1F6FB

Crystal structure of the ternary complex between ovine placental lactogen and the extracellular domain of the rat prolactin receptor
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
199
structure length
195
Chain Sequence
GKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ternary complex between placental lactogen and the extracellular domain of the prolactin receptor.
pubmed doi rcsb
source organism Ovis aries
molecule tags Hormone/growth factor/hormone receptor
molecule keywords PLACENTAL LACTOGEN
total genus 33
structure length 195
sequence length 199
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f6fB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f6fB01
4W68A 2XTJE 4ZS6C 4R4FL 4HG4J 4OBRA 1LO4L 5KOVC 5IK3B 1IC7H 3DBXA 4XRCA 1CD0A 4OZGA 3EDJA 4HJ0C 4PJ9B 1WCQA 5ALBH 1KT2A 1CVSC 3EYQC 4LCIL 3SDYH 4PJFF 3ULVF 4Z7WF 5C8JA 4ERSH 1N4XH 2P45B 1MWAH 2Q7NA 3I3BA 5IUSA 2P43B 1JN6A 3FFCD 4ZUTA 5E5MB 4R4ND 4YO0B 5D2LB 4HXBH 4K7PY 3I50H 3S3SA 4FABH 5CEZE 1S9VA 5D8JH 5IWLA 2ICCA 3MRNA 5HYSB 1UA6L 5IROA 1KIRA 5C0BA 3SQOH 2ZSWA 4G6ML 2AK4A 4S1RH 4KKBD 2MCPL 5ADOH 5D1ZD 2YUWA 3VJ6B 3ZYOA 4K7PX 5AD0B 4FQIL 5E2WH 2D7TL 4DGYH 3TVMB 3I9GH 3DO7B 3OJDA 5IVZA 1OAYH 4XNXH 1NEUA 3BXNB 4P5TD 3SKNB 4TQEL 5T3XL 4UTAH 4Z7NE 4E5XA 5GJTH 4O2FB 5D7SL 4ELMF 1BM3L 4XNQB 1WT5A 4HH9A 1RK0B 4OUOA 3VD9A 3P4MA 3MV7A 5TGBB 4X4XA 4M1DL 3N85L 4QF1B 4JPWL 1AIFA 1ACZA 4GJTB 1CL7I 3SE8H 5GS0C 3V4PH 2W0FA 3DX9B 5INDA 1T1WB 4PV8B 4X6BA 4OFYD 4NBZB 3QDHA 5ICZA 1OSPL 3EYUH 3TNNB 2H6PB 5GGTA 4ZNEE 4JCLA 4GH7B 5TJWK 1KFAH 4HKBB 1GGCL 4MD4A 3MNZA 2ORBH 3GMPB 3DX6A 1JWSA 1M71A 4LHUG 3G5VB 3HG1E 3AU1B 3W9EA 4RZCB 2AGJL 5DJDA 5DO2D 2HMIC 5BXFA 1IBGH 1YJDL 3VFPB 4DOHB 3X13A 1N64H 4HK0B 3L7EA 3FN0L 4KGJA 4LNRB 4J8RA 3VH8A 5KW9H 1TIUA 1DUYA 4OLUH 5I15H 2GFBA 1R6VA 3V0WH 4N0UA 1H3XA 4G8IB 4R26L 1J0YA 1TQBB 4UV4H 2J88H 3H7BB 3WFZA 4X9HA 4HW6A 5L7XL 5TE7H 3R4DA 4UB0H 1IKFH 2QQLL 2DF3A 5C0FB 4PRHA 4Y19B 1P2CA 4LSQL 3O9WC 4GQ9H 3ARBB 3IS0X 5J11C 3WLBB 3I02B 3ZE2E 5C0AB 1FZJA 3DYOA 2HVJB 5BVJA 4F7EB 1MHCA 1HK6A 4JFDE 1NUNB 3HC0B 4Z78B 4WW2F 5HI5D 5FO8B 5FOJA 3E3QC 2A83A 1JVKA 2QSCL 2Z92A 4Z7UB 1LK2A 3NFPA 5BRZB 1J05B 5CMAA 3SPVB 3MV8D 1CE6A 3TZVD 3VMNA 1CLCA 4R6UA 3TJEH 4XXCA 1A6UL 2OCFD 4KKNA 5GS2D 2MKWA 3N1PC 2W91A 3EKCA 4KFZC 3LQAL 5C0AA 2X6MA 5L9DH 1I9IH 1KPUA 4FHBD 4XNMA 3LD8C 4NKOB 4OD3H 1FZMB 3FB7A 2HLFC 1RIUL 1N0XL 1CGVA 4O2CB 1UWEL 2KZ1B 4F33A 1I9JL 4JY4A 5IHUL 4YXKL 3NTCH 3PP3H 3VXMD 4Z7UA 4HF5H 3VXRA 4JO2L 4KAQH 3TIEA 1TVBB 4D9RD 4IJ3C 1ERNA 1D5MA 1GGBH 3BZEA 3B5HA 3FOLA 4RFEB 1J1PH 4NZRL 4WO4A 2GQHA 4KMQA 5HVFB 2WUBH 1H3UA 1TLKA 1KJ3H 4LCIH 3RL2A 3BHBB 5C0EB 1QSVA 2HA1A 1KN2L 3MRPA 3BEVA 4OF0A 4G6FB 5JOFB 4LDLB 5FYJU 1RD6A 3T3ME 4GKNB 2NY3D 5CBAA 5DFWH 1OP5K 2NY4C 4LVHC 3BSZH 2PO6D 1E6JL 2P24B 4OIBA 1GIGL 4YHYB 2IFFL 3LKNA 1U8NA 2OQJA 3DX6B 2G75B 4X9GA 4L4TA 2JF1A 1FG2A 4LCWE 1A7PL 5DHYA 4NZUL 4QCIB 3D1MC 1KJ2H 4R2GD 5E8DL 1KPVB 2CKBA 1FYTB 5KS9E 1P1ZA 1U6AH 1YC8A 1MAJA 3T8XA 4YFLI 1FGVH 4H0IA 4LSDA 1CXHA 4O9HL 1KEGH 3QCUL 4HCRA 4ZUVA 3AREB 4DUWA 1Q1JL 4JDZA 2P5WE 2VIRA 4MZ2A 5H37H 5IVNA 3OX8B 4OD2B 3QIBD 3ZTJG 1WBYA 2F54D 4TUOB 4HUWB 3QQ3A 4TVPL 5GS1C 4TNVK 3ULSA 1QLFB 1D6EA 4FFWD 4JY6B 2OL3B 5HHNA 3ZZ1A 1YN6A 5L2JB 3BXNA 1IAMA 3SGJC 5GRYA 3QEGL 4JFFE 2ZOKA 1MFNA 2BSSA 5FHBH 1ZLUH 1G6RA 5F7WC 3KPOA 1RV6X 5LGJA 4B41A 5EU5B 4ONFH 3CFCH 1RK0A 4KKCC 5C0BB 2C3WA 2B2XH 3UBXI 3W81A 1C16A 1EBAA 3LV3A 4XNYH 3G5YB 1Z3GL 2VL4A 5IQ7L 3UZVB 4QTIH 3FZUD 2DMBA 3KJ6L 1N64L 1DBMH 3U48A 5I73B 3PWVB 4ZS6D 3FQNA 4P46A 1IEAB 1JPTL 2PCPB 4S11A 3MODH 4U4BA 3ZTJH 3ORJA 2EC9U 3MV8E 5EC2B 2J12B 1MHHA 7CGTA 2ZSVB 3HA0A 2AKRB 32C2B 3MCKB 1VFAA 1MCJA 3BWAA 3ES6A 3BESR 3CXHJ 3MLPA 4Q9QL 3RI5F 4FMFA 5IB3B 5FUOL 3MRNB 4LLAA 2ICES 4IRSC 3MLVH 4X5XB 5T1MB 4I4WB 3EAKA 2NXZC 3F7YA 3E3QE 3D87B 1RZ8A 4GUPA 5F6HI 4XH2B 3THMH 1NBZA 4K7FA 2D7QA 3AB0C 1RU9H 4RAVA 1WC7B 4XB8A 1HH6A 4FFWC 2J5LB 2V2XA 2J8UB 3QHFL 1Z5LA 3RWIA 5B39B 5J4MA 4JZNB 3LHPH 1BVZA 1MHPL 2P24A 2NX5E 3N1FC 4HLZG 3CSYA 2HLAB 2Y72A 4YWGH 4TYUA 4YFDB 1I9EA 5EOTA 3CK0L 2NW3A 1OGAD 3VH8G 2CK0L 2QSVA 4PRIB 4X99B 4KJYA 4Y8AA 4Z77A 1AXTL 3DSNA 2AEPH 4LHJB 2A6IB 4G8FB 2BERA 3SGDI 4HUXA 5C7XL 1OCWH 4XC1L 4AENB 1I9IL 1RJLB 5CILL 2YUZA 4LU5H 3B2VL 4LCWD 2R2HB 3QEQA 5F9JA 4POUB 4XCEA 3HRZA 1VHPA 3PDOA 2VZVA 4U3CA 1NFIA 4H25B 5SWQB 1PJ9A 3LN5B 4F7TB 4L4TD 2AKRA 2X09A 4NO0B 4MQXD 35C8H 2D7OA 5AWNL 4AEIL 4UOW0 1ZTXH 2HFFB 3GJFK 2E3VA 1U95A 4P49A 2P5WD 2PTTB 3S8WA 3IU4H 1F4XL 4Z7VB 1KCSH 2F58H 4PY7B 5GZOC 1JP5A 1FFOB 4EDXA 1TQBC 4NQVA 4U7SA 4DFIA 1HNFA 2RB8A 1PBYA 2EKSA 3PGDA 3VFOB 3VXUD 2FEEL 5BRZA 4O02L 5SV4A 3SDDD 1JGDB 5IF0B 5FECB 1U3HC 3AM8C 5J9PA 1H8OA 5I6XB 4F8TA 4TVSa 2IAMC 3GIZH 4B7LA 4H0GA 1NBYB 3TGXA 1XGPA 2ILLA 5AYUL 1CGYA 5ERWA 4PJHB 3DMMB 5J7CC 4E42B 2P5ED 4P23B 2DQJH 4KVCL 4LSVL 1YEEL 2JJUA 4GRWB 3TN0A 2APVA 5INCA 3BKJL 3ETBF 3BYTA 4JO3H 3DUHA 4JCMA 5EUOE 5FYKD 2DAVA 3RX7A 4U33A 4NQXB 2AJUH 1JHTA 5IB1A 5TPWL 3CCHA 1EMTL 5D7IA 4PB9L 2HFGL 5BRZE 1UACL 2ZUQC 5C09A 5D1XA 2VYRE 4LCUB 1JGUH 1KJVA 4KMTH 2Q76A 2V9TA 1KGCE 3QUKA 4X8JB 3UTPE 3VFSB 3LSOA 5B21A 1MY7A 4LIQL 4BZ1L 2J8UE 2YPVH 2BXYA 3V9FA 5IG7A 4OF6A 5K59F 3LIZH 4M5ZH 5CZKA 5E2JA 3C08L 1DANT 5E8NB 3C5ZC 2ZCHL 1T7VA 4M93B 4D8PA 4AT6A 2EE6A 3IDGA 3S96A 3TA3C 2NY3B 5IMKB 3NPZB 1IM3A 3MGAA 1U8KA 2WWKT 2ORBL 1RZGA 3CZFB 4JQXC 3X14B 1L0QA 5KOMC 4RNRB 3TA3A 5CKGA 1PZUB 1LO0H 4A2MA 2IH1A 1NGWB 4ZPVA 1S8DB 4L8DB 4D2NA 1F97A 3NZHL 1WWAX 3ARTA 3KJ6H 2W0FB 5INDB 1ORSB 2WW8A 5F71A 1AE6H 5ENWB 3U9UB 5FYJD 1P5UA 3QUKB 3MV7B 1ZT7B 4JHZA 3C8KB 4HH9B 4FFYH 5FYLH 3JV5A 3F12A 3DGGA 4O2FA 1WFOA 3SDAD 1CS6A 3ARED 3IETB 2J8HA 1G7HA 3OJ2C 3B4NA 3KPRE 1ZLWH 4PRNA 4RGOH 3IFNL 3MJGX 2Y23A 1FO0B 5HHME 3WDJA 4KWUA 4XNMB 3PDGA 4QYOB 1BFOB 3ZYIA 4K23H 1BOYA 1JRHL 2DQTH 3EO1B 1T1ZA 4JR9H 1U91A 2GEEA 5C0CB 5E1HB 3SKJH 3SDCC 1CFTA 4ESKA 3GI8H 1GZQA 4OCRL 2YC1B 1FRGL 4KVNL 2QEJA 4J4PA 3LHPL 2A0LD 3UYPA 4JRYA 4P2YA 4YHMH 1FFOA 4EDXB 4HQQH 1G1YA 4HPYL 5F9DC 5GJSL 1ZGLB 1OAUH 1DZBA 1S7SB 3KNBB 3H9YA 2GTZA 2GUOB 2YS4A 5FYJL 3TJEL 3NN8A 5MEOB 1U95B 4FQHB 3I02A 4G9FB 3MA9L 2CJUH 3RJDA 3N1QC 3WKNA 5DRWB 3L1OL 4GRLB 3BP7A 1G84A 1MJUL 1TENA 3VWKB 1GRWA 3B9KC 4E41D 3QIBC 3T65A 1NDGA 1S7WB 4LCWB 4HF5L 4LPXA 3UYRL 1HE7A 3P73A 4KUZH 5FYKE 1TMCB 4G8IA 1A7RH 2PKDA 4N9GB 5BZDB 4F3FB 2A6IA 2YD8A 1J5OL 2IMNA 1F4WL 1EAPB 1R24A 3NFNB 1Y6KR 3EDKA 5FGSA 4YC2B 5DSCB 5B22A 5I74C 3L7EB 2HLAA 4U1MA 3EIFA 5HYJD 2J6EH 1U0QA 5C07D 3BIAX 4ZMAT 2R1WA 3SDDB 3FZUC 4G9FA 4ODHH 3BPOC 1CU4H 3Q3GA 4OI7A 4QHLB 4OCLC 2IG2L 1T1WA 4X6CE 5I0DA 4OGYH 4Z8FL 1CDIA 3TCLA 3LKPB 3TBYB 1CFQA 1T5WB 3ZYZA 4G6MH 5C0CA 3QNYA 1YYML 4YFLF 2RHEA 4RCAA 4KZDL 2AABL 3WIHL 1UQSA 4WW1B 2YN3A 4S1QL 5EWIL 4A6YB 5B38A 4EZMA 2Y06L 3DURB 4M6OH 1ZT4A 4FQPA 3SKNA 5CJ8A 1AO7D 3MRJA 1U8MB 4H88H 5DZLA 3T2NH 4LLYB 2P47B 1NGXA 3I84A 4X9IA 5DA4A 5B4MC 4A6YL 5FB8A 5BV7C 1EFXA 4S10A 3VW3L 3BIBX 3LZFH 1FNLA 4JPWH 5GGVH 1Q9LB 2HH0H 4PJ7B 43C9B 2Z35B 3V4PL 2XWTB 5E6IC 5DT1L 2I5YL 1DQJA 4I18A 1KENL 3PGFH 4PJBF 5IW3A 4WU7A 2ZOKB 1WISA 5DHVH 4OLVH 1OVZA 1T6WA 4ZUWB 4O58L 4U7KA 1BZ9A 3S5LB 4PJCB 3T3PF 1R5WB 1EHAA 1QRNE 1CXFA 3MUGB 2D31A 5IB2A 4U0RB 2MWCA 3S37H 1U8KB 5C3LD 1PSKL 1UFUA 3N0PB 4RX4A 1MIEL 1VEPA 2BNRD 2Z93B 5CGYC 5K9KA 5FYLL 4D0CA 5IEHB 4TSAL 1I9RL 1CXKA 3GHEH 3GSOA 1FIGH 3DV6B 3OB8A 3ARZA 3DBXB 2GTWB 3PL6B 5DD1H 4U6XB 1CVRA 3SE9L 3G5ZA 4LSTL 3W5MA 2R0LH 2BNUB 5F88A 5IQ9B 5DGQA 1QA9A 3QO0A 3QDGD 1XIWC 5DD0L 4R4BB 4N9GA 5BZDA 2YRZA 1VEMA 4J1UA 5FUZH 3LS5L 5JQ6H 1UXSA 1JRHH 2DQTL 5D2NB 5GGSA 2E27H 3ARFD 5KANG 2VXUH 1NSNH 2X4TB 5CEYB 3LKNB 2O5XH 4BUHA 5CD3A 2DIJA 3LY6A 2AJ3A 4O4YH 1FZOA 4JFZL 3BP7B 3V6ZA 3R0NA 4DWHA 3WEXA 4FFVC 2BVOA 2FR4A 4WUUB 3BEVB 1K4DB 2A6KA 5MEND 2WANA 1OAUL 4CJ0A 5DMKB 3WV0A 1HH9B 2ZUVA 4EN3B 1S7SA 3KNBA 1R3HA 4ZAKD 4M62L 1P69B 1VB9A 4AM0B 2YD4A 3DSFL 4R3SB 4RGNE 3QUYB 3QWOB 1VCAA 5TDPB 3K7UA 4XHJC 5JW4N 2DQGL 3VRIA 1JNNH 4QRPB 3DIFB 5F7FA 5GS0H 4KK6D 1T1ZB 5CD5C 2ZUYA 1MAKA 2VDNH 4PGBB 3S35H 3F8UB 4R8WL 3PQYA 1IAIM 1BD2E 1BEYH 3QIUD 4PRNB 3QSKB 1CF8H 1WT5C 2LVCA 4YE4L 1MRDL 1MFAL 3FQWA 2Z92B 3ZT5A 5F9WC 2Q8AH 1QFHA 1INDL 3T0WA 2EYRA 1NGQH 2DKSA 4L8SB 5I66A 1BX2B 3ULVL 4EUPA 4AENA 4HUXB 1L4IA 1XR9A 4YK4B 4Z77B 1WAAA 3O4LA 5CJQL 1BVKB 2C3GA 1FV1B 2FO4B 1ZHNA 3BP6B 2CO6B 3BSZL 3W0WE 4I3SL 1XGUA 4G6AD 4EVNB 5IROC 2D0FA 2Z8WC 4XNZC 3BKJH 1XFPA 4EUPH 3BGMA 1JGEB 1R0AH 2IALA 5JTWA 2QADD 4LVNC 1NMAH 3HE7B 4D0BA 5JUEH 3D0VA 3W39B 2OTUB 3CLEL 4PR5A 5MEPB 1WC7A 2E6PA 4I1NB 4OQTL 4ZAKC 5LBSL 4DW2H 1YYMH 1GVIA 1ZT1A 4U1NB 4PV9A 2XA3A 1IKNC 4JQXA 4P4KD 3I50L 1NBZB 3T0VA 3OGCA 4PJGB 5IQ9A 1X5HA 5CJOL 2FX8L 3MMEB 5D8JL 4HZLB 2W0LA 2H2PC 3CFJA 5E8PA 3TJHD 1UWXK 2UUDK 1L7IH 1F4AA 1DQML 5DMIH 1XH3A 2X9XA 1CZ8H 1HXYA 1UKTA 1RUQL 3KPLA 5HVHC 4K9EL 4Z7QE 4LASL 4XBGB 1JWSB 1M71B 3U82B 3LZFL 4Z9KB 1NBVL 5SWZD 5ID1B 3QDGE 1I1AB 3D2UD 2IF7A 4OFDA 3QO1B 4ZXBB 3V0VB 2H6PA 1OP9A 5T3ZE 4LFHG 1T80A 3EFFA 4YHKL 2XZQH 2EC8A 3KXFD 3QQ4B 4NKDA 4U0RC 5F96H 5ITBL 1UADC 5A3ID 3EYUL 3T08A 3EDEA 5IGXH 5C3TA 2VLKB 5DJAA 5EOCH 3EJYC 2V5SA 5I1GH 3FTGA 4DTGL 1HXMB 2YPLA 3KPPB 4L4VB 4W81A 1Q9LA 2JCCF 3E6HA 2VR4A 2XZAL 4PBXA 3N85H 2EDOA 2AI0H 1IBGL 3IXAB 2F8XC 1EFXB 3L3KA 2X1XR 1HILB 4CDHA 1FLRH 1NEZB 1GGYA 2WZPD 4RMRA 2J8UF 3IDYB 5DK2B 1LO5B 3HAEG 4JRXA 4L9LC 4JPKL 4OLWH 2QADC 4OLEA 1CXEA 3L5JA 5DFVC 1SJXA 1YNTB 3NA9H 2BY3A 5B38B 3MFFB 4N0FA 2XN9A 4RDQG 2VDRH 5CLTA 4ZFOL 2KDGA 2AGJH 5EPMA 4KUCD 1MWAB 2P8MA 4LHQB 3QUZA 5JQ6L 2A77L 4PJ9C 2ZOLA 1RUKL 2CDGA 1WJ3A 2J4WH 4J3TA 4WV1A 4XXCC 4RGNC 4YHPA 1DVFC 4PJXF 3LKQB 1LO2L 2ZJSL 1ZANH 3EOAA 4IRJC 2WQRA 3V4UL 5EO0B 1EHLL 1RJZB 4KJYB 3C6SA 1P9MA 2R1WB 5TQ2H 1KB5L 2IPTH 1CD1A 4JM2A 3FB5A 3KS0H 4M8QB 3RKPA 2P46B 5F44A 1PKQA 2FYYB 3BQUC 5D5ME 2OI9B 4LSQH 3VGHA 2VLJB 5A3IC 4HKXB 4C56B 1KTLA 4NT6B 5I1AB 2P8LA 4NGHH 2QLVB 5EFIB 1A21A 4CMHB 1T1XA 3BP6A 5D5MB 5DK0B 1RURH 1FNSL 1OM3L 1TCRA 4OZHE 3W0WD 2D7TH 4XP4L 2VO5A 4NUJA 4R4NC 3VXME 4LK4A 3RIAF 4WNQB 4MJIB 1I8IB 3NPSB 3STZB 5DA0B 4BQ6A 4PJXB 4I4WA 1X5AA 3U7AA 4YE4H 4U1KA 3PG2A 3I6GB 5I1EL 2G2RA 2EZ0C 4HPOL 4JAMB 5C0BE 4AEHL 1KB9J 1A1MB 5I30L 1EHXA 5AWNH 1UM5L 2YD9A 3GMNA 2CKBH 1CT8B 1JF6A 3ZHDA 1AGEA 1NGQL 2F5BH 5KJRL 4GBXC 2IMMA 3OG6B 3TO4B 4IRSA 5KZCD 1BQLH 5JW4M 4ISVA 1AKJD 2DMKA 2O5YH 1CTOA 1QSZA 2F58L 4P46B 1UZ6E 4PJ9D 1X5ZA 1U92B 2W60A 5C0DB 5EA0H 3WN5C 4JM2D 5ALBL 3W9DB 4IRJA 4OLYL 4YDLB 1J1PL 4NZRH 3MREB 5GISL 5T3ZD 1NFDB 1T89C 4OCXL 1QVOB 2EO9A 3BEWB 4LEXL 4APQD 1R0AL 5DJCA 1FFPB 5E8DH 1N4XL 1U8OA 3QXDA 4JDTL 1U6AL 2DICA 1YEGH 4JO4H 2H45A 1LEKA 1FO0A 1XIWD 4YZFE 1E28A 2ERJB 4BSJA 4KK9C 3V0WL 3BFOA 2FBOJ 3BUYA 5ID0A 5IBUG 1ULVA 3P0YH 4FXGA 3GBMH 5F8RC 1QLFA 3QUYC 4DAGH 3L3DA 43CAB 3CH1A 3V52L 1LO3L 3V6OA 4N8VG 1RMFL 1SVZA 5T1KD 4GMTL 3OX8A 4OD2A 1F6FB 2P1YA 2A74B 2X4NA 3JWDL 4UTBL 3F7VA 5JHDE 4YUEL 5F1NB 3VGEA 4B5EA 3L9RA 3NCFB 5IIEA 2F74A 2O93L 5EUKB 1R5IB 5KVGH 1QA9B 5D6DA 1ZA6A 5HGHA 4XXDB 2Q8BH 2D7MA 4ZXBD 5A16B 1CQYA 4U6HA 4FNLH 3RPKA 4S1DD 4UOJA 5D7SH 3VFPA 3AU1A 1NC4B 2VSCA 3I2CH 3JWOC 1IQWH 3U0TA 2NYYC 3NCYP 4XMKH 3TWCL 2BOBA 4X6CB 5KVFL 1BLNA 1AQKL 4QNPE 1QSFD 1SJHB 1U8LA 5SWZA 2R23A 1FLRL 1MUJA 4PJXE 3FQXB 1AE6L 1DQJB 4DCQB 5F3HA 2DBLL 4K2UL 5JO5B 4CNIB 1SYSA 3QUMB 3QEHB 1N0XH 1W8NA 1S3KL 1YPZE 3I6KA 3WIIH 4LSUH 5DDHB 2Q76B 1C7SA 3CX2A 1YJDH 1CL7L 4QXGL 4DKFL 1MCPL 4Z5RB 2DQUL 4MQ7A 1CDUA 5LJYH 1N5AA 2E27L 4KK9D 4NQXA 1NGXB 4C4KT 3SO3C 4PJBE 1WZ1L 5E5UB 2F8VA 1NCTA 1DE4B 5E9DA 5IVZB 2R69L 1CLYH 5I15L 4EEEA 3P30H 3MRQA 1I1AD 1JFQH 3D2UB 1IC5L 4OZHF 4RRPA 3C09B 2NX5D 4LSSL 1RZIB 4UV4L 5E00A 1ORQA 1P7KB 4Y19D 1S9XA 1FFPA 5HVHB 3MOBL 1OGAE 2YHGA 4Y4HB 2ED7A 3SPVA 5HYSA 4PRID 3TBYA 4GQ9L 3B9VA 4NKMB 3THML 3FRPA 3QH3B 4UDTA 2X40A 3O45A 4UNTA 3QIWA 3FONB 5C0DA 4NGHL 1QNZL 4M9PA 1MAML 2NXYC 5L2KB 4OCWL 5DRZA 3MRKA 1WTLA 4OD1H 1U8PB 1FVCB 4Y4KB 4G3YH 2VDNL 3TJHC 4OM1H 3G6DL 2PO6C 2QSCH 4FG6C 1EGJH 2I9LA 3GSXA 1CD9B 3C6LD 4IDJH 4HJJH 3J8F7 3PQYD 1GOHA 3H42L 1HINL 4PY8I 4Q9BA 1NC2A 2P8PA 1WUNT 3RVWC 2UWEB 3TESA 4PJDB 5D2NE 2D3VA 3P77B 1QLEH 2BFVH 4NRXB 1KCSL 3OKEA 4UI2A 4MAYA 1S7QA 1UWEH 4OSUL 3VXSB 5L0QB 1WQVT 1FJ1A 4LNRA 5J0BA 3RJQB 4R0LC 5HGAA 2D03L 4WHDA 4NC1C 4HK0A 5HHOD 1HKLL 5IFJB 2VMFA 1BP3B 1KTLB 4NT6A 2V5TA 4JQVC 2XTLA 2HG5B 2E5EA 1IEHA 5HHQA 3UAJC 1HOCB 4AEIH 5IVXB 2DTML 5EZJA 3BE1L 3VWJA 1Z2KA 1AP2B 1MPAL 1HH6B 1NMAL 3IRPX 1EH9A 5I1IH 4OCYH 3VGAC 2OLDA 4DZ8A 3SN6N 3SJVB 1ZGLP 1P7QD 5HD8C 5LBSH 2J8OA 5HYFA 4DW2L 2X44D 5IJVB 2XY2A 1WIPA 3IDXH 4OZIB 5FYKH 1WK0A 4YGAB 1IFHL 2IFFH 3HI5L 3QI9C 5KSAC 1RUPH 2CH8A 5D7JB 1QKZH 1QSFE 2BVUA 2NXYD 4ZO7A 1A6AB 4XNQA 3FO1B 4NWTH 32C2A 3A6BH 5CZVH 5I1KL 4F57H 1D9KC 4LAQL 2Q3AA 4L3AA 3WBDA 3IJHB 1ZOXA 1PQZA 2VDOL 4QT5A 5I17A 5IBUB 5T33L 4IRJD 1QFOA 1RU9L 3CFEB 1YC7A 4LPCA 1GXEA 1BJ1J 1BAFH 3MBXL 4QRTB 4QHUB 4YDVB 2BVPB 4Y16D 4PB9H 1YUHB 5IOPB 3RGVA 1S7TB 2NY1D 2G60L 1T22B 4QHKJ 3VWJC 5GGVL 4ORGA 2DQEH 3QZWB 3MROA 4IRSD 1XGTB 2NTSP 3CFDA 1JNLL 5D96B 2XZZA 1O7SA 1OTTD 4W6YB 2AI0L 3QG6A 2XWBB 3CFKB 3OKLA 1UJ3C 5F97E 2FRGP 4NKDB 1A4KB 3UAJD 3TCXA 3VXOA 4KROB 4LU5L 5DRNA 1PSKH 2PYED 5GGUB 1J8HE 1KTDB 5ID1A 5GSVB 4NKIL 3L5IA 2YK1L 3P4LA 2WIIB 4LSUL 4EIZC 3HLAB 5JA8B 4ODSL 4QHNB 1Q9KB 4PRPD 1GHFL 1S78C 3HC4L 3ZKMD 5BO1H 1GZPB 5C6TL 1K8DA 1QLRA 5MP6H 2GK0B 4NQSA 3WO4B 2BNQD 5C0JB 1G9MH 4HEME 5FGCE 3RIAK 3NZ8A 3UP1A 8CGTA 3KYNB 3IU4L 1F4XH 1V7NH 4JR9L 2E6QA 2CPCA 1R3JB 1VEOA 4KHXH 4MB3A 2E7BA 1J0KA 4PGEA 4TSBL 1YNKL 3CGTA 2BMKA 2VISA 4FMKA 5A40E 5ACZA 1J10A 4M48L 2XZCH 2IPTL 2OR7A 2ICWB 3H3PH 1HYRC 2X9YA 2DIBA 1FH5L 3K2MC 3HAEH 4LARL 1ES0A 4Z7VF 2V7HB 4HIXH 3WFCH 5DJXB 2HJKB 2IAMB 2RFXA 1KG0B 1J0ZA 3MXVH 3F5WA 5TH2A 1ZLUK 3VWJD 1BVKA 4NC0B 4HWEH 1V8HA 5HYJA 3DX8B 4WW2A 4ENEC 1FFNB 5I8EB 1OAQL 1M7IB 4RA3A 1T3FA 3C9NA 1I3RA 5F7LB 2PYFB 3LMJH 5HHOA 1UKQA 2R4SL 3X3GL 5J9PB 3QFJE 5GPRA 1F58H 4WO4C 5EOQL 1G0DA 2OBGA 5JOPE 4JEGB 3ROOA 4IDJL 4XVTL 1A9BA 1F42A 4L1DA 5I1HH 4UUJB 3BPNB 3ULUD 4P9MH 1KLGA 2FGWH 2AEPL 1NLBL 4JY5L 3PWJB 2X4SA 3ZO0A 3MA9H 3PQYB 1I3GH 4MMZC 5T1LA 2A6JA 3QH3A 4NHUA 2G5BB 4KZEH 1JTTA 1XF3B 4HULB 1KUMA 1QLEL 1U9KA 2X2YA 5HYJE 4OLZH 3T77A 2UZIL 3DX7B 5DI8A 4LCCA 1DEEA 3KLSA 2EIDA 4Y5XA 5SWQA 5B3NA 1BBDL 3CAFA 4NNYB 4XTRD 5F6IB 4Y4FB 4EIGB 4CMMB 4U05A 1A9EA 2IBBA 1F2QA 2C1OB 1A1OB 4XI5D 1WCBA 2FB4H 1QR1A 3Q5TA 2NMSA 4IS6A 3WLBA 4I3SH 4PGDA 4Z8FH 2CQVA 4ODXB 1DVFA 1T4KA 1QYGH 2NW3B 1KCRH 1ONQA 1RZ7L 4YBQD 1M6OB 3C5ZD 5KSUA 4E9LA 3VFUA 3RL1A 2HKFL 3HNSL 4YHLH 1AO7E 1W72A 2BOCB 2Q86A 3DVNA 1A5FH 4WEUD 5AYUH 3O3AA 5EWIH 4PRBB 1KCUH 5KVMC 4ZS7H 2CXGA 2NXYB 4GAYB 4PUBL 1AC0A 3QO0B 1XZ0B 1PEWA 1KLUA 4NNPL 2NW2B 3RY6A 4UU9A 3D0LA 3C5ZA 3MJ7B 1ND0A 4L8CB 1UJ3A 2AERT 4G8GB 3WDIA 3MLWL 2GK0A 2E9BA 2JJSA 5T3XD 3IDMA 2YWZA 3R1GH 2JJTA 2Q7YA 2VABA 5JLZA 3CIQA 5BW7A 2GCYB 3WXWH 3QUZC 1VESA 1B2WH 2IBZY 1MHEA 2F74B 1N2RB 4KTDL 3LIZL 4M5ZL 4NO3A 1KC5L 4X5WB 3QXTA 2QL1A 1V3LA 3EHBD 3CH1B 1IQDA 4HT1L 4QF1A 4NZTL 5J06A 3R06B 4X7CC 2YR3A 1QRNA 1NFDF 5T1LD 3U4EB 4EQ2A 3WS3A 4GW5B 3B9KB 1CI5A 2V5MA 1NMCB 4UT7H 1F3JA 5IT2H 1FAKT 3RNKA 2ZUUA 1DANU 3ZHKA 1X7QB 4O58H 5CP3H 1E4WL 5C9KA 2IWGA 3FB6B 5C0RL 1P7QA 3DPBA 3QPQC 3TH4T 3BH8B 4GW4B 3FT2A 3OGOE 3RWHA 2GSIA 4U1GB 3RTQC 3CMOL 2EDDA 4FQJL 3JTSB 2ITDB 4P9HH 3GHEL 2VIRB 5IESL 1I3VA 3JWOH 5MENE 2J4WL 4KK5D 2FIKA 2FJGA 1FQ9C 2ATPB 3QEUA 1Z0MA 3HB3C 2V17H 5F1IA 1XCQB 4MAYD 4QWWC 4ZAKB 5FK9B 1MIML 4BKLA 3ARFA 3HZKA 2DQFA 1GL4B 1XF5A 3I75B 3S35X 4UV7L 1IGJA 3H2WA 2V2WB 5JXED 4HWEL 3D39A 3D3VE 3JZ7A 5C8JB 5FGBA 3NFSH 2R56H 4KTEL 3HCVB 2VXUL 1YN7B 4V2CB 3RUGB 4KKLD 1FLTX 1CWVA 5MI0B 4PJ9A 1SBSL 2X5PA 4GKZB 4M4PA 3AS3A 3D18A 3O2VL 3VXQB 3C6LA 4YHML 4YR6A 2LU4A 3K8KA 4CN4A 3WIHH 4LVOC 4W6WB 5F9OH 5I18L 2XWJA 1U42A 5B8CB 5FM8A 4XAWH 5B8CA 1JV5B 4RMVA 4WI5A 2KUTA 1LEGA 2VLLB 1UWGH 1G7LB 2UVFA 1E27A 1PYWB 5JORA 2NY5H 1IAOB 3AUVA 4M8QA 4F7MB 4XMLL 4HPOH 1F5WA 1FVDB 4Y2DA 3VFTB 5TE6L 1F90H 2CKBL 5IM7B 2YMXH 2UYLB 3H9SA 5DRWA 3CXHK 5CKAA 2CIKB 3IXTB 4HV8B 4XPFH 4RQQB 3IDYC 2X1OA 5FA3B 3SE3A 4UIMB 1A4JB 3C60D 1PY4A 2VDQL 3D48R 3O3DB 3ARSA 4UDTB 4G42B 3S37L 1H3TA 3IDXL 3QNXB 2W0PA 4PPTA 4U1JB 2XN9B 4WFHD 3CLEH 4UILL 3KWWA 5GSRB 5HHXL 2R0WL 3CU7A 4AY0A 2ZUSA 2EIBA 4YPGB 4JO4L 4KKLC 3P0VL 1CICD 1NEZA 3OAZK 3UJTH 2AP2A 4YEFA 1EZVY 3DUSA 1H5BB 3B8SA 1IGCL 2P7TB 4XPHH 4HFUH 5IB4A 4CRPA 4L5FH 1FGNL 1XF4B 1DE4A 1S5IH 4GW5A 4LGSB 4OUUB 1FORH 5DUBA 3L3IA 4JJ5A 5SWZE 5BS0B 5GS1B 1GGIH 2D0GA 4JG0H 4UAOC 5TDOB 3KXFE 4QO1A 5F7DA 4YGVA 1QHPA 2VJXA 4HIJB 5FYKU 5I75B 4W4NA 2OJZH 5DUPL 4AZ8A 1MHEB 3V0VA 4CNIA 3ZE0E 1H3PH 4ZXBA 5JO5A 2CMRH 2ADJB 5FOBB 2E7LA 4PRAB 4YXLH 3ZKND 3U4BH 2P49B 5EOCL 4TTGA 2R0ZL 4GMSL 2YD5A 4TUKL 1KF9B 5D71H 1FE8L 4NM4L 1P4BL 4JRWA 1DQQB 4G6FD 4U2ZA 1OSZA 5GXBB 2LU7A 1FBIL 3BPCA 5A2FA 1KPRB 3DVIA 4K8RL 4LLVA 5CHNB 1DL7L 3HI1B 5KSVB 4JHWH 4OKVB 3OGCB 3C60C 4BM7A 4PJ8B 1SJVA 5FF6A 4OB5H 4EDWH 4GQPH 2X4UA 5IJKA 5HDLA 2DBLH 3O3AB 1D9KA 4XPBL 1YA5A 1G9NC 3LSOB 2ITCA 4P3WA 2VL5A 4G6JL 2WBKA 4P2QA 3NCMA 3P4MB 5I1CL 2A77H 4QRQA 4APQA 3MV7E 4KHXL 3KAAA 4HIHB 3WN5B 3IT8D 4BSWA 4FQQA 2MQ3A 4IOFD 5DQJB 3TBVA 1ZK9A 3IKKA 5KSAA 3SDYL 3RKDC 4Y5VC 4KK6C 3FFCE 2EIZB 2XTJB 5AEAA 3T0XA 3WIFB 1QR1B 4LARH 1MWAL 4F2MA 3C60A 4EI5B 4EUPB 3L7FA 2CRMA 5DD0H 3BX7C 2PYEA 1LEKB 3WLWC 3BW9A 4X4ZA 3QIUC 1AKJA 4PJHA 4DUVA 3ZTNL 1DN0A 5EULV 1F3RB 3FQWB 3QXDB 4YBQC 2W9EL 5CJBA 3C2AL 4S2SA 4R7NA 4CBPA 1UVQB 1H3WM 3BZ4B 5D1QB 1QVOA 5E8OB 3KLAA 3V4VL 3GBNL 3QDJE 4QOKA 1UZ8A 4KI5F 3ZKNC 3IDNA 2K3TA 1SBSH 4M7LH 4ZFZB 2VZSA 2ADGA 5FO9B 2HJFA 3FO2A 5CSZB 5CINH 2PTVA 4PJBB 5BVPH 4NPYB 2HJLB 4K94L 4HXAL 4Y16A 3P11H 4M62H 1EVTC 3GIVB 1MFCL 4U49A 4LCYA 2X4PB 4WFHE 3UTQB 5BQ7B 3A6CL 3VG9C 3VXMA 4LLDA 1CZ8L 4D3CL 5BOPA 4ZTPH 5HVGB 4HUVA 5EORH 4MDIA 1T2XA 2DQIH 1RIHL 5BMFH 5F93C 1MLBA 1HH9A 4XGZA 1RURL 4UQ3B 5HGDB 4XP4H 2C7UA 5CEZH 3REWB 1I8IA 1RJLA 2EE3A 9CGTA 3ZDYF 5MERB 3DGCR 5ITBH 1WLHA 2EC9T 1FC2D 1KBGH 4X7FC 3WFBL 2ICWA 3RY5A 1CCZA 2Y07H 2NLJA 4Q9RL 3RKDD 1U3HB 1D5ZA 2D2OA 4U1IA 1R3LB 1BJ8A 4M6ML 3G08B 2JIXB 1Z0NA 2F5AL 4HWZA 5KS9A 1S9WA 4R4BA 3G6JE 3WLWD 2LU3A 4CKVX 4Z76B 4NQEE 4TNWK 5IKCB 4RGMC 2XN9D 4X7SH 1RZKH 2AJYL 2QBWA 2FLBT 5EA0L 4D9LL 5DYOA 1OB1B 4NRZA 4EQ3A 4U6TA 4Z0XA 1Y18A 3O4LE 5JHDD 1CICB 3O3EA 5DEFB 3GMRA 5JQHC 1UA6H 3RWEB 1VSCA 2PXYA 3RWDB 1XIWA 3B6SA 1T03H 2YPLE 3VRLE 2IQ9H 1RUKH 5CLWA 5EBLA 1GC1C 3R1GL 2DYPA 2FJFB 3SDCA 3HN3A 5C6WH 3TYFA 5KVGL 2XWTA 3KYMB 5CJOH 1MCQA 3Q6GH 5DZOA 3FQNB 2XKNA 5C0ND 3WFHA 5ITFB 5HDQH 1LO5A 3U7WL 2ESVB 2G9HA 3KVQA 1T7WA 5E2UH 5TDOA 4D9QD 1AGCA 2OL3L 1AGCB 4GMTH 4LPUA 4PJ8C 3MRMB 2DL2A 4JJ5B 1JWMB 4NZTH 1DSFH 3PL6C 4EI6B 4BUGA 4OFYA 3MRJB 1F6AB 1TJIL 1DL7H 2QSQA 1MCBA 1FNSH 2BRQA 1OM3H 4L29B 4XVUC 1PQZB 3TZVB 4UT7L 3VA2C 5K9QI 1T66D 1TVHB 4FZ8H 5L9DL 5I1GL 1S9YB 4P2CG 3KWWB 1ZLWK 1JPST 2MQCA 4OI8A 4AMKH 1WWWX 2K7QA 2W65B 4OCMC 1IRAY 1OF2A 1EFXD 4N90D 1CGSL 4D9RE 4JGMA 4M3KB 4X6EB 3O3DA 4P5TA 3TT1H 5KN5B 1CDBA 3G6AA 3ZKSD 1RK1B 1JPSH 3DTXB 4BSVA 5EBWB 3RZCA 3BKYH 4OZHA 1B0GA 4RA0C 3O6LH 2LTQC 1DFBH 3LRSB 2UUDH 1U8JA 3B2UD 4MXWH 1FNGB 5DHVA 3OR6A 4G8GE 4C59B 5ABDE 3BP5B 4CGTA 3FRPG 4B50A 1EO5A 4MA1B 4PJGE 2WWMD 2IALB 1T7ZA 3KJ4C 2R69H 5E1AA 3GBNH 4UQ2B 4QXUL 3VFMB 2OP4L 1BWWA 5EU3B 3IVKA 4JKKA 5ESVA 1JV5A 2FJHA 3MRPB 1IGYB 1J8HA 2K1MA 1XR9B 4DK6A 1BHGA 2VH5H 1AHWB 5EZIH 3TVMC 3MOBH 3H7LA 1LNUA 2NNAA 2QKIB 1N8ZB 3MCLH 4C83B 1A1NB 2OJEB 4S1SH 1LO3H 3LB6D 3QUXD 2VITA 5EG6C 2AAVA 2X4OB 4GRWF 1HHIB 3EYFB 4RWYL 2I07A 2JCCE 3HZKB 1F90L 5H94A 2EXWD 4YK4C 4AH2B 1FNFA 4MXVF 5E03A 1ZA3A 5BZWB 1FZMA 3K4AA 4CVXB 4ZFZA 4KY1L 3KDMA 5AYQA 2YPLD 4XPFL 5GHWL 5HPMB 1JYNA 1EHNA 4QTHA 3V6FA 1NCAH 1A6VH 2XRAH 3BZ4A 3RNQA 1U8QB 1T21A 4KROC 3ECBA 1G9NL 3NFPB 1CFSA 4Y7MA 4M1CC 1MCIA 4JANB 5FA4B 1P7QB 2F5AH 4N0RA 3D2UA 1E4KA 3HC0A 5C70A 3FN0H 3LEYL 5T5FH 1UCBL 5J57B 5F89B 4PTUA 1X7QA 2PW1B 4J4PD 2NZ9C 2PR4H 2FNBA 4TULL 3WDHA 4R97C 4OLYH 2B1HH 4PJFE 1QRNB 1X5FA 1T2QH 3C8KA 3WHXA 4C58B 3GEWB 5JXAL 1RZFH 3ABZA 1DDHA 2VB5A 4KDTC 1KCKA 4LAQH 4GRLD 2IJ0C 1GOFA 2DLEA 2XKSA 3P4NB 1YEHL 1OAKH 1YEFH 5BS0E 1EO8L 1W72L 1WZ1H 5D5MF 1FHGA 2VDLL 5I1JL 2FZ3B 1KYOJ 3QULB 4Q9CA 2APXA 1DQTA 2A73A 3MV9A 4H5SB 3R0MA 5F88B 5ACLA 1YMME 2FEDC 1DBJL 4MS8D 5IMLA 1IJ9A 3LPGA 3QHFH 4F57L 3OB0H 2V9QA 3RUGF 3STLB 1CFVH 2Z93A 4RIRB 3INUL 5K9KB 2RBLA 2PW2A 4I8DA 2Z91B 4AQ1B 5FGCB 5E4EB 3E6FA 5C0AE 1WZKA 3HI6H 3TPUB 3SDXA 1MFDL 1Q8MA 4OJFL 3TNNA 1XGYH 3G6AB 1IGMH 1OGAB 4PGCA 1A3LH 2EEAA 4NO5B 4LPYA 1AO7A 1VFBA 4FNLL 4PJ7F 1D6VL 2DQDL 2AK4E 4LLQB 3A67H 2FL5B 2BVYA 4KH2A 1HI6A 5AZEL 1I9JH 5J56B 1HWGB 2HYMA 5C08B 5K9OB 5D7LB 2AJSH 3QDMA 3K4DA 4PJCF 1BJMA 4OFIA 5LWYH 1T20A 3IFLH 5LQBH 1C08B 2X4QA 1KJ3L 1RI8A 5C0RH 5D1XC 4I3RH 3O8XB 5JPMA 4R7DB 1NL0H 2A38A 5AD0A 3ROLB 1DFBL 2AJZA 1BZ7B 5DS8B 4HWUA 3OKOA 3ULVC 1II4E 4YZFF 4TVPD 1ZKAA 2QQLH 3ZHLA 2NY4B 3TN0D 5FDWA 1IM9D 4EOWL 4YHNB 1W0VB 2D7PA 4X6DE 3PGCA 3LKPA 4MXQC 4PRHD 4XCCH 4JZJC 2VNCA 3HRPA 3HZYA 3S36X 4AH2A 2ARJB 2I9TB 1QSEA 4K55A 3OV6A 4OZFG 4XBEL 4B53A 3TFKD 2AVGA 2GJ6B 3HZVB 4LPWA 5JZ7D 3L5XL 1EJOH 1INEH 4YPJA 3GMOA 3QCUH 3HI5H 4PFEA 5BRZD 4J3UA 5CEXB 2XG5A 2WBWB 4PTTB 1HEZA 1V7MH 5I8KL 2FWOA 4KDWA 1PLGH 4FQLH 3STBA 2QHRH 3FMGL 4HFWA 2WINB 3MOAL 1IC1A 5ISZD 5F3BA 5L8LB 4HJ0D 1EEQA 3ARGB 5AUMB 1T1YB 3CSYB 2AXFA 5FHBL 1IKNA 1G6VK 3VD4A 1EGJL 4WFGE 2DWDB 2LVEA 4JRYD 3SDDC 2FSEB 2OXHA 5CEXA 3BRDA 4XP6H 4FQ1H 3D85B 3RVVD 1X5XA 2BXZA 4X6DB 2H1PL 2VWEC 4LF3A 3UPRB 4RISH 1Q0YL 5M94B 4L3EA 3ARFB 3EOAB 1A0QH 3HUJE 3FQUB 3BN9C 3KYNA 3MSPA 3BD3A 5ETUB 1FL5A 5GGRB 5IMOB 1MJJB 1JYXA 2C7UB 4MNGA 3ULVD 2ADFL 3W2DL 5DJ0A 4BSVB 4ZD3H 1TZHA 5ANMB 2GUOA 3OZ9L 2EYTA 1BGXL 3C87A 3FCTB 1IE5A 3P40A 3S3JA 1AI1L 4OCSL 3L6FA 4FFYL 4NBXB 1GOGA 5JIIA 1MHHB 1HSBB 3HNSH 1QBLH 2SEBA 4MDJA 5DRNB 4MNQA 4OT1H 1PEZA 2AV1A 3GIZL 1OTTC 4Z7QF 3OKNA 4V1DA 4OCYL 5DJZB 4AIZA 2AK4D 2HKHL 4KVCH 1HN1A 3OKLB 4QGTA 1YEEH 2H8PA 2XWBA 4X7DC 1ZLSH 2HTLD 3KPQB 5F21B 1FORL 2LAGB 1B4JL 3LEXA 1MI5B 2IPUK 1RUPL 3MLWH 1K6QH 3DVGB 2N7AA 3MLXH 1YNKH 3E6HB 2HKFH 1KJMA 3JWNC 2J88L 4PB0H 4UBDC 4CVWA 1UACH 2BK8A 2VLRB 4Y5VA 1F3DH 2QR0B 2CLRA 4BK5A 5KBNC 2WBJD 4IMLA 2BVPA 2VLMD 4BFIB 2OMBA 3LS4L 3MYJB 3QRFM 4JVWA 1C5BH 4XT1C 4XP1H 4ZG1A 5LXGL 1AGFB 2AXHA 3NACL 1NCCL 4MAUH 4F80A 1IGML 4APQB 2XI9A 3STLA 2EH7H 1VFUA 4LFHD 1VGEL 4DUXA 5IMMA 3X14A 5GGQH 5EIQA 3AREC 1KACB 5IMKA 4P5KA 1S7UA 1Z3GH 2VE6B 4GG8B 3MMEA 3PJSB 1PZ5B 4OZFA 3UBXG 5HYSG 1CK0L 2X4UB 2FBJL 2QADB 3FN3A 4EBQL 3QWQB 5ICYB 4TUJB 3ZE1F 4X4YB 3AMKA 3MV01 2VR9A 5ICYA 3TT1L 5KVEH 1JWUA 2D9CA 1FG2B 4DZBB 2Y6SD 1MCDA 1S7UB 1A3RH 1CLOL 1HOCA 1OSZB 4JVPA 3JVGC 4MVBC 2VZ3A 4WI8A 3RL1B 5FHAL 3M8OH 5IVXE 2VKWA 4Q9QH 1IGIH 4TSCH 3GSVB 2BSTB 5IT2L 1DVFB 3OHXA 3QNZA 1HNGA 5KG9B 1AGFA 4MAYB 2WUBL 3V7AE 3D3VD 4JE4B 5KSBE 5I6XC 3BRFA 3FOMB 3KPMA 5EU7E 1IM9B 3REWA 1KB5A 4FTVE 2EYRB 1TVBA 4LGRB 4L1HA 3RDTD 4F7CA 3VXTB 1SVCP 4Z7NF 3QXVA 2YSSA 3VG0L 1QACA 2I9LB 3L5XH 3OR7B 4XTRC 3I3EA 1XF4A 4L4VD 2QJDA 4XI5C 2XXMB 4GSDH 1FFRA 1CR9L 4HIIA 5E8EA 3EYVB 5J6HB 4OFPA 4PG2C 2R56L 4ZFOA 1CE6B 2DDQH 3P4OB 3FT4A 4P2RE 1VACA 3X3FH 3QWOA 4WCYH 1TTFA 2F19H 2Q87A 4RMTA 4GBXA 1QPXA 3WS6C 5GGTH 3CPLA 3Q0HA 4XP6L 4M93C 1U58A 2J7LA 1DN0B 4UT9L 3F58L 1J8HB 3BW9B 1BF2A 3GHBL 4MNGE 5TH2B 3BQUA 1EIBA 4EI5A 2CIKA 1XF2B 4JFOA 2UZIH 2BDNL 1P5VA 2GK2A 4GW1B 5DMGC 4HT1H 2OXGA 3MV8B 3RX5A 2R1XA 2R8SH 4MCZA 2FATH 4QRQB 4NQCB 4HBQA 2B2XL 4LNVA 4J1UB 5HHXH 4NCC1 3QUZD 4OZGE 3QEHA 1LEGB 1Z5LB 5DQDH 4JPVL 2VUOA 1D5IH 4XC3L 4Y4KD 1FN4B 3NCEB 4ODHL 1T0PB 4YLQT 1F6LL 3P0VH 3IJSB 5AG9A 4OV5B 4YDIH 1A6PA 1EXUB 3M17B 5C09D 4IHOA 4HKZB 4OIIL 2VDQH 1BLNB 4JRXD 3SE4A 1DBKL 4RZCA 5DJDB 5L8JB 1QFUL 3JTTA 2AEQL 2V7NA 1FO0L 1CDGA 2H26B 2W9DL 1U8IA 2I60H 4TNWF 4U1HB 5GSVA 5D96C 3MJ6A 1XF1A 2LFGA 3ZYJA 4U1GC 3AROA 3RTQB 1JF1B 4P99A 1A14H 4U6HB 3V5HB 1LVEA 2AABH 1REIA 3GJFB 3MLVL 4O4YL 3O2WH 5FK9A 4S1QH 4YNYA 4HIEA 4PG9B 2MSPA 5E5RB 1M7XA 4KKCD 4BZ1H 4WGVB 4NNXA 2NY0B 5GJSH 2FJGB 1F6AA 4X4XB 3QJHB 4UV7H 1OARH 1YEIL 2VN7A 2WUCL 5JNYA 1FE8H 1KEMH 3MRMA 4ORGB 4YXHH 4RGND 2XFXA 1L7TL 3E0GA 4D0DA 3RWHB 4FXKA 4MHHI 1VDGA 1BPVA 1RFDL 3IS1X 1HDMA 3MUHL 4ZUSB 2B1AL 4K3DL 1MCNA 3WXWL 1OLZA 4LEOB 3QJHA 4OLXH 1F4YH 3KPQA 5DMGD 4K71B 4L3ED 3HB3D 2CIIA 4N1CA 4WEBH 4NZDA 2WWKO 3WJLA 1F11A 3MV7D 4HMDA 5LQBL 4KPHH 1CBVH 1T83C 5DJCB 3T04D 4G8EA 3G5XA 4JFDA 2F54B 4L4VE 4KRPD 4XMLH 5HGBA 3V79C 2ENSA 1KN4H 1T5XB 4RFOL 3TCLB 1YEKL 3M8OL 3K81A 4DVRH 2EYSA 1FPTH 3VFRA 5JNYB 4ZYKB 5DYOB 8FABB 5ISZA 3BKYL 3IJYB 3AREA 4P2RD 4FQXB 1ETZB 1OTUD 3IYLW 3D69A 2NY1B 3MLTB 5BCAA 3BDYH 4RGMB 5JLZB 3H9HB 4NN5C 3GI9H 5EZJB 3GMNB 3LS5H 3DHMA 2EDQA 3O4OC 1OP3H 3QDJD 2IG2H 2YRPA 4U1MB 4Y2DB 3VA6A 4N8CH 3BDXA 3L3JA 5IMLB 5DSCA 5CWSA 4L9DA 3S3PA 4UU9B 3HS0B 1HCFX 3SKOB 2R1YA 3O6KL 1FYTE 2FO1A 1XZ0A 2GT9B 3RGVC 5J1SC 4P5MB 3O3BB 2W9LA 2DS4A 2VSDA 3NPSC 1T83A 2M1KA 1X5JA 3BH9B 3T0EA 1P4LB 2FECL 1JZ5A 4DJMA 3IJSA 4OV5A 1ZHLB 1FN4A 3GSNB 4I0PB 3S34L 1DUZB 4LSPH 1H5BC 4APQC 1RJYB 5CP3A 4Y4FC 3HPJB 4GBXB 4LLDB 4ZOAA 3MV8A 3RI5K 2EDRA 3GGWA 3GMQB 4HUUB 5C2BH 5GZOD 4WHTA 4EJ1C 1D5BA 1AQDA 1R5VB 5JOEA 5DVOA 4OZGF 1TFHA 4Y1AB 4JN1H 1F8TL 5HI3C 4K3EH 3F6IA 4YJZL 4ZAKA 3QDAA 4TQEH 3SKMB 1OAZL 4J12A 1U3HD 3VU2A 3U4BL 2CDGB 1I8MB 1BM3H 3W2DH 2IANA 2ZCKL 3CPLB 4M1DH 2V2TB 1WBZA 1P7KA 3U83A 5EZOH 3ARBD 1U91B 1MIEH 3NIFF 1VACB 1BBJA 3T4AB 1A6ZA 3VGAB 3UTSB 2H2SC 4NUGH 1HZHL 3L7FB 3I6LE 1L9NA 1MNUL 3HG1A 2EDKA 1SMAA 5T3ZH 4KU1A 4JPVH 3VXUA 3NZHH 2ICEA 2NYYD 1ZV5A 3VFNB 5KSAB 4Z7OF 1NCBH 3SY0B 5KG9A 3MR9A 5D72H 2BY2A 1FCCA 2N7BA 4JZJA 5I1LA 4ETQB 4U0QB 4Z0BH 4G6JH 1JPGB 1IARB 1XCTB 1N8ZA 2VLJE 4TNVF 1Z9OA 4HEPG 2APFA 4C4KO 1N59B 1UGNA 3OKMB 1O5DT 2Q3ZA 3QUMA 3VGBA 4NDMA 2DIAA 2G5RA 1ODAA 2ADIA 2EXYD 5ICXB 4ZPVB 4Y4FD 1KIQA 4HUNB 1EX0A 1JZ6A 1MQKL 3V6BR 2EECA 1RZGB 4QXWA 2YOCA 3GB7A 4XZUB 2ICWI 4UB0L 5D93B 3UDWC 4LRIC 4G9DA 5F1KC 3TT3H 3V5DB 5CEZD 5EO9A 3SGDH 3OR6B 2OZ4L 1EEZB 5CS7A 1WZLA 2ZCLH 2BCKA 3SO5A 2XT1B 5T1DH 1VGKA 4KVNH 2DL9A 3P0GB 1B88A 1TETL 3BWUC 3HI6L 4NZJA 4XZUA 2NY7H 2XQYK 2JELH 5ADPH 1ZT1B 4N90E 4MHHG 5TDNB 4G6KL 5IEKB 2OTUA 3G04A 5CSBA 4D0BB 4M03A 4B7IA 1GJIA 1FYTD 5J12C 4NHCL 3VRJB 2C3VB 4K8RH 4R2GB 1S7XA 3LH2L 1MCOL 4O5LL 4EVNA 3U36B 3VGDA 1XCTA 25C8H 5FIEA 1MCCA 4PJEB 1UM5H 3MRFB 1TITA 4F37F 4FZ8L 4G8GD 3O6LL 5F89A 4OLWL 1H9VA 2HFEB 3C6LC 3TBSB 4Y4HC 2JK5B 5DRXB 3TLRA 4YAQA 2C1OA 4AMKL 1F00I 5HDBE 4NFBA 1XGTA 3LAFA 5FA4A 3WFBH 2CLRB 5EBGA 1J8KA 3O3UN 4P46D 1A6ZB 4HXBL 3RVWD 5I9QC 3W9DA 4P3CL 2Y5TA 3TEUA 1KNOA 3RGVB 4XPTH 1QTYT 1LMKA 1DEEB 2VDPL 3VG0H 4OGXH 5CIPB 5C08E 3WFHB 3T2OA 3J7HA 5EC1B 5JUEL 3T0ED 3WHE1 3WL9A 1K3IA 2JJSC 4MNGB 4OQTH 1SHMA 1Q9OB 2R0KH 2X4SB 2ZPKL 5ADOL 3AXLA 4KDVA 3I9GL 1JI1A 4UUJA 2WQ8A 3U30B 1A6WL 1A9BB 5GZNC 5IVXF 4U6YA 4QLRA 1ACYH 2X9WA 1HSBA 1H0DB 4F7MA 1Z6JT 3VD5A 3MLYL 2QKIA 3NBNA 3BAEH 4R96A 3L5WB 3KG5A 1U3ZA 3FKUS 1YZZA 4JLRA 3ZT6A 4OZIA 4UTBH 1G7LA 3L3OB 3QT2A 3RZCD 4OZIF 1U41A 4P2RA 4HX1B 2B5IB 2CUHA 4GBXD 4FQCL 4XCFL 3ULUH 3BRGC 3HMXA 1TCRB 2X70B 4MA7H 5IBTL 1BIIB 3OSKA 4NQEA 4K3EL 4XVSH 5GHWH 3O3BA 2W0KA 3ARQA 1CF8L 3MCLL 4Z7OE 2JIXA 1JHLH 4ZO8A 4P57B 5F6IC 1HEZB 1MRDH 3SKOA 4JFDD 4O2EB 1PKQB 2CD0A 4A2LA 2H1PH 1FJ1B 2ZCKH 1Q0XL 3V8OA 2AEIT 4FTVB 3ARVA 5EO0A 4NRXA 3CVHL 1BQHB 3OTTA 4X6FB 3ARGA 3LEYH 1BD2B 5T5FL 5KSBB 1HHKA 1A7QH 2NY1C 1H8NA 4JPIA 4U1LA 2X70A 5F3BB 2ZP0T 1HZHH 3OQ3B 1NC2B 1G6RH 3TNMA 2ATPA 4WV1B 1G7PB 4FQXA 3NA4A 3EYQD 3FQRA 5KN5A 4LGPB 3T0EC 4JO1H 3D39E 3D3VA 3KLDA 3T0AA 3RA7H 3K46A 4M7KL 1JIBA 5HGBB 3S37X 2WNGA 1FVCA 2OR8A 2W65A 5EB9A 4WY7H 3N9GH 4NC1E 4ZFOB 2HKHH 1TCMA 4OGAD 3HR5A 3PWLB 3O6FD 5EIVA 3MLSH 1I1FB 3VMOA 4WU7B 3UBXA 4WUUE 3GUTA 4GKSB 2PXYD 2BZDA 2HWZL 3HAEB 1Q72L 1L7IL 5JHDA 5JIHA 3RZCC 5JW5B 1DQMH 5C0AD 1T03L 4DGIH 1KJ2A 1X5KA 3V52H 2YXFA 2B20A 1OAKL 1S7TA 1AGDA 4M61B 2ESVA 2OI9C 2ZCLL 4LVNB 4DQOH 3Q6GL 1ZT4B 1TETH 3PP4H 1PX4A 3TPUA 4MCYA 4OCWH 5I8CB 4RAUB 3QHZL 3SCMC 1BIHA 4U7MA 5EBLB 4OD1L 3D6GA 1OWRM 1VGEH 5D7LA 4JHAH 5C08D 5CJXA 1DQDL 1CFVL 3A0OA 3WO4C 1EEZA 4PJAB 3AY4C 5AAWA 3F6LA 4H8WH 3JXAA 4HGWA 2P5EB 1EUTA 3T0DA 5BJTB 4J7RA 4ENED 3NIGE 1AO7B 1VFBB 1INQA 4POZD 5T5NF 2Z8SA 3MJ8A 3QBTB 3GM0A 5IHBA 2EDTA 1I8KB 5DC4B 4Q0XH 3SJVE 5I9QB 2JJTC 3U2SB 3D0VB 4JFFD 3NA9L 2VQ1A 4YIQB 5BJTA 2PW2B 2DJSA 2XNAB 2Z8VC 5D1QC 4Y5YC 4I13B 4U3HA 3O9WB 5TFSH 3GSUB 5KSUB 3RY6C 1BVLB 1KTKE 3QUXC 3HPLA 1G7IB 3HE6B 2X1WL 4ODUB 4MNQD 1GYAA 5HGHB 4PGDB 2H2SD 4LMQE 2EEDA 4BH7A 1C5DA 3O6KH 5HI4D 3FFDB 1OGTB 1NAKL 1OAXL 4LVEA 4GAGL 5MERA 1IEBB 3GK8H 4IMLB 1RZJH 4ZDHA 4HHAA 4UQ3A 3P9LA 3IGAB 1CFSB 3VWKC 4ONHA 4ODWB 3S34H 3SHSA 2EDYA 5CD5D 3FRUB 4JZOB 4M8VA 5ISZE 4OUUA 1GCFA 1LP9F 1MI5A 3TV3L 4YBLB 4ZFGH 2DQJL 3MLYH 2XY1A 1IT9H 1HIMH 3BGFC 5HI5C 1X4YA 4JRYE 1SM3L 4FQCH 3EYOB 1F8TH 4JRYB 1A6TB 1KULA 3VGFA 1BAFL 3MC0A 2Q8BL 4NKMA 4XX1G 1OD9A 1MOEA 4KMTL 3BZDA 4M7LT 3HPJA 5GRJL 3K0WA 1MVFA 1T3FB 3C9NB 4K9EH 1K4CB 1JTPA 4WUUD 2YPVL 5DJ0B 3GSNA 2F5BL 2MPAH 4PGZA 2BSRB 2FIRT 5BZWA 3H0TA 3QP3A 4N5UA 1P4LA 5DJXA 1ZS8B 3HUJA 4R90L 1C5DB 3AM8A 3HKFA 1QSED 5EUOA 2E7CA 2PYEE 3VFTA 1V05A 2R1YB 1B9ZA 2B0SH 3HS0A 5LCVL 4FQQB 2FATL 5F7YC 1UG9A 3WIIL 2E9JA 1I7ZB 2IH3A 1Q0YH 1M4KA 4MA3B 3BE1H 1WEJH 7FABL 4YIQA 4OM0H 3VH8B 1S8DA 4L8DA 4N5EC 1MI5D 4ODVH 1JTOA 2EE9A 3PL6A 3ZE2F 5HY9A 4Y8DC 3MLSL 2ZG3A 1BOGA 2DWEA 4E41B 1V7NL 3TA3B 3MRBA 2AEQH 5A2JH 1FO0H 4PTTA 2FYYA 1T04B 1YY8B 2C3HA 2WIIA 1YN7A 4ZTOH 1KB9K 1OF2B 3UJJL 1RJZA 1YEHH 2GJ6A 3HZVA 3O2WL 3PWPB 4P4RB 5KTEL 2DQCL 1OT1A 5E6IB 1FZKB 3CX5K 3RU8H 2CR3A 3OAYH 3MRIA 4V1DD 4XP5H 1F4HA 4OZHB 1I1YB 1QBML 4OF5A 2J6EA 1A2YB 1I7UB 2BVQA 3NACH 4CVUA 1OARL 3VFSA 3K74B 3OPZL 43C9A 4WHCA 1W0YT 3ARYA 4HIJA 1YMHA 5E94A 1EHLH 5DD6B 5JHLL 4YHIA 43CAA 3EJZC 5CILH 1CGUA 3RHWF 3B2VH 1IQWL 3BH8A 2XFXB 1OOAA 4ONGH 1CXIA 3MFGB 3U46B 4QRTA 2NR6D 2OR9L 4NYLA 1I4FB 4XP1L 4KTYA 1MFDH 5LXGH 3WD5L 2NTFB 5KVEL 2LTQB 1KGCD 1UENA 3WFEH 5IFHH 5FM4A 3RNKB 3MTRA 5C0GA 4PJHE 3RWJB 1TQCC 1A3RL 1HHHA 3ARGC 3QDMB 1EJ6A 2LABA 3U4EA 3LVEA 1NANI 5GGQL 1JF1A 3DLQR 4BH8B 3CMGA 4J3SA 1LD9A 5CJ5A 2L4OA 4RDQF 1LE5B 2XYCA 5MP6L 1J5OH 2O5ZL 1NGYB 2BJML 5B3JF 4WUKL 2ZZUT 2DWEB 1JN6B 1KOAA 4DZ8B 4QXTA 5F7MC 4ZD3L 2GCYA 3FQUA 2Z91A 5DD3H 4LKXB 4N8CL 3TYGL 2J6EL 1TPXC 4U1HA 1PVHA 1KIPB 3AAZA 2GYSA 4WO4D 3DARA 1D5ZB 4U1IB 1ND0B 4EOWH 5C9JA 1FH5H 2VLKE 1VFOA 3MV9B 5EUOB 1EAPA 3BN9D 3ZMRA 2EIEA 1QNZH 2A1WH 3MV9E 4JDTH 3KPRD 3BQUB 5I74B 4PJDA 5DC0A 2EZ0D 4OCNC 5HHMD 4LLWB 3IDIB 1EEYA 1G7QA 4W6XB 2P8LB 1K6QL 3MBXH 3C09C 1TZIB 3VXQA 2COQA 1OP3K 5T3XE 4XX1E 5F9WB 4JDVB 5DEZA 4MCZB 2QHRL 1T4KB 1PD6A 4LCYB 5L6YH 5DR5L 2MHAB 5DVMA 3ARGD 5EOCJ 3P4OA 1FIEA 5KS9F 1DN2A 2GITA 2YPKA 4HIIB 1CLZL 4B0MM 5C86A 3AC0A 3D9AH 4HUMB 1UZ8B 4YHNA 1G6RL 1OQOA 3BYYA 4K3JH 4NNYA 2EH7L 2GW5A 3MO1A 1Q38A 4FS0A 1X4XA 2ITDA 1RSFA 3ESVF 4HBCL 2UWEE 5EPMB 4UT9H 1KNOB 1OPGH 2X4PA 3UTQA 3LN9A 3P9LB 4QYOA 3IKCA 4PGBA 3B3IA 4JRXE 2OSLB 3KPMB 3QAZB 4Y1AE 2GITB 1KLGB 4G80A 2EIZA 1OLLA 2MQ0A 3QFJA 3FO2B 5BV7B 4I77H 4MB4A 2FEEI 2GY5A 2LV4A 3BMVA 4RAHA 1W8OA 5EO1B 2MHAA 3IDNB 1TJHH 4G6AC 3H8NA 3MRRA 4H1LA 2DJUA 1QBLL 2R2BA 3LKRB 4TSCL 3GZKA 5FO7B 2NNAB 5EU5A 1CL7H 4JFPA 1TZIA 1BFSA 3MGTB 2JB6A 2E7LC 3NCBB 5I1KH 4F7CB 1RULL 3EOTL 5KANI 3JWOL 3QIBB 1AKJB 1MJ8H 3MBEB 1JPFA 5DFTA 4QHKI 2UV3A 3OKDA 5FV1L 5SWSB 3SGKA 2E8ZA 1LP9A 3OKYA 5T33H 3B9AA 1JFQL 4P2OC 5HHNB 1MH5A 3V8CA 2GT9A 1T89A 2AJ3B 1F3DJ 4XP5L 1INQB 2PTUA 3MLXL 4NBYB 5DWUH 5DTFA 3ARXA 1IM3B 2BSTA 1YPZA 1NGZB 1UXSB 4JN2A 5IB5A 5IB5B 4Q7DA 3RWFB 3B5GA 2YZ1A 4JFEB 1QEWB 2EDJA 1IZKA 4G43A 5KVDL 4TOYH 4RSVA 1FL6A 1G7MA 3UPCA 4G6KH 1MCWW 1FSKB 4UINH 3BPNC 1ADQL 1A7RL 2ZNWA 2A74A 2VXQH 2X4NB 3ARWA 3DVNB 4PJ5D 4LLVB 4HDIB 3BPCB 2B1AH 4K3DH 3LH2H 4BQ9A 4TTDC 3MUGA 5BW7C 3VD3A 3WYRA 3HC4H 5CBAB 4KK5C 3PV6A 3S35L 4ETQA 5C92A 1ZHNB 1GGBL 2Z4QB 1EEUA 3CFKA 3VI3F 5DQ9A 4FP8L 4Q58C 1W0WB 3X12A 1IAIL 2CIIB 5JMOC 1SEQH 3SDAC 1I1FA 3GNMH 1SJEB 1WSST 1RPQA 3CFDB 4BKLB 4JKPL 4V1DB 5I66B 4OSUH 4GAGH 1ZEAL 2VAAB 5EDXA 3LKOA 4BFGA 1S7VB 3MZGB 3EJJX 1KCRL 3BO8A 4ODTH 4OGXL 2EKSB 4IIQC 3ESUF 5DD6A 4LCCB 2XICA 1Z9MA 4YQXH 12E8L 1M1SA 5ITFA 1KCVL 2BNRE 4H0HB 4QTHB 2XKNB 4J2XA 1WBXA 2EYTB 4NC2B 3WJLC 4CADB 2CK2A 5E0QA 1GAFH 2PF6A 4ISVB 3MXVL 4N68A 3T1FB 1AHWC 3TYFB 2BHZA 1MJJA 3LRHA 4CVXA 4KHTL 1FCGA 1VA9A 5ETUA 4PG9A 1HIML 4DN4H 1BD2A 4PJIB 1IGCH 4XPHL 1RUMH 4TRPH 2R9HD 4YHZH 3RTQA 1T5WA 4GAFB 3I6GA 2R4SH 1EK3A 3BQUD 1V3JA 2W9DH 2E7HA 3QNXA 5DEFA 1R3IH 5HHMB 4XBPB 3JTTB 1GGIL 3KS0J 5L88H 5JDSA 4JDVA 4Y1AD 4M00A 5C2BL 4JKWA 1IGFH 1GC1L 1DP0A 5ANMA 3DYMA 1MCEA 3MJ9H 1CYGA 4HKZA 5E08H 1X6NA 4NQEB 1OT2A 5DUPH 5JMRA 4LSPL 1YEJH 3GM8A 3VCLB 15C8H 5EOTB 1AY1L 5E9DE 4UQ2A 4YR6B 1CLZH 1ES0B 3G6JA 4KQ3H 5GGTL 3G08A 1JZ8A 2FWOB 4JQIL 3L5WA 1Q0XH 3VFGL 1P4BH 2IH3B 3IFOB 3RUGA 2VRAA 2NLJB 2B0SL 5LCVH 3C6SB 1YPZF 3GHBH 4NQDA 5CUSL 2UZYB 2APBA 4XNYL 2ARJA 2I9TA 2FX9H 1OAZH 5IQ7H 2KZWA 5H8DA 1CQKA 4LQ1A 5HYQB 2VLJD 1B0GB 4PBWD 4R97B 4YDKL 3OB0K 1KFAL 5HDOA 4NQSB 3PL6D 2YXMA 3QPXL 3C6LB 2X42A 5BXFB 1D5XA 5EN2A 1Q9KA 5EU6E 4CN6A 3QB7C 3CDYA 3RVUD 1F02I 4RFOH 3GMPA 4WY7L 4DVRL 1U8PA 4FQHA 1GGUA 3AGVA 3MFFA 2DRUA 3ROLA 4GG6E 3LQAC 2O5XL 1KCUL 4WTZA 4WVRA 5DJ6A 3SDXE 4WI3A 3PWVA 3QI9B 5DK2A 3FONA 3IFNH 4PP1C 3X12B 3H9ZA 5K9QG 1FGNH 5CCKL 3WS3B 4PJ7E 1Q94B 4KJQD 1MFEL 1HI6B 2AQ1A 1E0OB 1S7VA 4G5ZH 5J13B 1MRFH 2VC2L 5DURD 3K4ZA 4CW1B 4DQOL 4FZEL 1YNLH 4YWGL 5IEKA 3FFCB 3V4UH 5L8KB 4HIXL 1HYSD 2X4QB 3B8YA 5KVDH 1WFTA 1A2YA 1I7UA 4GRMA 1I1CA 3QO1A 3BKMH 1YEIH 2WUCH 1NLDL 3IF1B 5DQ9B 4YX2L 3ULSB 3DHJA 1HWHB 5D7JD 2ZUXA 4HUWA 1H3GA 4YHOH 3PWNB 1MSPA 3DGGB 4NM4H 2MJWA 2R4RL 1A6AA 5HSFA 2GJ6E 3ZLQC 2NY5L 4P2QB 4PBVC 4MWFB 1MF2L 2C3VA 25C8L 2I24N 4EKXA 3PWUB 4X80H 1Y18B 3TVMD 5J3HC 1ZVHA 1JWUB 1U8LB 2V5YA 1P1ZB 3UZQA 3QCTL 3Q3GB 1E4WH 3DROB 1NGPH 3U6RA 4WFFE 3MBED 5CGYD 3K1KC 3BZFA 2FZ3A 2GJJA 3ILQC 3LB6C 5SWSD 3OKDB 3LPFA 3HI1A 5KSVA 4KZEL 4YXKH 3VMPA 1HKFA 4AEHH 5I30H 2A6DA 2GAZA 4OZGB 5E2VH 3FAXA 1DQLL 1HQRA 3TYGH 5IFJA 3JVGA 2OK0L 3FHAA 3MLRL 5A16A 1JPGA 1JL8A 2QQQA 4JZJB 4KRNA 1BQLL 4ZOCA 3HZMB 1CFNB 2X7LB 4UILH 1CDJA 4NWUH 3VFNA 3DRQB 1KCVH 2R0WH 2OZ4A 1YEDB 1E4XI 4NO2A 3HUJB 4QOKD 3OXSA 2J5LC 3ARDB 2A1WL 5SWSA 4TN9A 1AGDB 3W82A 1JNJA 5LGKA 3LKSB 3MBEA 1D5MB 2W9EH 4RMUA 5KAQG 1P84K 4OV6F 3TIDB 3PUCA 2QV2A 3F62A 3NH7L 1HYSC 1KJ2B 3ARBC 3Q5YA 2V2TA 1OWWA 1RZKC 2L0DA 5TPWH 1NCNA 4CU6A 1CE1L 2NZ9D 5B3JE 1R3IL 4I2XE 1TJGH 4Z7WE 1XF3A 4PY8J 5FYLD 3NAAL 3GKZA 1GC1H 1MREL 3UBXB 2HJLA 5L6YL 3SKMA 2A2QT 3EYOA 3PWJA 3QFJB 4PUBH 3CLFH 4AIZB 4P2OD 5EU6D 1ZLVK 3P11L 3ET9F 3P0YL 2CR6A 5H94B 1JRHI 3NGBC 2HP4A 5DGRA 4HCRH 2X89D 1D5BB 3MREA 4JREB 1LK2B 4LLUA 3RWGB 1OP5H 3L6FB 4PJDF 4Y5XB 1JUFA 2OL3H 3D3VB 3RNQB 3MRGA 1MHCB 5E00B 2P4AB 1FVEB 2YBRB 3DX8A 4WW2B 4HHAB 1G7PA 3L3GB 3IDIA 2ERJC 1TJIH 4X4MA 4Q97A 4NCDA 1ZHLA 4JFHD 1OTSD 3D39D 3C60B 5KSBA 1CG9A 2H32H 4O51B 3VFMA 2I07B 1HHGA 1P6FA 4X0KA 2G2RB 4ZFFA 2CGRL 1ZXQA 4N1EA 4XNUL 1O0VA 1CFNA 3TWCH 1TXKA 5L2KD 4N9OB 5GGSB 4O2EA 1BVLA 2BMKB 1PYWA 3DMMC 2DKMA 5JORB 3IDUA 3G6JB 2GKIA 4DKEL 1S7RB 1FFNA 1EEYB 4ZSOB 3H9HA 4X99A 1RULH 3EOTH 2AJYH 4R0LA 3G5ZB 1MUJB 4OF7A 1WAAE 4WJ5B 5ESVB 2NY2C 3UJTL 4F9PA 3EBAA 2GTWA 4MJ5B 3DROA 5FF6B 1LO2H 5T5NG 4HKXA 3CFIC 4JKMA 3LEVH 3QI9D 3JUYA 3C2AH 4AT6B 3N9GL 4RRPG 5GRUH 4PJEF 1DQQA 2V2WA 4HK3J 3JV4A 1C1EL 1FNGA 1U8HB 3ZSTA 4K71C 1WGOA 5SWSE 1QBMH 4WWID 5EUOF 3REVB 4FZEH 2R0KL 1H3PL 1MQKH 2YZ8A 4Y4HD 6CGTA 1CIUA 5CINL 4NQCD 3WL9B 1UB5A 4Y16C 2R9HC 1V5JA 3W0WB 4EUPG 3VFRB 3QUZB 2FHFA 3HLAA 2GSIB 5ALCL 5AZ2L 3HFML 1M05A 3HMXH 3K2UH 4N0FB 1YUHA 3SJVD 4YDLC 3WD5H 1Q94A 3FQTA 3EJYD 1RJCA 3LEXB 4Z6AT 4JRXB 4P3DB 4HWNA 1F11B 3H9SD 3RTQD 3S36L 1MCWM 2PNDA 3OAYK 4MA7L 5IBTH 1I1YA 4LBEA 3KLHC 4QRPD 1UQSB 3H6JA 4WW1A 5J8OA 1ZHKA 3MGOB 4MA8H 1IAIH 1UH2A 2ZSWB 4R8WH 2C3XA 5HBBA 3FQTB 3NTCL 3BJLA 1FP5A 3PWPA 4I48B 1ADQA 1S7XB 5I1CH 1HINH 4JO2H 4U1JA 4GO6B 2X10A 4N0CC 1G6RB 1WFNA 3BIKB 5F7KC 3MRBB 1D5XB 5EN2B 3CVHH 3FCTA 1UB5B 2WBJA 1A7QL 1PW3A 1N6UA 1AR1D 1UCBH 1IMHC 1RHFA 2WK2A 5LAXB 3RVVC 3SDCB 5DJYB 1RZJL 1CU4L 4Y0GA 3R8QA 4MB5A 4WWKC 1HCVA 1Z9SA 4L3EB 4NQDB 3RWFA 5K93A 4U1SB 3EZ8A 3CD4A 5FAAA 3NCYS 2VDML 1XIWB 3B6SB 5IBLD 4PIRF 3B5TA 1NGZA 4PJDE 5BOZG 2R1XB 4Z18A 5FCSH 2Q1EA 3GB7B 2VXSH 4GW1A 4HKJA 3ZT7A 4J6RH 4M7LL 1OD7A 1YEFL 1I1RA 1FYTA 2ID5A 1G0YR 4H20H 5ICXA 3H0TB 3MJ9L 4R0LB 3NAAH 4WJ5A 5EBMB 1NAMB 3MA7A 5DK0A 2K9UA 3T3MF 4F9PC 2IANE 4PRDA 1WZMA 2IBZX 1UJTA 4HGKC 4HC1A 3AS0A 4S1SL 3MLZH 4IRZL 3WUWB 2BP3A 2MCPH 3EYSL 4ACPA 2HTLC 3OKEB 3O6FC 3HHRB 5A2IH 5C0EA 3WUZA 1JE6A 3UCRA 4OJFH 3VDBA 1AD9A 3RHWK 2BSRA 2UWEA 1KENH 3PGFL 3W11D 2NY5C 1KBGL 3T09A 1FL3B 1U2HA 3T4AA 4OLVL 1AC6A 1MLBB 1H3VA 4NM8L 5IB3A 5JDJA 2B4CH 3MXWL 1U8QA 3ZDYE 3VXNB 3KXFA 1BZ7A 5LVEA 1J18A 7FABH 3PQYE 4WWKD 3BKCH 1DBML 3MRKB 1AGBA 1A6TA 2A6JB 2IPUG 2RAMA 3QA3A 1ZA3B 5JIPA 4RMQA 1J0JA 2YD6A 3AFLA 2PR4L 3SCMD 1B3JA 2DI9A 2X4OA 4TULH 1T20B 3RFZC 4BQCA 3DI3B 2HT2D 4PJEA 3O2DA 4QGYA 4HIHA 5TFSL 1P4IH 5K9OA 1DBBH 4K8RC 5CGTA 1SEBA 1XEDA 5HHOE 4LP4A 5KTEH 1WEJL 2FGZA 4M02A 4EN3A 3O9WA 1JHKH 1AD0B 3MRLB 4OM0L 1FZJB 3PNWA 4OI9A 4POZC 1W72H 5I1JH 1ORSA 3EGSA 3G04B 3QWRD 4OLUL 3V5KA 5SWZB 3KJ4B 4QXUH 1NGWA 2HJKA 4P5MA 1X5GA 3GK8L 1MAMH 4M1GH 2R2CA 2MFNA 2X7LA 2JJWA 1WWBX 2FECI 1QP1A 4KI5C 4P5KB 4HLZH 3IDGB 3S96B 5ACZB 5TQ2L 4JFEA 2EDWA 1C5CH 2DQCH 4KJWD 1B0RB 3HNTH 4WW2C 4G8GA 4F15B 3MRHB 1IZJA 3PP4L 1KLUB 4MCYB 2MCG1 1I8KA 4FQ2H 3B9EA 3U6RB 2YD3A 3DTXA 3Q1SL 4PV9B 3QULA 2VXQL 3N06B 5HHPA 4HC1H 2ADIB 4MLIA 2DTSA 4OKVA 4ORZC 1NGPL 4WFGD 5GIRA 4ZNEA 3ISWA 3P4NA 4X6EA 5C09B 4ZTPL 4MWFA 5EORL 4JFPB 4BH8A 1JHTB 2OR9H 5IB1B 4P9ML 5IR1A 1MFAH 3KR3H 1M6OA 5J11B 4ZUWA 4X9BA 2C26A 2EE2A 1HHHB 3QQ9C 4HWBA 4ODXA 3DI2B 2P7TA 5IB4B 2HT2C 3T3PE 2EDEA 1KSRA 4LBEB 4NN5B 3DMMA 3ULVH 2DOCA 3BHBA 3U7YL 4R90H 5D2LF 4P3DA 4LEOA 1A9EB 3DOSA 4M61A 3FOLB 4RFEA 4WO4B 3NCJH 3SGJA 3TIEB 1Y6MR 1P9MC 3MV9D 4ALAL 4D0DB 1T2QL 4CDGC 3TH3T 5BS0A 4G42A 5MHSE 5HGGS 3L3IB 2VDMH 3DVGA 2B5IC 3WNMA 3BUYB 3K1DA 5DEGB 5JA9A 3HAEA 3MV11 4PRPE 2IANB 5JR1H 2AJXL 1WIUA 1H5BA 2XXCB 4NFCA 3WCYA 2BVQB 1MJ7L 1RIVL 3JSSA 2DLHA 2WP3O 1J0HA 5T1LB 2BNQE 4QRSB 1AGEB 1LDSA 1RUML 1HHKB 1RY7B 4U1LB 1YEGL 1V3MA 1FZKA 1YQVH 2CDFA 5D1ZB 1EMTH 4GFTB 5IW6B 4KV5F 1FVDA 4MDJB 4IRJB 3S88L 4ZTOL 1QRKA 2V7NB 4DAGL 3QDGA 4Z78A 2UZXB 4MLSA 2ED8A 1PDKA 4AQOA 3FQRB 2HVJA 4BZ2L 1DUZA 1AHWA 4H88L 3T2NL 1ZAGA 3N50A 3PV7A 5FUCE 15C8L 3JUZA 3L3HB 3Q2CA 1NAMA 3MA7B 5D7KD 1FL5B 1LILA 5GGRA 5IMOA 4KY1H 1KG0A 3D9AL 2CRYA 3GRWL 2M8XA 4HFWB 1MCHA 2A9NH 5JHLH 4JAMA 3EFDH 1ZMYA 2CRZA 4X6DA 4TVPH 2CUMA 3MNVA 2UY7A 2VISB 4MJIA 5HHVL 2Y4SA 5DHVB 1T1YA 5JOPD 1BMGA 1MCKA 4GUPB 1G9EA 2HAZA 1DLHA 1T1XB 4K3JL 3EW3B 4WWKB 2F53E 3HE7C 1A7BA 3VWKA 4HBCH 3IAPA 1S3KH 3MPCA 3NOIA 2VDRL 4QHNA 3G5VA 3TPKA 4BZYA 4XBPA 2ZSVA 1TTGA 1CD1B 1IILE 3GMOB 5J89A 3QCVH 4LSTH 3G5XB 4JFDB 4KI1A 3FL7A 2YD1A 5ILTH 4QY8A 1CICC 4NJAL 4J3VA 5E8EB 4JM4L 4FTVD 4XCCL 4NP4L 4XAKD 4YHPB 3X17A 3KGRA 4XCNA 5I2IA 3QG6B 1XAUA 2FIKB 1D9KD 3MRFA 2IAMD 4Q2ZA 3T4YA 1GZQB 1C16B 3WNPA 1J1OH 4LOUC 3QZWG 4M1GL 5DEGA 3IXAA 3MQIA 4K3HA 3UJJH 2CDEB 3K3QA 3G9AB 4R7NB 4Z7UF 3C5JB 1MJ8L 1ORQB 3BO8B 5DS8A 1KYOK 1NDMA 2XG4A 1BFOA 1PLGL 4FQLL 3VI4F 1B0WA 3KPTA 4NO3B 4DFHA 4PGCB 4PJ5E 3OXSB 1A7NH 3QQ4A 2AS5M 2HFEA 3TBSA 2F9BT 2V9RA 1PKOA 3FFDA 3GO1L 5FKAA 3W5NA 5J12B 4A6YA 1PGRB 5MHSD 4JB9H 3DSFH 4ODUA 3S98A 1KTRL 1VGKB 3UXFA 2VABB 2KQMA 2Q7YB 3QNYB 1JGLH 2DM2A 2DMCA 3V5HA 4MA8L 3C2SA 1U8HA 5AZEH 3KPLB 5DDHA 4HH8A 2NXZB 1QBBA 1U93A 1S9KC 5I0ZA 4XPGH 2H26A 3G6JF 5IHUH 4DKAA 4HZLA 4YHYC 2VQ1B 4Z0XB 3H42H 5LWYL 2NW2A 1UWGL 4LRIA 3ZDZE 3BZFB 5HHPB 1OCWL 4XC1H 3RDTA 3MOQA 4TUJA 4X4YA 4CU8A 2CKBB 4YDJA 3P2TA 5IKCA 4RNRA 1J88A 3WJJA 4CUCA 4M5YH 3A6OA 2VE6A 1AP2A 4GG8A 2BOCA 2Q86B 2N4IA 3FO9A 3V7MA 4NDMB 1MEXL 1BZQK 5IMMB 4KRMB 4WIQA 3ARPA 3LN4A 1HKLH 3UYOD 5EO9B 1OPGL 2HMID 5HPOA 2AW2A 4ALAH 1P7HL 4LEXH 4XP9H 4PJGA 1SEQL 2YN5A 2ESVE 4GRMB 4KXZH 1HHGB 4X0KB 3RVTC 5J1TC 1KJ2L 4LPVA 3SOBL 5C2UB 4OGYL 3BI9X 4YHZL 5D1XB 4CW1A 4L9LB 3UC0L 1YQVL 3E2HC 3QRGH 5GS1A 1B6DA 3ECBB 4K8RD 2I60L 1FDLH 2EH8L 1V7ML 1WITA 2CLZB 1TZGL 1Q1JH 3LKRA 2R2BB 1ONQB 5FGRA 3CUPB 4JGJA 3MRRB 4H1LB 1GAFL 2C1PA 4GKSA 3VXMB 3FB7B 4IRZH 1BREA 4GSDL 5E9DD 1MCLA 4Y4KA 3O4LB 4M6OL 4XCNB 5I2IB 5J13C 5CAYB 4NHUB 3CLFL 3BD4A 4NPYA 4PTUB 4J23A 4WEMB 5H35B 4QY8B 1UCTA 5FO9A 3QIWB 3GSQB