5D1XE

Isdb neat2 bound by d4-30
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
115
structure length
115
Chain Sequence
KMTDLQDTKYVVYESVENNESMMDTFVKHPIKTGMLNGKKYMVMETTNDDYWKDFMVEGQRVRTISKDAKNNTRTIIFPYVEGKTLYDAIVKVHVKTIDYDGQYHVRIVDKEAFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D4-30 Light Chain
publication title Germline-encoded neutralization of a Staphylococcus aureus virulence factor by the human antibody repertoire.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 19
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5d1xE00
2Z6FA 2E7DA 3SZ6A 3RURA 3QZNA 5D1XE 4NLAA 2ITFA 2K78A 3SIKA 4YMPA 5D1ZI 4MYPA 3VTMA 2Q7AA 5D1QE 3QZMA 3QZOA 2MOQA 3VUAA 2H3KA 2O6PA 3OVUB 3QUHA 3QZLA 4H8PA 2O1AA 2ITEA 3QUGA 3QZPA 3RTLA 4H8QA 3SZKC 4WJG3 4FC3E 3S48A
chains in the Genus database with same CATH superfamily
4FLOA 2JJVA 3MO1B 5CZXD 2ID5A 4Z95H 3QJTB 4X42A 3QIBC 5KWYC 5CLWA 1E8YA 4V1DD 2CR3A 5KYYA 2D7OA 3IGAB 3QWQB 1F4XH 1TT6A 1S7QA 3T1FB 5HHMB 3O45A 5JPMC 4OLEA 4WO0A 3SE9L 1J9TA 1HVXA 1HL9A 2RD0A 2B8OT 3O6ML 2YFNA 4R97C 3MRDB 4X5WA 4PHZA 4ETQB 1P6FA 4XR8C 5FUOH 2XY2A 3IU4H 4LFHG 3N2JA 4ELMB 1B2YA 1H8LA 1XCTA 1NL0H 3P77A 2KHAA 2WBXA 3JV5A 1NPUA 2GTZA 1T1ZA 2XZAH 1PU0A 3PWJB 3LQAL 3N5AA 4MS8C 4WKXA 5DJ6A 5CD3B 5KOVC 3VFSB 3VWKD 4HOWA 3U0PA 2QLYA 1CFNA 1MVYA 4ZFGL 2I9LB 1TG8A 2YD1A 1BZ9B 5ICXB 2WNKA 5CEZE 1XCQB 1JSYA 1HL4A 4AQAB 1BXVA 3WCYA 1TZOA 3D0VA 1YA5A 4ONOA 2IJ0C 3MNVB 4LSPL 2TSAA 5BVJB 2W0PA 2WUCL 3V0WL 3V6ZA 3Q05A 4XCEA 4B3EA 1D5BA 5CBAA 4PW3A 4R2GB 2NMSA 3T4AB 2BNQA 1UT2A 4GRLD 3BMVA 4S1RH 2X05A 4UIMB 1GYUA 3ZTNL 5J3HD 3JV0A 3BJLA 3S97C 5I1DB 1OL0A 4HU2A 4GBXB 5F6HI 5LCVA 3VWKA 2VDOL 1GMEA 1HCVA 2A4EA 5LGHH 1R3HA 3LKQB 2YQGA 1BJMA 1C5DA 1TTGA 3O8XB 4ZI8A 1WITA 4JRLA 2YA2A 1M05A 1NBYA 1D9KC 1LP9B 2IDFA 4YC2C 5J12C 5LCVL 4OQ1A 2CO1A 3ZE2E 3E3QC 3OF6D 3ZT6A 3GSNH 4M29A 3UL4A 3H9HA 4QIRA 3UTQB 1ZEAL 4BINA 4P9HC 4XPGL 1UQSA 3D3VA 3I6LE 1G7IA 3L3IB 2W38A 3RWCA 2J44A 1D7CA 3HE6C 3E3QE 3RWEB 2QADD 2AV1B 3TP4A 1RU9H 2DQHL 2XPGA 4GRLA 3KLHC 5HDOA 1N8ZA 4L5FH 5F71A 1M6OA 4EZMA 1QSFE 2NY2B 2WNGA 3VWJB 5DSCB 4LEXH 4X6CF 4JNXA 4L37B 4NQDA 1MUJA 3K6SB 1M7IA 1RJYB 2CDFA 4GXFA 4O4YL 1FVDB 3P11H 4Q6IA 1I31A 3T8VA 5JOPE 4HBQA 2EEBA 1DUZA 3NCXA 3V7AG 5JIMA 5TDOA 4IBLT 4MD5B 1L7IL 1DANU 3MU3A 3OF6A 1FAKT 1FE8L 4M6NH 3DRTB 3T4YB 5TDNA 3K6IA 4I0KA 5HHQB 3UPRA 1ZXKA 3MOBH 4FFTA 3N1FC 3L16A 1PCSA 5T3XH 3GGWA 1CC3A 4JB9H 5F9JA 1CGSL 2IDQA 3LQMA 4LLWA 5DZOA 3H42L 2ZUQC 2R8SL 3MGTA 3K71A 4X5RA 1KY7A 2YXWA 4LP4A 1JNNH 3SPGA 1B3IA 1NIDA 4WI2A 3SE6A 5LGJB 3PABA 2X1OA 2C3WA 2FO4A 5IESH 4JFEB 1I8AA 3L3HB 2XG4A 2DQFB 1FF5A 5F7UA 1CZ8H 5CSZB 1ZT4B 2VUOA 3E8UH 3MXVL 2H2PC 3KJ4B 2YGQA 3T9WA 4X98B 3PJSA 1NFDF 4KZEH 3FU5A 4AKQA 4NNPH 2G75B 5IQNA 5CF3A 3PWLA 3G3LA 2YPVL 4LOUC 1YNKL 3IPEA 1YEHL 1N10A 3B2VL 4MTMA 2B1HH 4CVXB 4CDGC 1JYNA 1YPZE 5E2JA 5HHMD 4AL8H 1QSEE 1KGCD 4FXGB 1J48A 3GXNA 3HC0B 1QPXA 2ERJC 2J55A 4HKXB 4GT0A 5IJCC 3CE1A 4KMTL 1WAAE 1YEIH 2J7LA 3A4EA 1Z9OA 1IAOA 1XFPA 3MXWL 4EEEA 2NY3B 1X7TA 1TVHB 4RAHA 3MO1A 4PBXA 5TF0A 4IMLB 4EN2A 3HG3A 3VD1A 3QPXL 1OE2A 1Z2KA 1NGXA 4HP5A 4WUUB 3KJ6L 1JMXA 1N26A 3D18B 3PJLA 3T1FA 4NQCE 1S7RB 4QNPF 4J3BA 3IKKA 1YYLL 1HL8A 1TJIL 4I1PA 1LXMA 1NMBL 1Z9SB 4K7PX 3MRDA 1F45A 1VADB 4WUKH 4BGLA 1YEKL 5L8LB 4UILH 3K5RA 4UQ2B 3LRGA 2FB4L 1KTRL 1NGQL 1UENA 2HX9A 2VLJB 2W07A 2O5ZH 5FV2A 3RZCC 1PAMA 1BQUA 4PJAF 4DN4H 4N1CA 2EE2A 4XCNA 4O2FB 3PWJA 2FWSA 1JGVL 5CD3A 1W2KT 5H8DA 5KUMA 1SLUA 3G6DH 3VFSA 1RLWA 4PJ5E 5EZOH 4NQSB 2QPDB 1E4XI 2I9LA 1Q94B 1ES0A 4ESKA 1BZ9A 2G2PA 5ICXA 3H2PA 1P4UA 1XCQA 3C2AH 2G30A 1ORSB 1INEH 4GP4B 5KVDL 3FMGL 5IR1B 1RZGB 2PO6B 2BWDA 1X7QA 4NQEB 2VL4A 3MNVA 4JPVH 3KLQA 2HKHL 1A14H 2VISB 5BVJA 2Y3AA 3QCUL 4W9CC 1ZSDB 4KXZH 5D5MB 4TSAH 4AXWB 3GKZA 4OLXL 5AZEL 4NHUB 3T4AA 3D25B 3QUHA 3BE1L 5KBLA 2YPKB 4APQC 5MHSE 5I1DA 1XH3B 2NY2D 2WXKA 4V11A 5C0JB 3VWJD 1CE6B 4GS7C 3QAZB 5D1QB 3MV9E 4OCXH 5ANME 5KN5B 1KYDA 1UYWL 2EO1A 3LKQA 3GBLA 3O8XA 4O00A 2WVVB 4LE8A 4J3OD 3QH3A 3JZYA 3QPQC 1LP9A 2VH5H 2A2QT 3MHZA 4JX0A 4PW4A 4UV4L 3EHBC 2F1EA 3UG3A 3G6JB 1NEPA 3ZIMA 1PLCA 5DMJB 2BW5A 1BM3L 3ASNB 4N26A 1BAGA 1BIHA 2VXVH 4QTHB 5K93A 3UTQA 4U31A 5B3SB 2MCPL 3GHBH 3GMMA 4WTWA 3T0BA 4NN5C 1OAJA 3MA9H 4MQ7B 5HHOE 3RWEA 1MW0A 2AV1A 2OK0H 1HI6B 4B9JA 2Z7ZA 3HS8A 1H8SA 1FHNA 2IG2L 5IFJB 4WIQA 3VWJA 1FO0A 3FQUB 5DSCA 1FP5A 1JK9B 2VDML 2O5XH 4ZOCA 3K6SA 1RJYA 3HRPA 4TNGA 5BZDB 2EEDA 1JDAA 3WY3A 1FVDA 2HXAA 3FDWA 1YRKA 2ZJSH 2OMWB 3PU7A 2YHGA 4AV0A 1FO0L 1MCRA 4PJ8B 1EDYA 2VERA 2XETA 1J5OL 4M7KL 1MCPH 3HN8A 1PBYA 2AK4D 4TXVB 4H13C 3DRTA 1OVZA 3U0TB 3MUHL 3T4YA 5I18H 5M95B 1DBBH 1YYML 5HHQA 5ANHA 5I16B 1KLUB 1A7QL 2J57A 4KTGA 3UP1A 4Z7OE 1MFAH 2CJTA 3ECBB 5AG8A 1Z9LA 4LCWB 5INDB 3TTSA 2EDYA 3P54A 2P47B 1MHPH 4HDIB 3RVXD 1ITCA 1JPST 3GNML 3MLRL 4W6WB 2Z4QB 3LIZH 4JPSA 5EZLB 3HUJF 1MHEB 2PMZA 5L0QC 1KTDB 5CJBA 2EKSB 2DQTL 4JFEA 4NO0B 3CQPA 1DJSA 4FJZA 4ATWA 2YD7A 4IU3B 3PE9A 2JB5H 4LSQH 1NCWL 1PKQB 1ZT4A 1GHFH 5CSZA 5GRYA 3D4GA 4JR9L 4X98A 2P5WE 1OP5K 1OHQA 3WO4B 3MODH 3T6QC 2EEAA 3OG4B 3H9YA 2YD2A 3ARXA 4YHZH 1RUKH 4FP8H 2ZWSA 4P2RB 1YMHA 2NNRA 4BBWA 5I0ZA 2D7TH 4TPRH 4R83A 4JG1H 5D7IF 5C92A 5L2JA 1FLRH 1OZUA 2NY7L 4FXGA 5T1LB 1BOYA 3HC0A 4P5MB 4XE5B 1MEXH 2F68X 4HKXA 4JM2B 2ZX9A 2Z4TA 1M57B 1QLRA 4BYHA 5I1HH 3QRGL 3S36X 3Q43A 5GS0H 1QEWB 4JMNA 3WBDA 3O0RL 4CVWA 2NZ9D 3ARUA 3TF7C 2B4CH 1NSNH 3CVHL 3I6SA 3JT0A 5DJ2B 4RIRB 2EEFA 4MJID 2GBAA 2RMNA 1BFVL 4IMLA 3UO8B 4YHNB 3I6KB 4TUUA 1GGCL 1XH2A 5INCB 3D18A 3LS4L 4IBQA 3W5NA 2QDVA 3MLUH 3VXSE 4WCYL 2PO6D 2X2UA 4OLZH 4F3FB 6CGTA 5JXEA 1DL7L 4NQED 2VRQA 5MEPB 1ZHBA 1VADA 2BIOA 3I2CH 4KKLC 2K9UA 4KRPC 2CK2A 3BVXA 3EGSA 2AQ2A 4KX9A 3K2UH 2QSVA 3WXWH 1ASOA 1BBDH 2V7NB 1LJMA 4G6KL 1OARH 2JTDA 4JL2A 1FN4B 3VI3A 4MJIA 4O2FA 1WWBX 4DP5X 3VQ1C 1KCSL 2J88H 3RUGE 1ZK5A 2G3ZA 4U0RC 4JRYE 4Q2ZB 1K5NB 3DSNB 5B8CC 3FO9B 5IFAL 3LEVH 1Q94A 3NEOA 1G7QB 2NPLX 4JO5A 3DVFA 1ORSA 2CM6A 1V3LA 2ZCZA 1MIEL 1RZGA 2PO6A 5IR1A 5JDSB 3ESOA 4NQEA 4PAZA 1E43A 3CBRA 4GI8A 2PABA 5F6IB 2VISA 3GDBA 4CADB 4O02A 4QOKB 1ZSDA 5D5MA 1E4WH 5T5FA 3AG3B 2DS4A 4XPTL 4PJ9C 5SWSB 2UXVA 4NHUA 1KBGL 1H6EA 3D25A 3RIAK 3SKJL 3BUYA 4M1CC 2BXYA 1IC4L 4X8GA 3HG1E 1XH3A 1WF5A 4OB5H 4O02L 1YUKB 4DKEL 2ZXQA 1CE6A 3DX6B 5T5FL 4O51B 1ORQB 3FB6B 5D1QA 4CSZA 5KN5A 1BMWA 5AB2A 3K91A 3RWDB 1XL4A 4UBDD 1GZHA 3NJJA 2WVVA 1OAXH 2UVEA 1OGAB 3DURA 3FKUS 3D33A 3G6JA 3KXFD 1E4XL 1TKWA 3DGCR 4QTHA 1RV6X 4IKKA 4QXTB 5E00B 4K94C 1OP5H 3PP4L 2BY2A 1FBIL 3NT0A 3PP3K 4MQ7A 1YN6B 4HBCH 5EA0H 3RDTC 4PJ7E 1T89C 5IF0A 3SKNA 1WUZA 4LCWD 3TM6A 1CVSC 4G7SB 1LWJA 2WKGA 2FDBP 4FQIH 5IFJA 3DX3A 1NFKA 3FQUA 1HHIB 4PB9L 3WTUA 3U7WL 1JK9A 3RKDD 2XG5B 4N86A 3LPWA 1A4KB 1Z3GH 4G71B 1JYWA 1IEBB 2H1XA 1FDLL 2OMWA 3CDCA 2N59A 4GNKB 4PJ8A 3BUTA 4NO0D 1WE5A 1D2PA 3CQQA 1CU4L 2ZUSA 5HHPB 3EDJA 3U0TA 5K5YA 5AFAA 5FYLH 1MJ7H 5J1AB 1KLUA 4NB7A 5F9WB 1XX9C 5AOKA 4JUTA 3ZE1E 4N90D 3P2TA 3ECBA 4ZOBA 5F8RC 4D9RE 3Q0HA 3UBHA 4LCWA 5LBVA 1JF5A 3W57A 3RB7A 5BW7C 4HDIA 3SDYL 1A6TB 4MBRA 2Z4QA 3QUMH 3WFEH 5EZLA 3MRRB 3LV3B 1LK3L 1MHEA 1N2RB 4H8QA 3EFFB 1KTDA 3Q9QA 1F3JB 2EKSA 4GKZB 5T1LD 2OW7A 1PQZB 3H6JA 1P5VB 3SE3C 1GOFA 4L4VB 4NO0A 1OAZH 1OD9A 4IU3A 4G5AA 2A74C 1LDPL 2NYZA 1XD0A 1PKQA 3VXUB 5B1AB 3BZEB 2IH3B 4RGOL 2WANA 1R3KB 3LKPB 2WLNA 2VDLH 4FKEA 4RISH 1QG3A 4IRJB 3M17B 3DA0A 4D3CH 3VRLE 2X2YA 4Y2DB 4G7YL 3FT0A 3MYJA 4JE4B 1OQOA 3JTTB 4PIRF 4X0KB 4GKOA 4N9OB 1F6AB 2BOBA 2C3GA 4QRPE 5DHVB 5T1LA 3VSUA 1AQDA 1FZMA 5EZJB 3HMWL 3SKUD 3G5ZB 4OV6F 3PFQA 1FL3A 1QEWA 3I02B 2QZ5A 2YXVA 1MN4A 4AQ8A 4F80A 3NIDE 1YLBB 3T0EC 5DK0B 4JKPH 5DJ2A 4PRPE 2NYKA 1HOCB 1C08A 3C60D 5J6SA 2DTML 2CO6A 4ODWB 4EDWL 5DWPA 5ITBH 1W80A 1RVFH 1BGXH 4YHNA 1D7FA 4OZIB 2DQ6A 3I6KA 2KPWA 3DJTA 4BSJA 5IQ7H 4P46D 1AH1A 4XBEH 4XO4A 1NANI 3T0EE 5JW4N 2CRIA 5D93B 2ZPKH 3DLQR 5INCA 1CFQB 1ED3A 3UYRH 1SHMA 3JVGC 3FT2A 5TGBA 1OKEA 2FJSA 3F65A 3SBQA 4G1EB 3ABKB 3U2IA 3HTLX 5MEPA 5SX5K 4HA1A 1A6ZB 4NN6B 3TS8A 4Z7UB 2B77A 2RFXB 4XPBL 4K3DH 5IBLD 4IJ3C 4P2QE 5SWSD 1NAMA 3MJGX 2E75C 4RFOH 4ENZA 2IWFA 3NSYA 3DX8B 2V7NA 2DAVA 3C60A 3ULVH 1A3LL 1FN4A 3S7GA 4ABWA 4G7VH 1C5BH 5IMOA 5JOFB 5KVEH 4YWGL 4X6DE 2QSQA 1NAML 3FB5B 3QJZA 4G5ZL 4P46A 4Q2ZA 4WGWB 3DSNA 4P2YA 4HETA 3FO9A 4Z7QF 1U8LB 4BZ1A 3EJRA 3M1BB 3QCVL 4IBTA 2V8MA 1G7QA 3SE4A 3CG8A 1OGAD 2PP7A 2Y3NA 3SEPA 5AG9A 9PCYA 3PYCA 1QUPA 3AM8A 5DYFA 2MRYA 3KLSA 4JRXD 3HPLB 5JDSA 4ZFOL 2Q8BH 2O5YL 3U7YL 3N1GC 3DX0A 4K5NA 1LYQA 4CADA 4MCYB 4XP5H 5L2KB 4WFFE 4QAWA 5SWSA 2D7PA 4YQXL 1CD9B 1CGWA 1ZA6B 4BFNA 4R7NB 3EJYC 1XGZA 4MNHB 3DX6A 3VDCA 1ORQA 3FB6A 1H6UA 2J43A 3VFWB 7CGTA 1JXKA 2J6EL 4MA7H 4PTTB 1KCKA 1IIKA 3JWDC 2APWA 4YJZL 3GBNH 1OGAA 3OC5A 3S35H 3T3MF 1HK6A 5B1JA 4F7EB 3TZVB 4OIIL 3IE9A 2CALA 1OQXA 1UWGH 4LDEB 3ZTJH 1O7DC 3IAPA 4F7PB 4J6RL 3BZ5A 4QXTA 4MJ5B 5DLML 1HEZA 1X5YA 2WKOF 4PGCB 3ZVVA 3QZBA 3HJ0A 1AG6A 4N2LA 4KO9A 2EH8L 4IKIA 4MA8L 4DESA 2BSSB 1EJOL 1DVFB 2DWDA 1O7DE 2QQLH 3VWKC 3HVNA 1H3PL 2BNQE 2WNWA 3GBML 1HHIA 1Q1JL 1RSYA 2CGRL 1Z0NA 4XNXH 5BZXA 3BKJH 1UD5A 4KJPC 1HZKA 1T1WA 5EOQL 1AFVH 3VXNA 1IEBA 4F5CA 5B4MC 5LHDA 4GAJL 3KPTA 2AXGB 1MFDH 1T5WB 4K3EL 3H9ZA 2P52A 3HNTL 5HHPA 1E6JL 2WLYA 3QJSB 1DEEB 4TMPA 1E2VA 5J1AA 4YE0A 2WZ5A 2RCSH 5D8JH 5E99H 1JXFA 1AHWA 1RZKC 3D3VE 3LS5H 3MGOB 2YMTA 4YIQB 3D39D 3WN5C 2CMRL 2BSDA 3Q5TA 5CEZH 1WBYB 4F37F 3OM3B 1QBMH 4KJWC 4OF8A 1LK2B 4Q6IC 1A6TA 3ZIYA 3MRRA 3E38A 3LV3A 2GHWB 3L9RB 1N2RA 4HF5L 4AUUA 3EFFA 5EUKB 3TV3H 4M43L 3J27A 4JFFB 4NQDE 1P7BA 1PQZA 1P5VA 5EO0B 5SX5H 5KTEH 3LCYA 4UYQA 4L4VA 1HILB 1TZAA 3UGEA 3IKCA 4ECNA 3OR7B 4MXWH 3NIFE 1A1OB 2Y2TA 4M8QA 4A39A 3VXUA 2IFFL 4B50A 2LU4A 1F4YH 3LKPA 1R3KA 1PSKL 2Y7OA 4ODSH 1T03H 2X09A 5DJ0B 3Q6GH 3D39A 1G5GA 1LTXA 4GEIA 3OV6A 4AZ8B 3M17A 1BBJB 1IAMA 2WB1A 3CQFA 1P7HL 4Y2DA 1DZBA 4X0KA 3FNKA 3ENEA 1F6AA 1YECL 5DHVA 1QYGH 1J1PH 2P8PA 1XTMA 3HRZB 1KENH 3LXAA 3BQUB 2ODHA 3A0OA 2K6ZA 3OXRB 1CL7I 5BRQA 3G5ZA 2WXRA 4P9HH 3I02A 3MRBB 1CLYL 1SXSA 3L17A 5CLTA 5DK0A 1HOCA 2GBUA 3BWUF 5CLXA 2H8PA 4XNBA 3QR2A 3AC0A 4GP8B 2OMXB 4ODWA 3X1EA 1JVOA 4Z9KB 4YSEA 4LCIH 3ZR6A 4NPYB 3ARYA 3PL6B 5DQJB 5JW4R 4OZIA 1MH5B 4UOW1 5KYWB 4RDQF 2NXZD 3Q6FB 4DOHE 2OI9B 5F7DB 4E9QA 1NDGA 3RWHB 12E8H 5F0PB 3AS2A 1NDTA 1ICTA 3GXFA 4PG9B 3CZFB 4G1EA 2KYIA 1XGUA 3S88H 1NGWB 1MJJA 1MCFA 2ZONA 5L7XL 1BYNA 1P1ZB 4ZOAA 4FG6D 1A6ZA 1IEAB 4Z7UA 5L2KD 3GD1C 2RFXA 4L2LA 4I0CC 2X6CA 2BY3A 4F8TA 1T4KB 2CM5A 1NM9A 3IJ9A 3DX8A 4PLNC 3D7PA 4QAMB 1A6WL 4WSGA 3DV6B 1DJWA 3F62A 1I9IH 1THAA 3FB5A 3CFQA 4XN4A 3WS6C 3AUWB 3IFLH 1X9UA 1U8LA 3M1BA 1A25A 1ECZA 1IQWH 5I30H 5K33A 1AZNA 3EFDL 3ECQA 4KROB 2W81C 3R18A 4Y5YA 1ZKAA 3S2CA 1GAFH 5HHME 5ACMA 5K9JH 3AXLB 4HLZH 4NUJA 2OJEA 4MCYA 4DKFL 4XBMA 3NACH 4AVKA 1OF2B 4L3AA 5ITFB 5L2KA 1WZ1L 3ILPB 2V6HA 3OLDA 1ZA6A 4ELME 2NQ3A 3BIKB 4R7NA 4X7SL 5E56A 1GW6A 4MNHA 1JPEA 4PJBF 4UNTA 4DP1X 3X1BA 3VFWA 4MB3A 5LGKA 3QRLA 4LCVA 4LEOB 1DVTA 2I7OA 1DBKL 4OFKA 4Z3JA 1BXXA 3FUEA 4CU6A 5AYUH 4F7EA 4ZQTA 1E5CA 1MVFA 3LSOB 4YXLH 2OCJA 5F7BA 4BH8B 2BSTB 2VAAB 4R2GC 1TZHB 3P3RA 4L8BB 3T4AC 4EZJA 4LDLB 4MJ5A 3VM7A 3ULUC 2AK1L 4PGCA 4IM8A 2QVFB 2BSSA 3V0GA 4HOMA 5HBBA 4X8JB 4NS0A 3WTYA 2WLIB 3ULUE 1DN0A 3HOGA 5DD6B 3KHOA 1XXDC 3O8XC 4WEBH 2Q76B 2VSKB 2O72A 4PJEF 4JHUA 5I2IB 4HOZA 2WYZA 2ED8A 5AOMA 2I24N 4TUOB 2XZCH 1UZ8B 1V5JA 5MERB 3UO1L 3A6BL 3A4AA 2WVUA 1AI1L 1BFTA 2QR0B 1A1NB 1W16A 4YHOL 5IJKC 2YMXL 1TPXB 4I7ZC 4BFEA 1T5WA 1LP9E 5EBWB 1IBYA 3CVIL 1DEEA 2KZBA 3QXDA 1Y1DA 2AMUA 3WHE1 3DHPA 4J28A 2QKIA 2NY2C 3MGOA 4XVOA 4YIQA 2A7BA 3VWJC 1I1CA 3N1QC 3L3OB 1WBYA 2FE0A 2JQMA 2YD6A 4UTBA 1JZIA 4U6XB 1NAKH 2H7WA 4HWEH 1LK2A 4DKAA 4I5BA 1NUDA 1RIVL 5JR1H 4K55A 1O75A 4J3OC 3L9RA 3BZFB 5EUKA 1W0VA 3L6FB 1WT5A 2Y5EA 4JFFA 4KUZL 1KCVL 4H44C 4S0HA 5EO0A 2XWZA 1HILA 3FPXA 2OAAA 3T0WA 5AVYB 2IDCA 1A1OA 4FQJL 1I8KB 2ZOLB 1UUNA 1VFOA 1U8IA 2WQVA 4N8CH 2DIEA 1SXZA 2NUTB 3KYAA 4KNTA 3WE1A 3OLEA 4UM8B 2PETA 1V7ML 2E6JA 2JKRM 1VEOA 3GWJA 5DJ0A 2AJUH 4FFZL 2CPCA 3QE5A 1UUSA 2FIRT 4Y9CA 4AZ8A 3ABGA 5JXAH 1BBJA 5LBGA 3SOBH 2N3JA 4G8FA 1IJNA 1PZBA 1BV8A 1KBPA 3BPLC 4H1LB 1QBLH 5KYUB 4ZK8A 3VA6A 4BK8A 1AQKH 5IJVB 2IWEA 2FJFB 3BQUA 3OXRA 4JFEE 5IVXF 1OEZW 1WBZB 3KJ4C 3TNNB 5TK2A 3F3HA 5ILTH 2CAKA 4TKWA 1M56B 1PZSA 3U2SB 2JCCF 5I6PA 1QD0A 4QRFA 2XICA 3SY6A 2VZUA 3L5WB 3QFDA 5IHWA 2OMXA 3RVXC 5C7XL 1JUFB 4JFVA 2WXIA 1T5XB 1JPTL 4NPYA 3F58L 3PL6A 5DQJA 4LKXB 2PPFA 3PGDB 3DJSA 1SJXA 2J8UF 3Q6FA 5EU7C 5F7DA 1WHPA 4FXGC 1MCJA 5SWZB 5I28A 5TH2B 3RWHA 3G5XB 3CXDH 4HUVA 5GRWA 1NFDA 4HJJH 1EAOA 3CZFA 4EVNB 5D4IA 3WE6B 2WTRB 5EU7E 1EANA 1IEAA 5E1GA 2EVHA 5HI5D 4GKSB 4PRHD 2APBA 2SODB 2NY3C 3NJMA 5ADPL 1T4KA 2FVNA 3REWA 3CZKA 3RTLA 3MTRA 4BFKA 1NBVH 1CL7L 5EEXA 3CVBA 4MNGA 1MLBA 2BLFA 3DV6A 1I1RA 2ZXAA 5E2TH 4L3EB 2J3SA 4JHVA 1L9TA 2X89D 2ATPB 2C9XA 1AQMA 4L18A 1DBMH 4F91B 3M8OH 5JXEC 1WA2X 5DT1H 2BCKB 4WUUE 4MX7B 1ZJAA 3M1CA 5FB8B 1LO2H 1UATA 1ML0A 5GS2D 2PTUA 15C8H 2JJSC 2X42A 4AEIH 4POZD 4G3YH 3AXLA 4DUVA 1YEGL 1J1OH 2NT1A 5DTFB 5ITFA 3B43A 1GKEA 1WPCA 2C1PB 4HT1H 3DRQA 4M1DH 3KPQA 1HDMB 3FTWA 2DLHA 4I9WD 3A4DA 1CPUA 3BIKA 1BPVA 1QKZL 5I1IL 2DQIH 2VLJE 4QHNA 3DHUA 3ESPA 1SYSA 2F61A 3VI3E 4WO4B 4MJIE 1KYFA 4HV8B 1ANUA 2H2SD 1JDDA 2X89A 3HC2A 4TLTA 2PO6C 3GM0A 3DPBB 4JQIH 3ZO9A 4XVJH 5DZLA 4W6XB 3LSOA 4YDNA 1PF3A 1CIDA 3BD3A 4BH8A 2F8VA 2BSTA 1S4IA 2FT7A 4JZJB 3GUTB 2VAAA 4J3VA 1UA3A 5IEKB 1TZHA 4L8BA 3O6FB 2R4RH 1EJ6A 4NQEE 5JLZA 4TUKL 4H0HB 2CD0A 2HSIA 5ESQB 4NCDA 2ADGB 1S7UB 4MXQD 4LPTA 3X14B 2WUBL 4X4XB 5D5ME 2LAGB 4BCXA 1EXUB 3QAZC 4V33A 5D1QC 3HMXH 2WLIA 4M6ML 2CKBA 3WNOA 3CZJA 1MREH 5DD6A 1GZHC 4HMEA 1ZD6A 3I9GL 2XXGA 5I2IA 4AQZA 4ZO6A 4XP6H 2WO3B 3F6JA 4HH9A 2HRGA 4PJDB 5D1QE 4TUOA 3T2QA 4S0TD 1UZ8A 4EOWL 2CKBL 2VDKB 2EINB 2QR0A 2A77L 4LPYA 3KWTA 5IBUB 2BOLA 4KO5A 1D6EA 1XZ0A 1BVKB 5EBWA 1RLBA 1AGCB 3FFCB 1IC0A 2A9MH 1CTOA 3VQMA 4MZ3A 1NLBL 3G6JE 3UTPD 2HLFC 2EVIA 4HWNA 3O3AB 1R24B 5CLZA 4BZ2H 3VCLB 4JDZB 3BYYA 3ROOB 1QUNB 4U6XA 3NUKA 1HINH 1X44A 2AI0L 1KJ3H 3M46A 2R2EB 1UA6H 4ONFH 4UBDC 1F1DA 4CJ0A 3GLAA 1OTUC 4Z7NF 1QFWM 3FCTB 3BZFA 4PJ8C 3L6FA 3EH4B 4RCAA 1IAIM 3R0MA 4XHJD 5J7CC 1PKOA 1PZ3A 1KYAA 1U8NB 2CU9A 5DO2D 3HN3A 2DWXA 2QVMA 1XO8A 3BUIA 1I8KA 1B2WH 2BIPA 2JQZA 2PPAA 3V8CA 1E6OH 1U8CB 2IV8A 2NUTA 1ZV2A 4UM8A 1Z9NA 2UUDH 4X6EB 3RBSA 4W4NA 3FQWB 4JHBA 5LN8A 3K7UA 4K23H 2PCFB 3RKDC 2NNCA 3GEWB 4ZMZA 3OB8A 1CGVA 2O4EA 5FEBA 4LCWE 3TGXA 1IARB 2ZG1A 3DUHA 4QI3A 1RUAL 1OWWA 4XMLL 5A2BA 1JS4A 5SWZD 4G8EB 5D1XB 1JWMA 4H1LA 1T21A 5KSAB 1BM7A 5DZVA 2P26A 5KYUA 4XNZB 1DBAL 4UQ3B 1G7HB 2YBGA 3IDIB 3A6OA 3EOYG 5FDWA 2FQGA 3PAVA 1A7OH 3TNNA 1WBZA 1EQWA 1PEZA 4K94H 3WO4C 1CFVH 1VEMA 3BGFB 5GRXG 5AOLA 5FWRA 3WIFA 1XXFC 3MV7D 3D30A 1PKQE 3FQ1A 3LD8B 5TQ0H 5E08H 2UZXB 2HLAB 4MKTA 4OZ4B 1JUFA 4YO0B 1T5XA 3FSOA 4FG0A 4LSRH 4L3ED 3ZN6A 2NNFA 1T7YA 3QG7L 4P59H 4LKXA 2VKXA 4N90E 2A9DA 2YXMA 4XP4H 1WGOA 4WI9A 3HBQA 2PKDA 5SWZA 4P2RE 5FGCB 3GIVB 3O2VH 3EO1B 3G5XA 4JM2C 4MZ2A 4ES8A 1K85A 1XD1A 2HH0H 4AC2A 4FAAB 4EVNA 3V6BR 1K3ZA 2WTRA 3WE6A 2B1AH 2KZWA 3X12A 5BRPA 4IS6B 4AQ8C 2FGWH 5GISH 4RBPK 4GKSA 5CJOH 1AP2B 4TLKA 3SBPA 4PWGA 4E9VA 1MRFH 4HSAC 5DJZB 4YXKH 2D0GA 3PJNA 4ODTL 4M62L 2LLNA 1SHXA 2VITB 2YN3A 5JHBA 1XGQB 4L3EA 1ZT7B 1MIML 5KUKA 2ATPA 2XU9A 2VJXA 1N5YL 4EUPB 5E7FA 2XXFA 3QDJB 4NP4L 3HLKA 2BCKA 4R8WL 1M1XB 4MX7A 5H4ZA 5KW9L 4AGOA 5FB8A 4LDOB 1ADQL 2A4CA 1P69B 4HU8A 2KL6A 2HZHA 3GZQA 2WYTA 3TNMB 3O6FD 3PXLA 2WB7A 4BE6A 4YX2H 5DTFA 2MNUA 4EBQH 1S3KL 2A9CA 2W60A 1ASPA 4A7SA 4MA3A 5CS7A 1GCYA 1EO8L 3F05A 1RUPH 4LBAA 5T3ZD 4M9OA 1CBVL 1HDMA 3DPDA 1L4IA 2Q3XA 1FCCA 1KTLB 2Y2YA 4P46C 5FKAB 4K7PH 1M71B 4P23D 5T8IA 4MHHI 4WO4A 3SE4C 4XT1C 3ZZQA 4HV8A 5F7EH 5EWIL 4NZRH 1N67A 1BEYL 1PZUB 3DPBA 1UVQB 4KQ3L 2QDWA 3AITA 4PRBA 5F6IC 5E6SB 5F0JB 1W72B 1MCCA 5E4IA 3GUTA 5I15H 2K0RA 3K8MA 1KBVA 1QHOA 3D9AL 5EB9A 5IBLC 5IEKA 3B7RL 3O6FA 1HIMH 2VR4A 3MUJA 2VAJA 2EVGA 2XBTA 1ACYH 2AAVA 3QNXB 1RIUL 3NCJL 3ZT7A 5ESQA 2ADGA 1IGCH 1S7UA 4QOKE 5ALBH 4X4XA 3X14A 1TQCB 5IQ9B 5MENA 1EXUA 1UACH 3IXTB 4LL1A 4R96B 5SWSE 5EEWA 4ELDA 2AGJH 3QEGL 3EJSA 3H0TA 4XWOD 4NZ8A 3ORJA 2DKMA 2DM3A 1XF1A 1U30A 2WM0A 3NPSB 5CU9A 5T3ZL 2DLEA 5B1JC 4PJDA 5C0CD 2EDBA 1BOGB 3MOAH 2E8ZA 2Z3FA 3RY6A 1L5GB 5DZPA 2RAMA 4M7JL 2BMKB 3FRUB 2OZ4L 2BM3A 1RSFA 4UYPA 1OGAE 3VQ2C 1BVKA 4I0PD 3FT4B 3WKMH 3WO3B 3I9PA 5JUEL 4EJ1C 3HBPA 3UBGA 1FPTL 4OFPA 4WDIB 4P5KB 1CLOH 5CNHA 1AR1D 3WAKA 3O3AA 1R24A 4BQ6A 3SE9H 3VCLA 4JDZA 1XF3B 4GG6B 3ROOA 2D0HA 4DIXA 3VI4F 4M5TA 3TESA 2R2EA 3VFGL 1JPSH 1E8WA 5BMFH 3GJFK 3FAWA 3TXAA 2ZOKA 4X80L 4CRPA 4NLAA 4K9EL 1UKQA 2J56A 4RBPH 1U8NA 1QR4A 2YJQA 1O9WA 3IYLW 2OMZB 2Z7UA 4NAMA 5F9WC 4OSUL 4JFZH 3AT0A 2H6UA 3LKSB 1U8CA 4MB4A 2VXTH 4MNQB 3R0NA 1WCBA 1FNHA 4X6EA 3FQWA 3KYNA 3BKCH 4U6VH 2XA8L 5DRNB 2PCFA 1AOZA 4XVSH 2ESVB 4FNTA 3RU8H 4IOIB 3TCTA 4G8EA 3JWDH 1DQTA 4XAKE 5CHNB 4Z0BL 2BHYA 3UTSB 5KSAA 3NPZB 3ZTDC 1U2CA 1HAWA 2DD8L 3TPUB 3WU1A 4ZFFA 3FO1A 5D9SB 3IDIA 2Z1PA 4G6ML 1F4WH 4L4VE 4X8XA 5HYJD 1VPOH 1YHPA 2ZSWB 2CJUH 4RVBA 4E9WA 2DQDH 5KSVB 5FGRA 2Z93B 2R7EA 3C6SB 2UZXA 4KTDH 3VXUE 4OZ4A 4IRJC 1MFEL 2X2IA 4Y2DC 3V9FA 5DD1H 3D39E 3L9BA 3S36L 4H8WC 4DN3H 3GT6A 3QDJD 3GIVA 3EO1A 1J5IA 3MMEB 3O4LD 3UDWA 2R1YB 2YD4A 4QKXB 2NY5L 3KLKA 4Q9RH 2YN5A 4IS6A 2CHNA 1IB5A 3D34A 3V0AC 1AP2A 1XGRB 3D05A 1A47A 1G6VK 2NYYD 3EJUA 4OGYH 2X4UB 1T2JA 5KSBF 1RZKH 1Z6JT 4ZOEA 3II1A 2VITA 2FR4A 1XGQA 1ZT7A 1B0IA 1F8TL 4IIZA 1N8OE 4MMYB 4AE1A 2Q7NA 4OZIE 5E4AA 4PN6A 4OCYH 4HKBB 1J1XL 2FL5B 4PIBA 3OJ2C 4B9KC 3QDJA 3RP1A 2ZX6A 1M1XA 1QWHA 4KOCA 5AW0B 1QPPA 1UD3A 3DYMA 1C5CH 4NN6C 2E86A 2YGVA 1G7LB 1WAEA 2CCLA 3TNMA 2EADA 3TONA 5GJTL 3H42H 1JNLH 1OP9A 1QRKA 2HT2D 1CI5A 1WZAA 5DF0A 1HYRC 3QORD 5FXCH 4Z7UE 4FQPA 3VACA 3W81A 3LZFH 1YC8A 2EABA 5I82A 1VACA 1M71A 1FZKB 3OWRA 4ZO9A 1UCTA 4OJCA 3ZL1A 2ZKWA 1HKLH 3QJXA 1OPGL 4YVUA 2G3NA 3ARGB 3V0VB 1W72A 1FYTB 1QTPA 3MNWB 2Q0ZX 4NJAH 4QLRA 4NUQA 4L4TB 3QNXA 3QORA 1IKFH 2WGNB 2YRLA 2J12B 1A4AA 1E3FA 1W72L 5GIRA 2EIMB 5IQ9A 3TWCL 4ALAC 5L2KE 4R96A 3US0A 1K9TA 3IXTA 1R5IB 3HZMB 1EK3A 1VFBB 1DFBH 4WLCA 3CC5B 4KMTH 5ID0B 4U7MA 3ZL4H 4NZJA 5KVFE 1CLCA 4IBVA 4PUBH 4KKBD 3TZVC 3B9KD 5A1AA 1BOGA 2EH7H 3L3GB 5GRVL 2Z64C 3KPOB 2BMKA 3FRUA 4RZCB 4N0UB 3O3BA 3P69A 5H4YA 2EDTA 4DVRL 5ISZB 3FT4A 3A5VA 5CJQH 4X4KA 1V05A 3RFZB 3KJ6H 3NFNB 1O5PA 4ZMTA 1DVFC 4NCC1 5F6HJ 1CDHA 4BHUA 5KYXB 1BYPA 2ZCKL 5CUSH 1XF3A 4GG6A 1EFXD 4FD0A 3MLVH 1G4RA 2FT8A 1OSZB 1YEJL 1JI1A 5F3BB 2WKOA 2F74B 2G2RA 4P4KD 1ZLDA 4KY1L 2FT6A 3EF4A 4U3XA 1NWPA 2CA4A 3L4UA 3HFML 2OMZA 3QAQA 1HWHB 4WNSA 5HJBA 1QTSA 2BSRB 2IPUG 4ZUVB 3UROR 2OTUB 4MNQA 4FQQB 1QR1A 2Z92B 3WEXB 4LLMB 4AIZB 4ZMOA 5DRNA 2UX6A 3QISA 3VW3L 3GZPA 3AS3A 3WIAA 3T2NL 3HHRB 2VN7A 1ZA3B 3V2AR 2ESVA 3LTVA 4GQ9L 1DYZA 4W70A 4DFIA 4S1QL 1WT5C 5F88B 2VXQL 4IOIA 2P8MB 1B4RA 1QFWH 1JGLH 5CHNA 3KPRD 1W8EA 4KFMA 3TPUA 5D9SA 1GA2A 2YEQA 3WXVL 4GQZA 5AW4B 2ZP8A 2MPAH 4IU2B 4JFFE 3DX2A 4K7FA 4ADIA 2DN7A 4X7EC 4PYHA 3BWAB 3ULUH 4MDRA 5LKNA 4TF4A 4R7VA 3WKYA 1FH5H 3QWOB 3VXTB 1N9PA 3B2MA 5KSVA 1FG9C 1UCBL 4ODBD 4G82A 2Z93A 3FU8A 3C6SA 4OIBA 4OM1H 1BZEA 4GEJA 3HS0A 4LLAA 5GGRB 3V0FA 3U9UB 1KELH 6PAZA 4AJWA 3EO0B 5C6WH 2Z8SA 1SMAA 4NUGH 4X5QA 1R34A 3HRZC 3ZX1A 3RG1C 2YQ2A 4S10A 3MMEA 1KGYE 3BQUC 1TTCA 3N91A 2R1YA 2F7PA 1GY1A 1SEQH 2CQVA 2X53A 4WY7H 2H47C 3CHRA 4E0RB 4OQTL 3VGEA 2VJ0A 1NCDL 1XGRA 3FTXA 3ZJAA 2UWEF 1MQKL 3FCSB 2X4UA 3T5WA 4DH2A 2P49B 3PL6C 2VMJA 4YEEA 3UCRA 3FCBA 5EO1A 5C9JB 2OI9C 2ZXBA 3WGVB 1WDAA 1V27A 3PHQB 1RURL 4LVOB 3HR5B 4MMYA 4Y1AB 3DIVA 1DQIA 1I53A 4J3OH 4HKBA 1A6VL 4DGIL 2VDQB 3ZE0F 3CLEL 2CLVB 1UOWA 4IKLA 1L3WA 1WFOA 3TLRA 1QLEB 2OS7A 2EP6A 2GY5A 4GUQA 2Q3ZA 5IB1B 4QKTA 4TNVF 2XPYA 2YQ3A 3AWEA 4LVNB 1MHHB 1F3DJ 2X6AA 3UTZB 4NO3B 2H3KA 1CF8H 3PGCA 3WIHL 1DFXA 1KG0B 3IMTA 3ZDXF 2VO8A 3K81A 4DK5A 2KH2B 2OMYB 4FI7A 4PV8B 2H6PA 3B9EA 3FQ4A 2CJSA 3D07A 3FSVA 1T0OA 5DMIL 5E6ZA 1EVUA 1JP5A 2R39A 1N6VA 4KROC 1EXHA 1H6FA 1I75A 3QIUB 2DMBA 3VFOB 3F7QA 3RTQD 4FTDA 4U1NA 4DSYA 2BIIA 4GRWF 3ARGA 3MLXH 1FVCA 2XRAL 2KPNA 2BOCA 3U6XS 2YGPA 1I3UA 4RWYH 1FYTA 1AACA 1ZDSA 5AZ2H 1KC5H 3OPZL 2NX5D 2ZAHA 3IRZA 4TOYH 5CBEB 3D12B 4WFEE 3Q44A 4TSCL 4BFIB 3HNVL 5CINL 3RIFF 2Y06L 1ZLWK 1R5IA 2EIJB 2X10A 1VFBA 1X5MA 4Z3TA 4OZFG 3CC5A 2O5NA 3QRGH 5C8JB 5AW7B 4TRPL 1G9EA 1KCBA 1KV7A 4LU5L 3S3CB 4OKVB 1A3ZA 1PZDA 3N42B 2YAEA 3L3GA 3WEMA 1P5UA 4NUPA 3FH8A 4POZC 4RZCA 5KJRH 4N0UA 2K8MA 4AK1A 4U3SB 3MJ9L 1HQ4B 3MREA 5ISZA 4AMWA 1AS6A 1QA9A 2YPLB 3J8F7 2ZKHH 2F53D 3RFZA 3NFNA 3VDBA 1G9MC 4JG0L 1ZVSB 3LS4H 3O3DA 4UNIA 1FZJB 3PCYA 3VJ6B 1SUHA 3ZDZB 1C7SA 1L9RA 4GPVA 5KYXA 4H40A 3NZHL 4WCYH 1CXIA 2F7IA 1PTZA 1T66C 3FK3A 2K70A 4Q58C 5DEZA 3VU2A 4A2FA 2H2SC 1NCAL 3FU7B 1OSZA 4KTEL 3LNHA 3U4BH 1LEKB 4B6ZA 5IQOA 2F74A 2F5BL 3OKDB 1SZNA 3U4AA 1TPXC 3ZQXA 1FL5B 5EOTA 4ODHH 3LEYL 5G4NA 1KCSH 1UH4A 4PV9B 3QW9A 2C4XA 4MAZA 2BSRA 4ZUVA 4XMUA 3EYFA 4MXQC 2F53A 3IDMB 3L3OC 1WFUA 2Z92A 1KN2H 5HJ3B 1NGPH 1AKJB 3WEXA 1SRDA 1MIEH 4LLMA 1UH2A 4AIZA 1CYXA 1IEHA 4KQ4H 3UMNA 5TE6H 1SEBB 2XSKA 3REVB 1ZA3A 5F88A 2P8MA 2H3NB 3MLSL 5EFIB 2VDPB 2ZYIA 5CGTA 3SKJH 4Z7WF 4Z3FA 4Q14A 4FFVD 3W2DL 5L88L 2AXHA 2Q7AA 3EJTA 3FUMA 5FO9A 1E2ZA 1U91B 2EIDA 4IU2A 1UWEL 3GMNB 1OWRM 1JGEB 3G9AB 5HI4D 1AGDB 4YPJA 4FXKB 4YL4A 1F00I 1HESA 2APSA 3VXTA 1T2QL 2V9QA 3UAJD 2Q5BA 4CC4A 1CIUA 4IGBB 2OTWB 5GGRA 1A5FH 5DGQA 2AKRB 3UTPE 3WSQH 3DVNB 3U9UA 2JJWA 4BELD 1E4XH 3EO0A 4Y1AD 4IHBA 4XXDB 4NNYB 2Y6SC 3PP4H 4UAOB 1I7RA 3VSQA 3AUVA 4A68A 3QNYB 4LDCA 4LSTL 4UDTB 4NM8H 2LW3A 5C0DB 3GLDA 1JFHA 1U92B 4X2UA 3ZRCC 4GSDL 4LIQE 4E0RA 4OCSL 4PB9H 1LILA 1T0MB 3P0GB 2IXQB 2W0LA 1ZLWH 1R0AL 1CMOA 3FCSA 3UABA 3A23A 4JO1H 4LB8A 5AQ0A 4V2BA 4QHKJ 2ADIB 4AXWA 5C9JA 1CBJA 4DP6X 4OT1L 5B1KA 5G55A 2OZNA 3X3FL 4WI4A 3HR5A 4Y1AA 3QIUD 2CDGB 2HVKB 5GHWH 1SFHA 1PG7X 2C3VB 3DX1A 2XTJD 4JM0A 2YSSA 1PD0A 5J6HB 3FQXB 1BZQK 2CLVA 3MLYH 4MVBD 3IN2A 1NEUA 5SWZE 1GGUA 3S2AA 1VHPA 2Q2LA 3C9NA 2Q10A 3DHJA 1CGXA 4UTAH 2H32A 3RVUC 5I0DA 3V4PB 2YFOA 5IB1A 2I60L 4OJYA 2P4AB 1DLHA 5GRZA 3O6KL 1PNDA 2J8UA 3BH8B 2R2CA 2VN3A 5K9OB 1L0PA 1LK3H 2JB6B 4OIFA 4XNQB 1IC7L 2VT0A 2J5LB 4GW1B 2PR9A 3UTZA 4NO3A 3VFMA 3MOQA 4W4OC 4GXVH 1QACA 5ICZB 4PJIB 1MCIA 3S37X 2BSCA 3DIDA 1QW8A 5MENB 2OMYA 1S5IH 5ES4B 2ZWKA 3HBZA 3ARDB 5D2LB 3LJ3A 1HZHH 2CGYA 5GGQL 2B2XL 4KVCL 3QIUA 4NWTH 4L3EE 1MCSA 3VFOA 1RZQA 5IB2B 4GMSL 1ZOXA 4UV7H 5JW4M 4ONGH 3FCGA 4KPHL 3CHQA 3MRHB 4S1DC 5FDYA 4KMQA 3CN4A 2ICEB 3ELAT 4P04A 5CBEA 4HK3J 4NKMB 4ZYKB 2KLSA 4G7YH 3TCLA 4UNUA 4LQFH 4BFIA 3CZGA 5HVWA 1AHMA 5JW3L 1LO0H 4WO4C 3OJDB 4IQHA 3FO2B 1I7ZB 3V6FB 5JORB 1BAWA 5SWQB 1YJDC 4M02A 4OF5A 1UM4L 3ABMB 1HE8A 4OKVA 5GS1B 1GYVA 3LPPA 4ZDHB 3CGTA 3EUDA 3EJQA 2MQCA 4JZJC 3SJVD 3NCCB 3NJLA 2QGEA 2GT9B 4NLHA 1TXKA 4P9MH 4XMKL 2R9HD 3O6FC 2OJZH 4U3SA 1HQ4A 1J5HA 2QGDA 5FM8A 2O6CA 4JG9A 2DF3A 4IBSA 1HTYA 1ZVSA 3VJ6A 3GBDA 3U25A 4UQBA 3B83A 4C8XA 4PJCB 2DWEB 3F2LA 2JI1A 4UT7H 5MENE 4B5ZA 1KGWA 1U33A 4OGAD 4XAWL 4HFWA 1LEKA 3NCMA 4NNXB 3OKDA 4HCFA 2DKUA 3SJVA 2VR9A 1A3LH 4PJDE 4PVLA 3TVMB 4LARL 2G5UA 1DJGA 4LASL 4PV9A 5E8PB 4YWGH 3PWUA 4KGLA 5JIDA 1ZLEA 1GGBL 3QCVH 3VXMB 4AYMC 1PPIA 5HJ3A 1AKJA 2I85A 2JIXD 4OTXH 4XWOC 3ATAA 3VUAA 4HWZB 4XTRD 4BZ1H 4MWFB 3REVA 2PXYD 3FRPB 1MKFA 4D7BA 4P5TB 1U21A 2FLRT 5F96L 4AG4L 2H3NA 2JQAA 4GKNA 5I1EL 1AY1H 3AY2A 3CK0L 4TQEL 3TCXA 2BDNH 2CBTA 2DQCL 2A6KB 2J1ZA 2OX5B 4LSSH 3SGEI 1CD1B 1U91A 5F7YC 1TEYA 3NA9H 3UGUA 3GMNA 1JGEA 4CA4A 1AGDA 4HG4K 4FXKA 2APTA 2MEJB 4OCRL 4UF7C 4JHAH 2AW2A 2OTWA 2YD5A 5EORH 5TPWH 3RPIA 4OIIH 2AKRA 1ZTXL 2XN2A 3DVNA 3LZRA 3SCMB 5FECB 3I50H 2PXYA 1CLZH 5D1XC 1XGTA 3P9LA 4DNLA 1YNTF 5KSAC 1U41A 4RDQG 4XNZC 5HJDA 1KIQA 1X5KA 4GQPH 3CBJB 3MZTA 3QNYA 3KVQA 3S3BB 5HPMA 4Z23A 5D1XE 4HG4J 1U92A 3B9DA 1U8QA 1M3IA 4XVTL 3BGFC 1YQ2A 3IFNL 2J72A 2C4FT 1T0MA 2YD3A 5C0RL 2GUOB 2IXQA 3A67H 1OP4A 2L04A 4L9LB 5EOQH 5D6CB 2PP9A 4KAQL 3SY0B 1MELA 4YE4L 2ADIA 3W3BA 3T8XA 4PI2A 4Q6YA 1K6QH 3AU1B 4A6YL 1OOWA 1CJYA 2DM2A 1X9QA 2HVKA 2X88A 4HMDA 2C3VA 4HAFA 3L4VA 5F7AA 4OU3A 5J6HA 1EMTH 3LY6A 5E2VH 3UJIL 3T6ZA 3QI9D 4M1GH 5I1CL 4HWBH 1TJHH 3GSQB 3GKWH 3V4PA 2EDWA 3U30B 5K9OA 5F89B 3BH8A 3TOPA 1X4YA 2JB6A 3TBSB 1GGTA 1ZIAA 3LRMA 1FH2A 4XNQA 5AVVB 3ZOAA 2QTVA 5JA8B 1URIA 4M43H 1J87A 1NCBH 2AJYH 3V4PL 5FUZL 1N19A 4OD3L 4X99B 5DUBB 3T3PF 3V5KB 5IFHH 1NMAH 1JTPA 3BUDA 4HIEB 4Q0XH 4J8RA 1BWWA 3VD4A 4NGHL 3HI5L 2BS9A 5D2LA 5FIEA 4BKLB 2F1BA 4DK6A 3RY4A 1INDH 2IFFH 5E0FA 5IB2A 4K3JH 5I6OA 1DZ0A 5HYSB 1D6VH 3HZYB 3MRHA 5GRJH 4YDKH 3QDJE 3QI9A 4JREB 2ATAA 4N2NA 2I07B 4NKMA 1QQDB 4RRPM 1QATA 3AG2B 4DAGH 3GHPA 4YDIH 2HFFB 2R1XA 1CCZA 4HKZB 5FOJA 2FX9L 4IHOB 3M07A 3OJDA 3FO2A 5JORA 5SWQA 1C1EL 5DHVH 4H8WH 1XHHA 4UIKL 4A04A 1A0QL 1VA9A 5GS1A 1SDYA 4N2AA 4PY8J 3WFBH 3SBWC 5BOZG 1B4TA 4Y1SA 3TVMD 2GT9A 1NCIA 3ZTCC 3QZOA 4NZUH 3L9EA 5E1QA 1KACB 3SGDI 3QEQD 4OAWB 1KEGL 3B2PA 3VXMD 1TQCC 3S6CA 4GYBA 1GGIH 4AVHA 3FW6A 1OB1B 3MRQB 5A2JH 1R3IH 4KRLB 1WS7A 1JZ4A 4PJCA 3SQOL 4AJVA 4HEMA 1DJYA 1RMFH 3NPSC 3OAUL 5H37A 4IRZA 4W9ZA 2GQHA 5JZ7D 2ATKA 3HAEA 1EAJA 4WWPA 5GXBB 3RX7A 4X4YB 4QXGL 3KYKH 3MV01 1V55B 2J1KA 4NI6A 3W0WB 4IRZL 3H9SB 4U49A 3TVMA 4KC3B 1IQDB 3BRGC 3IS0X 3W37A 5E8NB 3VXMA 3NJFA 4UANA 4DGVH 4R3SB 3GB7B 4MS6A 1AZCA 3L54A 2QHRH 4Q7DA 1XBRA 1CDJA 3CN3A 5JW4Q 4HWZA 4MWFA 3WNLA 3FRPA 1CWVA 1TJMA 2YAFA 3T3ME 4DKTA 1JZ3A 4GG6E 2NY6B 5E2UL 4N85A 2J6WA 1EGJA 4E41B 4LEEA 1G1CA 3OKYA 2OX5A 4JRFA 5KANG 1CK0H 1CD1A 1BAFL 2OR9H 1G9NC 1S8DB 2NSXA 1JZ5A 3KPNB 4YSCA 1RUMH 3K8KA 5K1JA 4OCLC 2V5YA 1SN2A 3GIZH 2GSGB 4UQIM 3L2NA 2JJTA 5KVFH 1RPQA 5DFWH 4ALAH 3LXUX 3MUGA 3B5HA 3D4ZA 4WHDA 1HCYA 2JLLA 1RUQH 4MNQE 1VGEL 4LRIA 5DS8A 1N6QH 5FECA 1J8HB 2EDNA 2IBZX 5ABZA 2IH1B 3OX8B 3W5MA 2AK1H 1ZGLM 5I8OL 2W59A 1BQSA 2ESVE 1MFBL 4ELKB 4XMPL 5HDQL 1KNOB 1P7QB 1R5VB 2X40A 2CBPA 3QEHB 1UASA 3UTSE 4KDTA 2CHWA 4A7UA 2ICWI 3SGKC 3EG9B 3VMPA 2GC7C 1RAMA 1PD6A 2GUOA 3ZYJA 1F13A 5LGYA 4L9LA 1XIWD 1AE6L 1BQHB 5D6CA 5DQDL 2BNRB 1JD9A 3S96B 1P4LB 5CSGA 1TU2A 3B5TA 3EYVA 4PREB 2GB2A 1TVDA 1AI1H 2NW2B 3TT3L 5L4JA 5BJTB 3F7VB 1SBSL 3IB4A 3AU1A 3NJNA 1DLFL 3THMH 5C3TA 3BAEH 1ZHNA 1I1YB 3TJEL 3UC0L 2OSLB 4AGMA 3DDGA 1GYCA 5DURB 1DQDH 2I25N 4Q8BA 1CICB 2YAMA 3HE7D 1A9BB 2VLLB 4H26A 5JO5B 3GSQA 4CU8A 1JXJA 1SJMA 3BKYH 5HTSA 1MCHA 5F89A 2OSXA 2ADFL 3TBSA 2YIHA 1XIWA 4ETYA 4UTBH 4QCIB 5FS5A 4GFTB 5GGVL 1PLGL 1MG3C 5DUBA 1MCWM 4X99A 4YSRA 3V5KA 5IHUL 4A2EA 1YVLA 1A22B 4FQJH 1M2VA 4ZO7A 2E74C 1VSCA 5IHZA 1PL3A 1NKGA 4FLSA 4S2SA 5HYSA 1BYOA 3EXJA 3HZYA 3QQDB 5KSBA 4ZTPL 1YAZA 2F18A 2VN6A 2F15A 3P4LA 4PRIB 2L7JA 4LSVL 2VQ1B 2DQEL 3BKML 3F7PC 1EZUA 4PS7A 4K5MA 4DUWA 5C2BL 1OM9A 4LVHB 4QRSB 1WA0X 1MLCB 2BY1A 2OSYA 3OWEA 2VDNL 4ZAKD 2FQDA 2J8OA 7PCYA 3E9UA 2DLTA 1P4BL 1KBBA 3FUDA 2Z34A 4EQ3A 4BUHA 1O6SA 3ESNA 4I13B 4QXVA 2OCFD 1KB5A 3ARGC 2JELL 1NDMB 1NGYB 2WAQA 3H9SD 2WJ7A 2BPBA 1K8IB 1UD2A 2WC7A 3FTSA 1KB5L 4RAUB 3N43B 2X3CA 4OAWA 4JANB 4W9HC 3UP6A 5IV2B 1FYTE 5B38G 3DK0A 1PS3A 2QQKL 2C8NA 1OB1A 1MW3A 2IDSA 4L4TE 4U6HB 5AD0B 1G6RB 4PI0A 5FO8B 1SYVB 3R06B 1XGYL 1UOLA 1YEEH 2NY6D 3ARPA 3G08B 4GAYB 4NWUH 5I26A 2GHZA 3FTYA 4X4YA 5T1MB 5I0XA 1MRDH 1E4KA 1P5UC 4E41D 5E70A 2H6OA 2XBZA 4WI0B 2J4WL 2VZ3A 3TH4T 1IILE 5I1JL 3GLZA 1ZV9A 1WFMA 3H9SA 3LIUA 5IVNA 5I8EB 1OXYA 5LWYH 3RFZC 4MCZB 4IBZA 4BUGA 4GSRA 4BH7B 1MCQA 2NY1B 4PBVC 3QG6B 1BMZA 5F7KC 4UNVA 4N0UE 5E8NA 2YSTA 4AIXA 7FABL 3CMOH 3L9YA 4R3SA 5ISZE 4Y7OC 1DBJH 2ENJA 2QPFA 3VX1A 3QDGB 1CR9L 1OCWH 3TO4B 3OAWA 2PPCA 2ZIDA 1FFOB 1X5ZA 4YL9A 4M61B 1MJUL 4B95C 1PLBA 4ANKA 1J9QA 1WFJA 2B39A 4J3XA 3MRPB 1M7XA 4NKDB 5DA4A 3CLWA 5HVHB 4E41A 2WLMA 4P3CL 4QY8B 1JBJA 4H5SA 1J7VR 3GXPA 4LLUA 3KPNA 2HFEA 2HRPH 1YQVH 1HXYB 2GSGA 3VMOA 1EBAA 3KLAB 3BN3B 3ZMRA 5HDBB 3QIWB 1ODUA 4FULA 1PYWA 3MCLH 4PRDA 3X1NA 4GAGL 2DEYX 1B0RB 3RHWF 1J8HA 2WAHA 5BVPH 4HXAL 5FK9B 2YARA 3LAFA 2FBJH 1TTBA 3OX8A 5CMAA 4JY5L 2E6PA 5DMKB 4ELKA 5DURD 3ZYOA 1KNOA 3AZUA 1CICD 3UCQA 3MV8D 4URTB 4M5YL 4N1HB 1XF4B 1A6UL 5E9DB 4JKNA 2CWRA 4CC4C 1G9MH 2GCYB 1BQHA 4Y4KB 2BNRA 2ITEA 5AL8A 3R8QA 2XN1A 3NFPB 4PREA 2NW2A 5FF6B 2OL3B 1QI5A 4DCQA 3EXLA 5G4MA 3F7VA 2G2NA 4RSYA 1U8JB 1YEFL 1OT4A 3V7MA 1JZ6A 1WWWX 4YHKL 1A02N 4U0QB 4ZW3A 5CP3A 1I1YA 3HLAA 4FFVC 2OSLA 1S9YB 1S9WA 5JPMB 1IJ9A 1OCOB 4X7DC 5DYOA 4PS4L 5EC1B 4BDVB 2WZPD 1DEDA 2ENYA 1CICA 2Y22A 1A9BA 2VLLA 3DMMB 4Z3IA 2ICWA 3LKOA 5JO5A 2AI0H 4XCYB 2ZICA 4A66A 2XNAB 1S7SA 4X7FC 5FYJD 4U3HA 2GJ6D 3SD2A 1DCEA 4LLYA 1BD2B 3DX9A 5B39A 4QCIA 5I71B 1UKSA 4Y4FB 4ODVL 2Z6FA 4LVOC 3WJMB 5K9QG 3Q2WA 3QQ9D 2CXKA 4QMEA 5D7SH 3UBXI 5C0AB 1TQTA 3U46B 3EZ8A 1G7MB 1X9RA 2JKIS 4M8VA 4W9FC 2JMRA 1IGTB 2G60L 1CURA 2CNYA 2EO9A 4NSKB 1TR7A 4UINL 3ETTA 4Y1AE 5DC0A 3QQDA 3IJYB 4I3RH 4XVUC 4W68A 2FNWA 2WZPA 4OLYH 2VQUA 5CJ8A 1AO7B 1IBHA 2CE6A 4LVNC 4LL4A 2VQ1A 1TNNA 4UB0H 3LVTA 3GMLA 1OAUH 3STZB 5I73B 3B1TA 3NSJA 2GJ6A 2EZ0D 3A6CL 3DHMA 1SF3A 4QRSA 1CDUA 4QYAA 4P57B 1MLCA 2ROXA 4S1SH 5FAAA 2DJUA 3BD5A 4YSUA 3GS7A 5FLUA 5FYJL 3QIUC 3WDIA 3DGGA 4NJ9L 4H1LH 4ZS6C 3UBXB 4J3TA 5G5DA 3Q8AA 1TQWA 4LIQH 1NDMA 1UD6A 2WXGA 3H3PL 4MVBC 4YC2B 1NGYA 1OAKL 5AENA 3C6EA 5DVPA 3AT8A 1K8IA 4ZD3H 3FH7A 4JANA 3O9WB 2EVJA 2UZPA 1BQRA 1UXSB 3TFKC 2FO8A 4UT6H 4KV5F 1N3NB 4D9QD 1JWUB 5IB3B 4KI1A 4JJ5B 1UC6A 4U6HA 2E27L 3O6LH 3W9DA 5AD0A 2ZNXA 4M5SA 4E9SA 2IQ9L 1HNFA 5JW5B 1SYVA 5FA3B 4OGXH 5TD4A 3WLWD 5E5UB 3R06A 1CB4A 4WW1A 2SEBB 2Y4SA 4K2UH 4GAYA 2B0SH 2Z9TA 3N9GL 4KKCD 5T1MA 2E7LA 2VIRA 3L81A 4ODTH 4WWKD 5D72H 1A9EB 4OLWH 4HISA 3M6DA 4HS3A 3ZY7A 5HHXH 4PJHF 2VM4A 5PAZA 4E42B 1M53A 1DQVA 5I8EA 4MCZA 2GK0B 3SDAB 4BH7A 4JPKL 3CFCL 3QG6A 1OT2A 1ND0B 1RK0B 2K9FB 1IGIL 2YPLE 1NZRA 2E3VA 3Q8BA 4GRMB 3AU0A 3UJJH 3LNEA 3ZDZE 3TO4A 1SVBA 1FNLA 2FTAA 2VXUL 5ERWB 3DNKA 3MLZL 5I6NA 1W91A 5TFSL 2VLRD 4DPAX 2AJ3B 3NVQA 4Y5XB 1DANT 4NKDA 3TO2A 2J71A 3U1SH 4XPHL 5FYKD 1HNGA 1AZRA 2RJMA 5CN2A 4QY8A 4XMVA 3ZKMD 4JN1H 1MWAL 1IT9L 4FC3E 5E9DD 2UV3A 2WLJA 4YZFE 3PWPD 1S6NA 4PPTA 5LDUA 3BRFA 2AZUA 1OK0A 2P43B 4MRBA 5BV7B 1A1MA 3QEUA 3NSCA 3HC3L 3KLAA 5I8KL 3LZQA 3QIWA 2COVD 2VM3A 4KY2A 1OSPH 4UT9A 3KS0H 4OGAC 4PWJA 1RZJL 2W9EL 4YSAA 1YJDH 3HI6H 2GJJA 3KPLB 2G4EA 3X11A 2VLRA 2BP8B 4ADGA 1RIUH 4JO4L 4UT9L 3VMNA 5DMKA 4GLRI 3LH2H 5GZOA 1RPUA 1T3FB 3DMMD 1UM6L 1ETZB 3QEGH 2VLMD 1XF4A 3UZVB 3IWUA 4FXKC 5E9DA 5IUSA 2XJKA 3EFOB 2PWFA 1JXDA 3P0YL 2YD8A 3ZGIA 4IGBC 5GSVA 4Y4KA 2OULB 2HN7B 1WSST 2R4SH 1Q0EA 4Y4FD 2HKAA 3OKNA 4R5XA 5FF6A 2PXYC 1BQLH 4XO3A 4Q97A 2B9AA 4FZEL 3CPLB 3QUYD 4UAOC 3NCYP 4C47A 4GJTB 1JZDC 4PSPA 2VDKH 1FPTH 4FQCL 4XN5A 2IH8A 5DUML 5EC1A 3N06B 1PFOA 1ZGLP 1AO7D 3DMMA 3BEWA 2R69A 2VZVA 2M1KA 2E56A 4XCYA 2V5RA 5A2IH 2XNAA 1U3ZA 2HPTA 2FZ3B 2XQYA 4E2OA 4PJ5B 5GZND 4JPIB 1BD2A 3ROLB 2R69L 4FHKA 4Y4FA 4PS8A 3WJMA 4Y8AA 4F2MB 3FTGB 2AZAA 4Z7VF 5DHEA 3AGWA 3WDJA 1JCVA 4N2OA 3U46A 2B7DT 4L0ZA 4AYBA 3HEIB 1C16B 4F58L 1IGTA 1G4MA 1YY8B 2GFBA 3P73B 3Q2VA 3EH5B 1L9PA 4FXTA 4NSKA 4WENB 1SM3H 3IJYA 1N59B 4BKTC 2FHCA 4LCUB 1JRHL 3OHMB 4BA8A 4N0YL 1AO7A 4YLBA 1I1FA 3QPKA 3WEOA 2IBGA 3O9WD 2EYRB 3OKKB 4N25A 3STZA 3E80A 3ZYIA 2WOYA 2J5LC 2N7AA 4MAUL 3QULB 4MD4B 1N0XH 4J27A 3IMBA 1VIWA 3B3IB 4F15B 3RGBA 2F08A 2FJHB 4PJXB 1IBBA 5D71H 2FECI 3ARDC 3VD3A 2YAHA 3ZK0A 5GRVK 4KZ0A 3WAJA 3LHPL 4PJIE 5C0BB 1XF2B 4N0CD 3UBXA 4H25A 3BZDA 3QXVA 4E9XA 1SQMA 5D2LE 3QFJD 5LJYH 2R0WL 3IDYB 4OM0L 4GXUN 4N87A 1YMMD 1EO5A 5IZ7A 1DTUA 5AWNH 2BX5A 3MJ8B 2WZAA 4O58L 1JDCA 3D4YA 1MI5B 3O9WA 2NY0B 3TIEA 1IE4A 5H35B 3IBOA 1UXSA 1V7NL 3EOBB 4HGKC 4H2AA 3VTTA 3N41B 5IB3A 3EBHA 2AQPA 2FX8H 1OSEA 2E4FA 1IKOP 2Y23A 4JJ5A 1T5KA 2MFNA 4NKIL 5JW5A 2CLRB 5FA3A 2NSQA 2UY6B 2BFVH 5GS1C 2SEBA 3G9VA 1EJ8A 1O6TA 1Q0XL 3ARWA 4F7KA 2AJSH 4J3UA 1KEMH 2XACC 1A9EA 4HS8L 4H20H 1YMMA 4HSQA 4E42A 3G5WA 1TZGH 3T1WA 3DROB 2DQMA 3TBWB 1DQJB 5HVGB 5ABDE 3OSVA 2MKLC 5EN2B 4NXSA 1F8TH 6FABL 1ND0A 4HIIB 1SY6L 3CWGA 1WICA 3P9MB 4X0NA 3WNNA 5EEVA 1AJ7L 2OMTB 4GRMA 2AEPH 2AJVL 5ERWA 4PJCE 4EUPH 1JTTA 3KD4A 3AY4A 5HSFA 1MFCL 4HEME 3BDYH 4FQXB 1Q8MA 1OE1A 3C08L 4JFSA 5KVGL 3TVMC 2FEEI 3DUSB 2P5WB 3BVUA 5FWQA 1UM5L 2XQBH 4I3SH 5F0MB 2B59B 4F37K 4HCRA 5IEHB 4HEPG 5IHBA 2X4SB 2X87A 2P48B 3F04A 2CO4A 1QX1A 1OPGH 3SYQA 1X6LA 4NBXB 1B4JL 1AS7A 1DSWA 4N2GA 4HCRL 3VXME 2BZCA 4Z78A 4KHXL 4P5TC 1BF2A 2H4EA 3H8NA 4YNYB 3KWWA 3QYCA 4OCWH 5GPRA 4KI5F 1A7NH 3B8YA 3KPLA 1Z5LB 3MFGB 4XP1H 5LBSA 2BP8A 3OAYH 2BVUA 2IO5A 1W72H 2VC2L 3GRBA 3SQRA 4JDTL 4AC4A 1T3FA 1X5JA 3IEAA 1N12A 5B39G 2OSWA 4GSUA 4B27A 1FJ1A 3F00A 5LG6A 1ETZA 1KJMB 2DQUH 2Z7WA 5ID1B 5LBSL 3UZVA 1ET7A 1KB3A 5DXWA 3DO7A 2JJTC 4X4MA 3EFOA 3KCPA 1AR2A 4RMUA 4EQ2A 3LH8A 2HN7A 5EUOB 4LRIC 2RH0A 3ZKNC 3SCMC 3AQZA 3VXQA 3X2QB 3AW5A 3RGVD 1Y0LB 4Y2NA 1TENA 3V4UL 3KM1A 3MPCA 8CGTA 2EE3A 5T1DH 1TEFA 5KSUB 4N2IA 5D7LD 2GABA 5AVSB 2HJFA 4KDTC 1EAPB 2ZCKH 3QXAB 2EXTA 5F72S 3Q1SL 5MEOB 3K72B 2N1KA 4NM4L 4ACPA 4L9LC 3QS3A 3OMZA 4FZ8L 1CGTA 1YEJH 2FEDC 2ITCA 5C2UB 1LQSR 3P3TA 4JPIA 2H1PL 3FZUC 4IDJH 1FNGA 2UX7A 3ROLA 2D9CA 4JFXB 1F97A 4JY4A 1L7TL 2ZX7A 3RGVA 4F9LA 5IHHA 3FTGA 1AXIB 3ZKXB 5DMYA 1SGKA 5C0BD 3QJQB 1NFIB 3RAJH 4FTVD 3PLYA 3GMPB 4MSWB 4ZRGA 4FQ2L 2WBJD 1C16A 3OKOB 2JKWA 1A7BA 2Y7NA 3M45A 5HY9B 1N59A 3JVFC 4R9HA 1A6AB 1IGML 4WGVB 2DB8A 3U30C 3VW3H 1G9NH 3APDA 3NG5A 4P07A 3MRMB 1MWOA 5E6YA 2WXQA 3S35X 2NY0D 4GUOA 2OFQA 4YAQB 3DSFL 3OKEA 4RNRA 3QULA 2N4IA 3LEXB 1C8QA 3WN6A 4LGPB 2HTLC 4ORZC 4JVUA 3C6LB 4LP8A 4R90L 5JDJA 1PG7H 2VYRE 4U4BA 5D7JB 2FJHA 3ASOB 4LFHD 4PJXA 3DUUB 3GEFA 3V9CA 3NIGB 4ZUUA 2W9DL 1E9OB 4NHCL 4JHZA 4PJFB 5C0BA 4TUJA 1XF2A 4PLOB 5GJSH 4XX1E 4KVNH 5C6TL 3BSZA 2IPTL 3BW9A 4PJ7B 1INQB 1MCEA 1NGZB 4N3UA 5C09B 3S37H 5KS9F 1F02I 3OR6A 1FNFA 5HVFB 2VGLM 2AJXL 5H35A 3ATFA 1HQRA 4O5LL 3DBXA 3EOBA 2A3TA 4WW2F 3SN6N 4WZ9A 1I3GL 1KJ2B 5JYLA 4BJLA 4PLKC 5F9DC 2XI9A 2WSDA 1E5BA 2X7LB 3AFLA 3QYNA 2CLRA 2XWBA 2UY6A 2DZEA 5A2AA 3KBHE 4ZXBB 4FQXD 2A0LC 1NPJA 1NCDH 4FQLL 4XOCA 4JQVA 2FECL 1W6WA 5BO1L 2NY4D 1FYHB 2I5YL 2CIIB 4HFUL 2LLGA 5JIPA 1BIIB 4MAYB 2WWOA 3RIAF 1WQVT 3ERXA 3QHZL 1ULVA 3DROA 2NNAB 5E9NA 5L4IA 3TBWA 3P0VH 1JZHA 4GP5B 5EN2A 1Z3RA 4JVWA 7TAAA 4HIIA 2FH8A 2MCMA 4LESA 3P9MA 3U1QA 1FUNA 2OMTA 4GMTL 4AW7A 4M4RA 4HALA 1S78C 4PV1C 4XO5A 3TWYA 1E4KC 2WXMA 4FQXA 3CLFH 5A2FA 3FJTA 2WWNA 2UY7B 3DUSA 4XWGH 4P2OB 4XN2A 4XPAL 1IO4C 3WEAA 2B59A 1EO7A 1JZEA 4NKOB 4OD2B 5IEHA 5F9OL 1P7KB 1R3JB 2KQMA 1VLXA 3DV4B 3H9SE 3P9WB 4F8OA 3ULVF 1E28B 4LO9A 1OE3A 2XTSA 4PJGB 5HPOA 4L8CA 4IRSD 4U6YB 3ZHKA 1F56A 3FN0H 4HPOH 5E03A 1N0LB 4NPKA 1GW0A 3IT8D 5GGTL 1F11B 1RIHH 2NY6C 4YNYA 1BFSA 1RZ7L 3L45A 3OPZH 5HI3D 3IK2A 1Z5LA 3TBVB 1KOAA 2PWEA 3HNVH 4X7CC 2WO2B 2KS0A 3HKZA 2IGTA 3HC4L 4ISVB 4LF3B 1IGYB 1KJMA 1CFBA 3NFSL 4E41E 3SDDB 2A1WH 3QA3B 4YPGA 2R23B 1IKNA 3ZZLA 4YMPA 5I23A 1LNUB 5EUOA 4ODXB 4OLUH 4L1HA 2Z35B 5FGBA 3O4OB 4IRSA 2ZQKA 4HUWB 4C83B 3E0GA 5KZCB 1Y0LA 2GI0A 2JK5B 4QHLB 3SE8H 4M8UA 2Y07L 4R7DB 3OZ9L 2D8KA 2C7UB 4JZNB 5CZVH 4NQQA 1J8HE 1PDKB 5B7FA 4OZGF 5DFVD 5BPPA 1WWCA 1EAPA 1WFNA 4HUUB 2FNBA 2PF6A 3QXAA 5HYFA 5FFGA 3K72A 3TT1L 1R4XA 3SO3B 5DUPL 4L8DB 4P99A 1NCAH 4AGLA 3C8HA 2A5UA 4FFYH 3BYTA 2AV7B 5DRXA 3WOVA 4Y19B 4G9FB 5HYEA 1GJIA 1H6TA 2NXYB 3C6LD 1FAIL 1NBCA 2E9JA 2XWJB 3NK3A 2V5MA 4JFXA 2IC2A 2BNRE 3LEYH 4ADJA 4NN7B 2X4QB 2R29H 3WD5H 5L9DL 4HOXA 3GMPA 3RYMA 4LAJH 4MSWA 3L1OL 4X5WB 4FNLL 4B0MB 4EUPG 3OKOA 1CICC 2C7FA 5HY9A 1HU8A 1ADWA 4B9YA 2NRDA 1MCOL 1A6AA 1HHGA 2EDLA 5I74B 4S11A 2Y5TB 4PGEB 1MJ8H 1XCTB 2OXHB 1U8PB 5SV4A 2FSEB 2R83A 3ECVA 1I7TA 3P4MA 1HJBC 3TBTB 2Y7QA 5CN1A 1AMYA 2IAMB 3LEXA 1XAUA 2HCZX 4UOZA 4JHWL 4ZBJA 3C6LA 5DJ6B 2IDTA 2R2HB 2KC0A 5D7JA 3K4ZA 4APXB 3DUUA 1KPUA 1XR9A 3LRSB 4V1DB 4H8HA 5KBNC 5HD8D 3F7RA 4NZTL 4EN3D 3T6WA 1Z32X 2LVEA 5IJDC 3MBEB 3L7EB 4WI8A 4TVPE 4LSUH 4WVRA 4X9GA 4JFPB 4DP9X 1KFAL 4LMQE 1CXKA 3NRQA 5DK2A 5GGUB 2K78A 3L3DB 1D5BB 1NGZA 5CBAB 4AE0A 3NQIA 2EDOA 4BFOA 3GINA 1T04B 2VDOB 5EU6D 5LNEA 3QUKB 1A4BA 4LVHC 5K39A 4EXKA 4PRIE 4Z76B 5LAXB 4PJ6A 5CAYB 5IP4A 5B22A 1KJ2A 2K8QA 3GC3A 5FYJE 4LSDA 2AABL 3ZE2F 3QQ9C 5DHYB 3CN2A 2X7LA 5KVMC 2JKJA 1C5DB 4EN3A 3QBTB 2AANA 1DVYA 2DL2A 4ZXBA 3ETBJ 1R5WB 1RK1B 2XWDA 1A66A 3MACH 2IDUA 2X4OB 1LEIB 3H53A 1MZZA 5HHNB 1WK0A 1REIA 1IM3D 2QFRA 4BK5A 1BIIA 4DGUA 1G7IB 4MAYA 3U9PL 3P30L 2X1QA 5J1TC 4QD2E 2R56L 3INUH 2NNAA 4YXHL 4WK4B 5F1OB 2EZ0C 4GRLB 3CX5K 1N8ZB 4L2YA 1ID5I 1M6OB 2D2CC 2P5EB 2IALB 5IROD 2A73A 2EIBA 4JPWL 2W88A 1HKFA 1SHWA 4GG8B 1OO2A 3FU6A 2E7LC 2HUHA 3K0WA 5J56B 2VDQH 2EXWC 3NCYS 5T33H 2IF7A 3WDHA 3MC0A 1J0HA 1P1VA 3HFFA 2C9SA 2J1WA 1YNLL 3ARBD 4H88H 1QLEH 1KCRL 1UEYA 4P2OA 3CX5J 4OGZA 1S9KC 5DZ9A 1EERB 1NEZG 3CXHK 2WJ5A 2NY1C 5DI8A 3BUBA 4ZW6A 2V2WA 2GI7A 3SDDD 4NKOA 5E7BA 4OD2A 5B3JE 1P7KA 1R3JA 2QADB 2O1AA 4LRNH 4AEEA 2WXNA 5F9JB 3VXPB 6PCYA 2BIMA 1E28A 4GMSH 4PJGA 4R4FH 2BP0B 1BQKA 2DBLL 3K2KA 3Q2NA 4U6YA 5IROA 5TE4H 4KKPA 3TO4C 5I6XB 3VGFA 1PX3A 3TL5A 1MPAL 4KJQD 4W1TA 3KLDA 3KGTA 4J2QA 1F11A 3GJFB 3Q13A 5J8OA 3BDBA 3PABB 4QRUB 1FIEA 4CMMB 1L9QA 3QDGE 3EYQD 2UZIL 5HVHC 4EKJA 4ZX5A 3TBVA 3CXHJ 4BFFA 1D7DA 2GIYA 2X9WA 5AVWB 5ADOL 3T2PA 2FHBA 2XZQH 43CAB 2D03L 3NTCL 1PD1A 4XPFH 1OTTD 4ISVA 5E8DH 3GTTA 1RZJC 1IGYA 3VTAA 2VABA 3SDDA 3GTVA 1XMWA 3QA3A 3NCWA 4G9FD 2R23A 2VLKD 3KWUA 5JHDB 4Z95L 3QIWC 1YPZF 1LNUA 3BH4A 4FEIA 2Y36L 4ODXA 1UJTA 1IAKB 2Z35A 1AYOA 4EZKA 4C83A 2DWYA 2WMPB 1WTLA 1LD9A 1F4XL 2JK5A 4MQSB 4QHLA 4GH7B 4NC2B 4KXZI 1YG9A 1GVIA 1ILUA 1WAAF 3TEXA 2C7UA 4JZNA 1IBGH 1RP9A 3WFCH 2ZOTA 4IEFB 4HCGA 1PDKA 5GZOC 2IMNA 2JWYA 1T7VA 4FHBD 3ZKMC 1DSFH 2EE6A 4ZMWA 2PW1B 5FUOL 3LDBB 3IU4L 4KKAC 1TF4A 2A9NH 4L8DA 4CGUB 2PNDA 5DWUL 4Y4KC 5FYKE 1TSRA 2AV7A 2IAMD 3D85B 2XZAL 5F1NB 4Y19A 4G9FA 5TQ2H 2CPUA 5E9DE 4PM1A 2XWJA 3N50A 5IK3A 3ULSB 1HS6A 1NGXB 2K7QA 5HGAB 2BSED 1VENA 4HXBH 1AZBA 3B2UC 2QSTA 1X5LA 2X4QA 4I87A 3MBED 3IJSB 1O9ZA 1XCWA 3PNRB 3ESMA 4C56D 1HEHC 3DMMC 2IAND 2PCXA 3EDEA 4D0BA 2VUYA 2Y5TA 4PGEA 2DDQH 2OXHA 1U8PA 2FSEA 1KUMA 2W07B 4S1RL 4TVSa 3TBTA 5CGMA 2XKNB 4R5TA 2IAMA 1Q9KB 3ILEA 2QJDA 4XCNB 5I71C 4Y4FC 1KCWA 2VLME 4WWID 5I1EH 2R2HA 3A24A 1QASA 4APXA 3L2LA 3A47A 3LRSA 3GSNA 3NZUA 2BSEA 1BD2E 4N1EA 4V1DA 5LGHL 5B3NA 1G7JA 1ES0B 2V3DA 1TLMA 1J0YA 2VDPH 1JFQH 3MBEA 3L7EA 4NKQB 5T3XD 1I8UA 1X7QB 3DJ9A 3FO0H 4FKHA 3AVEA 3GSNL 3QUXD 5ABAA 3IE4A 4JFPA 1TO5A 4C56A 2HX8A 5C0AE 5DVMA 3ES6B 3DARA 5GGUA 3L3DA 5I73C 3CFUA 3IDXH 2XWRA 1KCLA 1T04A 3LNIA 1RU9L 3QUKA 4XBPB 4L5FL 1AO7E 5DZAA 3MCKB 4Z76A 3MNZA 5LAXA 2P5ED 4CC0A 1QFUL 4YHLH 5A3ID 4LEXL 2G9HB 3EO9H 3BSGA 2WW8A 5DHYA 3S34H 5C08D 3K1DA 2CRZA 3QH3B 1GIGH 2FSDA 3KWVA 1R5WA 1RK1A 2X4OA 4H7VA 1LEIA 5HP5A 5HHNA 1SHSA 3IS1X 5AOIA 3TA3B 4Y2OB 4KAQH 4M6NL 7PAZA 2AC0A 3L5HA 3O9WC 1T4WA 3GMMB 3W9EA 1BVNP 3MOBL 4DTGH 2VDMB 5T3XL 5BOPA 3IJ8A 3O2WH 5F8QC 1M2OA 3FSAA 2HTKD 4HKJB 4JB9L 1BG9A 3B8SA 2P5EA 1WTGT 3RPBA 4DP8X 1IZKA 1U3JA 1FO0B 1U3HB 2IALA 5LB1A 4AENB 2WIMA 4M7LL 4RESB 3CFDB 2HT4D 3MRFA 1JNNL 4E5XG 1UADC 1UWXK 4GG8A 4J23A 4N0CC 1YUHB 3OBAA 2CZNA 5IESL 3KPSD 5C08A 4BD4A 4IDLA 4CL7A 3CZSA 4DPBX 3GMRA 4NOBA 1V3KA 4Z7OF 1CZ8L 4MB1A 3WNKA 4URKA 4ZMAT 4AIEA 2FUQA 2VZTA 3E8UL 5FUZH 2AEWA 2BVEA 3SDAC 2FATH 1TZIA 2XIBA 3ILQD 3OL2A 4KZEL 1BX2B 4M48H 4OJDH 4NNPL 3ZO0A 1FGVH 1Q9OA 5ENWB 5JHDD 3UADA 2AF2A 3DJZA 1FVEB 4HMCA 4KK6D 4XC3H 3VXPA 2BP0A 4F7MB 3D6GA 2B1HL 2X2JA 2WQRA 3JTBA 5DJAB 3AY4C 1I9EA 3GJFA 1KF9B 4Y5XC 4QRUA 3PIQB 3UACA 4CMMA 3CDZB 3BPLB 3BAJA 2E46A 4MMZA 4GW4A 4NFCA 3X3GH 2CK0H 3JWNG 5DD0H 43CAA 2AK4B 2YQBA 1PGRB 1YEIL 1K4DA 2YPVA 4PP1D 4U3CA 2V37A 2ZYSA 4UQDA 4RAVB 4UM9D 5EEUA 5BV7C 1G0XA 3D85D 1JZ7A 1Q72L 1E67A 4IJTA 5D6DC 2JKTM 2VR7A 5JHDA 4I8DA 2HKFH 4OV5B 1IAKA 2L3BA 1YMHB 4PLJD 3VB9A 1TCRA 2WMPA 1KT2B 5L2JB 2QKSA 1D5RA 1MCKA 2XV2A 4AMKH 4MGXA 5F44A 3EYSH 5A16B 4CJ1A 3CZNA 4KUCF 4IEFA 2EDKA 3CVHB 3CPUA 1AZUA 4WUKL 3TF4A 1QLRB 1KWGA 4OD1H 4UILL 1CXHA 3WFZA 5IUCA 2PW1A 4BGDA 1G1OA 3QZWG 2BZ7A 1TYRA 4HS6A 1N4XH 5EBMB 4AM0B 3OAUH 5DR5H 3U36B 2O5ZL 1FHGA 4DN4L 3D85A 5F1NA 1QFHA 4HJ1A 5ACZB 3D2TA 2EYTA 3G6DL 4X4ME 3ULSA 3VG9B 3ET9F 1HEJC 3I84A 5H37H 5HGAA 4J3SA 5EZOL 2LLLA 1CG9A 2ZXCA 1S5HB 2R0ZH 4LT7A 4OI8A 4LGRB 1T6WA 3C2AL 3WHE0 4YDVB 1INEL 1WWAX 5BRZB 3IJSA 4WJ5A 3H56A 1TVBB 1ZHBB 3B2XA 1TJXA 1AS8A 4JPVL 1A14L 2B14A 4KRNA 3EGSB 4TSAL 4AUYA 3RUGF 5C0FB 3PHOB 1LO5A 1OY3B 1G1YA 1J10A 1E5AA 2XKNA 3VI3B 5KBDA 1Q9KA 4LL9A 4MJIB 2B3RA 4NO5A 1VZIA 3RGVC 4F9LC 2X5PA 4U1HB 4OCXL 2X4PA 1OZTG 3ZDYB 2NLJA 1NCCH 4JFWA 4P05A 2W95A