5D1XE

Isdb neat2 bound by d4-30
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
115
structure length
115
Chain Sequence
KMTDLQDTKYVVYESVENNESMMDTFVKHPIKTGMLNGKKYMVMETTNDDYWKDFMVEGQRVRTISKDAKNNTRTIIFPYVEGKTLYDAIVKVHVKTIDYDGQYHVRIVDKEAFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Germline-encoded neutralization of a Staphylococcus aureus virulence factor by the human antibody repertoire.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords D4-30 Light Chain
total genus 19
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5d1xE00
3SZKC 2ITEA 3QZMA 4WJG3 2Q7AA 2ITFA 2Z6FA 2O6PA 5D1QE 5D1ZI 3SZ6A 3QZOA 3S48A 4FC3E 3QUGA 4H8PA 3RTLA 4YMPA 3QZNA 4NLAA 3OVUB 2H3KA 2MOQA 3SIKA 3QZLA 4MYPA 3QUHA 2O1AA 2K78A 3QZPA 3VUAA 5D1XE 3RURA 3VTMA 2E7DA 4H8QA
chains in the Genus database with same CATH superfamily
3LH2L 4B3EA 4M7ZC 3DYMA 3U82B 4YLBA 4DPRA 4HKJA 3GB7A 1KMGA 3HE7C 4QT5A 3ZYZA 5HJGA 2I9TA 1B3IA 2GKIA 2OXHA 3HS9A 4YO0A 5FV1L 3QWRD 4CMMB 2IG2H 2R0ZH 3BUTA 1INQB 2ZE0A 5IB5B 1A7PL 3P4LA 4NQXB 3ARWA 3OB0K 2GJZB 3QWOB 1LWHA 2YPVA 4PY8J 2BP0A 2L3BA 4WFHD 5D5ME 5T33L 3QXDA 1JWUA 3O6FB 3HLAB 1TZGL 4QXTA 1PZBA 1X5JA 3OG4B 1A22B 5F0JB 1G7QB 2EAEA 2H26A 1IE5A 2MFNA 4X6CB 5EU4B 2ZKYA 5EV7A 2KL6A 3RUGB 2J73A 3D25A 4W6XB 4D0CA 1CE1H 2E7MA 2JJTC 3EYSL 4JO2H 5INDA 3O2VH 2ADJB 4MJHA 1QPKA 1CL7I 2VQTA 3FN3A 2MH4A 5MENE 1TNMA 1RUKH 1VCAA 4RAVB 3SODB 3V52L 1AACA 3OWEA 1U8JA 3SB3A 2NXYD 1RUPL 2W65A 3O6ML 3QJXA 2P44B 4JHVA 4KTEL 4EDWL 1I9JH 1WWAX 2M1KA 2UWEA 3IPEA 3WTYA 3CPUA 1YNKL 3VGFA 4P5TA 3NZHL 3S5ZA 2A6IA 4HXAL 5H4ZA 2ENSA 4H0IA 3SYQA 5GISH 3BRFA 4YHNB 1DDHA 2AABL 3P77A 2PNDA 2F1BA 4EI6B 1KT2A 1W8EA 2O6DA 1G7MA 4ZPTB 5FA3A 4L1TA 3QUYA 2BC4B 3Q01A 3BLBA 3CFBA 3SKOA 2HVKA 3MUJA 4FXGA 2B5IB 1LQBC 3LXCA 2BOBA 4POZD 3OAZH 4KKCD 1LP9E 3V9FA 2UVEA 3VFMA 5H37G 3INUL 1NAMB 5CIPH 1MI5A 3O6KL 3VE0B 1S2EA 3L1OL 2OR8A 4F9PA 4N2DA 3WE1A 2WQXA 5EN2A 1AZRA 1T0MA 1N18A 3FUNA 1LP9A 3KYMA 1YY9C 1A3RL 5HDBF 5KZCD 4M7LL 5EF3A 3QAZC 3KS0H 5C0IA 2ZXQA 2WXHA 4P9MH 2JH2A 4DCQA 2BFVL 1HXKA 3K1KC 2R27A 5IB4A 1P4IH 4KC3B 1VRSA 2WXJA 4GMTH 1GVIA 2Q8AH 1CFVL 3QNZA 2W92A 4FTVE 2G2PA 1MQKL 2D7PA 1OTUC 4MA1B 5D1ZA 1PKOA 1BXUA 3BAXA 4XCYA 5IR1A 5BXFB 2AJXH 1ZA3A 2Y6SD 1YQVL 2ZICA 4RMWA 3T9WA 3FTGB 2OJZL 5C0BE 5FUCE 3VXNA 2DQUL 4QOKD 4ICXA 2MRYA 3W11D 3QUZA 1OT2A 2WGNB 2E9BA 4FQQA 4KUCF 2Q8BH 2PPAA 4HD5A 4KZCA 1Q1JH 2NLJA 1PQZB 2WLNA 1LM8V 3OXRB 1S7RB 5C92A 1MIML 3GD1C 2XBZA 1F1AA 3KPRA 2Z4TA 4TRPH 5CN2A 2JKXA 2AFNA 4HFWA 2BY1A 5KVMC 1LO0L 2AEOA 2YSSA 3EIFA 3PP3H 1F97A 3MRNA 1MPAH 4WTZG 2X6VA 3LN4A 4AIOA 1EK3A 1UWYA 4J3OC 3SE3A 3SSGA 3VXOA 4QHMB 2G2NA 4TQHA 3E8UH 2V5MA 3K8KA 3LNGA 1DANU 3RP1A 2R56H 2X05A 1MWOA 2ITDA 3DPDA 3RVTD 2C9UA 4LT7A 3TCLA 1SN0A 1EHLH 4WKZA 3BWAB 3ZUNC 4WEUD 1RZKC 2R1YB 3HE6A 3TYFB 4FQHA 4OCXH 2NY3B 3R1GL 1RJZA 1W0WA 3MYJB 4ORZC 4AQAA 4R3SA 4JRYD 2GTWA 3H3PH 1JXDA 5D1ZC 3WXWL 1C5CL 2FJHB 2IH8A 1JV5B 3EDEA 4QO1A 3G5YA 2Y25A 2JKRM 1JNNH 2GVYA 4XO5A 1CF8H 2WKLA 3GMPB 3MRDB 3IF1A 4MNQB 4Y8AA 5D7LB 3ATEA 2A6JB 3X3GH 1UA3A 2F8VA 1CFTB 2K3TA 3HNSL 3RVXD 1NQBA 5G2NA 2X28A 4HH8A 4G11A 1PF3A 5AQ0A 1T1YB 5AZUA 1K3ZA 1AI1L 4L29A 4NFCA 2DRUA 2Q7NA 4M1DH 1IE4A 3LZOA 3D7PA 3OMAB 4XVSH 4Z7WE 3CFKB 5ACLA 4ZMXA 3PHOB 1LO3L 3G6JA 4NQUA 1AIFA 4UT6H 4WQOA 3GKWH 3C5XA 1KCUH 4OCMC 5E23A 1JK9B 4M3JA 5IB2B 3RIKA 3A24A 4LGRB 4JFDB 4P5TB 1PPIA 4O4YH 1ETB1 4LSTH 4GEIA 3ZMNA 1L3WA 3VNZA 4BV1A 3EF4A 4YZFE 1ZT1A 4XVJL 4OD3L 2W65B 3I84A 4JPKH 3ZBMA 2AJ3B 1OM9A 3EJYD 1JXFA 4MNHB 1H6EA 2APFA 1MKFA 2B8OT 3OMZA 3TVMD 5D71H 4XOAA 1WFTA 4R4FH 1RZ7H 1HK6A 1NAML 3DECA 1D7CA 1EFXB 2YUWA 1G6VK 3OHXC 5EZJB 1GS6X 4LL1A 2D31A 2FECI 5IVNA 2AQ1A 2C1OA 2PCPB 3D4GA 4CW1A 3NFNA 5AW0B 1CICD 5H94B 1B9KA 3UAJC 3WFDH 2XICA 2N01B 1KNOB 4NPJA 1OXYA 2BS8A 4CU6A 3UPAA 5E4EC 3EADA 4PWGA 5D70H 4C59B 3OSKA 3MLRL 1XB6A 4FXGC 4X99B 4XP9H 2H47C 1QLEH 3U46B 1NM9A 1KIRA 4HUKB 4NSKA 2JJTA 3CLEL 4KZDH 3L1EA 1ICTA 4IU3B 4DKDC 4JFHE 5EEXA 3KAAA 1S7VA 4CVXB 2VAAB 4UILL 1CYWA 1XSOA 1XTMA 3V5DB 2VUKA 4N25A 2JKLA 4KJQD 5FYLH 1HEJC 1WIPA 2NYYC 1FG2B 3O9WC 4ECNA 1F2QA 4PS4L 4YXKH 5LBVA 4KVPA 5D72L 3FUEA 4GUOA 1D7FA 3EKCA 2GI7A 5IQNA 1UZGA 4ODWA 1KBGH 4LB8A 4X8JB 2CKBA 5BMFH 2CHZA 4OCSL 3AWGA 1JV2A 1OP5K 5GS1C 4ES9A 3W11C 3P9LA 4ODUB 3F6JA 4QRRD 2XC8A 2WM0A 4A2GA 4JFOB 2CJSA 1ZJAA 4YHLH 1W6WA 2AQSA 2WBWB 4NC1C 2R0LH 1XIWB 2N1TE 2DLHA 2EO9A 4L4VD 3APDA 3BYTA 4D8PB 2EIKB 2D0FA 4XCNB 3ROLA 5EU5A 2YAMA 1HSBB 1WWCA 3EGSB 3FBKA 3LEXA 3THML 4BUHA 1AKPA 3MRGA 1GC1C 4X6DF 2CLVA 2TRHA 3V4VL 3SD5A 4AJ0A 5KVFH 2DB8A 2H45A 4UINL 4XCNA 3ZKND 1KYUA 4AYGA 3MV8D 3O6LL 3L1GA 4OLUH 4NQDA 1A6VL 2N1KA 3T2NL 2R2HB 3MLPA 1EUUA 5AYUH 4G82A 2ICWI 2VLRA 1E4WH 2O6EA 4PJBF 5AAMC 4HUNB 4Z78B 4IKLA 5DFTA 4IMLA 3QNYA 1EO5A 4X7TA 4RWHA 1DJHA 2Y1VA 3VFRA 1IAOA 2ITCB 3NYKA 1QFWH 4YZFF 3AG4B 3TWYA 3QWRA 3QFDA 3OBAA 3AY4A 5HDBB 5J11C 4FXKA 2Q76B 2QL1A 1PFCA 3T3MF 4F57H 1TTAA 5TQ0L 3JV4A 3UTPE 2GSIA 2GAZB 4OCRH 1A1MB 3ZRCC 1T6VN 1FZKB 4LVOB 5KOMC 4PJXF 4XP6L 5DTFB 1UQSA 5DK0A 1ML0A 5A6IA 2QSTA 2FIKB 3DV6A 1MFDL 3HRZB 3UIYA 5DD6A 3BX7C 1JPST 4NAJA 1KJ2L 1NBCA 4GW1A 1Y6MR 1F4XL 1ZIAA 4NJ9H 1FZKA 4HS8H 2Y7QB 5D7HA 1WA0X 5KEZA 2WJ5A 4OIIH 4RETB 2NW2B 4HLZG 43CAB 1L5GA 2WLHA 3D2UB 1QFUL 2H2PD 3W1ZA 2FJFB 1XFPA 2G0LA 5F88A 1K5NA 5DJ8A 4WUKL 5E2JA 3JZ7A 3KNBB 4OLZH 3ZHDA 5CBAB 3ZOAA 1WCBA 2D03L 2J20A 4ZUWB 4XO9A 3ULUE 4N0UE 1Q0YL 3QNYB 3RB7A 3V7AE 3QYMA 3H3BC 2FQFA 1TVHB 4Z0XB 4KK8C 3L95B 1ULVA 1AFVH 3MLXH 3UJTH 3E6HB 4N90E 2QQNH 1F11B 2Z65C 4FNRA 4XBPB 3IGAA 4H7VA 2EIJB 4XP5H 4Y5YB 5BO1H 2F15A 3LEYL 4B9GA 4MGXA 2DF3A 4LPYA 1UGKA 2QQKH 3C9NB 4OF6A 2E27L 4X6EA 3WDIA 1A47A 3F01A 1G43A 2Y1YA 2FGWH 4M6NH 1KEMH 5L4IA 1NCBL 1V3KA 1A5FL 5HHQB 4JY5L 2OJEA 2HPOA 1USQA 1OPGL 4QD2E 4RFEB 2GHWB 1OB1B 3WFCL 4N2MA 3G3LA 1ZPLA 3KGRA 4WHCA 3QJVB 4KJPC 4XN1A 2ZONA 2VL5A 5BVJA 1ZEAH 1NEUA 3W81A 3UPRB 3VQ1C 4IRJC 4MA8L 4MJ6B 4TUJA 5F6IC 1CBVH 2PN5A 3D09A 2YEZB 2DJSA 3QRGH 4X4ZA 1T5XA 4PJFF 3B43A 1WE5A 4RGNC 1D7BA 1VIWA 4CADB 2IQAB 5I1JL 4WUKH 1OK8A 3MRDA 3QDGA 2VN6A 3O3DB 5FO8A 2FJHA 4N2AA 4GQ9H 3WAJA 3MRQB 3MRBB 2MKWA 2K7QA 2VW7A 4H25A 5DO8A 2J1YA 3RDTB 5CD5D 1FFNA 4W9JC 4XAKE 4PS4H 2XWDA 1QI5A 4YXKL 2RCSH 3MQIA 3RTLA 2KLTA 3NIDF 3O8XD 3N43F 4KOBA 1OLZA 4XPTH 3S37L 1WTLA 5F9AC 2BRRH 1HINL 2X4NB 2V37A 2HYMA 5ANHA 1W72B 1D5BA 4G1MB 5E8NA 1BVLA 1PKQE 4Z7OE 4RMTA 1LILA 4PQXA 4Z9KB 4LPTA 1SJEB 4W9FC 5IV2A 5E6UB 3MV7E 3ZKNC 3E3QC 1F90L 3TURA 3MJ9L 1MFMA 4R90L 3VJ6B 4R4ND 3W9EA 1NBZB 1X6LA 3QYCA 5CU9A 4LDOB 4JHWL 4L37B 2QKIB 4KXDA 4C4BA 1E4KA 1TZGH 4IDJL 1W0VA 3M07A 4A7TA 4L5FL 1BQHB 2VN7A 1B6DA 1MJUH 4WHYH 2NTSP 1E50A 3POHA 1LDPH 3QUZB 5AW8B 5TDNA 3E8VA 3V6OE 2H0JA 3V55A 5I6MA 3VO0A 5A2AA 1GS7A 4U2YA 4MXQC 3T8XB 1IO4C 2KZKA 5AAMA 4B9ZA 2VXUH 4HXBH 3GHPA 5LCVH 3BUYB 3FO2A 3KPRE 3WUWG 1E4WL 1IGFL 2V5SA 2APBA 3MBEA 4MJ6A 4TUJB 4YE4L 4Q56A 4HK0B 1R5VB 3SE9L 4FI7A 2V17L 3VWJA 1UUNA 5J4MA 3APFA 3TN0B 1NBYB 5MEPB 4NM8H 3VXQA 1XGRA 3SDYL 2HX8A 1M2VB 5B4MD 3OAYH 1AS6A 3BAJA 1T0MB 4BFIA 3EYFA 4FKEA 4UDUB 4ZD3L 5HI4D 3ULVL 3N44B 1NCOA 5DZLA 1URIA 3VTAA 1GXEA 4LCIL 1BHGA 1KULA 3GMQA 4AGPA 1PD1A 1T83A 1XSJA 1OHQA 3HNTL 3MOQA 2YA0A 3NA9H 4WDIA 3VGBA 2XN0A 1F11A 2X2IA 4XBPA 4BINA 1DVFD 1Q9KA 2HVKB 1SLVA 3E6HA 4FXGB 4QRRE 4X4XA 3NIDB 2Y23A 3TO4A 1GJWA 1NCJA 4M5ZH 3V0DA 2OZ4L 2P5WA 4OF7A 5IZ7A 5K1NA 4YL4A 3NRPA 4KI5C 5GS1A 4H13C 4ZX6A 5GSVB 1DQLH 2VB5A 3KYOB 5BZWA 2P5EE 2D03H 1AC6A 2A9BA 2QQLL 1FRGH 35C8H 5IOKA 15C8L 1F6AB 2J55A 4NHCL 4X4MA 3TVMB 2WO2B 3KPRB 5EB9A 1N3NB 4JLRA 3HA0A 5I6XB 3TEXA 4DK6A 4FNLL 4FTDA 3T8XA 1YEKH 2BCKB 3VTMA 4P2QB 2WUBL 2VLRD 4I1PA 4PVNA 3TP4A 5GZNC 3JWDC 5C7XL 4LASL 3QDJE 3BKJL 4UT9A 3AWEA 4AK2A 4C4KO 3ZYJA 4K8RH 5L8KB 4Y5VA 3TVMC 1CR9H 1L4IA 4ZUSA 4XXWC 5FO7A 2RFXA 1N19A 3LVTA 3ARSA 3F7VB 3HG3A 5E2VL 4FXKB 1RHHB 3ARGC 4FFVC 3X17A 4JKWA 5BZDB 3VI4B 4TS6A 5EZOL 1KXVA 4LLUB 3NJIA 5D2NA 4CSSA 2CALA 1MVUA 2QVMA 5IB5A 3ARZA 3DMMD 2X9XA 2A6DA 1FLTX 2FX7L 1IAII 2C9VA 1Z9PA 3CVHH 3SPCA 4B9CA 2YBGA 2X6MA 4JRXD 4TKWA 1WICA 2C3WA 1EDYA 1QSFE 3CVHA 3MRPB 1ZCRA 4N0RA 4C83B 7PCYA 5I1JH 4BWWA 4APQB 2FWUA 1G9HA 3TBVA 3KW8A 4GI8A 5E2UL 1CIUA 4PRNB 4ZXBD 2X2YA 4U1HB 1L9RA 3QQ9D 3X13A 4BCYA 1EGJL 4JG5A 2ZG3A 5T33H 1ZT7A 1ZGLA 2NY0C 2WXGA 2XXGA 2OL3L 1QBBA 3BZDA 3NDZE 4H25B 2YQ2A 4KJQC 1OB0A 2RGSA 5BZZA 4H8UA 3ROLB 3EUUA 4ZMPA 5IUCA 3QJUB 1C5CH 4NN7C 3HC0B 2PTTB 4J27A 3ZPDA 3GSQB 1I1FA 1FVEB 1E5ZA 4DQAA 3JTBA 2VN5A 2YK1L 1JTTA 3HNSH 3STBA 3PNRB 4LKCB 4A2DA 2BSTA 2XHNA 2OAAA 1PYWB 2O72A 3GSQA 4RX4A 4PJ8C 3HZVB 4ZBJA 1XH3B 2FX8H 1RUKL 3X3FL 2R1WA 2DIJA 1BCIA 1XD0A 3GUTB 3N1QC 3CDYA 4P04A 4BFGA 4RSVA 1TLMA 1NGZB 1SVBA 4JPSA 4ELME 1Z5YD 3LHPL 4PY7B 1LD9A 4IDJH 4H88H 1Y18A 4LCUA 5CLTA 1JF5A 1ETZA 4BK8A 3B1UA 1BGXH 4R96A 3K71B 4C83A 1E5AA 4JFTA 4KV5E 2IFGA 4BD4A 3G08B 1A7OL 3DOSA 4GT7A 2P48B 4R7NB 1JGDA 3P2TA 1FHGA 1CFNB 1DLFH 4LCWA 2X7LA 3BWZA 4HKZA 3FCTA 4TULL 4YX2H 1RK1B 2XU9A 1BX2A 4GSDH 1BMGA 4ZFFA 1SUHA 1C7SA 4LLUA 3QDJD 5D2NB 3NPSC 1Z3GH 4J5VA 3QXUA 5C6PB 1JDCA 4WV1B 1E2ZA 1K4DB 1XIWC 3O4OC 4MLSA 5FFOA 1RZIB 3QB7C 4AX3A 4WEBH 1ADQL 4BH7B 2EEXA 4U6HA 1V7MH 3ABMB 3F12A 5E4OA 3HG0A 3W37A 3ARDD 4CW1B 3GXIA 3HIZA 4M43L 3RYMA 2HJFB 4P2QA 2V9QA 1U3HB 2UZIL 3O45B 3VWKC 4QYAA 4CMMA 1VESA 1B0IA 1FVDB 3ATDA 4MDIA 2IH3A 3CX5K 2ZOKA 3J2PA 4YDJA 4DPAX 5KYWB 3DGGA 3ZDXF 1BREA 2DM3A 3KM1A 2FJGB 2NY1D 3VA6A 2VE6A 1S5HA 3GLZA 2A9NL 3OX8A 3ENEA 5E6ZA 1B2WH 2YLKA 2EEAA 3WLWC 2PYED 3BUBA 4AGNA 1CG9A 6CGTA 2IADB 3TIEA 3I02A 1DBAH 1DQKA 4IOIA 2RJMA 4R2GD 5DZ9A 5CEZE 3NFSH 3WS3B 1EXGA 4FG2A 3QFJE 15C8H 1WWBX 4HEME 1AO7A 4D9LH 4ANVA 4BSWB 1A8JH 1MCHA 2HTLC 3ARGB 5PCYA 3TCTA 3ZHKA 4AT6B 1CL7L 3DOSB 3P40A 2O26U 1CGXA 1HWWA 2CPUA 3WKYA 1F8TH 3NRQA 4QHUB 3N0PB 3WEAA 3IU4H 1TENA 2EC9T 2BVOA 4G8EB 3C8DA 2G5UA 4PGBA 4ZJ9A 4Y5VC 3KL5A 4WWKD 1T7YA 3ZKXC 4DP0X 2CLVB 4FQHB 3DX3A 4W1TA 4OLWH 3SCMC 4L5FE 1AR1D 2X6UA 2IBZY 1AXSB 1WEJL 1ZV2A 2WP3O 4P9HC 4ALAC 4AVHA 3TNNA 1H6TA 4WHTA 5TF1L 4H44C 4E41D 1L0YA 1OM3H 1OCOB 1LO4L 1NGYB 1U3HD 5LKNA 2B1HL 3TBWB 4NP4L 4ZS7H 3TFKC 3EYVA 3QHFL 5LQBL 1OIOA 4PTTB 4YFEA 4ZT1A 2VABA 3IRZA 3U9UA 1HT6A 1W9XA 1DVYA 1XF3B 4XNYL 1F18A 1H8SA 2B3IA 3AXHA 4KV5F 3O3EB 1OF2A 1TF4A 1JHLH 1UM5L 2A83A 3CPLB 3AU1A 5B8CB 4W4OA 3HHSA 4GOSA 2LQRA 5MEQB 1N0XH 4D0DA 3KPSD 3UDWA 3ECBB 4NKIL 4HUXB 1NBZA 5HHPB 5E8PB 3T2NH 4P2RE 4QRQA 4YHIA 2MSPA 3M7FB 4ODSH 3ZDXB 4G7YL 1DEDA 2VXTL 2WVVA 2UXVA 5I75C 4G2AA 2WAQA 4N0UA 4WWNA 3PF2A 5D2LA 1AGCB 1MI5D 1BVLB 2KPWA 1OAJA 4G1MA 3PGFH 5DK3A 3AW5A 1HDMB 5D6DC 5L8JB 5TPWH 3L4VA 4Z76B 4WNJA 2VDPL 1IV8A 4ADIA 1QFUH 1YUHB 2WVVB 2ZCLH 4JFWA 3BVWA 5CFHA 3VVWA 1I7RA 3HG2A 4JY4A 4YSTA 1NLDH 1HXYB 3MRRB 4AL8H 1WZAA 5DD0L 3HUJA 4TLKA 2FLRT 3CK0H 1DQJA 5FUOH 4I0PD 2NXZD 1WA1X 2IJ0C 4HGMA 3QHZL 3HJ0A 3UJTL 3W82A 2JI3A 2MPAL 2YXVA 5I1IL 4EI5D 1XCQA 2P24A 2VN4A 4FFYL 4UTBL 1FFOB 3EDKA 3N42F 4IDLA 1ONQB 4FCHA 4C47A 1INEH 3RY4A 1DLFL 4ZFQA 2V2TA 3DSNA 1QI3A 1GW0A 2EXYD 5GRJL 5HBBA 3GHBL 4PUBH 3RIAK 3TBWA 2P28B 2PR4H 3PQYA 2Y36H 1G7MB 4ZPTA 2XBTA 2VN3A 4NGHL 3K91A 1WIOA 5DT1L 4ACPA 4GS7C 3L3IA 4JFQA 4H1LG 4RA3A 3U30B 5GZOD 4CGTA 1JWMA 4TN9A 1U8PB 4F7MB 5D4JA 1QNZH 2WXMA 3BGFC 3BKMH 2VWEC 4XPAH 5BMFL 1CLYL 5CJBA 3S3CB 1TJHH 2B4CC 2Y3NA 4MZ3A 2X4TA 1MCLA 1CFTA 2H32H 2HWZL 1DEEB 2VLKE 2QPSA 3PGDA 4TQEL 3OL2A 1NSNH 3BI9X 4QHLB 1ODAA 3CGTA 4WI9A 4UNIA 4Y9CA 2XOTA 4FG6C 2Y7NA 4WFEE 1A5FH 1T0OA 4Z7VF 1SY6L 4R3SB 4D0CB 2O5YL 4NIYE 2PTUA 3QK0A 4H0LC 2P3YA 4YGVA 3T2LA 4GG6A 3BRDA 4OM1L 1LDSA 1H9DA 1C16B 5JHLA 2W0PA 3QJFA 2XG5B 4NO2A 1NIFA 3W0WA 5EOQL 4L1BA 1SM3H 1YA5A 3DUUA 2ZNXA 4PLJD 2KQNA 3ELQA 1KTBA 3ISWA 3QULB 5INCB 5D93C 3GMMA 3HG1E 5C08A 2Z8SA 3DRQA 3OTTA 4DOHB 3CFJB 3ZE0F 1XAKA 2FSEA 2WJ7A 1RI8A 4HUWA 2VDQH 3R8BB 4IRJD 1E6OH 2WBJA 2W8CA 2K9UA 4ZTPL 2WD0A 3OHXB 4LMQE 1ZWIA 4FQLH 2A9CA 5AVZB 2ZOLB 3IT8D 4N0YL 1TFHA 3P1VA 3Q6FB 1U30A 1M7DB 5E8PA 3W9DA 1GZPA 1AOHA 2WIIA 2WXLA 4WO4A 2BNRA 4GW4A 4Y9GA 4XN4A 3MACH 5AWNH 3LRSA 4HS6A 5HDBE 1CXFA 3T0XA 4N6RB 5HI5C 5J3HD 3JV4B 3LAFA 3IMWA 3KYKL 3AQYA 4XNUL 3EUDA 5D7IF 2ZCKH 5D7IA 1A2YB 4ABWA 1TSHA 2YD8A 4JQIA 4PV1C 3O3EA 3AQZA 2RALA 1NPNA 2BFVH 2EKJA 4JM2A 1UWGH 1F3DJ 1HOCB 5DJAA 5CM1A 4AGQA 2VXQH 1U6AL 2WO3B 4AQZA 1J9TA 1TR7A 4U1KB 4OJAA 3H42L 2EDKA 4QY8A 3NZHH 5BXFA 5JHBA 4ZMOA 5JPMA 1YNLL 1BZDA 4HG4K 4UM9B 2NYZA 1PL3A 2AEQH 4O5LL 3QISA 5IBUB 1ZSHA 3BUDA 4MHHI 2D7OA 1RUMH 3IKKA 2WW8A 4LCWB 4OZIF 3FU6A 3BH9B 4PMFA 3WIHL 2OYKA 2C3VA 5EOQH 3BP5B 4Y16D 5LXGL 3KPNB 1FGVH 2VDRB 1QYGL 4QHPA 1VEOA 3BFWA 2NY0D 4P3DB 3MRQA 5J06A 4FZ8L 4O58L 1SXZA 2XWJB 3OXSB 5D7SL 4B9YA 3QG7H 1RQ5A 2VT0A 4DKAA 2NTFA 1YMHA 5BUAA 4W70A 4NKMA 1MLCB 1OANA 4G42B 1G9EA 4LFHG 3IS1X 1QHOA 2V7NA 4XWOC 12E8L 4QOKA 2CLZA 2YWYA 4I0PC 4MBOA 1U3HC 1YMMD 4IIZA 3GTNA 1TJGL 3B7UX 2C7UA 4DJMA 3FT2A 3N44F 2ZUSA 5IB3B 2LTQB 3NZ8A 1SVZA 3X1FA 1OB1A 2VR4A 3WD5L 4JPWH 3HR5A 4PJHA 5D8JH 3IETA 3TONA 5I1HL 3TT3L 5I9QC 3C6SB 3RWHB 3MBEC 5KANG 3JUYA 3IN2A 2WWKO 1CGUA 2CO1A 5D1QB 3A6CH 2CGRL 1E30A 4M02A 4GSUA 3E6FA 1PD6A 5IHWA 3H3PL 5KSAB 1U95B 3NA9L 4Y5YA 2CUAA 3RY5A 3QDJB 1UCBH 2NY7H 2Q8BL 5BQ7B 2CD0A 1RIVH 1RZGB 2E59A 3GRGA 2A6DB 2QVFB 4XN5A 4LCWE 1UHVA 3ARQA 4TUKL 4AEIH 2ENJA 1E27A 1FNSL 2CRMA 4U1NA 1YEEH 5CILL 4GQPH 5TGBA 2NW3B 3JQOB 1B0RA 3F65A 1AYOA 4Y9EA 5IROA 1DCEA 1XL6A 3UZVA 4XVUC 4NI3A 3F7VA 1P4LB 3AB0C 2NW3A 3RURA 2FHFA 1JPFA 1ZHLB 4LQFL 3PY9A 4X9FA 2AZUA 4Y5VB 3PE9A 2RACA 1VACA 2VDPB 3K6IA 2DJMA 4JRLA 3MJ8A 1UZ8B 1L9TA 3P0VL 5TE6H 1MN4A 4JFDD 4Q14A 4ZSOA 3RTQA 1FQ9C 4HOMA 1FVCB 2ZYHA 4GBXD 4U1JA 1S4IA 1I3UA 3FPYA 5T5FH 1A1MA 1BBDH 3LXBA 1N4XH 2EXWD 3WV0A 4I9XA 1TO5A 1HHHB 4LRNH 2J8UF 3OKMB 5L2JB 4E68A 1SRDA 3H0TA 4PGCB 4LPUA 1X5HA 2FYYA 3HW7A 3FT2B 3WL9A 4G5ZL 5D1QE 3C5ZA 4ERSH 1CICB 5JUEH 2ICEA 2JNZA 1GSKA 1DBKL 3GINA 3LQZB 4FC3E 4HLZH 4ZK8A 3VRJB 3VXSE 3HFML 2J72A 4CVZA 4A6YL 3ARGD 4FFVD 3N40F 4JY6A 1G7JB 3B56A 4BUGA 3U36A 3MBWB 1BM3L 4YPJA 3V8CA 1DBBH 3WKQA 2VLJA 1ZA6B 2W38A 3RGHA 3VG0H 1E4XL 4I0CC 5CD5C 3T6WA 2P42B 1G9NL 1PZSA 2XZAH 3R0NA 5IMKA 5C9JB 5DFAA 4FMVA 2EDHA 3NSCA 1TU2B 2R2EA 3M17A 3VFNB 2HTLD 5A2KH 3I2CL 5GPRA 3L7FA 4UYQA 4Y4FB 1J5DA 3GSVB 2G9KA 4H88L 5DMGC 4YPGB 3F7YA 4E5XB 4X8XA 1JGEB 4OFPA 3U1SH 5FGBA 4MYWB 5EOTB 3V9CA 4DTGL 1ACZA 3HPJA 1J5OL 4Z7UE 2MTAA 3UBXG 4XBEL 2IGFL 4Z3TA 1EEYB 1IC7H 2PW1A 2FO1A 3UJIH 2EEDA 5I19H 5JZ7C 2ITEA 5FDYA 5D5MA 1YC8A 5L9DH 3B9DA 3BWUC 1MELA 3HMXA 2AEWA 3NQIA 4AIEA 3GJEA 5L2KA 4R6UA 5I18H 1SOSA 4ODWB 1KFAL 2W0FA 3FHEA 3MR9B 4LIQL 3S36X 3ULUD 1AGEB 5E2TH 5ESQB 5MENA 2JKNA 3MTRA 4ADGA 3ASOB 3Q1EA 4OAWB 3DV4A 3ARTA 3U7YL 3F04A 1M7DA 2CRYA 4EPSA 2ATPB 5TDPA 2AXGB 1KBBA 1TLKA 4NNXA 5DJXB 4UINH 3RWDB 4O58H 3SBWA 3WMQA 3QORD 4CVXA 4TNEA 3X2QB 2E4TA 4D0BA 4RNRA 5D1ZI 3EYQC 4LPXA 3NTCL 2Z31C 4ZX3A 5JHLH 4KKZA 4YBQD 2E4FA 4WFGD 2VTFA 5F71A 4AGOA 3WN5B 5K33A 3PJSB 4NZUH 3CBKB 5LDUA 3O6MH 4OZGF 3G6JE 1JZGA 2KKQA 3VQLA 1FC2D 2WSKA 5I15L 5ISZD 4X6DE 2R4SL 4WJ5A 1V7ML 4OGZA 2NPLX 4YHLL 4GG6B 4FULA 4H2CA 1CE6B 2VXVH 4HCGA 4XNXL 4LVOC 2H32A 2F7RA 2D3NA 4JPVL 3TN0D 4XE5B 5EU6D 5B1BB 3ARDC 3F8UB 2Z9TA 1QW8A 2P43B 5CN3A 4ZW3A 5GRVK 2NY5H 2WN3A 3AS1A 3OKKB 5F96L 3MX0B 5FYJE 1A4BA 5KSVA 4HG4J 2X4QB 1UWFA 2DIAA 1OV8A 3OZLA 2WUCH 2I24N 1SNRA 4I7ZC 5FKAB 5E4EB 1LEIB 2A1WH 2XTJC 1E3FA 4JFDA 1GTNA 4NUQA 3P77B 1JXGA 4F8QA 1CT8A 3MRJB 3WUZA 1XX9C 4PI2A 3QFJD 5J6GB 4K2UH 3REWB 4G7RB 3PP3K 1BQKA 1L6PA 4KI5D 3VGHA 1L9NA 1SF3A 1BF5A 3NK4A 4LQFH 4A2MA 4MS8C 3HFFA 2X4SA 5DYOB 4Z3FA 2IH1A 3PAYA 5FKAA 1S3KL 4POUB 3RA7H 4HIIB 5DC2A 5FOBB 3N55A 4MJJA 1R46A 5E1AB 1W2KT 2HN7B 1KOAA 2VC2H 3LEYH 4Y2DA 1EV2E 2WWMD 3II1A 2WBKA 1EIBA 2BIMA 4R8WH 4ZO9A 5FW7A 4F9PC 2A0LC 5CF3A 5A7BA 4OBSA 3U9WA 4A7QA 2CA4A 5DDHA 1NL0L 3HKFA 4CSPA 2XZZA 1NM4A 1FA4A 3N85H 1TVHA 1MXDA 1T2QL 1CK0H 1V3MA 4O9HL 2XRAL 1D6VH 4FG6D 2Y69B 3HLAA 3LMJL 5CEZD 1FO0A 3GC3A 3LH9A 3NCEB 4RWYL 3EH3B 3UZVB 5SWZB 4WJ5B 2BP0B 5DVMA 1OM3L 4ZAKC 3GZKA 3B34A 2B0SH 5D2LB 4BCXA 1E5CA 3K0WA 4F1SA 3GZPA 4W6YB 2BFGA 5DD5L 3ILPB 4U7MA 4UOW0 4XMLH 3VD7A 4RX4D 3NJVA 4Q9QL 5LAXA 1UZ6F 2G5BB 4QRQB 5ISZB 4FS0A 5F1SA 5IW3A 4MB3A 1A3LH 1SYSA 2J4WH 4HIHB 4DN4L 2FE0A 3CFEA 4DZ8B 5EUOE 3OKEA 1U8IB 1PSKH 3HHSB 3CZLA 2H3KA 3VXMD 2XN9E 1V54B 5IK3A 5FYKE 1I7ZA 3RQ3A 3WY1A 3U7AA 1AR1C 5HD8D 2F19L 5EF1A 2FNBA 2N4IA 2WLJA 1QSVA 1X5IA 5MEND 3ILQD 1Z9NA 1SPDA 5DGRA 3QXVA 4KK9C 4PJCE 2H6OA 5GS2D 4PRHB 3VXUA 4C56D 2BPBA 4Q58C 2FDBP 2KERA 2Q2EB 5J6HB 2CBQA 2E74C 3HPJB 3BE1L 3EGXB 1R3JA 3KWVA 4WSJA 2HFTA 3ATBA 2PR4L 2WCSA 3DI2B 4PHZA 4CSZA 2OK0H 5KBDA 1QBLL 4EZLA 4DO6A 4A68A 4E0RB 1EMTL 3S3JA 1JNLL 1ZS2A 3GKWL 1MREL 4M6OL 4YVNA 5FUOL 4EBQH 5HHOB 5KUKA 4HHGA 4YDIH 3CIAA 3MJGX 3F7QA 3IDJA 3LNDA 3T0ED 3KPNA 2CK0L 4ZI8A 3OB0H 5KTEH 1LWRA 2EVFA 2MPAH 3DRTA 5I1IH 3NUKA 4YXHH 5MEOB 1JP5A 2YMTA 3L5XH 1QQDA 1NC2D 4PJEB 3AS0A 4YDMA 2XSKA 5ABDE 5C2BL 5KYXA 3M86A 5EZIL 5EU6A 5DVOA 2OMZA 1OARH 2H1PL 3O2DH 4KH2A 1SEQL 3QCTH 5FGRA 2ETWA 1IGJB 4CKVX 4D7PA 4HWBL 2BDNL 2ZYRA 4TUOA 1CDYA 1TZIA 4KXAA 4XCFH 1FH5H 2JKWA 2PWGA 3N06B 3R4RA 4Y1AE 1K6QL 5ETUB 1QFHA 2JTYA 3P9LB 3BCFA 2Q3AA 5I0VA 4HIJA 4KHTH 1R5IA 1S8DA 2IBGA 3G04A 1T1WA 4QAWA 2CO3A 3TS8A 1CQYA 1T0NB 3BOVA 3OKMA 4GLRH 2ZWKA 1S78D 4KNSA 4Z7QB 3AAZA 1JPSH 5DJ2A 4DNLA 2XTJD 3RI5F 3RWGA 3RVVD 4UQBA 4P5TD 1AY1L 5EIIA 5L2KE 5IROD 3BUQA 4Y19E 2MEJB 2HUEA 3MLVL 3HE7D 4LPCA 3A6OA 4PRHE 1JFHA 1M1XB 4LVHB 5SWQA 1RK0A 5SWSB 1U8HA 2C26A 2WCGA 4IOFD 1D9KC 5JIIA 5I19L 1LVEA 2F8OA 3CZFB 2CR6A 3D25B 1FH2A 5DMIH 1S6NA 3LZQA 3GPEA 1T20B 2XCMC 5CZXD 1I4FA 3ZDYB 2IDSA 3QZOA 1PLCA 2B15A 1F3JB 3SDAC 2R15A 1DVFB 4JRFA 4RISL 5EIVA 5I30H 5C09E 2P7TA 1DVTA 1XBDA 3WTVA 1P4LA 3SDCC 1ZHNA 3DSFL 1F3JA 2IANE 2FL5A 5GS3A 4H8VA 4L3EE 2WMPB 2CRZA 3UMNA 4G59C 5JYMA 2FWLB 4PU2A 2EICA 4NQSB 4BFNA 4OCLC 2XNAA 1IGTB 2J21A 2OMYA 3MPCA 4PJEE 2W1NA 4LLDB 4XVUD 4X98A 5IFHH 3FQRA 4WJG3 5IQOA 2I9TB 4OGAD 2OMWA 2GTZA 3ZKQD 3V10A 2R69L 3IDMB 1RZPA 4A67A 1M1SA 3RU8H 4X0KB 5EIIB 2AJ3A 3QS3A 4J7RA 3JV6B 2VDPH 4PY7A 1FAIL 4LFHD 1JNHB 2B7DT 3TBTB 2IMNA 4LNRA 4Q2ZB 2YGNA 3T1FB 4AM0A 1MSPA 2DQIH 1A0QL 5CUSL 4HBQA 3F58H 3L3IB 3BT0A 5GJSL 5ETUA 4X4ME 4AITA 2YQBA 2DD8L 3SCMD 3RVWC 5CR8A 1ACCA 3CFKA 1I1CA 3MJWA 2X9ZA 5KN5B 3NCWA 4W81A 3MA9L 4X5XB 1QZNA 2DWDA 2QVIA 4YLCA 5T1MA 4I77L 2CLZB 2JJUA 1L9MA 1T2XA 4U33A 5SWSE 1BQUA 2R8SL 1SDDB 4P4RB 1N5AB 3ESOA 1CGYA 4XE0A 5CAYB 3FQNA 5HHNB 3ZK0A 5IJKA 4IKNA 3SDAA 2DQFB 1IEAB 3M8OL 1FL5A 1Q0XL 3VI3A 1Q72L 1P5UC 3IF1B 5D7LA 2HKHL 4ODHL 4QKTA 3CAFA 2BIQA 3B1TA 3F5WB 3Q6GL 1X5LA 5KSBB 5C09B 2ROYA 3LSOB 1JTPA 5JPMC 2IAMD 3UAFA 1RK7A 1BZ9A 1YLBB 4AWJC 5TK4A 3SDXB 4E0RA 5DJZA 2D9CA 3MRKA 1A1OA 5C0JB 2ICWJ 3IJHA 2HFEA 4YC2C 2VWEE 1NKOA 5L6YL 5CEZL 2FBOJ 4LSTL 1EVTC 2ITDB 5C07E 1OP3H 2JIXD 4KUZH 3OSVA 1O7DE 3U2IA 1HQRB 1EFXD 1J8HB 5DQ9B 4PB0L 1PZDA 1MFCL 2PPDA 3S97C 2ZUQB 4NJ9L 5JPMB 3D33A 3B83A 1H5BB 4KAQH 3I3BA 1JN6A 4HT1L 2XT1B 4QHKI 1OP3K 1FG9C 1FNSH 5DS1A 4Y7MA 5E08L 5PAZA 3DOHA 4G7VL 1SMAA 4WWKA 5FO7B 5KBNC 1MNUL 3L45A 4IJ3B 3ZDWA 3IKCB 5TQ2H 3HB3C 3HJEA 4HUXA 1EAJA 1QBLH 4CUCA 3H9SA 4XAWH 5D7IB 1DQIA 1WBZA 4NFDA 4K3JL 4PV9B 3S34L 1KB9J 2QHLA 2D31B 5EU3B 2GJJA 3P2BA 3CFEB 1NGPH 1JGVH 4S1SL 3GXNA 4HPYL 4E9XA 3T4AB 3VRIA 4Z3GA 1OAQL 2DQDH 4QAMB 3UTPD 1KC5L 1DYZA 3V95A 5HD8C 4JGJA 3BZ4B 32C2B 4OZGA 5LCVA 3WTWA 4MJ4A 3WEOA 2JE8A 2DBJA 4H1LB 4X9GA 1BVNT 2YD5A 1TYRA 2WZPA 1PS3A 1GRWA 2WBJB 3WTSA 3N6YA 4FFWC 2XTSA 4PJXA 4X4YB 1UD2A 2ID5A 2J43A 2QDVA 5KSBE 4H8PA 1VGEL 3Q3GB 3HC4L 5C0CE 4DZBA 4NQDD 1VB9A 1G7HB 2BNQA 2DQJL 4HSCX 3T09A 3VXPB 4NN5B 1KGIA 2IPUK 3MRLA 4XI5C 4FQ1H 3MLXL 4Z95H 3P4MA 5KSAC 2Y7LA 3HZKB 4HIXL 1X9LA 1QVOB 2NUPA 3NN8A 2P8LB 2P1YA 4M5YL 4OF8A 4UM9D 4AYDC 3X3FH 2H0PA 2BERA 5FC9A 5C9KA 2LU7A 1F6LL 2WYHA 1BQLL 2KQMA 2JK5B 3SDCB 5BOPA 3LKSA 2Y6TE 3B9KB 1RLBA 4PJBA 4TOYL 4YWGH 1YECH 3C6LB 3VG9C 5IEKB 1LEKB 3HG5A 1XGPA 1JV5A 3D4YA 4M8QA 2W07A 1T2JA 4NRYA 2IH1B 4QO1B 2VQ1B 4PRIA 1XGUB 3A4DA 3PL6A 3DGDA 3ME0B 1GS8A 2YPKA 4G5ZH 2X1OA 4Y89A 2OYLA 3VGAB 1KJ3H 5J6GA 2YOAA 2LT9A 5CINH 5D7IE 3KWTA 2VXSL 3LHAA 2X6AA 5IVZA 3THMH 4D8OA 4Z7NE 5F9DC 2J7LA 1ZSDA 5A2LH 2VDNL 2QSCL 1DUYA 3UG5A 1ZTXL 1RV6X 4MS8D 3CXHJ 4K94L 1TJMA 1O9ZA 3U4EA 1W72L 4QRBA 4U31A 4X6BB 4YAQB 5KS9E 5JIPA 3KEDA 2AJYH 1MHPL 5B3SB 2WVSA 1CFBA 3SCMA 3LIUA 4RIRA 4BYHA 1QFWM 2WLIA 2ZP9A 2OYPA 5CCGE 4UV4L 4DGIH 2YXWA 4YDKL 4POZC 5T5NF 2DWEB 4NXKA 4QRUB 3M1BB 1FI8C 4EDWH 1H3UA 2EDOA 3RI5K 2OMTB 5K9JH 1P2CB 4G8GA 3QNFA 4O51B 3W0WE 5F7EH 1I1YB 1QWHA 2YRLA 1GYVA 3EH2A 4L8DA 3TF7C 5DR5H 2PF6A 2V7HB 1W80A 1I9JL 2OPCA 1JWUB 3TYGL 4A39A 5KYUB 5KSUB 1WZ1H 4WW2F 5KS9F 2K3HA 4PJDF 3UMTA 1NDMB 3AU0A 3HS0A 3QDME 1GZQA 3HI6H 3KBHE 1LWJA 3KE0A 1OAXH 3QJZA 3B9KD 1OT1A 5BNXD 5IB4B 3L3KB 1A7NL 1VPOL 4YHZH 4GYBA 2HJKA 3T77B 4OSUL 2X10A 3L3GA 3ROOB 5CILH 2EDRA 4QJ5B 1BFTA 1F00I 1ZTMA 1ETZB 4R5XA 1URZA 4IBYA 2ZSVA 4G80A 5F8RC 2XFGB 3TT1H 1E0OB 2GJPA 4QRRB 2JELL 4NPYA 3B2XA 5C3LD 5ES4B 2R1WB 4TLUA 3IJ7A 2N7SA 3QSKB 1XF3A 3LDBC 3UTSA 3EG9A 4N2LA 3B7SA 3IDGA 4YE4H 3VFMB 5IESL 4UZSA 1XGZA 3OZ9H 4O2EA 1AZBA 1A6TA 1IM9A 1OTUD 1XHHA 2JF1A 4IRJB 3QUYB 4FQCH 4OJYA 3SBWC 4XVOA 5IW6A 1ZD6A 2D7TH 2ESVA 3FT3B 5GRVL 2ZCLL 5FB8A 5EN3A 5TH2B 3BPNB 1WUZA 3VD3A 4KQ3L 1DP0A 2EIBA 2WXIA 3KR3H 1G1KA 3M17B 1E9PA 2I85A 4P46A 2YGPA 3GT6A 1FUNA 2ZNWA 4JZJA 2NZ9D 3D69B 3ZT6A 4BFJA 3AGVA 2CO7B 3GMRB 5A2CA 1XB3A 2VO8A 3QDMB 2ITFA 4OLEA 3X3GL 4XN9A 4LESA 5KSAD 2F08A 3L95A 3EJQA 4MD5B 4OSUH 3RWCB 4GI6A 2OMYB 5J8OA 1E5UI 3VXUD 4AEFA 5FYLD 5J89A 1HH6B 2CDGA 5GGQL 2NY2C 3WS3A 1RVFL 2AKRB 3U0WL 5F3BA 5KZCB 4IOIB 1YEFL 1NUDA 3GXDA 1DJWA 4OJFL 1EHLL 4DP4X 2VRKA 4QXTB 2F7PA 3OGOE 3D39B 2DQJH 1OSYA 2FJFA 1XGTA 2OQJB 5EO0A 5E8EB 43CAA 3FFDB 3HBZA 3SE8H 4ZTOL 3SZ6A 4Q6IC 2FJGA 1MY7A 1JPEA 5LAPA 4Z7UB 1Q38A 1CMOA 3RGVC 2EDBA 3H55A 3H7BB 3WY2A 2X6CA 1NMBL 5DD5H 1A4KB 1CFSA 2X12A 1RK0B 3EOTL 1RMFH 4U7SA 3BRGC 2CCLA 4WW2A 2BP3A 2CDFA 5EEUA 1A4JA 2DBLH 1TTRA 3VXRA 4GKZB 2MQ3A 3BJLA 4JG1H 2EDLA 4EE2A 5E4AA 2MIZA 1XR8B 3QIWD 4OUUA 2BNUB 3MV8B 1T7WA 5EZOH 2PCFB 4MSWB 1CDHA 1V5JA 2R0WL 2WNGA 3QGVA 5I66B 4PJFA 2DAVA 4EAEA 5DS2A 1OTSD 3P0YL 4MA7H 3BP7B 4UZUA 1YQ2A 3NJLA 5D71L 1PFOA 1PZ5B 3DMMB 5IFAL 2BVQB 1IGYB 1SOKA 1Q8MA 5JPNB 1VEMA 3CQPA 1RSYA 4PJAF 1O5PA 5IMLA 2VITA 1NC4D 4WCYL 4MAUH 2J8UE 3QRLA 3BVUA 3BGMA 5DGQA 3UYRH 2OTWB 5HXMA 3MODH 3LKQB 4I0KA 4JPIB 3RWHA 2ZX6A 3R19A 5KJRH 1NCDL 3QJRB 3MCLH 1N7ML 1OEZW 1FDLL 2XPGA 2MCAA 3BZEA 5D7LD 2ZKHL 5CP3A 1CFQA 3HN8A 3PP4L 2AEIT 3FCUB 4XNBA 2NX5B 1IC4H 4N2KA 3LIZA 2Q3XA 4QOKB 4DEPC 1L6ZA 3CHPA 5DJDB 4CJ0A 4HBCH 4R97B 3GMOB 4LEOB 4PTUB 1PZCA 2NY5L 4KFZC 4S1RH 1OLLA 2Z91B 2IQ9H 4HCRL 2F6AA 3UTTA 1OTTC 2NX5A 2HXAA 5FO9A 3MRFA 4F20A 2QHRH 3L3JA 4YHZL 1ESOA 3WIAA 5F0LB 2RR3A 1HL8A 1YPZA 4XMWA 1CTOA 1IAIH 2ESVD 3RWEB 3I9IA 3ULVD 3Q5OA 4AYFA 3R8QA 1OPOA 1RXLA 3NCJH 5HSFA 5I6XC 3P3RA 3MUUA 3FT9A 5B1KA 3K6SA 1UVQB 3N41F 2UV3A 3D0VA 4G43B 3QUYD 5JIDA 1JF1B 1Q4NX 3RPBA 1AH1A 2X0VA 3S35X 5KBLA 4YSAA 2XX1A 4HDIB 3R4DA 1EO8H 3FUHA 3KDMA 2PTVA 1ED3B 3BP7A 4XCFL 3IDXL 1YAIA 3SQBA 2YLHA 1CDCA 4PJFB 4J3OF 4HK3N 1I8MB 1IM3A 3QIUB 3KWWA 4L3EB 4GO9A 5DLML 2XTJE 4RRPG 2Z1PA 1S9XA 3EO0A 3FRUA 5HGHA 1P5UB 4WI4A 5D4QA 4JPWL 4OQTA 5D8JL 4PPTA 3E0GA 4ZFZB 1CR9L 3O0LA 1FGNH 4Q74A 2VMDA 2A73A 3C87A 1G7LA 2NOYA 4MRCA 2UXGA 3RJDA 2DWEA 4QRUA 3MRBA 3GRWA 2IV8A 4OLUL 1Y6NR 4JRXE 5M95B 5FO8B 3AROA 3C5JB 5E6SB 1SHMA 4MTMA 2KI6A 4PWJA 2O6FA 4LLYB 3US9A 5C6WH 4JDTL 3WS6A 4OZGE 2VZ1A 3FU9A 2YEZA 2JV6A 1AR2A 3STLA 3FBQA 1J88A 3DRQB 5FWQA 3V0AC 2D2CC 5AW5B 2J8HA 2VM4A 2QPDB 3GIVA 3P4OB 3QULA 5F7NC 5INCA 5DD1L 4GXVL 3ZT7A 5F9OL 1XCTA 1E3XA 1O6SA 3F83A 4X9IA 3KBFA 3DKHA 4DP6X 2SEBA 3B5HA 4K8RD 2DM7A 3BKYH 2MCG1 3EJTA 2ZKWA 3SY6A 1S78C 2CDGB 1NCNA 4HV8B 3SDCD 3SGJA 3VFVB 2J1WA 4XNZC 1AAJA 1JSYA 2F19H 3EBAA 4NC2B 3KPPB 2PR9A 4W4OC 3ZIYA 2B1HH 4TMPA 2VW4A 1RZKL 2AJXL 1JZ5A 3PPSA 3LKSB 4PRAB 5KSVB 1TJXA 2F74A 1J10A 5DWUL 1T1XA 2J56A 3K6OA 5D7KE 3WAKA 2HVJA 2YD6A 2DLFL 2BP8A 3QPXL 2R0KL 1KCLA 4ADJA 5EORL 3SDXE 4XNAA 5I74B 5BS0D 1JNJA 1K85A 4S1QH 4OLWL 1BJ8A 1NDGB 3R0MA 3UGUA 3UTTE 1CLZL 3QUZD 2YPLE 1OSZB 5HHOE 2YXMA 3T4YA 1E7VA 1MAKA 4IJ3C 4EEEA 4I13B 3FTUA 5C6TL 1OGAB 2Z8RA 3K6FA 2DIEA 4LP4A 2UZYA 3V6ZB 1XT5A 4OF5A 2O5ZH 4AZ8B 3BWUF 3ZL4H 3PQYB 1YN7A 1P7QA 4LF3A 4DESA 1NGQH 2X6BA 3MRNB 1TZOA 3LQAL 4OI9A 3DSNB 4NCDA 4C56A 1F6FB 5CSZA 5E6YA 4OZGB 4G6FD 5C97A 5K59E 3VMOA 1Q72H 3ARFC 4JREC 8PAZA 2IDCA 5DD6B 2YD7A 4GXVH 5B3JF 4QHKJ 4UNTA 1KUMA 4ETQA 4DKFL 2FQEA 5BRZD 3CFUA 1Z66A 3BKYL 3HRPA 1RZFL 3H9SB 5DHDA 3VYPA 4D9QD 4LSDA 3CCHB 4XODA 1DJXA 2AMUA 3K2UH 3X12B 4ZAKB 1WD9A 2FB4L 1LO5A 3RDJA 2MTPA 3TH4T 2VXQA 2XQBL 2ZYSA 1OAQH 1P69B 5IR1B 2ZD0A 2YARA 1NINA 2DLFH 1IU1A 2WZAA 4Y9BA 2ZCHL 1HHKA 3GXPA 2XWBA 5KYUA 2AK4B 2NY1B 4JVWA 4DN3H 2DZEA 4N3TA 4Y2OA 2YPLA 1D5BB 3HG4A 3KPTA 5KVGH 1QW9A 3DVGB 1I1AA 4Z7WA 1ID2A 3ZJAA 4M1GH 5A40E 2GI0A 4MHHG 1FFPB 4JFEE 1H0DB 4E41A 5I8EB 2H9GA 4LHJB 3BN9D 4QXVA 3D3VB 4HXAH 3GNML 4QTIH 3FU3A 5DHMC 1WS7A 1GGBH 4X9BA 1L0QA 3EGSA 3L2NA 3B37A 3MU3A 3V7MA 2WQ8A 3O8XC 3RLSA 5IJCC 1NAMA 1QP1A 3LX9A 3PWPD 5B4MC 4EN3A 5SWZD 3HE7A 1T03H 1LMIA 1U8MA 2VLMD 1OD7A 3GTTA 3MREA 4HUUA 4JO3H 4K3DL 4KKAD 3O3AA 5GHWL 3TWCH 3QIBB 4Z77B 3FUDA 2OM5A 1TVDA 2H3XC 4LSRH 5DJDA 1IIKA 3WBDA 2ZUQC 1SY6H 5AUMB 3V0IA 1NICA 3AQXA 3UFIA 3LPFA 1D5RA 4EI5A 3DPBA 3WHE1 3LKRB 1TIUA 1XV8A 1WHOA 3ES6B 4WWOA 4XMVA 1NPUA 4PJ8B 4U1MB 3MA7A 4ANUA 5FYKL 3ZKMD 4BSJA 2C1PA 5KAQF 3LEVL 3IDIA 4HKBB 3WFEL 3EO9L 4XNXH 3ZE2F 1RU9L 1M9SA 1ODUA 2BVOB 1BVNP 5E1GA 3WEXA 5F7YC 2KDYA 5F3HB 5B3NA 5JW4Q 1S7QA 2P5PA 5E9NA 2FATL 5D1XE 2HLEB 4FQLL 1U8KA 2ADFL 5HI4C 5IQ9B 4X98B 5T3ZE 25C8H 2CIKA 2VAAA 4KROB 1BFOB 2WWKT 1V55B 5ITBL 1MF2L 2H4EA 2XQYG 4UQ3A 1N5YL 4XPGH 1J8KA 3OG6B 3I50L 5DQJA 1Y07A 2DYPA 3OPZH 1UH2A 4QDGA 3UADA 2PYFB 1QRND 2AV7A 5D6CB 4QTIL 3RZCC 3OPUA 3BVDB 1OD9A 1J5HA 4U0RC 2XX0A 3UTSE 2ICWA 2ARJQ 3CZKA 1U21A 1HXMA 2CO6A 3MRCA 1JMZA 2CM6A 3KNBA 4NT6A 4Y1TA 4MQ7A 4NQXA 3H85A 2XVKA 3TZVD 1DLHB 1EEQA 2ZCZA 1OGPA 1Y0LB 2OI9C 2FD6L 3FN9A 5J0BA 4ZOCA 4YEFA 3PWNA 1NCWL 1H8OA 3RX7A 4XNMA 3OLIA 4CMHC 4JAMB 1DSWA 3CZEA 2Q2LA 1A4KA 1CFSB 3C6EA 3HMXL 4YHML 3VGEA 1A7NH 1VPOH 3EO1A 4QRAA 2YA2A 4UQ2A 3UERA 3MLWL 5JOFA 3ZTJG 1T0NA 1D6EA 4K8RL 5EU7C 3CDGB 4KGJA 1T1WB 1S9YB 1YYLH 4UT9L 4N4YB 4A55A 4PH8A 5E8DH 1DO5A 5C6TH 5A43C 3OKDB 4J2XA 3CE1A 4DGVH 1K4DA 3G5VA 4R26H 43C9B 4QF1A 4G83A 1SYVB 4YE0A 4M56A 3X11A 1JGVL 4JFFD 5ITBH 4L29B 4M4RA 5IBUG 5EEWA 2UX6A 2Q86B 12E8H 4M8VA 5FYJU 4Z78A 4ZUTA 5D93B 35C8L 3KEHA 2VLRB 5C0CD 3SIKA 2VZOA 1NUNB 1YN6A 1D5MB 2D7TL 3GGWB 1JGIA 1OSEA 2O1AA 3GHBH 5I0DA 2JB6B 4LASH 2OP4H 3L3OA 1O7VA 3R18A 1MJ8H 1QTPA 3ZKSD 4WJKB 2FGZA 4AQAB 2FLMA 1VJSA 2DQCL 3BKCL 5DT1H 3CDFA 1MCKA 1TKWB 1SMDA 2XKNB 1QOKA 3BP5A 3GLDA 3RIFK 4NDMB 1NIBA 4KQ4L 1RPUA 4C8XA 3QE5A 3D9AL 5ITFA 5AVYB 4YSCA 3O11B 2XY2A 4XPBL 5I5MA 2KT6A 3NMEA 4UI2A 5T1MB 3N5AA 5HI3D 3U1PA 3KPLB 2HP4A 1ND0B 5FECB 3ZTNH 4KXCA 3MLWH 4K71C 3G5XB 1X9RA 4WWID 1U8QB 1DVUA 3HC0A 4MKMA 4MQXD 5HGBB 2F9BT 3IM1A 4LQ1A 4LDCA 1QR4A 1S7RA 2BXZA 3IFOA 1EAQA 3FUKA 4JMNA 5EHFA 2ISDA 1EGJH 3V5HA 4XBMA 4Z7NB 1DQML 2A38A 2VDOL 1KCWA 3BUPA 3P9MB 3RVVC 1RJCA 4S0TD 4Z7QF 2FBRA 4HS6B 4WNQA 2GJ6A 4YL9A 3SGDI 5D70L 5ICZB 1CLVA 3FL7A 4XNMB 5LNGA 3V2AR 4MX7B 3A47A 3N50A 1RZQA 5HYJA 4Q6KA 2H5UA 4Q89A 4Y4HB 2ICEC 5GGSB 5GJTH 1NCAH 3ZYOA 2VLRE 1NCCH 4YVUA 5IGXL 3MV8E 4ONHB 4TNWK 2WQUA 3ZR6A 5GGVY 5KG9A 3HS0B 4S2SA 1QEWB 5IF0B 4NT6B 3CFJA 4XC1H 2XQYA 2BW5A 1S7UB 2IPTH 4YDKH 3OLDA 4LU5L 3ETTA 4BQCA 3NCYP 4FQJH 1DBMH 2XFXA 2MOGA 4MNGB 3EBIA 1CF1A 1UWXK 4QYOA 4ZRGA 3T0WA 1KNOA 1D9KA 5IVXB 2CSPA 1EXHA 3NFPB 1I1YA 3FONA 3QJQB 4YGVB 4XWGL 4LBEA 4OR1A 4OV6F 4OZFG 1S3RA 4XI5D 3EYSH 5B7EA 2YAOA 3WNKA 1I8UA 2XVLA 4XMKH 2YGVA 3D2UD 4HUVB 5SWQB 2VERA 4FTVB 2BSED 3HBQA 1DBBL 3LRHA 3VE0A 3LRGA 1NCIA 3IAGC 4OZFH 3O4LB 1YNTB 3D0LB 4K23H 4YSSA 2O61B 1WP6A 4XHJC 1UADC 3FF7A 2IIJA 2OMNA 3QCVL 2FSDA 5DJ2B 3RDTC 2F8XC 1I8AA 2V2WB 5GIRB 4BFEA 1U41A 3C09C 3K4ZA 4JQXA 4KX7A 1R9FA 1BOYA 4DEUA 5C8JB 5DHVB 4RESB 3IEAA 3P4NB 4EI6A 2F18A 2ILLA 2AW2A 4UILH 3NP4A 5B38A 1SOQA 5I1AB 5KJ7E 1IVLA 4KO5A 2BM3A 2MQ0A 1R3IH 4WFFE 3SGKA 3W2DL 1KCSH 3UPCA 1KTCA 4NQQA 3QUGA 3QIUD 4L3ED 5TFSH 3RGVD 2RH0A 4BDVB 3KG5A 2BVTA 5DA4A 4J4PC 1W6LA 3J07A 5DVNA 5IFAH 1T1XB 3C5ZD 1XCQB 3N1PC 1AHWC 1IBBA 4M48H 1XEUA 1SN2A 4GY4A 1WT5A 1CTNA 1B0WA 4JDZA 3NH7H 4K3EL 4J6IA 2OLDA 1BA9A 1TPXC 3AMLA 1I82A 1WAEA 2J5WA 3MCLL 4Q6IA 1F4YL 4GXUN 1W0WB 4LSSL 3ZKXB 3V4PB 4XWGH 1J18A 4OFQA 4UCFA 2Y5TB 5DA0B 1T0PB 1NBYA 1HXYA 3MRRA 2YMOA 3ZQXA 1YRKA 1FV1B 4A37A 4Q52A 4KQ3H 5I73C 4UIMA 5FO2A 5I8OL 1QR1A 3MC0A 2BSBA 3VQMA 3F7LA 3HBPA 3R06B 2I07B 1CGSL 4ICWA 4NS0A 3VXOB 4XXCC 4X6DB 2ZOWA 1TJIH 3QQXA 3V0WL 5IF0A 4LHUD 1TPXB 5GXBB 2XTJB 1NUFA 3LRLA 4NKOB 3BD3A 1NCUA 2GK2A 4GXUM 2YAQA 4YSRA 4KKNA 2HRPH 2EUXA 1KJMA 2HFFA 4AIXA 4NNXB 4Y1AD 4Z0BL 4E2OA 3D39D 3U1QA 4M4PA 2DS4A 3TTYA 1JZ8A 3NOIA 1N26A 4NM8L 3ARXA 3U7YH 1T6BX 4M7LT 3OJMB 2NLJB 4WK0B 3S3BB 3PDDA 4YBLB 1GL4B 2FEDD 1F2XK 5EA0H 1UD3A 3LQAC 1G5AA 4FKKA 5JZ7D 1UGNA 2ZX5A 4UNVA 4L1HA 3BPLB 4MXVE 4PJAE 1G6RL 3ZL2A 3R7QA 4QRPD 5A2FA 5J7CC 4UIKL 5J12C 4YHKH 2A74A 2IF7A 4C58B 1N8ZB 1WFOA 5IV2B 1HTYA 4UU9B 4KDTA 3GLAA 2DL9A 1X7QA 4IS6B 4OFVA 2DQIL 3UGEA 2GBTA 2H1LM 3L5WA 3MMEA 5AL0A 4M03A 4OQTL 2Z35B 2QGDA 3B3IA 4WUUA 1P7KB 1FYTB 3F05A 5IOPA 5T5FL 4C54A 5FM8A 5J13C 1P1VA 2XIIA 2P8PB 4ISVA 4KITB 1W0YT 2LV4A 1NMAH 2IPKA 3APCA 4PJGE 2KUTA 4Y19A 4LDEB 3S5LA 3VX1A 3MUHL 4PGBB 3L3OB 2MNUA 1EZSA 2YUXA 1KWGA 4HA1A 4JDZB 5IHUL 3CLFH 1ZANL 4TPRH 5TJWK 2EACA 3JYCA 1JD9A 5CCKL 3IVKA 4AQ1C 4LCYB 3H53A 4BSWA 3KCWA 3SOBL 3Q8BA 3LIZH 4CVZB 3ZR5A 3FUFA 2Y0SA 4JRXA 4P2CG 5HI3C 2F53B 4XVSL 5ECJE 3BHBA 1TTFA 1ZS8B 2J5LC 4F7TB 1MFCH 5L0QB 2LU3A 4AQ8A 4LSVH 5FA4A 2PO6B 4IMKC 3H2WA 3K3QA 3P4NA 2IAMB 3ULSB 4YR6A 3SKNA 1ETA1 3GO1H 2UWEB 1N67A 2DN7A 5DVPA 1UWEH 1HWGB 3FT4A 3JV6A 3CZJA 1WWWX 2G4EA 5CGMA 1OOWA 2EE6A 5EBMA 4X0KA 5KYWA 1WAAE 5JMRA 2L04A 2ZOKB 3VSTA 4U4BA 4IRSA 4OCXL 5C0BD 2QSQA 4E36A 3HNVH 3H9SE 1FVDA 4RRPA 3BLKA 4UQCA 5DQDL 3SDDC 4YWGL 4TOYH 4FTVA 2IOIA 1PLGL 1JNNL 5D55A 2KYIA 4XX1E 1G87A 3NJGA 1G5GA 1OVZA 3FC8A 2AXWA 4FXTA 4R0LB 3RAJL 4JANB 5I18L 5DJYA 4BH8A 4XOEA 1QI4A 3QQ4A 5DRZA 4K9JA 3TO2B 5GS0L 2KZ1B 1JG9A 5CGYD 3KLLA 2EVJA 4JUSA 2EDXA 5DJYB 2E8ZA 1S5IH 4GBXA 5TGBB 3O6FA 1AZUA 4M7KH 5GZOC 2A0LD 2AV7B 1KACB 1H9VA 4P3CL 5DZAA 2EC9U 2XJKA 1I4FB 4YIQB 1J86A 1MCBA 2DKMA 4PJDB 4ALAH 4B97A 2AI0L 2KLRA 3DMMC 1G7PA 3B2VL 3C5SA 5IY5B 4LEBA 5DJXA 1BFVH 4HS3B 1K8DA 1X44A 4F37F 1HINH 3KCPB 2AGJL 2UY7B 2WXOA 3AABA 4P4KC 1V10A 1Y1UA 1NFDA 4UV7H 4Y4KC 4UMSA 1ZLUK 2P80A 1LD9B 3JV0A 5FKPA 5G55A 4N0CC 4DP5X 5I8KH 4I85A 4Q9CA 3V5HB 2BSDA 3FQUB 4ZS6D 5DRNB 4WI7A 3GEFA 4EN2A 4M61A 2XG4A 1P6FA 4E9WA 2GG1A 2PW2A 1IQDA 5EFIA 1A21A 4JRXB 1SQ2N 2QPFA 2F54D 1YHPA 2BSTB 2CIIA 5GQBA 2LW3A 4LLMB 1HHJB 5C0FB 5KVGL 1LE9A 4MXWH 1E4XI 3LKOB 1BZEA 3ARFD 2M8XA 3KDPB 4V1DE 3GSOA 1JGEA 3HE7B 3O11A 3BMVA 3H2QA 4C56E 4YMPA 5FGSA 3TIDA 3QI9C 1FAKT 1HS6A 1DN0A 4JZJB 5D1XA 1ZHBB 3DRTB 3LV3B 3F7PC 4FP8H 4L1LA 1F02I 1M53A 3BEVB 1G84A 2NMSA 1N59A 1SUJA 3QZPA 5DC4B 3RL1A 4DGYH 4K5NA 1GAFH 1E3ZA 4KJWC 5C9JA 5D4HA 3TIDB 4JO2L 4LXFA 4D8PA 3CSYB 3EBHA 3IFLL 3GJFK 4LEXL 1IKFL 1JZJA 2VIRB 4AI7A 1G6RH 3WKNA 1HEZA 1WVZA 3I9GH 1KLGB 4LP5A 4Y2OB 1EAOA 3HE6D 4PJ9A 5EUKB 1YNLH 2AK4A 2W9EH 3RJOA 3QUYC 4GUQA 2AQ3A 2CZNA 1K6QH 4LDLB 1QTYT 4TSCH 2IANB 3MO1A 3T0EC 3OPZL 3KPMA 1AQDB 3MXWL 3WIHH 1NC2A 2CKBB 4DUXA 4ZXBA 4KKLC 1LEGA 5GISL 1RHFA 5DCCA 2J3SA 3X1EA 2E9IA 4PEEA 3T0EB 4JFFB 5TE7L 1S9YA 3CVCA 1QLFB 1L3NA 3QUXA 1N68A 1D6EB 2FUTA 1GIGL 5IHZA 4WO4B 1JZ6A 1OO2A 5E56A 3QCUL 4TSAL 5CLXA 4HS3A 2JCCE 3S88L 3PUCA 1DR9A 4AQ1A 1RJYA 1T22B 4P59L 1XBRA 3I75B 1QAWA 1CB4A 1F4XH 3VFGL 2VR9A 4FJZA 4HUWB 4GW5A 5CSZB 4ZQTA 4E42B 1M6OA 3SBRA 3O6LH 4X6DA 2QEJA 4XPFL 3SPVB 3TT1L 3QIBC 3G7TA 3MJ7B 4P5TC 1NCTA 4CJ1A 1JIBA 4GJTB 3SJVB 5FOJA 1MWAH 3WN5C 3QEGH 4NQCD 3T65A 4L4TB 3CX2A 5KVEL 1KV3A 5T1JA 3MLUH 4Q6IB 2YKLL 3B5GA 5E0FA 5B1AB 4A6YB 1MQKH 8CGTA 4WNSA 4MJIE 4N8UA 5DDHB 1Q9KB 1D5ZB 3TU6A 4MJ2A 3NCBB 1DEEA 3PGDB 3Q1SH 1NTDA 3AB0B 1ES0A 1KJ2H 1H6FA 1ZK9A 4JE4B 2OMUA 1N6QL 4WY7H 3FSVA 5EBMB 3ZE2E 1FZOA 4W9EC 1SOXA 1IM3D 1KYFA 3FT4B 4M6NL 2GBUA 3RZCB 2DMGA 4KJYB 4UTCA 1YEDA 5KVDH 1BD2B 3SQOL 2MNJB 3BH4A 1BLNB 2B16A 4TVUA 1BP3B 5E9DB 4BM7A 1NFDE 1G1YA 1EMTH 2SEBB 2MQCA 3CU7A 1ZGLM 4M6AA 2HFGH 3IS0X 1GH7A 1TYJA 1K4CA 4KMQA 4Z3JA 5ABZA 4KMTL 4NZ8A 5L88H 5FW8A 5HHXL 2HT4C 2V2WA 5GIRA 2P80D 4MDJA 2I5YL 4MS6A 1UOVA 1XGUA 3FB7A 1M7IB 4U6VH 1YEDB 3O9WB 2YD0A 4M8QB 3QEQE 3GXMA 2ZKXA 2IAND 3A6BL 1HX0A 2B39A 1RFDH 4PRDB 2WOYA 6TAAA 4PLKD 1I1AD 5FGCB 4CC0A 1N9PA 1JRHI 1IZKA 5HI5D 2V0AA 1JDAA 3QA3A 4ZMZA 3VCLB 3BW9A 3VM7A 5E2WH 4Z3EA 3QZLA 3SJVE 1BBJB 1NZRA 2EXWC 3JTSB 3MKGA 4F15C 2YKLH 3FYEB 3ZDYF 1RZJL 4D3CH 3CH1B 4KRPC 5IOPB 2IDUA 4I1NB 3W3BA 1ZKAA 3ISYA 3VWKB 4B60A 4OF0A 4QHMA 5SWSD 4OT1L 3SJVA 4DTGH 1VKXB 1JE6A 2D2OA 3CSBA 2F7IA 2VLLB 1KGWA 1LK3H 2DQHL 4MKTA 5T1LB 2R7EB 1RP8A 5BV7H 2FATH 5CP7A 3PDOA 2JLLA 5EZPA 3HFMH 5IVXE 3CVIH 1VKXA 4MJIA 4C4UA 4ZO8A 3RUGE 1QBML 1FLRH 2AK4D 4LU5H 1KCUL 4U3HA 1XMWA 4YUEH 2QPEB 2IWFA 4OJEH 3G5WA 2H1XA 1JZEA 5L7XL 1FBIL 1I8IA 4RFOH 3WOVA 4DHLA 5MENB 3U1SL 2DI8A 3VACA 4PBVC 5I73B 3O2DA 4RIRB 3MR9A 1T89C 5A2IH 1MLBA 4PSPA 1JN6B 3BXNA 1FP5A 4XWOD 2AMGA 2NQDA 2V8MA 4DVRL 2IALB 3NTCH 1UJTA 4NNYA 3T08A 2YBRA 5IHHA 2ZX7A 4K5MA 2WY3B 2HH0L 2W9EL 1IQWH 1MZYA 1JXJA 4P2QE 3EYUL 2VL5B 3QJHA 4HALA 4PJCF 5BVJB 1P7BA 3HMXH 1AXSA 5DZOA 1C16A 3ARUA 2UZYB 2ZIDA 4K8RC 3V6ZA 1FAIH 1HYSC 4WZ9A 4MA3B 3WLBA 4LGPB 4M5TA 3WS6C 4M1DL 5IBLD 4OZFB 1KWKA 1F58L 2ROXA 3BQVA 3IXTA 2BWQA 5KSBA 3BEVA 3N2JA 4OZHA 4XXWA 4GP5B 3BD4A 4Y4HD 1KLFA 4NZDA 1ZHBA 4F7KA 3JWDL 5EOCH 1YECL 2HLFD 2IFFL 4QRSA 4AT6A 2X4TB 3NCXA 4ZX5A 2XJLA 4JE0A 1I9IL 1QD0A 3RFRA 4OIBA 2NSMA 5FM4A 4I77H 4PCKA 3U36B 5AWNL 3SKOB 1P9MC 1QSFB 1SEBB 5TE4H 4KGLA 2D4DA 2HZHA 3OAZK 1S7SA 3HS0C 4M5SA 1VAHA 4MA1C 1PDKA 5C0ND 5I66A 5EH1A 4PJ5A 1U8LB 3FRPG 3BYYA 4PJ6A 3TEZA 1MWAL 2YZ1A 2J44A 5LGHL 3RPKA 1PBYA 2NNRA 2XZCH 2XTLA 3WMPA 4XN2A 1TCRA 4FQXA 3ULAB 1TYEB 1ZIBA 2PPFA 5LVEA 2VH5L 2ESVE 1YNTA 3D0LA 1BQSA 1ONQA 3LKPA 4Y2LA 2VSKB 4WFFD 4YHPA 5HVHC 5CO1A 1ZLEA 3FXIC 4CNIA 5DFVD 4AQ1B 3S36L 4JNXA 5DK0B 1QSEE 2NY5C 1A25A 1AQKL 1P4IL 2BMKA 2X88A 4MCMA 3J27A 3QPXH 4GI9A 2JCWA 4FHKA 4XP1L 4PV9A 3E8UL 1LP9F 4FF9A 4NQSA 4PJDA 3TBYA 1FFTB 5E6IC 4B5EA 1RD6A 1NEZG 2E76C 1CIDA 2AJSL 1UASA 3FHAA 2WZ0A 3LB6C 4ELMB 4L3CA 2R29A 2TAAA 1F86A 4GBXB 1EFQA 4ONGH 1NFKA 3FO0H 2DQUH 1NC2B 5C0EA 5CR1A 3O9WD 3ARBB 2DQEL 4HC1L 4NZFA 5FX3A 5F3BB 2RAMA 1KZQA 3KD4A 5MI0C 3D85D 4BH8B 4QJ4B 1X9UA 2IEPA 3DO4A 3QEHB 4JANA 2AITA 2YGOA 3KPOB 2HG5B 4GRWF 5ANMA 2HSIA 1LYQA 2CHNA 3RWCA 3VSQA 1IL1A 1LL1A 5GGTL 2OJ1A 1K8IB 3B6SB 3A6BH 3IJHB 1AKJB 3WXVH 2VIRA 5D2NE 5C0JA 4FFZH 4NQDB 4FMKA 2DH3A 3SDXA 5HGAB 2DQMA 2WKOA 4H20H 4BFKA 4ODTH 3CFMA 5ENWB 2UYLB 3BVVA 4WGVB 4ODBD 5EA0L 1JK8A 4MVBD 2OX5A 3HCVB 3MBXL 3C09B 2YSTA 3Q2CA 4MNQE 3RWEA 1M05A 1N70A 1P7QD 1P53A 4PAZA 3TNMB 4NHUA 2PO6A 2DQFA 2QZQA 2WSDA 3B9KC 5TDOA 2H7WA 3QO1A 1UYWH 3CH8A 4M3KB 4ESKA 3BESR 4WI6A 4I8DA 3EF7A 1VFMA 3HZMB 1GC1L 5CJOH 4HIPA 4YNYB 4IK7A 3S36H 4LLMA 2A6KB 4FL4C 3TO4D 2WQRA 3O81A 1JYXA 2P49B 4Z3IA 1CYXA 1KB3A 4PCTA 4X80L 2G5RA 1KXQA 4PJEA 4PRBB 4MXQD 1IQDB 2UZPA 1JAEA 1FL3A 1FZJB 2DEWX 3CVIL 1T1ZB 4MQSB 2GUOB 3JUZA 5CEXB 3V8OA 4MAZA 4G80B 4IBWA 4RGMC 1P84K 3VFUB 4IBQA 3ZTDC 4CC1A 4E9SA 4FADA 1IKOP 1TTUA 2JXMB 1FBIH 2JIXB 1UWEL 1AYRA 1I1AB 3S3PA 2DKUA 1IGYA 1OHZA 1AP2B 4RZKA 2CKBH 1KIUB 4WW2C 2Q86A 3CN4A 5C2BH 1IGTA 1IBDA 1CDGA 5AW3B 3QDMD 4UBDD 4NQED 4PRHA 2I32A 4P46D 1MRFL 4ELMF 2EEFA 3BSZH 1DVXA 5I6NA 5JO5A 1E9OA 1CXIA 2AEPL 4DGIL 4MXVF 2YUZA 4NOFA 5BZDA 3TIEB 5E5MB 3WJLA 3U0TA 3VGDA 4QXGL 4HWBA 1FPTL 5AZ2L 1NLBL 4JM2B 3GHEL 4PJGA 4QTHA 1MREH 4M6OH 4RGOH 5AG9A 4LSSH 4ZFGH 5DZJA 1JHTB 3Q9PA 3UAEA 1HCVA 1MCEA 2C1OB 2PCPA 5DEFA 4IRZL 2EUWA 4L0YA 3VXRB 3E3QE 1KF9B 4HJ0D 3RY6C 4Y7OC 2P5WD 2WINA 3GEWB 3RGVA 2KDGA 2J8UB 3JWNG 3PABA 5D5MF 5I1CL 5E70A 4L8BB 4AUUA 5EU6E 1KJMB 3KJ4C 1OP4A 3JWNC 3L7EB 4QMEA 3B2VH 5EF2A 5I16B 1ZT1B 1TZHB 5D1ZD 5HHMB 3EJZC 4YDLB 2YPVH 2O93L 5F1IA 5CLZA 3B9VA 4KI5E 1TUPA 1T21B 5E8EA 4B9IA 5KVFE 3GK8L 3N3EA 3RVUD 2BSSB 2Z92A 4FXLA 3VI4F 2J25A 3ALXA 3P0YH 1HQ4A 1ZS8A 1R3KB 3PHQB 4A2LA 1J12A 4Y16B 4WU7B 1SEBA 3E1F1 2BWIA 3ME0A 2FRGP 2A3TA 1HYSD 3QR2A 3JWOH 4ZFFB 1MCPH 3PAZA 1UENA 1LNUA 4BSVB 3WFCH 3M1OA 3H6AA 5G4MA 3INUH 5FM5O 3NA4A 4U05A 7TAAA 4NYLB 5E7BA 4Q9RL 1YEGL 3OAUL 3P2DA 3T2QA 2HAZA 5I1DB 4M00A 5T3XL 5HGGS 4MNQA 1J05A 3UYRL 1AG0A 1JHKL 2EILB 4HIIA 4NXSA 4Z8FH 2VXQL 4KDWA 4X83A 2F1AA 4BFIB 4JFEA 3LPWA 3LS4L 3VFVA 1NPJA 2W81C 3WXVL 3M46A 1KYDA 2NNXA 2FR4B 1JWMB 2GJ6D 4WKZB 2ZTBA 5DMGD 3LZPA 5A6LA 3DBXB 2YMXL 1G6RA 4M3HA 4RCAA 3FT3A 3Q3GA 4E9QA 1QHQA 1U4EA 2IAMC 3QNXB 1YEJL 3KLAA 4NO3B 2JKTM 3T0AA 2LLLA 2RCSL 1SGKA 5D7LE 1G0DA 3FB6A 4JDVA 1G9MC 3SGJC 3STLB 5EO1A 3AY2A 3VXRD 4ZS7L 1X4ZA 2WC7A 4YZWA 1ZVHA 3KVQA 4Y5XA 1UEMA 3MNWA 2PWFA 1H6UA 5DUJA 1SLXA 3BXNB 3DLQR 3L9RA 4HFWB 3T0EE 4JFFE 3EG9B 3RX9A 5HHME 4JHBA 4XZ4A 5I76A 2VZTA 4L8BA 1XMEB 2DQ6A 2HT3D 1X5XA 2QLYA 4NPYB 3OD3A 4UUJA 5DLMH 1G0XA 4AXWA 4WIQA 1HKLH 2NQ3A 4M9OA 2XWRA 5IK3B 1SDYA 2QVTA 4HLJA 1MH5A 5K1JA 4G6AC 1G1CA 1EPFA 2VKWA 4DZ8A 4TNWF 4H4NA 3HI1A 3LPGA 2YWZA 4JFDE 4R84A 2CKNA 2MOQA 3QFJA 4HGWB 4LRIA 1WITA 1IKFH 3IKCA 3CVHB 3T2PA 5KUMA 4KROC 5T1KD 4R4NC 3V0VA 3GS0A 3KWWB 4PJ5D 2HJKB 5D96B 3BCDA 1MUJB 3G6DL 3SQRA 3WNLA 5T1LA 1A0QH 2OCFD 4XCYB 3US0A 4ATWA 1CS6A 1CPUA 2Y06H 3CFNA 1KGCE 1UJ3A 4F2FA 5GGSA 5BUGA 3VI4A 4R26L 1JZIA 1UT9A 1ZVNA 3P02A 2E0PA 4F80A 2GPZA 5I0ZA 2N59A 2YEVB 4X7CC 3MLSH 4H1LH 1UUSA 2EYSA 5AVTB 5CHNA 2Y5TA 3V4PA 1PAZA 1PEWA 4URKA 5CWSB 4BHUA 2VC2B 4PB9L 5EN2B 1N12A 1II4E 5C09A 3O3DA 4HZLA 1LTXA 4NQEE 3FB8B 2L7EA 4ELDA 2PYEB 2FT8A 2J6EH 3C2AH 3GSNL 4MA7L 5FOBA 2BHFA 2YR3A 4K7PY 5DHXB 4G9FD 3MOBL 3O9WA 3J7HA 3EOBA 1ZJBA 3WIFB 2PW1B 2Y1ZA 1OGAE 3FB7B 3FOMA 4AGLA 1F6AA 3ARBC 2WBJC 1CLOL 4GFTB 5EO1B 4LF3B 4XB7A 2NCMA 3BSZL 3PQYE 3QUHA 4R7DA 3I6KA 5F1NB 5F9JA 4MCZB 4XVTH 2GTQA 1DQVA 3NGBB 4E5XA 4OQ1A 1NA8A 6FABH 1Z7JA 1I3RB 2FEEI 2ZT9C 4N9OB 3LMJH 4NP9A 4I4WA 4V11A 3B2UD 2P5WB 2OJEB 3QEQB 1BPLB 1U2HA 3IAQA 1JNHA 1AXTH 3TBTA 4H8WC 1NEZA 4JHAH 4E9RA 1E28A 4W93A 4JEGB 5FGCE 1KTJA 3ULUF 1KYOK 1RH8A 4G8EA 3S96B 3BQUA 5E8OB 1VDGA 5JXAL 1BF8A 4WY7L 1TTBA 3OLEA 1FRGL 1F3RB 4P5KB 1QHPA 4UQAA 1YY8A 4HKXA 2CWRA 2ORBH 2BHYA 2BH0A 3N9GH 4PCSA 1KCRH 1MRDL 3VI3E 2JK5A 3SDCA 2OYMA 5LG6A 4NYLA 3S8GB 1ZDSA 3KW7A 3MLSL 4UM8A 3KPSA 3BAIA 3WNNA 4ZUVB 2V9TA 4NGHH 3ZL1A 4P23D 3ZHNA 3B9EA 5ICUA 3NFPA 4FQ2L 1DJSA 4JR9H 3LS5H 2FL5B 4PJEF 3UTTD 4FP8L 3G5ZA 5FDWA 3UAJD 5E95B 5DI8A 2WYTA 3DUHA 4X9YA 4IBZA 5IW6B 4XVJH 2VRAA 5C1MB 2CO4A 2VW6A 1X5FA 2BSEA 1S5HB 2PYEE 4UF7C 4LHQB 5H2BA 1HIML 4L3AA 4P9HH 4UQ2B 4UTAL 3VFOA 4G8GE 2EVGA 3K1DA 2XZQH 1EANA 1U91B 3DTXA 1YYCA 3LRKA 3K2KA 4QR7A 32C2A 5JHLL 3JSSA 4YHPB 2QADC 3OMIB 4Z7UA 5HTSA 5HYIA 4HJEA 1FCGA 4GRLB 3RGVB 3RIAF 1VACB 3O45A 4OAWA 3TJEL 4KFMA 3LJ3A 2HJFA 5CP3H 3B4NA 4PVMA 3LH2H 4XNUH 1ACYH 4PGEA 2IH9A 4BKTC 3SGDH 3TEWA 1NGWA 5I23A 2GT9B 4Z1PA 1G94A 4D9QE 4GT0A 2DDQL 4Z7IA 3HC3L 4ONFL 4ZD3H 2BZ7A 4QXWA 2A77L 1KFAH 4LIQH 1HH6A 5FGBC 1J87A 3QQ9C 4FJYA 4GP8B 4QXUL 3A22A 4DAGL 4P2AA 1ORSB 4QKXB 4F33A 2B14A 2ED9A 3KLKA 3PAVA 5DQJB 1W72A 1S9VA 3DURA 5F97E 3NZUA 3G9VA 4PIBA 4S10A 4Y5YC 1NIEA 3D0VB 4CILA 1HSAB 2VMFA 2VUOA 3PWLA 1B88A 1G9NC 2PUQT 4TXVB 3G08A 5TK2A 4NI6A 1A6AA 4WFED 2WLLB 5IMOA 4ODVH 5DJZB 1TU2A 2R2EB 3VFNA 1U8OA 4ENED 5JIQA 1EEZA 1HSBA 3WFEH 4L4TE 2ZWSA 1FNFA 4H8QA 1RIHL 3NVQA 5IKCB 4RQQA 4AGMA 3AFLA 1EXUA 2JCCF 3GSXB 2DM4A 1J8RA 3NIDE 3FO1B 1WZ1L 3DPBB 3MBWA 4NWTH 4ZUTB 1WCQA 3K5SA 4N0FA 3CXFA 4LCCC 1LE9B 5F7DA 5JW4M 3NIGE 4MMZA 4BFBD 3RL2B 2VXVL 3FCGA 3RG1C 4A63A 4QRPB 4Y1AA 5C0RL 4Y16C 3UTSB 4KKLD 1G9MH 1HHGB 1UCTA 1FSKB 1BZ8A 5AOLA 4Y2NA 3K72A 5T1DL 2CUHA 1YC7A 2EDYA 2NTFB 5DRNA 5EORH 4L8SB 1YJDL 1OWRM 2B3RA 3SOTA 3OXSA 3HNTH 1H15A 1NFDB 2HG0A 3UACA 4AM0B 4ZO7A 2L7UA 3HI6L 5E5LA 2BHUA 4RAUB 4BZ2L 3FQYA 4G71B 5DZPA 5AAWA 3Q2NA 1ZT7B 3ASNB 3ECQA 3X13B 1UD4A 3JT0A 3K6NA 2R2BB 1Z5LA 3P73A 4JREB 1KJ2A 4HWZB 5TD4A 3V9EA 2F54A 5HHXH 1ID5I 4H0HB 1CZ8H 3MJ8B 3ZHFA 3BP4A 4XPGL 4JBSA 2GW5A 4WFGE 2CBMA 4S1DC 4G6KH 3QUMH 5FYJL 3NJFA 2CJTA 5ICYA 2E7DA 4TUKH