5D1XE

Isdb neat2 bound by d4-30
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
115
structure length
115
Chain Sequence
KMTDLQDTKYVVYESVENNESMMDTFVKHPIKTGMLNGKKYMVMETTNDDYWKDFMVEGQRVRTISKDAKNNTRTIIFPYVEGKTLYDAIVKVHVKTIDYDGQYHVRIVDKEAFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D4-30 Light Chain
publication title Germline-encoded neutralization of a Staphylococcus aureus virulence factor by the human antibody repertoire.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 19
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5d1xE00
3SZKC 3QZOA 2ITEA 3VTMA 4WJG3 4MYPA 4NLAA 4YMPA 2O1AA 2ITFA 2E7DA 2O6PA 5D1QE 2Q7AA 2Z6FA 3QZPA 5D1ZI 3RURA 3QZLA 4H8QA 3QUHA 3QUGA 3QZNA 3SZ6A 2H3KA 3VUAA 2MOQA 3QZMA 2K78A 4FC3E 5D1XE 3RTLA 3OVUB 4H8PA 3S48A 3SIKA
chains in the Genus database with same CATH superfamily
1TJMA 2FGZA 1KYDA 3GHBL 2CM5A 2NRDA 3FCUB 4HV8A 1J8HB 5CEXA 2PWHA 3WTYA 1ZANH 3QXDA 3JVGC 3LTVA 3A22A 3PLYA 1OGTA 2GFBB 1VDGA 2ZXDA 3O2WL 4P4KA 1RV6X 1ECZA 4P9HC 4WV1B 5HSFA 1S6NA 2CO3A 1EXGA 2R1WB 5HHVH 3LIZL 2BIIA 1QPKA 5KSBE 3B7YA 3DX8A 3ARDC 1DUZB 1U8HB 2IGLA 1KPRA 3MOBH 3D9AH 4G7QB 4JM2F 4Z7UA 2OMNA 5KVEE 3TF7C 3N41F 3E8UL 3IDGA 2D3LA 3IJEB 2FHFA 4YGVB 3LXAA 3QJHA 2AITA 5ESVA 1TO5A 1N6VA 2AXWA 4WW2C 3EBIA 1PLGL 3QK0A 2IPTL 1X9LA 5BJTA 3F62A 1IBZA 1BJMA 5L8JB 1JFQH 3KXFA 1HSAA 4O4YH 1CFQB 3ZE1B 4IRZH 1BLNA 1ZT4B 2IFFL 4W6YB 4F8QA 5DYOB 3QEQE 4YPGA 4YHPA 4K5OA 4Y7OC 1QRNB 2JLLA 3CVHB 4XO8A 1QI4A 1TMQA 3BDYL 3WXVL 1FV1B 4LHJB 3WJJC 4XGZA 2X4TB 2E7MA 1YYLL 1BGXL 2UUDK 4FS0A 4QRRE 3V4PB 3OPZL 1NPJA 3RWCA 3MRBB 3ZE0E 2UVEA 1HC1A 4NERA 3AQDA 2Z93A 3P77A 5TQ2H 5TJWK 3ROLB 1ZA3A 3BZFA 4XMKH 5KBDA 2Z8VC 3DVNB 5MENA 4QNPE 2XI9A 4GAJH 5D96C 3S4SB 4NIKB 1NUFA 4JCLA 2VR4A 1TITA 4LSPH 5GISH 1I53A 1C7TA 4BFFA 4XMTA 1XF4B 5HYQB 1OAUH 5JMOC 1FFPA 4MD0B 3FB7A 3PHAA 4Q2ZB 3CDZA 2J6EH 4U1KA 4ZMNA 3IGFA 4QRSB 3PABA 5F89A 1K9TA 2G60L 3O6LL 4OFVA 5F9AC 4MQXD 3TBCA 4Q6IB 2HJLB 3QDGD 2KLSA 3MROA 1NCTA 1RZJH 2I07A 1M3IA 1V7NL 3WSQH 1GZQA 5CFHA 4PS3A 3HAEA 3O4LD 4QXGL 2GBVA 3LD8B 4KK9D 1T5XA 3N1PC 1ED3B 4JHWL 5LB1A 1HX0A 4KY1H 5KVFE 3SYQA 3UTSB 3HNVH 4XN7A 2VDPH 2GBAA 5KYXB 2DWXA 2F7OA 3QQDA 4WNJA 4BFOA 5KN5A 3WTXA 5F0PB 2I7SA 1B90A 1HNFA 2H5UA 2XCMC 1LM8V 1DBAL 1WFOA 1WFMA 1P9MC 4G82A 4FXGC 1TIUA 3BVNA 4AQ8A 2AEWA 2AJYH 2X1QA 3LKRB 2EAEA 1KB9J 1F45A 4HWBA 5FWRA 3K8KA 1R3KB 3ZVVA 4EUPG 4ATWA 1KYAA 1LE5A 5BQ7B 5F3HB 4RQQB 4NO3B 5FIEA 1O9VA 2Z4TA 1UB6A 1BX2B 1A4KB 3P4NB 2IADA 3U0PA 3GMPA 2DB8A 4G8EA 3RX7A 3VGDA 4U4BA 2GC4C 2QFRA 2VO8A 4PJEB 4X98A 3SDCA 5IOKA 3IU4H 5ICUA 3RVXD 5HHMB 1UWGH 4U1MA 4J28A 1SDAB 3JV5A 1PD1A 3QDMA 2RB8A 4HWNA 1N6QH 2X88A 4ZZKA 1J9QA 2Y7LA 4OVVA 3SQOH 2C9PA 5LAPA 3I74A 1RZFH 3GZPA 5BVPH 2XPZA 1G84A 3UTTB 4ABUA 4AYDC 3V79C 3KCWA 5KTEH 1MCPL 4S0TD 3QCVL 5IMLA 2JJTC 4FFVD 2UYLA 2CDFB 5ISZE 1UOLA 1KPUB 4Y9CA 4K55A 5E24E 5C8JB 3RWIB 4BSWA 4GQQA 4RGOH 4U0RB 1C12B 3NK3A 3QUHA 1OSYA 3MUHL 3OG6B 4IBUA 2OSWA 4BFJA 4LBEA 4PWKA 3EDJA 1C8QA 1LK2A 1MKFA 3IMVA 4GMSH 4OCXH 5CM1A 4PPTA 4JZJB 1T1WA 4JQIL 3TYGL 1XIWD 1O6TA 1FNEB 3L3OA 3D48R 4MA1B 4GXUM 4AM0Q 5KSUB 4F2EA 5C0JA 3Q1EA 3EXLA 4HG4J 1MEXH 3U4AA 3H4HA 3Q2VA 2K8QA 3KL3A 2VJ8A 1OF2B 4QRUA 3HI5L 5L0QC 4YN3A 1GPOH 5HHMD 3DUUB 1F6AA 1G9NC 3F7PC 5AKRA 1IGMH 3STLA 1VZIA 4JFEE 4ZDHA 1V7MH 3VX1A 5EPMA 2FECI 4OZIE 5F7BA 3QUZD 3BT2H 1CG9A 1S7WB 4QXVA 1HCYA 2XT1B 5LGHH 3PWVB 5CJOL 4WO4A 3M17B 4F27A 2FGWH 4C4KO 4LCIL 2CGRL 3L48A 1Q9OB 2OSXA 3J7HA 4JFYA 5TGBB 5D7KE 1U8IB 2ZOTA 1YPZB 2VIRB 5I18L 5L2JB 3O0RH 4X9GA 2V17H 1WC7B 1JZ7A 4BBWA 4O02B 1JI2A 3FTZA 3MNZB 3T0EE 1K5NB 1KGXA 2PCPB 4KVNH 4Q6IC 5KYYB 3K71A 2AJZA 4PJDF 3WMPA 3FUKA 2DYPD 4PS4L 4WEBL 1KCRH 1CDIA 3SKMB 3WO3B 2O72A 1MLBA 1N0XL 3ABKB 3KPRA 4XXCA 4PV9B 5FO7A 3US1A 3GUFA 1N5AB 2QSQA 3HE6A 3L5WA 3LD8C 4L9LA 2GUOB 1OCZB 5G4OA 4XHQA 2WXMA 3CMGA 3Q3GB 3WTTA 1BA9A 3KPQB 4NGHL 5JW5A 1OP9A 4RNRB 1O7DE 1ZDSA 4PJAE 2ZP0T 4FNLH 4PIBA 4JK0D 3L3JA 5BZXA 4TNVF 4XP1L 3C8KB 3CSBA 4Y4HA 5F3BB 2BERA 4BZ2L 4NC0B 1QSEB 1IBGL 1ZPLA 2A6IA 4R2GB 2BRRL 3GMQB 3GTNA 1NAKH 3BRGC 2LHAA 4OVUA 3KWWB 1DE4A 5A40E 4QGYA 2VM4A 4DT2A 5D7JA 1FNGB 4QAWA 1JJUA 4JFHD 1D5RA 4L3FA 4HJJH 2F54E 2IQ9L 3FCGA 2E0PA 3VXSD 2YAEA 4J3VA 4NRXA 5E70A 1I7RB 1MWAL 3IJYB 1NUNB 4ZUUB 4N3TA 1EHLH 1XT5A 4OD3H 4LSUL 5DCCA 4IS6A 2X4NB 3R0NA 2NX5E 2LAAA 4X9BA 3A5VA 5I8CB 2G5BA 5IHZA 4XPAL 5D2LB 1O7VA 4NNPL 3N42F 3CLFH 4G7YH 5CGBA 4XCNA 3UXFA 4HS3A 4PJBA 3RRQA 2H45A 1UM4L 1F4YH 1G7QA 3QUZC 4KK5D 1J1PH 2B3IA 1HHKB 2Q20A 1XXDC 4GG8B 4LCVA 4MQ7B 4UOW1 4XHJC 1DL7L 1LO0H 4NRYB 5H37A 4LEXL 1QYGL 5JPNA 3CZSA 3UG5A 1UFUA 4PUBL 4XOBA 2QGCA 4FKKA 5ANHA 4D9RD 2Z6FA 1ZGLP 4N2MA 3BO8A 1X9RA 2KLTA 2M83A 3OHXB 1XZWA 3AS3A 3V7MA 1AIZA 1FHNA 3PJSB 4TSBH 4WFED 4W4OC 3OF6A 1IKOP 3EGDA 1TJIH 4W70A 2N0MA 4JZJC 3V0GA 2J8OA 4HGWA 2DI9A 2CH8A 5IK3A 4Z78B 4G83A 4XXDB 4MA1C 3W5MA 1RSYA 1J8HE 2JJVA 3APCA 3RIFK 5G5DB 5BW7C 5I1IH 5IJKC 1XGQA 2W0FB 1BWWA 3PFUA 4E9RA 1J88A 4PG9A 1RL1A 1BBJA 1K8DB 1VFUA 4X6DB 1SVZA 5INCA 3MMEA 4UINL 5FB8B 4M1GL 2FJSA 2FE0A 2PO6B 5F1IB 3ALXA 4KTEH 3IETB 3MJ9H 4NJAL 4JDVA 4B95C 5JYMA 1AGBB 2EZ0D 4XC1H 4OFQA 5CIPH 3QORB 1GZHA 1CVRA 4MJHA 3FQRB 1EBPA 3FQXB 2ATKA 1XF3B 1OGAB 4NJ9H 2WUCL 2X2HA 4ICXA 4L3CB 1FE8L 1QKZL 1TJHH 1G1KA 4XAKD 4BSVB 4RIRA 4WHDA 3DGDA 1XTLA 3NJVA 4YSUA 1L7TL 3REVB 4JQXA 3APNA 3ULSB 4O5LH 1HVXA 3ZE1E 5JHBA 2R29H 3BE1L 1KTLB 4A6YB 2F5AL 1EANA 1L7IL 1Z5LB 2IANA 4QHLA 4BQCA 1QRNE 1T22B 3BAYA 4LEOB 1N59B 3QI9B 2NW2B 1N68A 4MHHI 4KKCD 3V4VL 3S7GA 1HSBB 4U6TA 2D7OA 4KRMB 1TZHB 1MRDL 2W60B 3B9KD 5CSZA 3QIUA 4XPGL 3DSFL 1N4XH 4XP6L 3ZLQC 1WFIA 1VSCA 4ZTPH 1T89A 1U95B 1QLRB 3F5WA 3GM8A 2H1PH 4HEPG 3S5LG 4G6JL 5IG7A 4M29A 2WZ5A 2WTOA 2OMYB 4X7EC 4XNYH 4X9IA 1Y18A 3LKOB 5B1AB 4R97C 4CVZA 5E8EA 2R83A 1GGIH 1VGEH 4NQCB 4NQXB 3EYSH 5K59E 2IVFC 3LEYH 3VFUB 5I15H 1AKJB 4R2GC 1KYOJ 4I85A 2D7NA 3CVDA 4ESKA 4EKXA 3UYOD 3OAYK 3FULA 3VAEA 2JELL 1JV5B 3UBXB 1NAMH 4HIQA 5HI3D 3RKDD 3U9PH 2WSPA 2ODIA 3MO1A 4KVCL 4RFEB 4FQCL 3S6CA 5IV2B 4L5FL 5IGXL 2B1HH 4DO6A 1LP9B 4YVUA 5FUOH 3NEEA 3H1ZA 1QPPA 1ETA1 1UZ8B 2ZE0A 3D2UB 3KPOA 3T65B 1FN4A 3FU6A 2XIDA 3ZDZF 3QO1A 4C56D 3IF1B 1ITBB 1U6AH 4PCYA 1MREH 3B34A 3A6BH 4OIIH 2HX7A 2I27N 1EAQA 5F7DB 2BH0A 1NFDB 1IM9A 1RUKH 5CFAA 1NEZB 4FNTA 3UTSE 2CRMA 3DUSB 2EZ0C 1WWBX 1IEHA 4FA6A 5CEZD 1A5FH 1VIWA 1E40A 5DJZB 4PLNC 1ZHBA 3CGTA 5GRUH 2DF3A 5I1JL 1F42A 4WHCA 1T3FB 4MDIA 3FRPG 2YN5A 3GHEH 4ZNEA 3V6OA 3MJ7A 4YBHA 2FJUB 3HMXH 4UT7H 4W81A 1QI3A 2JCWA 5FV1L 4TTGA 2Z31A 5BO0D 3VFPB 3F58H 3G6JE 4WI7A 4JDZA 3G5XB 1VADB 1DBJH 3MREA 1AKJD 1O9ZA 1J11A 5DUPL 3WIFB 1JRHI 5KZCD 3QYNA 5BNXD 4PV1C 4QY8B 2AEQH 3I75B 1LO4L 5HHXL 4B6ZA 1QR1B 1FIEA 2MJWA 2K7PA 3MCG1 1XFPA 4PB9H 5E99L 4UQ2B 3T3MB 1WDAA 3LHPL 5CR8A 5IF0A 4UT9A 4KKCC 5I1EH 4YSAA 1FDLH 5SWZB 3QAQA 3AT0A 4PJEE 3MRIB 2YPVL 1OE3A 3L08A 4GQPH 3W39B 3PIQB 1VGKA 4POYA 2B0SH 2ALAA 4PYHA 4Z5RA 3BP7A 4BXVA 3CLEL 1GH7A 1J7VR 4N2IA 5ESAB 3QUXD 2HRLA 1WCQA 1BF2A 4FG0A 1KPVB 3L3GA 4HJ0D 5CJBA 2XXGA 5DT1H 5HGDA 2EC9U 4HULB 5J3HD 4XT1C 1WA1X 5DD6A 1ZKAA 1GMIA 3P11H 1XEUA 3D4CA 3VFTB 4I0KA 3ILPA 1OY3B 4LKXB 3UTTE 1UD8A 3JTSA 4AYEC 2DWEA 3HCVA 3LH8A 4Y8DC 2R56L 3O3DB 5GHWL 3ELAT 4QXTA 5DC9B 5HI3C 3RKDC 3RDTB 4MJIA 3A4DA 1SJEB 1U8CA 2HH0L 2IAAC 3EYUL 3VXOB 3ZT5A 3H85A 2LLLA 3ML8A 4XVUD 2ZUQC 3AG2B 2VR5A 1WWAX 3K2KA 3K6SA 1PLAA 2GTZB 2VXQA 4N5UA 1KWGA 4OI7A 3QS2A 5DXWA 1TTBA 4H40A 3CZLA 3NABH 5F6HI 3KYNA 5SWZD 2G4GA 3ESNA 2PP7A 2MCAA 2NNCA 2XWDA 2Y07H 1GMEA 3NZ8A 4TNVK 1MJJB 3O0LA 4OB5L 4NYLA 2CD0A 1DBMH 5FUCC 4PGBB 5IVZA 2H32A 4ZOCA 3AAZA 3HW7A 3IJ9A 4IRSA 3VRIA 4FKHA 3VFGL 3GRGA 3MRMB 2BIOA 5BOPA 4OF5A 5DJCB 3BQUB 4HHGA 4RMVA 5GSVB 3CXHK 4H8WH 5FW6A 4IBWA 2H0PA 4MB1A 1YPZE 2X2UA 4DP1X 3LCYA 4YDLC 4JFPB 1ZGLB 5I5JA 2ZP8A 4Y1AD 1O6SB 3DBXA 1UACH 5A2AA 4Q6KA 3AABA 3ZYZA 1A9EB 1U8NB 2VLMD 3QZBA 2QGEA 3Q2CA 2OMWB 4HKXB 3EYQC 4LAQL 4AIZB 5I8EA 1OW0A 2VR6A 4Y2OB 4XO3A 2YIHA 5MERB 2MNWA 3DPBA 4XVSH 2KH2B 5F7MC 3HG1B 1LQBC 1UWEL 1Y1DA 2J55A 3LZLA 5CJ8A 4F20A 4HJ0C 2VSDA 5F1NA 3RGBA 4EIZC 2EVJA 3OKKA 4FNUA 5E8OA 4AEHL 1F90L 2H3NB 3LRGA 3RGHA 3QZWA 1XGZA 5E6SB 3ROOA 3U4EB 4EJ1C 3L45A 1NGPH 1SVCP 1JMZA 2EXWD 1MCBA 3RY6A 3QAZB 3AS2A 5FYKL 1IC0A 4PJFF 3B6SB 5GGSA 3KBFA 2DH2A 2Z1KA 3QWRD 1B4RA 2J56A 4OZFG 2LU4A 2F53B 5ACZB 4M56A 4NCC1 4E5XB 4G6ML 4OZGB 3LAFA 1P7QB 2V3EA 3GMRB 1QLEL 2A83A 2IOIA 3VXUA 1CLVA 2EDLA 3CC5B 5LN4A 3WUWB 2LFEA 4XVUC 1A4JA 4DZBB 2XN9A 4QRBA 3GSRB 3MBED 3QFJD 3CD4A 2X09A 3U2SA 3TJEH 5D1ZA 5TDNA 4CADB 4MBOA 4ODVL 1IV8A 2CR6A 2NMSA 2X3AA 2QT6A 3BEWA 1MCKA 4KTYA 3UYRL 4KUZH 4X6FB 5KS9F 4OCWH 3BLBA 1KENH 3FUNA 2ZKXA 3AXHA 5EU6B 4TM9A 4Q9CA 1DBKL 1AXSA 2A6KA 1DSWA 4J3SA 4LCYB 4R3SB 1U2HA 1XF5B 3D07A 3FUHA 2YSSA 4ZPVA 4UM8A 2ZF8A 1I8MB 4PWJA 1Z9MA 3VA2C 1E9OB 1Q94A 2DLFH 4N28A 4XRCA 4E9VA 1VENA 5EC1B 4K3EL 4K23L 1IFRA 5D1ZI 4M5YL 2XNAA 3V5KA 3ZQ9A 1O0VA 2EUXA 4ZXBD 1VAHA 2JIXD 1D5BA 3VDAA 5C9JA 3K6OA 5IM7A 3TBVB 3UTQB 3FQNB 2Z7ZA 3RDTC 3BEVA 5C0GB 4DPRA 5I1LA 5AD0B 4X6BB 3TA4D 3S3BB 5FYLD 3KPMB 1ET7A 5KWYC 1RUQL 5T33H 3HEIB 2BFGA 2FQGA 1J48A 4FTDA 2HRGA 3IXAB 4GFTB 4DVRL 5C09E 3VI3E 1NLDL 1FL3B 3H9YA 2XZZA 2D31A 1XF2A 1JXJA 2XVGA 5LKNA 4X9HA 1JZ6A 5AB2A 3CH1A 1PW3A 1FFQA 2B16A 2DMGA 2YC1A 1WIOA 3BH9B 3ZGIA 1IBDA 3PGDB 2WVVB 5AOZA 2GJ6A 4F57H 4R7DA 1QUPA 2LQRA 3HE7A 1RUPL 5LQBL 4DERA 4X6DE 1NGXB 2DQEL 2P24B 2GITB 5BZDA 3DO7B 3K2UH 3DDFA 2OP4H 2EH7H 4YHOL 1Y0LB 2F0CA 2P5WB 5T5NG 3DRQA 4PJGA 3D0VB 3QULA 3O8XB 5DGQA 2WQUA 2EXWC 3S3SA 2DJUA 1HI6B 3DV6A 5JHDB 4NT6B 3HI6H 4BV1A 1NKOA 1EERB 1TYJA 1CE6B 3COOA 3PDGA 2Q8AL 1HXMB 1RVFH 1WEJL 4OTXH 3GI8H 2QPUA 1BVOA 1OGAE 1YEGH 2YXWA 3EO9H 3MRNA 4I77H 4JDTL 2XIBA 5EOQH 5FXCH 3U0WL 4F3FB 3OXRA 1Q9LA 4G8GA 4KNSA 4LL9A 2CJSA 4Z7NE 3RG1C 1AO7A 3AC0A 4YFDB 2WWKT 2H0EA 1SYSA 4J7RA 4P5TB 3TTSA 4BKLA 2UXFA 3GC3A 2BVTA 4YDIH 3MBEC 2Y25A 1K4DB 4IBZA 3CFKB 1UC6A 5FA3A 4G5ZL 4KZDL 2CO6A 3BUPA 3GO1H 3IGAB 5EN2A 4H8PA 4JRYA 5CN3A 1Z0MA 3OB0K 3DIVA 1LMKA 1AD9B 1ZT7B 3QA3B 5DF0A 4KGLA 4AMWA 2R1YB 4YSSA 4XVTH 2H8PA 4M5TA 4HUXB 3LIUA 2A9BA 1MCRA 5E94A 3EZ8A 1BZ8A 1IAMA 4GW5B 5HI5D 2IH3A 2P8MB 1RZPA 2AXFB 2R4SH 2JKXA 4I1RA 4R5TA 1A3RL 2X4UB 4HEME 4YXHL 4LHQB 2P5WD 5KBMA 4L3EE 3AW5A 4L4VA 4H44C 4Q14A 1OAZL 3EJZC 5IW6B 1A3QA 3I2CH 2VAAA 2MQCA 4NQCE 3FU7A 4G6KH 4K5PA 5DEFB 5LXGL 3NJKA 2VDOH 4LQ1A 4ZXBC 3X1EA 3RA7H 1G6RH 4NFCA 3WIIL 2VMJA 4DP2X 3PE9A 1MUJB 1INQA 3KPSD 2BJMH 1A22B 1DEEA 2BZCA 3I84A 4TNFA 3VMOA 2FHBA 4PV8A 5I23A 2VN7A 5GGUB 3MUGB 4M3HA 1N67A 1EJOH 2V2TB 3D3VE 2WBJD 5KVGE 4LLDB 3PXHA 1IGIL 1LP9E 4KJQD 4WY7L 4K3GA 4E9LA 3TU6A 5FM5O 5T1LA 4XCEB 4LSVH 3LV3B 4DP0X 4EI6A 1OCCB 1OAQH 3HB3B 3D18A 5DMGC 5GSRB 4RVBA 1UXSB 1KGCE 1IM3D 4OSUL 3DXAD 1NFDE 5CD5D 4M3KB 5C0RH 4ODUB 2FB4L 1BVLA 4AG4L 5IMMA 5KVEL 2OR9L 3HZ3A 1UT1A 3KBHE 2D3JA 2BNUA 3MA9H 4PRIB 5DJAB 1NBYB 4K5NA 3RFZC 2V7HA 1GY1A 4TRPH 1NCJA 4TKWA 4WF7A 3CFEB 4MZ3A 3DBSA 2XWTA 1AZVA 4ZW3A 1J0IA 4FQ2H 2WQ8A 3TCLB 3CX5K 2HUEA 3BKCH 1T21A 5T1DL 3VRJB 4MXWH 5D4IA 4IU2B 4Y2NA 2KZKA 5I1KL 1RJCA 4X50A 1A6UL 4JFZH 3VWKB 4G59C 1G7IA 4HV8B 2NY7H 1NCCL 1UJ3A 5CEXB 2Z0BA 3QXDB 1MQKL 1RZQA 5F0LB 4FTVA 3CN0A 4TL5A 1L6ZA 1OGTB 4P4KB 1L6PA 2R4RL 3BIAX 3FN0L 4OCNC 4UT6A 1GXEA 1DTUA 1TCMA 2OQJA 3G5ZA 4PJIF 1PLBA 3S97C 5LBSH 2JI1A 4X80H 5HI5C 2VWEE 1WV7T 25C8L 3I6LD 3QQ4A 4Z7UB 5DLLA 1KPRB 3RUGB 4BFRA 1BD2D 5T3ZD 1J5IA 5IESH 3IDGB 3RU8L 4HKBA 3QJHB 3QUMA 4RBPH 5ESVB 3ZYJA 4OCRH 3BMWA 4APQA 4PRID 4AMXA 5D7LD 5J89A 5BJTB 4RBPK 1AP2A 1OM3L 4GXFA 3KXFB 1ZPUA 1ZA6A 1HSAB 1SHMA 2GQHA 3ISYA 2Y5TA 2H26A 3MLYL 5FLVA 2P26A 1OE1A 5IR1A 2XWEA 1BLNB 5PAZA 2ICES 2X1OA 2G0KA 2UX6A 4Q52A 2KL6A 1H5BA 4YPGB 4YHPB 1CIUA 4P5TC 2WBJC 2QQLL 3GXFA 1L0PA 3PCYA 3UJJH 4KJQC 3VWKD 4GRMA 2D7MA 4XGZB 4ZPTA 5EOTA 1YEDA 2Z9TA 1G0YR 1KCVH 3MUZ1 4HCGA 3RWCB 5E1GA 1CUOA 1PEWA 3D09A 3ECBB 3P77B 2Z93B 3D34A 4P4KD 1JHKL 1ZA3B 1H8NA 3BZFB 4WWKA 5CEYA 3EGXA 5CD5C 5MENB 1VPOH 1WAAE 4J1UA 4I87A 1IBYA 4K8RL 4PRHD 2H1XA 4L4TE 5CU5A 3V0VA 3BGMA 2JB5L 3MZTA 4NPJA 5K9JH 3IRPX 4ICWA 1MNUH 1LJMA 2VXSL 3FH8A 1FFPB 3FB7B 1VB9A 3QVAA 5JTWA 1HKLL 3EYFA 3CDZB 5F6IB 1TXKA 2WJ5A 3Q8AA 3HN3A 1UURA 3WDHA 3PABB 5F89B 4MD5A 5AYUL 4UTBH 3ZHLA 2CPCA 5CN1A 1CL7I 2LW3A 3MROB 3H55A 3DOIA 3ILEA 1MHEA 1UM6H 4YHYC 4BA8A 1MFBH 3THMH 5DO2D 2I07B 4YSQA 2WQRA 1GZQB 3HAEB 1UD5A 3B1TA 2J21A 4WW2F 2LOEA 1T5XB 4LVOB 3OKNA 2IDFA 2WCSA 3FNKA 3IPEA 3OAZH 1UH4A 2FHCA 1L9PA 4JW3A 3HG5A 3SDXF 3HG1E 1FLTX 1JUFA 3QQDB 4W6WB 2AXJA 3H9HA 5KN5B 3FCBA 3LXBA 1CGYA 5KW9H 4IHBA 1GGCH 5KYNA 3ZDYF 2X7LA 4GQZA 1YJDH 2DMBA 2IO5A 2DPKA 5GS2D 3BVNB 35C8L 4Z0BH 1D5ZA 2AK4A 2FT7A 3LZOA 4ZAKA 1E3XA 1KCSH 1RURL 4OIAA 3V5HA 5FLUA 4KROD 4KPHH 1LE5B 3WCYA 4FA8A 1A6PA 5EEZA 2CO4A 2UV3A 1MG3C 4BH7A 2E27L 4K7PL 1DJIA 1M1XA 1ZJBA 5DK2A 2IGTA 3W57A 3K46A 4DJMA 1UB6B 3MV7E 4JO2H 2IADB 3NSFA 4N8CL 3GMPB 3U0PB 3VWKC 3DYOA 4Q0XH 4G8EB 3C75A 2HT4D 4X98B 2CJTA 4IW4C 2CHXA 1YDPA 2A9AA 3SDCB 4ZYKA 5LWYL 1H6FA 4RSVA 1COBA 4I1PA 2DLTA 4U1MB 3RWHA 1TQVA 4P4KC 4Z7IA 1JZEA 1ZTXH 3QDMB 4K2UL 3L81A 3RQ3A 5J13B 2PXYD 3CFIC 4LPWA 5B1JC 4HG4K 5F96H 2FWLB 3E3QC 3H53A 3JWOL 5IWLA 4J3BA 3KGSA 5JOPD 2WLJA 2MRYA 2GY7B 4OBSA 3WMQA 5ICXA 5EU6E 4FQXA 1IKNA 4Q9RL 4FFYA 1KWKA 3KMDA 1JZIA 5IMLB 3AT9A 1B0RA 2R39A 2UYLB 4KNTA 1NFAA 4GRWF 5B3JF 1KC5L 4BSWB 4IEFA 3ZKXB 5DHYA 3WFBL 1N18A 1FL6A 3Q13A 4GKZA 4I3SL 4CC4C 5GGSY 3W81A 1LEIA 1BEYH 2ALWA 4LBEB 3MR9A 1RUMH 5BVJA 1LK2B 4UOZA 4P5RA 2R8SL 5F9JA 4GAFB 1T1WB 1BMGA 3L3OB 3UMTA 4CC0A 5C0JB 5F71A 3GRWA 5DZVA 4LSQL 1U8JA 3V7AE 4C58B 4FQIH 2YD0A 3TCXA 4QRUB 5GRJL 3DOHA 4PJ8D 2AP2A 2NNXA 2ESVA 3C6EA 4NHCL 5E9DE 2CKBH 1F6AB 3QDJD 1EEZA 3ESVF 5AYTA 1RAMA 5B1BB 4ZDHB 5LCVH 2YEZA 4AIOA 4GAYA 5EPMB 4AVJA 1CG9B 5EBWA 4U7SA 1JYXA 1CGUA 2F74A 4KJPD 3EJUA 3A4EA 3WS6A 4WO4B 2LR4A 2NY5H 1ND0A 1EV2E 3MRKA 4U2YA 5EWIL 3ZL4L 2X28A 4KROC 4JFYB 2F8XC 5F6IC 2O1AA 5DYFA 1F00I 3FFCA 2A9ML 3IBEA 1NEUA 2HJKA 3KLLA 4YSOA 2AI0H 3QRBA 4JVUA 4N2FA 5GGVH 4AEIL 3C09B 5AZ2L 2WXJA 4I18A 2AJZB 3QJVB 4MXVF 4DUXA 3CN3A 4UWQB 3K71B 2VN6A 3A23A 5CLWA 1OAUL 1MLBB 4P9ML 3VXRD 5FO7B 2HLFC 1N70A 5B3SB 3BJLA 4S2SA 3HE6B 1KBPA 1PJ9A 3L5WB 4L9LB 1FYTD 2AMGA 3I3BA 4KZCA 1WUNT 2HTLC 4I8DA 2PXYC 5I8KL 3LNGA 4JPQA 5DZPA 5DURB 5JW5B 3IRZA 5G4MA 1G9ML 5KVFH 3B56A 4OJCA 2NY0B 3WKPA 4R4ND 4ABWA 1MPAL 3L3JB 2GC7C 2F6AA 5D5MF 1NJ9A 3IFPA 4Y4HB 1U3YA 3UIZA 2A6IB 3VGAC 1E5ZA 3BT0A 3FUDA 4AQ8C 1Z6JT 1T4KA 1CYGA 2ICCA 1DE4B 4DFIA 2WZPA 4WK2B 1UGKA 3U6RA 1DBBH 4XCCH 2IIJA 1DFBH 3B5HA 3P73A 5D7JB 1IGFH 1ZIBA 1JYVA 2W94A 3SKUD 5T1KD 2PW2A 3CXDL 4NRXB 5DHXB 4IS6B 1P7HL 2BVEA 3LIZA 2IJ0C 2G5BB 4PJ8C 4PREB 4WK4B 3SDCC 5IHZB 4WU5A 3H0TA 4UV7L 1L0YA 2P5EA 4OJFL 1OB0A 4XCNB 3SJVD 1OANA 3ABGA 3NTCL 4N1EA 4HS3B 2MTAA 4U1LA 4PJBB 3CDFA 1C7SA 5DEZA 3BFOA 1G7QB 3CV5A 4N1HB 4PVLA 1QFWH 5IZ7A 2F58L 5DURD 3WGUB 3PQYD 3WNPA 1DVQA 3HZVA 4HIJA 4KJPC 4U7KA 3W3BA 5JPNB 3IU4L 5KS9E 4NNYA 4HCRL 1YYML 2HRPH 3EZJB 3WIHH 4YJZL 3BO8B 3DRTA 1NFIA 2B14A 1YEKH 1ADQH 3HI1A 4N4YB 5HJDA 4P57A 3CDGA 2N7SA 2XACC 1CICD 4PIRF 3LPPA 3EGDB 4CMHB 5E08H 3MBXH 3NA9L 1RZFL 1TETH 2NNFA 3L4YA 1AR2A 1QG3A 3WHXA 3SDDD 4HJGA 4HF5H 4U1JA 4HGWB 5IK3B 4HXBL 3B2DC 3L3OC 5FOJA 5FO8A 4XNUL 1XGQB 3BGFB 3S5ZA 3BPNB 4PG9B 4E42A 1BBJB 5DGRA 5INCB 1B2WL 3MMEB 2E8ZA 2BSTA 2AC0A 2YLHA 1TJGH 4MWFA 4JDVB 4OGYH 4L9DA 5D71L 4P9HH 3IMBA 3Q2WA 2D03L 4R4NC 4ZFGL 3BVTA 1G1CA 2PYFA 2Y6TE 1E4JA 3MN8A 2ATKB 2G3ZA 3KR3L 1A3LL 1DLHA 4QIRA 4B5ZA 1A7PH 1JGUL 1AS6A 1GPOL 2W65A 3ZR5A 1AH1A 4WO4C 5C0BA 1LWJA 1HQ4A 3TT3H 4HJEA 4RIRB 4XWGL 3ZTEA 1WICA 4RAUA 2J43A 3AMLA 4RMWA 1RU9L 1SXNA 3FT1A 1NIEA 5DHEA 4WFGD 1KYOK 5K9QG 2IANB 3AQXA 4TULH 4QHLB 1I7TB 3G08A 3WI9A 3K1KC 3WXWH 1RHFA 3FZUD 3W1ZA 4XWOD 5F0MB 4XXCC 3QJQB 5EH1A 4JPSA 4TNEA 4OY9A 1HHGA 3DURA 3HBGA 1GC1C 4L9LC 5CSZB 3AT8A 1JN6A 3QIUB 4PCKA 3VB8A 1JGEA 1ACYH 3BKML 2WKLA 3GBMH 4GRLA 5EIIG 1CDBA 3F5WB 5ALCH 3T2OA 5IG7B 3CCHA 2YLKA 4NO5A 1D3CA 5BS0D 3PPEA 1Y18B 2L4OA 2YA1A 4ETYA 4CVZB 4K3JL 5E8EB 2A2QT 1I9IH 2NY0C 3MRDA 2GYSA 1PNDA 1XH3A 3S8FB 4Y4HC 4NQDD 3PNWA 3NPZB 4W9IC 2ZYHA 4XR8C 4AQ1A 2DEXX 1CYWA 1CICC 2WLIA 1WIUA 5B7FA 4LFHD 4KK6D 3ARUA 3MRGA 3BW9A 2NXYB 3SDDC 2QGBA 4DN4L 4OM1L 2QEJA 3RTQD 2L7JA 5JNYA 3KPOB 1FN4B 3RHWF 2IAND 3MXVL 3MXWH 3QO1B 2BHZA 2X3BA 2P8LA 2D3VA 4ZQKA 3E2HB 2VDKH 3SPGA 1IM9B 1ET5A 1JWSA 3QUKA 3UX9B 2AQQA 4F7CA 1W8OA 1EFXA 5FYJL 2PMZA 1YEEH 4GRWH 4JMXA 4HJJL 1ZHBB 2BDNL 3QRLA 1U8MA 2ICEA 2EDNA 1DUYA 4MDIB 4EN2A 4ZO8A 3MJ7B 3UROR 4AWJC 5I82A 5JPNC 3GEFA 5D4JA 4FZEH 5LDSA 2Z31B 1W9XA 1TNNA 3HBZA 1T5WA 2Z91A 4YSCA 3GI9L 3W5NA 1UUSA 4JDZB 3OZ9H 3MREB 1BFTA 1EAOA 1LL1A 2UWEF 4BCYA 1BMZA 2BWQA 4LLWA 2JNZA 1X4ZA 4ES8A 1MVFA 5B1KA 4MMYA 2IV9A 5ES4B 2Q8BL 4PBXA 5CCGE 3CSTA 2DQDL 3FZUC 4S1RH 2NXYD 3VSVA 4NZTL 3QB7C 3EXJA 5IF0B 4L8CA 1NGQH 4PRPA 2FJFA 3L1OH 2EQDA 4AKQA 2ZAGA 1VGKB 1E28A 4Z5RB 3NEOA 4APXA 4L0YA 2VJXA 1JPGA 1R3LA 5DS2A 3WY1A 1KGWA 5DLML 3Q8EA 3SGJC 3L3GB 5FEBA 1CDGA 3GTVA 4KRPB 5HGDB 5K1NA 5DZAA 1F13A 1A2YA 4AGMA 1KCBA 5E8DH 4K73A 4P5SA 1KLUA 5DD6B 5K33A 5C70A 1E4WL 4X8CA 5HGAA 3D08A 2Y36L 4XO5A 1GZHC 2BWDA 2GUYA 2R0LH 3ILPB 4I88A 3BDBA 5CKAA 5I1IL 4JO4H 3U7AA 3FQ4A 1OAKL 3JTSB 1RZKC 2DWEB 3IMUA 3HCVB 1J9TA 1H8LA 1TCRA 3O45A 4QXTB 3GXMA 3OC5A 4FQJH 3UZEA 3QXTA 5FWQA 5K93A 2NLJA 4MJIB 4ALAC 1HEJC 1MRCL 1U8CB 2ITDA 3Q5YA 5HDWA 4HSAC 3RTQC 4Q89A 2DZEA 3EJPA 3GLDA 4QPEA 3K6SB 3QISA 4B0MM 1KDJA 3GMOA 4IDJL 5JHAA 3LJ3A 5D2NE 2HG5A 1JNNH 4KTDH 4X7CC 2NYZA 2W9LA 3UG4A 3WFEL 1AR1D 3T0AA 3IM1A 3CZUB 1JP5A 1UQSA 1YO4A 3KYNB 3CVHH 5DD1H 2MHAA 3O11A 4U49A 3T2PA 3N1MC 3NZ8B 3GSVA 4NYLB 4RFOL 5C0AA 2YPLD 3V4PH 5IVZB 2H32B 5I6XC 1EVTC 3AAZB 1G9NH 1HCZA 3BPCA 5C3TA 3VRIB 2X6UA 3D52A 4GXUN 5H94A 4XO9A 2CHDA 2ISDA 4C57C 3OMNB 3CN2A 2CDEA 4QOKD 2TSBA 2X0WA 2D73A 4YQXH 3TFKC 2WKGA 4PM1A 2XY2A 3NZSA 4GI6A 4JY6A 2AW2A 1Q72H 2CNYA 4JG0L 3WY3A 2C7UA 1SPDA 3RIAK 5GS0L 5IMKB 5KSAA 3DBXB 5I26A 3HNTH 1KV3A 2NXYC 4OFPA 3IDNA 2QV4A 3HA0A 5DA4A 3IFOA 1CI5A 7PAZA 1GHFH 2K4WA 2XQYK 3KPRE 3NQIA 4KXDA 5I8EB 2IG2L 3P02A 3DPBB 2XBZA 3TIEA 4H26A 2JCCF 3GJFB 4F8PA 4Z3FA 1V3MA 4DOHE 2VXVH 4U33A 2QSCL 3E2HC 3QCUH 5F1NB 5D93C 3LZFH 1UUNA 3OKKB 4XCFL 5E8OB 2GABA 4NN5B 1X5AA 3QZWB 3ROOB 5CJXA 4Z18A 4AZ8A 3L1FA 6TAAA 2PPCA 3JVFC 2ZOWA 1XBDA 1ODAA 4ZO7A 3A6BL 3V6OC 3C2SA 1H8SA 1NCDH 5GGSB 1AG0A 1XR9A 4UCFA 1T03H 1CU4H 4DQOL 4YO0A 2Z31C 3D4YA 1A21A 1DQMH 3FYIB 4KQ3L 1UCTA 3FFDA 2Y3NA 2A83B 4QRPD 1A5FL 1DJXA 2J8UA 3VXUB 1NIBA 1A4JB 5ICYA 4X42A 4D0BA 2V6HA 4XO4A 2D0HA 3ESUF 1EAJA 2J6WA 3U2SB 2OTUA 4MXQD 5D1ZB 4NQUA 5TDNB 1TVDA 4JPIA 2IBZY 1AR1C 1CFMA 2WO3B 3ZE2B 1REIA 3BEWB 4LP4A 3F58L 4GAGH 1ID5I 4OLWL 5E6UB 4J23A 4FXKA 1R0AL 3RAJH 3OLIA 5M95B 1N5YL 4JFDA 4PJBE 4PCSA 5JIDA 2F18A 1AXSB 2A6KB 2P43B 1J05A 1XO8A 1J9SA 3VXMA 5DQ9A 1CFVL 2PWFA 2VN4A 4JO3L 8PAZA 2VM9A 2YSSB 4ZPVB 4UM8B 3D4GA 2H41A 2ZYIA 1Q94B 5GJSL 2OZ4H 4XRCB 1AHKA 1D5XB 2B0SL 1E6OH 1HK6A 3LH2H 1TQUA 3V5KB 2XNAB 3E6HA 4YE4H 3EOAA 1D5BB 1P5VA 5IM7B 5DT1L 5C9JB 3B7SA 3P0YH 3U83A 3QW9A 2O5YH 3BEVB 3LNDA 4D9QE 1JHTA 2K78A 4OLXL 4AW4A 3ZDWA 5I1LB 4WKZA 1KY7A 3FSVA 4M6NL 2KQNA 1XF2B 1MF2H 2P7TA 5TE4L 2D31B 1NCGA 1INDH 4Z7QE 3BHBA 3CH1B 2YC1B 4QKXB 4CUCA 1CDHA 2LU5A 2RH0A 3QQ9C 4U3XA 3PREA 4I3RH 2GJ6B 4NO0A 2RFXA 3DECA 4R7DB 3HE7B 3NCBB 4LB8A 2BCMA 2OULB 1UYWL 2VTFA 5DI8A 4OZ4A 1L9TA 3QJRB 3OMIB 3RJQB 5BZDB 1N64L 3QRGH 4NB7A 3DSNA 1GSKA 3DRQB 5BO1H 4IYKA 2ZCLL 1A65A 3LB6C 3LZNA 3QULB 4PJGB 1BAFL 4KQ0A 4JLRA 3CZKA 3ULUD 3REWA 7FABH 3DV6B 2DDQL 4LHUD 1I3UA 1SN5A 4UMSA 3FSWA 1RP8A 4MBRA 4XC3L 3HMWH 1FRGL 2QADD 3GXUB 1OTUC 3T3MF 1JBJA 7PCYA 3S37X 3KVDD 4JFWA 3CSYA 1FFNA 4KU1A 1CF8L 3T4YB 4JFVA 3QR2A 4DF9A 3MRNB 4L0PB 3RNKA 3OXRB 1Q9LB 3OAUL 1NCBH 4G8GB 4PQXA 5FHAL 1AO7B 5DVMA 2HFGL 3C87A 3RHWK 2OXHA 1IFHH 1SYSB 4JFFA 4X9FA 4B3EA 4OQ1A 3S34L 5CGTA 4BKLB 2X4OA 4G11A 5KVGL 2QMJA 4KBPA 3NN8A 5IHBA 3KYOA 4EOWH 4POZD 5FA3B 1X5MA 5EN2B 3KEHA 1YYCA 4JRYB 1KB3A 4O02H 4WW1A 1KBVA 1RJYA 4N2HA 5IVXF 5JQIB 4NUGH 3UPCA 4H8WL 3VGGA 3HC3L 4AT6A 3D85D 3GRBA 1X5YA 3GSWA 4MMXA 5E94B 1ZLSL 3KLHC 4R96A 1BXVA 4OF6A 4OCSL 4TQHA 2IH3B 2EILB 2BVPA 5I17A 2EIZA 4PS7A 5F7EH 1HWGB 2GSGA 1GGBH 4S0SD 3MCLL 4BJLA 3LZRA 1JZGA 1K5WA 4L4VB 4HOMA 1JGVL 3RY6C 2EINB 1XB8A 2Q7YA 3QQ3A 4Z3GA 1BBDH 4HBCL 2VAAB 3UDWA 4HAFA 4HALA 4JL2A 5T3XL 2WLZA 3FU7B 1KELL 1CLZL 1FAIL 3EO1A 1T83C 4X0KA 3ZYIA 4KI5D 1C8PA 3MACH 1INQB 1MIEL 1TLKA 3BVXA 1DEEB 4LIQE 2VDQL 4D0CA 4G8GD 4PV8B 1WS7A 2YJLA 4NX0A 1OP5H 1M3JA 5FC9A 5KJRL 4HMCA 2YPVA 3MV8E 4JX0A 5EZOH 3U2IA 3P3RA 1OZUA 2AK1L 5D1ZC 3TH4T 5T1LB 5J6GA 2BW5A 3X17A 4EI6B 3MOAH 2W9DL 5AZEH 4FFZH 2R2CA 2AQPA 2LU7A 3D18B 2DIAA 4HMEA 1S7SA 3ISWA 1MHHA 2ZICA 3ARFA 4AGPA 5IREA 3N9GH 5IMMB 4KK8D 1BVLB 1ILUA 1A64A 1YQVH 2FJHA 4NN6B 3VQ1C 3ULUC 4BA0A 3NPSC 2Y2YA 2BNUB 3BSHA 1YN7A 4FG4A 2V7HB 5E7FA 2QADC 3ME0A 2P49B 4LPVA 3GLEA 4N90E 1DFXA 2IDCA 2NSQA 3ILQD 4U1NA 3ZHNA 5CD3A 3QT2A 1TZGH 2XWTB 2CALA 3ZZ1A 5KBKA 1LE9A 1RSFA 1H9DA 4PG2C 4KUZL 3C6LA 4AGQA 2F2HA 2LTQB 1T21B 2EH8H 4I7ZC 3TLRA 1D5IH 3D69A 3DYPA 2CK0L 3VNYA 1OCOB 2O5ZL 3SPCA 5ADOH 2WMPA 3FTGA 4POZC 1G7IB 4UI2A 1UJ3B 1PL3A 1JZ2A 2NQDA 1S3KL 4H88L 5DO8A 3PAVA 4QYOA 1M6UA 1UXLA 1BVNT 2VC2B 4ODHH 4FTVB 4UQCA 1YMMD 1KLGB 3FO2A 2X89D 1KBGH 4GI9A 1FZKA 4X6CA 3FT9A 1M6OA 3EUDA 4L37A 1V55B 2OQJB 3G5ZB 1TDQA 3QPXL 4N3UA 4YHIA 4OZGF 1BQKA 1QSZA 2P45B 3F8UB 2WGXA 4N2EA 4UB0L 4QHPA 3QQ4B 3VJ6A 4RGND 32C2A 4IIQA 5HHNA 5L88L 3D05A 4ZOEA 5A3ID 1IGYA 4HKBB 5J6SA 3BX7C 5LGYA 3QUMB 1X9QA 4U3SA 3HRZA 4LU5H 2XN0A 4P23A 4APQB 3RWEB 4FQHA 2OAAA 5IW1A 2WWMD 4Q9QH 1AP2B 2VZVA 4I0PD 3R18A 1ZA6B 1YAIA 2VRAA 2Y5TB 2H26B 3EO0A 1X5KA 1PG7H 2WVTA 5ABZA 4P06A 3UTPE 4GKOA 5IR1B 2OP4L 1JERA 1H5BB 4Y8AA 5K39A 5T5FL 1U8LA 1ZHNA 3BD3A 2JKNA 5HYJA 4GRMB 1JDCA 4ZPTB 5EOTB 4M6MH 1P6FA 3GS0A 3MGOA 4OTXL 1YEDB 4ACTA 3MDJA 3CFBA 1YRKA 3D6GA 2Y22A 3MLVL 2BP8A 4A6YH 4S1SH 3U4KA 1B6DA 3BPOB 4FTVD 4NLAA 1FWXA 1RERA 3BAWA 5DUJA 4WWKB 5IB4A 2UXTA 1D7FA 2VLJA 2OMVA 3EGXB 5CEYB 1NGZA 4J1UB 4KK8C 3FQ1A 3GKWL 4FQPA 3V0VB 4Z3IA 2WKOA 2O6CA 3BGMB 4KDTA 4UM9D 1NKGA 4Y16D 2HT3C 5IBTL 1MOEA 5TE6H 1A3ZA 3CFNA 4LPTA 5FCUL 4FLSA 2EE2A 3PL6A 3ILQC 3PFQA 4XNXH 1BQUA 2WN3A 1XEDA 4IOSD 4NWUH 3EYFB 3LS5H 4MA7L 2WWNA 1KF9B 2BNRA 4XVTL 4MD5B 4KKQA 2WINA 1T7YA 4UNIA 1KCLA 2H6OA 5I19H 4N2NA 4U1SA 3X3FH 4OLYH 5HVHB 3G5YA 3GM0A 4G8IA 4G7VL 1MHEB 4NRZA 4Z7VA 5E6ZA 1H3PL 4P49A 2NNAB 5AQ0A 2JQMA 3HG3A 3WG7B 4Q6YA 5EU4A 5B7MA 4DK6A 2FLMA 3HBQA 3OKNB 3P2BA 3WKQA 3B37A 1G9EA 3JV4A 5AWNH 4HMDA 1CURA 1NCWL 1FL5A 3MTRA 5IQMA 4KOBA 1JUFB 2ED8A 1Q0YL 3H9HB 1LNUA 2E7LA 5DS8A 4P04A 1OSZA 1BQLL 3O6KH 2X7LB 4K3DH 4NN6C 4WCYL 4OUUA 4LDCA 4ZSOE 5D1QA 2DQGH 3VX0A 2KZ1B 2WWMC 2SODB 4I0PC 3R19A 1D5ZB 2AK4B 1OAQL 4ZAKB 5MP6H 1IGCH 1NMCC 1OSPH 5F9OH 3TONA 3V5HB 4OFKA 2MPAH 2LTQC 4BH7B 2A9NH 4CDGC 1M1XB 2ITEA 5DK2B 1B4JL 4ABQA 3SPVA 5B39G 3DK2A 4QR7A 2ROYA 4HJTA 3PWPD 1LHZA 2XN9E 5DR5L 3K2MC 1YDPB 4ZYKB 1RZGA 4NKDA 2OW6A 4Q56A 3EBGA 1JSYA 5JDSA 3SY0A 2B4CC 3F7YA 2F8VA 2NZ1A 3RWHB 2ZT9C 3ZE2E 4MXWL 2FT6A 2Q5BA 4A67A 2Z8SA 2CQVA 2F8OA 4IJ3C 2NY1D 2VSCA 1SLVA 2FX7L 2I26N 2P28B 2EJ1A 4JFZL 1BDYA 3N91A 1KJ2L 4Y16C 2XTJD 5ICXB 4KAQH 3GQFA 4FQXB 1RKRA 5DZJA 5E51A 2BOLA 3OSVA 4AY0A 1G0XA 2GB2A 3FCTA 5BCAA 1B0RB 3EJYD 3BSZA 2ETWA 1B3IA 3EJTA 3O2VH 2VR9A 3PWNA 2CGYA 4R8WL 4XP9L 1QSFD 2DQHL 4IEFB 5I9QC 3AGVA 5DHYB 1HESA 1FL6B 1MFCL 4GKZB 4YSDA 5LBSL 2C34A 5JXAL 3UAAA 1LEIB 2J57A 4PJ7E 3MR9B 1XGUA 3BJ91 5BVJB 3ZKQD 5F9JB 4M61A 5IESL 5IVNA 4B97A 4GBXA 1H5BC 3VSQA 5CZVL 3MUJA 1HFUA 3NSDA 1U8JB 2BVOA 4M4RA 4HLZH 4EO5A 2ESVB 1BMWA 5DMKA 3BPOC 2GJ6E 2WANA 1EEZB 4UAOB 2JFCA 4OZFA 2IDTA 1LDPH 2YEZB 1FORH 4GAYB 2C1OA 3U25A 4CU7A 3BZ4A 4XAKE 1AGEA 1F4XH 3S35H 3A47A 3UJJL 5EBWB 4PJGE 5J5EA 3M07A 3S3PA 2F74B 3GPSA 1NBVH 4FX5A 4LPYA 4ACPA 1ZAGA 1PVHA 1ND0B 3MRKB 2ZPKH 1GOGA 4KMQA 5F9DC 2XKUA 2EIMB 2YXMA 2MKLC 2D7PA 1UA3A 3FFCB 3VFVA 4M7KH 2HJKB 1C5CL 4XPBH 4XMPH 4XMLL 4K9EC 1OAXL 1MCEA 1AO7E 1GS6X 3RUGF 3N55A 1M56B 3NJMA 4Z7UF 5HVHC 4I18B 1YLBB 1TVHA 1S5IH 2NY6B 4UNTA 1AI1H 4HC1L 1DDTA 1IGJA 1T1ZA 4HK3J 2FQFA 3DHJA 4LNVA 4AK1A 4S2SB 1IAIL 3JXAA 4JY5H 4JKPH 4JRYE 4NQEA 5EZIL 3SIKA 4RRPG 5ADPH 3NIDE 2KDGA 2NY1C 3TEUA 1FIGL 2XG4A 3WFCH 1TZ8A 5DRZB 1BFVH 1PNCA 3B1UA 4WI9A 3THML 1DSFL 1A7BA 4LCCA 1C08A 1DHKA 3W9DA 1NJ9B 3IFPB 5KSVA 3DMMA 5C6WH 4G80A 5AVUB 2BSED 3V8CA 4D9LL 3PWLA 4AJVA 2AS5M 5HGGS 1KBBA 2W9EH 3QEQA 4Z95L 4FEIA 5AOKA 2VZUA 4ZAKC 1T4KB 4GO8A 1MCIA 4C56E 2Y06L 4FABL 3U6RB 2WQVA 1QSVA 3P73B 1MXGA 5KW9L 1GGCL 3FFCD 1XQ4A 5FW8A 1I1AD 4AM0A 2BHFA 2PW2B 2W0PA 4KJYA 1KSRA 2VUKA 3MRQA 4RLDA 2WCGA 5CEZE 4Z0BL 5FYLH 1IJNA 1L9NA 4NP4H 1OCWL 3HS9A 4WU5B 5AL8A 2V37A 3H0TB 5IJVA 2P5EB 3WIAA 1WVZA 3S37L 3VB9A 1JHLL 2QHRL 3ZGHA 1RMFL 4A38A 1OTSD 3H2QA 4FYSA 5L7XL 2EC8A 2WZ6A 3E9TA 5DTFB 1BQHG 1URIA 4AEFA 3OLDA 4OLUH 3TEYA 1KEGL 3DC0A 3HZVB 4HIJB 1IKNC 4HUVA 5C08D 4NNYB 4P8QA 2Q7NA 3HS0A 5JO5A 2ID5A 3GIVA 2KZBA 4J12A 4XP5H 5E1IA 4ZFQA 3DRTB 3MGTA 1NFIB 4E9WA 3HI1B 5EUOF 4PP2A 2HCZX 4P57B 3CDGB 1YG9A 5F96L 4XBPA 3DJTA 2Z1PA 3I6GA 3T2NL 1IMHC 3S96A 3FUMA 3NJXA 2FBJH 3O2DA 3LMJH 1G43A 3WHXB 4QLWA 2IPUK 2R69H 4HJGB 4U1JB 3MYZA 1OD9A 5I1DA 2F9BT 3RNQA 3SODB 5FO8B 5TPWH 5F7AA 1QW9A 2BO0A 4Y19D 2EDTA 4FXLA 3IJ7A 4E42B 2WAQA 5GZOA 1YNTA 2K9UA 3EFFA 4AMKL 4FADA 2BSTB 4YSRA 3UL4A 4MWFB 2NZ9C 4GG6F 4M3JA 3ARED 4DO4A 3VO0A 1NIAA 1KTBA 2ADFL 4ZMAT 5EB9A 2KHAA 4HS6A 1R47A 2OMTA 3ABMB 3MLZL 2PYFB 5BV7B 5L8LB 3H54A 3SDYH 1DLHB 2XBTA 3SKNA 2W65B 4QRTA 1NMAH 5C0BB 3HLKA 1HQ4B 4FZ8H 4PW4A 3ZTDC 1AZBA 3BESR 3FS9A 4Z7WA 3DK0A 4RAUB 3DWTA 1XWVA 3D06A 1UEYA 5HVGB 3C08H 5BPPA 3RURA 3VE0A 3K5RA 2NY3B 3G08B 2WOYA 4M6OH 5L6YH 4J6IA 2D7QA 3HNSH 1GJWA 1I8IA 3PHQA 3QWQB 4NKIH 4WGVB 2NY6C 5BRZD 3U7WH 3BD4A 1A0QH 3K2IA 1ES0A 3FHAA 3QHZH 1HHGB 3DURB 2MQ3A 3GIZL 4XXWA 1JN6B 3VGEA 1JGEB 1B0IA 1OTSC 4GRLB 4P2OA 3C5ZD 5MEPA 1UM5H 3ZDXE 3CCHB 4NM4H 1EO8H 2K6WA 1L3WA 4NO5B 4RWHA 2YZ8A 4NUPA 5JHLL 1LO2L 4TYUA 1JXFA 3MRDB 2H7WA 3NIFF 4XNDA 4OV6F 2B9BA 3PNWB 1KOAA 5HD8D 3QFDA 1ITCA 2VLME 4Z23A 4AQ1B 1J87A 2WLIB 4QTIL 3TGXA 4U6YA 2RIKA 1BFSA 1TEYA 4QDGA 3MRGB 1OAYL 2X12A 3KHQA 3TWCH 1HHIA 3FQYA 1IQWH 4ZX6A 3MYJA 3OM3B 1S9YA 1CS6A 1HILA 3M88A 1V3KA 4ZMWA 5JNYB 1CTOA 3FTUA 2DBLH 4PW3A 4KQ4L 2GKIA 2P8LB 4OZHA 4OZIA 4X5QA 4XAWH 4ZQKB 4L1DA 2YOCA 4J3UA 4OFYD 4HXAH 4OQTL 3BKYH 3QUKB 1JWSB 3NSCA 4HJ1A 4F7CB 1X5FA 3AREC 4M93B 1EFXB 3S8WA 4L18A 2RAMA 4Y4KD 3F7KA 4B50A 1J0HA 1WFTA 1U8MB 1A14H 2ICEB 4HCIA 4PWEA 1DUYB 1IT9H 5AW0B 1NOLA 1H15A 2AGJH 3G6DH 3MRFA 3IFNH 3RB5A 1NGWA 2J4WL 3T0EA 1D9KD 2MSPA 4G3YH 3QFJE 5FHBH 1T5WB 2Z91B 1KCUH 3GLZA 1E8XA 2V33A 4CSZA 1FNFA 3GS4A 4ENZA 4X7SL 4LLWB 2ZXBA 3QR1A 3LHAA 3S9DB 1BQRA 2HKFH 2B20A 1N26A 5D8JL 1X5HA 3BZEA 4L8CB 2OW7A 4OF3A 4HK0A 4IRZA 4NBXB 4NOBA 4TS6A 4PRPB 1F1DA 2FJFB 4GP8B 4PJAA 1ZV9A 4I4WB 4S10A 1YEKL 1E28B 1CFTA 4APXB 2XPGA 1DQDL 4RGMC 1JPGB 2N56A 1R3LB 2BZ7A 5CN2A 1A2YB 1AIFA 1KLUB 4WJ5A 4HDIA 5DD0H 5HGAB 1HH6A 4HK3N 2LABA 3K0YA 4EN3A 3BVDB 1NUDA 4N0RA 5AKTA 3P0VH 1YA5A 2ZG2A 5HD8C 2YQBA 1P4IH 3ARBD 3CVIH 4HIEA 2VZ3A 4NFBA 1TCRB 1CVSC 3O45B 3UTOA 1ZY9A 2J73A 2UZIL 1I4FA 1BQ5A 3S3DB 4ELMF 3EG9A 4BWWA 3D4ZA 1MCFA 2NLJB 1RP9A 2VXUH 4TQEH 2ITDB 4KNUA 5JXEA 1Y6MR 1ZMYA 3VFRA 1JD7A 2J6EA 5E5LA 5IOPA 3IPBA 1R3IH 4GH7B 1R17A 1YEJL 4ZJ9A 1E5CA 3SE4A 3GMOB 5FGSA 3HR5A 1DQQA 2C3VA 9PCYA 2HG5B 4YDNA 1JCKA 1URZA 4P2RD 2DD8H 1UQSB 3TT3L 3MLXH 1CR9L 1XGYL 2CLVA 4PRPD 3MSPA 2MHAB 3O11B 4N85A 4FXTA 4B53A 1CWVA 2ESVE 1W91A 3NRPA 4YK4B 4WTZG 3X11A 2FR4A 2NT1A 3GSVB 4WGKA 4Y4KC 4GRLC 4R7LA 5C0AB 4GFXA 4LASH 2EO1A 4PJ5E 4C47A 5SX5K 3BPCB 4DEWA 3JV0A 3VD2A 4N2LA 5H94B 3SKJH 2B8OT 4NAQA 3PV7A 5D1XA 1BREA 4DK5A 4XBGB 5C3LD 1U93A 2CDEB 2DICA 1QTYT 4N2BA 8CGTA 3QPQD 1MXDA 4YLBA 5I6OA 1I1CA 4AJWA 4AQ1C 2RBLA 3P4MA 4JY6B 3DKHA 4JO5A 5C9KA 3UAFA 3KYKL 1P5UA 2C7UB 3ATAA 1GKOA 1GR7A 2R0WH 4TVSa 5KSAB 2K0RA 3UIYA 2EEBA 3IDNB 1NCHA 7TAAA 4OT1L 1TYEB 3IFOB 1CTMA 6PAZA 3MRPA 3CLWA 3MZGB 4U6VH 4G42A 2VQUA 5GRVK 3TIEB 4H26B 2VMFA 1KJVA 2ZXCA 2FX9H 1UD3A 1PPIA 2DMHA 3HAEH 1JOIA 3IJSA 2XICA 1MRFL 4G8AC 4ZX3A 3H2PA 3GDBA 2ENQA 5J9PA 4XN1A 2XV3A 4WWID 3RI5F 1IEAB 5C0AD 4AZ8B 4HAGA 5CZRA 4ZUTA 4M43H 4UUJA 3LQZA 3TYFA 2O30A 2J1ZA 3AWGA 4K5MA 3ARBC 4X5PA 1PG7X 3L4WA 1X4XA 2OL3L 3E9UA 1XR9B 3M6DA 4JHZA 4UOJA 5GJTL 4YO0B 2WXOA 4YHZL 4Z7OE 1JWMA 4LARL 4RDQF 5IT2L 3FFDB 5C2BL 3WO4C 1QEXA 3LKPA 1G7LA 2J8UB 4Y88A 2HKHH 4KJWD 3W37A 2XYBA 4IOFD 4OLVH 2PCFA 5EORH 4BDVA 5ICYB 4NAJA 3S88L 4D0BB 5IROD 3JWNC 4G70B 2IAMB 1TJXA 1AHWA 2IEPA 2OTUB 2CA4A 3P1VA 3DXAE 5JW4R 1PKOA 4JPIB 4H20L 1W6WA 5L2KD 3R1GL 2Y3AA 3C60D 3I9AA 2ZUXA 3OZ9L 1MZZA 4XMZA 3APMA 2ENYA 2F1AA 2QZ5A 4FXKB 1M2VA 2P5EE 1XV8A 2WB1A 2XG5A 4AEEA 1F4WH 3OLEA 4JFDB 2F08A 4PW9A 2YFNA 4A7SA 1VRSA 3V0DA 1J05B 3ZHFA 5DVNA 3VXMB 5DQ9B 3CDYA 3U30B 1HT6A 2GJJA 2QQNH 2F19L 3L13A 1OHZA 3WTSA 3QXAA 3ALWA 3AVEA 4XX1E 4XBEH 5E6ID 5ICZA 3TV3H 3NRQA 3TM6A 3QPQC 4OJEH 5GZNA 2VMDA 2QKSA 4FCHA 3E6HB 5DD3H 1Q1JH 3EOAB 1P5VB 4V2BA 2XA8L 4ZMLA 3PXJA 3UZEC 4X99A 2UVFA 1WFJA 2CPUA 1JHTB 5E5RB 3CMOL 4WKZB 1IC7H 3WKMH 1EJFA 1NLBH 2XVKA 1TVBA 2P7TB 3KGUA 3VVWA 2IAMD 3BHBB 3UAJA 5T3ZE 3GTTA 2X2YA 1YZZA 4NO0B 5I6LA 2RFXB 4UYQA 4BKSC 3QHFL 4R7NA 4ZI8A 5DI8B 4OZ4B 5J06A 2DQTL 4LT7A 5FFGA 3DSNB 3KWXA 3QZLA 3FQ2A 4YHNA 2WAHA 1I8LA 3G6JA 4JLRB 3REWB 5HVWA 4W9FC 1BYOA 1DQLL 1WP6A 3Q7JA 2VH5L 2COVD 3O9WA 1YEHL 4TSCH 3CSYB 1FFNB 2KZWA 2J20A 3LEVH 2A99A 5GGTL 2DQMA 1CLOL 3RNKB 5C0BE 4W9CC 4D7PA 4DPCX 1F3DJ 4KJWC 2YMOA 2VDLL 2DIEA 4IOFC 2OXHB 4JFFB 2FRGP 2EEDA 4MLSA 2X4OB 5I28A 3AQYA 4IDLA 3NN8B 2KDYA 3KYOB 3GBNL 1A7OH 3ZY7A 5I5RA 4IRJA 5KSAC 4MDJA 2W88A 3QUYA 3SE8H 1P4BH 3S98A 4RRPM 1F58L 4WW1B 4XVJH 1JRHL 1RJYB 4DPBX 1ETJA 3C60C 5KBLA 2GT9A 4H25A 4FNPA 1GYVA 4TUKH 2VR3A 4AT6B 3GSWB 2FLRT 4MMXB 1T66C 4QHUA 1QVOA 4R96B 2OJEA 4A2HA 5EDXA 2BVPB 5I17B 1GC1H 2EIZB 4JM2A 4XH2A 2GSGB 1CIDA 1XSJA 1C1EH 2YUZA 2C9AA 3WJLA 1PDKA 5CJXC 4GKSA 2UZPA 5E6IC 1NSNH 2Q7YB 2VKWA 3QQ3B 2D3NA 4ZNCD 1AZUA 1Z3RA 5F7NC 2ZSVA 2NDFA 4QT5A 3EO1B 4X0KB 3DI2B 2ZKHH 4TSAH 1PY0A 4J3WA 4RMRA 5HDLA 3LZPA 3NG5A 4D0CB 1U3HA 3H9SA 5JZ7D 3MGAA 4OI8A 1U3NA 3QCTL 2BY3A 4TVPH 4OAWA 1SEQH 2IAMC 4KKNA 1HXKA 2WVSA 1OTTD 3SDAD 3MNVA 2YO3A 3JUYA 1OLLA 3QNZA 5FS5A 1INEL 1NBZA 4W1TA 4NM8H 4R4FL 4F7KA 1S7SB 1MHHB 1LEKA 3ARFB 4JPWH 4U0QB 3OLGA 3PGFH 4LSSH 4A39A 1UT2A 1DZ0A 3DTDA 4DUVA 1DVTA 1A6WL 2FJHB 3VD3A 4XMVA 5C3IA 4NHUA 1YN7B 2OZNA 4EAEA 4NO2A 3ME0B 3U30C 4U1NB 3MJ9A 1TTUA 5IHUH 2ZCKL 5CD3B 1G0DA 5K69A 3DTXA 5LDUA 3BC9A 1LE9B 3X1GA 2A3TA 1MJ7L 5HI4D 3EKCA 3WYRA 3C6LB 3CVBA 2EABA 2W59A 1LO3H 3D69B 5AOIA 4K7PY 4N86A 3E0GA 5E2WH 2WMPB 1E0OB 1T0PB 2DQJH 2FWOA 3FTGB 4ONGH 3VI4F 4PHXA 1BFOA 3V10A 1MHCA 3D87B 1RPQA 1MFDH 4QYOB 1AD0A 1CD1A 2GEQA 3GHPA 2WNWA 3T77A 4XBMA 4M7JH 2CLRA 3FO2B 1PX4A 4I9WE 3FQWA 4MCNA 4WWOA 5J0BA 4X6CB 1FZKB 2R29A 2E7DA 3HVDA 5E2UL 5K9QI 1HZHL 4XN5A 1M6OB 1CK0H 1JFHA 3FO9A 2NY2B 4L37B 4PP1D 4YHIB 5L4IA 4LQFL 3N43F 1JD9A 4RH4A 3GXPA 1MCNA 4QKTA 4NCC2 1I82A 1BZQK 3VJ6B 4NQVA 4DAGH 5L4MA 3ARFD 3SCMA 32C2B 4H2CA 4IIQB 2ZIDA 3V4UL 3P30H 2EDDA 4G9FD 4Z3HA 3IDXL 3DVFA 4JNXA 1IGYB 4KZEH 4U3SB 3HRZB 5AVVB 1INDL 3JYBA 1SQ2N 2BS8A 4P23B 5AVXB 3QG7L 4FQHB 3QIBA 1DVFD 1ZV5A 3CDCA 4N87A 5IW1B 2JV6A 3LS4L 1Q9WA 4DTGH 3EO0B 5AVRB 4QF1A 1GYCA 2AERT 4ONOA 1RZKH 2OA9A 1EK3A 4JG1L 2CE6A 1U3ZA 2YRLA 3ULUF 5K39B 2X3CA 1U8LB 1ZHNB 2N59A 1KLFA 4YX2H 3T3PF 4ZMQA 1B9KA 3QDJE 3KPLA 5HYJB 4P46A 4BE6A 5ELIA 4ALAH 3CQPA 3MGOB 1OTTC 2BFVL 2WM0A 4NZJA 2YUVA 3CFBB 2XV0A 5JOEA 2BP8B 2XV2A 1RIHL 3FXIC 3PP4L 4J3TA 4TUOA 2BLFA 2OLDA 5FOBA 4ETQA 5IB4B 2VLJB 1B2YA 2OMVB 4HGMA 1NGZB 3MV11 4M1CC 4WUUD 4EXKA 1AQKH 4A7QA 4RCAA 5JOFA 5C86A 1OXYA 1V05A 4Y9GA 2VOTA 4HFWA 4DK3A 3H7LA 4KMLB 2WXKA 3PL6B 3X3GL 3L4CA 4M8QA 1PIFA 4MSWA 4F15B 2EE0A 5HI4C 2BNRB 3X2QB 2C8NA 1B3JA 4EZJA 1TFHA 1XB6A 5HDQL 2WINB 5C09A 3VI3A 3VXRE 3PV6A 5IEHA 4YZFF 3HLAA 3WGVB 4U1SB 3L17A 4H0HB 3G5YB 1FYTE 2XQ0A 2HVJA 3HMXA 4G8IB 2GW5A 1QMUA 2WLLA 4PJ9D 2EVHA 3TT1H 4NRZB 4Z7VB 1XGRA 4P2QD 5EU4B 3WY2A 3KWUA 1P4LA 3ULVE 3ZK0A 3JV4B 3MODL 2FDBP 3NP3A 3RZCD 2BOCA 1FL5B 3OSKA 2XFXA 1AVAA 4ODSH 1LNUB 1LVEA 4C54A 3FH5A 5DS8B 4PVMA 5FDWA 3ARFC 1OSZB 2E3VA 3MLRL 5KG9A 3RL2A 4OUUB 5FYKD 4A7UA 3L3IA 1XR8A 3T8XA 5D1QB 2FEDD 1SJVA 2WJ7A 1DVFC 2IGFL 4DH2A 1DLFL 3UAEA 4Q7DA 3SYAA 1W8NA 3NBNA 3FO1A 1DVXA 2VLLA 3U1SH 3PDOA 3QJTB 2VLKD 3DX7A 3UBXG 2H2PD 2ZYSA 4M9OA 4U6XA 4PGDA 4DKEH 3AITA 5I0ZA 5CINL 3SPVB 1ZEAL 2H6PA 2J8UE 1A25A 4EI5D 4PJDA 1HAUA 5IMKA 4R26H 4CSTA 1F8TL 3RL1A 1RZGB 4LSRL 4NKDB 5KYWA 1F41A 4X8GA 1F6FB 5JDSB 3F7YB 3W0WA 1UENA 2F7RA 4ODTL 2FL5A 1ZK5A 3A4AA 4LGSB 5E8NA 1ORSA 3OJ2C 2EH8L 1UCBL 3LOWA 1NEZG 4IBYA 2E46A 3IS0X 1ERNA 2NY2C 3FUEA 5DC2A 4TNWF 3OKDB 4M48L 3ELQA 1AKPA 1DZBA 5CBAA 2WLKA 3DV4A 2FQDA 4HPYH 1BM3H 1QTSA 2EYRA 4F2ME 1E4XH 1W2KT 1CE1L 4LVEA 3VXME 1DVYA 3ATDA 3FCTB 2FEJA 1EHAA 3HRZC 3L54A 4P23C 1RK7A 1HYRC 5TFSH 3PWNB 5LBVA 4GKNA 3D3VA 5I1AA 2BCKA 3T04D 1KTCA 2ZJSL 2R0ZL 5I75B 5FFLA 3Q5OA 4UTCA 2PPDA 1XGUB 4KKZA 1KBKA 4M61B 1JPSL 4BXSV 2WWKO 4Y5YA 4Y2DD 2AJVH 2EECA 1YY8A 4BFBD 4ELME 2ZSWA 1AY1L 3TXAA 5I1GH 1HS6A 2BVOB 4M4RB 3H4FA 2AANA 1KEMH 2DL2A 2L0DA 1KIRA 4KH9A 3RZCC 1DQTA 1F3JA 4EPSA 1J5OH 1MJ8L 1ZRUA 1TKWA 4P3CH 2EDBA 1ACXA 2VXQH 1TT6A 4OZFB 1FBIL 3NVQA 4WSJA 3BYYA 4RDBA 3WDJA 2C1OB 3ZXAC 2GTQA 3BZ4B 2FATL 1PSKL 1AGEB 2HTKD 4PN6A 3BPLC 3MPCA 4UV4L 1JXDA 2YUWA 2R59A 3HN8A 2AJSL 4PJXF 3EDKA 2PPAA 2K6ZA 2H32H 2DTMH 3BVWA 4X8JA 3GSXA 5CF3A 1UZ6F 3Q01A 4W93A 2Y7MA 1I1YA 3VFVB 2H2PC 5C07A 2J44A 3FMGL 4HLZG 4BCXA 3L5XH 3LQMA 4LCUA 4N2AA 4EZLA 2JKLA 1L9SA 3NJLA 2AJ3A 4JFFE 4EI5C 5KEZA 1E2WA 1X5LA 1TVHB 5CEZL 3K8MA 1UATA 3AUVA 1IGJB 1RK0A 1T1ZB 4NZUH 3SO3B 4RWYL 3T6ZA 1M9SA 4NP9A 4DGIL 2YA0A 4H8HA 2XKNA 4NQEB 3HPJA 1CGSH 5E1AA 1F0LA 1S5HA 3BUBA 2XG4B 2CCLA 4WENB 4NQDE 5JPMA 1YHPA 3EYVA 1Z3GL 3F12A 1X5GA 2YR3A 4K15A 2FO8A 3A4FA 3Q0HA 4AV5A 4PCTA 2E7LC 4WEEA 1EMTL 4LCCB 4OGAD 4ONFH 1C08B 1I3GH 3GJFH 3W9DB 5KSVB 3DMMB 2VDRL 4G80B 2XRAH 4M62H 3PWLB 2VE6A 5TQ0L 3GJFK 1CXKA 3LKQA 3QEQB 1DJYA 3NACH 3B5TA 4TLTA 2ZAIA 2VO5A 4MAYA 1UGNA 1CXIA 2LT9A 3MJWA 2DS4A 3O6KL 4Y2DC 4AM0B 3S36X 3CFUA 4GUPA 5A2KH 2E59A 2VYRE 4KJYB 2QPFA 1AZRA 3Q1SH 3MRQB 1GRWA 3ESMA 1ODUA 4HIIA 1ZK9A 4HX1A 4ZTOH 3TVMA 3IMWA 4L4TA 4O9HL 5IJVB 2DWTA 4A2MA 4HQQH 1SHSA 4FLRA 4GSDL 2NT0A 3ZZLA 5AW7B 4PBVC 4WDIA 4GXVH 4A37A 2V2XA 2HTKC 1HDMA 1CPUA 3JWDL 3ZHKA 5HVFB 1MI5A 1CFNA 2MEJB 4XNMA 4AQAA 3ARGA 5MI0C 4HUVB 4U4IA 3QUML 2I69A 5E2VH 4JREB 1ZV2A 3HS0B 3QJSB 5JO5B 4X7FC 1OAJA 4KNQA 3GIVB 4HBQA 3ULUH 4N8PA 3AGWA 3DDGA 3MGTB 1ZD6A 4HU8A 1A8JH 4PP2B 3QEQD 3WS3A 2VXTL 2ZWZA 1RIVH 4XBPB 1JS4A 3WUWG 3QZNA 3I6GB 5I75C 3DHUA 3S96B 3F83A 2VDNH 3G7TA 1R3JA 2MQGA 4OI9A 4QRRD 2ZCZA 1S7RA 2L04A 5I1DB 3HPLA 5TF1L 5EA0H 3ZZQA 2EEFA 3RNQB 5EF3A 3NK4A 4TLKA 2OYLA 1ETZA 4Q97A 5HYFA 4NC1C 3V52H 5EO0A 4POUB 1BYPA 1YNTB 2J88L 1FGVH 2WD0A 3EFFB 4D7BA 3VACA 5E2TH 3GXTA 1W72L 5C6PB 3B7TA 1MFNA 5C0DA 2XLLA 3JTBA 1NPNA 3NJIA 3TNNA 4OGAC 3FB8A 3UP1A 4HS6B 4UIKH 1JXKA 2OMTB 1E8YA 1SXSA 4MRBA 4TPRH 1A7RH 1NMBH 1VFBA 4ZS7H 2IPUG 3SKNB 4R90L 1KIPA 4QRTB 4YS4A 1QLFA 1FGNL 3MV7A 4GJTB 2L3BA 3HC0A 2PYED 2CA3A 1SN2A 4Z7WB 4R7XA 1OQXA 1UD4A 3BKJL 1S4IA 1AZNA 1AQ8A 4PJHF 4C55A 2EVIA 3AROA 3OV6A 3VE0B 5DJ8A 2CRZA 2OCFD 3NAAH 3B43A 3EOYG 1I8IB 2GSIA 1NBVL 2VN3A 3PHQB 4YXKH 3GK8L 2O5XL 3L2MA 5D55A 4M03A 4GQ9H 1ES0B 4OFIA 2ICWA 4JB9H 2AJUH 1OP3K 2NXZB 4YFEA 4J5VA 2E9IA 2V4LA 5DD5L 1AGFA 2VQ4A 3V0WL 1QFUH 4P2OB 5MEPB 4XP4L 2VLJE 4ZFOA 2CBQA 4J6RH 1AI1L 3CHSA 5AZUA 3VNZA 4K94L 4KRLB 4Z0XA 1QBLL 3DMMC 3QS3A 4WUKL 5IQ7L 5IFJA 2A0LD 1E2ZA 4GPVA 1YNLL 3QFDB 3LPOA 1E8ZA 4U6YB 2QDVA 2ICWI 3MV9D 1HHIB 3MYJB 1WBYA 4JKWA 1S9YB 2I5YH 5E9DA 1AS7A 2E8YA 3DLQR 1HILB 5JW3H 3I9IA 4KHTL 4LSTL 2J2ZA 4N9OB 1HINH 1LK3H 4OZHB 4TNWK 5FUZH 4OZIB 1CF1A 4QJ3B 4Z3EA 3AY4A 1D6VH 1KJ2A 2B1AL 3CK0L 4KO7A 3J8F7 4IMKA 2I60H 5IB5A 2XZAL 3VYNA 5L9DH 3U6XS 4KV5F 3LEXA 5I1CL 1J1OH 4KKLD 3KM2A 3HUJF 3WTWA 3FO0H 1I1FA 4I13B 1MHPL 2QZQA 5ISZD 1S9XA 4HT1H 1IX2A 1H15B 3IFLL 4QRPE 3HC2A 1PMYA 4MNQD 3MRFB 2VL4A 5FYLL 1F97A 5LBSA 1KFAL 1NGWB 5C6TH 3FT4A 1OPGH 1P53A 4JREC 5D1QE 3T0EB 5LNDA 3HS0C 4YHKL 2ADIA 3EFDL 1DVZA 3VSTA 5FKAA 4IGBA 4J3OD 3T2QA 1QBMH 2XBDA 4GEIA 3IPFA 4Y4FD 2ZWNA 3FBQA 3A24A 4WRLA 3PXLA 5CP3A 1SFDA 4I9XA 1KB5L 3GRWL 2EXTA 3SGDI 3BZEB 4HK0B 1AXIB 3GNMH 4XP5L 5DWUL 5AVQB 4PJAB 3EYOA 3FYEB 4M9PA 3O6FA 3VI4E 4JFED 5DC4B 5GZOC 1CFTB 1R24A 1WQVT 4FQLL 4JAMA 4K8RC 4P07A 4ERSH 1UG9A 2XPGB 2GI7A 4N2DA 1BLIA 2B4CH 2VC2H 1BOGA 1FPTL 2FBJL 1AIFB 1KNOA 1NC4D 4WJ5B 4HDIB 1EO7A 3TA3A 1HH6B 4EN3B 1M7DA 3DPDA 3TEWA 3K3QA 1R1CA 2Z34A 3CUPA 4HISA 3KCPA 5JQ6L 2PR4L 2A0LC 3F3HA 4I89A 2GIXA 2IOMA 2WYTA 3N2JA 3KPNA 4HIEB 1JAEA 4FI7A 2BOBA 1FO0H 3HFMH 4E41A 1I4FB 1YCSA 2M1KA 3PWJA 3UO1L 3EG9B 2K8MA 2VW4A 4HC1A 2JSFA 1QRKA 4HJSA 5HGHA 3VFRB 5E4EB 1N19A 3F6JA 3UADA 1MCSA 1L4IA 4V1DA 3TN0D 5IOPB 4W9LC 4X4XA 4RFNB 1B9ZA 4UTAL 5GGQH 2QGDA 2QQKH 3TBSA 1WG3A 1DQQB 2C3VB 1HL4A 2UX7A 3HR5B 3NCJH 4LZKA 4UTBA 4JPVH 1H19A 1NMAL 1MFEL 1RZ7H 2F7PA 1N10A 4UNVA 1KJ3H 4QEGA 5AVWB 4F8LA 2OJZH 1OT2A 2CLVB 5E0QA 3VD7A 3CFCL 5DJYA 4XXWC 3X11B 3WY4A 4GEJA 5KS9A 2FR4B 5ERWA 3D39A 3C08L 5IQLA 4P2OC 2O6PA 2ZX9A 4DHLA 3D1MC 3FT0A 4R0LA 1PTZA 4M6OL 1T2JA 2C26A 2W38A 3SPIA 4YHLH 4AUYA 1WAPA 3F7VA 1FQ9C 4NKIL 4XPTH 5KVDE 1E65A 3N3EA 3QHZL 5D1XB 5FYJU 5BRQA 5I1HL 1IAII 3VD4A 1AANA 1U93B 3NFPA 5ALBH 2A77L 2P4AB 2Y72A 4J3OC 2BY1A 2B2XH 2F54D 3M8OH 3P4MB 3BAEH 3TH3T 4Y4FC 4EQ2A 1P5UB 5CGMA 2CNZA 3P54A 1YEIH 1NL0H 2NX5D 1R3HA 3D25A 4AKOA 1NC2A 4B9KC 5CILH 1U36A 1UASA 4LF3A 4OLZL 1MCOH 5I8OL 4K9EH 2EE6A 4YWGL 1P2CA 1SXAA 3MRPB 4FULA 4NQTA 4AC4A 1EVUA 4HZAA 4G42B 3WD5L 1KJVB 1RPKA 3JWOC 4DW2H 2H0JA 4NQEE 4X0NA 3NH7H 1VEPA 5D70H 1XL4A 3WMSA 3IJSB 4OF8A 4XZUA 2DWDA 3V0AC 3VTMA 4BFGA 3QJUB 3G6AA 4LRNL 1I9JH 3VGFA 5J9PB 5JW4Q 3AG1B 5FPIA 4XPHH 5HDBE 4NZRL 4KI5E 4QRAA 2WQAA 4ZUTB 3V0IA 2VRQA 4UUJB 3QEGH 4BINA 2HFEA 2AQ2A 4X7DC 3LQZB 1Z5YD 4XOAA 4JJ5A 3TYFB 1IVTA 2Y7SA 4PRBA 1BAGA 4B7IA 1P84K 1IBBA 4DWHA 1PZ2A 2ZXGA 5CJQL 3UJIH 3T0EC 3SBWA 4X5WA 4OCYH 1JWMB 2CHNA 5TE7H 3VD5A 4JO1H 1MFAH 1G7LB 3LKPB 4DKAA 2DJ4A 1BCIA 4TOYL 1J8HD 2PCFB 4BDVB 1FFOA 1RULH 3EUUA 4X8XA 3TN0C 2HPOA 4HWEL 4B96A 3BLKA 2WUBH 1AHWB 1YQ2A 3HAEG 3MAWA 1A6AA 2WP3T 1SBSL 2EKSA 5T3ZL 4MA8L 4D0DA 2NPLX 4DKFL 2Y1ZA 1XX9C 1H6UA 1SBBA 3I50H 4WHYH 2FT8A 4W68A 2WPGA 4AQEA 2KS0A 1O7DC 3KJ6H 3FAXA 4OKVA 5C0CA 4DEUA 1M2VB 4I5BB 4RISH 1HZLA 4GYBA 5DUMH 2XG5B 4G8FA 4IBSA 4P0DA 5E4OA 2YMXL 1EJ8A 2WQSA 1IEBA 4L1TA 3ULAB 4LCWA 5BV7L 2CKBA 3QXAB 3LQAL 3ZTNH 2CJUL 2HJFA 5ICZB 1KYUA 5LCVA 2XKSA 5IHLB 3ALPA 3D5OF 1IZJA 1QNZL 4FFYH 5JUEH 3SQBA 1YMME 5F9WB 3WJMA 3ZKND 3LRLA 1QRND 1UD2A 4X99B 3ZJAA 2I7OA 1F3DH 1T4WA 5JXEC 1TVBB 3LVTA 2JKTM 3OVUB 4JHAH 4H8UA 5E4EC 3VW3H 5H4ZA 1E6JH 4RFNC 1IC5L 2V8LA 4RGNE 2E7BA 2IWFA 1HEZA 4QXUL 3VWJA 3INUH 1UH2A 2CBMA 3RWDA 1PZDA 4R7NB 5I71C 5JHLA 1T2QL 1MVUA 1E42A 2WBXA 4Y1TA 5E5MA 1JPFA 1G9MC 4AIXA 3VFMB 3CH8A 4KUCD 5DU7A 3APDA 3KLSA 5G2NA 4YHNB 3T0XA 3G6JB 4GIAA 1R3IL 4YOKA 2B5IB 4AC2A 2HYMA 3S36L 1GAFL 1U41A 1F86A 2XZQH 4ODXA 3JQOB 5HGBA 3O9WB 4MA3A 1K2DA 2DD8L 2YXVA 1J1XL 4EBQH 4Y9BA 4ANUA 1PYWA 3H3BC 3Q6GL 4XODA 3IE9A 4G1MA 2WV3A 1DJGA 2PPFA 4IKIA 5JMRA 5BXFA 3QHTC 5KUKA 4Z7WE 4GSUA 5I76A 4PJXE 3NJNA 3U7YH 1P5UC 1A02N 3UERA 4IRJB 3TF4A 4MDJB 4MJ6A 5HHOE 3QUYB 4OQTA 4WV1C 1ZTMA 1KBWA 5ECJE 4N6RA 1D6EA 1G1YA 1SNRA 3UTSD 2YD6A 2GT9B 2VRKA 4H25B 3UAJD 1WZ1H 4PJIA 3L95A 3SOTA 4JR9L 4QHUB 1QVOB 2YRZA 2OJEB 4O58H 4YUEH 2VZOA 5AG8A 1WAEA 4JM2B 4XH2B 5F7HA 1WISA 2A1WL 4JM4L 1H3VA 3N41B 4FKEA 1PDKB 1DO5A 4JN1H 4GKSB 4CA4A 5GRVL 1Q0EA 1QAWA 3NT0A 3OZLA 2E6JA 2JKWA 5IFAL 1AJ7H 2ZSVB 4UZGA 3TX4A 5DQDH 4QT5B 1E30A 2PN5A 1ZGLM 4HUMB 3DARA 3ZKNC 5D2NA 3TO4A 4U6HA 4GSQA 4YBQC 1U3HB 3H9SB 2WZAA 1DQJA 3AU0A 3GHBH 4OAWB 3I3EA 5GXBB 3OKMA 5ENWA 2R0KL 1AHWC 3VXQA 5FX3A 4IRJD 2DQIL 1OP4A 2YAHA 2XTLA 3ZIMA 4PJCF 2D8KA 3MNVB 2XWJA 3QNZB 4FJYA 4L1BA 1NBZB 2BP5M 4OZHE 2Y7OA 3O2WH 1SDDA 4I2XE 1LEKB 2E74C 3ZO9A 2CBTA 2AQRA 4XHJD 4RMTA 4F9LA 1I9RL 1SEBA 3LNFA 3LIZH 3UTTD 1NWPA 3GMMA 1QFWI 3NP4A 4NHUB 2P80D 4LO9A 5AOMA 2IBBA 5ID1A 2AKRA 3E8UH 4NO2B 4Z1PA 2JJSC 3DOSA 2ZWKA 2DQCH 4JN2A 1A6VL 2YKLL 2DQFA 5DJ2A 3KW8A 1NICA 1PLGH 2QL1A 2IPTH 3N5AA 3STBA 5GZNC 4YC2B 1U8PA 2F5BL 1QEWA 3ARDA 3NESA 4D94A 2XJLA 2FWOB 1ASQA 4N8VG 2IFFH 1GJIA