2ZD0A

Crystal structures and thermostability of mutant trap3 a5 (engineered trap)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
63
structure length
63
Chain Sequence
SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intersubunit linker length as a modifier of protein stability: crystal structures and thermostability of mutant TRAP.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Rna binding protein
molecule keywords Transcription attenuation protein mtrB
total genus 10
structure length 63
sequence length 63
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 2zd0A00
1GTNA 5EF0A 3ZZQA 5EF1A 1C9SA 5EEWA 5EEVA 1GTFA 5EEUA 1QAWA 5EEYA 5EF3A 2ZP9A 1UTDA 5EEXA 2EXTA 1WAPA 2ZCZA 3ZTEA 4B27A 2ZP8A 2ZD0A 3AQDA 5EF2A 5EEZA 2EXSA 3ZZSA 3ZZLA
chains in the Genus database with same CATH superfamily
1NAMH 1R19A 4MA7H 1HH6A 5B7MA 5CZKA 1ID5I 1YUHA 4P9MH 3T4AB 1TOXA 5I71B 2IV9A 4U1JB 1XCQA 1X5MA 3CFEA 5G2NA 4XBMA 3U4EA 1HH9B 2ARWA 1FFPB 4M8RA 4O2CB 3SB3A 4P48A 2ADGB 2GC7C 3N42B 2WLKA 5EIVA 2OCJA 2YEZB 3HAEA 3PQYB 5IHUH 3RWIA 4ZUVB 3EIFA 1QLEB 4P2RA 1DL7H 3NIGB 4WGWB 4YHMH 5LAXB 4A55A 2DM3A 3NCFB 3UBXI 1QLEH 3ABMB 1FNGB 2VDNH 1MHEA 3UBXG 4HWEH 2NY6C 4LLYB 4QAWA 3G04A 1I82A 2EH7L 3MRNA 3JWDC 4HQQL 4JO2L 2FNBA 3NFSL 4QTIL 1RQ5A 3MC0A 3Q01A 1RV6X 4F7EB 2Y7LA 5ITBH 3D87B 5DD1L 2X2UA 2K1MA 2R83A 4NQEA 2E0PA 4URKA 5JW5A 1KIRB 3WTSA 2V7HB 1KPVA 2P7TB 3UCQA 1SVZA 3UH8A 2CLZB 1XCXA 4MS6A 4FQIH 3MKGA 4LIQE 5IVZA 4K3DL 4HHAA 1P2CB 4HD5A 3VSTA 1OALA 4Q9RL 2WXNA 1NCHA 3D50A 2GK2A 1YQ2A 3D4GA 1H3TA 2W60A 4CADB 3ABKB 2J73A 1Q9LB 2DJSA 2CK0H 3BE1H 3L9YA 4HIXL 1NIAA 2BJML 2AJZA 4R0LA 2YAMA 1NEZB 1P4BH 4JFFD 3DTXB 4HUVB 1FHNA 2Y69B 3BVWA 5E6SB 3LZPA 4J1UB 2BIIA 4LKXB 1MCWW 4S1QH 5DGRA 1DUZB 4XCEA 5C3TA 5FUZH 1G7JA 1LO2H 3MLUH 3CFIC 5K9OB 4XMPH 3P0YH 3PGDB 4M6AA 4WW2F 4IM8A 2NY5C 1LILA 4Z18A 3VSVA 3GTVA 1A3QA 4KRMB 2YKKA 3TS8A 3MGAA 5DEJA 4XTRD 3BVUA 3GIZH 3NP4A 2XCMC 5JW4R 1YYMH 3WNOA 5GRZA 4PJAB 1F4AA 4M3JA 1I1AD 1BZ9B 1IC7L 5K9QG 1HU8A 5JXAL 2ICEA 3DHJA 4G6JL 3QFJB 5D8JH 3WD5L 5MHSD 2YRZA 3NP3A 4LU5H 5L2KD 3DETD 4GIPD 1JVOA 4GMTH 1EUUA 1ZE3C 4CNIA 2BSEA 3T6QC 4M8QA 1QWHA 1AMXA 3O2DL 1FYHB 5DUMH 1CO1A 3BSZH 1D9KD 3ESVF 3VFWA 4JCWA 5DQ9B 1PNCA 5F93C 3H85A 4L1DA 5KUKA 4BH8B 3FT4B 3NPSB 1ZTXE 3EH2A 5CS7A 4XPTH 1MPAH 5KVGH 4LRNL 2BNUB 4ODTH 4PS8A 4OGQC 2AJZB 1AQDA 4X4XB 2GAZB 4HWUA 4P46A 3RWEB 3BP5A 4W9DC 1M2VA 4OJAA 3DIFA 4GQZA 4KUCD 2PYFB 4L1BA 4YDJB 5KJ4A 1NEPA 2R0WH 1R24A 5T3ZL 2DJ4A 3JWNC 5DD0L 1TYJA 3BGAA 2VDLB 2Y6TE 3C08H 4P46D 5IB2B 3CX5K 1KG0B 2IMNA 3FTXA 1X5IA 3M86A 1RZJL 4OKVA 5TQ2H 4BDVB 4HCRH 4LDCA 1MFNA 2W65B 1JWSA 5A2KH 1IQWH 5JW4Q 1KIPB 1X5FA 2EDBA 3Q13A 3IDIB 3VWKD 4BK5C 2UZPA 3OVUB 4G42A 4UQCA 5JMRA 2DKSA 4NQEB 4ANKA 5JOPE 3QFJE 4TV3A 4E9XA 4J3UA 4R26H 5L4FA 2ITEA 4L3EB 1BG9A 3LXCA 1YJDL 2DWYA 4I85A 3LMJH 1PLGH 3F00A 2E9BA 2D9CA 1WHOA 2X41A 3FO1B 3OXSB 4RISL 4FX5A 1ODUA 2DYPB 3VD0A 1QPXA 1Q90A 2ZYIA 4TVPE 3C6SB 4IQHA 1KCSH 4CNIB 4K3GA 1BQRA 3RIFK 4I4WA 1SMOA 2ZCZA 2XQBH 3A4FA 1BX2A 3P40A 2R15A 3QO0B 4DVBA 3IVKA 5DQ9A 1CI3M 4KOCA 1T04B 4OZHB 1JHKH 2F8OA 1LO0H 5BRZA 5IQLA 1TXKA 4NUJB 3SEPA 1J0YA 2QKSA 4YL9A 1HAWA 1FHGA 3GIVB 4C54A 1QTSA 3UJJH 4LGSB 1WBXA 3ARFD 2A77L 4JJOA 4LLVA 4P9HH 4BUGA 5B7FA 2NPLX 1ZLVH 2X6BA 2I5YL 2WNXA 3V9EA 3HS8A 2QVFB 2X4PB 3MCLL 4LHJB 1GCYA 1T4KB 3NFPA 1UC6A 4IBYA 4JRXA 4MYPA 4OKVB 1LHZA 1U8KB 2NW3B 2WQRA 3E6HB 3LXBA 4MA3B 4EUPB 1JTOA 3NJKA 2DQEH 3QORC 2ZPKL 4DP6X 2PWFA 1WVZA 1IIIA 3QG7H 4PRDA 3S48A 5JORB 4Z3GA 4JM4H 3S8GB 2YR3A 4PP1C 3GSVB 4NWTL 1CK0H 1CZ8H 1EANA 3JTSB 3L9BA 4QCIB 3T0WA 3HC0B 1OZUA 2XY2A 3RG1C 3ARTA 3MJ8B 4HSCX 1QRKA 1ASQA 2F7QA 5GJSL 1HOCA 1KJ2B 4R4FL 5AOZA 1YEKL 3KL5A 3KPSD 4EN3D 1OSPL 4HD9A 4KI1A 3SYQA 4OUUB 5BRZE 2Y07L 2P1YA 3BKML 3ZR5A 4MD0B 4QJ5B 1FPTL 3E8VA 2GQHA 2L7EA 1EFXA 4D9QD 3UPRA 1C1EL 5E6IB 1OANA 1SXZA 3VGDA 1D5XB 4E9YA 1NCIA 1QBMH 2ITDB 2EE3A 1U8IA 5MHSE 2ZOKA 5JIDA 1II4E 4AVIA 4I18A 1A1MB 1MJ7H 3QWRD 2I07A 2EXWD 4LZKA 5JXED 3WUWB 2Q3AA 5I16B 4Z7OB 1N8ZA 5DLLA 2FD6H 3WY1A 3DROA 2Z4QA 3RTLA 1ULVA 2A9CA 2BSSB 2D0FA 4YSCA 2EDXA 3SKNB 3V8OA 1J9TA 4XO4A 4UT7H 1W72B 3MJ9L 4LVNC 1WYJA 4GOSA 3MZGB 4OLUH 5HDWA 3PWJA 5J1TC 4D8OA 3MLPA 1A7QL 3AAZB 3JWNG 1T0MB 4KV5E 2BP5M 1XH3A 4AT6B 1AQKL 2QEJA 4DK3A 1Y0LB 2MMXA 3D51A 2GY7B 5TTRA 4X9BA 4ETQB 3RB5A 3GMNA 5DJ8B 3VQ1C 3DPBA 3T4AC 4IKLA 4K3EH 3QCUH 4M6ML 2CAKA 4HUCA 1BF8A 1F18A 1EFXB 2CCWA 3KM1A 1I9IH 4QHPA 2JJTA 1DCLA 3IMBA 2RH0A 1ZANH 2B9BA 1TTBA 2ICWA 4JANB 1ICTA 2WWMD 4JY6A 1IEHA 5E2WL 2VLKE 5J6SA 2J21A 4XPFL 3MV8D 1XSOA 4MAUL 1G1CA 2EO7A 3ZSTA 8FABB 2OL3A 3CXHJ 2CE6A 3NDYE 4J4PD 3V5HB 3OL2A 1T21A 4N5ED 1LYQA 4W9CC 3VQLA 4ZFFA 3LV3B 1N70A 2HVKA 2GK0A 5AW5B 3OQ3B 3UIZA 2J6WA 4TMPA 2IADA 4CMHC 2VMCA 4U0RC 4IOFC 3SGEH 3MRRB 2YMOA 4LLUB 1QR1B 1WH0A 1G9NL 5EIIA 5JHLH 1RU9H 3MNMA 4F5CA 5IK3A 1ZIBA 2R1XA 1JVKA 4MMZC 1BEYH 4IBQA 1MFCH 4PJDB 1QRNB 4I77L 5BS0E 3E8UL 1YY8A 3H4FA 5F9WC 2HLAB 5ITFB 3OR7B 1XR8A 1BD2A 1FFNA 1MCJA 1S9WB 1U92B 1EV2E 1HI6B 1BQ5A 3SKJH 1FFOA 1MIEH 4AGLA 4JZOA 5FFOA 3LRLA 2XKNB 2PF6A 2QFRA 1KC5L 4ORZC 4P23D 1YEKH 4YQXL 1K85A 4IU3A 1AS6A 5IQOA 5DS8B 1QFUH 4LCYB 4XNMA 4NKIL 3L95A 4NZDA 1J18A 1P69B 2MKLC 4LQ1A 1ZWIB 3QIUC 4P59L 3BOVA 4G6AD 1E9OB 3L5JA 2EKSB 1TJIL 3GXTA 2P80A 4UF7C 2DQEL 1MFBL 1JPGB 1BFOA 3HR5A 1MKFA 3I02B 4EQ2A 3LPPA 4JFYB 3RIFF 1OARL 4LLDA 2JKJA 4BH7A 4HISA 1A25A 5CP3H 1HINH 4BBWA 1AZZC 3VJ6B 2WXHA 3FL7A 1BF5A 1BZQK 3DTUB 1NWOA 4GRLC 3TFKC 3LQZA 1R6VA 3AXIA 3KLAB 1JS4A 4KV5F 3ARSA 1J1PL 3L95B 3FUHA 1H0DA 1CLOH 5KYWA 2CBOA 2Y7OA 3P9MB 2FHCA 1PTZA 1BM3L 4R8WH 4LNRB 3MV9E 5A2BA 1UATA 3OPZH 4B5ZA 3UTQA 2D0GA 2P5EA 4OLVH 2G4EA 2VGLM 4K7FA 4E0RB 2GB2A 4OCNC 3ZTNL 5DMKB 3MFFB 5CP7B 1T22B 3ARDB 4WEMB 3SKJL 2WLIB 4X6BB 1FJ1B 1UOLA 1GGIH 1WS8A 3DDFA 4CU6A 1UJ3A 1WHPA 1B0IA 1OGTA 1NCOA 2F54B 4PJ9A 4Y19D 3QRFM 3LQAC 4JBSA 1CGXA 1I1YA 5E9DD 3UGXA 4ODUA 3GSOB 3OZLA 4DEPB 5C9JA 3ETTA 3IKCA 1A4BA 3SQOL 1O7VA 4IHOA 4A6YH 3DVGA 1G5AA 3BSHA 3MBEA 4KITB 3VXUA 1VEMA 4JY6B 4OD3H 2W91A 4KKZA 2F1AA 2VXQL 4HZLB 4KUZH 1N0XL 1RY7B 5GGVH 1TF4A 1KBWA 2VYRE 4FE9A 4AC4A 3N04A 1ETZB 3BUTA 5EC2B 3KWUA 4HGMA 4FQJH 1PF3A 2ICES 2MPAH 3HC3L 4GRLB 3K7UA 4K94H 4X5XA 2W95A 4DN3L 1BZ9A 4WJKB 3D6GA 2XTJB 3KPQB 2Z31A 4Y1AA 2H0PA 3V9FA 3FK3A 2YD4A 4KJYB 4D9QE 2COQA 2DM2A 4KQ0A 1OXYA 1QR4A 3X17A 4N85A 2A6JA 5J06A 3FT9A 1RIHL 4H1LG 3C6EA 1MCPL 3OX8B 2WVUA 2YRPA 4FFVD 1A1NB 1E3FA 1RJLB 3O3DB 5GGUB 4B7LA 3S8WA 4ES8A 2VE6A 4K5LA 4Z7WA 1VF5C 1OGSA 1AHKA 4M62L 3QCVH 4P3DA 5F0PB 3RGVC 3UACA 1M6OB 4OFIA 4XC3L 3QIBB 5CGYC 3BPLB 5EC1A 3E38A 3AY4C 3FSZA 4P5MB 1JGLH 4ZT1A 1AQHA 1M7UA 2CR0A 4X9HA 5L9DH 2EXYC 4ALAH 1RZ7L 2R2EA 4PS7A 1J5OH 5IKCB 5SWSB 3N3EA 1T1ZA 4HK3N 4NJ9H 4XAKD 5BS0D 3X3FL 4K9EC 4G5AA 4U0RB 1JP5A 5HDLA 4MJ4A 4MDJA 1AQ8A 4BWUA 3TEYA 1FIEA 4XMLL 5C0IA 4G9FD 1R3HB 3RZCB 2VR4A 4NO5A 5IQ9B 4JFPA 3Q2CA 4Y4HA 2X2JA 3U4KA 1MCCA 4CSZA 3EYUH 3QPKA 5CEZE 4PW4A 5L4MA 1KDJA 4OJYA 2AKRA 3NJIA 2PPDA 1C08A 3PGDA 4JY5L 2VO5A 2XQYK 3HE6C 3VXSD 2EYRA 2MEJB 2JKWA 3BZ5A 2VLKD 1EIBA 4AGOA 5IV2A 1AR1B 5EZLA 1CFVL 5BXFA 1FZJA 3NJFA 3VUAA 3BRFA 1ZGLP 4LLMB 2DMBA 4WY7H 3GSXB 3RNKA 4Z7WB 5TDOB 1BBDL 2HKFL 5DMGC 4OCYH 3NH7H 4PPTA 3L7FA 1YMMD 5DO2D 4OT1H 3QIBA 1AZVA 1YEIH 2XWCA 3ULUD 1WIUA 2M83A 4HULB 4UILL 3IBEA 5DJXA 4RLDA 3VRLF 3T8XB 1AGCA 5I74B 5KS9B 2C4XA 3EW3B 1THAA 3S3SA 1LP9E 2KI6A 4M93B 1S9VA 3IS0X 2XQBL 3IVKB 3FMGL 2PW2A 1S3RA 1GOGA 5DD3L 1FFOB 4RDBA 1J8SA 3BD5A 3FTVA 3ML9A 4QTHB 1FO0H 3BN9D 3CDZB 3HG0A 2ZXEB 5GZNC 3HRPA 5E23A 1ZCRA 1ZDQA 5HHOA 3L4CA 5K9OA 3US0A 4RAVB 3CJJA 1TJIH 3H53A 5FCSH 4KTGA 4LSVH 3TCTA 4DJMA 2HMID 3HEIB 2WXJA 5EBMA 1I8UA 2K3TA 3AU1B 4XWOD 4QLRA 4Y5YB 4Z0XB 3QBTB 3ZGIA 3MNDA 3UZEC 4D9LL 5BVJB 3M1BB 1MN4A 3O6FC 4AYSA 1XSJA 4O58L 3CQPA 1WITA 4G11A 5ACLA 1JPSL 3GRWL 5I73B 5LXVA 2K4WA 2BM3A 1R5WB 4PI0A 1IEAA 3BEWB 4FADA 1IAOA 3U1QA 4B9YA 3IXAA 2R4RH 3BPOB 4Y2NA 5T5NF 3MJ9A 4BD4A 4FXKB 3T8XA 3N85H 4OUUA 5E03A 2JKRM 2CO1A 3I9AA 3CFDB 5IHWA 4JFDA 4QY8A 4MA1B 4UYPA 1XV8A 1DN2A 2PPFA 3SO5A 4OGYH 3FB8A 1QWUA 4GINA 3BP5B 5I76B 3BESR 1OY3B 2HX8A 3BYYA 3SDDC 4LCUB 2LAAA 2R23B 2Z7WA 4F8OA 3V79C 3FQNA 1SXBA 3DOIA 3BEVA 2BNQE 4X5RA 3MDJA 1WFOA 4XCFH 4IOSA 3LXUX 3U0PA 3QIWC 4Y4HC 5BRZD 3BXNA 1SUHA 3B2VL 2H32H 3Q43A 5IGXL 5C07E 2ZAIA 4G9DB 3EOBA 1AO7B 4X98A 3BX7C 5DRXA 2VXVL 3ZVVA 2NSXA 1MNUH 3F6JA 3OZKA 2F7OA 3L5XL 5LBSH 2XWXA 3F7YB 4XVUD 3GF8A 3IJHA 4TLUA 3N43B 2IH9A 1E6JH 2F8VA 3KLKA 4HIJB 2D3NA 2MRYA 3BH4A 1MW3A 2QZ5A 4J6RL 4OM0H 1C5CH 1IBBA 2NR6D 3SO3B 4ZFZA 2TRYA 3WJLC 3NPSC 4QXWA 5D71L 4NHCH 4UT7L 1U58A 2VLJA 1OWWA 3KYNB 1MHCA 1OT1A 4N2GA 4OCRL 3IPBA 2X3AA 5K9QI 4P5SA 3CC5A 3RGVD 1RUQH 4K7PH 3ECBB 5K59F 3QJSB 3CSTA 5EOQH 5JA9A 3ATFA 1AHWC 4ZMOA 2BVUA 4XNQB 2LU4A 3NSXA 4A7GF 1HYSD 5JORA 5KSBB 4OCWH 4M00A 3NZHH 5E00A 4XNXH 1T7XA 1IZJA 5KBKA 1CURA 3ZO9A 2XZZA 3U7WL 3CHOA 1DQMH 3T6XA 5IM7A 4GUCA 4U3SA 2DIJA 5DTFB 4CC4C 5E51A 2JI1A 2KH2B 2NZIA 3VWKB 4ZNEE 1FL6A 4NQDD 1U8OB 4PJBF 3V5HA 2YUXA 4WJ5A 2C1PB 3DV4A 3X13B 5F8RC 4RZCB 2GCYA 3K5SA 3TGXA 3B7YA 3F7RA 3RX7A 2R51A 3L3HB 3WS3B 1LQSR 5D7JA 3BWZA 2QHRH 1IFHH 2DQFA 12E8H 3RWHB 1HJBC 1IC5H 2OTWA 3Q5YA 5IESH 1PLAA 2CJUL 1R5WA 2QVTA 1JYWA 1DN0B 4LSUH 4HV8A 2FEDC 5ADOH 4LASH 2D73A 5B1AB 1Y0LA 4PRNA 2BSTB 4NM4H 1BVKB 3LHPL 3NK3A 4PS3A 2CA4A 1RUMH 1AVAA 3AQZA 1ET7A 4N3TA 4HOXA 1IUZA 1UWXH 5FGCB 4AVHA 1ZTXL 5IB5B 3MOQA 3BDYL 4YHML 4JQIL 1JF1B 3BGMB 1QI5A 3US1A 1BQLH 4OTXL 2HWZH 4HEPG 1VPOL 4ABUA 1AG6A 3WKYA 5IY5B 1YNTB 3C6LD 2J2ZA 3AREB 5KSAC 1JK8B 1K2DA 2FX7H 3CXDL 3JWOC 1MOEA 2CJSA 4NN5B 3L3DB 1DVYA 1CGUA 4U3XA 2QGDA 1A22B 2KZKA 1FDLL 4IOIA 1PZCA 2A9AA 5DC9B 3GEWB 4B95C 1JWSB 5CP3A 1S9KC 1ADQL 1UCBH 2UVFA 3GNMH 3IFNH 2O5ZH 5ANMA 4KK8D 3FN9A 3SDDD 4MAZA 1ZLSH 3ZKND 1JMXA 4MD4A 3UO1H 1PYWA 2NW2B 2G5RA 3M88A 2WP3T 3DV6B 3GB7B 4QRPB 1L7TH 5D1XE 5DMIH 4F2MB 3GTTA 1MQKL 4JG0H 3SCMB 2R2BA 3HUJE 4L4VA 1P53A 5MERA 5B39G 2DL9A 2IC2A 2ZOUA 3AABA 4QOKA 4RGNB 3NBNA 4OZGE 3PWNA 1AYRA 4RRPA 5GRUH 3DVNB 5I1AB 2V2WA 1U93A 1IV8A 2X7LA 3NTCL 4PJ8B 4MA3A 2G9KA 5EPMB 3ZDXF 1WBZB 4QGTA 1OE1A 3EZ8A 3QCUL 1PY4A 4M5TA 3BFQG 4PJ9B 4XNMB 4ZS7L 4NPYA 5AVWB 4MJIE 1KBKA 3P54A 1W8NA 1HEJC 3QARA 1NC2D 3V6OA 1KXVC 1JV2B 2LW3A 2ROXA 4KHTL 1E30A 4YSUA 5FWRA 1U30A 5HY9A 4HKJB 4NQQA 3MGTA 1ONQB 2IH3B 2XBZA 5EZIH 3SPHA 4MKTA 1YDPB 1ET8A 3KCPB 5EU6B 2HFEB 1XMEB 2V5YA 4F7KA 4YXLH 1U6AH 3X14A 1YAIA 4QMEA 4J1UA 3QC5X 3DUSB 3MRRA 4LLUA 5C2BL 1U4FA 3G6JF 4DEUA 1VIWA 5EO1A 1ZGLM 3MRKB 5DD1H 1KIUB 1M05A 4WWKD 5ISZA 3UYPA 4ZRGA 3BI9X 4H7VA 2FYVA 4YHZH 2HTLC 3U4BH 5CGYD 1AIFB 5LG6A 4PUBH 5D5MA 1RZQA 3I2CH 4OSUL 1KCRL 2WV3A 3NSYA 4PWJA 1HNGA 5KBNC 4K3JH 2PPCA 3HI1A 4I3RH 3PJSA 2FAUA 1QOKA 3DX8A 2CBMA 1P6AB 4U4BA 4U1HB 2E7CA 4F93B 3EO1B 1U3HD 5BZWB 2WTRB 3QJQB 2G0KA 3CFCL 5D7KE 3TO4C 3VA2C 5I26A 1IBGH 4JN2A 1A7OL 1NINA 4CA4A 4XMKL 5GGTL 2FRGP 1KLGB 3BISA 3MV9D 4ISVB 1J0HA 5K39B 2FYYB 5BNXD 2C3XA 3QUZA 3WFEH 2Y22A 4JPVH 2CRMA 1YNTA 3FOMB 5A7BA 3IKKA 4S1QL 1QRNA 3U30C 3AS0A 2V37A 3ILQD 4WDIB 3RYMA 1DBBH 3HE6D 4WFHE 2NZ9C 1CLZL 1NGWB 1YPZB 4GRLA 1FO0A 1KYDA 4GEJA 3BMVA 4HS8H 1SGKA 3LZLA 2JTDA 5C2BH 1MCPH 1ED3A 2F54A 1KENH 1YUKB 1SNRA 1EQWA 4H8HA 2RQ8A 5D5MF 2IAMC 3EYOA 4EDXB 3N9GH 1TZOA 2OZ4L 1SJEB 3EHBD 3EBIA 1EVTC 4P0DA 3QO1A 4QRQA 2NCEA 1X6NA 1NMBH 2B16A 2ZCKH 5DEGA 2EDWA 1OW0C 1R5IA 1S9VB 4W9EC 2VO8A 4WKXA 3HBPA 3LPFA 4DN3H 1T1XB 1BJ1H 5KG9A 5IFAH 2Z34A 1BZ7B 3BPNC 4PEEA 4QRSB 4M48H 5LG1A 4MD5B 3MLRL 2FX8H 3ME0A 1FO0L 2R1YA 5DFAA 3LIZA 3NH7L 4G72B 4OZIE 3KGUA 3NGBB 5HYEA 4YDVA 2Y5TA 2N0KA 1IBZA 2WLYA 3GEFA 2VDLH 5ICYA 1OP3K 4N2DA 4KNSA 4JO8A 1FCGA 3SQOH 3K0YA 3GHPA 2AFNA 4KZDL 1MCIA 4MMZA 1SQMA 1ZE3H 5A7EA 5HVWA 4NWUH 2AZAA 1A5FL 1FGNL 2EDHA 5KYXA 2CDEA 3QYMA 1I8MB 1KGYE 5SX4I 1X4ZA 1SOQA 4OQTA 3BT2H 4OGXH 35C8L 3EJTA 4KJWD 3MCYA 2ENQA 2H3XC 4WTWA 1M57B 5PCYA 5A3ID 2F7PA 4G1EB 4WY7L 4I7ZC 5IVXE 5SWZB 1FNHA 3ATBA 1ZVNA 1AGBA 5GGRA 5C07A 5IG7B 4G1MB 2VITB 1F2XK 2YHGA 5F9OH 2J56A 4NUGH 4G43A 4HDIB 3P0VH 1R5IB 4PGDB 3MA9L 2FGWL 2YUWA 1KV7A 5C86A 2BNQA 4ZYKA 3W9DB 1DLHA 3ZZQA 4BEIA 2V0AA 3BIAX 5L8LB 2GI7A 2C9SA 4QRTB 1YLBB 3KJ6H 4IRSA 5SWZA 4ZO7A 1SYVB 1MRDH 1J8HA 5E56A 1RPUA 4NNXB 4AG4L 4F33B 4OF0A 1QBLH 4BM7A 3LHAA 2N3JA 3ARRA 4FG6D 1OP5K 4JZJA 1KSRA 5AW8B 4ZPVA 1N64L 1TTRA 2CH8A 4LSRL 3CBRA 2DQUL 1MJJB 1M1XA 2X1XR 4XPGL 2YKLH 1HNYA 3V6ZB 3HG1D 3KNBA 4UDTB 1MIEL 3BQUA 4S1RL 3SE8L 2L7JA 4UTBH 1KEGL 3M46A 4LPCA 3ISYA 2C3VA 3O8XA 3NIFB 1RIUH 4CDHA 4DZBB 4YHZL 5AAWC 1ZS8B 4KHTH 4QKXB 4GT0A 4J3OG 4GMTL 1ZSDB 2ZSWA 1MH5B 4YFDB 2HFFA 3MLUL 2C3WA 4G8GD 5DJXB 5EORH 2RCSH 4DPBX 2MWCA 4G7YH 3WGUB 4IGBB 3CHXA 5B1BB 3S36X 4MFHA 1QFWI 4KZEH 4UM9D 4MNGE 2WXRA 2FGWH 3PFUA 5ACZB 4DO4A 1T04A 4QXUH 4KJPC 4F58L 3QUYD 4NBYB 4FI6A 1I1FA 2LT9A 2VSMB 4W6XB 3LPOA 3ERXA 2Y6SC 4OLYH 1T83C 4MAUH 4W4OA 4BSVB 4YDZA 2EE6A 2P45B 4QF1B 4WUUE 1S8DA 1E9PA 7PCYA 3ZN6A 1I85A 3P9WB 4G3YH 3LNFA 1WWWX 2FEEI 2YBRA 1KELL 2VZ1A 1WT5C 4W9LC 5D7IA 2VMEA 2VN5A 4Y4KD 2J8UE 2YUVA 2I7OA 1KJMA 1B9ZA 4W4OC 4CMMB 4FQQA 5HP5A 3FQ4A 4HU8A 3PQYE 4U1NA 4NN7B 4N6RB 2WSDA 3V6FB 1BPVA 1Z9OA 2OYMA 3T0XA 2OTWB 1E50A 2WW8A 4CSPA 4WCYL 4N0CD 2I7SA 4CVWA 1C9SA 2LAGB 3F83A 4LPWA 4TVSa 3DSNB 4FHJA 4NPJA 2CM6A 3T6VA 1E4KA 2ZUYA 1JZEA 4DGUA 1DVFD 4G1EA 5MI0B 5K39A 4JQIA 1T1ZB 5D2NB 1DQTA 2YA2A 4JRYA 3EO9L 3BGFC 3NIGF 2BP0A 5KS9F 1U8OA 3O0RL 4ODBD 2VLJD 3LVTA 4QAMB 3RHWK 1OPOA 4Y5XA 4BKLA 3QDGD 4A7TA 3E1ZA 2NY0D 3TH2T 4KJQD 4WFHD 2JXMB 3LKQB 4RWYL 5CJOL 3NFSH 1U33A 4XHQA 4I3GA 4NAQA 4NDMA 2Z0BA 1Q1JL 4ZDHA 4NZUL 4WUUB 5DRWB 3RUGA 1QNIA 4Y8DC 4Q89A 5EFIB 2H1XA 4GBXA 3H9YA 3SOTA 1U8HB 3HUJB 4O2EA 4NENA 4PP1D 1I8LC 2NQCA 4AKQA 2DV6A 1J11A 2IBZX 4LRNH 3S37X 4BGDA 2VM4A 4MNGA 4AQOA 4ANUA 4XC1L 3VFSA 4BZ2L 5BZDB 5JOFB 4PJCE 1ZIAA 4TQ8A 1IKFL 1B6DA 2L4OA 3MLVH 4I0PD 3QIWB 2OSYA 4BJLA 1QVOB 3LHPH 3GPSA 3I74A 3HFMH 2YWZA 2PCPA 3HVDA 3QI9B 1RMFH 4WI3A 3U1PA 2GUOB 4JS7A 4MDJB 5GS0C 2KBGA 4RRPM 2CPCA 4QRFA 4ZD3H 3GLAA 3IB4A 3HHSB 2DI8A 3Q8EA 1UJ3C 3V6FA 1G7IB 5HDOA 3STLB 1WUNT 1OAQH 4DQOH 4KVNH 1BV8A 3PDGA 4MA1C 4YJZL 1Q0YL 1MVFA 2WNWA 1S7UB 3NJMA 2WXPA 4DP2X 2QHRL 1F1DA 2XWBB 4U6VL 1J1XL 4BFEA 4G9DA 5HTSA 4OZHE 1IARB 3VD1A 1S7XA 4UIMA 1TYEB 3L17A 5C0AA 3MREB 1FV1A 1ZMYA 3O3EA 4K2UL 4RX4A 4Z7UF 2WKLA 1CFNA 4YK4C 5D4JA 2ICWJ 2QSTA 5E0QA 1S5HA 1Q94A 5E2UL 3MCLH 1LDSA 3DSFH 5BQ7A 2GFBA 2YAHA 3CVIH 4IKJA 4DFIA 4R2GD 4FFTA 3QJFA 2R4SH 4PJ7A 3VFNB 4QCIA 2XWDA 5IMKA 2V8LA 3SGKA 3C5ZC 2V5TA 3KGRA 3MFFA 4P2OC 5GRYA 3RVVD 1I8AA 4PD4K 3TONA 1AXTH 2I9LA 3FJTA 4HKZA 1O7DE 2XOTA 4PRHA 5C0EB 4YFLI 4MYWB 4ZW5A 4POZC 1GJWA 1IC0A 4WFEE 2DQCH 3C8KB 5DK3A 2C34A 2FE0A 1E43A 3JQOB 4NRYA 3AITA 3HBZA 1QATA 1SEBB 5AYUL 4FULA 3VI3B 1G7QB 1S2EA 5E00B 3TOPA 2WZPD 4R4BA 3E9UA 3OB0K 2J6EL 4HZLA 4GXUM 2QKIA 4DNLA 3GXFA 1OK0A 3CHPA 2JNZA 1JFQL 3M6DA 2KYIA 3MRGA 4U1HA 3EHBB 4B9PA 4RFNB 4NKDA 2JTYA 3QYNA 4EBQL 3F12A 4AKOA 4D0DB 2AXWA 2IDTA 5I73C 2WBKA 1FYTD 3DGCR 2IALA 4LBEA 4PTUB 3HRZB 4PJGE 1IQWL 4HUUA 3MREA 1Y1UA 3O3EB 3FQWA 4ICWA 1MFAL 2AZUA 1EJOL 4RSVA 1NMAL 2C1OA 3FW6A 3S3DB 4ZFOL 5G4MA 3MRKA 1CG9B 3T6ZA 5ALBL 4R5VA 3FFCE 4XXWC 4JPWH 3GHEH 4QEGA 5CCHE 1FGVL 3TC9A 3WY4A 2JKIS 1YAZA 3QZLA 3GMOB 4PJXE 1HHIB 4YR6B 4PRAA 2W0FB 4WDIA 2NNAB 2KLTA 1WFIA 4X99B 1OGAB 4B6ZA 5ES4B 2AABL 5DTFA 3KG5A 5EUOE 5CILH 3CN3A 3MV9B 4YZFF 1AR2A 1OLLA 3GMQB 4XBPB 4N2FA 3QR2A 1WBZA 2Y3AA 3IU3A 2CHXA 3L3HA 3SE4C 2EIJB 1J0ZA 1R34A 2XIBA 1M2OA 2AF2A 4V11A 2NRDA 1OZTG 4R97B 3WLWC 4WFFE 5DFTA 3RGHA 4ELKA 1SYSB 3LZFH 5I74C 1PX8A 3M7FB 1EVUA 1A6AA 2YD0A 4LKXA 4ZFOA 4JFEE 3CFUA 3IM1A 2R59A 4Z7OE 4NT6B 2E59A 3V7MA 2OL3B 3QDGA 4S2SA 2AGJL 2E9WA 2EABA 4OCSL 4XBPA 3VQMA 4QRRD 4O02L 2R0LL 2XPYA 4NQDB 4QT5B 5IUCA 2ALWA 5KVEL 4J8RA 1DVFC 3M1CA 5FWQA 1T6BX 1O9WA 3BPLC 3O3BB 4KOBA 5DZNA 4QNPE 2ZPKH 5EO0B 5EU6D 1WZ1L 15C8L 1U8PB 4H8VA 5EF1A 1EZVX 4HOZA 3AY4A 1YEDB 1XH3B 3L3IA 5L7XH 1P4LB 1TEFA 3J07A 2NOYA 5DI8B 3DECA 5FCUL 1YDPA 5JO5A 2X87A 2UWEA 4UU9B 5DD5L 4RETB 4E9QA 4GEIA 3JV5A 5ILTL 1JCVA 3KBPA 1M1SA 5A6LA 1BEYL 3KPPA 1J5IA 2E27L 1E4WH 1AS7A 2H9GB 4XO9A 4N0UE 4UYQA 5JHDE 2IWKA 4BFIA 5C7XL 4JKMA 1EDYA 1K8DB 4KO9A 3L2NA 2J72A 5H2BA 1YEIL 4H0IA 3IDNB 5DMJB 1P6FA 2A6KB 3BQUD 2GIMA 5CR8A 3O11A 3EJJX 2QBWA 4NIYE 3CZJA 2VXTH 3UC2A 2B3IA 1RXLA 3DX7B 1AO7D 1TKWA 5I1LA 3VDCA 4BDVA 4HXAH 1HCZA 2APSA 3HFML 2AC0A 4PG2C 2HKAA 3GMNB 1GA2A 3IDXH 3PU7A 3QDJE 5DJ8A 1NMBL 5E6IA 5HXMA 4J2XA 4QT5A 1NBYA 3I3DA 5DYOA 5DWPA 5T5FH 4XX1G 1KB5L 2E4TA 3DIDA 3F7LA 2N56A 5IHUL 3S96A 2HRPL 3DHPA 3IWUA 3HI1B 2R29L 2XX1A 4NQVA 3DJRA 2XJLA 4L3EE 3CSBA 3W3BA 3OGCA 1N4XL 4P59H 4JFFE 2P24B 1UA6L 1INQB 2VLRA 4YLBA 2XV3A 1QRNE 2EDJA 4PJFE 3SD5A 4FD0A 3GSUB 5ACMA 1ZV2A 2YXFA 2RIKA 2QVMA 4MZ3A 3VG9B 1EMTL 4PJ5D 4C56D 3MNVB 5E1AB 5I1CL 3ARWA 3TBTA 1EK3A 1RZKC 2X2HA 1E4XL 3IKCB 2NNCA 1DO5A 2GKIA 3KW8A 5HJBA 2YGOA 4IRSB 5ICYB 1ASOA 5SX4H 1FVEB 3CPUA 5C0CD 5D6CB 1YYML 1TJGH 4PJAF 5EU5B 3V4VB 4A6YA 4ZXBD 5C3IA 1F3JB 3JWDL 4AXWB 4WV1B 4N90E 3V4VH 43CAA 1KY6A 4G6KL 1QSEA 3F5WB 2IPTL 4Z5RA 4I5BA 1WD8A 4TVPH 3GINA 1INEH 2WYTA 3WIHH 3II3A 4H0LC 4LU5L 5I1KH 5KG9B 1KXQA 3VA6A 2ZWZA 4LAQH 1UG9A 3CLFH 4KUZL 4P2QA 2EXYD 4UM8A 3AC0A 3P9MA 2P47B 3DX9A 4WHCA 4BINA 2G2NA 1DUYA 2FL5B 3MRCB 1UEMA 1H3XA 1AXSA 5C09D 5F3BA 5EZOL 3U0PB 2XKUA 1G7LA 1PKQB 3P0VL 3WE6B 2WM0A 3VRJB 3P9LA 3HS0B 4E9VA 2VC2B 3RKDD 3U2JA 1AO7A 3T1FA 2C26A 1S5IH 4F37F 5C0FB 1FFTB 5H37H 2COVD 2VDQH 2G5BA 4YAQB 3O3DA 1O7DC 4JDZA 2W60B 3I02A 1CMOA 1TCMA 3SKMA 4HUWA 4I2XE 5FXCH 4Z7VA 4MMZB 2WTPA 5IB3A 3MLZH 1LWRA 1RK7A 2KZWA 4EQ3A 3QEQD 5DGQA 1MCEA 4HUVA 3T2PA 1LTXA 3T3ME 3L3JB 5KVFH 1SLXA 3GSUA 4G7YL 4HPOH 1G87A 1E6JL 1G6RL 2Y5TB 3QAZB 4NWTH 3U9PL 2IJ0C 3LKSB 1NCDL 1YA5A 3CZGA 3WTVA 2R69L 2V3FA 4LSQL 4LNVA 3H9HA 3GLDA 1K6QH 3LH2L 2XG4B 4UZSA 1EXUB 4JKLA 2V9TA 5E5RB 5MEOB 4BZYA 2R0KL 1SJHB 3IPFA 4ODSL 3CGTA 1GGIL 1DQQB 2FWSA 2E7LC 4GKNB 2VXQA 3VWJD 5E7FA 1T1XA 2N7AA 4OJCA 4GUPB 1YEJH 3HCVA 5I0YA 3MACL 2BINA 3ZTCC 5FGRA 1KCBA 1RVFL 3FTZA 1HIML 2EE0A 4B3EA 2B3RA 1AGDA 4TSBH 4Z23A 5F96H 3CMOL 3QISA 4GG8A 2CLVA 2WGXA 1BHGA 3MRLB 3OX8A 2EDFA 4Y5VB 5GGUA 5G55A 2KT6A 4E41A 2Y36H 4XMVA 4OGAC 5FYKD 5CJQH 3TV3L 2C7UB 5FO7B 3OAZK 3IJSB 5K9JL 3IGLA 1BDYA 3DIVA 1ZKAA 4NP4L 3DBXA 4KK5D 5EEZA 3QUZD 1BJ8A 2YD6A 4MS8D 4TQPA 5E94B 4EUPH 3FO9A 4U7MA 3KL0A 2BY0A 5D96B 1KLGA 2PR4L 3QJXA 3OAUL 1LEIA 2ZAHA 5GGRY 2PYEE 1QW8A 4X0KB 5C0BA 4OFYD 4OAWA 5EZJA 2XXFA 4H1LH 1CD1B 1MFEH 4L4TE 3RL2B 4E42A 4YDIH 1MJJA 2BIMA 3RDTB 3UO8B 4HALA 2Q86B 3QDGE 3KWXA 3JZ7A 1OPGH 3VD2A 2KPNA 2QELA 3QQ4A 3B7TA 4YZWA 1S3KL 4JZNA 2Q8AH 2CCLA 1E67A 1UUSA 5K93A 3TT1H 1HXYA 1HL8A 3KJ4C 5I8EA 4EIGB 4QYOB 3DC0A 2EEBA 4LEOB 3OJ2C 3C2SA 1U36A 1IC4L 3D4ZA 2ZYSA 1P5VA 2WJ7A 4FFZL 4H88L 4WTQA 3IDGA 4JFHE 4JFQA 3FZUD 3MLXL 1U8KA 3E6HA 4XE5B 2NW3A 1J8HE 2XVBA 5DFVD 1UOWA 2P4AB 1FV1B 5CKAA 1DQLH 3WGVB 4F8QA 4L1LA 5DQDL 5ITFA 4PJEA 4QXGL 2YPKB 4U49A 4GI8A 1F4YL 1A6TA 3MX0A 1T89A 3P30H 3LS5H 5CCKL 4FYRA 2JB6A 4MQ7A 3LY6A 2Z31D 4Y1AD 5I75B 4JFPB 2Y1VA 4NRXB 2FK9A 4NFDA 3ZLQC 5LDUA 1PZAA 3R4RA 4U1LA 1AZCA 2WZ5A 4N0UA 1AGBB 2WLLB 2OMYB 2LV4A 3PREA 1X7TA 1NDMB 1QSFD 3HZVB 4HUUB 2ED6A 4HS3B 2D4FA 1E5YA 4QRBA 2XWJA 4UTAH 4NZTH 2HXAA 5CEXB 5C09A 4BKLB 4TQEL 2VN6A 4O4YH 2CDEB 3QHFH 2D4DA 3JTSA 3OKYA 1JSYA 4JKPL 3EF7A 4NDMB 2HZHA 1DN0A 4FLOA 1J12A 3O2WL 1UKTA 2DWDA 2DYRB 4FNPA 5E8NA 1IBDA 3P69A 1A2YA 3BT0A 1T3FB 3DSFL 1IX2A 1NDMA 3MODH 2XZAH 3EYFA 3I75A 5D93C 4R7NA 4NKOA 2JLPA 3MGOB 2FD6L 3SE4A 4M7ZB 3RZCD 3QORB 5DYFA 3V0WH 4K3DH 3RHWF 3CZFA 1CCZA 4YXHH 3RA7H 4JFZL 2XYBA 4NUJA 5FK9B 4JO3H 3C6LA 2FH6A 5IMKB 4P9HC 2V6HA 1BREA 4FQXA 1UD6A 2RB8A 2DQIH 3IXAB 4I9WD 2MOVA 5CNHA 3KYOA 1J5CA 3RWIB 4O00A 3HNTH 1CZ8L 5AAWA 1ZXQA 2YLKA 4X5WB 2ZOLB 4HQQH 1HC1A 5GZNA 1ND0A 3CDYA 3U6XS 3MZTA 2YJLA 3IN0A 5JXEC 2OMUA 2ED9A 5FYKE 1CDYA 1UB5A 5FUCE 3H7BA 4EZMA 4MRBA 1ACXA 1JWMB 3D85B 3FSOA 1T0PB 1GVIA 1I3UA 3SYOA 3FFCA 3GIZL 4QD2E 2E47A 1NCAH 3QNXA 5KYUA 3LKSA 3QUXA 4LSUL 2EUVA 3DUHA 3BPCA 1QFUL 3B34A 1JFHA 2IG2L 1A66A 1IEBB 2CO6B 1IGIL 2ZWYA 3VFVA 1N7ML 2FT7A 1JNNH 3O41B 4NJAH 4XXCC 5B1KA 3TNMB 4NQDA 1WTLA 4DKEH 3L6FA 4GRWE 1GSKA 4NO3A 5EA0L 4YDKH 2AAAA 3LN5B 4Y4FD 3U9UB 1J9CT 2BFGA 4HPYH 1CGVA 4U2YA 1WCBA 5DDHA 3N42F 5FGBA 3N06B 1FLTX 4Q58C 4RQQA 3KLSA 4YH6A 5E0FA 5TE4L 3WUWA 4F7PB 5I75C 1OGAE 4X6DB 2F7IA 3L4XA 4PJGF 4Y4KA 4A04A 2CLVB 2VL5A 3KPRE 2A0LC 1BVLA 1GZHA 4XNXL 1AFVH 1LDPH 1F4XL 1UGKA 4YX2H 1JGEB 1HZLA 4M8UA 1Y6KR 4OCWL 2XWJB 2BSBA 5CBEA 1S9XB 1MZYA 2M26A 4Z7NE 4L05A 2WO2B 2NR6C 3F58L 3QEUA 1DFXA 1WWAX 4QO1B 5T3ZH 1PCXA 1IILE 2FEJA 1IGYA 2HG0A 3BKCL 4JFFA 4XVUC 2R0LH 3NEXA 1CDBA 3VGFA 4YSPA 3B2PA 5J4MA 4YR6A 4AW4A 3CDCA 4B9ZA 3ZPDA 5BOPA 3G6DH 4PJ8A 1S9WA 2GCYB 3JVGA 1F3DJ 4WAFA 4MVBC 1TMCB 2BOCB 3PHQA 1QKZH 4A66A 4GAYA 3FUEA 1FNEA 3VI4B 4YC2B 1ZV5A 5DS2A 4NKMB 1OAKL 3SOBL 2W92A 4HCIA 1GGCH 3NEEA 2MFNA 1RFDL 2VDMB 3X12B 4KO7A 3MJ8A 1AH1A 1L9SA 4GS7B 3WNLA 1P7QD 2QKIB 3RX8A 1YUHB 1DDHB 1F00I 3SDXF 4LSRH 3LKOA 4R90L 1KG0A 1UM4H 4QRRE 2BMKB 4E5XB 2BIQA 1WC7B 4ZW3A 3TZVA 1J05A 4R7LA 3IGFA 5TDNB 5F3BB 3GSRB 4P23B 3UOAB 2FUQA 1EAPB 1H9VA 3IXTA 4L8SB 2Z91B 1VFBA 4XBEL 5FYKL 2GBUA 4NZRL 2OJ1A 5I71C 2UX6A 3MV7A 3QNYA 3GMOA 5KYNA 3L3DA 1KCKA 1XR8B 3O6FD 1OK8A 2JVUA 1DYZA 2WXMA 1KEML 1XGQA 4NAJA 4IGBD 3KPQA 1QEWA 2J1ZA 3MV7D 4FLQA 2KDYA 1TJGL 4KO6A 3OC8A 1RI8A 3U1SL 3SQBB 1QAWA 3NAAL 3V52H 3FU0A 4RA3A 5I5JA 4ODUB 1OSPH 4PBXA 2ZXCA 1B3IA 1MI5D 3VD5A 4Z76B 2NZ1A 1NJ9B 2O26U 3NFNB 4XVJL 2ADJA 4YIQB 2H3NA 5DD6A 3U7YL 3VMNA 1GYCA 1E8WA 4FHKA 5F1SA 2WWNA 3K8MA 5TK4A 4XNZB 1AE6L 4PWFA 3Q5TA 4J27A 1V7NH 3MRFA 4M6OL 4YGAB 2ERJC 1EO8H 2Q3XA 1NAKH 2OMWB 2V7NA 4WJ5B 3B2UC 4FXKA 3ETBJ 3C09C 3GBDA 3VXQA 2I60L 2UV3A 4OZFB 5ESQB 3WFCL 4HWZB 4FDWA 4XCEB 1YEWA 3ULUC 4ORGA 3F3HA 4DW2H 2G2PA 3RGVB 4NYLA 3X11A 1KTLB 4ZG1A 5GGRB 5C07B 4G82A 2ZYRA 5C6PB 4GRWF 1MCHA 4L4VB 3TNNB 5TK2A 4X6CF 3KMDA 5IEHB 5JNYB 4PJXA 3KPRD 5T1LD 3DUSA 3VJ6A 3NCEB 4ZUUA 4FQLH 4MZRA 1D7FA 2GPZA 2XTLA 3K6NA 4GQPH 3QQNA 1FLRL 2KLRA 2UZIH 2VZ3A 1VFOA 3THMH 3KDMB 4BZ1H 3VFPB 2YN3A 3O6ML 4N0CC 4IKNA 3EGXA 3O4OC 8PAZA 3SBRA 1IGFL 2QV2A 4GBXD 1FL5A 4U6TA 1CU4L 1V55B 4WHYH 4C57C 1PEZA 3F8UB 4WV1A 1OF2A 3QUXB 4MA7L 3QQ9C 4AK2A 4PJDF 5T3XE 3WOVA 1IMHC 1JGDA 5FM5O 4A38A 4ZUUB 4PH8A 5HPMA 3W82A 4HLZH 1UWYA 4KMTH 4NI3A 1Q0XH 1IGJA 4IBLT 2EICA 3L3OA 4WNQA 3VFPA 3FZUC 1D7BA 4MNGB 4EIBA 3D25B 2O61B 5EU5A 3SZKC 3UBXA 3WFBH 1GJUA 2GSIA 4WK0B 3KPSB 4LIQH 1A4CA 4W1TA 2G3MA 1AD0A 1YZZA 4J3XA 4JO4H 1NFDB 4KO5A 1MUJA 3UX9B 4N6QA 2IDSA 4H8UA 4QRRA 4TOYH 1KYAA 5E4EB 2ZG3A 2DPKA 1U3JA 3WKML 2ZIDA 4N2EA 3ZDYF 3ZE1B 4PMFA 5CJBA 5B38B 1YNKH 4W9FC 5AD0B 5TPWH 5HYSB 1ED3B 3HZMA 3RWDB 4JL2A 2PCYA 2J8HA 4AI7A 1BYPA 2F1BA 1XFPA 1TZHB 2BSCA 1Z5HA 5D55A 5F89B 5GSVB 3FUMA 4BZ1L 3HZYA 5DWUH 1RUAH 4HWNA 5D1ZI 1RAMA 2PP8A 2Z7YA 4ODXA 2FLMA 1YQVL 3ETSA 5G5DB 3INUL 2KMWA 4MS8C 2GEQA 1KTKE 4YSAA 2G75A 3S98A 3WENA 2ZCLH 3O6LL 1HKFA 1YYCA 2JLLA 3N41F 3H3KA 5JW5B 5F2FA 3SODB 4ANXA 2OMWA 4GI9A 1P4UA 3ZDZB 4CGUB 5BRZB 5AZ2H 5I66A 3DBXB 3DNKA 3D08A 2H6PB 2R0ZH 4Y16C 1TUPA 4FNUA 3KLDA 1KIUA 1M05B 2BIHA 1CLCA 3L3OB 4F2EA 4ZUVA 2FIKA 4DTGL 1J8HB 3IDNA 3BC9A 3CFQA 4FQHA 5E1HB 2JH2A 4IRJC 5FW8A 2EDKA 3L9EA 4G8GA 4Y5VA 4AH2B 3MNZB 3PABB 4PCTA 4XMXA 1TNMA 5A6IA 4TRPL 1ILUA 1NKGA 5AW7B 2Y4SA 1RSFA 3CWGA 5DD0H 2F08A 4HF5L 2YGPA 4UINL 4BYHA 1A65A 2YPLD 3B3IB 3U7YH 4ENZA 2YN5A 1F90H 4KX8A 3V4UL 4GSDL 4I3SH 5JZ7C 5DZ9A 1JHLL 1VFBB 4L0YA 4HIHA 5D6CA 3WEBA 1JZ3A 1MI5A 1XMWA 1VGEL 4IRZH 3VQ2C 3TA3B 2GABA 2YPLA 3B9KC 1A9BA 3IGKA 4ADIA 3MLSH 1MFDL 4PWEA 3GSWB 5IJKA 3MR9B 1AKPA 2PP7A 3KPNA 3NCCB 3ATAA 5IW1B 3UTSA 4BH7B 2LE9A 1U3HC 2GTZA 3HLKA 1INQA 2VLRB 4NX0A 3KJ6L 3B5GA 4ZMLA 5TDOA 3TM6A 3F7QA 2M8XA 2VDRL 4RH4A 4K71C 3MLYL 1NIDA 4WSKA 4LHUA 4UV7H 1MY5A 3DTDA 5D7IF 4YBQC 1JVLA 4XBEH 1ZTXH 5F1KC 2BVPA 3OAWA 3VFWB 1S7XB 3RDTA 4NUGL 4AE1A 3ZUCA 2B1HH 3VGHA 2ZWNA 3MR9A 3PV6B 4HUKB 5CP7A 4DN4H 2F58H 2K70A 3HHRB 4N22A 4X6DA 3HRZC 3WXWH 3QQDB 2HFGL 4X7SL 2ZAGA 2ZF8A 5MP6H 3MX0B 4LVNB 3MOAL 4RFNC 3EHBC 1KXVA 4OFPA 1A7PL 4OLEA 4Y1SA 1XX9C 3SQRA 3UTSE 3TBWB 2X4OB 3VGGA 2R8SH 1GY1A 4JM4L 1EXHA 1M7XA 5KYYA 1MWAL 3L5WA 3SGJC 2VE6B 1LVEA 5IFHH 3HC4L 1CFMA 3ILDA 3FQRA 3FOLA 1AR1D 5FLVA 4N2AA 3DJTA 1NIFA 4MCMA 1FZOB 1SVBA 3E6FB 4R4BB 2A77H 1ZEAL 1HQRA 2XX0A 4P9HL 3ABZA 4AMWA 4LLAA 5J3HC 5DEFB 1IZKA 2D7OA 3DUUB 2H2SD 2IFGA 3HMXA 3UTZA 1V3KA 1WZ1H 4H44C 5E6IC 2GITA 3ABGA 3Q1EA 3P3UA 3T8VA 3WNNA 1RL1A 3GMLB 1PW3A 2Y25A 1IT9H 1CVSC 4FERA 4L1SA 1DQJA 5C0BD 5C97A 1QFWL 1JZ6A 2Z8WC 4YHKL 4G8GE 4K5MA 3X1EA 6FABL 3BAEL 3O45A 2Z92A 4JGJA 1CICA 3RU8L 1EXUA 1C16B 5I8CA 3EXLA 5GS0L 3K71A 1XF2B 2P44B 1Z9MA 5DJ2B 4CVZB 2DLGA 3EDEA 2AQRA 3IFLH 2LR4A 3PE9A 1AP2A 2XVKA 2VC2H 3VFNA 1BFVL 1IKNC 5FF6B 1ZVSA 4Z8FL 3IJ8A 2AK1L 4PRIA 2CDGB 4HIIB 3S88L 2DIBA 3I6KA 5LGKA 1HFUA 1F45A 5DMYA 1OGAD 1SF3A 4FQ2H 2FWUA 5IV2B 4Z3IA 5C0RH 2V2TB 4DKEL 1I7UA 3QEQE 3FHEA 4ZSOB 5IJBC 4DVRH 1VZHA 1CL7I 1HCVA 4RGOH 5EBMB 1KN4H 3LKRA 1BAFL 2M1KA 3UJTL 2YIHA 5CHNB 5CWSA 1L9OA 4QGYA 3NVQA 2QLVB 3R1GH 3KPOA 2AEOA 2R0WL 1TPXC 2XKSA 3JWNH 3MYZA 4NLAA 3BYTA 3VXOA 4BRJA 4PJAE 4Y2DB 3U79A 4YUEL 1EEZB 1U3HA 3Q8FA 1E5CA 1BZEA 3OZ9L 4ZODA 3NCYS 3WO4B 2ZUWA 4QUOA 3MLYH 3VWJC 1JZ8A 4KGLA 3TYFB 4FP8L 5DR5H 2MOGA 5D2LA 4M5SA 3D30A 1H0DB 5A3IC 5FYJH 3CC1A 5ISZD 3GRGA 3IJYA 5F88A 3GMRA 1KYOK 3DHMA 4DZ8B 2CNZA 4E2OA 3L1GA 5EUKA 3AG1B 3MLSL 2ALAA 5EOCL 3P2DA 2XV6B 3WD5H 4DCQB 4H4NA 4JJ5A 3KPSE 2R2BB 4GBXB 3OLDA 4Y19B 3WNIA 1KACB 3WJJC 2UZXA 1IKNA 3K46A 2Z4QB 5EBGA 2ED8A 3N0AA 5I15H 1JGIA 1B0RB 4UT6H 2EVFA 4EOWH 2EADA 1T5WA 1DUYB 4RMUA 4XMZA 4NO3B 5J12C 4ELKB 3P4NB 3ARFC 4JPKL 5FKPB 2JI3A 4N1EA 3HE7A 3HG1B 3L4YA 3AXHA 3W9DA 1FAIL 4LCWB 2WLMA 2ZKHH 4XGZA 1ZOXA 3BDBA 3DVIA 3IK2A 4XO8A 3ZO0A 5HHXH 4TPRL 2OS7A 2VLLA 4W9HC 3L1OH 1UWXK 1KWKA 1TZGL 1D6EB 1GGYA 4NQXB 1CWVA 1JZGA 4L4TA 4M9OA 3LIUA 2XXMB 3ZE1F 3ZDYB 2XPGA 1G9ML 4PIBA 4UQBA 4HFWB 1RZ8A 1GHFH 3VCLB 4DVBB 2ZNWA 4UOZA 3CK0L 5IQNA 4QDGA 2NY2C 4TTDD 4MNHA 5D1ZD 4QJ3B 3IFOB 2OCFD 4JFHD 4HEPA 3QIWD 3S5LB 4M1CC 2AHIA 2VLLB 3IS1X 1LO4H 1FGNH 4LOUD 4QHLA 4Y8AA 3VH8G 4MNQB 3FUKA 3B7UX 3PAYA 3A67H 1SOXA 1FO0B 4P3DB 4U6YB 3HJEA 4KY2A 1VERA 4TUJA 4X0NA 4WKZA 4F1SA 2G0LA 1H5BB 2F19H 1E27A 2ENPA 3MUJA 4KKAC 4QTIH 4DT2A 2AQ3A 1J05B 2FT6A 5CIPH 5T1KB 5DVOA 5IOPB 2OL3L 4NUMA 5KTEL 4RAUB 5J1AA 5HDBF 1NGZA 1C7TA 2ED7A 4BELD 2QSQA 5C0GB 4G9FA 5H37G 4YGVA 4TKWA 3QZWG 4Z9KB 3UYRL 1BIHA 1CGWA 5LNEA 2J57A 4FLSA 1JF6A 1XDTT 3ZIYA 1AY1L 2WMPA 1OSZA 3E80A 3HPJA 3UZEA 1FQ9C 4GAJH 4A7GA 5FV2A 4PJIB 4N25A 3UEQA 3RX9A 1NFIB 4LSTL 1FNEB 4XWOC 4YZFE 4PV9A 1XF5A 4LSPL 5DC0A 5ISZB 4DHLA 1KTBA 3QH3A 4JG9A 1PAZA 3RGVA 3FFCD 3MRIB 3GQFA 2P48B 2FB4L 3GBLA 2ICEB 3L5IA 1IE4A 1FZJB 2VN7A 3V2AR 2HRLA 4PMEA 3QXAA 5DUML 4Y9EA 1YY8B 5LHDA 1JPTL 4FA8A 3WAKA 5HDRA 2GBVA 1LD9B 3WS6A 5E8PA 5HGHA 3OGOE 1S7TB 5F21B 2O93L 1G43A 4YHPB 2Y7NA 4ILDA 1QNZH 3KLAA 4P2AA 2Y36L 5M7QA 1ZHBB 3KPLA 4JHAL 1N5YL 1UWGL 1L0XA 5EU4A 4G8IA 1LK3H 4J3OH 3QZPA 1ZHKB 2NTFB 4NI6A 3ZXAC 2F53E 1BZ8A 2FHBA 3KPRA 4JRLA 4Q6IA 1IAIL 1ZLDA 3HC0A 3QJUB 2MPVA 3QA3A 1BVNT 5FYLE 3U36B 1QSFE 2R56H 4WUUA 3RUGB 3C60D 1KF9B 1TQCC 4JFED 3TX4A 4XCCH 3EYVA 1XGTA 3JV4B 3LEVH 1KIQA 3EJUA 4IK7A 5E8OB 4NT6A 3RY4A 2PN5A 4FTVE 5BZDA 3EKCA 3PWNB 4NOFA 3T09A 1B2YA 4LLDB 1KN4L 4PJDE 3UJTH 1DBAL 5BS0B 5HHXL 4JM2B 2C9XA 3B3IA 2PKDA 4IBUA 3BW9A 3Q6GH 4N26A 2ESVE 5DHYB 3C60C 2XUWA 5AG8A 1G0DA 2Y9RT 5D2NE 3SDAD 3S4SB 3T5WA 4ESKA 3IMTA 1LO3H 3ZHNA 3ULSA 1GZPA 2DDQL 5J8OA 2J2ZB 5AUMA 4W68A 4EOWL 1N5AB 3BVNB 3AM8C 5D72L 3KZ8A 3HZKA 2KHAA 4JVPA 1HXMB 4WWNA 2VISA 5JQ6H 4RWHA 3NA4A 4HJ0D 4E5XA 4LVHC 3WXVH 3C9NB 4IEFA 5LAPA 1KNOB 1S7TA 5DA4A 3COOA 5KOMC 4NQED 4P05A 4J7RA 4OIIH 1ZLWH 2FEEL 2NY4C 1WZLA 3RTQB 4H20H 2JI2A 4O9HL 2KLSA 1R75A 2UZYA 1KJ3L 4JFOA 4JPIA 1JRHL 4PS4H 5CM1A 4WW2C 1W2KT 2IAAC 3L13A 3SDCD 3T0EB 5F7EH 2YXMA 5FGCE 4ANVA 2H47C 3BPNB 1A14L 4EI5C 2OQJA 4BFRA 3IU4H 1UYWL 1OSYA 2KQMA 3H42H 1D2OA 3IDYC 1KB5A 2BNQD 1FYTA 5DVKA 4BA8A 2P24A 4GSUA 2J4WL 2AJXH 2A38A 4GAFB 2XWZA 5ID0A 6PCYA 1RZIA 1OTSC 2NLJA 5F6HJ 4OH2A 1JNJA 3GHBH 3INOA 4YPGA 4MX7A 1G5GA 1WUZA 5GIRA 3B7RL 2JKTM 4L8SA 4UMGA 5DHDA 2BZCA 1JYVA 4XN9A 1OAXL 3EJQA 3GK8L 2VTFA 3ULSB 4TLKA 1A3ZA 2FQFA 5EEUA 5C2UB 2OXGA 1E6OL 3OMAB 4PAZA 2B1AH 4BHUA 2J8OA 1KT2A 4NC1E 4ZPTA 3ZE1E 5GGVY 3K6SA 1OP4A 3FU8A 3SPVB 4Y9CA 4OBSA 3ARFA 4UQAA 1O6VA 2LU3A 4YO0A 1WK0A 3O6KL 5CIPB 2PTTA 3LB6D 2YEZA 3HAEB 5FYJU 3N44B 2W38A 4Y2DD 1G7LB 1PKQA 1SXCA 4PJIF 5GHWH 1ACCA 3A4DA 2UZYB 1F4WH 4JPIB 3T08A 5F7FA 1JGUL 2GSIB 4LARL 3OB8A 1MAMH 4CU8A 5A2CA 5EZPA 5SWSE 4XN8A 3BAEH 1URLA 4PJ9C 2APFA 3T2QA 3REVB 4K94C 4LLQB 4L37A 4M03A 2A6IB 2QPFA 4OF8A 4WO4A 3ZGHA 1NAMB 2NDGA 4OT1L 5ERWA 1BIIB 1MAKA 1MWAB 3V4PB 4ACTA 4LRIA 5TFSH 1MG3C 4WK2B 3VXSA 1QO3B 4HW6A 4QHMA 3DK2A 3FCSA 1CT8B 4PJGB 1L5GA 4U4IA 1AJ7L 4MLIA 3BVXA 4UTAA 4Y4HD 4LKCB 2ZX6A 3L1FA 4PRID 4PJCF 2H6OA 2GJ6A 2CXGA 3GSWA 2WMPB 3U9WA 2BP8A 5KVFL 5F0MB 1U8LB 1QRND 4D2NA 4GXVL 1CL7L 3EJPA 3PWUA 2R23A 2A7BA 3Q2VA 2BVYA 1KPUB 3ESMA 3ULUE 2E3VA 3ML8A 4N28A 4QHKI 4N2OA 3CVHH 3S36H 1NUNB 5C0BE 1WZAA 3LEVL 4ES9A 3I6KB 2JV6A 3LKNA 1XBDA 1XXFC 4JL1A 1H5BC 4WUKH 3RVTC 4Z7NF 2P8MB 4LMQE 3VRIB 2XT1B 4H5SB 1RK1B 2EVHA 3OKLA 1X5GA 2PUQT 1YC8A 1MCDA 2K9FB 4OZHA 5C0IB 3SCMC 1DANT 2AGJH 3IJSA 4MCZA 2CZNA 4JHAH 4I3RL 1JG9A 1DBMH 1EGJH 4M1GL 4PGCB 3BDXA 4NQEE 4NZRH 3LS5L 1NANI 3FO9B 1FNAA 3FAXA 4N68A 1XCTA 3K5RA 3QVAA 2MCMA 1EFXD 4BGLA 2DYPA 4XNBA 2OSLB 1VLXA 4LE8A 2F5AH 2CBTA 2MCPH 3ZMEA 2BIOA 5KSBF 4D9RE 3WS6C 4RAHA 3M7OA 5KYYB 4R90H 1RZFH 3WI9A 3KPMB 3AREC 4QJ4B 5KSAB 3VI3A 4KKRA 4AZ8A 2IMMA 4YNYA 2VUKA 3OZ9H 2ZTBA 1I1FB 1HHJB 3PXHA 4PJAA 1JE6A 4GUOA 2RBLA 1UD3A 5D7SL 3OR6B 3C12A 1W8EA 1EEYB 5JPMB 4P4RA 3FTGB 3VB8A 4MJID 1FBIL 3VFMB 5D7LB 3SOBH 3ZYZA 2WQSA 3CAFA 3CUPA 4ZAKC 4L9LA 3RX5A 3X13A 2BZ7A 3DI3B 3FULA 5KEZA 2VITA 3FH5A 5KBPA 1XZ0A 5E70A 2QPDB 4R7NB 1T2QH 1TETH 4PVMA 3TO4D 1YYLL 2GHZA 1U3NA 3K71B 2W0PA 1ZHNB 1ZS2A 4HWBA 3TVMB 4HAGA 4S0HA 1TJMA 5B21A 1DQDH 1PAMA 5C0DA 3OHMB 4XCNA 1ZLVK 2XA8H 4ZZFA 1GAFH 4GQRA 1RZPA 3J27A 1HXYB 5J3HD 1I9JL 3LNIA 1X7SA 2KZBA 4HS3A 2N7BA 3FT4A 3ECVA 2B08A 5TE7L 3AQYA 5C0NC 4GW4B 4P2QE 5TDPA 3VI4A 2CO7A 4YHKH 6FABH 1E0OB 2XTJE 4XNYH 3LEYH 3A24A 5HHOE 4BUHA 1FJ1A 3KW7A 5HYSG 1TFPA 2PCPB 3D07A 1QLRB 4WO0A 3U25A 5B7EA 4RBPK 1KZYA 3FN0L 5DUPL 2NQ3A 3KLHD 2FL5A 2MOQA 2C5DC 2C4FU 2CLRA 4FFZH 4H88H 2Q10A 2VL5B 2FJSA 3RJDA 4XN4A 1JV5B 3BDYH 2HJKB 4HCRL 1BX2B 4PRPD 1A4JB 2X2IA 3MN8A 4QRAA 2Y3NA 2L0DA 3N91A 3VYNA 2Y5EA 3SO3C 2IEPA 3QH3B 5FM4A 3MXVL 9PCYA 4AGPA 5KVEH 4Q8BA 1E3XA 3D0VB 3QXTA 3FO1A 3OXSA 4YLQT 4N8CL 5KSVB 2VXUH 3WO4C 4CL7A 1DE4A 5DRWA 1V3MA 4HV8B 4AL8H 4HMEA 3CSPA 1BYNA 2EILB 3MLTB 4HBQA 4NKDB 1BJ1J 2NY7L 5FA3A 5FFLA 1TR7A 4MB3A 2X89A 4K8RH 5D2LB 4DUWA 3ZE2F 2RR3A 1U2CA 3RBSA 4N86A 3P77A 5F3HA 1NCTA 5HHME 2YD9A 2OAAA 3OAZH 4Q9QH 2MHAA 4BZ2H 5D7HA 1CD9B 3QDHA 4TVUA 1A8ZA 4LESA 1SEBA 3AWGA 2CCVA 5E6UB 4OZIF 2OTPA 4QR7A 5CU5A 4FXLA 2BWDA 4FQLL 2MNWA 3BP7B 4OI8A 3QNXB 5KYUB 4X99A 3POHA 5CLZA 4NHUA 1T0NB 3PG2A 4Z3JA 1WDAA 3BIBX 1J1OH 4C59B 2J5WA 1E2ZA 1S8DB 2B4CC 3CUPB 4JRWA 3NJJA 4N0YL 1P7QB 4RWYH 3TIEB 1DFBH 1EAQA 1EBPA 2JFCA 2K45A 3APMA 3FRUB 5B22A 4E41B 3RWDA 4PI2A 1UM4L 4NQCA 3FO0L 3VGBA 4Q4IA 3SKNA 2XWTB 2EEDA 1QUPA 3U6RA 3GSNL 1VGEH 5MENE 4IRZL 1QMUA 2XRAH 4W6YB 1M53A 3AT9A 1E4XH 4OFVA 4JLRB 1JF1A 3BGMA 5TE6H 1ESOA 2VSCA 3HG5A 3QFDB 5CZRA 3NACH 4XC3H 1J0KA 1UT9A 5JXEA 1HXMA 1UGNA 4WK4B 2ZOKB 5BVPL 2WBWB 3JWOH 4KHXL 4ERSH 5IZ7A 1N6UA 4TSCL 1H8NA 3FN3A 1L4IA 4TRPH 3ZE0E 1J9RA 1MRFH 3LQZB 2P8MA 5ETUB 4J8RB 4K07A 5SWZE 1XGYH 2V17L 1UACH 3HKZA 4ADGA 4WI6A 1RZKH 5E1IA 1NGXA 2QDWA 2ZXQA 1BXVA 2BDNH 2VZOA 3MJ9H 3CH1A 3SHSA 4AWJC 4P46C 4YE4H 4IS6B 2Q6WB 4Y19E 1GZPB 3VXRE 2O5XL 1FL5B 2IWFA 3LPGA 2A83A 1BJMA 4YVUA 3WLBB 1FORH 2W88A 1PZUB 5J6GA 1LK2A 4ZFOB 4MXWL 5T3XH 4D0BA 1BOGB 2X6UA 2XFXB 5EN2A 5E5LA 5GRWA 2QDVA 1FE8L 3UBFA 5JHDB 1YEGH 3L4UA 1FUNA 1MJ7L 2EACA 4PB0H 3K6DA 4Y4FB 1VACB 5G4NA 2D0HA 1OB1A 3WNMA 1IL1A 3OMNB 2XIIA 3RWFB 1NC2A 4TQIA 2XTJD 4HHGA 3G9VA 3NRFA 3WE6A 5EU7E 2PYEB 1FH2A 2AQ2A 1B4TA 5JHMA 2VN4A 4Z95L 5IFHL 3ZQWA 3KPSA 3QUKB 4JQXC 1C1EH 3C8DA 4BFFA 1KFAH 3FDWA 1U8IB 2ZQKA 2J88H 4X9YA 3Q5OA 4FG2A 4N90D 3SDCC 3NCWA 4E68A 3QWQB 1IIKA 1DSYA 2IIJA 4M3KB 4PJHF 3IRZA 3OC5A 4V1DA 5DJYA 5DMKA 4A7QA 4I5BB 4APQC 3QG6B 2AEQL 5CD3A 1ADQH 4BUQA 1ZT1B 1MVYA 3ARVA 5E8PB 5HGHB 3FONB 5ICUA 3D85D 4HJJL 3DMMD 4PV9B 1ADWA 2GI0A 3VXQB 1MVUA 3IDMB 5AW3B 3NOIA 3HLAA 1GGCL 2ZUXA 3G5VB 3B9KB 3QR0A 3WHXA 3DMMB 1QR1A 1F5WA 2EDQA 3CZEA 4ZO8A 3W9EB 2W1NA 1K5NB 4R3SB 5ADPL 3NSFA 2NZ9D 5EO9B 4LQFH 4FQCL 1CQKA 3FQYA 2F5BH 2W81C 1MZZA 4G83A 5E5MA 3DJSA 2IALB 4K5PA 3CU1A 1J9SA 2RD0A 4KPHL 2CGYA 2G9HB 2HP4A 3DPBB 3OXRA 4CBPA 4OM1H 5HGAA 3V0EA 5FOJA 1UTDA 4KJYA 2BSDA 4LCYA 4I0KA 5GISH 2M2DA 3DKHA 1NBYB 4TUUA 1MF2H 4FNRA 1FLRH 5CLWA 2FATL 4LK4A 4PCKA 3L3OC 4PJHB 2WWOA 2XY1A 3A6CL 3PIQA 2YC1B 1H19A 4L5FH 3R7QA 1R33A 1F6AA 4JFEA 4UOQA 3DX7A 2LTQC 5E5MB 2D7NA 1P7KB 1SHSA 5BS0A 1I85C 4LLWB 5D6DC 1A6VL 4IIQA 4X8CA 2BSSA 4MA8H 1HN1A 1QPPA 2EIKB 3OQRA 4WHYG 4DEWA 1SXAA 4N20A 3MNVA 4PW3A 4OCXL 3HLAB 4MHHG 2CO4A 1DQML 3PL6D 2HMIC 5AOMA 1X5XA 2V5RA 3V5KB 4FKKA 1UJTA 3I6LE 4FG0A 2EDMA 1I1AC 4LHQB 3PWPB 5DVLA 5AB0A 3VNYA 3NMEA 1L5GB 1XEDA 2X4RA 4O4YL 3EXJA 1U8CA 5B8CB 1K9TA 3O2VL 3T3PE 1FVCA 5IBTH 1MCLA 1CPUA 4P5TA 5EOQL 4YDLC 2D3JA 2Q7NA 3Q05A 1UXWB 1RHHB 1UT2A 5AAMC 4X9GA 3MA7B 4OBRA 3IE9A 4U3CA 4N87A 4DW2L 4HJSA 1GR7A 4Y7MA 4XVJH 2YGQA 1GYUA 1RLWA 4OB5L 4J6RH 5DRNB 4P4KC 1DZBA 5I1HH 2P8PA 4CILA 2ZUVA 3BVNA 5D5MB 3ZMNA 2CGZA 4AQ1B 5CCGE 4FQ1H 4EO5A 3VNZA 1CFSB 5IM7B 3OBAA 1Q72H 4HS8L 3BSZL 1EO8L 1J48A 25C8L 5H35B 4UM9A 3JVFC 5AVYB 1AE6H 1I3RA 2G3NA 5H4ZA 5LGHL 4ZK8A 4UT9A 3V7AE 4F57L 5IJCC 3ULVF 1H3PH 4PB9L 4PTTA 4KTDL 4TUOA 1K8DA 3L7FB 5B8CC 2NUTA 4JFSA 2A9MH 4OJEH 4I0PB 4GYBA 3N6YA 3GLZA 3C09B 5DRNA 1OVZA 2BK8A 3ECQA 4I3SL 3WLWD 3AJ7A 1OTTC 1G1YA 1UM5H 5J6HB 5HY9B 2YQBA 2ENJA 4Y2OB 2X88A 4XNZC 4NRZA 1CGTA 3MSPA 1PD0A 3RWJB 5IVNA 3HC3H 2Z31B 4Y1AB 1Q8MA 5T1KD 1Q0XL 3DMMC 5CUSH 3CVDA 3ME0B 2ZSVA 5F0JB 5DSCA 2YPVH 1NGYB 1I9RH 2IADB 4U7SA 3OKOA 2HX9A 4X7EC 1MCSA 1OW0A 2NNFA 4MAYD 1HZHH 3S5ZA 3FC8A 1HHHB 3HAEG 5C8JB 1OSEA 4HGWB 2CBPA 4KDTC 3OB0H 1NEZA 2VH5H 3QW9A 4D94A 4U2ZA 5GS3A 1BPLB 4NNPH 4XZ4A 3O4LA 5HI4D 2NY3B 2PABA 4RVBA 2MNJB 3ZKXB 5FF6A 1CN4A 3MPCA 3N1PC 3WNJA 3RGBA 2C9UA 4L23A 2ERJB 5T8IA 1ET5A 1IGCL 1OTTD 1TZIB 1ZVYA 5DZAA 1SBBA 4H25B 1OAKH 4R4NC 5AW1B 5GPRA 5I17A 4GG6A 2NXYC 4Y4FC 1E4HA 3W0WD 4JDEB 1E4WL 2MIZA 4ATTA 5C7XH 5FDYA 3TH4T 2VKXA 2IQAA 5C71A 1MH5A 2FWOA 4G2AA 2KQNA 4DOHE 3POCA 1K3ZA 3I75B 4XP4H 3X3GH 3LAFA 1EDQA 4Y2OA 3NTCH 4GS7C 1P7HL 3TO2A 1R3JB 2YMXH 2VM9A 5E2VH 1CLYH 1GY2A 5T1DL 5I1GH 2H8PB 2B59B 4AQAA 4X6DF 2YQGA 5DUBA 1DE4B 2ETWA 4J6IA 5LN4A 2ZG1A 2D2CC 4YC2C 4ZFGL 1S7WA 1BGXH 3MJ7B 2WBJC 2VRQA 2UY7B 3IWVA 4XNYL 4L0ZA 3AS2A 3QO1B 1LK3L 1D7CA 2FH8A 3DJ9A 1MUJB 3FQ1A 4K8RD 4J3VA 4RX4D 1M1XB 4PRPB 2IG2H 3TZVD 2H0JA 5IFJB 5FHAH 3BCDA 1C8PA 5C09B 3UAFA 1CXFA 4IBWA 4Q9QL 2WIIB 1OM3H 4HEME 2JJTC 1M7IA 1MLBA 2FJFA 4K23H 1CFTA 2QADB 4KC3B 3WNPA 1OB0A 1WISA 1G7HB 4GUQA 1T0NA 2YK1L 4AEEA 4QRTA 3WTYA 1DBBL 3GSNA 4ZZKA 4JQVC 1N59A 3BVDB 4H8WH 4ALAC 1ZLWK 1CFBA 4LVOC 5DJDA 2CUHA 2ZD0A 3MOAH 3QHTC 3WS3A 1UYWH 4AJWA 32C2A 5CWSB 4WRLA 2HFGH 3ZZSA 3ALXA 4TM9A 3TFKD 1ML0A 1INEL 3VRLE 1CYWA 4Z7IA 3ZX1A 3P4NA 5FKPA 4G6KH 1AD9A 1IBGL 2BHZA 2GTZB 2VIRB 4FN0A 5LCVL 4NJ9L 2X70B 2GG1A 2MQCA 3BZEA 3KGTA 3NRPA 4H13C 2HVBA 4BSVA 1P1VA 4S1DD 5HBBA 2F18A 4QHMB 3WXVL 5C6TL 2OL3H 2VLKA 3P02A 3KWWA 5I1CH 4LCCA 4OQTH 4U05A 5IWLC 3VVWA 5B3SB 4Q97A 1BLNB 1NH6A 4XN7A 3BRGC 5LO7A 3A0OA 1X4XA 5I1JH 2HKHL 2O30A 5EU4B 2EUWA 1EEQA 2Y1YA 3I50H 2Q6WA 2EYTA 1QA9A 1RHHA 2HRPH 4PJFB 4XPAH 4ONGH 4WO4B 3QHZL 1RERA 3WFHB 3H55A 5L0QC 3WKQA 4WWKA 3NJGA 3CFJA 1G7HA 3H6JA 4MCYA 4K15A 4U1MA 4RMWA 4YMPA 1OP5H 4KVCL 1BXAA 5GS0H 3KR3L 3V52L 3BKCH 4IOFD 1HEZB 4LLYA 2J1YA 1DDTA 4PG9B 4S0SD 2XZCL 3OTTA 4MB4A 3O2DA 4TSCH 5DFVC 5IHZB 3H0TB 1PZ3A 3FB8B 1Z9SB 4C56B 4L29B 1HYRC 1J1OL 1T5XA 4Z6AT 3BN9C 3VWJA 1A6PA 3CHRA 1W0WB 2XA3A 1RP9A 4WWKB 2ZKHL 2V33A 3A23A 2YJQA 3QZWB 4U1KB 1B3JA 1PJ9A 1GSMA 1X5JA 3UROR 1F4YH 2XN9D 3X1FA 4KZDH 4EEEA 2ESVB 4K5OA 3OF6D 3ZBMA 3O45B 3VU1A 3WBDA 3L48A 1JXKA 4WGKA 5I18L 5I15L 4PP2A 5KW9H 5BZZA 2LLLA 4AMKH 2DQFB 3G5WA 5IBLD 1SY6L 1TVDA 2I32A 3FXIC 1EAPA 5IW3A 1AQDB 1TJHH 4X4XA 5EWIL 1NCJA 1N64H 2J43A 2N59A 1U91B 4M48L 4PB9H 5D7LA 3S2CA 3GSQA 1MELA 1NOLA 4G71B 4ABWA 2QQNL 4Z7VE 3BWSA 3WG7B 2IH8A 1L9NA 4POYA 4IBVA 4LOVA 2H3KA 2JE8A 1FH5H 3X1GA 4V33A 4UIMB 1BWMA 1FNFA 3MROB 1OQOA 1LEGA 2F1EA 3ECBA 4KZCA 4Z0XA 2AI0H 5BUGA 3MCG1 2J7LA 2GFBB 2FBJL 5GXBB 3N44F 1P6WA 3FT3A 1TSHA 2X6VA 1IAIM 2HLFC 1ANUA 2HT3C 1BFSA 2FCBA 5AYQA 5FUOL 5TJWK 2D8KA 3G3LA 1CGYA 4TTDC 3W1ZA 1TVHB 4YSOA 5JTWA 5TGBA 5LKNA 1D5ZA 3HZ3A 4L2YA 4JFTA 3I85A 5AB1A 5CEYA 4HSQA 3WJLA 5E6YA 4U1IA 4S0TD 3FRPA 5IT2L 7FABH 2OP4H 2XV0A 4MB1A 2NXZD 4X7TB 3A6OA 2WLJA 1QW9A 2D3VA 2YS4A 3VTMA 3B1UA 3D0AA 4YSSA 2KC0A 3RA7L 1S7VA 3OAUH 3GSRA 4P23A 2F54E 2AXHA 3KJ4B 4HLZG 5FO2A 4BCXA 1IFHL 4BKTC 1UKSA 2WUCH 5JQHC 3ORJA 3SSGA 4TSBL 1CDIA 2H2PC 5KVFE 3FFOA 1BGXL 5D1QD 4EN3C 4I77H 4ZAKB 5AFAA 1D5ZB 4YFLF 3BO8A 1N0LA 1T89C 5C08E 5H8DA 3WEXB 4DPCX 2OMXB 4XB3A 5KJRH 1U8HA 3HUJA 3ZTJH 1NMAH 3HG1E 3OGCB 4A2GA 2VNCA 3EJZC 2OMTB 5AZUA 5F7HA 1LK2B 5DD5H 1E4XI 3DX6A 2X4QB 3EDFA 1HWGB 1DVZA 5D96C 4X5LA 5A1AA 1T4KA 4JRXB 5EDXA 1XSIA 4DTGH 4C4BA 1RZJH 3IGAA 1AKJB 2WIMA 3OSVA 1O7SA 5EBLA 4OLYL 1B0GB 3FCSB 4OIBA 2FYYA 1HHIA 2K7PA 3EJRA 4EI0A 2HX7A 3LRGA 3MBXL 5FYLH 2AK4B 2GJ6D 4OCRH 4KPHH 3M1OA 2Q3ZA 1CFQA 2ZX9A 3QWOA 3CQFA 4FL4B 4OCYL 1AZNA 4PJFF 3WELA 4NSKB 1KBVA 1MPAL 4XPAL 3ECWA 5EORL 4K5NA 3TFBA 4LBEB 1XT5A 5K1NA 1S5HB 5LBVA 2P5EE 4R2GB 2YAQA 1W72A 2YRLA 5INDB 3SY6A 4UQIM 4XHJD 2C1OB 3BP4A 2VR3A 5DHVB 1IQDA 2YMTA 1XIWB 4WI0B 4Q56A 4IMKA 1LMIA 1HEHC 3BCFA 5KVMC 5I1KL 3CFBB 1NPNA 4KKQA 5EEXA 1NEUA 4ZMXA 2R56L 3GXUB 1U4EA 2AV7B 1MIMH 4ZQKA 5DJ2A 2GJJA 3MODL 5A40E 3O3BA 2R1YB 4ISVA 4QNPF 4TL5A 3CQQA 2PWGA 1A47A 4KXZH 5D9SA 1NOFA 1G7MB 1W0VA 3PF2A 5IVXB 1OHQA 3D7PA 3KWVA 2A9ML 3KS0J 4MQTB 1A6ZB 3AXLA 1HOEA 1YEDA 3L3IB 5FDWB 3R7RA 4PJFA 3WFHA 5L2KE 4P57B 1H3PL 1T6WA 1MJUL 5G5DA 2E75C 4U1GC 1RJZA 1DVUA 2F54D 1MCOH 2VERA 3BKJL 4GT7A 2EDDA 4KK6D 5K33A 4X80H 3KWTA 3ASNB 3T4YB 5BV7B 1M4KA 1Q9OA 2HB0A 1J0IA 2IPTH 3R06A 2DOCA 4A63A 2AEPL 2C1PA 3DV4B 3MI6A 1RULL 1HSBA 4OZ4B 2QSVA 3E0GA 5D70L 1BQLL 4OTXH 1F3DH 1KGIA 1ETA1 3AU0A 3KPRB 3MBEB 3RUGF 4MNHB 2WB1A 3FB6A 5DK2B 3VGEA 1E5AA 3HS0A 1XGUB 2E7BA 3QS2A 3V4UH 3IJEB 2QVKA 3FQXA 3M17A 4OLZL 5I0ZA 3LTVA 1KDIA 5JMOC 2P42B 3IDXL 2JKSA 5JW3H 1HESA 3E2HB 3HS9A 1OTUC 1JNLH 3UDWA 4G1MA 5IHBA 5I6OA 3SGJA 2MPAL 3ZL4L 3QG7L 4B0MM 3KBEA 3Q6GL 4FZ8H 4HCGA 2QVIA 4IRSC 1Z0MA 2PXYD 4GG6F 3FPYA 5GRJH 5AENA 2VDLL 4I8DA 5I1DA 2DRUA 3VAEA 3D2UB 1V5JA 3BIKB 1Z9LA 4JPQA 4KQ3H 4RMQA 5AUMB 2PXYA 3P4OB 3CH8A 2WANA 2PWDA 4F9PC 4KMLB 5GS1A 5DJ6A 4HZ1A 4OUOA 2WQVA 1SLVA 2V2WB 3HJ0A 1DHKA 4FTVD 1RPKA 4HVBA 2B1AL 5EUOF 4HLJA 2E7LA 4TNEA 1BMZA 4UV4H 2X0VA 1ZEAH 4PJIA 3FU6A 5KSBE 2B59A 4AQAB 3C60B 1BQHB 3D1MC 1NLDH 4O2FB 4RNRB 3WTWA 4X7CC 4OI7A 4MD4B 3F64A 1FSKB 1P84K 2NY1B 4Q0XH 5KVGE 4EDWL 4YEFA 1JV5A 3B83A 4YDVB 3ZDYE 2HYMA 3VB9A 4CBZA 1DVQA 3AACA 3BUYB 3JT2A 4ODXB 2HFEA 2NY4B 4K7PX 2DQDL 4XP9L 3QEGL 4U1NB 2AMGA 1HINL 2BVOB 4IMKC 5FYJE 1I3VA 3FCUB 4NO5B 1N10A 1BD2E 4FRWA 1MREH 2AW2A 2CR6A 4GJTB 2F9BT 1URZA 5KSUB 4FYTA 1EZVY 1VAHA 1A6WL 1OE2A 4NPYB 5F7DA 5EDSA 4JDEA 1JJUA 4ANWA 4DPRA 2X9WA 2XBDA 3FYEB 4NNXA 4F33A 1YNLL 2GUYA 4ELMA 1CI5A 3AROA 3ARBA 2TSBA 3G04B 3MRNB 4IDJH 3F65A 1CDUA 4LDLB 2VR5A 2ZP9A 1QQDB 12E8L 4WFGD 4TQHA 3TZVC 2EKJA 5I66B 3SDXE 1F4HA 5HVHB 3H6AA 3ZHFA 5DSCB 4NCC1 5AL0A 1VENA 2HH0L 2N01B 2NY1D 2R0KH 3LZFL 1M7DB 4R7DB 1E5ZA 2PO6A 2Z8RA 1KJ3H 4H2CA 5ALBH 1RK0A 2D03H 3QPXL 4G8FB 4WEBH 5B3JE 4H40A 4F7CA 1BECA 3WFDH 4UAOC 5J6HA 1BAWA 1WTGT 3WTXA 4JRXE 4I9XA 1I1AA 4L8DB 3PJNA 3MRBB 4DKDC 4MNQD 3RWJA 1WE5A 2BVQA 5I1IH 5CEZH 4FABL 1M71B 4P5TC 1N26A 4L3CA 4X4ZA 3VD4A 1INDH 2EO9A 3EG9B 4P2OD 5FLUA 4I1PA 3HNVL 1G9MH 2TAAA 1SYVA 3D0LA 4O5LH 4L8BB 1SJVA 4R84A 5CIPA 3TEUA 1ZA3A 1H9DA 1BG1A 2AAVA 2G5UA 1JDAA 1ZSHA 2OMYA 1AD0B 2GTWB 3Q8CA 2E9GA 2PXYB 3MRLA 1SY6A 3P4OA 3TJPA 3OKKA 4AQ1A 1QSZA 3H9SE 2DTML 3QCTH 3SPGA 2O6DA 1AG0A 1U2YA 3CFTA 1WG3A