2ZD0A

Crystal structures and thermostability of mutant trap3 a5 (engineered trap)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
63
structure length
63
Chain Sequence
SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Transcription attenuation protein mtrB
publication title Intersubunit linker length as a modifier of protein stability: crystal structures and thermostability of mutant TRAP.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 10
structure length 63
sequence length 63
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 2zd0A00
2EXSA 3AQDA 2ZD0A 2ZP8A 3ZZSA 5EF3A 1QAWA 2ZP9A 1GTFA 3ZTEA 3ZZLA 1UTDA 5EEYA 4B27A 2EXTA 1WAPA 3ZZQA 2ZCZA 5EF1A 5EF2A 1C9SA 5EEZA 5EEVA 1GTNA 5EEUA 5EEXA 5EEWA 5EF0A
chains in the Genus database with same CATH superfamily
1K8IB 2ZAGA 4E41D 1QLFB 3ZQ9A 4QHMA 1F6AB 4KVPA 1TPXB 3KG5A 3D39B 4M3JA 1K6QH 5I1GH 2Z93B 3QNZB 3HPLA 1DBBL 3RURA 1AMYA 5F7HA 1H8SA 2F5AL 4QRTB 2DEWX 4K3HA 4G6FB 1P69B 5E2TL 5AOLA 4FFVD 4ZAKD 4U1IB 5AVZB 4KMLB 1JAEA 1G7HB 5D4JA 2VDRL 2HCZX 2VR3A 4JG0L 4LLWB 2ATKB 2OMYB 1RVFL 5FGCB 4DHLA 4XO8A 3OWEA 3FT3A 2C4XA 2J6EL 3QEUA 5ESQA 4OD2B 4UMSA 4AQEA 3IXAB 4XVTH 3GSOA 1VACA 2FD6H 3I02B 5EO0B 4EBQH 1TJIH 1SOSA 4I8DA 4PWJA 4IU3B 5KYXB 3GSQA 3U4EA 3ZRCC 4HIPA 3GB7B 5I0VA 1SEBA 1DP0A 1QFOA 4NPYA 5EIIB 1S7RA 1HC1A 3BAWA 4LPTA 1CCZA 1ID5I 1E9QA 4DP7X 1BQ5A 1YMHB 1ETJA 1IC0A 4X5XB 3P3RA 3ZGIA 2BVEA 2FEDD 4P0DA 2KQMA 3R18A 2ITDA 5C0BE 1IM9A 2PW1B 4Z6AT 3QFJA 3GI8L 4G6AD 1IEAB 2JTDA 1DBKL 1MCOH 1X5XA 3UZEC 4DVBB 3ZRSA 4A37A 1P0SE 3ULSA 5F89A 1GHFH 3RIKA 1FSKC 3ZSSA 2P24B 1MG3C 2MKLC 3JV4B 3G6AA 5I73B 4G9FD 1J0YA 1BZ9A 4U0QB 3B9KC 4KO6A 2PPAA 1J5OL 1N0XH 4J3TA 1E5UI 5JPNA 2D0FA 1X5IA 1JGLL 2P8PA 4EUPB 5DD3H 5D1ZI 3L17A 2GJ6B 3UO8B 1TQBB 3H0TA 5ELIA 3T0EB 2B15A 4Z7UF 1NGXB 4P5KB 2K3HA 2ZCKL 2IH3B 1F11A 3NA4A 5E2WH 3BZ5A 5JIIA 3RL2A 2EIMB 2QJDA 1IM3D 1K72A 3EO1B 3HMXL 3WNNA 1GCFA 1E5AA 4DCQA 3BHBA 4W9IC 1FZMA 4BELD 4FLHA 3B2UD 5HPMB 1B4RA 3PUCA 1PLGH 5K39B 2QQKH 1KYUA 3CIQA 2NX5D 4LCCA 5LO7A 1AOZA 4YAQB 1EEUA 2IAMC 3RLSA 4NZUL 1TQVA 1EO8H 4MNQB 3GKWL 4RH4A 5GZNA 1N0LA 3RIFK 3HUJF 4BA0A 4HZ1A 4WWKC 1JNHA 2E5EA 3DRQA 3GTNA 4GO6B 1Y1UA 4WTXA 2J4WH 5FDWB 2R15A 4DERA 3QWQB 1W0VB 5BRZB 4XPAL 2FJFB 3OAUL 4R0LB 3MFGB 1IFRA 3VFPA 3TEUA 4B9CA 2DM7A 4OIFA 1BCIA 1AZZC 1QHQA 3NJHA 2CJUH 1CMOA 1EEZB 1OT4A 2IH1B 2A6IA 1KN2L 4K55A 1ZVHA 1XR9B 4BZ1H 1CR9H 2DJSA 2GVYA 5GGVY 4MVBC 3O3EB 4LEXH 4XVSH 1H9VA 4PQXA 1H3WM 4NFDA 1J8KA 2DIEA 3KNBB 4PJXA 3TC9A 3FO0L 4ZS7L 3VFNB 5BZZA 4FQQB 3WIAA 2FO1A 1KJ2B 4UWQB 4N8VG 2G4EA 4J3OD 4JZNB 1QNZL 4R3SA 1IBFA 4UB0L 4KXDA 1T4KB 3B7RL 4LCYB 3GNMH 4RIRA 3SDDA 5HDBB 4YNYB 3ZXAC 1VFOA 2PYED 3APDA 5E4IA 4TLUA 4BFOA 3TPKA 3KM1A 3BWUF 4ADJA 5EOTB 3TH2T 4N2HA 4JN1H 4CU6A 4GQ9L 2HT2C 2R2CA 1YECH 1UWEH 1G1OA 1MQKL 2NY6B 3N55A 4BKLB 3QXWA 4BWWA 1YEIL 2W65B 1YNLL 2W38A 2Z7WA 1NAKH 4YHZL 1G84A 1O9WA 4UT6A 3KW7A 1YMME 3D08A 1BVNT 5ILTL 4OCXH 3I75B 5EZIH 3FT1A 1EJ8A 2DDQL 1HNFA 3S35H 1O75A 2ZE0A 1MEXL 1R5IB 1QPPA 3IJHA 4P23B 5INCB 1FO0H 1CE6A 4FXTA 3SN6N 3D25A 2MCG1 3QYMA 5D1XD 3EFOA 4WI6A 2Z34A 2MPAH 4RISL 4YUEH 1ADQH 3HW7A 1ZGLA 4W9HC 2HT3D 1OSZA 1ECYA 2UY7B 4OZFA 1ZLSL 3U0WL 1MY5A 2F2HA 4NQEA 1JTTA 5I0YA 4KHXL 4ZUUB 5DFVD 2R9HC 1CFNA 3B56A 3DSFL 4DPRA 3E7JA 3C2AL 3PUUA 2D9QB 4PJCF 3GSVB 3AXHA 3E9UA 3HS0B 2MOQA 5KSAB 2VDQL 1NMBL 4NUQA 3BKCL 4M1CD 3DTXB 3DMMA 1BQRA 2XKNB 3QUZD 4GI8A 2C5DC 3PWUA 1S46A 5FPIA 5HHOB 4Q2ZA 4ZQKA 4HG4K 2H9GA 4FMVA 4Z8FH 1E6JH 5D7LD 3SDAA 1MREH 3T77A 3LKRA 3NACL 3K71A 4OT1H 5IVZB 3IFOB 5C6PB 3P9LA 3MLVH 4FQCL 2IDUA 3DUUA 4V1DB 4X6DA 1J05A 3GUTB 2C1OB 2J3SA 3AACA 4JO1L 2HRLA 3KJ6L 3V0VA 2NY5C 2EDXA 4LLUA 5G2NA 1JV5B 3EYFB 5C0GB 4FNTA 2AXGB 3X12B 5T5FL 3T2QA 3UCRA 1IKFH 3GK8L 2A9AA 3UP1A 1A0QL 4JPIB 5I8CA 4PRHA 1PZSA 1MWAL 5E6IB 3TA3C 2NY1B 4NKOB 3VXRA 1I85A 5KVFL 1VFAA 1HWHB 1R3LB 4OZIE 3BSZH 4DGIH 3N0PB 2WXOA 3WUWB 4W6WB 5A6MA 1UB6B 4B96A 3NBNA 4L1DA 2XV3A 1IAOB 4IEFB 2DQGL 5AZ2H 3N0AA 1QRNB 3RWEB 4OZIF 1WPCA 2EJ1A 2CALA 2VWEE 2H1XA 4RX4A 4ODVH 4LEOB 3VGGA 3QULA 2TSBA 4MHHI 1WZAA 1PTZA 4L4VE 4JRXB 5JHMA 3QS3A 3D3VB 3EBAA 2AQPA 3PABB 1QVOA 1E40A 1D5MB 4H8WL 2YD3A 3EOBA 4XNYH 4AYFB 2HLEB 1NDGB 1M2OA 4PP2A 5FF6B 3VGAC 3U6XA 4P59L 2B5IB 4CADA 4IIQA 1CD1A 5I1HL 2R0LH 5A2IH 3VFUA 2ZUUA 4Y1TA 5T8IA 3PAUA 2Z35B 1UZ8A 3EH4B 1QUNB 5EPMA 5HI4D 1VHPA 4IOSD 2B16A 1KGJA 1KB5A 2MQ3A 1YG9A 3AXLA 3VFVA 4PRDA 4X6CB 1MWAB 1B6UA 3ZYJA 1TG8A 5DRXB 1IU1A 2VDMH 4L29B 4UM9A 3CFJB 4WCYH 5KVDH 1L7TL 3IVKB 2APWA 4AIZB 5LDUA 5F3HB 3HNVH 3UEQA 4FC3E 3I9AA 1WWWX 2KZWA 1TZAA 2W59A 5HYJB 4M5ZL 2BPBA 1BBDL 2XG5B 4S1QH 1KC5H 5EUOF 3NIDE 3A6BH 1NKOA 2OP4L 4AEHH 1G7QB 4MJ2A 4PJHE 1KN4H 1YJDH 4K5NA 4NWUH 2A9NL 3KBEA 4LQFL 4M7LL 1I7ZB 3GZKA 4B9IA 4WNJA 3SE9L 1N3NB 3BISA 1HCZA 3CXDH 3MGOB 1J86A 2NCMA 3BUQA 1PL3A 3V8CA 4F7CA 4P46C 3UACA 2W88A 5B1CA 3WG7B 1JZ5A 4W9KC 3VJ6A 5DRWB 4NRYA 4N0UA 1P4BH 2ZWLT 4LARH 4M3HA 1DHKA 3TP4A 2I32A 3ZHNA 5F7FA 4ZJ9A 4D94A 5ABDE 1RHFA 3OC5A 1PDKA 2A74C 2AGJH 3LD8B 1RERA 4KKCD 1S8DA 1WFJA 4W4OA 5E5MA 4ATTA 1ZGLM 3SDCB 4H8WC 2CLVA 2F19L 1WC7B 2XU9A 4FL4B 5AD0A 1GPOL 2I07B 1RUKL 3HLAA 4ZG1A 1CLOL 2WXGA 2WUBH 3N6YA 5G4MA 3WSQL 1TQTA 1WICA 3GJFH 4PG2C 3D0LB 4DAGL 1U3HC 1ZCRA 2A0LC 2YC1B 4N8CH 1S9YB 2NZ9C 1GGYA 2ORBL 2X4RA 2D7TH 1ND0A 4O02A 4W1TA 4DGUA 5FFGA 2HJLA 1KCSH 4HDIA 5HXMA 2VITA 4PGZA 1BMWA 5F21B 2OQJA 3KYKH 4U1HB 3BQUA 5IQ9B 2V3EA 5JQ6H 3MLXH 4ZOEA 3ERXA 5A16A 2GJ6D 4RLDA 2YXVA 3A6CH 4Y5YC 1TZGH 2BHFA 4NN6B 5IVXF 3BUYB 5J1TC 5L2KD 1U8LB 1Y0LA 4GRWF 3T0ED 1IEHA 4G8FA 1OSYA 2JI1A 5ANMB 3WY2A 5CZXD 2DQEL 3UJIL 2ED7A 3AREB 4R84A 4L8SC 5LQBH 3N41B 3QUMA 4MJIA 3QWOB 3FRUB 2FYYB 4J4PA 3WENA 2QBWA 2GFBB 1HU8A 3L7FB 3BGFB 1P4LB 2ZUQB 2RTTA 3V4VH 4HKXA 3IAGC 3FU7B 1XB8A 2Y69B 3ES6B 3O41B 4PP1D 2Z91A 2BCKA 4J23A 4LRIC 5H4ZA 3CUPA 5LBSA 2XWBA 1DZ0A 4X4XB 4HJ1A 5E08L 1M53A 2VZSA 1KGUA 4OUUA 5KVGE 4MA3A 2AQ3A 2PTVA 4EN3D 1N19A 3QNYB 3WELA 3FRPG 5LNDA 4U3SB 4OFQA 1BFSA 1G1YA 4PWKA 5CJXA 4QRPD 1IKOP 2OMZA 1FL6B 2I60L 5F3FA 3VNYA 4RDQF 5HI3D 1UT9A 3D85B 3HB3D 3QZLA 5E5RB 1WS8A 2K9FB 3PJSA 3QCUH 2VH5H 3WJLA 1A64A 2LU7A 3QDGA 1VF5C 2VDNL 4D9RE 3UTTE 3ETBJ 3PL6C 4PJBF 4PCSA 2PABA 2V2TB 4ZO9A 5FO7B 3TASA 1DBML 4PRID 1BOGB 5I66B 1G9ML 1X5JA 4ABUA 2WYIA 3KCPB 2OPCA 4FHBD 1AQMA 4AYSA 3GBEA 1P7QA 5BV7L 2IADA 4X9YA 5DVNA 1E8XA 3CFIC 2VR9A 1YUKB 4LNRB 1SLXA 3TPUA 1YYMH 3AT0A 2HFFB 2WBJC 3P9WB 5DSCB 3KMDA 3O2DA 5DI8B 4W9DC 2I27N 2IFFH 4JM2A 2NY6D 4JDVB 1IEBA 4HULB 1OZTG 2ZPKH 5ICXB 1RJLB 2DJUA 1MUJA 5EU6B 1FG9C 4NWTL 2NOYA 2WC7A 2A99A 4IDJL 4JFZH 4OIBA 5JHDE 3KLSA 5HGHB 1IQWL 1U30A 5I75B 2ID5A 4BM7A 3HN5A 5CUSH 2OMVB 1ICTA 4JB9H 4NP4L 4QYAA 5EC2B 3VU2A 3M46A 2BVQA 1E9PA 2FRGP 3BW9A 3GDBA 3KPMB 4AYGA 2D0GA 5B1KA 4C56E 5DJYA 3BAJA 3X1EA 5LVEA 1UWGH 2QQNL 3NTCH 4R5VA 1FBIH 1E5YA 1XGTA 4KO5A 7FABL 2FLBT 3LXBA 4OAWA 5JW4Q 2ZWNA 3BZFA 4X83A 5IMOB 1OCRB 2P44B 3KH4A 1JZFA 4XWGH 3QJRB 2AK4B 5KSAD 2GK0A 3I9GH 5BV7B 2B0SL 2MTAA 3MV8B 4LPVA 4PG9A 4CSSA 3GLZA 5I1JH 5JDJA 1NCHA 4JVUA 4ZTOH 1QBML 4JM0A 4MQ7B 3FO9B 1KYAA 5L88H 3FO2B 4ZAKA 2CR6A 5FK9B 1NC2D 4YSUA 5C7XL 3ARPA 2DQTH 2HTLD 3BPLB 2V7NB 3OPUA 5D7IE 5D2LA 4PJGA 2IPTH 3EHBB 3QNFA 1GYVA 1E3ZA 1DQLH 3GFUA 4FXGC 2IGFL 1LDPL 4OCYL 4JFFB 4WNQB 1RK1A 2WMPA 2FB4L 3QNXB 5DHYB 2IANB 3NZ8B 2ADIB 5GSRB 1QWNA 4ZYKA 1RZ7L 3ZDYB 4I9WD 3L5WA 4Y16A 4G72B 3TT1L 4FQLH 4EIBA 3TBSA 1MJ7L 2FDBP 1UUNA 4LF3A 1JHTB 3LS5H 4B5EA 4Z7NE 3ILQD 2YPLA 1CLZH 2A6DA 4WDIB 3V4PH 2XXFA 4GBXC 5E6ID 2NY1D 1FGNL 1TU2A 4XCYB 2AXHA 2VTFA 4FN0A 4KMQA 5KUMA 5L6YL 1C08B 2NQ3A 2ARJB 3T3PB 1WBYA 4AQ1B 3BKYL 4X4ME 3W82A 4W9GC 3ZDZB 4NP9A 3JWOL 3T8MA 3VRJA 4L18A 5JIKA 4LSPL 3NJFA 2QELA 1CF8L 4I48A 4QPEA 1HQ4A 1OE3A 5F7NC 2NY4D 3SE8L 4PBWD 4R2GC 3LN4B 1TUPA 1IGCH 2SODB 5LJYH 3T08A 1I9IL 4G9FA 4LLMA 3HC4L 4H25B 1MCPH 1NIEA 2BP8B 3CK0H 4JRXD 1OK0A 4BCZA 5DMKB 2OSYA 3D3VD 5GJSL 5ITFB 2X4PA 4LGPB 3CFMA 1M6OB 3RWJA 4XNXL 4KI5D 3AT8A 2FEJA 2W1NA 1W80A 1JHKL 2E9GA 4JQXA 4JO4L 3IFPB 1CGTA 5HHNB 3E8UL 4PJFF 3J2PA 4NEHB 2L8AA 2X4OB 1UB5A 2HRGA 4JN2B 4BHUI 5ADOL 1F3DJ 4QTIL 2AJSH 2IH9A 3EJYC 3MV9E 2Z31A 5F1KC 2Y6SC 1IM3A 2I9LB 2YRLA 3CD4A 3KWTA 5DD1L 4DF9A 3GTTA 4U2YA 2X44D 6FABH 5DC9B 15C8L 4TRPH 3V5KB 1U93B 1VFUA 5HYJD 1R3IL 4LSUL 1RLBA 1FJ1A 3CHSA 5D93B 2NX5A 4K2UL 3N06B 3QJUB 3F12B 3ZDXE 2XTSA 3V7AG 1SM3L 2R8SL 1Q1JH 5IGXH 1OD7A 4JPKH 1IUZA 4KROC 4ATWA 3NJMA 3Q05A 4GQQA 2JCCE 3S8FB 3DOHA 3SKUD 1BAGA 3ROLB 5C0BB 1G0YR 2JJTA 2X53A 1JGEB 2WVSA 3P0GB 1PX3A 3O3BB 3PHSA 4PFEA 3GRWH 4MBRA 3QQDB 1X4YA 1A1OA 3MLYL 3DIFA 5FHBL 2X10A 3P77A 4AEFA 5C0EB 1QACA 4HJTA 4BDVA 1OO2A 1J8HB 1PLCA 1DCEA 1N7ML 3VXNA 3VI4F 4OD1L 2J71A 3PGFH 3QQ4A 4IBZA 4ODXB 5FCUH 4BIKA 5ALCH 1OL0A 1N59A 3IDMA 4Z7UB 4LVOC 3SDCD 1AFVL 2PYEA 4WI9A 2D31B 4AIXA 1BJ8A 5D6CA 4C83B 2MNWA 3MNVA 2ZF9A 2JXMA 4MAUH 4WEEA 2GI7A 1AI1H 2BSSA 3JBG7 3JUZA 1CU4H 2PO6D 2CRMA 5F3BA 1FG2A 2PXYD 4ZUVA 2DYRB 1QZ1A 4NLAA 3V6OA 2B59A 1R5WA 5I6KA 4G8EA 4X8GA 2UZYA 3IDJB 2R51A 4EI5B 3E3QC 4FADA 1OTUC 3HG1E 3NJXA 2GB2A 1LLAA 3IXTB 3PE9A 3RTLA 4M6AA 1AR1C 3P1VA 4MMXC 3Q48A 2JJVA 1RZQA 1H8NA 4U1KB 1ZT7A 5MERA 3IFNH 5GHWL 1EV2E 1T20B 1TVHB 3TV8A 1LE5B 4AWJC 3WKML 1A14L 3WFEH 3FPXA 1DDHB 2F1BA 4JCMA 3SKMB 3VSVA 4U6YA 2AJVH 3VFWB 4XRCA 1WBXB 3BEWA 3HCVA 3GJFK 2OCJA 1QI5A 3ALXA 3Q8FA 1WITA 3DHJA 1ZT1A 3HZKA 4LLQB 1U33A 2GQHA 3V2AR 4DP1X 3IN2A 2AV1B 2WXIA 4ANVA 3FK3A 2QV2A 2WJ7A 3OGCB 3IAQA 4TSBH 2CLRB 3DPBB 4Y9BA 3Q8CA 1OF2B 5TE4H 1ZDSA 3OB0H 3HBGA 1J1OL 4EDWH 3HC2A 2AXFB 2W0KA 5IESH 3SGDI 4JANB 4PU2A 3EW3B 3CFKB 3QXAB 2JNZA 4R4BB 5D7LA 4WY7L 4ONGL 4PYGA 4ZUTB 5MI0B 2BJMH 9CGTA 4LSDA 1P1ZB 4OQTA 2LHAA 4GSDL 1SXCA 2P8LB 2Q8AH 1JWSA 3X14A 1UFGA 1AQ8A 3A4AA 4QTHB 1IBGL 1KY7A 1R24B 2VLJE 3ASNB 1KLGA 3GF8A 2RH0A 5DRNB 3MRQA 1ITBB 4B9YA 1G7PB 2R23B 4RA3A 5HHPB 1X5FA 3PNWB 2WZ0A 3PWJA 5KYWB 4X4YB 3O2WL 4HVBA 4Z3TA 3RWCB 2VUOA 2HKAA 3D85D 2UZIL 2XDHA 5K9JH 3WXVL 4RSVA 1QBAA 3Q1SH 1EO5A 4ERSL 1YVLA 5AVTB 5C0ND 5IB1B 1RMFH 2VZVA 5IJCC 5IJKA 2O61B 1KBGH 1KPVB 3FS9A 5TF0A 3S34L 5IFAL 3O4OC 3IE9A 1OAQL 3FTGB 4I4WB 4BKSC 5LDSA 2AJ3B 1SJHB 4A63A 3C09B 2OXHA 5L4IA 4H0LC 3EFFB 1MDAA 5DC0A 5FUZL 3WFHA 5AVVB 4HQQH 5LAXB 3O2VL 4P4KB 3QUYC 1L9PA 1BMZA 2OR9L 3LB6C 4PJCB 2YAFA 2PWGA 4BFJA 4C4KT 3NPZB 3VE0A 3GIVA 1BD2A 3BP4B 2YAPA 1DUYB 3QUKB 3KWUA 1JPSL 3OKNB 3CWGA 2WXMA 4I18A 2BNUA 1RU9L 3ZHDA 5E9AA 2ROXA 5G4NA 4FFYA 4UTBA 4E9SA 1X9RA 1KXTB 4ZXBB 6CGTA 4IU2A 1SXNA 2F6AA 5DMGC 4ZFOL 4BXSV 3L4YA 3AU0A 3VDCA 1GAFH 1TQSA 4IOSA 4KX7A 4N9GB 3TOPA 3UZVB 3VH8G 1SDYA 1KFAH 1NAML 2EADA 2MKWA 3WFBL 5JW4R 4PJEF 3RHWK 1R3KA 2NLJB 1MZZA 4AYBA 2HX7A 2WXLA 3ARGA 2VDRH 4JG0H 2KLTA 4Z7OE 3SQBA 4YFLF 2XFGB 1OD9A 4QT5B 3U25A 4KMTL 3ML9A 1BIIB 2J6EH 4Y2DC 3GMOB 3SDYH 1OGAB 4I0PB 3QORC 1ZPUA 4EUPH 2CWRA 4XP5H 1HH6A 4WNSA 1M9WA 2IXQB 1IAII 2PWFA 3X1NA 5IQMA 1A2YA 3BUBA 1EHLL 3CZGA 1QWUA 3O6ML 4LASH 1JZ6A 4MNGE 2BS9A 1KNOB 4HS8L 4KK9D 3CHXA 3MKGA 1PMYA 2ATKA 2OMYA 3CVHB 4AE1A 4OZIB 5F7KC 4GIOA 3DETC 3EHBD 1NUDA 1A6ZA 4JFFD 3QIBD 1OGTB 1T1ZB 3TJHC 5JOFA 5EO0A 3I02A 1DBKH 3VFMA 3C5ZD 4G6JL 4ZW6A 3KPLB 5KZCD 5B8CB 2DYPB 1IIKA 2D03H 4IRZL 5B39A 1X4XA 3OQRA 4G8IB 2CR3A 5I1CL 1GYUA 2GBUA 1RUPH 4ETQA 4KDVA 3RE0A 3Q5OA 2K6ZA 3S9DB 2KT6A 4HIIB 1HL5A 2AJYL 1JGLH 4PJ5E 2NY7L 3PPSA 1E9OB 4UQ3B 1MIML 5D1QB 3BGMA 5KANG 4OVVA 5FYJD 4JG1H 4L5FH 4J28A 3DYMA 4GG6F 4XWOC 1PFOA 4BZ2L 2YA1A 4U1LB 3I6GB 2ZCKH 1GH7A 1DO5A 1UACL 1L0PA 4OZHF 5CLYA 4JZJC 4XGZB 3VWKB 2WUCH 5IHBA 4LKCB 3HMXH 5C0IB 2X1WL 5DHDA 5AYUL 1KJ2H 5H4YA 1DLFL 2V4LA 3SY0B 4MJ6A 1H15B 3AWGA 2HRPL 4CSTA 1ETZB 4XAKD 3VD1A 4JO2L 5L2KA 1IJ9A 3VQLA 3S4SB 1KTLB 3FSAA 3QRFM 3BLKA 4BBWA 1UXWB 2EYSA 2BY3A 2OXGB 4NYLB 1BGXH 3QJZA 1JGUL 4WU5A 4YBLB 1INEL 2GK2A 3K5SA 1I8LA 1KEGL 4FERA 1HDMA 2O5YH 4XBPA 5TQ0L 5HPMA 5CWSA 4EPSA 2C3VB 4UAHA 3D5OF 3TM6A 4XMTA 4WI0B 5DEFA 5J8OA 1MCCA 5I2IA 3VNZA 1BF8A 2IDQA 3UAAA 4JAMA 1P9MC 5DTFA 1N4XL 3LH8A 4J3XA 3SKNB 2J1ZA 1Q9LB 2G75B 4YAQA 4HUXB 2ICEB 4MNHA 4ZTPH 1KB9J 1OOAA 4EN3A 4ZS7H 1DL7H 5T1LB 1YY8A 4KXZI 3SPVA 1FNEB 3NAAH 3NRPA 4FXKA 2XXGA 3ZZ1A 5I17A 1QNZH 4JHUA 4M8UA 3M1BB 2NQDA 4QRPA 4UB0H 3RBGA 1FL5A 2VM3A 3S37L 4HWZB 4FZ8H 1J9CT 2WB1A 4Z7VE 4R0LA 4MCYB 1NLBH 2CGRL 2HVJA 5T3XE 3ATFA 3HBZA 1DDTA 3EJJX 4OFKA 1VESA 1F5WA 3AM8C 4GQ9H 4Z18A 2F1AA 1XT5A 1E4KA 3JVFC 1J8HD 1WAPA 1L3WA 4R83A 1MQKH 2EDQA 1Z3GL 2OL3B 1V55B 2WYHA 3KNBA 3FAXA 1YNLH 1MCJA 5C08E 4YHZH 3DO7A 3PXJA 4W68A 3ARQA 2QMJA 4PRIA 2QKIB 4GRWB 5ILTH 1JPGA 4NGHL 4XPBL 3EJRA 2R2BB 3U6XS 1T4KA 2DDQH 5CEZD 4YNYA 1BVOA 1MEXH 3U82B 4GW5B 5PAZA 1GS8A 4RISH 1UHVA 4ILDA 2R69A 3FB7B 3IJYB 3AJ7A 3IDXL 5IHUL 1ZLSH 3V0EA 1XGPA 5JW5B 1OXYA 2ICWB 3U0WH 2WQXA 1EEYB 1MIEH 1OCWL 2P7TA 3CVDA 3QDHA 1KCKA 1OTSC 3IN0A 4KHXH 5CEYB 4BKLA 3LNGA 1J9TA 3D33A 2DQIH 1BXVA 4EI5D 2UZXA 3ABMB 4A2GA 1F42A 4RWYH 2NPLX 5TE7L 4CVZA 1RUML 2PPEA 3EOAB 3WS3B 2FHFA 3L7EA 1NMBH 3NQKA 1KT2A 3DV6B 2FBRA 2IIJA 5F9WC 2R2HB 3B4NA 2VB5A 2CNYA 2KDYA 3GWJA 5T1KD 1O7DE 2WVVB 4JKNA 5GGSY 3BX7C 1PX4A 3U6RA 3X1GA 4NQDD 4TXVB 4GKLA 5DGQA 2KZKA 4HSAC 3BQVA 2A5UA 5E4OA 1GJWA 4I77L 4ZNCD 2P5PA 3NFPA 3NACH 2CJTA 1OSPL 2BZCA 5CXPA 3ZO0A 5D4HA 3GSVA 4QRAA 3TO4C 4Q6IB 1OLLA 1EZSA 5BRPA 2XV6B 3LXUX 2FHCA 4WTZA 4GRLD 2J8UF 1ZD6A 5ISZD 4OKVB 2LQRA 4XNZB 8FABB 4BCXA 4FTVE 5T5FH 2QPFA 3LKPB 3LVTA 1K5NB 1NC2A 3GK8H 2GBTA 2Q7YB 3MYZA 1LM8V 3BMVA 3U0TB 3KPRB 2O5ZL 1BFVL 1IBZA 1MWAH 3O9WB 3SIKA 3IFOA 4ZFFB 5KVFH 3PWLB 3GPSA 5JW3L 3QDMD 5BOPA 2D7MA 4Q58C 1E4WL 1B9ZA 2A4CA 3MLRH 4TF4A 1P4IH 3ZT5A 2XZZA 3VD5A 1FVCB 5LN4A 3F2LA 2JB6A 3WKPA 1D6EA 1KB3A 1CDHA 2OLDA 2AXGA 4FZEL 5C0GA 5MEQB 4AM0Q 3HZVB 5C9JB 1UZ6E 3OB0K 4OBRA 4BXVA 3FDWA 1Z0NA 4HKJB 3M45A 1D9KB 4U6HA 1AOHA 4CGTA 4M7ZC 1PNDA 2IWEA 2KDGA 4BFFA 2QVIA 1UZ6F 3B37A 4X8CA 1M71A 1CICD 2EIZA 1Z3RA 3VXUB 5T1DH 5FV2A 4P59H 2XG4B 4QRRD 5I1HH 1UB6A 1IAOA 4IEFA 1M1SA 5DWPA 2HMIC 3C08L 3MI6A 1PQZA 3GJEB 4WW2C 5ABAA 3RWEA 1D2PA 4P4KD 2WO3B 4ENED 4YMPA 3WY3A 4LEOA 1C8PA 2VMJA 5TE6L 1U8NA 2NXZC 2O93L 3RRQA 2APVA 2WZPD 3IF1B 5T3ZD 3OMIB 4JRXA 2YOCA 5J0BA 3D3VA 1LO4L 4L23A 3O0LA 3SJVE 4MMZB 1ZA6A 5FF6A 4ZW5A 1ROCA 4CAGA 2PCPA 4ZXBD 3DA0A 1CQKA 3GLEA 1BBDH 4ZFQA 1J0ZA 2ZOTA 2WNXA 4EQ2A 1QNIA 1QTSA 3AG1B 4LOUC 2XACC 3WYRA 1J10A 2OP4H 5B1JC 5BUPA 1MVUA 4WV1C 2A9NH 4HIJA 4M7JH 5D7IB 2YN5A 4TVPD 4S1RL 2LLLA 5E4EC 2VLKE 2A4ZA 2B9BA 3IVKA 4HJSA 1ZT4A 5CINL 2EYTB 5HYJA 1OGAD 4LPXA 2OMBA 4DT2A 3GINA 4H8HA 3V5HB 4OV5B 4MXVF 4QHKJ 3P3TA 2H2SC 2NSMA 4YSCA 4G59C 3EYUL 4OD3L 5CIPA 2GYSA 5KJRL 2XZCH 3RA7H 2J5LC 4GKSA 4ZFOA 5LCVA 2FH6A 2CBOA 1A7RL 3MJ9A 4DZBB 1Y7VA 2F19H 3B2MA 1SEQL 3BO8B 2EZ0D 1CT8A 1XMWA 4G1MB 5F7EH 4KFMA 1THAA 2OZ4L 4H8UA 3DXAB 4NZJA 5D1ZB 3ILDA 1ORSB 3WTUA 3LV3B 5EBLB 2HT4D 4M8QA 5A2KH 1IO4C 2GAZB 5FW8A 1U92B 4MLIA 4YLCA 5FYKD 3NJVA 1DYZA 2WYZA 3OPZL 3WN5B 5KSUA 3L3GB 1LP9F 3EUUA 2ORBH 2XKUA 3KVDD 3SDDC 4DKFL 4PJ7A 3UBXG 4AM0B 4PJFB 1QAWA 4L3AA 4F5CE 4FQ2H 3SDCA 3MRMB 3QP3A 5L4FA 3UZQB 1A9EB 1ZE3H 3WJMB 3PLYA 1RZIA 2D3LA 2GKIA 2RHEA 1F2QA 4FABL 2PO6A 3FFDB 5D1QD 4GINA 1HL9A 2OMUA 3MRKB 2PXYA 2P5WB 4L48A 4M6ML 5A2FA 3WFDL 5B7EA 1S9YA 4W81A 2DQEH 1XQ4A 5CGYD 2HUHA 4HH8A 5JDSA 2VISB 1JZ8A 1F4HA 1QR4A 1G9NC 1JOIA 2XV2A 1HNYA 1L6PA 4M00A 4U1HA 3QI9C 5IQ9A 3ZKMD 1X5MA 4XHQA 1MQ8A 1B2WL 3OHMB 4HETA 2LW3A 1XF2B 4LVNC 4AQ8A 5AOJA 1NLDH 5AUMA 2G30A 5EU4A 1YPZA 3G5XB 4BH7A 3ZDXB 5C3IA 1MFBH 1U8LA 4L1BA 4XP1L 4G7YL 2F15A 3B9KB 3CFEA 2JCCB 4HWBL 5ANMA 5BVJB 2WGXA 5AB2A 1FORH 4KJWD 4QHUA 4A2FA 3H9ZA 4DESA 1AO7E 5ID1A 1YSOA 2ZCLL 4JUTA 4XC3L 5D70H 4QXUL 1Q94A 2FYYA 1AD9B 4UDUB 5CBAB 1A02N 3LIZA 2A9CA 4QRQB 1XB3A 1MN4A 4WJ5B 3QG7H 5F97E 3OSKA 1SDDA 1JV2A 4MXQD 3JXAA 4KKZA 1KV7A 1QLRB 4FG4A 4PJAA 1FYTD 2BFGA 1S5HB 1FRGH 3SQOL 5J6HB 4XO3A 3BDXA 1IKNA 3LZPA 4Z95L 1JUFB 2VDNH 1IV8A 5EULV 1NDTA 4P5TD 3ZBMA 4AV5A 3RVUC 1X5GA 1JF5A 3TZVD 3QE5A 1U2CA 2COQA 5T1LD 1DBMH 1P6AB 4QXGL 3FFCE 1F3JA 2CGYA 1G9MH 2WKGA 2CUIA 4HC1H 3FUEA 3MRDA 3NJGA 3EBGA 3QYNA 4NQXA 3BPCB 4G7VL 3VWJB 2IAMB 5BV7H 4XMZA 4AGMA 5GGTA 4F9LC 3JWNG 3Q8AA 4AXWB 1CE1H 4WFED 4CU8A 4MZ2A 2Y6TE 4HHGA 4NENA 3HG1B 5ESAB 3EF4A 1USZA 2CO6B 4UT7L 3P4OB 3CQQA 4UQ2A 3HE7C 4DUVA 2V2TA 1UZGA 4GG8A 3AC0A 3FSWA 4NWTH 4IDJH 1OY3B 2F7QA 1BOGA 4JFOB 5I66A 4LRNH 1A8JH 1M1XA 4PHXA 1EZLA 1UCTA 2J73A 5J6SA 1BPVA 1I8IB 4NP4H 4DN3H 1WCQA 2Q3XA 3D87B 5D72L 3RY5A 2CO7B 3DI3B 3V52H 2O6DA 2BNRD 4F2ME 4Y4HA 1HHJB 1NGQL 3ARFC 4G80A 1AKPA 2PP9A 3RDTD 2QQNH 1I4FB 4A7GF 1QMUA 5KANI 3QQ9D 4KV5E 5E8PA 3HZMA 1VEMA 4R96A 1B0RA 2N7AA 5I74C 1NEPA 3DHUA 3BFOA 1S7TB 2WHVA 3LNEA 1PG7L 4KVNH 4YEFA 1N5YL 5EEWA 1JN6B 3MX0B 1KIRB 5KBKA 1CXHA 2OMVA 3KVQA 4RGNC 1NEUA 2LFEA 2R4SH 4NBZB 5T33L 3KPMA 3FH8A 4G7SB 1QBMH 4MB4A 3SOBL 1KWGA 5C7XH 5AAMC 2VLJB 4OU3A 4CMMA 2WINA 4D3CL 4NLHA 5BJTA 2QLVB 3QZMA 3IEAA 3L9EA 2UWEE 2AEQL 3B2XA 3NJNA 2FB4H 4H0IA 5IR1B 3KXFE 4CC4C 3NCBB 3VD0A 1BQLH 1C5CH 4JZOB 3NIFE 4ZUSB 1W0WA 2JJSC 3KWWA 4KRNA 4NKDA 5M94B 2DLIA 4ZW7A 5LGJB 4M02A 1MJ7H 3CG8A 2F8XC 3A23A 1L9RA 5FK9A 2PKDA 3KPRD 4PVLA 2DPKA 2E7MA 1RZGB 3SE3A 5E00A 2GSIB 3KVPA 3JT0A 1EJOL 3FC8A 3O9WD 3WTXA 5L6YH 4FS0A 4YHNB 4N25A 5FYJU 3WTYA 3QIBA 3EKCA 1J1PH 1JWMA 1P2CA 3JWOH 3NT0A 4FFTA 4QHLA 3RWFB 2EILB 3C5ZA 1MVFA 2MSPA 4O2FB 1CF8H 4U6XB 4Z7QF 5GGSA 3SO3C 5GRXG 3BAYA 3SE8H 1KIUB 2FL5A 4NNYB 3REWB 1E7UA 1JPEA 5FO8B 1HI6B 1I9IH 3HC4H 2XNAB 1D9KD 4YC2B 4BV1A 2WKOF 4ABVA 4HLZG 2VDPB 3OKKA 2CM6A 2ARJA 4PJEB 3ROOB 4XNXH 3LDBB 3UTSB 3VXUD 3WO3B 4KZEL 4F15C 4XE0A 3N42F 4XMUA 5GRYA 5SX4H 1EDYA 3QUGA 3BVUA 5H37A 2OSWA 4ZS6C 3HG3A 1DQML 4M5SA 1KXQA 4GW4A 3TA3B 1DLHA 4HPOH 3A4FA 2CDEB 4AMXA 1CB4A 1B2YA 2N3JA 5DJAA 3MRRB 3TA4D 3BQUC 4EIUA 4F9PA 5ADOH 4F8PA 1KZYA 4GLRH 4QTIH 4DO5A 1MNUL 1YN6B 5JHLH 2ATAA 1A4KA 4K94L 1PG7W 2IV8A 3M1CA 5DMKA 4KK6C 2ENYA 4WO4B 3AGVA 5ITFA 2RIKA 3B2PA 1ROWA 1UQSA 4GKZB 5CHNB 3BH4A 15C8H 1FVDA 4QRSA 4TTDD 1QR1B 1N68A 2A6KA 2BZ7A 3FQWB 4K7PL 3US0A 2XA8H 4X9HA 1HE7A 4Z3HA 1A7QH 3SPHA 1NCBL 3P9MA 3L3IA 4MNGB 5DMIL 1SM3H 4HF5L 2R8SH 1GZPA 3ESNA 1CDIA 2Q0ZX 3QZWA 1XB6A 3VGEA 4Z7WE 4XN2A 4UAOC 2YGOA 3LN5A 3ZX1A 4UDTB 1KZQA 3L8QA 2I9LA 3GBLA 4H40A 4YSRA 3PGDB 1L5GA 1ADQA 5D7JD 2YGPA 4P2QB 3V5KA 4TQ8A 5JORB 1YRKA 3K80A 3WNMA 1G4MA 1DUZB 3SBQA 1GGBL 2XVBA 3S96A 4LOEA 3IMRA 2MQCA 1WAAE 2X28A 3MROA 5I26A 4A7VA 1UXSA 4DKTA 5LXVA 1FYHB 3WL9A 1DQDL 4G42B 2X38A 3RVVD 3ARTA 3OJDA 4E2OA 1T1YA 4JS7A 3HI1B 1ZHNA 2P9RA 4NC0B 5IKCB 4IM8A 4OD1H 1S6NA 3I6KB 4XAWH 5MEOA 2P4AB 4PJ5B 2KHAA 2ZYIA 4V33A 4MZRA 2NT1A 1N26A 1I9EA 5EOQL 3IB4A 3B9AA 3O3DA 2K8QA 3DXAD 4OZHB 3P73A 3BT2H 1ZLWH 3MRPA 5K9OA 1ZOXA 3AB0B 5F2FA 1M7IB 3FONA 3MBWA 1OCOB 2JIXD 3TF4A 2DLTA 5F7LB 2BSED 4OM0H 5SWQA 2JMRA 4O5LL 5J11B 3P4NB 5FAAA 1E43A 1TYJA 4K94C 2HAZA 4Z7UA 3UP6A 4OCWH 2IGTA 3FQ2A 3CDYA 2ESVE 4TMPA 4C83A 1YEWA 5GHWH 1IVLA 5T3XL 1J18A 1XR8A 3WKMH 1XEDA 1JXKA 2ZOWA 1MHCB 4YPGB 1S7SB 2P5WD 1QA9B 4G3YL 4AEIH 1L3NA 1U8OB 2EEBA 3CLFL 2NR6C 4EI5A 5IFJB 1OCCB 1W72L 2J88H 3QIUB 4YEEA 2X0VA 2X7LB 1H6EA 3QEQB 1YDPA 5CF3A 3T5WA 3DRTB 3LS4H 4OI8A 4QMEA 1KELL 5DEGB 5HDRA 3X1FA 1ZANH 5F1IA 5T1KA 1LE5A 3HUJA 2EDEA 1J1OH 5T1MA 1T4WA 3Q13A 4PIRF 4NQDA 2FX7L 1IGYA 5T5NF 2QGDA 5C6WH 3A67L 1XCQB 3VFWA 3B9KD 3L13A 1WBXA 1FV1B 1SVZA 2D2OA 4GSDH 5BMFL 4P99A 1PZ5B 3TWCH 4A2HA 3W11C 4I3RL 1BREA 1Z5LB 4JQIL 4MJ5B 4Z7VB 3VXME 3WJJC 3NCWA 4D9LH 5DD6A 2YQGA 5B1BB 1R1CA 3DPBA 2E9JA 1R47A 4GRLA 1ETB1 5D5MA 1WTGT 1D7BA 4HHAB 3KS0J 5ISZA 3D4ZA 3V7AE 1P5UC 1IGML 3VO0A 5EU3B 4XCCL 1B0WA 5EOCJ 3ARBB 4S1SL 1G6VK 1CL7I 5IHHA 5GJTL 2O6FA 1U4EA 3QXAA 4R4BA 4DZ8A 1IQDB 3GI9H 4J8RB 2GC7C 1KV3A 4DQOL 5IFAH 1DJSA 3Q5YA 4EUPG 1MFEL 2OJZL 2V9UA 3BEVA 3QDMA 2G2RA 4OCMC 1OAQH 3VI3E 3HE6C 2ZP9A 3PDDA 4JGUA 3F7RA 1ZS8A 3PNWA 4L3CB 3T1WA 1S9VB 3L3OC 4KOBA 1XZ0A 3IETB 2IAMD 4M5YH 1U8MB 3KDMB 4YDVA 2GHWB 3FKUS 3VUAA 1LMIA 3AG4B 4S0HA 1C12B 3X13A 4LSVH 3B3BA 3MCLL 2DWTA 4WWKD 4YHMH 4KFZC 3RAJL 1CN4A 4RFOH 1JPSH 3IKCB 1KPVA 3HZYA 1CICA 4CJ0A 5HSFA 4IGBA 3CVHH 1CD0A 4QRRA 5CCKL 1RK7A 5DUML 1KY6A 2V3DA 3CDGA 3FW6A 1CFQA 3GZQA 3FQXB 4MVBD 3UBXI 4P4KA 4GAGL 2XZAL 5GS1C 4NKMB 4PJCA 4N2EA 4QYOA 3WFBH 5C2UB 4FFZL 4PTUB 2BVOB 4M1DL 2VDLB 1GJUA 1TETL 2DTSA 3FF8A 4ZBJA 2J8UB 2WZPA 3WEAA 5KS9A 1DUYA 2V6HA 1HSBB 1ZLVH 4I5BA 1NMCB 2YD0A 3A3YB 4KMTH 4G7RB 5D96B 5DWUL 2DBLL 4ZXBA 1SF5A 4J39A 5KAQG 1T5WA 4RFNB 2HT2D 5AW0B 1RK0A 4YFDB 3V8OA 2YAHA 4XVUC 3IWVA 4KKBC 1YEEH 2NNAB 4N9GA 4CGUB 4HGWB 3FXIC 4TS6A 2Z31C 3EYQC 4TUUA 1SY6L 1EHLH 2AKRA 4WTWA 5EG6C 1JS4A 5GS0L 4O9HH 1EJFA 4HS8H 3MJ7B 1T7XA 3LJ3A 1MXDA 2XPYA 4XP9L 2MOGA 2ADJB 3DWTA 2VQUA 3IJSB 2VXQH 4A7UA 3Q3GB 4LBAA 3V55A 4NS0A 3MDJA 1TFPA 1WS7A 2I25N 5JNYB 5FYKU 4XNUL 1UOWA 2QSQA 4H7VA 2W9EL 1L7IH 1UA6L 5E8NA 2HX9A 4JUSA 4D9QD 2BC4B 1EHXA 4UZSA 2ED8A 4IRZH 4WW2F 4MDJA 4PJDE 4Q9BA 1ADWA 2G60L 1FNSL 3WS6A 4F3FA 2FYVA 1PYWB 4GI6A 4U1GC 4BSVB 1XVSA 3HI6H 2WO4A 3VRIA 2ZKWA 3FQTB 4IRJC 5HHVH 1KGXA 3NA9L 3AS3A 5ITBH 4POZC 5DLML 4OR1A 4PUBH 4P48A 4HCRH 5DK2A 1RIVL 1O0VA 1I3RB 4G6KH 4YR6A 4ANUA 4AQOA 4HUWA 3DX9A 4R7LA 2OYPA 5KYNA 5JA9A 3EO9H 3NSDA 3SJVB 1I3GH 4I1PA 4OCSL 3BDBA 5IFHL 3ESOA 4WTZG 1WK0A 4N0YL 4JHAL 1CGYA 2DYSB 3UTSD 2HRPH 1XEUA 3V6OC 4MS8C 4LCUB 3OWRA 4B41A 2P45B 2QR0A 5AWNL 2QADC 4JO2H 2MEJB 1L6ZA 3OG4B 2ODIA 5FXCH 3ELAT 4C59B 2F58L 3K74B 2UUDH 1NUGA 3OLDA 2EDBA 3TA3D 2BINA 1N67A 4YLBA 4LSQH 3CH1B 2VLKB 5CILH 2GCYA 1EEQA 2QDWA 5GS0C 4PY7A 2OL3H 1RZ8B 1HCVA 5EUOA 1JGUH 3TBWA 5I8EA 4LKCA 1INEH 5ADPL 2OI9C 1NL0H 3MBEC 3QXDB 4AZUA 5CZVL 1G7MB 4ZDHA 2HG5A 2GPZA 4ZT1A 4F7KA 4R2GB 1NKRA 5TQ0H 1LHZA 4PJXE 5DQJB 4YXKL 2CKBL 3EXJA 4XE5B 4DEPC 5FIEA 3GMRB 4UQ9A 4NHUA 4JJ5B 3IAPA 2Z0UA 5DD5L 3S4SA 1J5IA 1XF3A 1E4JA 4J6RL 2GEEA 4P2RE 2CM5A 5IOPA 2XRAL 1YEDB 4FD0A 2B1HL 3OHXC 1CGSH 2TRHA 4LCVA 4UIMA 5KG9B 1J9SA 1SHMA 2XC8A 3HC3H 3K4ZA 3JYCA 2P8MB 4QRBA 1UD4A 2EIKB 2EEAA 4J1UB 3V6FA 3GIZL 3OSVA 4JKMA 3S37H 1LP9B 3GSXB 3W0WD 5AZUA 4P2QD 2CGRH 4QDGA 3OTTA 2APSA 4U1SA 4MXWL 1FYTA 1SUHA 5J89A 2EDJA 1NCJA 4NXKA 4HXBL 1NEZB 3ATBA 1NIFA 3B7UX 3EJSA 4JFXA 5AVRB 3VTTA 4CN6A 3H6JA 3SKNA 3QCTH 3WTTA 4P5TA 4U1NA 1Z3GH 5KVGH 1A6UL 4HUXA 2VSKB 3TZVA 2W95A 4WTQA 1TZHA 2VXSH 3RVWC 3WIHH 1O7VA 1FNEA 3INOA 3ZZLA 5DF0A 5ICZA 5K9KB 4TYUA 3FQRB 5DXWA 5AAPA 4EN2A 5FO9B 2JB5L 4G70B 1ZKAA 2Y06L 5SWZB 4PJ6A 3WY4A 3A6OA 4Y7MA 4KROB 4PRPB 1TTCA 5I1DB 1RZJC 4AVHA 1CZ8L 3MO1A 5IHUH 1T5XA 1DQTA 5EEUA 5DJ6B 3C75A 2OMTA 1I1AC 1OCWH 2YD9A 4K0OA 4HJ0C 3MZTA 2HVKB 5H35B 1HINL 4GXUM 2Y5TB 3NZHH 4P46D 2CA3A 4YSTA 2ENQA 5IVXA 5MHSE 4RGMC 1RJYA 1T6VN 3K8MA 2R2BA 3D8MA 1RUMH 4LSTH 1EBPA 3W39B 2YRBA 3SKJH 2HKFL 1IL1B 3DVGA 3PP4L 4PS8A 4NUGH 1KGIA 1CG9B 2FO4B 2QEJA 4YVUA 4B3EA 2BNRA 3O6LL 1H8LA 2Y23A 3WMPA 5KVEL 3KEHA 1AO7B 1EEYA 1ZLWK 3RDTA 5JMRA 1AZCA 3QJTB 3E6HA 3K6IA 5DS1A 4ETYA 4ONFH 5E2JA 3DX3A 1HXYB 1I1FB 2FGWL 2GITA 1VRSA 5INDB 3PWVB 4X6DF 4N1HB 3T3ME 1VFBA 2LLGA 3QEQD 4QRUB 3U30C 4QJ4B 3EOAA 2XWCA 4X42A 3C9NB 1HTYA 1UKSA 5IJBC 1XF5B 1CGXA 4QHKI 1U3HD 4XBEL 3F7PC 2R2HA 2A0LD 2E86A 1DQKA 4PRHE 1G1KA 1KGWA 2R1XB 2NZ9D 4K23L 5EH1A 3ESPA 2WVVA 2NW2B 3AITA 4XB7A 3ARGC 2VLLB 2IDFA 3EFDL 4QRFA 4ZI8A 1N6VA 4R97C 3LHPH 3VFSB 3FQYA 4JVPA 2K6WA 4HISA 2BW4A 4AI7A 1BFVH 1OKEA 4LDEB 5AQ0A 1BZ8A 1EFXA 3BJ91 2BP3A 2PWEA 3UO1L 4F91B 1P7BA 2CJ3A 2AJUL 4G1EB 3HOGA 5JW3H 3TV3L 2V5YA 1E4WH 4JQVC 1ZWIB 1XGYL 2FECI 1K2DA 1EGJL 1A6WL 2FBOJ 4PJBA 4OKVA 3QJFA 5F7UA 2VAAA 5IW3A 8FABA 4FZEH 1RUAL 1L9MA 3BWAB 2VZ3A 1IAIL 3DO4A 3FB6A 3ME0A 4HS6B 4K8RL 4Z76B 3ECVA 3K6DA 2EE0A 3DURA 4H1LB 1ZV2A 4NQTA 3U0TA 1IMHC 3B5TA 2BZDA 4N4YB 2EVIA 2RFXB 1BEYH 3BUTA 1I7RB 3GQFA 3G6DL 3ZK0A 4YSOA 4ZFFA 1M56B 4P3DA 4I3SL 1PZBA 1G7LB 3LQAL 3G04A 1SJVA 1PEWA 3JWDH 4B9ZA 1SYSB 2YGNA 1OV8A 4JHBA 1FVCA 1HL4A 3C08H 3PHOA 2A83A 4F2MB 2UYLA 1PCSA 3FTVA 5MEQA 3B2DC 3I9PA 1P7HL 2NTSP 1I9JL 3JTTB 4X0KA 3UTPE 3VXTA 2HWZH 1D9KA 4YDLC 2PWHA 2FQFA 1YQ2A 5CSGA 1NCWH 4IBUA 3QISA 3HRZC 4XCEB 4XXCA 4W9FC 3VXUA 4BUQA 1ACYL 1BBJA 3ULVC 1R3JA 3DOSA 2PWDA 2BRRL 5HYFA 4QF1A 1NBZA 3PL6D 3BKJH 3FTZA 3PWPB 1U8JA 3O4OB 1JI1A 4KK8C 3S3DB 1OAUL 2C9VA 3MRFA 4YK4B 1V27A 3MRGA 3AY2A 3T04D 1WF5A 4D0BB 4N0UE 4TL4A 2N01B 1DANT 5BZWA 3F00A 4X8JB 2EXYC 5CINH 1IRAY 4B9KC 1M2VA 3FQ4A 4LCWB 3NIFB 4X6EA 3TN0B 2YMXH 3PAVA 4DP6X 4KK5D 2WBJD 3K1DA 5TDPA 1S78C 3CJJA 2WPGA 1OHZA 3CN0A 4AE0A 5FUCE 3L1GA 4G2AA 4UCFA 4K8RC 4CC1A 4ODUB 3EYUH 4OD3H 1T3FB 3RWGB 1XD1A 3BT0A 1LL1A 1NCDL 4LP4A 3QDJD 1F56A 4IBYA 5FW6A 5DUJA 1EIBA 1A7RH 4Z7QB 4FQIL 3G5ZB 2X6BA 2Z3FA 4LFHD 5D6DC 3MRHB 4HKZA 5D7JA 4FP8L 2XICA 3LQAC 3L3KA 2OZ4H 4AV0A 3AS0A 1TTGA 3JVGA 4WHTA 5I16A 3BAIA 5BS0D 5B38B 4YN3A 1ZLVK 4CW1A 5GIRB 3CFCH 3LEXB 4AJVA 4YSSA 5IMMA 1HXMB 5C8JB 3K2UL 4FXKC 1UJTA 3L6FB 5HVGB 3RZWA 4Y4KC 3W1ZA 3FCGA 3N42B 4Y2DB 3CXHK 1H0DB 2X4UA 4DKFH 1BM7A 1FFPB 3FT2A 8PAZA 3D30A 1PY9A 4FNLL 4FQPA 4A2LA 2IMMA 3PP3H 4XN9A 1RPQA 4QY8B 1E5CA 7CGTA 5I6XC 3DXAA 3MRLB 4XPHL 2R7EB 4P57A 3CN4A 3J8F7 1UVQA 1ETA1 3PQYB 4FABH 3LV3A 3I3EA 5ENWA 3OKYA 2JIXA 4MJIE 3RU8L 2HXAA 3AY4C 4ESKA 5AZEL 2EXWC 1URLA 3L3GA 3UC2A 4Y2NA 2CHXA 2OK0L 4BH8B 2B9AA 3CV5A 3TVMB 5I0XA 1NSNL 4NI6A 1YAIA 4A6YA 5H2BA 5F6HJ 2FVNA 1A9EA 3WJMA 2AXWA 2Y3NA 1B2WH 2BHYA 3MSPA 5F1NA 4HOXA 4QLWA 3BDYL 1A1NA 3TLRA 2CDGA 4K3JH 3SPGA 1E2WA 2ENJA 1WEJH 5C3TA 3WDIA 2UXVA 1JYXA 1FVEA 3DVNA 4OCNC 1ZHLA 4GBXD 4HWBH 3NGBC 3EH2A 3WEXB 2CIIB 4NN7C 5HVHC 4WI4A 4P2OB 1GZHA 4ICXA 4O2EA 1IGTB 4AK1A 2VISA 5CD3A 4XC3H 3O8XC 4HAGA 1UA7A 3OKLB 1I8UA 5AKVA 3T2LA 2V8MA 4KY2A 3UAFA 4L4TA 3QDGE 3LSOB 3JQOB 3P0YL 1AYRA 2Q8BL 4P5SA 1XF2A 1NTDA 4R2GD 3L1OH 2AJXH 1BEXA 3G5XA 3BH8A 1M4KA 2EDFA 3HKZA 4H5SA 3QG6A 4JZJB 3SQOH 5E7FA 3IRZA 3LRMA 3MUGA 4HZLB 2RQEA 4X6FB 1JJUA 2DIAA 2X88A 3FTXA 4C4KO 3K6NA 5DZNA 5F8QC 1ZHBB 2UUDK 4N6RA 3BZDA 1IAKB 1LK3L 2P52A 1UXLA 2ZOKA 3CFBA 4ZX5A 5A43C 1SVBA 2BOBA 2GTZB 4EI6B 3U0PA 4QRQA 4Y4FB 1U8KB 2BWDA 3NSFA 5H37G 4AH2B 4G7VH 4LP5A 4H26A 4ELME 3TFKD 5ACMA 3VI4A 1P7KB 2MCPH 2ZG2A 3PXLA 4X4ZA 1P5VB 4UIKL 1C5BL 1S5HA 4AYDC 3EJYD 1FNHA 1UOLA 2C1PA 3DUSA 4JM2F 2Y6SD 1C16B 2VXVL 1TZIB 3QAZB 1TYRA 1U6AH 2V9TA 4C55A 5BO1H 3ETSA 1QLEB 4APXA 3JV5A 2H32B 5AFAA 4JFWA 4QHNA 4P4RB 3AS2A 4WI8A 3KLLA 3UAEA 3O81A 3BRFA 5FKAA 1OAJA 3B3IB 3NH7L 3T6ZA 1LO5A 4BKTC 3WEOA 3MRBB 1NOLA 5GRZA 1F0LA 5SWZD 2B39A 5D72H 4DN4L 3FPYA 4JPVH 3AQZA 4KROD 4PRPD 2PF6A 2X70B 4MKTA 2YSSA 4Q52A 4E41E 3BFQG 4WWKA 1RP9A 1DBAL 1XGRA 3EOTH 4JDZA 1NGQH 3ULUL 1NIDA 1MLBB 3KGRA 3P4OA 4PLKC 1MPAH 4HT1H 4P9HL 1OIOA 4WAFA 2C9PA 3RKPA 4Z3IA 5F7WC 3L81A 1PG7H 1BP3B 1QSEA 1SF3A 1N5YH 3V4LA 1MCEA 3BN3B 3OKDA 1UGNA 3KAAA 4X0NA 5EBGA 4BWUA 4DO4A 4RNRB 1L9NA 5F7DA 2I5YH 4WJKB 5I82A 5D2LE 5T33H 1KLUB 2CO7A 5L9DL 3WTVA 5GGRB 4URKA 4E0RB 3MA9L 4GAJL 2ZYSA 4KTDL 1ZMYA 1EHNA 4PJGF 3VXMB 3SBPA 1DFBH 2MRYA 2WXRA 4D3CH 1CDCA 2WIMA 4ONHB 3H3BC 4U4BA 4U6TA 4V11A 2ZUVA 4HIQA 3B5GA 5D7EA 5DD0L 4H0HB 2H4EA 1S7TA 2AEQH 2WOYA 3GMLB 1JN6A 5DJ0B 4MJHA 1KOAA 5I30L 4XH2A 1JDDA 1XL6A 4ABWA 1XBRA 1OTUD 3EH3B 4K71B 5JPMA 2FJHA 1AR1D 3KLAB 1CI3M 1G43A 5F9WB 2DD8L 2H3NA 1OAKH 1WT5C 4FG6C 4IMLA 4WENB 2CXGA 5IR1A 3TBVA 4HJJH 4HS3B 3M7FB 4G9FE 3SBWC 1P84K 4JZOA 5MEND 1T2QL 12E8H 4YHPA 5FDYA 3S98A 4U1JA 2NDFA 3HPLB 4OGXL 3ULUC 3RG1C 1XH1A 5JIDA 5FWQA 5JXAL 1RZGA 5F0MB 4H13C 2GSIA 5GRWA 3HKFA 3ZKSD 5K1NA 1NIBA 4KQ3L 4EIGB 3NDZE 2NNRA 5DJXA 2E4FA 3QR2A 2BIPA 3JWNE 4NJ9L 5AL0A 4AY0A 3QUXC 1U8IB 4CMHB 5I8KL 3RWFA 2BSBA 2X3CA 3HR5B 3FT3B 4CRPA 4KITB 3QEUB 5ESQB 3AMLA 4AQEB 4M29A 2HZHA 1S3KH 1URZA 3GSOB 1VACB 3AXIA 1HI6A 3CNKA 3RB5A 4DP2X 2FR4A 4PN6A 1MNUH 4XNAA 3GSQB 5F1OB 2NX5E 3EJQA 1SEBB 3MUUA 4IQHA 5J6GA 1S7RB 4PJEA 1OPOA 4MCMA 3TT3L 5IUSA 2G9HA 2BRQA 3MRCA 4JKPL 2NY2C 4F37K 4BK8A 5I0ZA 3SCMA 2ITDB 1IM9B 1C7TA 1LD9A 1K4CA 1TIUA 3TA3A 4NKIL 3GRBA 3QFJB 3PWPD 2ITCA 1OAZL 4PD4K 5GS3A 3LY6A 4YOKA 4EBQL 1ACCA 1KTKE 1TJIL 3BOVA 1HVXA 4JRYB 2ZX9A 4GAAA 9PCYA 4NO3B 5HGBA 1QPKA 4MQTB 3ULSB 5CMAA 1EA9C 4CU7A 3A24A 1U4FA 4UV4L 3N9GH 3QUYD 3LB6D 1PF3A 1YUHB 4B0MB 1BZ9B 1WLHA 1B90A 4LCWD 4XCNA 4F8LA 2NXZB 4KKRA 5JPNB 1GGBH 5BQ7A 4IK6A 1FAIL 1T89A 2P8PB 4PJIA 5DQDH 4RDBA 1T83C 4DOHE 2X9WA 2PYEE 3ATDA 1Q0YL 3EUDA 3MRJA 3TO2A 1PCXA 2EE9A 3H0TB 1FA4A 3TYFA 1EZVX 4B9GA 2PN5A 2MQGA 4PV9B 1F11B 1ZVYA 1E2ZA 1WTLA 1SBBA 1XV8A 3QUHA 5EOQH 1CC3A 1XCWA 3W0WA 4JFDD 1YNTA 3RL2B 3TTSA 1SXAA 4ODBD 4U1MA 3BVDB 5EIQA 2DQMA 4UANA 5ANHA 3BAXA 4DCQB 3BHBB 1FZMB 1ML0A 5DD3L 5TD4A 3IU3A 4KDWA 5E4EB 1XD0A 4KNSA 2VQTA 3DKHA 4PGDB 4O5LH 1OB1A 1MJ8H 5IKCA 3ESUF 4Y2DD 5D1XE 1BF5A 1HEZA 4LCCB 1M3IA 3QORD 1KEMH 1HHHA 2KYIA 4OF7A 1BJ1H 2GTQA 4UU9B 4GG6A 1RHHA 3Q06A 1N0LB 2NXYC 1JNHB 3DYOA 4N0CC 1CYWA 4OZHA 3SPCA 3II3A 5CP7A 3PQYD 1M7IA 5IHWA 3BN9C 4M4PA 3VFPB 4JEGB 4G3YH 1PLGL 3QC5X 3CLFH 3DETD 4P46A 2A6IB 4AGNA 4G83A 1BWMA 4XO9A 4JY5H 4JG9A 4K3EH 1TVBA 3TJHD 4PJXB 5D7LE 1XGUA 3FZUC 4N2KA 2CCLA 4JJHA 4R3SB 3SDDB 3KPNB 3PP3K 1DN2A 5CCGE 4RIRB 1IX2A 1UJ3C 2FX7H 1MHCA 2A74A 3N43B 4XX5A 4A1RA 1A3ZA 1S7SA 3D9AH 3PV6A 4JMNA 2L04A 1QA9A 2R56H 3KWXA 2CJUL 1U8OA 1QEWA 2A77H 4PGBB 1TQWA 4UOQA 2GJJA 4BZ1L 4LEXL 4AJ0A 1OQOA 2VW7A 3DRTA 3RZCC 3RTQC 5EMYA 4BFRA 5DGRA 2Q6WA 4RMSA 3LNFA 4YXLL 3V10A 1U3HA 3H56A 5DEGA 1R75A 4XWOD 1A4AA 1IGMH 5KSBE 3N91A 4XCCH 4W9JC 3MOBL 2E0PA 5HP5A 4S1SH 5F6IC 3IJHB 1AY1H 1CE6B 2WQSA 1ONQA 1D2OA 3D25B 3QI9B 3EFOB 1MLCA 2DMHA 1ZGLB 2BDNL 5KBNC 3T9WA 4UYPA 4JN1L 2VDLH 5IBLD 4OZFB 3WY1A 4LVNB 1WFIA 1YECL 4NQEB 2VXTH 4Y5YA 3K6FA 1CFNB 3QZOA 1F1DA 5DZPA 1TTUA 25C8L 4OCXL 3H42H 3JV6B 4L8SA 3F62A 3V95A 1ZIBA 2HJFB 4WKZA 3DMMB 2XPGA 3MCLH 5D2NA 4PVNA 3PWUB 4YUEL 2J6WA 4Q2ZB 2EINB 4ZQKB 2H9GB 2E6PA 3SGEH 1BFOA 3CBKB 2K4AA 4CBPA 1CDYA 3SDAB 3LKRB 3K71B 4LRIA 4L3CA 1AKJD 4LLDA 2PTUA 3P9LB 4ZO7A 3S4SG 1PPIA 2G0KA 3DUUB 3H53A 4GAGH 4RMWA 1A8ZA 4X6DB 1J05B 5C07B 3CZLA 4Q9RH 2QPUA 3U1QA 1QD0A 5FW7A 2C3WA 3V0VB 1IFGA 3O45A 4C57C 5I0DA 4PTTB 1TETH 4AITA 3T3MB 1KYOK 1LWRA 2CK2A 3I3BA 3FCTA 2DM4A 4XP4L 1MCRA 4YSPA 2WLLB 2Y2TA 1KB5L 2WLYA 5DWUH 4ELKA 4PRHB 2Z1PA 4OT1L 3VXRB 2J56A 1OLZA 3MLVL 4ZW8A 1VFAB 1BZEA 1E8WA 2C8NA 4XNMA 3PL6A 2WCGA 3OJMB 1Q9OB 4RGOH 4Q9CA 2A73B 1T7ZA 2ZP0T 2EC9T 1C5DA 3UAJC 4YSQA 1IKFL 4XP9H 1HSBA 4FGMA 3QULB 1PAZA 3APFA 1TZOA 3ILPA 3O4LA 4AV4A 1PY4A 2ZXAA 3ZE0F 2LOEA 2V5SA 1QVOB 2WBJA 4XNUH 5LG1A 2W9EH 4IBTA 2EKSA 2NNAA 3MJWA 4PP2B 1OTSD 3BSZL 1GC1H 4DGIL 3RVTC 4IIQB 1BVNP 1CD1B 2I69A 2EO7A 1QO3A 2HRHA 3VFUB 4XNQB 3WOVA 3H8NA 1LO2H 2ICES 4KQ4H 1UZ8B 3EDFA 2N0MA 2R59A 3QDJA 2G60H 4OLYL 1FNSH 4FOMA 2WSDA 2EKJA 3QCVL 3AXLB 3VFVB 4M8RA 4PRDB 1H19A 4LDLB 1JI2A 4RGNB 2DQJH 5TDNA 2CR0A 3Q3GA 5DA4A 1AXSA 3RUGF 1TTFA 4PV1C 2WTRA 5BS0A 3V6BR 4RBPH 5CZKA 3LQMA 3ULVF 5DLMH 4GXUN 5AB9A 4QIRA 4KWUA 5I28A 4MB3A 2X4TA 2R0LL 1F1AA 4Y5VC 2APFA 1GTNA 2GJ6E 4LLVA 2ZSWB 1J8SA 2DV6A 3KYOA 5L2KE 3GMMA 3T0EE 5IFHH 4JRWA 1OANA 1TDQA 2F7RA 2BNQA 4QGYA 5BPPA 3FQTA 3R7RA 4O02L 4WCYL 4O58H 5IB3B 4UTAH 1NPNA 3WBDA 2X2IA 3AG2B 1NGPH 1CF1A 1J11A 1E7VA 1FFRA 3L5XH 3E2HC 3LMJH 4FXGA 4GAYA 4RDQG 3VJ6B 2PMZA 2WXQA 5FECA 4CNIB 4N0UB 2E76C 3A6BL 3WO4C 1ED3A 4AEHL 2BS71 1KN4L 1YJDL 5DT1H 3QH3A 3UX9B 4OF3A 5ADPH 2ZKMX 3NCJH 4H44C 1SOXA 5CZVH 5HGDA 3SO3B 1EXHA 4HGKC 1PDKB 3E1ZA 5E5MB 4KUZL 1S8DB 3CXDL 4CVWA 1ZLUH 2CKBH 2CLVB 4Q0XL 3BLBA 3OJVC 3OZLA 1IJNA 1RZFL 3C8HA 5DD5H 3HLAB 4NCDA 4J6RH 4GBXA 4QRPE 5D7KD 1SMOA 2XRAH 3MXWL 2B1HH 2JF1A 4YQXL 2Q1EA 3MHZA 3NCMA 4HUNB 1GMIA 2XX0A 1P4BL 1A1MA 4BJLA 4JRYD 3D09A 2ADFL 4FKEA 4LARL 3H3KA 3WLWC 1I8KA 3GIZH 3F3HA 4M93C 1RUQH 1CDBA 1ND0B 2HMID 1BXUA 4XB3A 4AYMC 2HJLB 4HGMA 4GFTB 1VJSA 4HDIB 2VITB 4RFEA 2H6UA 2DWXA 2HTKC 2OQJB 2B7DT 3BQUB 3SE6A 4HEME 4DUXA 3GMRA 1QFWM 2NXZD 4MXWH 4PRIE 5FOBA 4HXBH 3ENEA 5DJZA 3SGDH 1YNKL 1S7UA 3GTVA 5HDBE 4UF7C 5E8DL 5A16B 1Q4NX 1W6WA 5K9QG 1OGSA 2XQYK 1Y0LB 1X5YA 2H5UA 4N8CL 3Q9QA 4NNXA 1BAWA 3DSNA 5DA0B 4M7LT 1PEZA 3CBRA 1KJ3L 1KCSL 3EJTA 4MCNA 2JB5H 3GSXA 1GSKA 2J44A 2Y06H 1TT6A 3QUMB 4LOUD 4MJIB 4N22A 3KYKL 2XFXA 3PWNB 4WI7A 5JQ6L 2OJEA 2WQAA 4CC0A 2B14A 4UAOB 1NEZA 1CZ8H 4Y0GA 1CL7L 2BERA 3IMSA 2Z91B 5KWYC 5I71C 2BOCA 3AUWB 2ED9A 3OQ3B 4TSAL 3EO0A 5DCCA 1YJDC 5K9KA 4PJ9C 1UM4H 3FQRA 3ET9F 1JK8B 3BIBX 4O4YH 4MA3B 2HKFH 5JIQA 5GZND 2H2SD 4LHUD 1R34A 3FH5A 5LQBL 5SWZA 3K2KA 3DGDA 1UD6A 4PRPA 4X7SL 1CGVA 5E23A 3VGHA 3V4VL 3O6LH 2WP3T 1F4WH 3TBBA 5DJ6A 5FA3A 3MXVL 2AQ2A 4IGBC 1OGPA 4H1LH 1YC8A 2FGWH 3PJSB 1JERA 5EU5A 4FLRA 4DK5A 3QDGB 3RIFF 3ABZA 7TAAA 2C9AA 2FIKA 2QTVA 1TJHH 4HSCX 2P26A 4NQCD 4UI2A 3ZHFA 1NCGA 3NDYE 4XBEH 5KYYA 4K23H 1DQJA 2FO4A 3SDDD 3T0DA 2FE0A 1BHGA 3ASOB 1YC7A 2XWDA 1URIA 1HZLA 2OV0A 1AMXA 3MJGX 2VH5L 3K0YA 3QCUL 4O2CB 3TPUB 1JNNH 3U7AA 4I9WE 3UO1H 5F96H 2AJUH 2QL1A 4JM2B 1IEBB 1EGJH 3F83A 1A6WH 1MUJB 4ACTA 2Z0BA 4NM8H 1QHPA 4XP6L 2XN2A 2YOAA 4QXTA 2CHZA 4H8VA 2LAAA 3NSCA 1SYVA 3S88H 1RUAH 3CN1A 1W2KT 1IAIH 2VN3A 1DQVA 4NZTL 4OGZA 4UQCA 3WKQA 1LK2B 1F41A 3QI9D 4MMXA 4OUOA 1E9PB 1OVZA 1JVOA 2BVQB 3BW9B 5EBMA 1MAMH 3QIWC 4RMUA 1JHLL 5DJYB 2O6CA 1VCBC 4NQED 3GBML 1BV8A 4DNLA 1T04A 2IFFL 2AZUA 2LTQC 1XGTB 5GS2H 4UQDA 1D5RA 2ICCA 1O7SA 3BZFB 5MENA 2XHNA 3GS4A 4JRXE 3LXCA 3L4VA 4YX2L 3BD3A 3D3VE 4P49A 4UBDC 3MV9D 4KI5E 5CUSL 3C5XA 1J1XL 4GRMA 4PG9B 5IMKA 2NCEA 1CFSA 4JL1A 4OGQC 5FGSA 1JZDC 3C60A 3HI5L 1P5UB 4ZAKB 3KYMB 3Q8EA 1OAXH 1UWGL 3NPSC 2E8ZA 1FBIL 1FHGA 4IBLT 1U9KA 4X6CE 4DKEH 3T09A 4PJGB 4A7GA 2BRRH 4Y7OC 3CQFA 4L37A 2CLZA 4XWGL 5PCYA 2WMPB 3MGTA 2Z7YA 5EU7C 5C07D 2R83A 3RVUD 4ZO8A 3JTTA 4PY8J 2Z8SA 3D05A 4XPTL 5E1HB 4ZYKB 4Z3GA 3BH9B 5HYJE 1JYVA 2Y1YA 3HE6B 4Y16B 5J13C 3TBSB 5L88L 3BSGA 4IYKA 4LF3B 4OH2A 4YS4A 4FFVC 2YPLB 3DROA 2A6DB 2DQTL 4HLJA 2ZKXA 4FLSA 4OF8A 4ZO6A 3GSRA 4BFBD 2DQFA 1JGVL 1K3IA 5E03A 1TU2B 2IPTL 3VXRD 3UTZA 2PNDA 3D1MC 1J5CA 4Y1AD 1WBYB 3GKZA 4HIHA 4PM1A 1KIPB 3PWPA 3T2NL 3HE7D 3BYTA 2E7DA 4LEEA 3VRJB 4UNTA 1U8PB 2CSPA 1Q9KA 4XI5C 2EDRA 4GEJA 4I48B 4CSPA 1HQ4B 1NCDH 5IJVB 4X7CC 4MA8L 4FQIH 3OR7A 3LRGA 2WCSA 5TK4A 3QUYA 4YXHH 1CLZL 4G9FB 4LLMB 5FCSH 3V4PL 1ES0A 4LCWA 4W93A 3PGCA 3KL5A 5K69A 1YEHH 4PJ7E 1D7CA 4FHKA 2FQGA 4APQA 2YPVL 3KPOA 4F7MB 2FEDC 2X4PB 4AMKL 3ARFD 3RWJB 3D2UD 2X1XR 5FKPA 2BP0A 1A6AB 2GG1A 1YMMA 2XTJC 4NZDA 3ARDC 2JELL 4AZ8A 4K9EH 3MPCA 3BKMH 3LRHA 1SDAB 1SJXA 1UB5B 2YK1L 2QPSA 3D4GA 4H88H 2ZWSA 1ANUA 1IGCL 3LKSA 3MRHA 4KXZH 5HHXH 4JFDA 4D0CA 4RGND 5GGUA 2Z31B 4TNGA 1E8YA 1MCPL 4XPHH 2N4IA 3CBJB 3E0GA 3T4AC 3CFDA 5DUBA 4W9EC 4KZCA 5GIRA 3V0HA 3G9AB 1A5FL 1PD6A 3OMZA 3RU8H 2HVBA 4GS7B 4EXKA 5K59F 3ZY7A 3L6FA 1JVKA 2D8KA 3STLA 4F1SA 1FJ1B 3MJ8A 2NX5B 4Y2DA 4HHWA 1YPZE 3QORA 1NFAA 2KI6A 2UV3A 2WLJA 4HEPA 1WA2X 5ANME 1B3IA 4YSDA 1HEJC 5CBEA 3BDYH 4OKDA 4NC1C 1OK8A 3F6JA 3PQYA 2MOVA 1DVZA 1Y07A 2Y7LA 4MDIA 4AL8L 3G5VA 4TRPL 2IDCA 1QPXA 1HAUA 1A1OB 4RBPK 4IW4C 3UDWC 4XXDA 4BDVB 4IRJB 3HIZA 3ZE2E 1LNUB 3BPNC 3T65A 5F9JB 5DJ8A 4PJAE 4HMCA 1Q1JL 3W5NA 3G5YA 4JPKL 5IGXL 2WLZA 5JXEA 1J0HA 4URTB 3LH2L 3P0YH 3QVAA 1GVIA 4N2AA 1N59B 3IDMB 4WSGA 2NUTA 2KBGA 4E5XA 2PYEB 3DVFA 2M83A 3FHAA 5D6CB 2CMRL 2QQLL 1E0OB 3GRWL 3D0VA 5C2BH 2JXMB 3G08A 1QSZA 5HHMD 4AVIA 2BSSB 3QFDA 3WEXA 1AHWC 5MEPA 2JI3A 3MLZH 5F3BB 2WSKA 3PFUA 1FG2B 4ZUVB 5L0QB 2B59B 1R5WB 3OKLA 4G8EB 3QJXA 4PWGA 3N85H 2UZYB 3RGVA 2PCYA 4ZS6D 4F33A 1VIWA 3PGFL 4RA0C 1NAMA 5FCUL 3KH3A 3OV6A 1GY2A 1DQIA 3BQUD 4HKBB 4L4VA 5MERB 3CX2A 5CNHA 3AFLA 4NXSA 4AYID 5I9QC 1DVFC 4HFUL 5I1LA 1ZLUK 1AI1L 4YBQC 5CJOL 3FCSA 4KK6D 4ZMVA 1X7SA 2OI9B 3M1OA 1PS3A 1I8MA 2WWNA 2IBBA 5E5UB 3X17A 4AX3A 3ZTCC 4JBSA 4B7LA 1G7IA 2J1WA 4U6YB 5I6LA 4J27A 1FZJB 1A9BA 1U91B 4XRCB 3QHTC 3BEWB 3HCVB 3NCYP 4NQSA 1LO3H 1TZ8A 4WGKA 2FECL 3CMOH 3ALPA 3OHXB 4DN4H 3RFZC 1DZBA 1RIUL 4DFIA 2X09A 4GO9A 2DN7A 2EYRA 1TZIA 5LGYA 3WFEL 3ZR6A 2VQ4A 4WHYG 1TMCB 3FSZA 4ZD3L 1U8QB 1QFUL 2H32A 3OM3B 4P9HH 5D7LB 4RMQA 3P54A 2AF2A 5A2BA 1OPGL 5T1JA 1JWSB 1AKJA 1A21A 3MC0A 1IBDA 4P9MH 4FYSA 2YA0A 1P9MA 4J3UA 4Y8DC 3VX0A 3FU6A 4N68A 2AQ1A 1S9WA 3R1GH 4TSBL 3VVVA 3HZ3A 4N86A 3Q0HA 2X70A 3MACL 5E1IA 4FFYL 4UTBL 1WGVA 5L9DH 2ALAA 2D0HA 3PWJB 4A66A 3BAEH 4GAJH 4EDWL 1INDH 3FUKA 3INUL 3QUZC 1N8ZB 2EEFA 4JHWL 2EDWA 3IJEB 1WWCA 4NNPL 1AANA 2H3XC 4F57L 2BJML 5DD0H 3EYVA 4ISVA 2GTWB 4JGMA 3X1BA 4YBHA 4BZ2A 3KLKA 1VADB 2DMGA 4DSYA 1GGCL 2HLAA 5ID0B 1OCZB 2OXHB 3FJTA 4JFFE 3WFHB 5FA4A 4RGMB 1EO7A 3CHPA 5LG6A 2HFGL 2W0LA 3BZ4A 2WZ6A 2WB7A 3RYMA 3VMPA 4ONHA 1N6QL 2DD8H 3ZDYE 1X7QA 4GP8B 3GIVB 4KX8A 1BD2B 3RX9A 4HJUA 4WEMB 4C4UA 2XQYG 1XAKA 2XBTA 5J12B 4FXLA 4UV7H 1Z9NA 4I18B 1IT9H 1X6NA 2BNUB 3M7OA 4JLRA 4XO4A 1JPTH 1ZS2A 2GI0A 1BMGA 1FN4B 3T0XA 4HQQL 5I5RA 3VDAA 3U30B 2FX9L 4OGXH 4YHIA 5IUCA 3IYLW 4FMFA 3QW9A 5FYJE 3CZUB 5JXAH 5C6TH 4KH2A 2WK2A 4JM4L 1KXQE 1O5DT 2FEEI 4HH9A 5EA0H 3DX7A 1WIPA 2V9QA 5IB4B 3ARGB 2APXA 3FT4A 4L3EB 5IIEA 1WG3A 1V7MH 2WXKA 5K9QI 4R97B 1ORQA 5I8KH 4MD0A 4XN1A 2EABA 3U79A 4N8UA 5IOKA 5BUAA 4KQ0A 1F00I 2HH0L 3NSYA 1HH6B 5GSVA 1GAFL 3RIAK 3W11D 3TO4A 4XAKE 1FGVL 5IEKA 5DK0A 5HI4C 1KFAL 2C9SA 1A2YB 1BQHA 5HBBA 3VXSB 1LWHA 2RJMA 3DPDA 3H55A 1HWWA 4J2QA 3TT3H 3FFOA 1U8IA 4KRMB 1ZEAH 1PX8A 3UPAA 5E8EB 3UIZA 2GC4C 4JKPH 2JI2A 3HR5A 5DHVA 3RGHA 2NY0C 3SDYL 4E9XA 1A6ZB 3DC0A 2X4SA 4TLTA 4NKIH 2UX7A 1GIGL 2CA4A 5I6PA 1OAZH 1QSVA 2D3JA 4XP5L 5JOFB 4OFIA 2W60A 3VFMB 3ZE0B 1U8HB 3HE6D 4S10A 3RJOA 4Y16D 5B39B 5I1EH 1J0IA 3FYEB 4LASL 2MFNA 4UV4H 3QXUA 1JPST 1I9RH 1FAKT 2YPLD 2ZXWB 3A22A 2WO2B 4ETQB 4ZW3A 2X0WA 5HDOA 2KZBA 2W0PA 4XCFH 3UTTA 3VQ2C 4YDLB 1T0MA 1GZHC 1FAIH 1II4E 4NOFA 1Q0YH 3S3CB 3BGMB 1B3JA 3GLDA 4OIIL 4E9RA 4MB1A 4JRYA 1ZA3A 2D03L 1EUUA 4NO3A 3SGKC 4GPVA 2D73A 2CPUA 1J8HE 4WW2A 3ZYIA 2BHZA 3TNMA 1RUPL 1YUHA 5JLZA 1Q0XH 3F64A 3P3YA 2CPCA 3BWSA 4MJ6B 4Z7UE 5CEZE 1GRWA 2JKTM 4LESA 2QSVA 5JHDA 3C6LA 3GZPA 4ALAH 3REVA 1MG2C 2WKLA 4ZMWA 5BUGA 5L2KB 3BC9A 4JG1L 4L5FL 1X9LA 4WWNA 4CDGC 1I3UA 1ZVNA 5CN2A 3UGUA 4PV9A 2EIJB 4RMVA 1K8DA 4JFHD 3WE6A 5CLTA 2EYSB 1L0YA 5JOEA 1CFMA 3MREA 4XVUD 1UOVA 4KKBD 4TSCH 4X9FA 4AJWA 4C56A 2BW5A 2Z31D 3L9BA 4WU5B 4K5MA 2WUCL 5B1JA 3S7GA 4WV1A 4M5TA 5IEHA 4FULA 2WIIA 3MLSH 1KJ2L 4UT6H 4F7PA 3S97C 2WNWA 4HV8A 1QYGH 2P80A 1TQCC 3WNKA 1HDMB 4XBPB 3HN3A 1JK9A 5CWSB 4HXAL 3CLEH 3M8OL 4PGDA 4LL4A 3VXOA 5DEFB 5I2IB 3EDEA 3H1ZA 4X6BA 3HUJE 3LNDA 1E3FA 4JAMB 1TQBC 4FQJH 5DTFB 4K7PY 4OZFH 1F8TL 5F0LB 4UU9A 1MFAH 4MNHB 1BGXL 2K7QA 3CC5B 4EN3B 4LHUA 3M6DA 1YY8B 3SPVB 4FXKB 3KGSA 3P2DA 1B0GA 4NN5C 1QW8A 5I17B 2EVGA 4ECNA 4QRPB 1FL5B 2YD5A 1GOFA 2O5YL 4OLZH 5I5JA 3FNKA 5LUMA 2DJMA 2HVJB 2Y4SA 4XN4A 4EMZA 3U2IA 2P43B 1R4XA 3HB3B 4JE0A 4G9DA 4LFHG 1WZ1L 5ISZE 3OGOE 1F3DH 4PGEA 1C7SA 4IRJD 1FFQA 3U9PH 2Q87A 4X7FC 3ZUNC 2CQVA 5C0CB 5D5MF 5DZJA 4ZTPL 2VUKA 1G1CA 4POZD 2ZUTA 3VG9B 4NQCA 4BSJA 1DL7L 4KJYA 3MLTA 3QJSB 4M6OL 4WHCA 3EG9B 4YXLH 3DO7B 4PRIB 3NAAL 4GMTH 3JV0A 5DR5L 1JPGB 4I89A 3KPNA 3MOBH 4HOZA 4FZ8L 3QDME 1FWXA 4L3FA 3GLAA 1SJMA 5HYSB 1JZ7A 1NLBL 3N04A 5F7AA 4FQHA 3NN8B 1AIFA 1GGUA 4GNKB 2BDNH 2NYZA 3B6SA 4PGBA 2YFNA 1XGPB 2X4NA 4NBYB 4AEEA 1DTUA 2P7TB 4MS8D 1T2XA 1WIUA 3LPWA 2QADD 4WUUD 1KPUA 2UZXB 4JFTA 1DEEA 4UT9A 25C8H 4G8GB 3NGBB 2L7EA 2B1AL 1X5AA 1CVSC 3EGXB 3M86A 4CVZB 5JPMC 1A3RH 2AK1L 3L7EB 1GZQA 3Q6GL 1KT2B 2OBGA 5GS0D 2B20A 3O8XB 4QRRE 4IOIA 1SOQA 3QI9A 1VENA 3K0WA 2IBGA 43CAB 3RL1A 1KACB 3MBED 2R0ZL 3F04A 3S3PA 3U6RB 2OJ1A 3FSVA 4PJCE 1MIEL 2R4RL 1HEHC 1H3PL 4DH2A 1UD2A 3NFPB 3NK4A 3FTYA 1E65A 2DQIL 2NY6C 4JDTH 4DK3A 3GYRA 4RWYL 5BNXD 1K3ZA 2BHUA 4N0RA 3MV9A 5BZDB 4NUMA 5ACZA 3JV6A 5BCAA 5KS9F 1EAPA 2HJFA 2XQBL 2DH3A 2JQMA 2XT1B 2YPKA 3FHQA 4P23C 1J0JA 4YE4H 4XP4H 1C9SA 2YXWA 1MH5A 1NC2B 1KB5H 4A2EA 2WLIA 1R33A 3DLQR 2X2HA 4TVPE 3GHEL 3WLBA 2B77A 2JCWA 1DVQA 2CKNA 4RZKA 5C07A 3WD5L 3V6ZA 1B4TA 1IFHL 2K8MA 4TNFA 5AB1A 3WIIL 3HS0C 3RVWD 3G6JF 2DQCH 1WRFA 4FKKA 2JB6B 1OGAE 4EVNA 5ABZA 4PTTA 3CLWA 1OTTC 1D6EB 4JFQA 4B0MM 2IOIA 4JO5A 1FCGA 1DFXA 2WLLA 3ZTNH 3CAFA 4PIBA 4PW9A 4F9LA 3I74A 3SCMC 4U6HB 3KW8A 4X5LA 1AG6A 1BJMA 1NEZG 1M71B 1I1AD 4Y1AA 1MI5D 2EIZB 1S7WA 5A6LA 4OGAC 4HJ0D 3MLRL 3HE7A 1P4IL 2A9ML 4JO3L 1A7NH 3SGJC 5K93A 4FA8A 1Q9OA 4YH6A 1KCVL 2A73A 1PQZB 5C97A 2NY4B 4OLYH 4AENA 3WAKA 1WFUA 3O6KL 4PBXA 3QCVH 3HR6A 4GKNA 5FYKE 2BWQA 1U8NB 3FMGH 1T89C 1BD2D 3OAWA 5FGBC 4W70A 2OTPA 4RRPA 5E6IC 1XGQA 1U3ZA 2UZPA 5LCVL 3ARFA 3DTDA 3A5VA 3T0BA 2Q76B 1T0PB 3TS8A 1ZA6B 3D2UA 5T1DL 1WZLA 3AW5A 2PCPB 2VJ8A 4TUJA 3IU4H 3HG5A 2IBZY 4XNQA 1JDCA 4L2LA 3RPIA 3AMKA 4N90D 1CTNA 5D1QE 3FUHA 2H6PA 2C9XA 3IDUA 1FE8L 2Y7QA 1CD8A 2XN9B 1MVUB 4HIJB 4S0SD 1NICA 3I6SA 5HVFB 4O02H 2VCOA 3ZW3A 3ARGD 2F8IA 2X4QA 3EDDA 4L3ED 4N2OA 4X50A 3EJZC 4W9ZA 1AD0A 1ZT4B 1CGWA 2PW2A<