZD3H 1XF5B 4F2MA 5B38B 1NANH 3VXRA 1AFVH 5KSAD 4ZFZB 2D9QB 3NFSL 5T1LB 4G80B 2XQYG 1OTSC 1A3LH 3DRQA 2IADA 1UA6H 1P4LB 2AV1A 5C0IB 5CD5D 1JGVH 2VDKH 5KJRL 3TBSB 1QQDA 3QB7C 3GUTB 1K4CB 4QRPD 3O3DA 4M03A 3EDJA 3AUVA 1QLEH 4PJFA 4M7LL 1GH7A 2BSTB 1JMZA 2OK0H 4TSCH 2Z35B 4TQEL 5EPMB 1UJ3B 4OJFL 3NN8A 3GSXA 2EYSA 2R69H 4ZUTB 3VFPB 3U2SA 4XZUB 4YPGA 1WITA 2ZCLL 4NO5A 3O6KH 4ODHL 4JAMB 3WHXB 3MRIA 3RRQA 2Y7QB 4U1HB 4WW2C 4YHOH 25C8H 3PABB 4HIJA 4F7TB 2H9GB 4FMKA 1U8IA 3QQ9D 4P2YA 4JHWH 3KPSB 3MLVL 4LCUB 4LKXA 4PLOB 1NFDF 3STBA 3ET9F 3TPUB 5FF6B 3HG1E 1CDCA 3LPGA 1JHTB 4YHLH 4XNYL 3B2UD 3GMMB 2APTA 3PGDB 2YHGA 2C4FT 3OF6D 4CL7A 3UTOA 3VI3F 1FNHA 4V1DE 5K9OA 3S34L 1FV1B 1U91A 3ULUL 2PYFB 3C09C 4OB5H 1EXUB 1NAML 3QIWC 2NTFB 1XGTA 1YPZE 1ZVSB 1DBBL 1HHKA 3G6DH 3JV0A 1OQXA 1DUZA 1PEWA 3RP1A 1G9MC 2GUOB 4JPKL 4F57H 1HE7A 5D5MA 5C09A 5IB5A 5KBNC 1RZJH 1I9IH 4PJDB 4PJDF 3LN5A 4KTEH 3H9SA 5B8CB 4U6XB 2BNQD 4WFFE 3IXTB 2UWEF 1R0AH 1T04B 4XP1L 5EZIH 3CZFB 3MMEA 4NRXA 4KK9C 5CZXD 1C5DB 3UTSB 3O9WA 3QFDB 3THML 4KVCH 3MCKA 4HIIB 4L3EA 1EGJL 4Z7WE 3BDXA 1F8TH 3RVVC 3SE3C 4MS8C 5EPMA 5HYQA 1WTGT 3GMRA 1BFVH 1N7MH 5JQ6L 1BD2A 2K3TA 1EK3A 1WUNT 2JCCA 5DDHA 2DAVA 4R4FH 3U9PL 4NQVB 3ZKMD 2VXQL 43CAA 1KCSL 5CP7B 1I7UB 2Y7QA 5F96L 3QEQE 4ESKA 2UUDK 4GMTH 4QWWD 4X5WB 5DJYA 3W39A 4HQQH 1IVLA 3QNZA 1NEUA 1FL3A 2XT1B 3T3MF 1U3HB 2VLLA 4PB0H 3JV6B 5D1ZD 3TVMD 3KYKL 2EH7L 4QGYA 2CRIA 3OJVC 1T03L 5I76A 1E4WH 1U8PA 3PGDA 4UV7L 4YAQB 1I7ZB 3SJVB 1UCBH 5DJAA 3RIAF 2PYFA 4LK4A 4OF3A 4GG8A 1X5LA 3QHFL 3IGAB 1AKJB 2NQCA 1HKFA 3F6LA 3ZKSD 4LLMA 2DTML 3ARFA 4YJZL 2YPVH 2G75A 3HNVH 1TXKA 3FN0H 1ZT4A 3C6LD 1YY8B 3CFBB 2Z0BA 3DV4B 4DKAA 3PL6A 2B4CH 2IANB 4R8WH 4X7EC 3HE6C 1S9XB 3P9LB 3L3HB 2H2PD 2VZOA 4PGBA 1J0KA 3BH9B 1TFHA 3NIFE 4PUBH 3CCHB 1A6WL 3UCRA 1WBXB 3ECBA 1F58L 1A2YB 4QNPE 3QWOB 3QXAA 4LSPL 4M7LH 4EZMA 4KAQL 4FFZL 2J8UE 3TO4D 4LLWA 5D9SA 2HFGL 1MFBH 5DK2A 1HZHH 3OKOB 1IKFL 3HRPA 4OM0H 1FDLL 3UXFA 5IMKA 3LD8B 32C2B 2EDYA 3LD8C 3N9GL 3O11A 4QHLB 5DJ8B 3BZFA 1TZGH 4IRSC 3P77A 4PREB 3T3PE 1MELA 2HA1A 5FA3B 5I1LB 1PKOA 2FECL 2Z4QA 4Q9BA 3ZL4H 1CK0L 1Q94B 3WL9B 2A9ML 5F7DB 2GJZB 5FUCE 4OF8A 2WIIA 5J11C 4KRPC 3SE3A 5CBEB 3D69A 3BHBA 3SDCB 1IKFH 4PRID 4S1RL 4DWHA 1G6RA 4L5FL 2HFFB 4TTDD 3L3JA 3N9GH 3TCXA 2J8HA 3TVMB 1XF3A 4ZXBB 1NGQH 1ITCA 4NN5C 5ADOL 1RV6X 1FVCA 3BKMH 4EDWL 5CCKL 1H5BB 2YK1H 3X3GH 3E2HC 3EO9L 2R2EB 2P24B 3O4OC 1DL7H 4OGXL 3WHXA 1NUFA 3OKYA 2D0GA 1F4WL 2BRQA 5JORB 5E5UB 5HDQH 4GH7B 4UDUA 3PABA 3KLAA 3FAWA 2YA2A 4NGHL 3ZO0A 1HEZA 4O2EB 4M8VA 4BYHA 3LKNB 2DIAA 3MLZH 4YR6B 5AEAA 1Y6MR 1ZLWH 4BJLA 5DEFB 1MCBA 1U8NB 1D5ZA 1DZBA 5DMKA 1JPSH 3T3PF 4FQJH 5C0NC 3P11H 2H32H 4KJQD 4RA0C 2X7LB 3CX2A 2AGJL 3EOAB 4NP4H 4PJFF 5C2BL 3PUCA 3TV3H 4LPVA 1Q9WA 2MKLC 3M07A 4YIQA 5C0EB 3DVGB 3ULVE 3UTQB 1WT5C 2H26A 3AY4C 5J1TC 5FB8A 1X5FA 4ODVH 5EOTA 5E1HB 3PNWB 3EO1A 3V6OA 3TJEL 1NBVH 2CLRB 1KTLA 1SHMA 3OKDB 5JPMB 1HH6A 5BS0A 4EDXB 1OCWH 2E27H 1KTRL 1R5VA 4MAUH 1GHFL 3CFIC 3VGBA 1LDPH 1NKRA 5JNYB 1MCCA 2ADGA 3U0TB 4O58H 2R2BB 5HHME 4KRNA 4JFFD 4ZG1A 1ZA3B 2VKXA 3K4AA 5C0JB 1XMWA 1J0HA 3MV7B 3QIUC 3BGAA 3LMJH 5F3HB 1X9QA 1J8HA 1Y0LA 3TVMA 3PJSA 3TH3T 4RDQF 5C9JA 4RISL 1SJXA 4KVCL 2MQCA 4PJCB 1BD2B 2CJUL 4MQ7B 2XZCH 3IJYA 1A9BB 2IH1A 4R7NB 1OHQA 4OZHB 5C0GB 4MDIB 3IKCA 3TJHC 2OL3B 1EA9C 5JMRA 2XKSA 2WAHA 1BWWA 4PLKC 3UTTB 1DE4A 3HI6L 1PKQA 4RAVA 1S5HA 1EEUA 4NO3B 3VGEA 1DQJB 3PWLB 1G9NC 5DQJA 2NX5A 4DQOL 2NY0C 5HYQB 1VFOA 4GAFB 4UTAL 1KACB 3TNNB 3W81A 1SMAA 4LSSL 1Q9WB 5F7NC 1Q38A 4XC3L 1HQRB 4CVZA 3DVNB 3VDBA 5E9DB 2E7HA 1XF4B 2EO9A 1WIPA 2IFFH 5AUMB 3I6GA 4JPIB 5B39G 5J11B 3RPIB 2SEBB 1AO7A 2WBJB 2QSVA 4H88H 3QDGB 3G6AB 4BH8A 1JV5B 4I9WE 5GRJH 3MRGA 3SKMA 5DD0H 1MRFL 5KN5B 4JEGB 1Z3GH 3LEXA 5CJXA 3CFJB 3QAZB 1JHKH 2B0SL 3GZKA 2HT3D 5E94B 4RFOH 3W9EA 4F8QA 1KEMH 2DIBA 4K55A 2IQ9H 2BVYA 4HFWA 4WO4B 3SE9L 3DBXB 4AH2B 3PL6B 3I02B 3VXRE 3FO9A 3A6BH 1M7DA 2CUHA 3WL9A 5E00B 5CEZD 2JJVA 3QNYB 4UAOB 5BV7L 1F4HA 3RGVA 4JGMA 1CLYH 2FGZA 3RY6A 3MRFA 4LVOC 2I07B 3RNKA 1T21A 4NRZA 1JPGB 3OMZA 3Q3GA 1NCAH 2YWYA 4L3CA 3C5JB 3MREB 5DGQA 3GSOB 2WQRA 3F12A 1AD9A 1EGJA 4MNQE 5IF0B 2N4IA 3QUZA 3ARQA 1CVSC 4N0FB 3SGJA 3SCMB 5FFLA 4QRPE 1ZAGA 2R4RH 1DBAL 5D7JB 4ORZC 5HHQB 4TNVK 2VQ1B 3G5YA 3KJ6L 4G7YH 4NQED 3TCLA 2OTWB 5D7JD 5FKPA 1WZMA 3GO1L 5JZ7D 4WI6A 1SY6H 4EIGB 3P2TA 4NWTH 2GY7B 5I1EL 3QIBD 1TJGL 2QSQA 3TBVB 4X5XB 5ETUB 2X4NB 5FA4B 4J3WA 4Q7DA 2VLRD 1OTTC 4U6YA 4OF6A 1XCQA 4KUZL 2E9WA 3F5WA 2O61A 3BQUB 3ZTJG 5HGDB 1PYWB 2IAMB 4MQXC 4LCCB 1DQQB 5IFJA 4D0DB 3ZL4L 5E7BA 3L3IB 1G7IB 3U1SH 1XGUA 3WJLA 7FABH 1JZ4A 3ROOB 5I6XB 5F70A 4FFWD 1UQSB 5MI0C 5D7KE 4W6WB 5DJXB 1Z9MA 1GGTA 4JHZA 4YDJA 1EFXB 2DL9A 2XQBL 1OD9A 5LVEA 1XZ0A 1D9KD 4Y2DC 4IIQC 5GISL 1W8OA 1M6OB 1XIWD 4R3SA 4GLRH 5DZLA 3DARA 3ARBD 4XI5D 1PDKA 1UXWB 1CQKA 4NSKA 1YEJH 5J6HB 1RJLB 3H9SD 1NUGA 3MYZA 3H7BB 4MA1B 4F7PA 4Z78A 4L3EE 4Z7WA 3BWUC 4ZFZA 5MEQA 2C4FU 5SWSA 3IDYC 4OAWB 1GIGL 1DANT 2IH1B 5FIEA 2BNUA 4MDIA 3SGEI 5DRXB 4M02A 4WTWA 2CKNA 1LP9A 5I2IB 5I1GH 4WFEE 3VCLA 1A9EA 4LEXL 4ZMAT 4DVBB 2F58H 1YQ2A 3U9UA 3UBXA 4LHUA 5C07A 3OR6A 4LIQE 2Z93B 4AJ0A 1AXIB 3DX7B 4MJ5B 3MRPB 5GRJL 4X6BA 4YQXL 3MC0A 2W9DL 3RGVC 3D1MC 4NZTL 4W4NA 4I0PD 3GSQA 4KHTH 3T09A 1F6AB 1HHIA 4HMEA 4Z18A 1FNLA 1ZT7A 4J1UA 1KTDB 4MNQB 3KAAA 4YXHL 4D0CB 1G7QA 1KT2B 1XGYL 2F58L 4Y5YC 2R29H 2OX5A 4P46D 3FB5B 3MV7D 5FDWB 4R0LB 3J8F7 4APQD 4OZIA 1VA9A 1I3GL 4B7LA 4OLXH 4E5XA 1NFDB 3X12A 4P3CH 1OM3H 3MJ8B 2NY6D 3D39D 5IFHL 3MZGB 4LCWB 3MRRB 3VWJB 2Q8BL 3NVQA 2J4WH 1IAIM 1DSFH 3EO0A 5IMOB 5F1IB 2YSSA 5HHOA 3FB7B 5CSGA 4F58H 3WS3A 4ZTOH 4UI2A 1MCIA 1JJUA 2ICEB 1YEHH 5TH2B 3DUSA 1IKNA 1T0MB 3ECBB 2CMRL 3SDDB 5J89A 1ZHNB 4HSQA 3VFNB 4HZAA 3EFFB 2F8XC 4KI5D 1YJDC 2K9UA 4DGYL 1FNEB 2W0KA 5T5FH 4F80A 1WFTA 1YQVH 1GGIH 2BXZA 4XB7A 2WUBL 3GSVA 5D7IB 2R4RL 5C09E 1KN2L 2X4QB 4U1KA 1F4YH 4XWOC 4B5EA 4DW2L 3JTTA 4YXLL 1R5WA 3F7YB 3T2NL 1UZ8B 4HXBL 3IDIB 1QLEL 4U1SB 2BSRA 2NR6C 4V1DA 1KC5L 5INCB 1I9JH 2E7CA 3NACH 4O4YH 1CLZH 3V95A 1MCKA 5E2JA 3WBDA 2JF1A 3BHBB 2WBKA 2WWMC 2O5XL 4XNQA 3LDBB 3W11C 2Z31B 4ODHH 3TJEH 5IF0A 1ITBB 1JYWA 4FFVD 2AABH 4CMHB 4GUPA 2VXSH 1G7JA 1JHLL 3QXDA 5TE6H 4KPHL 3RDTB 4UV4H 4JDZA 3V4UH 4WI4A 4EN3A 2YUXA 3UTPE 4N0UE 4ZYKA 1CLCA 1DQTA 2CLVA 1HXMB 2NXYC 3QQ3A 5FGBA 2YWZA 4TNWK 2V5YA 1NAMH 2ZSWB 1SVCP 4M9OA 3FOLA 4K7FB 3SDYH 3TC9A 1DEEA 3CXDL 5CKAA 4FG6C 4J3VA 3MLSL 1OP3K 5J4MA 1GL4B 4EBQL 3UAJD 4L4TE 4IDLA 4NUGL 2EZ0D 3LS4L 1BP3B 4GOSA 1OAUH 3MA7B 3VRLE 4NQCB 3HC0B 1K8IB 5EC2B 2QQLL 1KBGH 1DLHA 4HFUL 2AJUL 5D7IF 3EFDH 4OLZH 4NJAH 1R24B 1UJTA 4WO4C 1JI1A 4JKKA 4PS4L 4ACPA 5JR1L 3RVWD 1MCPH 4PJEF 2QSCH 4QTHA 4Y4FD 2CUIA 4RFNB 3IAGC 4ODXA 4MA3A 3QO1A 2EDHA 3GSUB 1UCBL 4N5EC 1KLGB 2GUOA 3ARSA 1XR8A 3S37L 4CDGC 3VXPB 4A6YL 4PRIB 4HMCA 2YA0A 3EFDL 4HUVB 4G6FB 4JY4B 1FZKB 2YUZA 3KYMB 7CGTA 5T33L 3ZDXE 2NW2B 1CD1A 5FECB 3TBYB 4Y16D 4PJIE 5IFJB 4QKXB 5DD5L 4H20H 5F3HA 1NKOA 4O02L 1FL6A 4PJHA 5IQ9A 3VXSE 1T0NB 3HRZA 1RZ7H 1QZ1A 3L5WB 1MQKH 1RZ8A 3DURA 3S9DB 1WLHA 1FSKC 3SPVA 5KSVB 4IOFD 1AJ7H 4PREA 3I2CL 2YN5A 4NO2B 1EO7A 4M4PA 1IGCH 4DVBA 2BHYA 5C0FA 1UWXK 3VRIB 3KDMB 4PB9H 1B0RB 4JPWL 4XBPA 4R3SB 1ZSDB 5EOQL 3V6OC 1JGLH 2P5WA 2P5EE 2R8SL 4KC3B 2J8UA 3REVB 2FEDC 3GSRB 3LHPH 3CFDA 4MNGA 4WI7A 3CSPA 3WD5L 1JF6A 3OTTA 5JHLL 3DTXB 3U0WL 2X44D 1EBPA 3HE7D 4C4KT 5J06A 3UYOD 4LEOA 1CG9A 1BQHA 2OZ4H 3HZMA 5KTEH 1IGML 2A77L 2DICA 1H3GA 2QQKH 3UTSD 4LVOB 5F1OB 3RL1A 3QPXH 3HN3A 2B4CL 2VLKE 2V2TB 2AJVL 3X12B 3PDDA 1D5XB 2VDPH 4N0UB 2YPLA 1HHKB 1P1ZB 1JRHH 5GGRA 2EDTA 1V5JA 1FZMA 1EO5A 3ARFB 1TNNA 5BRZA 2DI8A 3NCEB 4M1CC 3E6FB 4PGCA 3VXNB 2IWGA 1LE9A 1ZT7B 4J1UB 4MNQA 4DJMA 1I8KB 3Q48A 3QEGL 1SYVB 1I4FA 3BAEH 1GGBH 5CD5C 1INDL 5SX4H 5C08A 5FK9B 4YEEA 1T6VN 2OXHA 1ZWIA 2AKRA 3T8XB 5DJ2A 2BDNL 3HMXA 1LQSR 3W9EB 5HGBB 4EI5C 3T4AB 2Y07H 2BHZA 3U30C 5D7IA 2F53D 3PHOB 1QYGL 3RWGB 4AMKH 2VDQH 4R4BB 4MAYC 4NUJA 4LARL 1CFSA 1D5IH 3W0WB 1X4XA 2BVEA 3O8XD 1U8JB 5CSBA 3LEYH 2P5WD 4XP9L 1ZSDA 5J9PA 1WWCA 4ZOAA 1A7QH 2ICEA 4EUPH 3KLHD 2WP3T 4G9FD 1NMCB 4GJTB 2DQGL 5IW1A 3THMH 2VXUL 3QQ9C 4UOW1 1IGTA 1K4DB 3L7FA 4YHOL 1BX2B 1V8HA 3K4DA 3E8UH 1OTSD 5EUOF 3HE7C 4KQ3L 4L4TD 4JY5H 1T83C 3IKCB 5EB9A 2FNBA 1UKTA 3QUMH 1EEZA 3D3VD 4KQ4L 1R5WB 4R4FL 1ZXQA 3DRQB 3U9PH 5CAYB 3ZTNL 4KWUA 2V9RA 4GAJH 4KVNH 2A1WH 1INEL 3LZFL 1MHHB 3S6CA 4FQJL 3WXWL 1HKLH 1J0JA 1ZTXL 5CUSL 3BPLC 4OI7A 4OGZA 2AEPH 4UU9A 2GCYB 1TLKA 3IFLH 3QIBA 4KJWD 2P46B 5AG8A 3EDKA 2K7PA 3MSPA 2MCPL 3GI9L 3LIZL 3QA3A 1OSZA 2H8PB 4JREB 2GY5A 3OJDB 4JRYA 3V6ZA 3IDMA 3STLB 3JVGC 1MEXL 4PRNA 4CVXA 1RZ7L 1IEHA 2BVOA 2O26U 3VXTB 4U3CA 3QXAB 4TUJB 3IRPX 4DZ8A 4BQ6A 2FB4L 3EO9H 5F9JB 4HAGA 4MAUL 8FABB 1CVRA 1AXSA 1FJ1A 2EDXA 2JELL 5GQBA 3RKDC 1QR1A 1CE1L 1ZT1B 2XTJC 2GYSA 1T20A 2DYPD 3H9HB 1N5AA 3PIQB 5LCVL 2EDNA 3BN3B 1MF2L 2DYPB 3FQUB 5C0DA 5F93C 4AY0A 2QHLA 4Y89A 4EDXA 3EBAA 2WINB 2AV7B 4WUUA 1W0VB 3VJ6A 2GJ6B 1IAIL 3OSKA 1AP2A 4HGKC 3WD5H 5JHLH 1U58A 4WDIB 1UGNA 3R4DA 1X5YA 3QUXB 3TO2A 3MUZ1 4G9FA 1CE1H 4HUWA 1G6RB 3NFSH 4KDTC 1CICA 1QD0A 5CP3H 1PVHA 2W9EL 2PW2A 3BDBA 1BJ1J 4HUXB 1DUZB 1S9VA 3IVKA 4WHCA 4PJ7A 3W9DA 1P4BL 4F9LA 1AE6H 1DEDA 3O2DL 2E3VA 5BZWB 3BD3A 4YHZL 2NY4D 4MSWB 1SYSA 1LDSA 2NZ9C 2QADC 4HWEL 1B6UA 2HTKC 3IETB 1YNLL 2ZUSA 4XNZB 1NGPH 3CZJA 4RGOL 2ICWI 2BXYA 2RJMA 3A6BL 1M71B 4BZ1L 3D0VB 1NC4B 4D9LH 2OK0L 1I9EA 5CIPH 3SE9H 2AERT 3DI3B 4YBHA 1EVUA 3MXVL 1UB5A 4K8RD 5KSUA 2N7AA 1DBMH 3GM8A 4ALAH 5EU3B 4IIQA 3D25B 1BD2E 3ULVH 2VLMD 5BRZD 1MLCB 3DVGA 2VQ1A 4LLAA 1MIEL 3BZEA 4RIRB 1A3LL 1HILA 1A6PA 4M3JA 1J1XH 5I66A 3C5ZD 5T1MA 4UV7H 1V3LA 1Q9OA 2ICWJ 4QHKJ 1FDLH 3UEZA 1AGFA 3GSRA 1FFOB 4LCWE 2QLVB 4NHCH 4S1SH 1BBDH 3G08B 2VLLB 3FONB 1UM6H 5DMGD 4YBQC 2FSEA 4OI9A 3CK0H 4GSDH 5EOCL 3BI9X 1PYWA 5AD0B 2EEAA 3D39A 5IB1B 3KS0H 5IEKA 3WHE1 5T3ZH 5IVXB 3QH3B 3LPFA 1KJMB 1G7MB 2J5LC 1U3YA 3ARBA 1QEWA 1ZLSH 3ILPA 2AJ3A 1FNGB 4OUUB 2MHAA 1IEAB 1WCBB 3I9GL 1FLRH 4GXUN 4JDVA 3WJJA 3MRKA 2FBJH 4JVPA 3B6SA 4PJ7E 1CFSB 3LVEA 1NBQA 3HMXL 2I5YL 5ILTH 3C8KB 2ZWLT 4XNMB 4HX1B 3EYUL 5ERWA 2LQRA 1YNKH 5FM5M 3IDIA 3OAZH 3U79A 4TNVF 1OAYL 2MCPH 1TPXC 4NCDA 3TM6A 3RWIB 2DQHL 5GS0L 5CEXB 4P46B 1Z2KA 3SN6N 2WWKT 3DRTB 4NKOA 3ULUH 1HIMH 1ZK9A 3EGSA 3CXHK 4Z7NF 2FR4A 2GFBB 5T1DL 1R3KA 3WIFA 2F5AH 1YEFH 2GEEA 5E6YA 1FO0H 3VWJD 2R69L 3B43A 1XF4A 1RZJL 1YEJL 5EU6E 5DJ6B 5AAWA 3Q2CA 4QRQA 2VXVH 5TGBB 5I74C 5DMYA 3VD3A 3BX7C 1NLBH 4E0RB 1ZHLB 1SQ2N 4YGAB 5IW3A 3OKEB 1I7TB 3P4LA 4YHIA 2ED9A 1A8JH 4O2CB 4X4XB 4MQXD 4ZTPL 1FBIL 5IB1A 3ISWA 2PKDA 4R90L 2P5ED 4PRDB 1S7VA 1TQCB 4XVTL 4WCYH 5FHAL 5D2LA 4JFPA 2ZKHL 4HCRH 3LRSB 5F9JA 4OZIE 1CDYA 1TTGA 3U2SB 2PUQT 3QWOA 5I73C 4LLDA 1JWMB 3V6FA 4NKMA 2OTUA 3D5OF 4G43A 1WIOA 4PP2B 4TRPL 1QA9B 3PDOA 1EUUA 4L8SB 3GMNA 1TQBC 3DX6B 4WTXA 4OZ4A 3V6BR 5IMOA 1JWUB 5D7LB 3SGDH 2R29L 1RVFH 5TQ0H 3JBG7 4LSTL 3U4EA 5GGVL 5DVOA 4ZQKA 1I7RB 4QHKI 3QEHA 5KTEL 5IJKA 3OJDA 5DJZB 1HCFX 4BQBA 3GSNB 3VRJA 3C60C 4NQEA 3TA3A 4HXAL 2OSLA 1Z0MA 5FO7B 3FB6A 3IT8D 3VXTA 1MQ8A 4FQCH 4POZC 4LNRB 1FH5L 2NTFA 3LS5H 3OAYK 4JFYA 4ZNCD 4X6EA 5B3JE 2B1HL 3KXFA 2HP4A 2VLRE 4YDIL 5JPMA 4XCCH 2GTZA 5CIPA 4KTDL 1WC7B 3LB6C 3EUUA 3PWPB 1D3CA 4AT6A 5CZVL 3IU3B 3O0RL 3ULUC 4MS8D 2BVQA 4U6XA 1HINL 2YEZB 4PY7B 4WU7B 1I1YB 4W68A 1J9CT 2AJSL 2OR9H 1A14L 3QG7H 4Z7VF 5D96C 3MJGX 4NQCD 1FRGL 2FX8H 1CL7I 2FLBT 1C16B 2FIRT 5HYSG 2DN7A 2NY1D 2DD8L 2R8SH 3LKOB 3B5TA 3MCKB 4HFWB 3QWRD 5EO9A 1MAJA 1TIUA 4QWWC 4P9HC