5D1XE

Isdb neat2 bound by d4-30
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
115
structure length
115
Chain Sequence
KMTDLQDTKYVVYESVENNESMMDTFVKHPIKTGMLNGKKYMVMETTNDDYWKDFMVEGQRVRTISKDAKNNTRTIIFPYVEGKTLYDAIVKVHVKTIDYDGQYHVRIVDKEAFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords D4-30 Light Chain
publication title Germline-encoded neutralization of a Staphylococcus aureus virulence factor by the human antibody repertoire.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5d1xE00
3RTLA 3QZOA 2O6PA 3QZNA 3S48A 2MOQA 3QUGA 4NLAA 4MYPA 5D1QE 2Q7AA 3SZ6A 2Z6FA 2K78A 4WJG3 3QZMA 3QZPA 4H8PA 3QZLA 4YMPA 4H8QA 2ITFA 2O1AA 3OVUB 2H3KA 3QUHA 3RURA 3SIKA 3VUAA 4FC3E 2E7DA 3SZKC 5D1ZI 5D1XE 3VTMA 2ITEA
chains in the Genus database with same CATH superfamily
4B0MM 4CRPA 3R0MA 5JHLL 1N2RA 1CFBA 1V05A 1EANA 2YPKB 2A38A 4FQ1H 4AQAA 3OHXC 2V7HA 5ENWA 4OJDH 1IC7H 1NBYB 3BN9C 4TUJA 3GJFA 3Q06A 3FT3A 3OJDB 4JO4L 2IGFH 3K2IA 4LLMA 1IAIL 4U0RB 5D55A 4ZDHA 3GJEA 1OARL 3PABB 3MV8E 3K71B 3THMH 1JI2A 3MNDA 4O5LH 1NKRA 1ND0B 4W9KC 5AW3B 5IBTH 3SKMA 5KAQF 1XZ0B 4JZNA 2FB4H 2YEZA 5ICZB 3FBQA 4HWBL 5CGTA 1YVLA 2JI3A 3NEXA 1FGVH 4IU3A 1PGRB 1TQCC 4NENB 5HVWA 3CDFA 3PP4H 3Q8AA 3HNVH 3JWNH 2YQ2A 4RFOH 3IXTA 4ZSOB 4W9EC 5CCHE 3BWAA 4LSRH 3GLZA 5I8EA 5J3HD 1EMTH 1N0XH 3F7PC 4I9XA 2A0LC 4PJ8B 5IHBA 1PKQA 3AU0A 3KGRA 2DYPD 2H3NA 1Z3GL 5F44A 2JB5H 5CU9A 3OR7B 4U1NB 4K7PY 1TYJA 2WP3T 4OCMC 4QHKI 4QUOA 1H0DA 5ERWA 3TL5A 2ENJA 4JFVA 5KVEH 4D9LH 2JCCF 4OCWH 4DKTA 3E2HC 1E5CA 2VERA 4JLRB 2IBGA 1UWXK 3MMEB 2G60H 3P2DA 1QR4A 2X1WL 4BDVA 1A9EA 1BEXA 4UUJA 2X4NA 4KK6D 3GBEA 2DEWX 3S5LB 5CJQL 3WXVH 4PGEA 3CG8A 3WO4B 1MIEL 5E2WH 4X80L 2XVLA 5KVFL 4PJEE 1MAML 1TENA 1GPOH 3DOSB 3EHBC 4FXGB 1NCNA 2APVA 3FMGH 3KBPA 4HJ1A 1M2OA 3QIWB 5L2KD 3KPLA 5TE6L 2CHZA 4HOXA 1U8QA 1BVNP 1ML0A 2DWYA 1NGYB 1HCFX 3HN3A 1BVLB 5CN2A 4CU8A 1XR8B 1Q94A 3PQYA 2X89D 4QRPE 5D8JH 4GQRA 1L6XA 15C8L 1S7RA 4FDWA 2Q9OA 4A7GF 3E8UH 1P1ZB 3JV5A 2P5WD 1IL1B 4Z7UA 1BOGA 5A2BA 5M95B 3FH7A 2ZUYA 2BPBA 3G6JA 2VDML 3RWDB 1T66C 1ODAA 3A6BH 3ULVE 5E2JA 4YGVA 4KJYB 4GMTH 2XPGA 4U1KA 4P5MA 1KJ2H 3L3JA 5DS8A 2YPLE 4XXDA 4TTGA 1D5MB 4F7TA 2CCLA 5GRJL 5L2JA 4L0PB 4OLYL 4RWHA 3REVA 5E4IA 4HJGB 5KN5B 4EUPA 4QAWA 3ILQD 4TSAL 4LLYA 1IZKA 1MCLA 3OJ2C 5I1CL 1DBBL 4GINA 2VQUA 2F68X 2VJXA 1R47A 2YIHA 1X7TA 2FNWA 5LGJA 1AD9A 4AQEA 3UZQA 3NVQA 4JQVA 1QBLL 4F9PC 3U4BL 3CXHJ 3QSKB 5CZRA 2Y36L 1KBBA 3KGUA 2E46A 2PNDA 4FEMA 4KJPD 4MQSB 3VSVA 4LMQE 5HYJB 1HDMA 3FT4B 3N9GH 4GRWH 4M61A 4ELKB 3QC6X 4G3YH 3B9DA 2I9TA 1I1FB 2E6QA 2PTVA 3GXFA 4QIRA 4DGVL 1U42A 3QDMD 2E7LA 3ZR6A 2EACA 1J0KA 3GD1C 2F7RA 1LK3H 2X09A 1I1AB 1XGTA 4NO0A 2EUXA 1KB5L 2TSAA 1KTLA 5GSRA 5FM5M 3FSWA 1C5BH 2G2PA 3H9ZA 3NZHL 3EYQD 1RIVL 4NO3A 4JRYA 2ZG3A 2NY2C 3FFOA 4J6RL 1MI5B 1FO0A 3SKOA 4CU7A 5H35A 2CKBB 4HPYL 5HBBA 1LXMA 1CU4H 4O9HH 4XN9A 4LEOB 1M9SA 3EG9A 4NQCE 4HG4K 2ITDA 4HS6A 1SHWA 5B3SB 4HUUA 1BF5A 2BNUB 2NNRA 2F58H 4Z7QF 3D7PA 2P4AB 3FN0H 2V8LA 1KLGB 4PJHF 1O7DC 2LR4A 4JY5H 2GITA 1NCTA 4P4KA 3GHBH 1HEHC 2QMJA 4HK0B 2HX8A 1BIIB 1GZPA 1U8KB 4UINH 3UACA 2BZCA 3LKSA 1QOKA 2FT6A 1YEDB 5C09B 1TZHB 4NUGL 3HLKA 4GSDL 2BJMH 5DD5L 2HP4A 4XBEL 2Z3FA 2VR7A 1YNKH 2W91A 3BSGA 5DZ9A 2VQ1A 1TETL 1LO4H 2XPYA 3GO1L 3UBHA 4ALAC 1LWJA 3BGFB 3WMQA 2EYRB 2NX5D 1Y07A 4IIQA 1JZEA 2EDJA 3ARGA 4OD1H 1KUMA 2PO6D 5D71H 2FH8A 3S88L 5D93B 5EO0B 2YGVA 2PPCA 4RAVA 5D7IA 3EO9L 1Z1WA 1QFWL 3BEWB 1L9RA 3IN2A 1B4JH 2OJEA 1ZA6A 2OBGA 2R0ZH 3K8MA 3OKYA 1E9PB 1IC5H 4HCFA 4JFPB 2V37A 3MCYA 2GJ6E 4PS3A 3H42L 4XB3A 1C08B 1BAWA 4NQSB 2VMDA 3VX0A 4LPTA 5H37G 4YSOA 1AS8A 3F7VB 4RMWA 3V79C 3V4PL 2V9RA 4JDTH 4ZQKB 4JZJB 4GT7A 3MV8A 5AD0A 3FDWA 4UTCA 1KTKE 2WVVA 4N5UA 2WM0A 4WY7H 1T6BX 4PGDB 3MLUL 4XPGL 3RX7A 4AZ8B 1OAJA 1P7KB 2J1XA 4KXAA 3IE9A 4FKEA 2I9LB 4AC2A 1NIDA 1V3LA 2FBJL 1GMIA 2VDNH 2X1QA 4FFZA 4Y16A 5GHWH 5DEGA 1UXMA 3PWPE 1MW0A 2Y1AA 4OQTH 1GS6X 3HNTL 5CP3H 5C97A 5C0DB 4PS4H 3V4VH 4HH8A 2KPWA 2WQXA 3ZL2A 2YKLL 1D7CA 4JHVA 4AITA 2GJPA 1AGFA 1VA9A 5I18H 5I74B 1E4HA 1M2VB 1BD2E 4XODA 3CU1A 2E9WA 3ULSA 4UZGA 3DGGB 4HFUH 5IEHB 4OV6F 3KS0J 3PWUA 5KBDA 4Z0XB 1H3GA 3LXUX 4MB1A 1DTUA 4X4XB 3SY6A 1ECZA 2ZYSA 1JPGA 4G59C 1BREA 1BAGA 1WBXA 1ITCA 1QTYT 3EYVB 4WDIB 1I7ZA 1NJ9B 4IKKA 4MJIA 2ZE0A 3WAJA 1T83C 5D7EA 3DRTA 4L0ZA 5I8CA 4Z7NF 2BM3A 3T8XA 1MIMH 1FLRH 4PJEA 3L9YA 1WS8A 2Y2WA 3SIKA 3I6KA 3QB7C 4R5XA 4U49A 3HPLB 3LY6A 5HGBB 3L2NA 3O6KL 4IU2B 1FORH 1R4XA 1T04A 1IB5A 4FQIH 1JZ5A 3TBVB 2IPUG 2O5YL 1NQBA 3KYOA 4DP0X 5HYEA 4A04A 4HAGA 4Z18A 4XNDA 1BGXH 3VD3A 5HHNA 4MYWB 5FB8B 3LIZA 3GK8H 4QRPA 1G9ML 1TEFA 2XZQL 3JV6A 3FT2A 4F9LA 3SSGA 3H9YA 3T4AA 2O5XH 5DRNB 3WNIA 1N5AB 3ZE1F 3A67H 4NZRH 3I9GL 1RFDL 5EOTA 2YAHA 4JQXC 3A6CL 4N2MA 2F54B 4LSDA 3SDYH 2ADGB 2GPZA 3R4DA 5D2NC 1W9XA 3WGVB 1AXSB 3CN3A 3A4DA 4RNRB 1SJEA 1A22B 3RGBA 4GAGH 1CLZL 1HEZB 5BVPH 1Y0LB 2ZXAA 4ZMZA 3HG2A 3QULB 1FFPA 4FI6A 1GOHA 1G7JA 1XMWA 3Q1EA 4GW4A 3RDTA 1HTYA 3V0AC 1ZK9A 3NAAL 2V5MA 3OPZH 3KWXA 5AOLA 2A6DA 3B2MA 2D8KA 3L4UA 4XNUH 3N40F 3BDBA 3HR6A 5MEND 2CG9X 2ID5A 3CHXA 3BEVA 1HQRA 3V6BR 4YUEL 2AZUA 3S96B 5E8DL 1QP1A 4MXVF 1HHIA 1UT1A 1MFBL 2MQCA 5E23A 3OAYH 4N8PA 5IW3A 2GJJA 5AL0A 3GMQB 4YPGA 1UH3A 3B9KD 4X98B 5EEYA 4HUKB 3ZTCC 1OAXH 2G4GA 3LZFL 4H25A 5DLLA 4NKDA 2FEEL 1ASPA 4NQEE 2FHCA 3EGSB 3GLEA 3V7MA 3JWDH 4Y4HB 3QDJD 3V6FB 1X5IA 4W9FC 5HGDA 3TOPA 2X3BA 1CIDA 4JKWA 4B96A 2YS4A 4NQCA 4XP1H 3T6VA 4NRXB 3PQYD 3R06B 4P3CL 2XXCB 3IJYB 4L4VB 3M88A 2DQEL 4IHOB 5CN1A 4IRSD 1CDJA 1F6AA 4JM2B 3NH7L 4WFHD 3U2JA 1KZYA 3REWA 4PJDB 4XXCA 2V7NA 4GRLD 4XN5A 5AVXB 1NFIB 3QEQE 2YC1A 1CFTA 4JFHE 3MA7A 1F58H 4XRCA 1LE9B 4Z7VB 2W80C 1DVUA 2MEJB 3ESOA 5F89B 4AYGA 5IREA 4AYEC 1DO6A 3ZMRA 3VFWB 4AG4H 4DGIH 3B6SA 3PG2A 1RUKH 3RGVA 3H1ZA 1XGYL 3DX1A 5FO8B 5L0QC 1R3HA 2JQAA 3ZR5A 2Z93B 3FULA 2EINB 5IHZB 2EZ0D 4X83A 4D3CH 4EF3A 5I26A 1FVCB 4NGHL 3QQ9C 4YEEA 5F71A 1BQHA 4FL4C 4XNMA 3FB8A 5GGUA 5DD6B 1WE5A 3S4SG 5EEWA 4HOWA 5E6ID 5C0FB 3PNWA 3GSXB 3RTQC 2GJ6A 2G30A 1QR1A 1Z66A 3H53A 3BPNB 3BP7A 5B39A 3L5JA 3L17A 4HW6A 3L3HB 4Y19E 3T3MB 2Q87A 3MX0A 3ULUE 4MAUH 4IDJL 1PG7H 3GKWH 4R97C 5JXAL 4JRYD 3RY6C 4WWKB 3MJWA 5HHXL 3CDGA 2ZOTA 2GEQA 1JNNL 1BM3H 1J1OL 2HCZX 2EXWD 2WLHA 4JR9H 4OM0H 4KOBA 1KCSL 4ZUTB 1MJ7H 1H3TA 2E0PA 3VYOA 1AXIB 3QCVL 5FF6A 4KQ0A 3MRKA 3OKEB 4FN0A 1FIGL 5E8OA 1WSST 3QIBA 4UT7H 4LQFL 2Z31C 3P30L 4A63A 4FMKA 4PSPA 4TQEL 4YBQC 4NZUH 1CCZA 4L8SA 3KM1A 3DUSA 1B2WL 1BFVH 3U0WL 2X2YA 2DQJH 5GZNA 4FQQA 3N5AA 3DHUA 2LAAA 3GPSA 3ZOAA 4DETA 4ATTA 1BD2A 2AABH 4HC1A 1PLBA 3D4GA 4KTEH 2XTJC 2YQ3A 4GY4A 3RLSA 3LZRA 2EYSB 2ZG1A 4J39A 2OSXA 3F12A 3QFDA 3JV4A 1FDLH 2PXYC 4AKQA 3B2VH 2ESVA 2I60L 1CD0A 2EDMA 4AQOA 2GTWA 4FG2A 3LS4L 3CUPB 2P3YA 3MBXL 4ZMOA 3FCTA 3MRQB 2DBLL 2OV0A 3KDMA 3TONA 4NRYA 4NYLB 3WNKA 4BFRA 3FQNB 4HX1A 3CC1A 2R2EA 5F96L 4W9ZA 2CXKA 1HZKA 3CVCA 1TR7A 1DJXA 2G5BB 3BH8A 3FF7A 2R1XB 1AP2B 3NESA 1JCVA 1XF4A 4XCNB 3DKHA 3GEWB 4BH8B 4FNTA 1JGVL 3RKPA 1RZIA 4LCIL 3D05A 2BRQA 5IF0B 2EDKA 4XOCA 3EDFA 4EBQH 2F18A 2CKBL 1R1CA 4EUPH 4F57L 4XN4A 4RAUA 1QSFE 3ZE0F 1QRNE 5ADPH 2QLVB 4Y16D 2BSCA 1N67A 2QSCL 1MVYA 1S9WA 3L7EA 4D8PB 3CDZA 1FNFA 3ET9F 5GJTL 5FHAH 3SPHA 1QABA 1H8LA 5EV7A 1TQUA 1RPQA 1XL6A 2XN1A 1IGIL 4LPVA 2VR8A 1T3FB 1LEKA 3U46A 2ZUTA 3OXSA 3LZQA 5BQ7B 2GBVA 4JFOB 2Y07L 3GSQB 1JGEA 1JHLL 2CO7B 1LDPL 2I24N 2RB8A 2WZ5A 3MV9D 4P2RE 4B3VA 5IHLB 2YA2A 4LP8A 4CMHC 4DGUA 1MHHA 1MFDH 1AGBB 4PD4K 4FERA 2WZAA 3F7RA 3IFNL 4YR6A 4QTHB 4KKPA 4XI5D 2ZWKA 4O00A 2FBOJ 4MJID 3T5WA 5K69A 1T89C 1MREL 1CXEA 2J2ZB 1HH6B 5CN3A 4OU3A 1A6WL 2UXTA 2P7TB 2VMFA 4M6OL 3KNBA 4C83A 5CR1A 2O61B 2HTKC 4XNQB 3UAJA 1JWSB 5GRWA 5TK4A 4OCRL 2JKJA 2EEDA 2WXRA 3UC0H 1JAEA 3OG6B 5CZXC 2VSKB 3QG6A 4ADGA 2DIEA 4FXTA 4IW4C 4TLTA 2HFEA 4QF1B 2XN9D 3CQQA 4M8VA 3ZUNC 4NIYE 1IO4C 3LH8A 3BP6B 4D0BA 4DNLA 3DNKA 3DX2A 1HE8A 5E70A 2X4RB 2E7MA 4NKOB 4HVBA 4KKQA 3K6SA 4P23A 4CW1B 4ZNCD 4L05A 4RCAA 2XWJA 2CQVA 4EI5D 3UROR 3QEQA 4DP5X 1R17A 1XO8A 2UWEE 2CUAA 1OTUC 2OX5A 3VWKB 1ZKAA 3QWOB 3QPQD 2BRRH 3TH2T 3D18B 4P9ML 5CCKH 4GQZA 1U91B 2WN2A 3ZYZA 3FCSA 3AU1A 2V2WB 1KTRL 5GZOD 4M7JH 3DRQB 1IFHL 5DQ9A 4X6FB 2CR0A 3PWVB 4QTIH 3OAYK 3QIUC 1NC4A 2KLSA 2XG4B 4J1UB 2YFOA 4EIGB 4ODBD 1O7DE 2ITFA 7CGTA 5IFHH 4ZFGH 1YEJL 2K6ZA 1HOEA 4WTWA 1G87A 5LN4A 5ID0B 3PP3K 2QFPA 4RX4A 2OPCA 4HKJB 1KFAH 4L9LB 4JHBA 4PGZA 5BXFB 1N3NA 2ZSWB 3MROB 4ZD3H 2VABB 1A1OB 1MZYA 3CTTA 2PPFA 2E4TA 4Y19A 2AEPH 4FFZH 1GAFH 1RH8A 1TJGH 2FJGB 1CD9B 3HE6C 4ZXBD 5A40E 2VISA 3CPUA 3UBXG 4KXCA 5HHVL 2R4SL 4WU7A 1KYOJ 4G43A 5AW6B 1CG9B 4OY9A 1B3JA 5TPWH 3WJLC 4XP6L 3CFUA 5AW5B 5ICUA 4NO5B 1DQDL 1ZHBA 3QAZB 2F9BT 5GGVL 2FAUA 4JPKL 2VN7A 3T3PE 3IMVA 4KKAC 4LCUA 3V4LA 1QEWA 1Z32X 5BVJA 2ISDA 1G9MC 4B3EA 3OHXA 4F37F 3HZYA 3BUYA 1M6OB 1ZA3A 1XIWB 2PPEA 3DMMC 5CLTA 2J72A 1M9WA 2BCMA 2KZWA 2X1XR 3J8F7 4KZEL 4FXKC 2R8SL 3ME0A 1NANI 3HG0A 1L9OA 2CJUL 2CE6A 5E9DB 1D9KD 1FZOB 4LPYA 2YPVA 3GSVA 3BD3A 2AEQL 1JD7A 1TTGA 2FLMA 2IPKB 4TVPL 3SYQA 1JCKA 3LRMA 2AXGB 4MNQE 3CX5K 3AS3A 4X8GA 4NZJA 1AHKA 3OAZH 4PTTA 3V0VA 4V2BA 5DT1L 1AI1L 4H13C 2WQWA 3D69A 2YRBA 1PU0A 4XO3A 2A77H 1AG6A 2WLMA 3NN8B 5IZ7A 2DJ4A 3GB7A 5EBLB 1I8MB 4AIOA 4HSQA 2QVIA 1BFTA 3ERXA 5JIIA 5KVGH 5I5MA 2YOAA 4N0YL 4OT1H 2MNWA 4JB9H 4LNRA 4PGCB 4YFEA 1G7PB 5KBMA 5LUMA 2R1WB 2ATKA 1ZVNA 3LQAL 3ULVH 5FCUH 4F1SA 3WS6C 1A1NB 4Z1PA 3X17A 4PJFF 4OKDA 1J87A 3SD5A 3STBA 3QUKB 2Z91A 5FWQA 5JNYB 3ROLA 4D0DB 1URIA 2J44A 5IQ9B 3EO0B 4XVSH 1JV2B 4HYTB 2GY5A 1JRHL 3O11A 1MJJA 4ZODA 4IBLT 2AS5M 3MQIA 2AQNA 4BINA 2JCCE 1UB6B 2DL9A 1IAKA 1QSFA 4U0RC 2F5BH 2WO3B 1QRNA 4RGOH 3D08A 3ML9A 4HQQH 2VITA 5AYUH 3UJJH 4BFEA 3KXFE 2X7LB 2AJUL 3O3UN 3KBEA 4AGQA 3DVNB 1KCRL 3VFGH 1Z9NA 1XGUB 4FADA 2M2DA 2NW2A 3T2PA 5GZND 2B2XH 4YN3A 4Y9FA 3SOTA 4AM0Q 2GBAA 5EORL 3UABA 5AVUB 3QZWG 1LWRA 1MQKL 3VDCA 4H8UA 5AW7B 5C0BD 2EVHA 4P2RA 3UJTH 5B1AB 3KJ6H 1JF1B 3T8MA 3UC2A 1RZKC 2ZWZA 1T4KA 2ESVD 4LLQA 2P46B 3WMSA 4PLOB 2CALA 2NY0B 4ODVL 4IHBA 5JW4R 2WYTA 1NGWA 1KDIA 4Y4KD 3WUZA 2CJ3A 4XO9A 1L9PA 4JANA 2OYLA 1EUTA 2A9NH 2O6EA 1BJ1J 4FFTA 2BCKB 1SHXA 1TNMA 1SYSA 5I8KL 2OYKA 1DN0B 3SGDI 3WO4C 4CAGA 1ZT4A 2NY6B 3TO2A 3V4UL 3D0VB 5D5ME 4WGKA 1AD0B 1BM7A 1OSYA 1Q1JL 2XYBA 1J9RA 4FP8H 4JG0H 1DE4A 4FXGC 4UAHA 4CBZA 3JTTB 4ZFZA 4JFQA 1OK0A 3QIWC 1OP5H 4GKLA 1T7YA 2EH7H 2HVJA 3GMLB 1Z0MA 4H26B 5I17B 3S4SB 1FJ1B 3K91A 4LU5H 1P7BA 1Z5HA 1UZ8A 1FAIH 4NPKA 5DDHB 1E4XI 2EKSB 1F45A 2UWEA 5D6CB 1KJMB 2RH0A 1N6VA 3ARQA 5F9JB 4PBWD 4YE4H 5D4HA 5LDUA 4UB0H 3BKCH 4PBXA 5I8OL 4OUUA 4ZO8A 3AVEA 3GXIA 4CSPA 2WXJA 5T5NF 5AB0A 4FC3E 4KI1A 4EEEA 1E42A 4P2QD 5FYLL 2D2OA 3HG3A 1FNSH 4OJYA 2KLRA 5TFSH 5JYMA 1IU1A 2QSQA 3S3CB 4ZFQA 1OGAB 2BSED 4HKBA 1CR9H 4ISVB 4OZIF 4GG8A 4LEXH 1H5BB 5H2BA 4BIKA 2IF7A 1JNHA 4OGXH 5F1NB 1NBZB 1UYWH 5HHMB 2C1PA 3B2UC 3TYGH 2G9HA 2B15A 2K78A 2BHYA 1FZKA 1QA9B 2MTPA 2OMVB 3OMAB 1I3VA 4GO9A 4KO6A 4DKFL 3DXAB 2CNYA 1TO5A 4FQ2H 2KYIA 4Z7QE 1IM3B 3AWFA 3TESA 1DVYA 1MRDL 1ZSHA 2HLAA 3HLAA 2OXGA 1NEUA 3CVBA 3D87B 2OK0H 3FQXA 2HKHL 3T6ZA 4HIXH 8FABB 4PHZA 1GY2A 3DGCR 3Q6GL 3BLBA 4MMXB 4ZMAT 1XGQB 2RAMA 4P2OA 2K0RA 1P7QD 2FSEA 4OSUH 4C57C 4KAQL 3CFCH 1JFQL 1I1AC 3CZSA 4DVBA 3FO9B 4PYGA 3VRIA 1RZFL 5KUKA 5EU6B 2LLNA 4DP6X 4NRZB 1F18A 3UGEA 1USZA 4HC1H 2WKOF 3KR3H 5EU7C 3H9SE 2GHWB 1JWUB 2CD0A 1SPDA 1HESA 1I9EA 4XN8A 3BWUF 3RVVD 5KYXA 4FA8A 3FRUA 4S10A 3J27A 3CFEB 3DJ9A 3QNFA 4PRIE 5EUKA 3WL9B 2APBA 1RUML 1IAOA 5D72L 5E00B 2YGNA 4MNQA 4OM1H 5DU7A 2IH1B 4HJSA 5DLML 1HXMB 3FFCD 3HUJF 3AREB 4O2CA 1A2YB 2OM5A 4MJ2A 4W9DC 1F13A 1RURH 1I7RA 2YD4A 4PJ9D 1JIBA 4R4FH 5ILTL 1RAMA 2HRHA 2DQDH 1ZV2A 1MRCH 2Y5TB 3ASOB 1XH2A 5HYQB 4OGAD 3SDDB 1N8OE 4TNWF 3BGFC 5CILL 1NFKA 2EVFA 3NIGB 5K9JL 2WY3B 1A8ZA 2XTJE 4R7XA 1J1XH 2G2RB 1BIHA 1AZNA 1AHWA 1P84K 2EDFA 1QSED 4J2QA 1JWMB 4XCFH 5D93C 1QPPA 3ARBC 3D2UD 3ES6B 1WZAA 3M45A 2XX1A 4KKLC 1E30A 1OPOA 4BXVA 4WJ5A 3M07A 1RUPH 1EZLA 2XETA 1WG3A 5J0BA 4K0OA 4OGYH 4U1SB 4MBRA 2NZ9D 4EPSA 4BH7B 4L3FA 3Q9QA 1UOVA 1J9SA 4U3HA 3N0PB 1B0GA 3R7RA 1JNLH 1C1EH 4U6YB 4XGZB 4JZJC 1XF5B 4J8RA 1ZPLA 3VVVA 1M3IA 1YO4A 1YLBB 4P05A 4I18C 5HI3C 4NM4H 2XWBA 2Z0UA 4FNLH 4KKBC 2QPFA 4PGJA 3TT3H 5CCGE 3VXSB 1SEQL 4NUQA 3AZUA 5EZLA 3MV7D 1JZ2A 2H7WA 1DVFD 4N22A 4I0KA 4YOKA 5DJAB 4PUBH 3T08A 3EJYC 3EGDB 4JQXA 4JKLA 3NJGA 4YHOH 1PQZB 3II3A 1S7XA 5DGRA 2IMNA 1TZGL 5KYNA 3JYBA 1T03H 5I74C 3FO0H 3KYKL 3C8DA 3GBMH 5E2VH 1ZS2A 4Z3FA 3WTSA 5F6HJ 1WFMA 5ITFB 2A0LD 4F8LA 3ROOB 5GRUH 3QH3A 4JDVB 1YN6B 5EBMA 1NCOA 2VDPH 3ESUF 2ZAHA 2ETWA 4HSAC 5D5MA 4WU5A 1SRDA 4NI3A 2UXGA 1SMAA 2G0KA 3AXLB 3VFUA 4NFCA 2AMUA 2XZAH 1BJMA 3PHSA 4WEUD 2XYCA 4CILA 4V1DB 2WBXA 2C9SA 2QVMA 1AFVL 3BQVA 3PS6A 4NQDB 1NSNL 1SXZA 2AJVH 4TUOB 4PSRA 5IW6A 2Z8RA 3ARDB 5C0AE 2QQKL 4J3UA 5GJSL 3VXUD 2VAAA 1NMAH 4F37K 5IESH 3LHPL 1CXIA 4XOBA 4R5VA 5AVZB 4MXVE 3U1SL 2DMKA 3EJZD 4XNXL 2WQAA 3TA3D 1LMIA 4CVWA 4ZMWA 4NB7A 1F4XL 3UBXB 5JHLA 2ZSVA 1D2PA 3S7GA 1JHTB 4NSKB 1XCWA 3BSZL 5F7LB 4KNTA 3FU7A 3D3VE 3QQ4B 5DD3H 5HI5C 1NCAL 4KU1A 3WAKA 4BZ2L 3W11C 4D0CA 1JGUH 4KUZH 3ULUH 2W88A 4N0FB 4ODTL 1IKOP 3T6WA 4OFKA 4HUXA 5EUOF 2DQHL 4ZNEA 1XTMA 5DEFA 1XH1A 5FW7A 1N4XL 3VDBA 4I9WD 2CH8A 4MA7L 2OA9A 4HWBA 4GXFA 4MS6A 1T2QL 1XXFC 2PABA 4MKTA 1RLBA 2A7BA 4HV8B 2GAZA 3P0VL 3DIVA 3QNYA 4AIZB 1CFSB 4DTGL 4IRZL 2XX0A 3T0DA 3KCPA 2MHAA 1RZ8A 2NY4B 1WF5A 1ZWIA 4Y9EA 1OLZA 4HIEA 3VGGA 3DBXA 2WW8A 3RWGB 1KTDA 3P0YL 3QS2A 1A66A 3HS9A 2FK9A 4XCYA 2GIXA 4YXLH 1DZBA 2IXQB 3U36B 4MCYB 3D50A 2BMKB 5D7KE 5B3JF 1BCIA 2K9FB 3QJFB 2X6MA 4WW2B 3IAGC 2YPVH 4BSWB 1KACB 5LNDA 3LQAC 3A3YB 4G9FE 3X1NA 2QPEB 3DVIA 4FYSA 1JF6A 3G3LA 3H9SA 1IM9B 4YX2L 4Y4HC 4QOKB 3O9WB 5F7WC 3UBFA 3H7BA 2DWEA 4TOYH 4UNTA 5HGHA 3CN0A 5I0XA 4KWUA 3NP3A 3R7QA 1ES0B 4PRIA 4H8WC 3RY6A 5BW7A 5TTRA 1A7QL 3QP3A 2NY2D 1K6QL 3MRLA 1D7BA 2LGNA 4M1CC 4LVNB 4JFDD 4JM2C 4PVBA 2UY6A 1F3DH 3G7TA 4G80A 5CHNA 4PLNC 2WXHA 4X5XB 4PB0L 2AXFA 2HMIC 1CFNB 3KGSA 3VO0A 4NPJA 4IBWA 4WFFE 3P0GB 3VFNA 1LEGA 1BECA 3MACL 3ZDXF 1OK8A 3VGAB 2VLMD 2Z31A 2C4FT 4IOSD 4WFGD 3HFMH 1RIHL 2ITCB 3I2CL 4A1RA 1KIUB 2D0GA 3T0EB 3G5VB 4LSUL 4P49A 1GGCL 1F6FB 5SWSB 2DQUH 3AMKA 5JPNB 1I8IA 2C3VA 1JNJA 3DHMA 3UADA 2HJKB 2VMJA 1GSKA 3LMJL 4QR7A 3TBYB 4GNKB 1QBBA 4NZFA 2CBMA 3VD1A 2Z92B 4IEFB 4PRDB 4ZTOL 2FGWL 1KJVB 3QZWB 4HMDA 4AIXA 3HHSA 4Q89A 4MA3A 1ADQL 1UZ6F 1QI3A 3BPNC 4GXVH 1U41A 3V0WL 5A16B 1VFAA 1OOWA 2AJZB 2R0LH 3RWHB 2ZX5A 2JV6A 2Y7OA 2VXVH 1B6UA 1F02I 1E5AA 1QLRA 2DKUA 2EEBA 3CXDH 4WWKC 1T5XB 2OZNA 2YBGA 3ABMB 4LRNL 4BFIA 3EOTH 3WLBA 2Y1ZA 1SJMA 4U1LA 2X44D 2ZYHA 1Y6NR 3CCHB 2PLTA 1MCOL 2CZNA 4G7VL 5TGBB 1CICA 4NKMB 4OJFL 2C9AA 3QR0A 4ZPTA 1KB5A 4WI6A 5JIMA 4XNZB 5TQ0H 3RVXC 1T1XB 5DA0B 1COBA 4GAYA 2C4XA 5JQ6L 3UJIL 5ACMA 3H2QA 3RWFB 4GQ9H 2BXZA 2APSA 5IMKB 4DEWA 4L5FL 2Q8AL 3EDJA 1BOYA 1CBVH 1ZGLP 5IWLA 3K74B 1MFCL 4M8UA 5MHSD 1MEXH 4H0GA 4K23L 3BFQG 4QI3A 3BVNA 4UT9L 4BFKA 5F6IB 4OGZA 4NWTL 3V5KB 5T1MB 4GKSB 2VDOH 3A23A 4ESKA 1FVEA 2H45A 3O2VH 4FZEL 4ZSOE 4ZJ9A 3LEYL 2DQMA 1CYWA 4GO6B 3QZNA 4JJHA 2XRAL 4U1JA 1MVUB 3ZE0E 4X5PA 5AAMC 5DJ6A 5EG6C 1J0ZA 5JORB 1JFHA 3WNPA 4AL8L 3RZCB 4QKTA 2X4OB 5HHPB 2BIOA 4R5TA 5IMMB 5DJ2B 4F7EB 5JOPD 4GKNB 4YDIH 5EPMB 1HN1A 1CQYA 4F2MB 3GUFA 2OMZB 3NCYS 1T89A 3L7FB 5EF0A 4Z77B 3QUHA 4R26L 3RWIA 5I1KL 2CAKA 1FBIH 4FQCL 2DLHA 4OZFA 4FCHA 1ZEAH 2XWCA 5C0AA 3SDAB 4Q0XL 1YYMH 1S3KH 4NERA 1DJSA 3SHSA 2ADJB 4NJ9H 3AQDA 4NBZB 5MEPB 4JHWH 4H4NA 1AR2A 2BY2A 3B7YA 1SVBA 2OCFD 4HGWB 3RWJB 4F3FA 1DUYB 1KGXA 4UIMB 3GSOB 3WKPA 1XBDA 4S2SB 4YSAA 5EO1B 1A7RH 1VCBC 2B1HL 1FE8L 1U36A 3Q8BA 2DJSA 4HFWA 4AC4A 3IDYB 3TJPA 5LGHL 1ITBB 1P69B 3D3VA 3V4PA 1BZ7A 3EFDH 2GG1A 4ALAH 1C7SA 2OTUB 4Q6KA 2LFGA 2AZAA 4DQAA 1AQMA 2D3NA 4UQ9A 1MH5A 5T1DL 5LO7A 4F91B 1S5HB 1VERA 2OTPA 5CJOL 3LSOA 3KPMA 2HAZA 1NOLA 4KKCC 3TIDB 3QPXL 2AV7B 4KMTH 1VEOA 1RJZA 4TNWK 2QR0B 3CBJB 1INEH 3LPWA 1F4AA 4R7DB 3EOAA 4LKXB 1KWKA 5CEXA 5M7QA 3PPEA 4HUMB 1AXTH 2WTPA 3UZEC 3QXAB 1C12B 4M6ML 2WNXA 1C9SA 1WCBA 1VESA 3VJ6A 4YSPA 5CMAB 3Q3GB 3SJVD 3LPFA 4BGDA 2GUOA 4XVUC 2AQ2A 4G9FA 3RVWC 1BZEA 5ESVA 3VACA 1SEBA 2EIZB 3UMTA 3GI8L 1K8IA 4LHUG 2LLGA 5D1QB 2NW3B 3BW9B 3F8UB 3NDZE 3WY1A 3HR5B 3ECBB 5K59F 4NNPL 2LVEA 4HWZA 1CGVA 4AYDC 2XLLA 2XFXA 3CVDA 2FH6A 1R19A 4KPHH 3PREA 5DMKB 4NC0B 2ICWA 4F7CB 1AQHA 3WHE1 3WJLA 3P4OB 4GH7B 4M1DL 1X5HA 5E2TL 1MVFA 2IDCA 1ORQA 4JVPA 1XT5A 3HZVB 1N59A 5EU7E 1VPOH 2BOLA 3IKKA 4KXZI 2H1PL 1A6ZA 1MCIA 1E50A 4N2LA 3KVDD 3VWKC 2Z4QB 1G7QB 4MZ3A 5DR5L 3HMXH 4Y8AA 5T1LA 1OM3H 5FO7A 4P48A 2OSLB 3DK0A 2W8CA 4Y2NA 3VNYA 3OXRB 2O6DA 5JZ7C 5AW1B 4ENEC 1TIUA 1KCBA 4DN3L 1NGQL 3VI4F 3JTSB 2YEVB 4LBEB 2GYSA 1HSBA 4GJTB 4OTXH 4PWFA 3JYCA 4HXBH 5FO9A 3BGAA 4POZC 3SEPA 5C09E 3MFGB 2XY1A 2ZUQB 4L9LC 1R3JA 1YECL 4JPWH 2APFA 3VMOA 3H56A 5T3ZL 3LZOA 4LLDA 4X6DF 3QQ9D 4JHZA 3TBWA 3VGBA 1NMBH 5BZWB 2ZX8A 3LKPB 6PAZA 5J6GB 3Q0HA 3WN5A 4D2NA 1IVTA 1MCPL 3RTQD 2W07A 2JJWA 3QQ3A 1KJ3H 1HX0A 2XIIA 4JPIB 1AR1B 2VN6A 3WS3A 2UXFA 2BWIA 3GMRA 3WS6A 3OMZA 1S9VA 4DSYA 2BSRB 3Q5YA 3PXJA 4JN1L 4OFYA 1DBJL 3QAZC 4PTUB 2VLKB 4MD4B 1DYZA 2VM4A 2FEDD 3CSYA 4LXFA 3DX7B 2YPKA 4N2FA 5FM5O 2EVGA 6FABH 1NBYA 1JPTH 1XIWC 2JJSC 3II2A 2H2PC 3A4AA 3OJDA 3K4DA 3K71A 1BZDA 3NTCH 4DVRH 3QI9B 4LRIC 4KHTH 3NJXA 3FQUB 1ND0A 3R4RA 4GRWB 2IOOA 2VLJD 1XZ0A 1IC4L 3S36H 3EADA 1G6RH 5IROC 5C07D 4TPRH 1OF2B 1E5ZA 1IRAY 1FGNL 1NGZB 4MQTB 1E3FA 4OLUH 4PRAB 1S7WB 5JTWA 1FRGL 3MUUA 2DI7A 4YSSA 4ZSOA 1B4LA 5F9DC 3VFSB 4RGNB 2WD0A 5DUML 3K6OA 5BRZB 2A9ML 4TQHA 5FUZL 3WKNA 3IAPA 3TFKC 4Z7OB 4U1NA 3U9PL 3FQWB 2PXYD 3CFIC 5GRZA 4G8GD 3VAEA 1KYFA 1TKWA 4RRPG 4TRPL 3IU3B 4H0IA 3H2WA 2QZ5A 3Q13A 4JLRA 3HG1B 4IK7A 3DVGA 1TEYA 3O6FD 1BZOA 5JHLH 2BIQA 4HEME 4MJHA 3WIHL 5IR1B 3E6HB 1RKRA 5H4YA 4GKZB 2V9TA 2ED7A 4JO4H 1IAIH 2MFNA 3LN4B 3DO3A 4QRBA 2W38A 1OARH 4JK0D 2VMCA 1ULVA 2ARJA 1OSPL 3IK2A 4XCEB 5L9DL 2I7OA 1UENA 1WP6A 2NY5L 2ZD0A 3WFDL 3DOSA 4FXGA 5E1AB 2X4SA 5HI4C 4ADIA 4FHBD 2D3LA 1ETA1 1S2EA 4HWBH 1J5CA 1U8MB 1AGEB 5HDQH 5FGBA 4B60A 1JE6A 2UZIH 3MVSA 3QIWA 3RFRA 4MJ6A 1J8SA 2QKIB 3KEDA 4RISL 4EZJA 1PNCA 3VX1A 2GW5A 1BXUA 5FYKD 2QDVA 7FABH 1EH9A 5DWUL 3ZY7A 3I02B 2O26U 1CBJA 1Z7JA 2JQZA 1Z3GH 2XA3A 5CEZL 3OJMB 1BYPA 4OBSA 1JUFB 1ZHLB 1ZSDA 2BX5A 5BZDB 2ZP0T 4UQIM 4P5KB 5AL8A 3RWDA 5JOPE 2Y23A 5C08D 4NBYB 4TVSa 4LOUD 4UV7L 4EE2A 1YPZF 3Q8CA 5CD3B 5KOMC 1RJYB 3SE9H 2AITA 3IJ9A 2HFFB 2CGZA 5CJQH 5DHMC 2BSBA 2NY0C 1MIEH 5B1BB 5J1AB 4HJGA 4X80H 2FJHB 2PN5A 3ZKXB 5KVFH 4F58L 2E9IA 4TVPE 3GXTA 2DI9A 3OKOB 4N9GB 3CHQA 4C59B 1P5VA 4NCC2 4XHJC 4K8RL 4YMPA 1FL6A 4WAFA 3MNWA 3GXPA 5TE6H 3D9AL 1W72B 2VCOA 4DF9A 3HB3B 1X4XA 5HYJA 5I19L 4ELKA 2ORBL 5F1SA 3V4VB 1VZIA 5DFTA 2HTKD 4GRMB 3PAYA 4U3XA 2CK0L 15C8H 4OZIE 2OJZL 4L3CA 1ZTMA 3FUNA 1BX2B 4LLUB 4QKXB 5FV1L 2VDMH 2W5PA 2N0MA 3V52H 2GSGB 2FX9H 2K70A 4AQZA 3RPBA 1ZJBA 2ZOOA 2BNRB 4PI0A 5KTEL 2F2HA 3T1FB 4PY8J 3GHPA 4M9OA 3B3IB 5B21A 3OMNB 5SWQB 2CKBA 3QEGL 5DVLA 2NY3B 1ACCA 4TSAH 2WUBL 3GS4A 4KQ4L 1QFUL 2BNUA 5I1CH 1DBBH 3O41B 1D3CA 1T20B 1AQDB 5JOFB 2AQRA 1KLGA 1KYAA 3OZLA 4AIEA 3NCJL 4JO1L 4DK3A 4YE0A 1QI5A 4HK0A 1QBLH 3L8QA 4R8WL 4Q9CA 1EJFA 3U4BH 4G83A 1U8KA 3H2PA 4ERSL 3UCQA 3UXFA 1TQBB 4RRPM 4ES8A 1H5BC 2YUWA 3QIUD 5JHBA 4NQXB 5C09A 1Q1PA 1L7IL 3TZVB 5I9QB 3VE0B 2I5YL 4MZRA 1BZQK 2WWMC 4ICXA 5EC2B 4DGVH 1OP4A 2O5NA 5EMYA 3BPOB 1M7DA 4HIJB 4QRRB 3B2DC 2Y7QB 4YSEA 1EEUA 1KB5H 5EBWB 4FA6A 4UQBA 2J12B 5EDXA 3ARZA 1XL4A 5FCSH 2FX8L 1RIVH 3HUJE 4AL8C 4MMXC 1OL0A 1DCLA 3ATBA 4Z3JA 5EO0A 3BP4B 3QXVA 4J6RH 2DQTL 2XNAB 3ARBA 3IEAA 5AOKA 1KBGL 3BEWA 3VD2A 1R3KA 3RBGA 1AZCA 2F0CA 1SXSA 1X7QB 2EH8L 3HE6D 4NKIH 4MRCA 3BKML 1JPFB 1MY7A 5EZPA 5IMLA 3IM1A 4NQVB 5D7JB 1C08A 1A9BB 4JDZA 5HGAB 2IWKA 3HJEA 1OAUL 2F1BA 2B59A 3T3ME 5F0LB 1BEYL 3F7VA 4HU8A 4JZOB 4JZJA 1PL3A 2P8MA 3X11B 5DYOA 3KYAA 1OAKL 3TWCH 3VWJB 3B5TA 4NUGH 3LAFA 4GSDH 4P3WA 1H8NA 5DJ0B 5IHWA 3QBTB 4I18A 5DD5H 5AKSA 2WXIA 5AKTA 5DRXB 2J71A 4AZ8A 1KMGA 3DMMD 3ZKSD 3NSJA 4XBEH 2TAAA 3RQ3A 3HC3L 1TTAA 2ZCLL 4GW5B 5HYSB 1TETH 3AREC 2NDFA 1S9KC 2MQGA 1PD0A 3GO1H 2JFCA 3LN5B 4LESA 3C12A 1KIPA 5J06A 1UZGA 3QHZL 4ANUA 1Y1DA 1LO0L 3U30B 4PV8A 3TO4D 2WLYA 1QO3B 5AW8B 1UCTA 4UM9A 3S88H 2WTRB 2F08A 4O02B 1QUNB 3GXDA 5B4MC 3EO9H 2E7HA 1KBWA 1FHNA 3K5SA 5AWNH 1QFWH 3SDDC 3NPZB 1M2VA 2XXMB 1UXSA 2BVOA 2WXKA 3L6FB 3ZL4H 4A7TA 5JHDB 5GRVK 4N8VG 4M5YH 2F74B 1PKOA 3TEXA 4Z0XA 3D85A 1EK3A 4X4XA 5KSBE 3CAFA 1KN2H 4PRHD 4HEMA 2PCFB 3WFCL 4A38A 4AT6B 3EYVA 1F2XK 4WDIA 4FQXD 3BIAX 2VR4A 2ARWA 3C8KB 3E3QE 1J0YA 2KERA 3PDOA 5K1NA 2EUVA 4FZ8H 4JE0A 5B38G 1F11A 2E75C 4ZFFA 3MLUH 2XV3A 3HPLA 3D39B 1TVBB 4IU2A 4X9BA 2XIDA 2VLRD 2FBJH 1FPTL 2C4FU 2WANA 4GUPA 2AKRB 3B9VA 5C2UB 5EEXA 3RA7H 2PW1A 4HS3A 12E8L 4PP1C 2YGQA 4K7PH 4PWIA 4KTGA 3HNTH 2QJDA 3OR6B 1HE7A 1N2RB 3S37H 1AZBA 3F7KA 5AENA 5FB8A 4DESA 1BYNA 1U8NB 2V7HB 5ENWB 3ARFB 2YKLH 4TUJB 3GJFB 4ODHH 4B9ZA 3FT3B 2OMNA 4LHUB 4LLMB 3ZE2B 1MFEL 2ZWLT 5E1GA 4PCYA 3L3GB 1IEAB 3BZ4A 3GJEB 2MPVA 3TF7C 4XWGL 3CFNA 4ZI8A 1BVZA 3JVGC 2NY1D 3SKMB 4HG4J 4JZNB 4QRUA 3BDXA 1FIEA 1ESOA 1AXSA 3PE9A 2EJ1A 2L7EA 1ZVHA 1WAAE 1N68A 2NUPA 1YUKB 4Z3IA 1BQHG 5CLYA 1HEZA 1DSWA 1E2WA 3IXTB 1HU8A 1A3LL 5I8EB 1NMCB 3QULA 4PJ8D 1SY6L 1PKQB 4MB4A 5BV7B 2H3NB 3WYRA 3O6KH 1TDQA 1E3ZA 4K9EL 1H0DB 5D1ZA 5ERWB 1MFVA 1WC7A 2DB8A 2V2XA 3WY4A 3ZT6A 3MJ7A 2O5YH 4M93B 4N6RA 4Q9QL 4WW1A 2A83A 1ILUA 4LAQL 3MZGB 4KXBA 4BDVB 4FLQA 1A9EB 4UUJB 2AXJA 1G9MH 2XZQH 3A4FA 2NNAB 1CLOH 4OZIA 3P11L 1A21A 5E9AA 4DQOL 2DLGA 4LIQL 5FOBB 2AXWA 4HLZH 3TXAA 2NSXA 5E8NA 3FCBA 5I23A 3GDBA 1TJIL 1RFDH 3N41B 1DVQA 3ARDC 3INOA 3K72B 2LU7A 4ZO6A 3EGSA 3FQTB 2H0JA 1NBVL 3QQNA 4Y4HA 3QIWD 2CJTA 4HWUA 5FS5A 3FU8A 2Q6WA 3RNQA 3N43B 1F8TL 1CLZH 1U8QB 3CSBA 4NN5B 1I85C 2XVKA 3GKZA 4OIBA 3X1BA 4ZO7A 4NRXA 1MW2A 3VXQA 1ZMYA 3WKQA 1Q94B 3GNML 4ZW8A 3SYAA 3IKCB 4IHOA 1S7RB 2HT4C 2H0FA 5B3JE 3NAAH 5IJKC 4CU6A 1U8HA 1I8LC 3C8HA 1PZ5A 2FLRT 4Z7UB 1BOGB 2ICCA 4PCTA 3G6JB 1NFIA 3GTTA 2WBKA 4Z8FL 1TTFA 3NIFB 4YUEH 1LE9A 3EJPA 2XPGB 4U1KB 4FLOA 5FIEA 1T4WA 4K5PA 1OTTC 3S34L 1MFBH 3OF6D 3L3JB 3VFWA 5DS8B 2VUKA 4M43L 3MJ9L 5L2JB 1I31A 2WK2A 4Y8DC 5FOJA 1KPVA 5C0CB 1VAHA 1YAZA 4ZMLA 5C6TL 4LLYB 4RH4A 3MRJA 5DZNA 1VIWA 3DO4A 3HUJA 2QSVA 3QFJD 4RZKA 1QHOA 2ODIA 2K8QA 5IHZA 2BP8A 4KDVA 5LGJB 1NZRA 4RDQF 1AD9B 3UZQB 3ZDXE 4GI6A 2APTA 4U7MA 1MNUH 3WTVA 3W82A 1MCFA 1O7VA 4H5SA 5HYJD 4WW2C 3IGUA 1UCBL 5C0FA 5IHHA 4G7QB 2PPDA 3OB0H 4Z23A 3C75A 3KAAA 3NZ8B 1ZLDA 2ZXGA 5DWPA 2YSSB 3QNXB 2DQEH 1EFQA 4P9HL 3O9WC 1LO2H 1I1AD 2W81C 1XGTB 1WFOA 4NO0B 1FN4A 3JUYA 1KTLB 4WO4C 4TL5A 2NY5C 4NO3B 2VB5A 2XWZA 4QO1A 1MI5D 5IIEB 2UZYA 2DQGL 4LVNC 1FO0B 1FFTB 1RZKH 3SKOB 3TN0A 3CV5A 3NABL 2YD9A 3UTTE 1XEDA 2ZYIA 1XGYH 5KW9L 1EHNA 2E47A 3EG9B 2ITDB 4HUUB 3VGAC 1BBDL 3MGTB 3NCMA 4YGAB 5GSVA 2CLRA 3OLIA 1ZLSH 3T0EC 1J5OH 2GITB 4NGHH 1YEIL 3LZLA 1QNZL 1GZPB 5T5FH 5CZVL 1FVDB 2C9QA 2AK4E 3LKSB 1WD9A 2G9KA 3MLYL 5JPNC 3G5XA 4M3HA 1WWBX 1HOCA 1SLXA 1VEPA 4HU2A 1X9QA 2EC8A 3BZEA 4PJ5B 5KSBA 4KRMB 3MREB 4WZ9A 3B34A 3HC4L 1CYGA 1W72L 3CUPA 2C7FA 4A6YL 1O75A 5DCCA 4IIQB 1U92A 2IQ9L 4JUTA 5JXAH 5HHXH 3ARGB 4G1MA 4NYLA 4Q6YA 2P24A 2QL1A 1J1OH 1D7DA 2QV4A 4RAVB 5D7IB 4BHUA 3RU8L 1JVKA 5JXEA 1KCSH 5EZOH 1QX1A 1KIRA 2VL4A 1PZAA 2IV8A 1ZA6B 1A8JH 1AP2A 3QCVH 2KPNA 1FIGH 4JGUA 4WI3A 4XH2B 4EVNA 5CJ8A 1JDDA 5INDA 2P5ED 3FO1A 2NQ3A 3P30H 2PWHA 4JQIL 3LZNA 1MFMA 4ABUA 5ABAA 4KX9A 4TQEH 5JLZA 1L7TL 4TUUA 1KN4L 1UD4A 1B2WH 3U0WH 5EN2A 4CGTA 5K9QI 1E28A 1K5WA 4XNZC 4XVTL 3MV8B 4M6AA 3K6IA 4NWUL 1HIML 5D2LE 1TTUA 4RIRA 4IK6A 4XN7A 4K94L 5HI3D 1ASQA 2ZCHL 4KKBD 1BMGA 4DN4H 2XN2A 4WENB 4JREB 1KGCE 2ZKHL 5AZUA 2N56A 1HCVA 4G8AC 4E9SA 3CWGA 1IC0A 1FCGA 1WAAA 2AV1B 4GSRA 1E9QA 4JFXA 2I60H 1DQIA 4JKKA 3VMNA 3MBXH 4OI7A 2X88A 3EJYD 5F6IC 1IGYA 5DF0A 2IALB 1PZUB 3TVMD 1T3FA 2J57A 1AGFB 4AYSA 1AY1L 1XTLA 4Z7WF 5BQ7A 5KBLA 4AJWA 3BWZA 2CHXA 2CO7A 3H85A 4IGBC 2ZCKL 2GC4C 1JGVH 1KTJA 2RFXA 3RZCC 3QUYA 4LCIH 1MRFL 1QEXA 1AGBA 2ZXBA 5E99L 1JPGB 4G6AC 2D03L 2M1KA 1WBXB 3HFFA 1Z6JT 4XMWA 4K8RC 2APWA 3UZEA 2CKBH 4WI0A 2R69L 5AW4B 2J2ZA 1CK0H 1HH6A 5LXVA 4W6XB 5I8CB 5FHBL 4F57H 3T8XB 5L8JB 4PJEB 4QEGA 2FO1A 2O61A 2VL5A 3VM7A 3SDAC 3A0OA 4XX1E 4QTFA 3VRJA 1IILE 4RMQA 3I6KB 2HH0H 1YNLL 2JKIS 3IB4A 3FO2B 2J1ZA 4PJBB 2EE9A 1T04B 2QSCH 5AVTB 1XX9C 2RIKA 3SPJA 3KYOB 5L7XL 5GJTH 4QF1A 3HIZA 5HHNB 3PJLA 3GHEL 3U7AA 1A25A 3BP6A 4QRPB 3IDYC 1IGIH 3MKKA 3K6NA 3QFGA 1NKOA 3JV6B 5IVZA 5JW3L 4X0KA 4X9YA 1LQBC 2HYMA 3T4AB 5ISZD 1PSKH 1YN7A 2VW6A 5C0RH 2OW6A 1LDPH 5DVOA 3LS5L 1FQ9C 5EOTB 2F54D 5F1KC 3VWKA 4CN1A 1OTSD 4XX5A 5IEKB 1QAWA 2DIBA 5H37A 3IFNH 5A6MA 5DEZA 2J43A 2YPLB 3ISRA 1SJEB 4LNVA 1NOAA 3W11D 3FT0A 5CKAA 1LYQA 1ZT1A 1QBAA 1GS8A 3HS8A 4J1UA 2WINA 5IHUL 1FFPB 2XZCL 3WIIL 1YNTF 4HF5L 4HT1L 1G7JB 4M6OH 4Y2LA 3ZYIA 1FLTX 1MCEA 4GW4B 4MJ5A 5JO5B 3RDTB 3CHPA 4L5FE 1QQDA 4J6IA 4JRXE 1XB3A 3QT2A 4TNGA 3P3TA 3TNMB 1W91A 3KD4A 3S48A 4OCRH 3II1A 1AQKL 2A6DB 5ID0A 2IH3B 4XB7A 2VH5L 4HETA 2H8PA 5HHME 2O4EA 3JZYA 4HKJA 1F3RB 1G1CA 1RMFL 1N8ZB 4L9LA 4Q7DA 3QUXC 1HHIB 1JOIA 3ETSA 1IT9L 2VABA 1A1OA 2DF3A 5D1QC 4A55A 1CT8B 2MPAL 3IJSB 3NJFA 3SQBA 2FJGA 4G7YL 3ZW3A 2NXZB 4YPGB 3VI4E 3QWRD 1GZQA 2CBPA 1IGJB 5FDWA 1NAKL 4H25B 1Q0EA 3GRWL 4XE0A 4HBCL 1VFBA 2YOCA 3KYNB 4P9MH 4BKLA 3NZUA 4ODSH 4XOEA 4NZ8A 4PU2A 4WV1A 4EQ2A 2VWEE 5HGDB 3UTTA 2WVTA 2B4CC 4NO5A 5E8EB 1IFHH 1LNUB 1H19A 1RULL 4FKKA 2EEXA 1DJIA 2K8MA 5IFJA 2CM5A 4D7PA 1FG2A 5CJXC 4L4VD 1G4RA 4M1CD 1J05B 1XIWA 2JJSA 3ZGIA 4JM2D 1RL1A 2BOBA 2Q3ZA 2VDRL 1KB3A 3OLDA 4MNHA 1UACL 2OR8A 2HMID 1T7WA 2EXYD 4RBPH 5E9DA 2H6UA 1FZOA 2AK4A 1RZ7L 4PJXB 2IPKA 3BDYH 5JUEH 1KOAA 3BSZA 3E1F1 1KZQA 1ZLWH 5DJYB 4K3DL 3B6SB 1RZGB 2HTLD 4BZ2A 1WZKA 4OFVA 3NN8A 4LQ1A 25C8H 2ZUQC 5EBLA 1YCSA 1C7TA 2H32A 1V7NL 4OBRA 4P8QA 2R4SH 1I8MA 4KKRA 2GEEA 2VC2L 3UAFA 2GC7C 1TZIA 4PD4J 4K9EC 4XP6H 2EDYA 4I5BA 1BQHB 3E38A 3NIGE 4XNMB 3JWOL 1DQDH 5GGUB 4QRQA 3KHOA 5GGVH 4JPKH 4IRZA 3PNWB 5H8DA 2DBJA 2R1WA 4X7DC 5ETUA 3V6OE 4EIBA 4HLEA 5CZKA 2YRLA 1NCGA 1AR1C 1E6OL 1H3VA 1A1NA 1QR1B 1GCFA 5B39B 3BP7B 4PFEA 4GG6F 5DC2A 3V0DA 4KZEH 4F8NA 2IPTL 2Z64C 3MX0B 4D8OA 5I1GL 1GYAA 2CJUH 1JZ3A 3ZSSA 43CAA 5D2LA 2M8XA 4R96B 4WWKD 2AEQH 5H94A 4TVPH 2XT1B 4FXLA 3CDGB 2IGLA 2CCVA 3JWNG 4KKZA 2W9LA 5DT1H 1AI1H 2O72A 2W59A 3QI9C 3N91A 5FF6B 3TURA 3RVXD 4XN1A 5E8OB 1FNEB 5T8IA 2AGJH 3QIBB 3PWPB 3V2AR 2X7LA 2IWGA 1J11A 4LZKA 1DVSA 2NLJA 4AEIL 4CGUB 1I82A 2QMKA 4DP8X 4Z0BL 4EZMA 3EJRA 2VUOA 5LNGA 4ZMPA 4FQQB 1G7MB 3DETC 4ZUVA 2D3VA 4Z7IA 2F61A 3QJRB 4RGNC 4N26A 1KPRB 1HWGB 5D1ZI 1LK2A 2O30A 5FYLD 2VGLM 3LQAH 1UTDA 2H47C 1NL0H 2OMYA 1DCEA 4OLVL 3F12B 3QFDB 3JV4B 5I16A 3L16A 1TYRA 2B3RA 2WIIB 2QTEA 2WQVA 1H3XA 1P9MC 2N3JA 3TWYA 1MCJA 2XICA 4FNUA 1GJUA 4BWWA 1AJ7L 2PP7A 2UVEA 1OCWH 1LP9F 4H8WH 5T33L 4XNAA 4NRYB 2BCKA 3ZDYF 1RZQA 1Q0XL 4ONOA 5J9PA 3CN2A 3TYFB 3O4LE 4KO5A 3PL6A 2R2EB 3D0VA 1AD0A 1YPZE 2EE0A 1NFAA 1WLHA 1XF4B 5DD1H 1ADQA 1PMYA 3MNZB 4HWNA 1ZGLM 5T3ZE 1P4BL 5KYWA 3JTTA 1XEUA 4FJYA 4P9HC 3DX3A 3HKZA 3L3OA 2ILLA 1X5KA 1JRHI 4L8BA 2X41A 4DJMA 3FONB 2XBDA 4H26A 5I17A 4TMPA 5EFIB 3AC0A 3GINA 5EORH 3EYUL 3STZA 1MQKH 2PTTA 2O5ZL 1JTPA 3OBAA 4X4ZA 4WFEE 3UTSD 4MASA 3KW7A 1RERA 1DEEA 2NSMA 2BSTB 3NIDF 3MCG1 5F9JA 5JQHC 1E7UA 3GIZL 4HUVA 4HJTA 4LE8A 3SDXF 3WEXA 2F8VA 1SBBA 1S9WB 5KAQG 4G9DA 3CDZB 2OFQA 1T7XA 5HDWA 3V6ZB 1QBML 2WLNA 4NHCL 1U33A 4P5TA 2BNQE 3AY2A 3V10A 1U95A 2BP3A 1IJ9A 1R0AH 3LXAA 4L3EE 3SBRA 1MELA 3T9WA 1X7SA 3CX5J 3O8XC 4JRXA 5FW8A 3V4UH 4KKCD 3OXSB 1IGTA 3ZKXC 4ISVA 4XO4A 2Y06H 1Q1JH 1JGEB 2UUDK 1H5BA 1JHKL 1V7MH 4UT9A 1T0MB 3PUUA 1DFXA 4KUCF 2WB7A 1MHHB 4EN3A 5MP6L 1QA9A 4GIAA 4DHLA 3OZ9H 3AT0A 4L4JA 4NM8L 3W57A 2BY3A 5IVOA 5CGMA 4X6CF 4EO5A 4HJ0C 1IM3A 1EO7A 4M1GL 4DIXA 8CGTA 4TVUA 3ZTNL 1M7UA 3HB3C 3DO7B 2JIXA 3GZKA 4OFQA 1X5XA 2GB2A 3BC9A 3VI4A 2OZ4L 4XVUD 4C83B 3RVWD 2KZKA 4NQEB 1YA5A 3VXNB 5EO9B 2DPKA 3P3YA 2CIIA 4C56E 2X1PA 4AVIA 3RX8A 1EEZA 2QFRA 4KK8D 3SE6A 7PCYA 4KTDH 5I8OH 4J2XA 1H3PL 2HFEB 2IIJA 3VXTB 4OKVB 5L4JA 2CCWA 5F1IA 2EIKB 4BK4A 5FYLH 4HCRL 4JFYA 1ZY9A 3U1PA 3MV01 3SQOL 3BLPX 3T0VA 1V3JA 5D96B 2NSQA 5J7CC 2CRIA 3RHWF 1FFNB 2NY3C 1J9TA 4P23B 5HDLA 2I07A 3HW7A 2FRGP 4ZUUB 2W0FB 3I6GA 4E9YA 4DAGL 4KI5D 2WBJA 4E0RB 3QEQB 4K94C 3WL9A 1RK7A 4KRLB 5F7NC 5L8LB 5E00A 1N5YL 3N1GC 2IH1A 4G72B 1HXMA 4LVHB 4I48A 3L3IB 1LO3L 3FCSB 3CX2A 1N64H 4OR1A 1ED3A 4F2EA 1E90A 1MRDH 1A2YA 3CFKA 2R56L 1TQBC 5DQ9B 1KBPA 4ZUSA 5EA0H 3VRLF 3U9WA 3TZVC 2L8AA 5I9QC 1NC4B 4JCLA 5JZ7D 5CJ5A 3Q6GH 5CEZE 4KI5F 1AO7D 4X2UA 4H1LG 3AUVA 4KAQH 5HYQA 1RQ5A 1JFQH 3NA9L 5AOMA 3SDDA 1EAOA 4L4TD 2A6IA 4XT1C 1E2ZA 4P3DB 3TBBA 4FG6C 3FYIB 4BHUI 4JDEA 3OKNB 3PGFL 1NUNB 3MLPA 1F4WH 2IO5A 1JWMA 1N3NB 1SVZA 4PRPE 1E4JA 3EZ8A 2FWOB 3Q48A 1XAUA 5IK3B 2DTML 1EXHA 2DM2A 2VISB 1ONQA 1JYXA 1WQVT 3DUHA 4U1SA 5D7JC 1NLDL 1DQJA 4RBPK 1RUMH 4WU7B 2KC0A 4G43B 4I3SL 2Q8BH 3CXFA 2Y7LA 5D72H 1IBHA 4P07A 2HPTA 3W39A 2AMGA 5DLMH 1FF5A 4XGZA 1ZLWK 1XF5A 4H8HA 1NFDF 4YDVA 1ZHBB 5FGRA 4Z95L 2D2CC 2VN4A 4A2HA 4X42A 2DQFB 4LCUB 5BVJB 1PEZA 1SXCA 3HZYB 3BUYB 1DL7L 1ZA3B 1ZDQA 4Y1AE 4Y2OA 3TC9A 1QYGL 3V5HB 1W6WA 2ZX6A 3BH9A 5CILH 5E9DD 3U30C 4NUJB 5K9JH 1U8LA 2VXQH 3JVGA 3IRPX 1OP9A 3GM0A 5JR1L 2HWZL 5I1JH 3EGDA 1OB1B 4EDWL 5IROD 4KRPB 1PQZA 2XY2A 5KS9E 2FX7L 3V0VB 4AYFB 3DIFB 3QZLA 3D69B 4K07A 2KHAA 3AM8C 3NJMA 3RVTD 4JL1A 4YDLB 3UTQA 3EJCA 4HH9B 5ITFA 2X2JA 3BXNB 3GB7B 4PLKC 3VSUA 3VGEA 3AT9A 3OQRA 4WKXA 3TFKD 5K1VA 1CLVA 2HG5A 1C5CL 2G3XA 4UMSA 3TASA 3LB6C 4JDVA 3O4LA 4JO2H 4OZ4A 2F7QA 3VFPB 4KTYA 1WGVA 4LSPL 2WAHA 3IF1B 4WCYL 1YPZA 2BVQA 3ZTJG 4R4BB 4LNRB 4DT2A 1NIFA 1AIFB 2ATKB 1MCWM 3JV0A 4PWHA 2DKSA 5C0JA 3S3SA 4LLWA 1AACA 4NCC1 4WTQA 4ANWA 5H37H 3BGMB 1SEQH 4JFFE 3NJLA 1I75A 5LBSH 4G8EB 3L81A 2CUIA 1OT1A 3OJVC 4TUOA 3L4TA 5CM1A 3IFOA 4KFMA 1BYOA 1MJJB 2YBRB 3O11B 3APDA 1EEYA 5HI4D 5KVDH 3S8FB 3WKML 3ARFC 1ZTXH 3CPLA 3A6OA 4ECNA 1QSFB 1SHMA 1TZGH 1QRNB 5F3BA 1UURA 2NYKA 3KYKH 2VITB 4N1HB 1E4XL 3ZMNA 2J4WL 3EDDA 1B0IA 1YEEH 4J3OF 3V0IA 5LN8A 1I85A 1CGSL 1WUZA 3QA3B 3UBXA 4XBGB 4OQ1A 1UGKA 3TJEH 2WVUA 2BNQA 4RVBA 5FDYA 5I0ZA 2UXVA 1JERA 3QQ4A 1OO2A 2EE3A 5C2BL 4APXB 1ET5A 3EBGA 1I8LA 3DOIA 2Y5QA 3WFEL 1ROWA 3TX4A 2WYZA 1S7QA 1MF2L 3N2JA 1NMCC 5B1JC 4U6HB 2JKLA 2GI7A 2XG5B 3UO1L 5BV7C 2IAMC 5GS0D 4JHUA 2V5YA 1UQSB 4U7SA 4HEPG 4XPTH 1X5AA 2B5IB 1CDYA 2PPAA 2L7JA 3WNNA 4HV8A 2NY0D 4LLQB 2UYLB 2V8MA 1TEGA 3RI5K 1AFVH 3FTYA 4M93C 4Y2DC 1P4UA 4FQHB 3BKJL 4Q9RL 1NGWB 2DM3A 4MB5A 2YZ8A 2ICEB 1FYTD 4JANB 4G6JH 1CZ8H 5IB2A 2QQKH 3OM3B 1DQVA 5GJSH 1P84J 4XHJD 1SYSB 3Q5TA 3RWGA 3S2AA 3VW3L 2NY6D 1OAYL 4EN2A 3LHPH 3TO2B 1PG7X 2V3EA 2YD3A 3U36A 4N2HA 4C56A 4EXKA 2BMKA 3U1SH 4NT6B 2GJRA 3QJFA 4WW2A 4BSWA 1F4XH 4LASL 3HMWL 1DE4B 3GS0A 1HHJA 3EYSL 4A2EA 1OSZA 2Q0ZX 2F8OA 3WIHA 3BSZH 1IM9A 4OFDA 1GJWA 4ZFZB 5D1QE 4B50A 1DBKL 4JJ5A 1AYOA 3SQRA 3FW6A 1ET7A 1NCAH 4BZ2H 4NN5C 5F9WC 4EKJA 4WO4A 2J7LA 4ODTH 4PP2A 3U83A 1ES0A 1SDYA 2DQHH 1UZ8B 2KKQA 3FQ1A 5CINH 2EDQA 2F53E 2AQSA 2H32H 5TE4L 1N4XH 4MA7H 2UWEB 4JL2A 4BUGA 4UNUA 3FSZA 5G2NA 2FCBA 6CGTA 1MXGA 1QACA 4WUUE 4PJIF 3WUWG 1AHMA 3O3DA 4YQXL 1QLEB 3O6LL 2FUTA 4OUUB 3VH8A 3D4CA 4DTGH 4IRZH 3WE1A 1MJ8L 4JGNA 3DPDA 2N01B 1Y6KR 5BPPA 1KIUA 3PV6A 4BUHA 3P0YH 3VQLA 1OGAD 2ALAA 5EF3A 4NX0A 3WEOA 1UC6A 3G5VA 3K3QA 4OLZL 3LH2L 2WXOA 1DN2A 2EDNA 4HKBB 1MWOA 4OD3L 2PTUA 5HHOE 1SXBA 5DD0L 2WWMD 4M6NL 1IQDA 1NTDA 2G9HB 4YK4B 1FZKB 4WGVB 3DXAD 3TBYA 4YX2H 4UOW0 1Q9WA 2FQGA 1IM3D 4PRPA 4KVNH 2G3MA 2Z92A 4IEFA 4MBOA 5J56B 3ZPDA 2HLAB 3QZWA 4MLSA 1SBSH 1BZ9A 1MJUL 2Z6FA 2GFBA 1KT2B 1A7QH 2QADB 1ZD6A 1RP8A 1K6QH 1SJXA 4P2OB 2XKSA 4KHXL 4AQ8A 3MJ8B 1ZANL 2GTZB 3C5JA 5EU6D 2ENYA 3FUMA 4J27A 3V0HA 1NDTA 1DP0A 1WITA 1TXKA 3MACH 3TJHD 2WYIA 3T3PB 2R23A 4E9LA 1R6VA 2MRYA 3CCHA 4IKLA 4S1QL 2Y25A 4LIQE 4NKMA 4BFOA 1TMCB 2DEYX 2YD2A 3GC3A 3JT2A 4DPCX 4LSUH 4JS7A 2VLKE 1G9NC 4ZS7L 3FRUB 1QLFB 3SZ6A 1T1XA 2A9BA 1N26A 2CBOA 2CDEA 1D5ZA 3PGDB 4NQTA 5EUKB 4B27A 4M62H 3RWFA 1G4MA 1IAOB 3CK0L 1N10A 1CXFA 2FHFA 3MZTA 4GUOA 3K0WA 4MNQB 2EDHA 5DS2A 5KS9A 2CR6A 3ARED 3ARWA 3K5RA 1CXKA 1PX8A 4O2CB 4PW9A 4ZTOH 4YZWA 2FGWH 4MVBC 3UAEA 4XB8A 5AALA 4IS6B 4WEBH 3M46A 5T1MA 4GKSA 3V0WH 2IOMA 3ARYA 5B4MD 3OV6A 4HXAL 5DZLA 3UPAA 3VXRB 5TDPB 1K3IA 4Y0GA 2AFNA 2WCGA 3KLQA 4RGNE 2NZ1A 4IIQC 4DH2A 4IGBA 5FUOH 3QXTA 5F7YC 1C8QA 1YMME 3ARGC 4A39A 1NA8A 3MUZ1 4LRNH 3RZCA 4FTVE 1AHWB 5DJ2A 4S1RL 4ACPA 4BSVA 1MCOH 1KB9K 3BAYA 2C9XA 4ZW5A 1A4JA 2OMZA 4JFFA 3TTSA 4Z77A 4L0YA 3DX9B 4WJ5B 1S7SB 2BSDA 4HZ1A 3L4VA 4RFNB 5JQ6H 3UJIH 4XWOD 4Z7WE 2FVNA 4LCWE 4IOIA 5DO8A 5A7BA 2JCCB 4ZAKC 4L5FH 1B0GB 2Q8AH 2VKXA 5LB1A 2PWDA 1MFCH 5MEPA 1GTNA 4FYQA 4J8RB 3RWJA 1DUYA 4K23H 1MHPL 2OR9L 3BUPA 4FABL 4S2SA 1B0WA 5D70L 4JG9A 3KXFB 5EO1A 1YEHL 4JREC 2LW3A 3WHE0 3VXSD 4YHKH 4WF7A 4FZEH 1IFGA 4O58H 2DN7A 4YVUA 2VOTA 3IFPA 1INQA 1ZDSA 2EADA 3LEYH 2XRAH 5D9SA 2OS7A 1DDHB 3EH4B 3MYZA 3HVDA 4YFLF 4L1LA 1INDH 4HIPA 4AL8H 3QHFL 4EAEA 1KNOB 3MHZA 4GQPH 4A68A 3L95A 5J6SA 2HJFB 5KBNC 4U1HB 4P99A 1CGYA 2OKMA 4KY2A 1FWXA 1HK6A 4R26H 4B9IA 1M42A 2QR0A 4UTAH 2A5UA 2H2SC 2W65A 3LCYA 4Q56A 3ZKQD 1DQKA 4YBLB 4R7DA 3L48A 4LKXA 4JFED 2J1WA 1R5IB 5T3XD 4Q0XH 3QCTL 4FG0A 1KGJA 3QH3B 5EBMB 3TIEA 1A7OH 3ZN6A 1EBAA 4NNYA 4ZUWA 4BQ9A 3Q3GA 4M00A 1G1YA 3QJHA 1MW3A 1DSFL 3VFUB 1UA6L 2JWYA 2NNXA 1OVZA 4JPVH 4F1ZA 3QUXA 3SPIA 4H1LB 4GI8A 4R7LA 2X0WA 1IMHC 2EIZA 4V1DD 5D1QA 2NW3A 3AGWA 3BW9A 1YY9C 3FFDA 4NQDD 1GOFA 3HR5A 2HRPL 4GBXD 2D9CA 3ARDD 3ILPB 5IW6B 4N0UE 3PDGA 5DMKA 2F53A 2P26A 1JDCA 2VAAB 4F7CA 4F9LC 2YMXL 2E7CA 3P4OA 3T4AC 3VFVA 1N6QL 3UTOA 1A6TA 4O2FB 4C4KO 3SD2A 4WUUA 3QPXH 3MLTA 2GCYA 4GOSA 3HZVA 3IPEA 4JO3L 4CBPA 1VACA 3QRFM 1C5DB 1ACZA 3KWUA 1T2XA 3H6AA 3PRZA 5CJXA 4IBUA 4XPHL 1G7QA 4YSUA 1UXLA 1EAPA 2B14A 2BWQA 1B9KA 3H7LA 5GS1B 5AKVA 4G5ZL 2OSLA 5T1KB 4D0CB 1YEGL 2IG2H 3SE4A 4XMPL 5FKAA 1M7IB 4AM0A 2DRUA 4HUXB 4OCXH 5HHOA 5DMJB 5DEFB 2VRQA 2DDQH 1WFJA 3QDMB 3SPVA 1S8DB 1Z3RA 3ETBJ 3GIVB 1MPAL 2I25N 1F56A 2P49B 2R7EA 2R15A 4LSTL 2NTSP 1HAUA 2GAZB 4Z7QB 4MSWA 4F80A 4O2EB 4HWEL 4NNPH 1SY6A 4ETQB 4PJHB 4UQ2A 2NY4D 4S0SD 3HJ0A 3KCPB 2V5RA 2MHAB 1RZ8B 1ZWIB 4ONGL 4CN4A 1U58B 4HIEB 2C3HA 3DBXB 3RTLA 2E6PA 3WSQL 1HAWA 4XCYB 2NXZC 3SGEI 3UYPA 5E2TH 5GGSA 4DCQA 1SQMA 1LEIB 1MG3C 3U2SB 1N70A 3ZYOA 1TZAA 2CGYA 2OR7A 4JPIA 5J57B 2AI0H 3ARXA 4M5ZL 5GGQL 2AXHA 5K9QG 3H9SB 2Z4TA 4QOKD 3O9WD 5DR5H 3BZFB 3M7OA 3G5ZA 1NIAA 2B0SL 2CLZA 3AABA 3H7BB 2DWEB 5KANI 5AQ0A 4BQ8A 2VLKA 3BCFA 5HGHB 2FQEA 4MD4A 3FUEA 4TSBL 4XO5A 3DX7A 4PRIB 1MQ8A 1VZGA 3PY9A 2DQ6A 3INUH 4J23A 4DN3H 3MRLB 5FYJL 4UQDA 1F90H 1UVQA 2J6EL 2R9HC 5T3XH 5MI0C 2UY6B 2VN5A 5EWIH 2Z35B 2VXUL 1CXLA 1QG3A 4G80B 3QI9A 4L23A 4N5ED 2AXFB 4JRWA 3RIFK 3WFBL 5BV7L 3MC0A 5KYUA 4PJCE 1B9ZA 3VFNB 2PO6B 1AE6L 2Z31B 5DI8A 2IANE 1NC2D 5LXGH 1YECH 4EKXA 5T3ZH 3N1FC 1PCXA 3T0ED 3QJQB 2KH2B 2JKNA 4EDXB 5I75B 5SWSD 1H6FA 3MXVL 3Q6FA 5A6LA 3RPKA 4FKHA 2H6PA 4UDTB 5CS7A 1P5UA 5BRZA 5KZCB 1I8IB 1YMMA 2C3VB 2DH3A 3OB8A 4NO2B 4FTVA 3FQWA 4AOFA 1F00I 1OHQA 3MRFB 3SDCA 3BRFA 1TFPA 1MXDA 3H3KA 5TF1L 1J48A 3MJ9A 4X7FC 4NP4H 1WZ1L 3FXIC 1CMOA 4JN1H 4LSQL 2R27A 1P9MA 1X5GA 5AZEL 1HNYA 3HHSB 1KGWA 1RU9L 1RXLA 3G5WA 1MAJA 1SGKA 1OE3A 1UH4A 3P1VA 4Z7WA 4JN2B 4AJVA 2C5DC 4AMKL 4HULB 3U9UA 5LQBL 5F8QC 5IR1A 1UM5H 1VFAB 3PWLA 1IEBA 5DZJA 3QUMB 3B83A 1JYVA 2JXMB 4MCNA 4OZGF 1B88A 1T0OA 2Z7WA 3GBNL 1L3WA 1SN2A 4XCEA 5AVSB 1IEHA 4P46C 4AENA 1QLRB 1T7ZA 2R39A 3DHPA 1WBYA 1IC7L 2Z1KA 3L13A 4BFIB 3EW3B 1TQVA 2IGFL 4U1LB 3D39E 3PFUA 3THML 1DBML 3CLEH 4Z7NB 1CICB 2Y6SC 1FRGH 4ZPTB 4JE4B 1LP9E 5TQ2H 2EE2A 5CSZA 2ZP9A 5IBTL 1QLEL 4XHQA 3ZDYE 2FIRT 3MRNB 3MOAH 1SJVA 3CH1B 4QGYA 2F19H 4GAYB 5DUMH 1M4KA 4QPEA 1B4TA 2A9MH 3P40A 4YHYB 2ADFL 3B7RL 1JUFA 1U21A 1VZHA 1ZHLA 2OTWA 1WCQA 3L1GA 3QJVB 4LSRL 5HVHB 4TRPH 5BZDA 2VDQB 4FFWC 2YWZA 1NCIA 4GEJA 3LXBA 2WMPA 1QZNA 4WSKA 2C8NA 1J12A 2JB5L 3BVNB 3GXNA 2AVFA 3C5XA 3DX8A 3WIHH 1WRFA 5CD3A 1HKLL 1RJYA 5I30L 2HFFA 3Q9PA 1KCUL 5KJ7E 5HDBE 3O8XA 3HVNA 4K3JL 5J1AA 3WUWB 3NIDE 2G60L 1OSPH 3IMTA 2WLLA 1A6VH 1JJUA 4TTDD 5IUCA 4U05A 5EZIH 5L9DH 2NY5H 3ASWA 3ESMA 3WFDH 2V5TA 4E5XG 2E74C 4F24A 3G04B 3FB7A 2JELL 1MHEA 2JTDA 1AAJA 4KV5F 3IDXL 1A4KA 1W72A 1BQUA 3KWWA 4RISH 1A0QL 2ODHA 4OLWH 3I6LD 4A6YA 1VGKB 1GPOL 3TT1L 3GYRA 4OZFB 1F3DJ 1KYUA 5DWUH 3SDAD 4K71B 4N0UA 4W4OC 5CEZH 3MLRL 4OIAA 4PJGF 3WV0A 1P2CA 1T1ZA 4Q6IA 4K7FB 2DW5A 4LLUA 1ZLVK 4HJUA 1BBJB 1EO8L 3TPKA 2JJTA 5HHQB 4UCFA 1TPXB 5D8JL 1UXWB 2JCWA 1UM6L 3HHMA 4JQIA 4UV7H 5C0EB 5DZOA 4OI9A 3SY0A 2A9DA 3D3VB 5SWQA 3V4PB 5MENB 3N85L 4F58H 3OSKA 1OWWA 3O41A 2HT2C 1OXYA 5AVVB 5LCVL 3WMPA 2F6AA 4PJ7F 1MH5B 1G7LB 3D0AA 1U8IB 4Y5VA 1VKXB 5EU3B 4W81A 3KPMB 4IIZA 5ICXA 4FNQA 5I1LB 4HCIA 3R8BB 1UT9A 4NQXA 1RJZB 4PG9B 5DJZB 1R5VA 2X87A 4M7KH 5EC2A 1D7FA 2VMEA 2CK0H 2CRYA 3EOAB 4X9HA 3QDJB 4BSJA 3AROA 2K4AA 2P80D 1UJTA 1E9OB 2Y7QA 1KENH 1GS7A 5LKNA 2NR6C 5EBWA 2EC9T 3N9GL 4BQBA 5IJBC 3ATDA 4CDGC 2XQBL 5ADOL 2OULB 2GUOB 4DKDC 1GYVA 5EIQA 3BP4A 3H8NA 4G9FB 4B41A 2YLHA 4LKCA 1SNRA 3UAJC 2VRAA 1K8IB 5GGTL 5IGXL 5K9OA 4LB8A 3QEGH 2R69A 2A9AA 1NUFA 4GMSH 1F1GA 2WUBH 4KQ4H 4WHYG 3VXPA 3FSVA 3UTPE 1DQTA 4P5SA 2XFXB 1G1OA 3IE4A 5HGAA 1CVRA 4JY4A 1WD8A 4ODWA 2JLPA 4AH2B 1CUOA 1QPXA 5JDJA 3SO5A 1CU4L 4O9HL 2K45A 4R8WH 4JZOA 4P23C 3DSFL 2ZUUA 4JEGB 4ERSH 1ORQB 2F58L 4BA0A 4XMKL 1L7IH 1N59B 4MAYD 5DJ0A 1EBPA 2I5YH 4PJCA 3ISYA 1MCNA 1EZVX 1A6ZB 1NINA 2IANA 4NHUA 3ZHDA 3GHBL 1A3QA 3BT0A 3W0WE 3S0PA 3JTBA 3SO3B 1NAMA 1NCHA 5T1LB 5T5NG 5FO7B 3BCDA 4YHZH 1CWVA 4CUCA 1IC1A 1FYHB 5B7MA 4JCWA 2FX8H 2IBZX 1QO3A 3H3PH 4A2MA 2VSCA 2WTRA 4QGTA 1QUNA 4OCSL 5E7BA 1LO4L 2DQTH 2VRKA 5SX5H 5CCJA 3P73A 3KW8A 3VFRA 1KBGH 1HSBB 2EIBA 1R34A 2B20A 5E5MB 4X99A 3AM8A 5FO9B 5I6NA 5JHDA 4W9LC 4FGMA 3FBKA 5GGRB 2P42B 1TQTA 2F74A 1G5AA 3HA0A 1F4YH 4PJ5E 1PVHA 3NJVA 3IU4L 1JS4A 2PCFA 1B4JL 3KVPA 4WHTB 4X6EB 3P3SA 1BEYH 1IC5L 3APNA 3TBWB 3T1WA 3IMUA 3IJEA 3C8KA 5LGYA 3WN5B 1TZ8A 1OAKH 1PJWA 5EC1A 5DVMA 2W07B 5DMIH 5I71B 4AXWB 1AR1D 3QQ3B 1YUHA 5F7FA 1LGVA 3WS3B 3GMRB 4PRNA 3D39A 1TVBA 5F7EL 3HC3H 1BWWA 2ZCLH 1AZVA 3DGDA 1KGIA 1GHFL 1LP9A 1GGBL 1JV5B 1LO0H 1T1YB 3CSYB 3OR6A 4OLEA 3GRWA 1SUJA 4AEFA 1SXAA 3IN0A 1U8NA 1G0YR 4Q8BA 3ARFA 3DJRA 5GHWL 5IY5B 4LHUA 3VG9B 5F7HA 4E9WA 3L3GA 1IEAA 5KBKA 3QI9D 5D1XD 5BS0E 2BW4A 4MMYB 4YIQA 5C0IB 4PS4L 5ECJE 1TF4A 5FA3A 4NFBA 3KLHC 4GAJH 4KRPC 3SYCA 1AYRA 3VUAA 2YMTA 4FA7B 3WFCH 2X4TA 3CFTA 4YDLC 1OPGH 3DETD 5CSBA 5IVXF 4N90D 5B1JA 3ZE0B 5BRZD 3SODB 1S6NA 4GRWF 2IAMA 5E5UB 5CGYC 2A3TA 2EE6A 2PYED 2XSKA 5IG7B 3CN1A 5DUPL 3MLXL 1BA9A 1TKWB 1HZLA 1FPTH 3GMOA 3L4YA 1MIML 1FLRL 1TLKA 2B4CH 2DEXX 3HG1D 3NSYA 4Y2DA 12E8H 5DRWB 5AW0B 3TEUA 2JVUA 3DVGB 5DVPA 3C5SA 4QRAA 3S8GB 4YLCA 2NNAA 3C5ZC 5DHYA 5FOBA 2GJZA 1URLA 3HRPA 4L8DB 1X9RA 4S0TD 4XWGH 2FHBA 1BGXL 1EHLH 2ARJB 4A2LA 4WLCA 1SM3L 1J1PH 3U6XA 4J3SA 3GK8L 3K72A 2FL5A 1DQLL 3FQTA 2X4SB 1SXNA 1QFPA 2O5XL 4H40A 3RBSA 4PJBE 5K93A 1BMZA 4MJ6B 3QRBA 2G5RA 3ZRCC 1SY6H 3MOBH 1U4EA 3IKCA 1HSAA 5CGBA 4OCYL 2PR4H 4K9EH 4PAZA 5F7BA 1ZSDB 4LP4A 1CFQB 2Q1EA 3DROB 5HP5A 2VR3A 4Q9QH 1JN6B 4LAQH 3VMPA 2AJYL 3OPZL 2X4PB 3T8VA 2B5IC 4R0LA 3BWSA 3ALXA 1AKJA 3P11H 3EUDA 4XNUL 5C0CA 1XCXA 4LIQH 3H4HA 2R83A 4MRBA 2V3FA 1Z9LA 2XN9B 1TJIH 2ICEC 2WO4A 3HNSL 5EOCL 4PYHA 4PJIE 2UX7A 4PJ6A 4BQ6A 1NBVH 3F7YA 3CIAA 5EOQL 1JGLL 1P5VB 4QHPA 1BQKA 4HJ0D 4OF3A 1FL6B 3MNWB 3QUML 1F8TH 1ZCRA 3E6FA 3HB3D 1HHHA 4XXWA 2Y2YA 3QDGE 4N4YB 1CXHA 4MXWL 3NZ8A 3QZPA 2FSDA 4N9OB 4XP5H 4FNRA 2YSSA 3GNMH 3QNXA 5F3FA 3CIQA 4L3CB 2Q2LA 4RRPA 2OCCB 4MQ7A 3RVUC 4PJAF 5E6ZA 4GI9A 4MXQC 4Z8FH 3N1MC 5I0WA 2BNRD 2X38A 5IIEA 3B43A 4QRTA 2WIMA 4M43H 3MJ9H 3MCKB 3W0WA 2NY3D 2F1AA 3LNHA 2VDQL 1E4KA 3DTDA 9CGTA 4R4NC 5C6TH 4AQ1B 4KO9A 1F58L 4PVNA 3MGTA 4AG4L 4FQJL 1MFNA 1CL7I 3KPQB 4BFJA 1RLWA 4RAHA 4I7ZC 2WGNB 1FVDA 1KPUA 2VW7A 3IFLH 3KPRE 1U93B 1BP3B 4N1EA 5JIKA 4PJXE 3TZVD 5C9KA 3W5NA 1LVEA 2GIYA 3HI5L 4YK4C 3RWEA 2WCSA 4D3CL 2KZBA 2EDBA 4PJ5A 1UKSA 4QRRD 4P9HH 3RWCA 2ED8A 5I66A 3MREA 1M7DB 1O6TA 4E42A 4HK3N 4ZOCA 4HA1A 4MQXC 2YZ1A 4F8PA 3HE7D 2QADC 1CTNA 3HAEG 4P2OC 1O6VA 2DQGH 2WLIA 3CMOL 5FM4A 4GIPD 1UHVA 3ARBB 5E7FA 4MAUL 1DJGA 1R3KB 1JTTA 5C8JA 5KW9H 2SEBB 5BRPA 5K33A 2ZOUA 4XH2A 1JVLA 2CMRH 2XBTA 4YVNA 4W9GC 2OZ4A 5D7JD 5IMLB 2WWKO 4TULL 4ANVA 4JR9L 2CPCA 4OM0L 5AFAA 4JDZB 3LEVL 4D94A 2B59B 4ODXB 4ZAKA 5AYQA 4A2GA 2DYSB 3VU1A 1YEIH 5CZVH 2P8MB 4AUUA 1L9TA