4GAFB

Crystal structure of ebi-005, a chimera of human il-1beta and il-1ra, bound to human interleukin-1 receptor type 1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
310
structure length
306
Chain Sequence
DKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords EBI-005
publication title Design of a superior cytokine antagonist for topical ophthalmic use.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 306
sequence length 310
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13895 Ig_2 Immunoglobulin domain
B PF18452 Ig_6 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gafB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gafB03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gafB01
3HR5A 2ZCHH 3MLXH 4DJMA 1WCQA 5AD0B 2A83B 3TPUA 3CX5J 1JCKA 4Y5XC 3TIDA 1HCFX 1TQCB 3WIFB 5LGHL 4I18A 3DX6B 3ARFB 1DBKH 3VD7A 4XH2A 4K8RD 3M8OH 4PJ7A 4XNZB 5I66A 5T3ZL 2APTA 5TDPB 1QRNB 1HSAB 4TTDD 2XQBH 4HKJB 3ARGA 4NO2B 4GMSH 1OB1A 5DJCB 3AU1A 5FYJH 2E7LC 2EKSB 5TQ2H 1YEIL 2J8UA 4XMKL 3OB8A 5IVXA 4HIXH 4PJBA 2FEDD 5D72L 3PHOB 4H1LH 2VMFA 4TVPH 1ZLWK 1CFQA 3K4AA 2QSVA 2VDNH 1JPSL 4BFBD 5I17A 4BSWA 5EO9B 5TE7L 1GH7A 3SPVA 1GRWA 1JHTA 3MGTA 1LP9A 3UZVB 1PDKA 3ZSSA 4JO3H 2VDPH 4YDJA 1G84A 5KSBF 3UTQA 1W2KT 4YXLL 3R8QA 1XFPA 4XPGL 4F7TB 4KAQH 3OKMB 1X5HA 4OBSA 5GSVA 2X4OA 4LLQA 1F6LL 5AEAA 4MMZC 3QG7H 2HFGH 1KJMB 4OFPA 4FQXC 4GRLC 5E7BA 2C1OB 3BQUD 3ET9F 2FYYB 3HC3L 3O4LD 3VH8A 3QUKA 3DSFL 4JFFB 3P4OA 2VQ1B 2VKXA 3EYQC 1KB9K 2VDQH 2I9LB 1KCLA 4MA1B 5D5MF 2Z35A 3KPSE 1G9MC 3GGWB 1LQSR 3MRCA 4HPYL 1VCAA 2DQGH 1T2JA 4GRWF 3L5WA 4ELKA 3FO1B 3EIFA 1OAUH 3FQWB 1U3HC 4Z7UE 1UH3A 2B1AH 1RURL 4KY1L 4KRPB 5AAWA 7FABL 3DOSA 2C7UA 1KJ3H 1T1YB 5GS0C 2A74B 4Y0GA 3VFNB 1T83C 3QPXH 2X4PA 1P7KA 3QJFA 2IH3B 5KSUA 1MFDH 1UB6A 2QADB 4MXWH 5MHSD 3JZ7A 3I02B 3W0WA 2W9EL 4KI5D 1I1CA 3S36H 5IFAH 2UY7A 3KYKL 2VNCA 5KSAC 1LDPH 3H2WA 1NDGB 4DGYL 1P84K 5FYJD 5T1DL 1UADC 2DBLL 4QXWA 3RWFB 3O6LL 1R5IA 1DQDL 1EMTL 1VHPA 4OCRL 2LABA 5BV7H 5IMLB 4TVPD 2I60L 4N0FA 4U33A 5DRXA 2VDKH 8CGTA 4L9LC 4Y2DB 3F12A 4LKXA 4JJ5A 4IRSB 3EYUL 1DP0A 2XPGA 5DC9B 1W0VB 4G8EB 4Z77A 4M6NH 1FG9C 4U1NB 5FKAB 4WO4B 1NLBL 4LF3A 1U8JA 5C3LD 3HHRB 3AS2A 1M71A 2FGZA 2XA8H 3OL2A 3CSBA 4JY6A 1CICC 1KEGH 2EIZA 2P8MA 3T77B 2FL5A 5ESAA 2I25N 1ZT4A 1LE5B 1X5YA 5E0QA 5GGTL 2IPUK 1XZ0A 2VABA 3RWDA 2Y6SD 2WWKO 1IAII 3DI3B 5CEZE 1IGIL 3H3BC 1XAUA 3QHZL 1UEYA 3HCVB 2KPNA 2YD1A 5HYQB 5HHVH 1E4XL 4G42B 1HOCA 3WN5B 4HJGB 4OZFA 5BJTA 2VXVH 3BRFA 2C1PA 1QQDA 1J0KA 4M7JL 4POZC 4DN4L 2JJWA 1XGUB 5SWZE 4ZOAA 1L0QA 2BP3A 3GMRB 4PY7B 4Y5XB 3N85H 1EEZB 3FOLB 5EORL 1IGML 4Y7MA 2HJKB 4RA3A 4OLWL 2QR0B 1FNSL 1NKOA 1MREH 1O5DT 3T04D 1QP1A 1LO3H 4PJEB 4UUJA 1MAKA 1W0WB 4Z0XB 5I1KH 1REIA 5I1DA 4YHKL 3QDJD 3PNWA 3K3QA 5B3JE 3X12A 4CW1A 3TZVA 4OCWL 1DBJL 3MACH 4NQEB 2Q8BH 3C5SA 4BFEA 3RL1A 5JA9A 2IGFH 4KK9C 1IZJA 4QYOA 1CXIA 1PW3A 4PJ9D 4HBCH 3OX8A 2VB5A 2AJYH 1SVZA 3ARDA 5IBUB 3U9UA 2XWTA 4NJAL 2WWMC 4BZ2L 5EZJB 1FL3A 3WXVH 3WJJC 3J7HA 1VPOH 1F11B 1JV5A 2WINA 2GJZA 1K3ZA 4GG6E 2FO1A 4QRUB 3TO2A 2NY4B 1IKFL 2RHEA 2ICCA 4DKEL 1OAXH 2XNAB 2FD6H 4S11A 5F1IB 4NUJA 3IB4A 4PRHE 2IF7A 4FQXB 4GRLB 1RUPL 1JGVH 4I1NB 2OJEA 2BSRA 4ZAKC 5AUMA 3F7VA 1FO0A 5F7LB 2O61A 5CILH 2NXYC 4XCNB 3BAEH 1HSBB 5JXAH 1CGWA 3T65B 3MNVA 4AM0A 2N1KA 3RL2A 4KJYA 2JIXB 4O2CB 3OJVC 5EWIH 1H0DB 3X13B 3MLVH 3H3PL 1U8MB 3F7RA 3D0VB 1Z9LA 4N9GA 5J6GB 5KTEL 3GHBL 3C6LB 3KXFA 4KWUA 4P4KB 1U3HB 4LBEB 2X4SA 4WU5B 1A7QL 1NJ9A 4FZEH 4YO0A 1LK3L 1QFUL 3BJLA 4UINH 1JTOA 5D71L 2PYEE 4F8TA 2YD4A 5D7SH 4ZSOA 1FFOA 2FH8A 4G80B 3SE9L 1T5WA 4QY8B 1OF2A 1FV1B 2D31B 3F58H 3FO0L 1ULVA 1KCRH 5GGUB 5FECA 1NMCB 2VUOA 3D9AH 4M5ZH 2MKWA 2IH1A 3NN8B 3LQZB 2YZ1A 3UYRL 2YZ8A 3TESA 3MLRH 3B5HA 3H7BA 4GMTL 1QFWI 2WM0A 2CKBA 3H42H 4P9ML 4PTUA 3WSQH 4WUUA 3JV4B 4ZPVB 4ZD3H 1T21A 5HYEA 1ACZA 4X6EB 1TVBB 4FHBD 4F57H 5I15L 4FQHA 2BOBB 3BPNC 1MAMH 2AJXL 5E6IB 2GT9A 4PG9A 5DMYA 1F4XH 2ZPKL 5J4MA 2I24N 4JQVC 4NPYA 1GHFH 2HT3C 2OQJA 1S9XA 3MGAA 3NCEB 4M61A 4K71C 3V4VL 3IU4H 3IAQA 4PRHA 3IDMB 4APQA 3PWNB 1IGFH 4Y4HD 4YEFA 4GAJH 5CFHA 1HHJA 2CXKA 4V2CB 3NBNA 1XR8A 5JMRA 4KVNL 4J4PD 4E5XA 4WI5A 1DR9A 3VJ6A 4L3AA 3QUXC 1WWCA 2DLFL 5HHMD 3UYPA 5ISZD 4OD1L 4P2QE 5EOTA 1KTDA 2LU4A 4OCSH 3B2VL 4HUMB 5C6PB 4HFWA 1BFVH 2BY2A 1K5NB 4KI5F 1P5VA 5TE4L 1W72L 4MJ2A 4CDHA 2ORBL 1V7MH 5ICZB 3OKKB 2PTTA 3F65A 1ZLVK 1KUMA 4Q9QL 2F5AH 1D3CA 5C07A 3EYSL 2VXQL 3VFRA 5FF6A 2WBWB 4FXLA 1XF3A 5F96H 3DXAE 4YX2L 2Q86A 2QQKH 1MHCB 4MA8L 4X98A 3FQTA 2G60H 3EDDA 3BGFC 3VXNA 4GSDH 3CUPB 4JPVL 1UCBH 1DN0A 2EDXA 4C83B 3WS6A 3O3AA 1VA9A 4HLJA 3EJZC 3F7YA 1MQKL 2IANE 2QQLH 2C3HA 5IEKB 3AREB 1QVOA 3FQXA 2VDLH 3MLUL 1J86A 3DJ9A 1MHHB 2Z93B 4AYFA 4HWBH 2UVFA 4L5FL 4NFDA 4B50A 3IFOB 5JPMA 2CJUL 5J6HB 4R4FL 3GNMH 1NEUA 1Z9SA 5DTFB 2J4WL 3TV3H 4KZDL 3KPMA 4K94H 3IETA 3G6JE 2X1QA 3VRJB 1S9WA 2ITCA 1MHEA 5HI3D 2Z91A 3BIKB 3S35L 3E6HA 2NZIA 3GBNH 1HQ4B 5CBAB 1U58A 4RMRA 2YS4A 5BZWA 3B6SB 3KVQA 3UJTH 4FTVD 1U6AH 3LN5A 4ZAKB 1AP2A 3UP1A 1RUQH 1ZGLP 3VXSE 4OKDA 1E4KC 2BY0A 4MJ6B 2NXYB 4LPTA 5D1ZD 3U0PA 2COQA 2IAMC 3T1FA 32C2A 3VA2C 3O2VL 1XGRA 4JHAL 1T80A 5DI8B 4YHLL 5ADPH 4OB5H 4M8VA 5T3XE 4MHHI 4EDXB 4G3YL 1OWRM 2NY5C 2AGJL 1YJDL 3ZZ1A 4RWHA 1BMGA 4JDTH 4QXTB 1DTUA 5J7CC 3QH3A 4KKLD 2YD7A 3VXRB 2DN7A 1CVRA 4ODWB 2WIIA 3QUYA 2LQRA 3LS5H 3R8BB 5ELIA 1A6UH 1YNLL 3VFUB 3MRGB 2HVJB 3U0TA 4HKZA 4ZTPL 1G9NC 1NSNH 3DO3A 4TNWK 4TVSa 4K7PH 1IC4L 3CSYA 3BSZL 5FEBA 2R8SL 2W9DL 3U79A 2ERJC 1RZ8B 4RFEB 3H7LA 5F7NC 2D0HA 2VZSA 2EDLA 5DUMH 5FGRA 4KROC 1IL1A 3VD9A 4WI3A 3FFCD 2IANA 5T5FL 4WHYG 3X14B 5D7LB 5JPNA 3RBSA 5E08L 4O00A 3QUZA 1S5HB 3L9RA 3LN4A 1MIEH 4KTYA 1P4LA 2HG5A 4XHQA 4ODVH 1HHKB 4TSCL 1FL5B 1YMMB 4RZCB 1I9IH 1Q9WA 1DL7L 4EI6B 3J8F7 2BNRA 2GJ6D 4TTGA 3FN0L 2RBLA 3RKDD 5KJRL 2CDEB 3SDDD 3VXTA 4K71B 2NY1C 1QHOA 3DSNA 2OX5A 2JJVA 4JR9L 2ADJB 3C8DA 3LKNB 1V5JA 1H8NA 2ICWI 3CXHJ 4LVOC 3W39A 2OJZL 3QIBD 4GKZA 3FCTA 4B7LA 3RDTC 12E8L 2A1WH 2GFBA 5KOVC 1IT9H 3QUXB 1T1XB 1QFWL 3ULUL 4OUUB 3S3JA 4U6VH 1XGPB 5INDB 1G1CA 3QEGL 3A6CL 4GKNA 5ETUB 4NFCA 2VL5A 4JJHA 5FHAL 1ZHLB 3BEVB 1FHGA 1PVHA 1G7IB 3O3EA 4G6KL 1GAFH 1QHPA 5D1QA 3KPRD 2NX5D 3MRRB 1DE4B 3KYNB 5DZLA 1ZEAH 4WDIA 3U9PH 3EOYG 3UMTA 3V5HB 4PJDE 1IM9B 4FG6D 5JO5A 2CKNA 1M4KA 3SJVD 3TA3D 1DUZB 4GG8A 3TIEA 1QNZH 1FVDB 2F53D 5IFHH 2IWGA 5IB3B 3X3FH 2JCCE 1CG9A 1JRHI 2DTMH 3R06A 1MNUH 4PJ5D 4M7LT 3VWJD 1MJ7L 3HZVA 4UQ3B 1MCKA 2BSSB 3QCUH 2W0FB 3TVMA 1P1ZA 4OD2B 3HUJE 5HDLA 4NQCE 4LAQH 1P4IH 2AK1H 3VRIB 5DEGB 2WBJB 3JV0A 3KS0H 1CLZL 5DQDL 5E1AB 3P0YH 1YECH 3TT1H 1RV6X 2E9WA 2GHWB 3M17A 1I8MB 2X7LA 3B83A 3TLRA 2N7AA 3O9WA 2Q76B 3TBSA 3IT8D 5IOPA 3QWOB 2AV7A 5LAXB 1MIMH 2P5WD 2EXYD 2XKUA 4WUKH 5EZLA 5D6DC 3BUTA 3KJ4C 5FUZH 1MI5D 1IC7H 3FT2A 1RHFA 1FDLH 1DQTA 5CGMA 3PP3K 5F89A 4QF1B 5ID0B 3D3VE 4Z95H 2GCYB 4YZFE 3GDBA 4Z7WF 3DV4A 5C0RH 4LCUA 2HT4C 3LQAL 3SOBH 1YNKL 2YPLD 3WS3A 3MOBH 1UM6L 2EH8L 4MB5A 8FABB 4WTZA 4RDQF 3VXUE 3OZ9H 1A3RL 4KTEL 4M1DL 4OLXL 5EBWA 2V2TA 1BQSA 2NY3B 3BH8B 3TJHD 4ZQKA 4AEHH 1UM5H 1IKNC 4XPAH 5L6YL 3B2UD 2GJJA 4MZ3A 4Y5YC 1SJXA 1JUFB 2VDOH 4AIZA 2V2WB 5HYSA 1P6FA 5FB8B 1G6RL 3ARFD 1YY9C 1N6VA 2ZCKL 1QSEE 4KDWA 1PGRB 3STLB 4LSUH 4NCDA 5I1AB 3SKUD 2YUWA 5FFLA 5JR1H 2HH0L 2VLJE 3OGCB 4UQ2B 4D0BA 3I6KB 4JFYA 3B43A 2DJSA 3L1OL 3S5LA 3QI9A 3L3GA 5HDOA 3RX5A 1R5WB 3PL6D 2IC2A 2NR6C 1IEAA 5C0BA 3K7UA 2Z8WC 4URTB 3GMLA 5L2KB 2DQIL 1BEYH 2MJWA 3PP4L 2VLKD 1DSFL 1YEFL 4YHYB 5IHUL 4LPWA 5J13C 3KYOA 2WP3T 1P4BL 3BPLB 4TULL 3RWGA 3GSRB 4RWYL 2QQQA 1AD0B 3SE3C 5F7HA 5C2BL 3IYLW 3NAAH 1GGCH 1YEDB 3W2DH 2VQTA 5TF0A 3U7WH 3V6BR 2WAHA 4UNTA 1XGYL 4I2XB 2DIJA 3F8UB 5CJXA 1DQQA 4GUPA 4KUZL 1R3HA 2MQCA 1S9VA 4RNRA 1QFPA 3MRLB 2QKIB 4HXAL 4RAHA 1GGIH 2EO1A 4IRJA 1KPRB 4LK4A 4F3FB 4L8CA 1NFDB 4HKBA 4XCCL 4LHUA 4NFBA 5KSBE 4QRSA 3QIWA 3STZA 1CD1A 5KBNC 5DD6B 4EVNB 4NGHL 1CS6A 1ZVYA 2FX7L 1WICA 4JFEB 3RWIB 2J8HA 3B8SA 3EJJX 2HFEB 4UAOC 3QQ3A 4ZS7H 2H2PC 4I18C 3O6FC 3V6OE 4P2OD 4WFHE 1CVSC 3QBTB 4UTBL 3BEWB 4RISL 3RNQB 1QTYT 3BFOA 3ARGC 5ID1B 3DYOA 4FQ2L 3PABA 1GIGH 4JVUA 4K2UL 2IMMA 3U6RB 5EOCL 4PB0H 4JM2D 3D2UA 2PXYD 1I8KA 2UYLA 5D5ME 1QSEA 1J8HE 4NM8L 2QADD 5K9OB 3P9MA 1VGEL 2D4DA 4GRWE 1JPGA 3D18B 3CFDA 1H3XA 2NLJA 2R9HC 2XTJE 1G7HB 1FCGA 5K59F 3I2CL 2V17H 2G2RB 2BNUB 4QRPB 5DC4B 2HVKB 3O2DA 4NZUL 4UOW0 5B4MD 4NYLA 5CUSH 5EU6A 1S5IH 4G6JH 3RAJH 3NA4A 5BRZB 4LLMA 1UVQA 4IRSD 4WNQB 1MWAL 2BDNH 4E41E 5SX4I 5F88A 3CLFL 1KLUB 2ADGA 4KHXH 4QO1A 4Y4FA 4JPWL 1XR9B 3BMVA 4XP1L 1X3DA 4NQXA 2BK8A 4ODUB 4JCLA 1E27A 5GJTL 1M7IB 1WITA 3SGDI 3WIHA 4IDJL 2YOCA 4RMVA 3REWA 5EUKB 1BF8A 2DMCA 3I3BA 3FMGL 3CCHB 5DRNA 3U1SH 4NKMB 1B4JH 2VIRA 3ES6B 5KN5A 1RUKL 3GB7B 5CGYC 4ZUUA 3SDXB 4LPXA 2D03H 3SKOB 4OSUH 4OD3H 2P45B 2BNQE 3L5JA 1ZMYA 2O5YH 5HHOE 3GUTA 4OJFH 4PJFF 2NTFA 3GJFH 1CF8L 3NCCB 4I0CC 5C0CE 2PR4L 1BAFL 4Y5YB 2RB8A 2XN9A 5H2BB 3V9FA 4PIRF 5FXCH 1NC2A 4U1HA 2V2XA 5CINL 3W5NA 4OF0A 4H88H 5L8LB 4YBQC 1KEMH 1TJGL 5C7XL 1U93B 5BZDB 1D9KA 4X7FC 1DDHB 3MRBB 2HFFA 4Y16B 3SCMA 5F72S 3H9SB 3REVA 2ZSWA 1PKQE 5IW6B 5JHDE 3S34L 2BVOB 4ZFOL 3BXNB 4IOIB 3H0TB 4QOKB 1HINH 4JFDB 3BPCB 2AJUL 3QXVA 1OP5K 3EYFB 1FP5A 4OQTA 3KPOB 3IRZA 5TPWL 3D39A 3MLSH 4OIIL 3FTGB 4LU5H 3GSXB 3QFJA 2RAMA 4ODHH 2ZOKB 1T2QH 3VFVA 4LSVH 3EO0A 4FQXD 4GRLD 3VG0H 2FB4L 1C08A 5DUPH 1V3MA 3WFDL 4NT6A 1I3RA 4PJHF 1H3GA 1OAZL 3ILPA 4AK1A 1CGXA 3QHTC 3DMMB 3EYQD 4S10A 3NFPA 2E27L 2JIXD 1D6EB 3BYYA 2AQ3A 5CGTA 5DT1L 3TPUB 4LKCB 1Q9KB 1ACYH 1X7QB 2OXGA 5B21A 4I18B 1S7UB 4QGTA 4A2MA 3O6FB 3S98A 4O5LL 3RWJA 5IJVB 4NRYA 4FQ1L 1NCDH 2FX8H 2VLRA 4PJ7B 5E2VL 5F7DB 5I66B 5BQ7A 1GC1C 1RU9L 3UPCA 1U3HD 1MCQA 3M1BA 3GJFK 3IDXH 3ARGB 3JV6A 3SE4A 1OT2A 4JVWA 4I3SH 5H94B 3O3BB 1IGTB 1GL4B 4TUKL 1EJ6A 1KENL 3IDIA 5D2NB 5GS0D 3TZVC 1OPGH 4H8WL 4PJBB 5E7FA 2YA0A 1OD9A 1CFQB 1PLGH 1J1XL 3UO1H 4H5SA 3ZKXC 3HMWL 1VKXA 4PY8J 4WHYH 4C57C 3SPVB 1JHTB 1AGDA 3MJ7A 1CXLA 3RTQB 5KSAD 4NO3B 2NXZC 2LE9A 3D6GA 4IMKA 1PZ5B 3SDAB 1JZ6A 4ZFGL 2P8LB 1TQBB 3WE6A 5EZIL 3O41B 5ALCL 4PP1C 3WHE0 4YFDB 5GSVB 5JHDA 4LLQB 1ZHBA 4MD5B 2VN4A 3GSVA 2I9TA 4W6XB 3A67L 2QSCL 4HZLB 3OTTA 3C5ZA 3OG4B 2AAVA 1J5OH 4WHTB 3MBEB 4HGWB 4DZBB 5INCA 4MAUH 3GI8L 4GQPH 5I8EA 2AK4B 4YUEH 1CICD 3P9LB 5E8OA 4HIIA 4XCYA 3MFFB 1ZAGA 1D5XA 5GRJL 4EOWL 3HRZB 3WLBA 4OZHB 3LSOB 3M07A 1GGUA 4N8CH 4V1DA 1JWMA 3O4LE 2A9NL 1SBSL 2EC9U 5HI5C 5HYJA 2VISB 1G9ML 4X6CF 2W0PA 3BD3A 4JM2F 3GKZA 3SDCA 2MPAH 1AJ7L 4JB9L 3EHBC 3FL7A 4C4KT 4LGPB 5CD3B 4POZD 5JW3H 2XFXA 2JE8A 2X4PB 4P2RB 3BN9C 1P7KB 4JFOB 5DDHB 3V0WH 5KSUB 1PD6A 2DYPB 3RVWC 1MAJA 3W0WB 4UNVA 2VDRH 4YFEA 2Q3AA 5DF0A 5F9DC 1RZKC 1DUYA 4MNQB 3UAJC 3NIFF 3VXPA 2R4RL 5H37H 3RGHA 4P3CH 3MJ9L 3U4EB 1KPUA 4CAGA 4ZUVA 1N5YH 1QZ1A 5MHSE 3NZHL 3KLHC 3L3HB 2UUDH 4KI5E 2NY6C 2D3VA 4RAUA 2QHRH 4MNGE 4OFDA 1CT8B 4TOYH 5I2IA 1U0QA 5GJSL 5FYJE 4A6YB 4F8QA 1I7ZB 4L1HA 1TNNA 1DBBL 1K4DB 4PUBH 2DL2A 2HT2C 5LQBH 5CEYA 5ILTH 4TVPE 2WWMD 3DRTA 5LBSL 5CLWA 1JYVA 3BH9A 4K3EH 3BUYB 2EIZB 2B2XL 2WUCL 1B6DA 1SBBA 3I50L 4APQC 5FCUH 1ZT4B 2ESVA 4KRNA 1OAYH 3NCYS 4UI2A 1XZ0B 4HUVA 4JRWA 1L7TH 4YH6A 1NBYA 1BIHA 4F7MA 3VH8G 2PO6A 4Y1AB 4Q9RH 3GSUA 3ZE1F 4XC3L 5F6HJ 4ZAKD 1IM3B 4UILH 3WEXA 1V7NH 3I9GL 5HGBB 3WDIA 4EDWL 43C9B 2NXYD 3LEVH 2C1PB 4ZXBA 1LVEA 3GMOB 5D1XB 4PB9H 2A38A 1T22A 5DJ0B 3TBWB 1CTNA 2QHLA 2C26A 4I0PA 5GGTA 3WUZA 2WUBL 1WBYA 3C60B 1KIQA 1QLEL 2UWEA 5JIHA 4TUOA 1KF9B 4H20H 1JYWA 4F9PC 4HWEL 4PJEF 2ICEB 4Y19D 5DJ8A 1J0YA 5D6CB 5TDOA 4NN6C 4G8GB 4HMCA 4S1DC 3TGXA 1HE7A 5I1DB 2FATL 1INDL 3R1GL 4MGXA 3PNWB 1BFOB 1A6WL 4F15C 4BFGA 4Y5VA 1DEDA 3VE0B 1CE1L 4D0DA 5E70A 1SM3L 4TUJB 3RL1B 1A8JH 1PQZB 1WBZA 2YPKA 1EAPB 3ZKXB 2CDFB 4ERSL 4N68A 4QYOB 4YQXL 3OX8B 3QDJE 4JHBA 2HJFB 4ODBD 5C0EA 2D9CA 2UUDK 2NXZB 1L7IL 3QYCA 5D7LD 5DD5L 5A2KH 1RMFL 5FYJU 2FDBP 3HFMH 4M6AA 3MRHA 4K7FA 4XP4H 1TJHL 4XCEA 4F7CA 3QEQB 4LIQL 3TO2B 4HMDA 5LWYH 4UT6L 1V3LA 5IESL 3Q6GL 4LCYB 3IFNH 4NUJB 3GMQA 5C0IB 1C1EH 3ZDZF 2BSRB 3G5ZB 4LGRB 3LPWA 5C0GA 5AUMB 1NAML 1G0DA 1FL6A 1KSRA 1QSFD 3FQRA 4JEGB 4OZ4A 1I3GL 4ZS6C 1QBMH 2A73A 1S7WB 1F5WA 1BZ9B 3RL2B 4PRPD 1BBDH 4TRPH 3UZEA 5CLTA 1MLCA 5I30L 3ZDXF 3BRDA 4NJ9L 4E42B 1H3VA 2DWDB 4PGBB 4FQCH 2PYFA 2APBA 4OM0L 4LCWA 2NY5H 2DQCH 5ITBH 3QUXD 2X4SB 1MRDH 1ZLUK 3RWCA 2Y36H 4PJXB 3QUYC 4PGEA 1I4FA 1N0LA 3WLWC 4GKSA 4HFUL 3IDNB 3W11C 4FS0A 5FGSA 5JW4N 1T5WB 5DJ6B 3V52H 3SEPA 3TYGL 3PV7A 1D6VH 1T7VA 4OZGF 1OCWL 4N0UB 1XF5B 1GZPA 1K8DB 1KJVA 1DBKL 4O51B 3HZYA 2DQHH 5L8KB 5I9QC 4KTDL 1IM9D 2XQBL 4MWFB 4PTUB 5GS1B 4GXVL 3QUZC 3DETC 1GOHA 1T21B 5ANMA 1X5GA 4X0KA 3EJZD 2NY6B 3WKML 4HIXL 4ODSH 4Z9KB 1QPPA 3QWRD 4X4YA 2CK2A 3IFLH 4FMKA 3MRDA 1JF6A 3PWLA 2WLZA 1OY3B 1F90L 1P2CA 4GW5B 1S9XB 4QXGH 4Z8FL 3AS1A 1X5LA 4NWUL 4CVXB 3HNTL 4R7NA 3HMXH 4JO3L 1SY6L 3QIUB 1FG2A 3DROA 4P3DA 3RNKA 5IB4B 5I1LA 1OQXA 1IE5A 2PN5A 1A2YB 5CCKH 3FFDA 1XR8B 4GW1A 1UJTA 4E5XB 1NCWH 2MHAA 1OP3H 3VJ6B 1AY1H 2X4RA 4JRYA 3IJYB 4KMTH 2XZCH 1PSKH 4V2BA 5EOTB 1KTKE 3NFNA 1UQSA 3NZ8B 1OSZB 3VMOA 1KT2B 2IAMD 5JQ6L 2QEJA 2VDQL 2A6DA 5L9DH 1MFEH 1NMAL 4NRXA 1H3UA 5CKGA 2PTTB 3P0GB 4M1GH 4N1HB 5D1QC 3QO1A 1I8IB 5HHME 5ISZE 5C07B 3VFRB 4MCZB 4XBEH 4NN6B 3SGEH 3DGCR 2EO9A 4NKIL 4KJPC 4X98B 3FQTB 4XVSH 1AHWC 3HN3A 1MFAH 1T6VN 1VACA 1AQDB 3QXUA 4Q2ZB 1D5IH 2XYCA 3ARXA 3FB5B 4WFGD 3F7YB 3MOQA 1W72A 4KC3B 3OGOE 3QPXL 5KSVA 2DQUH 1QVOB 3FQXB 4MA3B 4Z7WE 5E03A 4WY7H 4CN4A 2NW2A 2EE6A 3KJ6L 1U8PA 1ZANL 3UPRA 1F4HA 4KROD 3CPLA 3KPPB 3TVMC 1EJOH 2CSPA 3ULVL 5LJYH 5EN2A 2RJMA 3UTPD 4AIOA 2GI7A 2H32A 3R4DA 3L3KA 4NBZB 4NQVA 3TNNB 4XBGA 4Z76B 5I1JH 4NQSB 3MJGX 5FV1L 2A6JA 1MRCL 3ARSA 3IXAB 4OCMC 5BZWB 2P44B 4OZIA 5T1LB 1K8IA 2XWBA 4DKAA 1AP2B 2EYRB 4X6DA 4ZNEE 4LLUB 4MDJA 2NY1D 3U0PB 3T1FB 2EE3A 2XA8L 4K3DL 3S97C 4Z7NF 1XGRB 2H26A 1Z9OA 5I0ZA 1VESA 2J88L 2QSTA 4FTVE 4LPVA 5CEXB 1IAIM 4Y4HA 5EU7E 3VRLF 2HFTA 1S78C 3RDTD 4CADB 1OLLA 4EIZC 2VWEC 5HHVL 3T2NH 1KG0B 1FE8L 1UG9A 1KNOA 1OGAA 3ESUF 3OPZL 3OF6D 4HS6A 4HKZB 4JFED 3QXAA 4QHLB 2X4NA 1QLFA 3AFLA 3CSYB 3JUZA 2KQMA 4JANA 1MCWW 4U05A 3U2SA 2Z92A 3O6ML 5BMFH 5HY9B 1QEWA 2OTUB 3CVIL 1A0QH 2ED7A 2XG5A 3VD5A 5AZ2H 4JHWL 2X1PA 4HUWA 5LGKA 1WBXA 1IL1B 1EHLH 4LP4A 2AXFB 3QI9C 3DGGA 4X5XA 3OV6A 3ZYZA 2WBKA 3SKMA 1KJ2H 4U6HA 1QKZL 1HEZB 1A4JB 1YPZA 2CUHA 3L9RB 3LN4B 5DD0H 3T2OA 1IBGL 2XZZA 1JHLL 2HG5B 5JUEL 1CGYA 4L4VD 4YHIA 2Q8BL 3DUUB 3EZ8A 3CDYA 1WT5A 1Q9WB 35C8L 1DBMH 1IEBB 1X6LA 3FFCE 3DARA 1DLHB 4AL8H 1JWSB 2AJYL 5KAQG 4MMXC 1MUJA 1IFHH 4KV5F 4EKXA 1IC5L 3SGKC 2X6MA 5CSGA 3HG1B 2EDOA 4PLKC 3ZYJA 2VXUL 2W60A 4JM4H 4RAVA 1LMKA 5CJXC 4WI6A 3AGVA 4ZFFA 5EUOA 3MCG1 1LO2H 2GJ6E 4AEIL 4PLJC 2JB5H 4ZNEA 3VI3F 5I1HH 1OAXL 4IRJC 2FECI 4GKZB 3FCTB 4DVRH 5K59E 4RFOH 3L5XL 3B9DA 3QCTH 5IG7B 4ISVA 2AS5M 1CFTB 1EXUA 2IFFH 2E9JA 5JXAL 4B0MM 4GKNB 2Q7NA 3PWJA 1MFCH 3C08L 3UCRA 5FYKD 1JWUA 1TZIB 4HT1L 3BP7A 5D1QB 2EH7H 4G8IA 2O5XH 2H2SC 4KFZC 4EBQH 2HT4D 1ZS8B 2DB8A 4O9HL 4WDIB 3P0VH 5JORA 1UYWH 4NUGL 5I76A 5JO5B 1AHWB 3HE7A 4FZEL 1I1YA 4JZJC 4NBYB 4UINL 2FIRT 2VZ3A 3T0EA 3GMMB 5D93C 4GG8B 3TIEB 4HK0A 3KPRE 2NX5E 3OKEA 1NUFA 4JDVB 4L4TD 5DO2C 1TENA 2MCPL 2P8PA 3ROOA 5MEQB 4P23B 1CWVA 4PV8A 1YY9D 5A2JH 2XKSA 1KCRL 4D9LL 4FQQB 1OQOA 4YHOL 1EFXA 4P59L 3SJVE 4GAGL 1E6JH 5HSFA 4BZYA 3TVMB 5EBMA 1QFWM 3MLRL 5K9QG 4PJFE 2F53E 5C0DA 4Z7OF 1INEL 2NR6D 2D7TH 3WSQL 1DQMH 1UB5A 5JW5B 4U1KB 5L88H 4PJ5E 3NCFB 4ZD3L 2WQ8A 3LKQA 1YMHA 4HEME 4MQSB 3M17B 3H9SD 4Z5RA 2X7LB 3T0XA 1INQB 3LHPH 4M62H 4Y4FC 3CH8A 4HPOH 5FUCE 2KZ1B 1QSZA 1MAML 4QOKD 2W38A 4HIEA 4D3CL 5EZLB 2YRZA 5E9DB 4XXDA 1Z3GL 3K81A 4HX1A 4FABH 4XVTL 1N5AB 4P46A 1MLBA 1U8IB 1S7TA 3L7FA 4OLVL 2P5WE 4GAJL 3U4AA 1VFUA 3DV4B 3QRGH 2B5IC 2D7QA 4D9RD 5GS2H 5I73C 1MI5E 1HDMA 5IVZA 3RX7A 2V2TB 1M1SA 5EBWB 5LXGL 5T1MA 3WIIH 1E4JA 2W1NA 3QIBA 4QRTB 3VFTA 5FGCB 5GRYA 1AGBA 1CXEA 1UWXH 2R69H 1S9YB 5HYSB 3TT3H 1BFVL 2A77H 2B4CC 3BZFA 2YSSB 2YPLE 4PJAB 3I6GA 3O6FD 5DD3L 1ROWA 3MODH 5BO1H 2FR4A 1FFQA 2PW1A 3ARGD 3SN6N 4PJHE 3KPRA 3S5LB 1KLGA 3QI9B 1D9KC 3WL9B 3U30C 5K9KB 1IEAB 3ROLA 3D85B 2W07A 3GMLB 5JNYB 4GW4A 3OXRB 3SCMC 4PP2A 4I13B 4AENA 1G6RA 1JF1B 3BD4A 2A9ML 3HI5H 1XF4A 3D69A 3ZL4H 2DMKA 4K23H 2R9HD 4XI5C 3FAWA 3LMJL 5I75C 4QRRA 1NPUA 2G5RA 1RZGA 3UTSA 3RWGB 2VE6A 1QOKA 1RZJL 3I75B 2GYSA 5L0QC 3QRFM 1A1OB 4S1QH 1RIVL 2VLKE 2BJMH 4YHPA 3TV3L 4WGVB 1S9VB 2XXCB 4NZTH 4MD0B 4U1MA 4X9GA 2DQFA 4Z7QF 3PGDA 4UDUA 3CX2A 2X4QA 5IMMA 1DZBA 3WXWH 2VAJA 2ZSVA 2VR4A 3BWUC 4L8CB 4F80A 4HKBB 4R8WH 4LHUB 3MV8A 4ZTOH 2AK4D 4OZFH 1CD1B 1UT9A 3STZB 3EDFA 1YEJH 1NFIB 5FUOH 1AI1L 3FRPA 3QQ3B 1J1OL 4WTZG 5FO8B 5GS2D 2XZQH 3C5JB 5ADPL 5DVMA 1ZA6B 3QHFH 3R0MA 4KKBC 1A1MA 4CU8A 1CBVL 4J8RA 5CGYD 1MH5B 2Z0BA 5DFWH 3ZKQD 4EN3A 1YDPA 3PABB 1GC1H 1CTOA 1U9KA 3ZDYF 5HYSG 1T20A 5L7XH 3D2UB 1R3IL 3KPLA 5LKNA 4LSDA 3LS5L 4KZEL 4JZJB 4FQLH 4P2RD 1FYTA 2ZZUT 4KGLA 4C54A 1A7RL 2E5EA 2ICES 3X3GL 3W0WD 3DBXA 4PJHA 5CBEA 3V7MA 4Q74A 2R1WB 3CFDB 3BKYH 2IQ9H 2EE9A 3FN3A 3FQNB 2DJ4A 3S5LG 5AD0A 1H3WM 1K6QL 5HHNB 1MPAH 3E8UH 4X6CE 2X41A 3BW9B 3DX6A 3MCLL 4IMKC 2CRZA 4YBQD 5C8JA 1QRNA 1HSAA 1CLYH 5IMOA 1F45A 1UA6H 4NO2A 4PJIA 1HXYB 2DIBA 3ABZA 1CFBA 2EKSA 4HH9B 5CJQH 3SE8H 4WW2A 1YEHH 3C5ZC 2G75A 2HWZH 2ICWA 5F88B 5L8JB 1I9JH 3CU1A 3RA7L 2ADIB 4WIQA 3NIFE 3LH2H 4EUPB 2RFXB 1K85A 1H3PH 4NQXB 4RFNC 5EO9A 4AQ1B 2D4FA 3ARBB 1R5VB 1T5XB 1FO0H 1PG7X 2W59A 2FIKB 4WFFD 5DMIH 2DLGA 3S3SA 3LZFH 4LCIL 5CEZH 4WCYH 4YE4H 4LVHC 4YWGL 2B0SL 5ENWB 4D0CA 1T66C 4F7TA 2PUQT 4LHUG 4CMHC 3OKMA 1MWAA 1RZ7L 5H35A 1OTUC 2GK0A 4MJIB 4LDLB 5KN5B 2B5IB 2Y07H 1OWWA 4ZUUB 1HHIB 1KJMA 3SDCC 3VGEA 5I73B 3ULSA 2C1OA 4S1RH 2DQDH 1PFCA 2FYYA 2KDGA 4LLYB 4JFFA 2XN9B 3V5KA 4U6VL 2AI0H 1FAKT 4XNYH 2BRRL 5HDQL 4JGJA 5I8CA 3CDGB 2I9LA 2EDYA 1B0GB 4ZUTA 2V2XB 3ZE1E 4OTXL 5DFVC 4JG0H 3GGWA 1CLOH 2DDQH 2R4SL 3HAEB 1RZKH 3FO1A 1ZEAL 2AEIT 3FQWA 3N9GL 1D9KB 4M48H 3U30B 2VDMH 2CKBH 3TZVD 4G7YH 1GGYA 1TJIH 2HFFB 4JY4B 2A74A 3VFNA 4E0RA 1QNZL 4JO4L 5IFHL 4PJEE 3U4BH 1PY9A 2IH3A 3X3FL 1DANU 3IFPB 4YNYB 4KK8C 3I02A 4A6YL 2E6PA 3BGAA 1NDGA 5L0QB 3QFJB 4PP1D 2W0LA 2KZWA 3RWFA 3PQYA 1P4IL 5AWNL 2AK1L 2BXZA 2LVCA 4EZMA 1OM3L 4Z7VF 1D7FA 1TZHB 3TBYB 1FNEB 5IMLA 1RI8A 2PO6C 1YECL 3TT1L 3DPBA 1F58L 4CNIB 3FONA 3OKLB 4Y2DA 1C08B 1CK0L 1WFUA 1WZ1H 2IADA 4NT6B 4ZFOA 3ETBF 5GIRA 1I3RB 3B3IA 5CJBA 1MIML 2G9HA 2ZKHH 3UC0H 1MEXH 1N6QH 1VEPA 4NHCL 4U1NA 5FKAA 3NFPB 4WO4A 3RWEB 3SKJL 5C6TL 3W9DA 4CMMA 2EDWA 2Y7QA 4I0PC 1HH9B 4PJ7F 3T77A 3WFBH 4N0YL 3CFJB 5TF1H 3SKNB 2WZPD 3RWJB 3WO4C 2VLRB 5IBTL 1Q38A 5BQ7B 3ZDZE 3KXFD 5HI5D 2D7PA 4GAFB 4WHCA 5HYIA 3BZEA 4B7IA 5IB2A 5IVXF 4PJBF 1CFSB 3HCVA 3EHBD 5HYQA 3OZ9L 5A2IH 2BVYA 4G42A 1IAOA 3IDIB 4ZDHA 1A6ZA 4Y5VC 3WN5A 1CN4A 4HJGA 5ITFA 1NGQL 3EKCA 5T33H 4PS4H 3ZDXE 4H5SB 3RVWD 5CZVH 4Z18A 1LP9F 3TYFB 3NA9L 1XGUA 3MJ7B 2VZ1A 3RUGB 3GMRA 4PY7A 3PIQA 5DJXA 1EEZA 3FOLA 3UAJD 4ESKA 5SWQB 5JR1L 2QR0A 5GGRB 4WUUD 3T0AA 2F19H 1PKOA 4X6BB 1CDIA 3KLHD 4NN7B 1W0WA 4Z0XA 2L4OA 3VFWA 4OI8A 4OZGE 3C5ZB 4RGOH 3CXDH 3C09C 4I77H 4NQDB 4NQEA 4YR6B 1AFVH 1QA9B 5EOCJ 2HT2D 5D70L 1A7OL 5GRWA 4YDIL 3ARRA 2AABH 2YWYA 5HHPB 5KS9B 4LRNH 1N64L 1S7XA 1T7YA 3MOAH 1MF2L 3DV6A 4XP6H 4OZHF 4UOJA 1U95A 4APQD 5EZJA 3NAAL 2VYRE 4LCCA 1YN6B 4OLYH 3I3EA 3P77B 4QHNB 2XV6B 4V1DB 4CMHB 4FN0A 4XWGH 2XTLA 4ETQB 4RBPK 1HXMA 1CLCA 1RK1A 4QHKI 5F1IA 2GY5A 5JMOC 1RFDH 4ODXB 2XFXB 4XAWH 4XCNA 4UDTB 3MUY1 4TQEH 4N5EC 1HSBA 3MYZA 3PGCB 3CZJA 3OSKA 4JG1H 3VXOB 2CGRL 5C07D 3QCVL 3PHQA 4O2FB 3KYAA 1S8DA 4F37K 4MVBC 5T1KA 2UZIL 1JGUL 5KVFH 1H0DA 3X13A 5TE6L 3VXPB 1U8MA 3D0VA 3HPLA 5EC1A 4S1DD 1IGCH 4UZGA 3TCLB 4PRDB 2YK1L 3C6LA 3ZT5A 4MJ5B 1U3HA 4P4KA 1BECA 4WU5A 3MV9B 4FFYL 5BS0B 4RAUB 4Q6IB 3NCMA 2YMXH 1A7BA 1GVIA 1NANI 4HCRL 4QY8A 5GHWL 4X7SH 1FV1A 2B1HL 1EZVY 5GGUA 4M6OL 1YYML 3DRTB 3HI6L 2BVUA 3NN8A 4M03A 3BH9B 2V17L 3I85A 2CK0H 3WBDA 3BWAB 4LASH 3WFEH 4FMFA 4FOMA 2H1PL 5I8KH 5I1GH 4HUVB 5CP3A 5I1IL 1NBYB 1RVFL 3JV4A 1U92A 4ZPVA 3SHSA 4F7MB 3LAFA 2PO6B 1CL7L 3GSUB 2OTPA 2CUMA 3GMPB 5T1LD 5MP6H 3ZKMC 4X6EA 4XNMA 1C5CH 4KHXL 2BFVL 2BOBA 1WCBB 5E6IA 5F9OH 4ZS6D 1WIOA 3HS0A 5GZOC 1UCTA 1BVKB 5MEPB 1ZVSB 1KFAL 1T22B 5E5UB 4I0PB 1HHGB 4G9DA 4GQ9L 1KIQB 2Z9TA 3IDMA 4TUOB 5DA4A 3PWNA 3JWOL 4ZG1A 4OFKA 4FQIH 5TDOB 1JGEA 1A6VH 1G7LB 2DQJL 1BWWA 4J3OC 1KBGH 1B4JL 3GSNB 4WEBH 3QUYD 4NZJA 1LO4L 3WLWD 3PGFL 3W11D 4AT6B 5DQJA 4Z7NE 4PBVC 1X4XA 5GGQH 3VDCA 3ELAT 2F54A 5E8PB 4X7CC 3QJHA 4Y19E 1WBZB 3MR9B 2WWKT 2DI7A 2AXGA 1K5NA 4P5KA 5JW4Q 3VRLE 2OR7A 3WNMA 5ICZA 3QDAA 5GISH 5I16B 4HMEA 2EC9T 1JN6B 4O58L 3LEXB 3RIFF 1T0MA 4H88L 5CJOH 3QUZD 1FZJB 3DETD 1MHCA 1I7UA 3QNZA 3KPQB 4XCEB 3LPGA 5FAAA 2AQ1A 5LGJB 3CUPA 4DUXA 4L29B 1FIGL 2JELL 4ZOCA 4C83A 2FX9H 3NABL 1RUAL 1JNNH 2AJZB 3KAAA 4LOUC 3VGAC 5IEKA 4KKAC 2BNRD 4LDEB 4QRQA 3AREA 5D7LE 2P43B 5KVEL 3DUSA 1MHHA 4ONFH 1E4WL 4FP8L 4LSTL 4OZ4B 4QEGA 3QSKB 3IFOA 2A0LC 4ZO7A 1T6WA 5I71C 2YXFA 4LU5L 2F74B 3MLWH 5IGXH 1MLCB 3NTCH 1XH3B 5DTFA 3PDDA 1IEHA 5DJ2B 1T2QL 4LSVL 1QSFE 3BIKA 4R4NC 3V7AG 1HQ4A 4PGEB 1F4WL 5CBAA 1NAMA 2FCBA 2YBRB 4PRPE 2DM2A 3KPSB 4KV5E 3B5GA 2Q3ZA 2VZVA 3K2UL 4GKSB 3O0RH 4LRIA 3E2HB 5E8DL 3L3DB 4MJ6A 3C2AH 4WWKA 4Z7UB 1ORQB 1U8KB 4YEEA 5D1QD 2AV1A 3VI3E 1GZPB 3FB7B 5DI8A 1KJVB 4OV5A 4ZOBA 3HZYB 1UH2A 2FX8L 2DRUA 5BCAA 4M3KB 1D5MA 3FQUA 4KJPD 5IBLC 3IDXL 1T2XA 5FIEA 3VXRA 4J1UA 5DR5L 1OD7A 4ODWA 4NWTL 5EU5A 4M02A 4P5MA 4LEXH 1U8HB 1R0AH 2HVJA 1F3DJ 2GITA 3KWWA 5AZEH 4X4YB 2HP4A 4U0QB 5ECJE 2BY1A 5C1MB 5F3BB 3IDYB 4KQ4H 1P2CB 1T7XA 4KMLB 4UV4L 3TVMD 3VWKA 3VCLB 1RZ8A 4R7NB 1KCUH 4M43H 5IW1B 2J6EL 2OK0L 3DROB 3RNKB 1I1FB 2VAAB 2BC4B 3X14A 5JW4M 1FJ1B 2XXMB 3FFDB 3HNVH 5GGSB 4GW1B 2X40A 3HNSL 1S5HA 3H3KA 4XCFH 2MHAB 2Y1VA 2YRPA 2NPLX 2H9GB 2X4RB 1HHKA 1IGYB 4DK3A 1FL5A 1YMMA 4RZCA 1MCLA 1IAKB 1KCSH 1V3KA 3ALXA 4HG4K 2XOTA 2FJGB 3Q2CA 5E2TL 1GOFA 1SVCP 1NCCL 4Z7OE 1FNAA 1SY6A 1IGJB 3RY4A 4HZAA 2CDEA 4QHMB 1MCCA 5IVOA 5BVJB 2APWA 5JW4R 4NRXB 3QZWA 4HUNB 2MMXA 1PX3A 15C8L 2OSLA 3ILQC 4PYGA 2AJVL 4JPKL 4TPRH 1S78D 3ZHDA 4JO2H 1FFRA 3F6IA 3S37H 4QHUB 3ULUC 3HE7C 1TPXC 1YUHB 4WEUD 1A1NB 4DGIL 5IIEB 2WMPA 3T0EC 3S88L 1T1XA 1EERB 4OCXH 2H3NB 2GTZB 5JW3L 1W72B 1MCSA 4N8VB 4OUUA 4HC1L 1QD0A 4YFLI 5FV2A 1XGPA 5INDA 1V05A 4IDLA 3S7GA 4MA7H 5ETUA 3MGOA 2OM5A 3PV6B 3HZMB 1ZHLA 4K9EL 4IS6B 4TNVK 1BD2A 1G7IA 4YJZL 5IHZB 4R26H 3ARPA 3QI9D 1DE4A 3GK8H 3KYNA 3E3QC 5KAQF 3O2WH 4KHTH 3CFIC 4WFGE 3BP4A 5C0BD 3V5HA 4DEPC 2H32B 3L3KB 3O8XB 4G7VL 3BHBA 3VXQB 6FABH 3O2DH 2P1YA 4LSRH 1YYLH 1OAQL 1DUZA 3KGRA 5DSCB 1ND0B 2A6JB 5TQ0L 4L8SB 4DGVH 4HKXB 1FVDA 5MENA 4FFWC 1K8IB 2XWBB 5IB3A 1NGPH 2J5LC 4LARH 1LD9A 1Z9MA 4X6DB 4Z0BL 2WNGA 1RUML 4XPFH 5CJ8A 3UTPE 4GG6B 4P2YA 1JZ4A 4P46C 3SGEI 2YR3A 5D96B 1BP3B 2BSSA 4PLKD 3OKOA 5ICXB 2W0FA 3TBVA 4OD2A 1QR4A 2H26B 3WIHH 5I71B 4LMQI 1CGTA 1CFNA 1EV2E 3VRIA 4FXGA 5DEGA 2WBJA 4PLJD 5E1AA 4YC2C 2IPTL 1YZZA 3PJSB 3JVGC 1S3KH 4IRJD 2OYPA 1J88A 3ZTNH 4JN1L 4LHUD 5EOQL 2Q76A 1CZ8L 2XWJB 3QWOA 4R0LB 5LAXA 3OKDB 3UJJL 5GSRA 2OS7A 1GGBH 3KNBB 5F6HI 3MRPB 1E4KA 4XHJC 1JE6A 1QLFB 4CRPA 2NCMA 2Z92B 4Z7QE 1F42A 2A6KB 2IG2H 3TO4A 5I1CH 2H2SD 4PRIA 2RCSH 2CLVA 4GLRI 4QF1A 3LQAC 5F71A 3I6LD 3DURB 1G6VK 4U2ZA 2PYEB 3RRQA 3MLYH 1B88A 2X4UA 3TJEH 4JFEE 2ZWLT 3D2UD 8FABA 2OMBA 4HWNA 2YD8A 5J89A 1QSED 1UFUA 3BH8A 2X10A 1ZK9A 4F58H 4HF5L 5DO2D 1KB9J 4P5TA 4OFIA 4YHIB 3PF2A 3C9NB 4HJJH 5SWSA 3S36X 4ZYKB 2V2WA 7CGTA 1U36A 5FB8A 2R0ZL 2F58H 4DWHA 1MJJB 3WCYA 2FGWH 3ZDYE 2JK5A 1MUJB 5I1AA 5IK3B 5F7EL 3GIZL 2XKNB 4G5ZL 4OQTH 4UQ2A 1JNLH 1BJ1J 4H0GA 2R29H 4L4VE 5EU6D 2X05A 1JBJA 1L0YA 2X89A 2CO7B 5EUOB 3LRSB 4MS8C 4Y4FD 5L2KA 1YQ2A 4MX7B 5DJYB 1FLRH 1AQKH 1BM3H 3L95B 4I9WD 2FBJH 3TPKA 5SV3A 1EXUB 1EHNA 3LS4H 3GSRA 3NCJH 5DWUL 1AD0A 1EGJA 3PWJB 4S0TD 2GSGB 1OAKL 1CGSH 4DQOL 2ZCLL 1G9EA 5BXFB 5E8EB 2Q8AH 4P2QB 3UDWA 4MJID 5J56B 4I2XA 2P49B 2HTKC 1HHHA 4FQCL 3BKCH 4EN3C 1K3IA 2NY0B 4TSBH 5EO0A 2LU7A 5I76B 2QKIA 3H9HA 2JJTA 1TPXB 1RZFH 1KPRA 4F3FA 5FYKE 1I1RA 1NAKL 1NFDA 1JNJA 4X99A 5FYLH 2XN9D 5D8JH 3OKEB 1NBVH 5FHBH 5DD6A 3DXAB 1NC2D 2O5ZL 3V52L 3OF6A 2FJHB 1N26A 1TQCC 5LGHH 2ATKB 1QACA 1EFXB 3EJYD 3BEWA 2EYTA 5J0BA 1D9KD 3RNQA 4L4TE 2AJ3B 2AVGA 5ID1A 1CE6B 1QO3A 3RKPA 3U6RA 1UB5B 3JWNC 2ZOLB 1YEIH 1QR1A 4IIQA 4WW2C 3SCMD 1YMHB 5D72H 5CSBA 4Z5RB 2EDDA 4KKNA 5HVHB 4X7TA 4ODSL 5JIIA 1TFHA 3OJDB 5K9OA 2PNDA 4XI5D 5TE7H 3D18A 5HHXL 4HIEB 3SDYL 3G6JB 1JGDA 4XXDB 1ADQL 1FGVL 3D39D 1HK6A 4P46B 1DLFL 1FZOA 3QFJD 1MLBB 5FOBA 3H9SE 3L3OB 2G2RA 3GM0A 1S7TB 4QRPA 4XPGH 3L7FB 4FQJH 2HVKA 2HYMA 4QOKE 4PBXA 3ARTA 1KTLA 4JCMA 3VXSB 5BRZA 1JNHB 4IM8A 3QDMA 5CZKA 1B3JA 4YXKL 3RI5F 1KLUA 2XQYG 5T1MB 4KMTL 2EC8A 3HC3H 5ICYB 4YXHL 1AGBB 3DSFH 4G6MH 1J7VR 4O4YL 4Z7VE 4U7SA 5J11B 1JK8B 4D9RE 1M7IA 1ORSB 2MTPA 2OL3H 2AJSL 1OSPL 4MA1C 5DD1L 3DHMA 3RBGA 1QRKA 2VLRD 3AY4A 3ZKSD 5EUKA 5FYKU 3MRQB 2B4CL 4KKBD 2FR4B 1A7PL 3CCHA 1GGTA 1TCMA 1LEKB 4NKMA 1X5IA 5FDYA 3ES6A 2DBJA 4KQ3L 5FYLD 3GB7A 3SDXA 5I8OL 1RURH 2AEQL 2X42A 2ZJSL 4K8RH 4HJ0C 4KY1H 4MCYB 3SKOA 4KRPC 3ROLB 3VXMA 7FABH 4LQFL 1UZ8B 1BPVA 4A2LA 3VG9C 3CIQA 4PJ7E 1SEQL 1B6UA 5C0FB 1RAMA 4H0HB 3WFZA 3N06B 5F3HB 3AM8A 4BYHA 1XF4B 3D69B 2QQNH 5T3ZD 2W9EH 5A40E 4WTXA 4QRRB 1KV3A 3KYKH 3UTSB 2DQEH 5IVXE 4PJBE 1CCZA 4KK5C 3I84A 4DGYH 1AC0A 5T1DH 4ENEC 2DBLH 5C0NC 3F5WA 3O6LH 4PJ8A 5JHDD 1EMTH 4OCRH 4YHPB 5IV2B 5BZDA 3SO5A 1I75A 4LLAA 1LP9E 3C5ZD 4JKLA 3NIDF 1F8TL 3PGDB 4UDUB 5E2WH 1NGYB 5IMMB 3MRBA 1EEUA 3EYUH 3QWQB 4Y16A 5ADOL 4U1JB 3G6DL 2AXHA 1KN2L 4M7KH 3OAZH 2FWOB 3MV8B 2DKMA 5M7QA 3BKJL 4C56A 1KOAA 1YY8A 5IW6A 3WNPA 2YUZA 2BVOA 1BX2B 3BXNA 1NLBH 3GI9L 4IOIA 4WO4C 5JOFA 1T04A 4JFDA 1NCBL 2V9RA 2QBWA 3TNMB 5D2LA 4WEMB 1F02I 1NC4B 5F1OB 3FTGA 3MLPA 1NLDL 1FNLA 3GSXA 4HS8H 4TSAL 3PXJA 4V1DD 1T66D 5HPMB 5GGTH 5J9PA 1OTUD 4LHQB 4OV6F 4W6WB 3MRJB 5HYJD 1KIPA 2AK4E 5E2UL 5C9KA 1WQVT 1IGIH 3SDCD 4OGXL 1EAJA 3QHZH 4EN3B 4UOW1 3QO0A 2LVEA 1E4XH 2VZTA 1T20B 3KPLB 3FO2B 3JV5A 4OZHE 4PRAB 2P24A 4BQ8A 1LEGB 1HI6A 4YDKL 5E95B 1HNFA 4DOHE 4ETYA 4M7JH 3DMMA 4X5LA 5CMAB 1Q1JL 2BCKB 4DN4H 4QLRA 2VXSL 1YEEL 1UH4A 1D6EA 2BX5A 5IROC 3CVHB 4LKCA 1Q9KA 1IGMH 1EVTC 5EORH 5BMFL 2FNBA 5DFVD 1X7QA 1S7UA 3O6FA 4OGAC 1A0QL 4EQ3A 4OLWH 5IJVA 1FNSH 3LN9A 5AZ2L 4P2RE 5F7DA 1I1AB 5C8JB 1EPFA 1EHLL 1LK2B 3S4SA 5IMOB 4H8WC 3W0WE 1RHHB 2JCCB 4PJIB 4YHKH 5H94A 1HN1A 1IGTA 3O3BA 5D2NA 1UM4H 4WW2B 1ETZB 1DBJH 2G75B 2ICWB 3MRMB 1MFBH 3DLQR 4QTHB 2XRAL 3HUJB 5D7JA 4R2GC 4E9LA 4KK8D 4OCYL 1JHKL 1UKSA 3RZWA 2PTVA 4X8JB 3RTQA 1YC8A 1BZ7A 3RU8L 4NO3A 4NJAH 2ESVD 5HDBF 2ID5A 4HLZH 1PZ5A 4LCCC 3SDAA 3EOAB 2P8LA 1LO5A 2P42B 3O41A 1NKRA 4D0CB 1SMOA 3ZE0F 2PO6D 4YBLB 5H35B 4XC1L 1MWAB 2GK0B 2NY4C 3U0WL 4MD5A 1IKFH 5DJZB 4DKEH 5IQ9B 1J87A 1L4IA 1OTTC 1NGWB 2VRAA 2FLBT 4HZLA 1SJVA 4WHDA 1RUPH 4WFFE 4WHTA 3ULSB 3MBEA 2LAGB 4DVRL 5B39B 4HGWA 4Q9BA 4RFOL 3FRPG 5J57B 1XCQA 3D3VB 4DZBA 2BRQA 4OLUH 2DI9A 4CGTA 2GIYA 3V5KB 4LLVB 2AK4A 2DM3A 4I0PD 3P9LA 5GRUL 2UZXB 5I8CB 4NN5B 4KRLB 3MFFA 4ZUTB 3VXUB 1X6NA 3Q48A 4XMLH 3HRZA 4OZHA 3H3PH 3LSOA 5EB9A 4MZ2A 5SX5H 2R0WL 5KTEH 1EO8L 4JRXB 4WI9A 3C6LC 4JAMA 4P4KC 2VISA 1A7QH 2HN7B 2R56L 3T0WA 3VG9B 3SE9H 5CD3A 4K7PX 5J1TC 4E0RB 2VLJB 4P2RA 3UTOA 4P9HL 3MNZA 4JFOA 3FO0H 5DDHA 3S3PA 2DYPA 2PCPB 1NMCC 1WAAA 3C87A 3UYRH 5JDJA 2ATPB 4MNQA 2YWZA 1E6JL 4GMTH 1CFVH 1FAIL 1BQHB 4RMQA 3PQYB 4P9MH 2H41A 2BSED 3CK0L 5J1AA 3U4EA 3W9EB 2DWEA 1Q0XL 5L88L 2IQAB 3L3HA 1WWBX 2YD3A 3FONB 2P46B 1CT8A 1TVHA 2IADB 3QG6B 3RY6A 2AJXH 4ZFOB 5DMJB 5E6IC 4S0SD 5GIRB 4A6YA 1I7ZA 1IQWH 3B3IB 3B8YA 2G9HB 1K4DA 4HH8A 2ZPKH 2DS4A 4HIJB 1JMXA 1SYVB 4MQXC 3V4VH 1X5JA 3KPTA 3W9DB 4CMMB 1ZE3C 2Y7QB 2X70A 3BUYA 1ERNA 4C4KO 3HC4H 4K3JL 1J9CT 5KSBB 4OGYL 4LCWD 4NP4L 2F8VA 4KVNH 2NNAA 3FB6B 3BZEB 5IB2B 1P7QA 4Y1AA 4DVBA 2DLFH 4OD1H 5DURB 1IAOB 1IM3A 1A6ZB 2ARJQ 2EEBA 3GSNL 4ZDHB 3WIIL 3PUCA 2W65B 5HGBA 5ITFB 3B2VH 3EZJB 43C9A 2CDGA 4N5ED 3KXFE 3OR7B 3GMOA 4UT7L 5D1XA 1I7RA 5TE4H 1W72H 2LTQB 3TT3L 3W82A 3DYMA 5DJ0A 3TBWA 3PIQB 5DJXB 2P4AB 3EFDL 4MVBD 4Q9QH 3C60A 3BPOC 2QL1A 4N0RA 2R0KL 2VXQH 4ZSOE 5D5MB 3JBG7 2L7JA 2IPKA 2ICEA 1J8HB 5D6CA 4YX2H 2BERA 4JFPB 3LY6A 4G8GA 2KQNA 4MA8H 1VGKA 4U7MA 4GRWB 4N0UE 3CC5B 3VFWB 2H32H 2AW2A 5MERB 1BFOA 3EAKA 4AY0A 4UIMA 4PFEA 3VE0A 1MQKH 4TUJA 3AREC 2Y5TB 1PQZA 4WUUE 3RZCB 1EAPA 3MLUH 4R2GB 2CDFA 3IU3B 4O2EA 3ZL4L 5LCVL 1F00I 1ZA3B 1S7XB 4L5FH 3DV6B 3R0NA 2HJFA 3MRIB 2CJUH 4R4FH 4D8PA 1U95B 3G5XB 3CMOL 2I07B 3THML 2J4WH 4LCCB 4ONHB 3K0WA 5E8NB 4KZDH 3CLEH 4ZFZB 2BJML 4FA8A 4HS3A 3QEQA 3C6SA 4W81A 2BOCA 4OUOA 4P49A 4WV1A 1HXMB 4JRYD 3S35H 3ZKMD 1NBZB 1RK1B 2HKHL 4LCYA 5TFSL 1FGNL 3H6JA 5C0IA 4JQIL 4MDIB 4R8WL 4YK4C 3G5ZA 4LRIC 2WK2A 2ZUWA 4JDZB 1PJ9A 4R97C 5GZOD 5JZ7C 3MXVL 4WWKC 3RX8A 4JKPL 4OCNC 4CJ1A 1A02N 1G7MB 2R2BA 3GKWH 3O2VH 1S7WA 1A5FH 1BZ9A 1TZGH 4YHLH 3PHQB 3JWDL 2BNQB 1S8DB 2DQTL 4G3YH 2XZQL 2AGJH 5T1KB 1YJDH 4E42A 2DWDA 3QHFL 4PGBA 3HPLB 5EC1B 2CLZA 4X9IA 1XGQB 5CD5C 1BIIB 1XGTB 4PJXA 5L7XL 1L0XA 5C07E 4F9LA 2C4XA 4TN9A 4GBXB 1YNLH 3IDNA 3L6FB 5IB5B 4ZTPH 4W4OA 1A14L 5DJ6A 3DX9B 1IC4H 4OFYA 1UWGL 3BSZH 2R8SH 1X5XA 3KR3L 2ADFL 4U1LB 3E1F1 3VWKC 4N0UA 1XF5A 4NIKB 2EXWC 1K8DA 3Q0HA 4O51A 4XGZA 5E56A 1P5UA 3WDJA 4LDOB 5T5FH 1Y0LB 3EDEA 5EPMB 1PKQB 2AEPL 4MWFA 5E08H 4M5YH 5GS1A 1MCDA 3QQ4B 1N59B 1UA6L 3EDKA 1U92B 2YC1B 4XP9H 2V9TA 1G7PA 4HCRA 4TSCH 3DRQB 2HWZL 3CGTA 4LOUD 1I9JL 4KKAD 4XNMB 5IBUG 1DL7H 1HWGB 4JVPA 3LD8B 2ZP0T 1HKFA 3FN0H 3HS0B 5KJRH 4GW5A 4LNRA 1TTGA 2A0LD 2UWEF 4CVXA 5MI0C 3AB0B 4HIHB 1N7MH 4G9DB 3QIUA 4HGKC 4JR9H 5CEZL 4R96B 3V95A 5IB4A 5F9JB 3MRKB 4O02H 4J6RL 4CN1A 4DN3H 1A2YA 2IBGA 1JGEB 4H0IA 4R4ND 3LKSB 2OJZH 1CYGA 1KB5B 2DF3A 2VC2H 1OGAD 3IJYA 1CQYA 3ULUH 2DQDL 5DQJB 1BOYA 4IHOB 1FRGL 5DHVH 3KS0J 4N90D 2F54B 3NZ8A 1OSZA 3QJHB 4X4XB 3QEGH 1KT2A 1JFQH 1VEMA 3A6CH 3CZFB 4DKFL 2AXGB 4P5KB 4U1GC 2YUVA 4BSVA 1PAMA 1BGXL 1WEJH 2EIBA 2VLLB 3DUHA 4G6KH 1NL0L 1QLRB 3BPOB 5L2JA 1OTSC 1I8IA 1JF5A 1T0MB 5KZCB 2CIIB 5IBLD 4MCZA 3SGJC 4F9PA 2JJSA 4GAYA 1Y6KR 1I7UB 4ONGH 3QNZB 3G9VA 4M48L 1J05B 1OT1A 3QP3A 2VDML 4GXUN 3GJFA 3FRUB 1AQDA 4HGMA 3QUMH 4HQQL 4Q2ZA 3FB5A 3KLAB 2VQUA 4NOBA 2NY7L 4QRQB 2ED8A 1IAIL 4AG4L 4MA3A 4PJCB 3DUSB 3ULVC 1FN4B 3OAYH 1MJUL 1C5BL 3KPPA 3P11L 3VI4F 4DUVA 2BNRE 5DJDB 2YEZA 5EA0H 2WBJC 5DQDH 3L5HA 3TNNA 4Z76A 2FJFB 4NQSA 2Y06L 4NCC1 1EBPA 3RJDA 1Y18A 2V5TA 1NAMB 3GRWH 3GSWB 1WZ1L 3O4OB 1ES0B 3IXAA 5T1LA 4YK4B 2EYRA 1MEXL 4BFIA 1N6QL 4R97B 5HHQA 3O4LB 1AR1C 5E4EC 4LLUA 4WWKB 4L3CB 5IT2L 4CJ0A 2AV1B 3TO4C 1RQ5A 4J12A 5IHBA 4KJWC 4OQ1A 3RGVA 1GSMA 1F4YH 4OV5B 1NH6A 2VSDA 3GJEB 4QWWC 5CEXA 1VB9A 4EJ1C 1D5MB 3FQUB 1YNKH 1URLA 3ZTJG 3ULUD 3HE7D 1UM6H 2EH8H 5E00A 4IJ3C 1J0HA 1A3RH 4J1UB 4KTEH 4M1DH 4OLXH 4CADA 3T0ED 2NY3C 4JFXB 5EU5B 1Q0YL 5FA4B 2RIKA 4AMKL 1KG0A 4P5MB 5L6YH 4P5TC 3VD3A 5J06A 4PGDB 3KWWB 2GITB 2YPVL 4BJLA 3O6KH 4QHLA 1F13A 1G6RH 1NEZB 1ZT1B 4X5WA 5DVOA 1EFXD 3G9AB 2APFA 4OM1L 5HY9A 1TIUA 3BT2L 2OTUA 1FH5L 3VWKB 5GRVK 5I1EL 2HH0H 1V3JA 3UJIL 3WFCL 1XF2B 3LKPB 4MNGB 5HTSA 5F1SA 2Y72A 2BXYA 3L1OH 2KL6A 2VITB 2AXFA 1E6OL 5DUBB 1HEZA 1A4JA 1RJLB 2DQIH 2V9QA 4CVUA 3EYOB 4FFWD 3PP4H 3OAYK 3DUUA 1DSFH 1AFVL 1YEFH 5IHUH 4YHYC 5IM7B 4PJHB 3A0OA 1IEBA 2V7NA 4NKQB 4P46D 1P4BH 2AABL 2CO6B 2J6EA 3BPLC 4TULH 5C08A 3DWTA 1DLHA 4RWYH 1JWSA 3HLAB 5MI0B 3EOTL 4H26B 3RVTC 4DFIA 3QZWB 1BZQK 3HG1A 3UDWC 4LEOA 1XGYH 3LOWA 4UV7L 2OSLB 3DIFA 1Q72L 1U3ZA 4YPGB 3BO8A 3SQOL 4IMLA 2JJTC 2Q87A 3PWPA 1O0VA 1AXTH 1W0YT 4L9DA 2F5BL 3FHQA 5IG7A 1O7SA 4XHJD 4NGHH 5DS8A 2X5PA 1CFTA 3TM6A 2FX7H 1AC6A 1OARH 3CH1B 3MGOB 4U1GB 3VGHA 2VWEE 2C3GA 1TZIA 1BD2B 3N1PC 3CFCL 4UTBH 4RCAA 4IOFC 1M6OA 4RISH 5A16A 1C16A 1EVUA 1ZS8A 3BP4B 3MXWL 1IGCL 4FQ2H 2P5EB 1RJCA 4LSQH 3BHBB 1AHWA 1NEZG 2H6PA 2R0LL 4IIQC 4OZIF 3P3YA 4HC1A 2ITDA 3GMMA 4NM8H 2YMXL 4JDVA 5MENB 1VGEH 4X6DF 4PJGA 3OHXB 4QRRD 1JZ7A 4X7SL 5MEQA 4HK3J 4P23A 1UXSB 3UTSD 1LD9B 5C0BE 4ORZC 3IDGB 2CMRL 4FQQA 3I2CH 4BM7A 2IJ0C 4PJ9B 1GXEA 2DIAA 1Q94A 1B0WA 3OKOB 2CXGA 3TBVB 2CK0L 2VN7A 4PPTA 4NZUH 3FT4B 1CFNB 3MBXL 1KELL 1B2WL 5I1GL 4FXGB 1M7XA 2VR9A 3ZHLA 4U1KA 2W0KA 5JW5A 4CBPA 3D48R 3VFGL 1MCJA 1EHXA 3CLFH 3MV8D 1INQA 4JPWH 4XP1H 4X80H 1IQDB 5EO1B 3QZWG 4LLDA 2MNUA 5GSRB 3T1WA 4KMQA 5E9DA 5GJTH 5T3XL 1N5AA 5E4EB 2X1XR 4IDJH 3NIDE 4WFED 3AY4C 5EZOL 2BY3A 1U8IA 2IPUG 3TO4B 4PRIB 2CLVB 1XEDA 1PZUB 3FMGH 4P4RB 1OOAA 4EN3D 4U4BA 4FQIL 1YPZF 3BE1L 2X4UB 1F3RB 1A6VL 1KACB 1RUKH 5I6XC 4LP5A 1N8ZB 4IJ3B 1FYTD 1HNGA 4GO6B 4XB7A 5GGVL 3O11B 4Q0XL 4R90H 3BMWA 4QRTA 1CF8H 4JFZL 4P5TB 5A43C 2PR4H 3I6LE 1BAFH 3BJ91 3AM8C 1A21A 5SWSB 1TETL 1S9YA 1F4AA 1XIWA 1AKJA 2YSSA 4NZRL 4PJAA 1KC5H 2LAAA 5CINH 2JK5B 1QRND 4KH2A 2BVQA 5JTWA 4PJ8C 1TJGH 5EUOF 5C7XH 5IFJB 3WL9A 4JFQB 5DVLA 4G43A 5K9KA 1CD0A 3MJ6A 3D85A 4U3HA 4XNXH 2BVTA 5JNYA 3OXRA 4Y16C 1LE9A 4XAKD 3IF1B 1JNNL 1JF1A 2D0GA 1RZJC 1SEBA 2ZNXA 3INUL 5EU6E 5FO9B 1FLTX 5FO7B 2AJUH 4AEFA 3TCXA 4NM4L 3I75A 3V4PH 4OIIH 1ZSDA 4AZ8A 1GCFA 4X7EC 2EYSB 3S96B 3U46A 1AXIB 1PG7L 3SGKA 4NZDA 5TGBB 1A1OA 3NTCL 1FORL 4L8BB 1JIBA 4QHKJ 5BOPA 4I9WE 1IZKA 1KXQE 3ULUF 1HHHB 4PRNA 3G08B 4MD0A 3UPAA 1BLNB 5EO0B 3GBML 3H9HB 3L5IA 4X6FA 1OAZH 5HDBE 1RJYB 5IVNA 4F7EB 4X99B 1HILA 4JFFD 5HHMB 5ISZB 3DMMC 3V6ZB 4MJIE 1VFAA 1YQVL 2E27H 3N1QC 3QAZC 3ZE0E 2HKFL 2FRGP 2CIKB 2WLYA 3P30L 5DT1H 5F93C 1NFIA 1HH6B 5D4QA 1SJHB 3RHWF 4O5LH 4OLZL 5AYQA 3QT2A 2OP4L 5CZXC 3C5JA 4FQ1H 5E2VH 5FO8A 2HMIC 1A6AB 4BZ1H 3CVHL 4BELD 4JRXD 1ZA6A 2EYTB 2XN9E 1EHAA 1CU4L 1MH5A 2VXTL 1T03L 3B9KA 4IBLT 5C0AB 1WJ3A 2E7CA 4HJ0D 4KRPD 4YHNB 1QO3B 4TUKH 5KW9L 3WD5H 1QR1B 5D2NC 1MCHA 4H8WH 4IIQB 5I18L 4JZJA 4FNLL 4X7TB 3QULB 5EIVA 1J1XH 5KVGL 2XA3A 3HMWH 5D7JC 5C09A 4QXUL 4TYUA 5CSZB 2R1WA 3QDGA 1MCOL 3FQNA 1JGDB 1MCEA 3RTQC 3VMPA 1UC6A 4KK5D 5HHNA 3VWJC 3V8CA 4ENED 3BW9A 4WU7B 3V8OA 1FZOB 2OI9B 5C0ND 3PQYD 4M43L 3SDAC 5FOBB 4ZFGH 3PWUB 5EZIH 1JI2A 1TQBC 5DGRA 4KVCL 2XY2A 4B53A 5DHYB 1HXYA 5DK2A 5BW7A 3X11B 2RGSA 4Y2DD 1KTLB 4PREB 2WSKA 4HH9A 2QSCH 2R15A 3D39E 3QDMB 1YEGL 4U0RB 3MBEC 3QFJE 2WW8A 1N6UA 2ADIA 4X83A 3AXLA 1FVCA 2DD8L 1ADQA 2F8OA 3MV7A 2RFXA 4WO4D 3GI8H 3HI1B 4EUPA 3VDBA 4XMPL 3ARBA 1R5VA 3L3JA 1T5XA 1IJ9A 2MKLC 5DJAB 1U8QA 3VFMA 1I7TB 4L3EB 2FIKA 1WUNT 5GRJH 1FPTL 2L7UA 4EOWH 4MNHB 1KPVB 4NNYA 5ENWA 1JRHL 2A9NH 1NCAL 1SBSH 2XG4A 2EDKA 4MJIA 1F3DH 4TPRL 1G9MH 5I6XB 5DURD 2VJXA 1D5BB 1HHIA 1AJ7H 4JB9H 3VXMB 4X7DC 3QNXB 2MWCA 4ODTL 2VLRE 4MD4B 2R1YA 3QQ9C 1ZGLM 2V5YA 1CIDA 4LLYA 3DVGB 4PTTA 1EUUA 5GS0H 4JPIB 3TC9A 4MA7L 5FYLE 3BP6B 3CDGA 4OGAD 1X4ZA 1B0GA 3UBXI 3VU2A 3FZUC 1F97A 4U1IB 3BI9X 2R4RH 3F5WB 1EEQA 4MSWB 3HAEA 4PJ8B 5K9JL 4KHTL 3IDJB 3NZHH 5HVGB 5T3ZE 3ALPA 2DLHA 4Z6AT 1G7JA 4LSRL 4NQED 4MLSA 1MCBA 4JY4A 5GJSH 1A7NL 3RY6C 4R2GD 4ZO6A 1DBBH 5M94B 3QXDA 1IAMA 4C56B 1WWWX 1YY8B 3IFPA 4XVJL 2Y25A 4YNYA 1LNUA 4EQ2A 5JOFB 5LBSH 1T04B 1K4CB 4G6AC 5HGAB 5D2LB 2DLEA 2WUCH 3DX8B 1EEYB 3SDDB 3I50H 1FNGA 3HE6A 1RIHL 5J9PB 2NY4D 4NHUA 1KIPB 1B4RA 1OTTD 1TZHA 3TBYA 1FNEA 4Q6YA 3QO0B 2V5SA 4CNIA 1AE6L 2YD5A 3VGGA 3OKLA 2XZAL 5DHXB 3K80A 2P24B 3I9GH 4PGCA 1HI6B 4JO1L 4V1DE 2OMNA 1EIBA 2I5YL 1Z0NA 4HV8B 5HYJE 2FO4A 5D1XC 3ZTJH 4WI8A 3QAZB 3RWEA 2BVPB 2XICA 3GZKA 2WUBH 1HH9A 4IRZL 1FCCA 4G9FB 5T1KD 3C60C 5HD8C 1QLEH 3CFJA 5JOPD 2PW2B 5J12C 3SKNA 1C5DA 4M1CC 4HWEH 5TDNB 1MVUA 2HLAB 4PJIF 1HZHL 3UTTB 3C6LD 3BRGC 2NX5B 4P4KD 1QBAA 3S4SB 1A9BA 3TJEL 4Q58C 2FATH 1INDH 4WW2F 1JPTL 1RJZB 1CFSA 4KGJA 3R1GH 3RIAF 1A6WH 1YC7A 5KVDL 3SJVB 1SM3H 3TA3B 1A3LL 4FXKA 5D7JB 4ERSH 4HJJL 3LKOA 4PJFB 3EUUA 5DLML 2D7OA 2W91A 3G5YB 4YQXH 3TYFA 3HC0B 3RUGA 1BZ7B 3BESR 3VA6A 3VWJB 2JKXA 2N56A 2FGWL 1L7IH 2VZUA 5HXMA 5SWQA 3A6BL 4P3WA 5DD5H 4DAGL 5GGRA 4N8PA 1RMFH 2HRPH 4X6BA 1LO5B 2R29L 3V4UL 1WZKA 3ISWA 2KUTA 1TJHH 3TFKC 4M8QA 1MJ8H 3Q3GB 4UT6H 4WV1C 5IESH 1RZIB 1E0OB 1IILE 3Q6GH 4FFVC 5EBLA 3EO1B 2N7BA 1AGCB 5E6ID 3WHXA 4G8FB 1MRFL 2Q1EA 2ESVE 4NQDA 4YR6A 3U7YL 4LSSL 5CP7B 1AQKL 1QA9A 3GO1L 5T5NG 1XCQB 5HI4C 1NAMH 2FBJL 1AIFB 2P5WB 4MQXD 5HHPA 1I3UA 5KS9A 1I3GH 2EKJA 5ACMA 1CD8A 3HA0A 1MI5B 1UJ3B 4H25B 3GHEL 5I30H 1YN6A 1J1PL 3P77A 4QHNA 3M45A 1WIPA 4XPHL 3L7EA 3V7AE 3UEZA 2YD2A 4S1SL 4ETQA 4JAMB 1OGTB 3FO9A 3JXAA 5F7WC 2UWEE 4F9LC 1RZFL 5FGBA 4RGMC 4S2SB 1QUNA 4HFUH 4X4MA 5DQ9A 1CDYA 2F54D 3WNOA 2X09A 1U2HA 5CIPA 4PGJA 4ODXA 4WGWB 4W4OC 5FK9A 3FT3A 5FHBL 3LEYH 1TDQA 1NMBL 4UDTA 3MNZB 3TYGH 5BVPL 4B5EA 4MJ4A 3PGCA 3VXOA 3S4SG 4BH7B 5E5RB 1OCWH 5KZCD 4O2FA 2UZYB 4P57B 4GS7C 1JYXA 4OAWB 4KTDH 4XPBL 4JKMA 4M6MH 5GS1C 4GXVH 3TCLA 4PRDA 1S7VB 3EFFB 5J1AB 1BF2A 4MJ5A 1ZLSL 1T0PB 1F3JA 1TCRB 2DWEB 3MV9A 5E94B 1J0IA 1W8NA 3PL6B 5BS0A 5LVEA 3WKMH 4Q6IA 1TVHB 3ARED 3QEHB 1KN4L 4KK9D 5CS7A 1EDQA 1RIUH 3OR6B 4YHZH 5ACZB 2AERT 2VLKB 4HWZB 4JY5L 2JF1A 5I74C 1F90H 1HYSC 4Z8FH 4NWUH 3BGMA 3HNTH 2Y23A 1PYWA 1X5KA 4ELMA 4EI5A 2X70B 1SY6H 3QIUC 3TH2T 3BWAA 1KIRB 3RVXC 3HB3C 3G04B 4FQJL 3HKFA 4U2YA 4YGVA 2NNAB 4QTIL 1UWEL 4UU9B 1P7QB 3MLZL 3LIZL 5GZNC 1D5ZA 5KVMC 4DVBB 3GMPA 4Q97A 4NQUA 1DQLL 3ARZA 4DW2L 4EEEA 1VFBA 1WCBA 2EZ0C 5JZ7D 1KB5L 3VI4E 4D2NA 3QXTA 1C8PA 4M93C 3MTRA 1PEZA 2CDGB 4G6ML 4LCWE 4WWKD 1BQLL 5JQ6H 1HIMH 3F7PC 3AC0A 2LU3A 4NNPH 1I7RB 3WNNA 4ALAL 3JWOC 1BVKA 1FBIL 5MEPA 1ZVSA 1NMAH 2OL3L 1CGUA 1HHGA 5J12B 4BA8A 2V5RA 1NDMB 1Q9OB 1HKLL 2JJSC 2IPKB 3MCKB 4JHZA 4P2OB 4Z78B 3VXRD 5CD5D 1G7LA 4NKIH 2ZUUA 1VGKB 3GSNA 2E9BA 4K8RL 3QEUB 1PG7W 4XBPA 4GRMB 4X6CB 4UB0L 4JM2B 4AT6A 2D7NA 3MREB 4UIMB 3RFZC 2PXYB 4LSPL 4RQQB 5JQHC 1UZ6F 3Q1SH 5E8PA 3RWHB 4KUCD 3MR9A 1IMHC 2QQNL 3ZT7A 4O2EB 3KYMB 4R3SA 3VWKD 5ANME 2EXWD 2ZUVA 4RIRB 5F7KC 3KJ6H 1R3KA 2DQEL 1ZANH 5I16A 3IKCA 1JN6A 4D8PB 3LEXA 3BKMH 3ULVH 2K9UA 3MRNB 4J7RA 3MUGB 1U91B 1FZJA 3KPQA 4HS3B 2H45A 3C6SB 2BOCB 5LGJA 4WV1B 3NFSL 4L29A 1YMMD 5E2WL 1H15B 5E6YA 4U6XB 3OAUL 3U36A 1MRCH 5EU4A 2IEPA 2AJZA 1RULL 4M7KL 1FFPB 1MVFA 5B8CB 4JN2B 2HT3D 1JGLL 3KG5A 3NH7L 4K3DH 2R2BB 3V79C 4JRYE 1NUGA 3RGVC 3WFHA 2F74A 2J88H 3PWVB 1JZ3A 4HS8L 1XH3A 3MO1A 5B38A 4XNQA 1FZMB 4XXCA 2ARJB 1VADA 4R6UA 1LO0L 5DJ2A 2VH5L 2Q20A 5AYUH 4DTGL 1DFBH 2CLZB 2OLDA 1SQ2N 3H8NA 4CVWA 1CDHA 3AROA 4XX1G 2EDRA 2J8OA 4JE4B 2YBRA 3B4NA 1FE8H 4XNUL 4RGMB 4WI2A 1T1WB 3KPSA 5F70A 3TH3T 5JHLL 2ZUTA 3OPZH 4KXZH 2M2DA 5E99H 3L3DA 4CN6A 2IBBA 2ZCHL 4Z7UA 3MLXL 1BD2D 1ORQA 3O6MH 3QNYA 1G9NH 1U8KA 2MOVA 1OTSD 3CVIH 3OBAA 4LPYA 3FB7A 3UXFA 1X4YA 4JHWH 3G5VB 1L6XA 4XGZB 4GS7B 2P5ED 2WIMA 3M8OL 4ZUWB 5ESQB 2G5BB 3IJHA 3N1FC 4PYHA 1QKZH 2V6HA 4GMSL 3ARWA 2D7MA 3W5MA 5IMKB 3GEWB 1IBGH 5TH2B 5FYJL 4WTWA 1JHLH 5ERWB 5TQ2L 3DO7A 1G7PB 5JUEH 5MEND 1UM4L 4BQ6A 3NGBC 1MFBL 1U8HA 3VFOB 35C8H 4TVPL 5IEHB 2VDNL 3HPJA 3ARUA 3ULVD 5I74B 5F3BA 1W8OA 4LNRB 5I19H 3VCLA 1JPFB 5IW1A 1IC5H 2VDPL 4HHAB 3GM8A 4OZIE 2VXUH 1EGJH 2WBJD 1I1FA 2VAAA 2BC4A 4X6DE 1FJ1A 4KAQL 5IF0B 5GGSA 4AEIH 4PV9A 3QG7L 5IB1B 3G6AA 4NC1C 2HFGL 3PDOA 2H9GA 4HUUA 1IGYA 3T4AB 3L5XH 3VGDA 1QFHA 3IAPA 1IAKA 1AGFA 3N1MC 4OLUL 2FJGA 1JP5A 4M93B 1AR1D 4DKDC 1IGJA 1L6ZA 3TO4D 3C08H 4QHMA 4PRID 4YBHA 1JVKA 4KJWD 4BSVB 5BVJA 4HT1H 5IJKA 1S7QA 1I9RH 5L2JB 1OGAE 4QWWD 3DX7A 4XMLL 4O9HH 2DQGL 4GAYB 1FQ9C 4N90E 4NUGH 3RVVC 3QA3B 1OAUL 3TN0A 2NY3D 4QHUA 1ZLVH 5EH1A 1YUHA 4KDTA 5SWZA 2B1AL 1A1NA 4MAYA 4P5TD 5IIEA 3GJFB 2ENSA 1KJ3L 5SWSD 1JL8A 2MCPH 2H3NA 2GTZA 4PJCF 3T3MF 4N8VA 4NKOB 4K9EC 4P23C 2VERN 1YPZE 2I26N 1MFDL 4D9LH 4MXWL 2VZOA 3PV6A 3HZMA 3RPIB 4YHOH 1AXSA 3S36L 4P59H 2AKRB 5IFAL 4GAGH 4IS6A 3T0DA 1RSFA 5FCSH 5IHZA 5KANI 5KSAB 5FM4A 4HSQA 1LDPL 4OZGB 4EXKA 4M7ZC 2X89D 3AAZB 4WWID 5GXBB 1JZ2A 1CFVL 1INEH 1V8HA 4MQ7B 5C3TA 3IRPX 2YEZB 3O8XA 3OMZA 4RX4A 5BV7L 3VXQA 5L2KD 2X2YA 2DM4A 2VDKL 1Y18B 4L9LB 4CVZB 5DSCA 1ND0A 2DLTA 4HAFA 4L8SA 4HKXA 3VMNA 1T7WA 2HJLA 2XI9A 1IQWL 1NGXB 5EUOE 4D3CH 4BFIB 5CKAA 4M6NL 4GG6A 1Z3GH 4Y8DC 5HHQB 4XVTH 3RVTD 5EFIB 3NACH 5ICXA 1CICB 3QFDA 1KEGL 4GXUM 1OP3K 2GSIA 4YPJA 3HC4L 2Z8RA 3RGVB 3CX5K 4OLVH 1K2DA 4HBQA 2DL9A 5MEOB 2QLVB 5FYKH 3WNLA 1ZT7B 1MELA 4JFHD 3PJSA 2E7BA 5E00B 2UV3A 2O93L 2FSEA 1CXHA 3CFKB 5LXGH 2XWJA 4ZMAT 2B20A 5M95B 1C7SA 2HLFC 4R0LA 2E8ZA 4Y4KA 3OKDA 2VXVL 1OL0A 4YAQB 4KUCF 1QSVA 3KNBA 3MRPA 3LV3B 1XIWC 4NNXB 3ULUE 2V5MA 4X5WB 5DD3H 3VFPA 4PG2A 2A6KA 4WI7A 1C12B 3N85L 4IOFD 3T0EE 4XP5H 3FB8A 4YIQB 5D7IB 4KJQC 1QBBA 3DURA 2PYEA 5C0AD 2MQ3A 1MREL 2DICA 3GSOB 1LO3L 5CJ5A 5F1NB 4Y89A 4JZNA 3Q6FB 5I1KL 4NSKB 4U1SB 4OFVA 3JSSA 4J3VA 3E3QE 3NGBB 3MACL 4HAGA 2A9MH 4GT7A 3C9NA 2IGFL 4L8DB 2EECA 2ZG2A 3NPSC 3QDHA 4ZYKA 3LMJH 4ORGA 4OF6A 3NIGF 5C08B 4HBCL 1RZJH 1MJJA 1VSCA 5FM5O 2XT1B 3JTTA 5IK3A 3ECBB 4QRPD