2ZD0A

Crystal structures and thermostability of mutant trap3 a5 (engineered trap)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
63
structure length
63
Chain Sequence
b'SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription attenuation protein mtrB
publication title Intersubunit linker length as a modifier of protein stability: crystal structures and thermostability of mutant TRAP.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Rna binding protein
total genus 10
structure length 63
sequence length 63
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 2zd0A00
3ZTEA 5EEWA 1C9SA 1QAWA 2EXSA 3ZZSA 3ZZQA 2EXTA 5EEUA 5EEVA 4B27A 1GTNA 1UTDA 1GTFA 5EEZA 2ZD0A 1WAPA 5EEXA 5EF2A 5EF3A 5EF1A 2ZCZA 5EF0A 3ZZLA 5EEYA 2ZP9A 2ZP8A 3AQDA
chains in the Genus database with same CATH superfamily
2Q6WA 1RUPH 4QT5B 5I1KL 2CM5A 4U1HB 3BD3A 3IN2A 3VXRA 3VXUA 1AMXA 4X4YB 5I1IL 5LWYL 2R69L 1R1CA 2FR4A 2CO2A 3LPPA 5AW5B 3VFNA 3COOA 1DSFH 4KNSA 1W80A 3Q5YA 5I0YA 5ESQB 1E9PA 3QS2A 4WI0A 1T2QL 2NY1D 4XCEB 1BVOA 4JLRB 4HSAC 4HKXA 5AVUB 5HYJB 1I7ZA 4JPVL 3TZVD 4JPQA 5DZOA 3TO2A 2VW6A 1INQB 3KPSE 5HDWA 5B3NA 2XT1B 5ICUA 2GVYA 2A4ZA 3TCLB 2CA3A 3PREA 3F7VA 4P8QA 1CU4H 1N2RA 3AWGA 3FSVA 4GRLB 4JKPH 2EVGA 3PAVA 4OKVA 3FQRB 5ALBL 2FZ3B 5FYKD 1SLUA 1R3IL 3KVPA 1DCLA 4E68A 4LESA 5I30L 2UV3A 2NTFA 3VMOA 1C08A 4W93A 1NC2A 2CCLA 5F1IA 4PJFF 1GY1A 1A7QH 1W6LA 5SWSB 2GK0A 3EGDB 1OSPL 4JM0A 4AEIH 3WXWH 3QQDB 2W9DL 2X4QA 5AKVA 2RMNA 1IC0A 2CH8A 4K3EH 4PGCA 1T22B 3H9ZA 4QRPA 4NPJA 2HG5A 1E3FA 2VIRA 1S7UA 2IBBA 4ODWB 2BIHA 1TVBB 4ZUVA 3UOAB 1P5VB 1YG9A 2WKOA 3G6JF 1WZ1L 3B9KC 15C8H 2LFEA 4MJIE 1CLYH 3WNMA 4MMZB 1RHHA 1U8JB 5T1KD 4OM0L 3L16A 1HL9A 3QORD 1JHKH 2EXYC 3Q1SH 1NL0L 6TAAA 5CSZA 5EC1A 4O02L 3B2PA 1ZLEA 3KDMB 4W9HC 2BIPA 5CZKA 2J6EH 1JZ8A 2ARJQ 2K4WA 4IKIA 2DYSB 4J1UB 5C0NC 4JFYB 1MQ8A 4KKLC 5F88A 5EOCL 1TOXA 2P26A 2AKRB 2OM5A 1IQDB 5D5MA 4A6YH 3L5HA 2UY6A 3CN0A 3SDCD 1CS6A 1OKEA 2BP0B 3KR3L 3CFIC 3LEXB 4A1RA 4KQ3L 3X14B 2GSIB 3EYUH 1XR9A 5L4JA 2A6IA 2ZNWA 2A9BA 4KQ4L 4LLDB 3NJXA 4AVHA 1SHWA 5EBWA 5IBUB 4NZ8A 4DP8X 5I18L 3L3DA 2QDWA 2WYZA 2OMUB 5BRZB 4R7DA 4U1NB 1FNGB 3L3OA 2BDNH 2YPLA 1QFWL 5E24E 2I69A 4AM0B 1T80A 3VDAA 4ODXA 3RHWK 1Y6KR 4CL7A 4R97B 3N6YA 1IAMA 4N2IA 1J5IA 2E59A 1JF1B 2FB4H 3D18A 2EICA 4NNYA 3U9UB 1XB8A 4F1ZA 3VAEA 3AY2A 1QBMH 4JG1H 1S7SA 5FYJL 4XVSL 4HP5A 1XD0A 1WAAF 4HIPA 3QJHB 3U2IA 2DI9A 2P5WA 4PRIE 1PL3A 3CZEA 4FXLA 1K2DB 2JLLA 3IGUA 1GJWA 2CHNA 2WAHA 3O3DA 2A74A 2WLLA 4AMKH 4P07A 5DWPA 1DVFA 1IGJB 3CG8A 4MCYA 5HGHA 5T8IA 5CLXA 4B6ZA 2DM4A 5T5FL 1FLTX 3CZSA 2GC7C 4GLRI 1TQSA 2YJQA 3AG4B 1RSYA 1VFUA 2VOTA 5DLLA 1EXUB 1CFNB 3WKPA 3BZDA 2QLYA 2YKLH 4XX5A 1F4YH 1RJLB 1FH5L 2EO1A 3Q43A 4DVBA 2EQDA 1QTPA 2C8NA 2Z4QB 3ZR5A 2Z34A 1U3JA 3CHOA 4G7RB 5IBLD 3D33A 2XKNA 1WG3A 4JMNA 5EFIA 2NT0A 5HDLA 1VFAA 1MDTA 4K5NA 5E1AB 1N9PA 1Y18B 3FQ1A 4I3SL 5T3XE 4GO6B 4I48B 1ZLDA 3H0TB 4PY8I 4TN9A 2VABA 4OLUH 1HWGB 1ADWA 5DJAA 3ESNA 2GTWA 3ULVF 4F5CE 1KCBA 3P73B 1TQBC 1BBDH 1E8YA 5DVOA 4BZ1H 1KPVA 3ZYJA 2DYPD 3QUYB 4Z3EA 3QT2A 5HYEA 5L7XH 2A9MH 1J5DA 3VTMA 1S2EA 1SUJA 3X1NA 1FFNB 3C08H 4HPYL 4ZW7A 4GXVH 4IRZA 5SWZE 3LKNB 2OJEA 3UMNA 4CBZA 4HJTA 4P46B 4P3CH 3T04D 3ULUL 2ENPA 1O6VA 2RJMA 4IOIB 4C56E 4DTGH 2WCPA 4FQHA 3EH4B 4KUCF 5GISH 2DYRB 3N40P 1MJJB 4AJWA 1JGLH 3O8XB 4TUJB 1E4XH 2YZ1A 5DYFA 3OAUH 4FNTA 4O2EA 5CEYB 2AJXH 2VDLL 3VX0A 1AHKA 3WTTA 2OL3A 2BRRL 3DHPA 5MERA 2PCFA 4ZUSA 3HW7A 4J5VA 3RWHA 5AB9A 3OC5A 2NX5E 5KSBF 1YLBB 1QSFE 3KPQA 3HZKB 1N7MH 4ZYKA 2P49B 4OIIH 1D7BA 4BGLA 3DXAD 2PETA 4XRCB 3ZQ9A 5FHAL 3GTVA 5ICXA 1CDGA 2FX7L 3MV8B 4D0CA 1J0YA 4K7PX 3D05A 3LDBC 1DVXA 2BCKB 3VWKD 1IGTA 3OJDB 1MREH 1QSEB 1G9NH 3LEVL 2FWSA 4WWKC 3OLEA 4ANKA 1IGIH 3ETSA 4X6EB 3U6XS 3PHQB 1KN4H 3CX5J 1KCSH 5JHLH 5CF3A 1H0DA 3GEFA 5E70A 4F9PA 1ADQL 4IIQA 4PRAB 3FO1A 4I5BB 3N42F 4OV5A 3UPAA 1YA5A 4CVUA 3BH9B 4X9YA 1YEKL 1RURL 3BN3B 2NDFA 4P5KB 2VAAA 4Q2ZB 4MB1A 4QNPF 5HHOB 1FG2B 2W65B 4HZAA 1ZVYA 2F7PA 4I18A 4PJ7A 4GBXD 4PB0L 4P2RD 3OMNB 4PJHB 5IB1A 3K6OA 1GGYA 5IKCB 3GXDA 2DJUA 1QNZL 2NUPA 2WLMA 2HJKB 3U9PH 2NW2B 1S9WA 4PJ5D 1K5WA 4NOFA 1G9MC 2B2XH 4K94C 2RFXB 2IWKA 2DTSA 3WY1A 2GY5A 1TU2A 1L4IA 5F6HJ 4NAJA 1FDLL 1ZHNB 3D3VE 4DF9A 1QVOB 5TJWK 4Y2DD 3PL6A 4DK5A 4WHTA 4XN8A 1MRCH 1VKXB 4YXKL 3CZNA 2JJTC 2ZKHL 1XHHA 1G6RA 4NKDA 3OR7B 5SX4H 3O2VH 3MV9B 1X5GA 2A6KB 3WUWB 1JP5A 4KITB 3HOGA 5I66B 1K8IB 1BBJB 2AGJL 3HNVH 5CZVH 1ZLVK 4OAWB 4TLTA 4A38A 4H8VA 2E7MA 5B7FA 1R0AH 4NLAA 4XNQA 4HIHB 2Y6TE 3FF7A 1YUKB 5PAZA 3U46B 1X5ZA 3Q3GB 5F89B 3LNFA 4KZCA 1NGPL 1U8HB 4R0LA 4TVPH 5FOJA 5HD8C 1UYWH 1V7NH 5LVEA 1HJBC 1E5YA 1CR9H 3A21A 2VERN 4Y9FA 1EZUA 1S8DB 4M7JL 2BWIA 4Z78B 5JW3H 2E7LA 5I1LA 1AANA 1W8NA 4PS8A 4YXLL 4G1MA 3HUJB 4XZUA 1A6UH 1B0GA 2V2XA 3OXSA 4G7YL 4B3EA 3UTSA 1FYTB 2FUTA 2Y2YA 3PUUA 3BCDA 2EACA 4ONGL 3AS1A 2FO4A 4XP6L 2YD2A 3CMGA 4GYBA 3P4OB 3ARED 1H15A 2ARJB 2IALA 3LQZB 2WWKO 5DFTA 4AIEA 3IDGA 5D9SB 5DJCB 1UD4A 3DX7A 3IXTB 4AIXA 3NGBB 1OEZW 2QHRL 1S9XA 3D4CA 4FNSA 4XWOD 3M1BA 4RIRA 3U7YL 1IAIL 7TAAA 2ESVB 1IGMH 3QUMA 3AG3B 3SKNB 4JM2C 1UM4H 2CKBB 2OQJB 4YBLC 3SE4C 2Z0UA 4F2EA 5KYYA 5K1NA 4FQXD 4XNUH 5CFAA 3MA7A 2Z31C 2QVIA 3BAXA 4RWHA 3O6ML 2IQAA 1UG9A 2OI9B 4H7VA 5I6LA 1CMOA 1LEIA 3AMKA 2MWCA 5FAAA 2IAMC 2ZXQA 5HHVH 5EWIL 1JGVL 2WINA 2BNRB 4NKOA 4NC1E 3WDHA 2Z93A 3ARRA 5KJRH 3APDA 2HPOA 1NGWB 4V33A 1DE4A 4RNRB 5DFVD 3MRBA 1RIVL 1A3RL 3IB4A 1J0KA 2YAEA 3TOPA 3ULVD 2DLEA 4XBPB 3WHE0 3BT2L 3CWGA 3IN0A 4LSUH 4JGJA 2FH6A 3Q8FA 3TX4A 5MHSE 5C07B 3B6SA 1ZIBA 4Z7VE 3SCMD 2VRKA 4MS8C 3VI3B 4NGHH 3FRPG 5BNXD 2EUWA 4R90H 1BQLL 2DM2A 2CCWA 3FH7A 5DK2A 5E0FA 4DGYH 4YO0B 2BCMA 3KH3A 5HHPB 4G8EA 2OCFD 4IBSA 3W0WB 1G7PA 1J1XH 3CXHK 3SGEH 3BSGA 3H9HB 5I1AB 3A6BL 3NZUA 4BA8A 3THML 3BQVA 2G2RA 3ARDD 4G43A 4KH9A 1TYEB 4FA7B 5GZNC 4WFHE 3HI1A 5DZ9A 5C3IA 5DQ9B 2QQLL 3ARBD 3FTGB 2WSPA 3OJVC 4FXKA 3HPJB 2VZ3A 3WUZA 3ZZLA 3LX9A 2R1YB 4L2YA 4XPAH 4YVNA 1TTBA 3B3IB 3HC0A 3IDNB 2DJMA 1JGDB 1EZSA 3OB0H 5F7EH 1W8OA 1RZQA 4KZDH 1SPDA 2FNWA 2AITA 2CJSA 1AR1C 1WAEA 3J7HA 1AHMA 1OV8A 1EHAA 1T0PB 5C8JA 3VWJD 4MD5B 4XPFL 3NQKA 1SN0A 4A2FA 4CNIB 4AX3A 1Z3GH 1FO0B 4Z7AA 3O2DL 5DZPA 3HN5A 5EBLB 4J3TA 4BFIA 1G9HA 2IANB 5I8OH 2FJHA 4X5WB 3HFML 5FGSA 3F83A 3BZ4B 1ZT7A 4I0PD 2RR3A 2QTEA 5HJGA 4Z3JA 4YDKL 4ESKA 1XF2B 3D2UA 4QHLA 4MLSA 2Y25A 2R15A 2EDLA 4KK6D 2PUQT 4Z7NF 1GJIA 4ONFL 2ITCB 3DVIA 4N0YL 5BVJA 3RWJA 2WXJA 5CR1A 3BSZH 1UC6A 5ACMA 4M61A 1MW3A 3RVVC 3ATDA 1QBLH 1I3VA 3TBSA 1AOHA 3D0LB 3BUBA 4OCMC 4PJXF 4UIMB 4YR6B 3KPSA 4F9LA 3HBZA 2GI0A 2DTML 4OCNC 3T8XB 2JI1A 3WNOA 2YSSB 1JZIA 4YDLC 1FCCA 4MHHG 4FE9A 3IFNL 4NQED 2YK1L 2UUDK 4OD2B 2XTJC 3TBBA 2DJSA 3VACA 1F3JB 1I9JL 1CICB 2XIIA 3F7YA 1I3GH 5DTFA 3EHBC 1TVHA 4KX9A 1S3RA 1U58A 3SKJL 2CKNA 3FULA 3ZR6A 4FYTA 4R3SB 4F15C 2GIMA 1OGAD 3RGVA 4F91B 2ODIA 3P1VA 4DIXA 3MUHL 5KSVB 4WFFD 4EI5D 4CADB 2FQEA 3MRDA 3UBFA 2BVPB 2ICWI 4LLWA 3CHRA 3ZRFC 4P59L 4OD1L 4X83A 4L8BA 1A7BA 1WBZB 3CDGA 3K6SA 4MJIA 2BVOA 4UOJA 2IBZY 4O51A 5B7EA 3RUGF 2YD8A 4O00A 1NBZB 5IBTL 2QVMA 3WFCL 4YHPA 3W81A 3ZDYF 3NPSC 4TOYH 3S34H 2HT4D 4F27A 1W72A 5HHQB 2V9QA 3VXMB 5DZAA 4X6CA 1IFHL 4UOW0 3DJZA 4Q6YA 3MUJA 2BNQE 2FLRT 2F18A 4M6NH 4R96A 3MLYL 4IK6A 2JXMA 4DUVA 2VDQL 3QEQD 3S98A 3IJSA 1UURA 1KXVA 4TNWF 4ANWA 4LAQL 5LN8A 4P2QE 4EE2A 1GAFL 3MRFB 3ZPDA 1GA2A 3BQUC 1GTFA 1F4XH 3DARA 3KYOA 2OL3H 3QDMD 4LDOB 5HI5D 2HRPL 1KCRL 3V4LA 1JZ2A 3QJFB 5EUOF 2IMNA 4N8VB 3UTQB 3ISRA 3ARXA 3UTOA 1EO8H 1C7SA 5DC2A 5BZZA 3WXVL 5F3HB 3FOMB 1HXMB 5BXFB 3RWDB 3WLBB 3FT3A 3IAGC 4YHKH 5DZJA 1O9VA 4YN3A 3O81A 4TQEL 3D51A 4E42A 3CK0H 2VLJD 4N2OA 2G5UA 5DVKA 4JZNB 2I26N 4AMXA 4NERA 4RGNC 5FYLH 4BFEA 3T2PA 1H3PL 2YD3A 4M6OH 4PRIA 1TXKA 5GGVL 1NICA 2EXWC 4NKMA 4NHCL 3HA0A 1OWWA 1EDQA 3MLTB 3MI6A 1FVDA 4UYQA 3PWLB 4BH8A 4Z1PA 5AB2A 5KYUB 3WD5L 1JZ4A 2OX5B 3PGFH 4JW3A 2WYHA 1CXIA 3J2PA 3JV4B 1YMMB 3KW8A 4A2EA 1DBJH 32C2A 2J43A 5D1QE 3CMOH 1GOHA 4FQ1H 2WNKA 1TQVA 1TIUA 4KX7A 4AYID 4FFZL 5KSUB 1G0YR 4B9IA 4Z76B 4EN3D 4PRPD 1YQVH 1TTRA 2P7TA 2ZNXA 2AJVH 1MCPL 4H8UA 2D9CA 2I7OA 5DRNB 1IVLA 2XCMC 4PLKC 4EJ1C 3FRPA 2DICA 3O41B 1SEQH 1N6VA 3FQUA 3H54A 5TDPB 4ABWA 1NCDH 1MF2H 4WCYL 4LFHG 4UBDC 4X7EC 3NCEB 3RWEB 3UG4A 4F5CA 2AJUH 5DZLA 1C5DB 4U1JA 1IC7H 3WO3B 1F6LL 3QULA 4NJAH 3WTUA 3MJ9H 4JFOA 1HHKB 1MJ7H 5DK0B 4ZZKA 5ITBL 3QIBD 4ZRGA 3O3UN 4PBWD 4MAYB 3GSRA 4FNUA 1MFAH 2NY7H 3ARUA 4XTRC 1MWOA 2SODB 3HCVA 1NMCB 1M1XB 4Y4HB 2J3SA 4P9HL 3V4VA 2A5UA 5JTWA 3HNSH 8CGTA 2AEQL 5SWZA 4AGQA 3F84A 1XIWD 4Z8FL 3B8YA 3CZJA 2K0RA 3SN6N 4YDIH 1M3IA 1ZDQA 1DUZB 3DX0A 4C56A 4LSRH 1U8LB 2ZUSA 1XGQA 2GW5A 1DFBL 4JDVB 3RDTB 1E4HA 1FFOB 4OT1L 4JQXC 3IEAA 1SEBB 4X98B 1TKWB 1UT2A 1VEMA 3Q7JA 5JO5A 3DX9B 3IMWA 4OFPA 4XVOA 3VI4E 3L7FA 2XN9B 4F8NA 2C34A 3ARWA 3DX4A 3X1GA 4POYA 1ZV2A 4FKHA 4GUQA 1QSFA 4NQSB 4ZX4A 1X5MA 3DJTA 3K7UA 5DD0L 1MCOH 4FTDA 5E9DE 1KXTA 2YQGA 2AS5M 3FYEB 1CXLA 1E8ZA 4ZFZA 3QWOA 2VSCA 2YWYA 5GRUL 2MPAH 4K0OA 1YDPA 4ODSH 3D25A 3JZ7A 3IJ9A 5KG9A 1OCWH 2DQGH 4JDZA 4E9YA 4ZTPH 4IQHA 2HX7A 4I88A 2MCG1 4ES8A 4WEMB 1JNHB 1DQMH 2UX7A 1JL8A 1ORQA 3QUMH 1U3YA 1T1XA 3HE7C 1KN2H 1PD6A 2FHBA 3QIUD 4NUGH 4W9LC 4B53A 5IFHL 2E7HA 3IFPB 3QH3A 3FFCE 3FQWB 2F54E 2BWQA 3FN9A 1HEZA 3P30L 5DCCA 1LWRA 2IFFH 4KRPC 1FZMB 2IDFA 2V2TA 3GRWL 1NM9A 1U30A 1OP5K 3KZ8A 3BAEH 3SQOH 1AD9B 2NY6C 4FNQA 3MUUA 1FZJB 3DX6B 2W0KA 2BS8A 4GW1B 3IJYA 3QA3B 1ZS8A 3F5WA 5EZOL 3WS3B 2W0FB 2CLVA 3V0VB 1BEYH 1WC7B 1IEAB 3OGCA 5DS2A 3ESPA 1BVZA 3U30B 4CILA 3D06A 4Z23A 3SE8H 1RFDH 3MV7E 4ZMLA 1NDMB 3U7AA 2DQHH 2CHXA 3KS0J 3I50L 3D3VA 3IGFA 1JUFA 3LTVA 4H25A 4R4FH 2JKTM 5GGUA 4MDIB 3ZDZB 5D7IF 4YHML 1KACB 3VFMA 3X11A 4WO0A 4BWTA 2GUOA 3IMUA 4K7FB 5HYJE 4ELDA 4JFQA 2QPFA 4WTQA 5BS0E 4XAWH 3CHPA 4Y4FB 1HHGA 1A1OB 1LDPL 4MA3B 5HDQH 2CLRB 5IVZB 4L9LA 4FERA 3CN1A 4KFMA 4HOWA 4XPGL 5G55A 1ZE3C 3W56A 3LDBB 4X99B 1EVTC 3QGVA 1U92A 3K74B 3G9AB 2GYSA 2Y5EA 3NZHH 3WNNA 3ZL2A 1X6LA 3G5ZB 1BZDA 2D3JA 3NZ8A 2R9HC 4UDUA 3S48A 5EN2B 1DJIA 1NEZG 4FHBD 1R19A 1RMFL 5CSBA 1EXHA 4RESB 5IW6A 1MH5B 3S35L 4KJPC 4IOSD 5LB1A 4F7TA 5SWSE 3T0ED 3ALXA 2WLIB 5T1LA 4N2AA 2DL9A 5T1JA 1P7QD 3FTUA 4K71B 4CSPA 2CO7A 2ZOTA 5GGRB 3FJTA 2CO4A 3RKPA 3NIGB 2GY7B 1AFVH 2KPWA 4APXB 1AGCA 3ABKB 4KTDL 1MFDL 5A3IC 2JJTA 5EEYA 1SZNA 1D5ZA 1Q9OA 3X3FL 5BOPA 4B9JA 1HKLL 1MUJB 1TJHL 3JUYA 4G5ZH 4UIKH 1W2KT 1S7WA 5F9OH 4OU3A 2W9EL 4J3OC 5KZCB 1PTZA 4DUXA 1WO2A 4PD4K 3VDCA 2HTKC 3SODB 1XCQA 3TWYA 1FORL 2KLRA 3HC4H 4X9FA 5CNHA 4LSSH 4QGYA 5T33H 3O6FB 4PG2A 2I9TB 2GCYA 1NMBL 3TJHC 5BMFL 4ZDHB 3MRQB 3N91A 4JPKH 1RSFA 2EIBA 2P46B 5B39G 2DQDL 3B9VA 3ZHDA 3S36H 4GKZB 4TF4A 3DO4A 5J1AB 5J11B 4N0FA 2VLKB 2VXUH 4WEUD 3FH5A 1FFPA 2X1OA 5E99H 1N0XH 4W9JC 3HG0A 4PREB 3WFBL 4MA7H 5BRZE 4YHOH 3UMTA 2P42B 2F61A 5A2KH 2D7MA 1HU8A 5IREA 3SDAC 3BMWA 3LRSA 2Z7ZA 1PSKL 3WELA 1N5YL 3U1SH 1K3ZA 2ENQA 3MO1B 2WUCH 3SOBH 4Z7VA 4P2CG 1CBVL 3VXSD 4XHQA 2DKUA 1MDAA 1VGKA 3WBDA 2F5AL 1OTUC 4WU5B 3X12A 5C0IA 4K7PY 2PXYB 4JM2A 4GAGL 2H6PA 3GB7A 4CC0A 3B7YA 3M07A 2O4EA 1EAJA 4OZGB 5DURD 1OWRM 5DHXB 3B5GA 2PR9A 1ZVNA 3IMRA 4FNLL 5AAMC 4Q74A 5BVPL 1JV5B 1EIBA 5F1SA 4KJQD 2B08A 4KHXL 1W72H 1ZGLA 2X12A 5F7YC 1DVYA 4HH9B 3FH8A 3FT1A 2MJWA 4EDWH 3NSFA 5FEBA 3G6DL 5KAQG 5D4IA 2P24A 1KEGH 4YUEL 2EILB 2BMKB 1MNUH 5IHUH 4L5FL 3SEPA 4YBLB 4FL4C 2GBAA 4JPSA 5DJDB 2APTA 3KGRA 3AXIA 1RU9H 2C9RA 1S5HB 1Z6JT 1E27B 3L1OH 3CSYB 4NRZA 3ZYZA 1J7VR 4G6KL 4NAQA 4XZ4A 3CLEH 2WO4A 1MCKA 2LE9A 2YJLA 2OSLB 4WVRA 2DH3A 4MXQC 3B2XA 4OJYA 2IPTL 2UZPA 4KK5C 3QEUA 3ZX1A 2FJGA 3LPOA 4J3SA 2CO3A 2NCMA 4YL9A 4XOBA 5EU7C 5E6RB 1QKZH 5EMYA 3ERXA 3DECA 5GZNA 1XTLA 3S5LB 2NY4B 5IQ9B 2FUQA 2EH7L 3QEGL 4YS4A 1CYWA 4OV6F 3SY6A 4L1BA 3LV3B 1Z5HA 1GSKA 3MOAL 2XX1A 4XMLL 5I6KA 1NFIA 5TE7H 3PV6B 3EBIA 1XGRB 2XN0A 4R8WH 2DMHA 2ZSVB 2FGWH 4NPYA 4DGWC 5DGQA 3CVHL 1QLFB 1AXSB 4LP8A 3RWFB 3I6KA 4OBSA 4U7KA 1CN4A 5B1CA 1DN0A 3PPSA 4NAMA 4TVUA 4FFVD 3ZTJG 2ZWNA 4DKFL 2Q7YB 1ACYH 3GI8H 3VA6A 2KDYA 3L3IA 1V8HA 3Q8BA 1WS8A 2VQ1B 1JPSH 4WU7B 3W37A 4ELMA 4DZBA 2YAOA 1XSOA 3WNKA 5DEFA 2G4GA 5EU7E 1CE6A 1AGBB 3VE0A 5T3XH 1QTSA 5IFJB 2IH9A 4NN6C 4WTZG 1TTFA 2WPGA 3MZTA 2R0LL 1KB9J 2ALWA 2A6JA 1AZBA 5C9JA 5I1HL 1HSAA 1QSEE 1PEZA 2D0FA 2WB7A 1G0DA 4JPWH 5TE6L 2IDSA 4AL8C 5FGBA 3HS0B 4P4RB 3I9AA 5L4IA 1YEGL 2PW2B 3EJSA 1CE1H 3HZ3A 1A1NA 1P1VA 1X5IA 2QQNL 3D52A 4AQOA 2OXGB 3WI9A 1NEZA 2ITDB 2BNQA 4YBHA 1O9WA 5CJQH 4QD2E 2FSEB 3FN3A 2O1AA 2AVGA 2X4NB 3LN5B 1ZA3B 2AEIT 3D30A 2WBJC 4Z5RA 4Y4KB 4HGWB 4PJHE 1JTTA 2QKIC 4P2QA 4M5SA 2OMTB 4TQ8A 3SZKC 4IMLB 2ZCHH 1T20A 1MFBL 2B5IC 3CSBA 4C54A 4YDLB 1U4FA 5L4FA 4U6YB 1J8SA 3LH8A 4UT9A 1BVLA 4RX4A 3LMJL 4HUXA 1M71A 3P54A 1AI1L 1I7UA 2H6UA 1BFOA 5FUZL 1RJZB 3GBLA 1A6VL 1QLRA 2Y6SC 1QMUA 3UZEC 1IC5H 3LRKA 2VUYA 4MXVE 1HI6A 1DQTA 4LMQE 4NKIL 5MENE 4L0YA 2PWDA 2Y06H 2B1OA 3AABA 3D69B 3L5IA 4U1SB 4PB9L 2XLLA 25C8L 2PWGA 2C7UB 3FOLB 1NGZA 4LASH 1ZHLB 3NG5A 4HUMB 4RAUA 4IRSA 2ICCA 3QNFA 1TTAA 5I28A 4YZWA 3SJVD 2E7DA 3RX8A 5HGBB 3OKMB 4YDJA 2FE0A 4OR1A 5A2AA 5F21B 4HIEA 4JAMB 5DVMA 5KBMA 3VGBA 1J1OL 2HB0A 4OZFG 2HJLA 1D5MB 2UZXB 4YZFF 4Q9CA 1KC5L 1RAMA 2WN2A 4AYGA 5IROD 4HBCH 4EI6A 5T1MA 4LSVL 1HN1A 5LBGA 3D0VB 3GWJA 5D1QA 4HJGB 5JYLA 3G6AA 1CGSH 1I4FB 2NZ1A 2NMSA 2Z35A 1OT2A 3HUJE 5HJDA 1KXHA 3RLSA 3UXFA 1WICA 3A67H 1HEJC 5F0LB 2R2HB 1U8MA 1FYTE 2PO6C 2N7SA 3FONA 3U0TA 3QCUH 4KI5C 5ECJE 3TBCA 3I85A 3IDMB 1LILA 3AC0A 4MJ6B 3EYSH 3K8MA 1OAKL 4QHNB 4XHJD 2APVA 1OARH 3CBRA 4R26H 3CTTA 2R59A 5E23A 1LHZA 3CZKA 3GMLA 1ODAA 3I2CH 4JVWA 1MPAH 2IH3B 5CM1A 5IQ7H 1HHHB 1RZIA 4KVCL 3RAJH 3MBXL 2Q8BH 4CW1B 1KCKA 1TQWA 4J3OG 3CFCL 4ZNEE 4Y5VC 4S1RH 5C0FB 1YECL 3ZE2E 1CLOL 1X4XA 3REVB 5JPMC 4BFKA 2DWEB 4RZCA 4X7SL 1ILSA 4TTDC 3F64A 3BZEB 1HWHB 3C60B 1Y7VA 3NT0A 5KOVC 3QO1A 3TV8A 3NJJA 3OX8B 3OVUB 2KMWA 3PFQA 3KPOB 1J10A 1K4DA 3CFKA 4KWUA 2HLFD 2ZYIA 3OJMB 5LBSA 3AGWA 3EG9A 3X1FA 3C5ZB 2OP4L 4FCHA 1JPTH 2Z7YA 1AKJD 3C9NB 2YAHA 1MCWM 3GGWB 3HE6A 4KI5E 1JZFA 2LR4A 3VG0L 5DUPL 3PXLA 3HI5H 3LZQA 3VI4A 1BF8A 1G9MH 2J1WA 5D1ZC 4K94H 4OD3L 2DBJA 4P23D 1Z1WA 3E6FA 5EUKB 4BFGA 1MJUH 2LQRA 4F7PB 1URLA 4GIOA 2OS7A 3MGAA 2M83A 2AERT 1QRNB 3VI3E 3DBSA 5HDOA 3ULSA 2H0FA 5E9DA 3CVBA 3VXOA 2A6DA 3FYIB 2EIMB 2NQ3A 1IM3A 3DPDA 4JG0L 4JVPA 1SN2A 2JNZA 4QRUA 5IZ7A 4HHGA 5HJBA 1L0PA 3W0WE 4JHAL 3LD8C 3UYRL 5C0RL 4GXUM 2FBOJ 1FZKB 1PQZA 4OF6A 3JXAA 3N5AA 1XV8A 4X5XA 4PJCB 4KKBD 4KVNH 4G9FD 4OCSH 1EGJH 2G4EA 2UWEE 4CC4C 3FDWA 3MJ7A 2DIAA 4NN5C 1G84A 4Y7MA 2PWEA 3U4KA 1BM3L 3V4UH 3BDYH 2XJKA 3FFCA 3L2LA 1JDAA 4HMEA 5DRZA 5IB4A 3FB6A 4JPIA 2F54A 4NWTH 4EF3A 4ZFFA 2JVUA 4Y1AE 1CIDA 1QQDB 2X6UA 1RVFL 4PWFA 5AOJA 3DSNB 3F7PC 1OTTD 5IF0B 3QB7C 12E8H 1CYXA 4H2AA 4XNAA 4F57H 2EEDA 1Q1JL 4JRXB 3FO9B 4KTEH 1FZOA 2PTVA 1NGYB 4OVVA 3PP4H 5BUPA 1IL1A 2NXYB 4QT5A 5JYMA 1NGQL 3G7TA 4E9WA 1Q9LB 1HXYB 3PWNB 4QRRB 4WDIA 4JN1L 3O11B 4A7TA 1A3QA 3MV7A 1UD6A 5E08H 5F71A 4XP5L 2F8IA 1OK8A 4XCYA 3NESA 3K5SA 3HE7A 1REIA 5ESQA 3KCWA 2NY0B 3ARGD 4FOMA 4XP4L 5I19H 2BP8A 1PG7L 5CR8A 1XF4A 3H53A 1JVLA 5HYJA 3BKMH 4CJ0A 3MREA 3SBWC 5BS0A 2HJFB 4PJEE 1INQA 1MI5D 1D6VL 1LO2H 4APQD 4AT6A 5AVVB 1MSPA 1NCAL 2EDTA 2BSCA 3FZUD 5H8DA 1DSWA 4GRLA 1E28A 2QEJA 3SY0B 4J3UA 3FQRA 2FZ3A 3GSUB 3H42L 1BFVH 1SHMA 3QISA 5C08D 5TDNB 5ICZA 1U8NA 4X6BB 3HR6A 2Z8SA 1E2VA 3H56A 1LMIA 3N43B 3VVVA 1Z0MA 1UGNA 2V17H 5SWSA 4LCWB 5KEZA 3EGDA 5K69A 3F58H 3C8DA 3QQDA 2WW8A 3ZZSA 4U0RB 3RU8H 2ALAA 3LZOA 1JNLL 4ENZA 2HA1A 1Y6NR 3X3GH 2GJ6B 3MOBL 2NW3B 2RGSA 2DKMA 3BP5B 2P5PA 4MMZA 3HG3A 3BWAA 5MEPB 4HOXA 1SXZA 3UC0L 2F74B 3NA9L 4OLVH 1Z9MA 1JFHA 3D39D 3O2WH 4L37B 3SYCA 4PV9B 1F2QA 3L4ZA 3PHSA 5KVFH 2NY1C 3VXME 2OMVB 4OZFA 3VJ6A 1UWEL 2VDPH 2X70B 3P77B 3N1PC 3MRNB 4LEEA 1ET5A 3N50A 1MCNA 4OJDH 4Z0BH 4J1UA 3TZVC 2G5BA 4H8WC 4JFYA 4ADIA 4L4TB 5D71L 1IZKA 3LKPA 3QCTH 3RNQB 5C09D 2EEBA 4LVHB 3UZQB 4KC3B 1A9VA 3TYGL 1D9KD 3HHRB 4XAKD 3SDXB 3DJSA 1W0WA 5E94B 2GSIA 3HC2A 2B4CH 1WFOA 5IHZB 4LLDA 3RKDD 1ML0A 5JLZB 4UB0L 1WS7A 2ZYHA 4LPWA 5BRZA 1KJ2L 2ISDA 5IGXL 3MRRB 3UEQA 2VO8A 2W5PA 1JJUA 1DLFL 3E8UL 3MN8A 4FXGB 1J1PL 1TZGH 3B2VH 4YSQA 1C5CL 1U33A 2VWEC 1JF1A 3VFSB 5CZRA 2D3NA 4AMWA 3Q48A 4OLXH 1EA9C 3FL7A 1R3LB 4TVPD 2VLRD 1TEFA 3BGMB 2ENSA 5MP6L 3VXQB 4JO4L 5CP7A 2QV2A 3QORC 4GMTL 2N0KA 3M17B 4FFYA 4YNYB 5HVGB 1OSEA 1TZHB 4UQIM 1U95B 2Y1AA 5GRVK 2X28A 4FX5A 4TL4A 1AHWC 4HS8H 5E6SB 4GAYB 2QBWA 2Q86B 1DBBH 5FYKE 1EXUA 1CFNA 1YMME 1I8IB 4KY2A 3VXUD 2BC4B 2XWDA 3P4NA 5LNGA 1J88A 1RJLA 3VG9C 3PFUA 2HVKA 3FCGA 3NUKA 4H20L 1WQVT 2CSPA 2YAQA 4X7DC 5ALCL 3SDCC 2F19H 1UXSA 2Z4QA 2ZCZA 2VQTA 3FAXA 4WV1B 2YFNA 2B59B 4OUOA 2OR7A 3SDAA 1CXKA 4ECNA 5PCYA 4XC1H 3ZW3A 2EEAA 2VWEE 3PV7A 5E1AA 5IM7B 1Y18A 3RL2B 2UY7A 4I48A 4Y19B 1JK9B 5JR1H 1UD3A 4UT9H 4XN1A 2CNYA 1KEML 3ELAT 3JV0A 4UQAA 1X7SA 1E4XI 2YXFA 4N8CH 4P2OB 1VDGA 2IMMA 3P73A 4KO9A 2V7NB 2Z92A 3ATFA 3RJDA 5K9JL 1GYAA 1T7XA 3CH1A 3H3BC 5TFSH 4EKXA 3KLHD 2I27N 3AWFA 4JY6B 4TLKA 3L3KB 2XZQH 4N2LA 1YCSA 4FJ6A 1HHIB 2NY5C 5C86A 5IMMA 1NC2D 4AJYV 1FSKC 1MW1A 2C3XA 1I85A 1YJDL 1QUPA 1CJYA 1AGEB 1N8ZB 4ODTL 3T3PF 4LVEA 5K1JA 2WQUA 4I87A 4IOIA 3RZCB 5F9AC 2AFNA 4DKDC 4QRPD 1I3UA 1MJJA 2X2YA 2VDLB 3I84A 4RRPM 5DWUL 2DWDB 4Q9RL 1HZHL 1OGSA 4FCAA 4ZD3H 1KPUB 3T0EA 3F2LA 1O75A 2HSIA 3MOQA 1FE8L 1KTKE 2XN9E 4L3CB 4GRMB 5IBLC 1E40A 4ZOBA 4G9DB 2J1ZA 1FG9C 4K23L 5I1DB 3HZKA 3IRCA 2B1AL 1NMAL 1BWMA 3QUXD 4NNPH 3N04A 2YPVA 4M5YL 5DEGB 4K3HA 3TEUA 2EO9A 3QR2A 3OB8A 5B4MC 4XRCA 1F18A 1LP9B 3OBAA 1KMGA 5F6IB 1MWAA 3PJSA 1LD9B 4KY1L 3D4ZA 1DQDH 3HMWL 4QCIB 2J1XA 5F3FA 1NUGA 5A40E 3OJDA 1QSEA 5FO2A 1CGVA 4NCC2 3EIFA 3UBXG 3FQNB 4QHKJ 2R0KL 3FQYA 3PHQA 2RB8A 3P0GB 4NIKB 1AY1L 4XPHL 5K9QI 2BIIA 2GJJA 3QDJE 2YPLD 1IBBA 4NFDA 2CPUA 2RALA 1ZWIB 5BQ7A 4LIQE 4GS7B 3BH9A 3EJJX 6PAZA 5SX4I 1R33A 2IGTA 1J5CA 2XRAH 1MW2A 4L8SC 3T0WA 5SX5K 1FG2A 4HD5A 2W65A 2OV0A 3BHBB 4IIZA 2EJ1A 1KT2B 5DDHA 4PJHA 2Y4SA 3AU1B 3HNTL 4TNGA 3KYKH 4PSPA 4NO3B 5E5MA 1NJ9B 4BKLB 2HJKA 3HIZA 2NW2A 3GSNA 4HHAB 4XNXH 2P5WD 3OB0K 2B0SL 5DS1A 1Q94A 1JPGB 1P9MC 1T6WA 2HG0A 2RFXA 4BE5A 4LF3B 1GYVA 2JK5A 2WZ5A 1DVFD 2G9KA 4AZ8B 4D94A 3B7RL 2XN1A 5FUCC 2E9JA 4EOWH 1M2VB 4F2MB 4DOHB 1QVOA 5CCKH 4ZW8A 5MENA 2QVFB 3AADB 4JHWL 5INCB 5IMOB 1VKXA 2MCAA 5DRXB 4HWBA 4Y88A 4ZX6A 2GBVA 1N0LA 3H3PH 1E3XA 4IRJB 3T6ZA 3L4CA 4N0UE 1K8IA 2WWNA 1BBJA 3QPQD 1HL5A 1YNTB 3BD4A 4RA0C 4OAWA 2DWXA 4IHOA 5D96C 1HEHC 4OCLC 1NC4B 3SBPA 1DHKA 2O5XL 3I6GB 3UJTL 1V3LA 3ETBF 4KK8D 4NNXB 4AUYA 4N5UA 5DQDL 5CJOH 4RFOH 1SHSA 1S8DA 3P4MA 3ZTJH 3VMNA 3TJEL 3CBJB 1MVUB 2E75C 1BXAA 2ZUWA 2W07A 3HUJA 3NJLA 4N24A 4EDXB 1WCBB 2HKHL 2FHCA 4NQDB 4YXHH 1MJ8L 1MCHA 1FYTA 4G42A 3MU3A 4KO7A 2VITB 4Z7WB 1J5OL 1FF5A 4L4VD 3GHEH 3VFPB 4ZFGH 1E5UI 3FXIC 2AK1L 5C0CB 3VXTB 1UEMA 4U1KA 5DJCA 3IXTA 3LZFH 5F9WB 5IOPA 1RZ8B 3QPXL 1UVQB 2GJPA 3CZGA 4BZYA 1NKGA 5KJ7E 2EDYA 5LXGH 2F7RA 4Y2DC 3TM6A 4ALAL 4PWEA 1A7PH 5IMLA 1IGYA 3NH7H 2E4TA 5T3ZL 1OT4A 2KC0A 3SKNA 3MCG1 2BOBA 5GJTL 4ZNEA 2CKBA 2OQJA 1MOEA 4DGIH 1OAYH 3RG1C 4HCRL 2UZIH 4JFPB 3ZL1A 4DPCX 4ONHA 5B3JF 4PCKA 2WWMD 3CLFL 2VLMD 4ZMQA 3F8UB 2JKWA 3BUYA 4OI9A 3SGEI 3VYNA 2ZPKL 3EF4A 3K80A 2NT1A 2WJ5A 3VWJA 4XCFL 1MHCB 4P2RE 1QEXA 4UOQA 3MLZH 3WKNA 4Q14A 1XCXA 2EE3A 1HE7A 1E6OL 3BFQG 2WXHA 1MZYA 3LJ3A 2I85A 2PO6A 4XXCA 3HLKA 3U25A 2CGRL 5FYLD 3PWUB 2DQTH 3NCBB 4HV8A 4GSXA 1G87A 4OVUA 5GS1A 2FWOB 1B9KA 4GAJH 4YHZH 4XBPA 3PIQB 4J3VA 3JUZA 1VZIA 2VT0A 3ZQXA 1RUPL 4NYLA 4QAWA 4ZBJA 3UAJA 3OHXC 2AK4E 2DZEA 1UZ6F 3GSOB 5BV7C 3VI3A 2ZT9C 4Q6KA 1UM5H 3L5XL 1PKQB 2X41A 3AREC 4XCCH 4WHCA 1WFMA 1UXMA 3HZVB 1XCWA 5L88H 5IEKB 1DSFL 4HS3B 3SPJA 5HHPA 3W0WA 1QWNA 3KVQA 3BOVA 5KBKA 4W9ZA 5JPMA 5I1AA 3H9HA 1FRGL 2XG4B 3APFA 2EIEA 4XWOC 4YAQB 1XSJA 1A4AA 1UZ8B 5CLYA 1TVDA 5KSAD 5IJKA 3BIAX 5D70L 2UWEA 4UT6L 1ZE3H 3GUTB 2EIZA 1KBGL 1ZJBA 2R1YA 4OZFH 2O6PA 1CU4L 1AG0A 3KM1A 3PWJB 4JKPL 3B3IA 4TUUA 5G5DB 5E03A 1GC1C 4W9KC 3GPSA 3D4GA 4LHJB 3IAPA 1A6TB 5TF1L 2I5YH 5EN3A 1JMZA 5K39B 1BX2B 4Y1AA 2B15A 3I6LE 1FV1A 5D1ZA 2B77A 3HS8A 4MD5A 4X4ME 4K4KA 2WY3B 4H1LB 5AVTB 3QXVA 4YDNA 1F4WH 5EF0A 2DMBA 1JDCA 5E8NA 5DFVC 2VC2H 3KLDA 4B9ZA 2R1XB 1PY0A 3WXWL 4N68A 4Q6IB 3B1UA 4RBPH 4X5WA 3WIHA 3LH2L 2GTZB 4GMSL 5IVOA 5JDJA 3BZ4A 4XNZB 1UENA 3MUGB 1ZVSB 3OXRB 4BWWA 3TV3L 4XX1E 4NOBA 4HEME 4H8PA 4GXFA 4K8RD 1C8QA 1B2WL 3SCMC 3V4PB 3ZLQC 1CZ8H 1XH2A 3CQFA 2F9BT 1PS3A 1YAIA 4LE8A 1RIUL 2R29L 4Q52A 5AKTA 1JHKL 4MNQB 1SOSA 4PG9B 4J3OH 5HVWA 3Q1SL 2ITCA 3UBXA 1YY8A 4CC4A 3RPIB 2QHLA 5IV2B 1PFCA 3T3ME 3ATBA 3G9VA 3VFUB 4OGXH 5GSVB 3ARDC 4A7GF 2QGCA 1RZFL 2IGLA 1PAZA 4FFYH 4PJEA 4YR6A 4UIMA 3ZY7A 1NFAA 2HH0H 3ARBC 1WTGT 4W9GC 3T8XA 3UTSD 4AVJA 2ZYRA 3K2UL 4HIIB 4NX0A 4A6YL 1OK0A 5KYNA 2EEFA 2JCCF 2WJ7A 2CU9A 1NAMA 4LARH 2RIKA 1DDHB 1C5BL 1IEBB 1CICA 1B0RB 1DVSA 3T65B 1OO2A 3VFTB 3LXAA 4PR5A 5B3SB 1WH0A 1BAGA 4U3SB 4J8RB 3CV5A 4IS6B 3VWJC 4MB3A 4RFEA 2KZKA 3BUTA 4R3SA 3AJ7A 1DBMH 4O4YH 4L05A 1QSVA 5KSVA 4ZUTA 3K2KA 1THAA 2IOIA 4LEXH 6FABH 4G7VH 1WVZA 1Z32X 2BVPA 1R6VA 1O5DT 4FYQA 5CEZE 4I0PC 1A2YA 3KW7A 1QBML 4DGUA 4WFGD 4JG1L 1WBZA 4K3DH 3OPZL 4FN0A 3RTQB 3WJMB 4RA3A 1ND0B 2CRZA 3BCFA 2B8OT 4NS0A 2AXHA 4KK6C 3QFJE 4FMKA 2D4DA 3QEHB 1A9BA 4LP5A 4AMKL 3MZGB 4ZUUB 5AAWC 3A5VA 2ZOLB 4L4JA 3VXMA 3WEBA 4OLEA 1XZ0B 1K5NB 4PGBB 1HC1A 3L3JB 3BWUF 4TKWA 3NA4A 2FVNA 5JXEA 3DRQA 5D6CB 5JQHC 2V9RA 4AOFA 3IDXL 3IT8D 4MAZA 4GRWE 1PD0A 1BAWA 1VADA 2C3GA 3ZOAA 3KPTA 1KIQB 4WGWB 2AHIA 2MHAB 4L23A 3MRFA 1R3HB 4W9EC 3K3QA 1JSYA 2K1MA 1H6EA 3HB3D 2VZ1A 2D7PA 3W2DH 4R84A 4U7SA 4XMZA 4OLUL 5FCSH 1H8NA 3QJFA 3UTQA 5FC9A 1PNDA 2XY2A 2JKSA 3FQXB 5F3HA 1CD1B 1IJ9A 3FOMA 2YPVH 1HXMA 1S3KL 4EI5C 1LJMA 3DSFH 5FWQA 5IR1A 5BXFA 3E38A 1G7QB 4I2XB 2YAMA 2JB5H 4OIBA 4NQUA 1AP2A 5E4AA 5MEOB 5DFWH 2VRAA 1KBBA 1MWAH 1X5AA 3GZQA 4UAHA 3WNPA 4JZNA 4XPBH 5L7XL 3TZVA 5IVXF 2H3KA 5DJYB 4LSPH 2FSDA 3C08L 4DKAA 3OZ9H 2HT4C 3MV01 3AXLB 1NBQA 1I1AD 3RA7H 3LQAC 4OM1L 4P3CL 2OX5A 2G3XA 4NQEE 1ZDSA 4DTGL 1VEOA 2DPKA 3JV4A 1YMMA 2O5NA 2Z3FA 2B9AA 1W91A 1SN5A 1U3HC 2AQTA 4G6JH 5J3HD 5L0QC 3D0AA 2X4UB 2LAGB 3BGFB 3D2UD 3OAUL 2OMXB 3EDEA 2AJXL 3BPOC 3GM8A 3WLWD 5KSUA 4GG6E 3ORJA 3HR5A 4YHIB 1DQJA 4FLQA 4E9TA 2A83A 2CRMA 5DRNA 2CIKA 5TQ2H 4RISL 5AOZA 3O41A 2G9HB 3GSNH 4N2EA 2MCPL 5TDPA 3MBEB 2AVFA 5FM5O 4WFED 3IDIB 4I3RL 1RQ5A 4UQ2B 5E1IA 5CBEA 3PGCB 3RWEA 4XN4A 1C5DA 2C9UA 4QPEA 2NPLX 2WP3T 3TXAA 1KENH 4WGVB 4QGTA 1DQVA 4MX7B 5HVHC 3CZLA 4B27A 2VSMB 3QC5X 1XSIA 2J88L 5DK0A 4ORGB 3D9AL 4UQ3B 1TO4A 4TNEA 4AL8H 2PPFA 4YWGL 5JHLL 1I8LA 3I9PA 4BHUA 4X80L 3GMRB 5IP4A 1QR1B 2P8PB 1TZIB 3CVDA 4IJ3C 2B14A 4L8DA 3RGVD 2BVYA 3RPBA 1BGXH 3SDCA 2MQ0A 4UTBA 5T1KB 2XG5B 3ISYA 1JWUB 5IB2A 4JDVA 1RZJC 1RK7A 2V5SA 3QHZH 4X9HA 3H9SB 1FFOA 5L2KB 1U8QB 5I0VA 4X98A 1QYGH 1TKWA 3MRJB 4MJID 3V5KB 3JTTB 3DX9A 3QDME 1AHWB 3U9PL 2XN9A 1XX9C 4YHLL 1GHFL 2WVVA 4BM7A 3M8OH 2JKJA 4LLAA 1YEHL 2X4SB 2D7TL 4JR9H 4NQSA 4W6XB 4LLYB 4OGZA 5K5YA 5MEQA 1NQBA 2HVJB 5F9JB 4ZXBB 3JVGC 2EVIA 5I8CB 1L9QA 4JN2B 4WI4A 2ZAGA 1USZA 4PU2A 3S3PA 2BW4A 2E9GA 1N5AA 3BE1L 1T89A 1LO4L 4N2KA 5MI0C 1MRCL 2YEQA 4TNFA 4G8AC 4XX1G 4Z3HA 2WLHA 2WIIA 3OQRA 5ANHA 1TITA 1VZHA 1NCUA 1INDL 3QIBC 1SUHA 4PMFA 4HFUH 4LRIA 3ZDXB 5CZVL 4G8IB 5CINH 1M53A 5IFAH 5D1XB 4PJDB 4BIKA 1R0AL 3QDJA 1F4HA 2O5ZH 3HRZC 3FQWA 2C1OA 3K6IA 1BA9A 4H2CA 1XIWC 5JDSB 1IQWL 4K2UL 5I6OA 1UYWL 1V7NL 1FZMA 2EXYD 2ZUVA 3Q2WA 4PRPE 4W70A 3AW5A 5HDBF 4MWFA 1LYQA 2BNUB 5JW3L 3ATAA 1AD9A 1Y0LB 1FZJA 2YARA 2Y7QB 3DX6A 4GW1A 4OZHB 1NAKL 3QA3A 4JRXE 5F2FA 1CTNA 3JTSA 3DYMA 3CPLA 5C0ND 1OB1A 4GEJA 1Y1UA 2OYMA 3V0VA 4CSZA 3V8CA 4FADA 4PRID 1WC7A 2EYSB 3TEYA 4HUCA 3AG1B 4FP8H 1KG0B 1MHEA 5GGTL 3IPBA 3RVUD 4HIJB 1JOIA 4JFZH 5B8CB 3QWNA 4Y5YC 3GHBH 2DYPA 3K1DA 4PBVC 5KS9B 4WRLA 1W0YT 1L9RA 4WJKB 3L4YA 3MCYA 4AK2A 3SDDB 5AW9B 3NZSA 4K7FA 1R17A 2I60H 3C6SA 1JPST 1UM4L 2EDHA 2WQSA 4RAHA 4NSKB 4JREC 4QXGH 3PUCA 1AD0B 3B7UX 4Y4FA 1QX1A 2BVQB 4H88H 4MA3A 1RV6X 5FGCE 5IVZA 4FULA 1YN6B 4H8HA 4X8JB 2PP9A 1YEWA 3QIUC 4X99A 5T3XD 4PIBA 1FGVL 1KB5A 3V0EA 3ZTEA 4P5SA 2ZXWB 3G5ZA 2ZG2A 1JGIA 3ZU8A 2AQ3A 3GI9H 4BFRA 4CSSA 4OI7A 3WO4C 1OAUL 2Q0ZX 4WEEA 2A3TA 2Q3XA 3EO9H 5AW0B 1BD2D 4LCWE 1WBYA 2AEPH 2WLIA 3EYFB 1UGKA 5CXPA 5GJSL 5A16B 3GBML 3MRMB 4IU3B 2DLFH 5DT1H 2O6EA 4JM2F 5E2WL 1VAHA 2X2UA 4G1EB 1AGDB 4DERA 1MXDA 4HISA 3KL5A 4L8SB 4MJJA 5GGRA 3ABGA 1OP3H 1JDDA 5C92A 1EK3A 4KK9D 5SWZD 2WANA 2CXKA 3G04B 2I9LA 2V3DA 3STZA 1AYRA 1J05A 3O9WA 3V7MA 1CO1A 1P7KA 1MUJA 2RQ8A 3VSUA 4C56D 3Q6GH 4ANXA 3KBFA 2GC4C 4Z7UE 1J1XL 4UZGA 3QXTA 5F7NC 3OLIA 3BDXA 2QFRA 1T5XB 2HLAB 3NJMA 4QDGA 3ZHFA 2EIKB 3HI6H 4IDLA 4N8UA 5DUMH 1CF8L 4GKSB 3ZRCC 1CFSA 1G5AA 2EDRA 4PEEA 4XPAL 5ID0B 3P9MB 1ZEAH 1QSFD 5INDA 2WMPB 5F97E 4ZDHA 1I3RB 4K7PH 2FIKB 3PP3H 4KZDL 3MRQA 3CZFB 5EPMB 3MLVH 3SDXE 3KLAA 1C1EH 1AIFB 1OSZB 2L0DA 3NFNB 3HC3H 4X7TB 5E00A 3VWKB 3GZPA 3QFDB 4FZ8L 4P2RA 1BLNB 3T1FA 3RJOA 2VLKA 1BZEA 1M7IB 3NOIA 1NAMH 3O3BB 1LK2B 4QY8B 2J5LC 2WWKT 4FZEH 1F1GA 5C2UB 2QMKA 2P8MB 4PS4H 3LCYA 3RGHA 3T0EC 1TCRB 3IXAA 4DUWA 5D72L 7FABL 2XZAH 5I6XB 2AK4A 4PJFB 2CJUH 4QIRA 3JTBA 3BVTA 1JNNH 4Y2DA 4YMPA 4JFFB 4HFWB 4I89A 4C83B 4GBXB 4QTIH 2PXYA 1GIGH 3MKKA 4KV5E 5I1JL 3DA0A 1B88A 3DHUA 2ADJB 3FUDA 2VAJA 5DU7A 2XBZA 5AYUH 2YKKA 5DA4A 3A3YB 3U36B 2FYYA 3BSZL 2FYVA 3G6JB 5KYWB 1WAPA 3DOSA 1RUAL 3CDYA 5BJTB 1JV5A 1D5XB 3DROB 3WL9A 3T77B 3MNWB 4NIYE 1NCHA 2GJZB 1FZOB 4LL9A 2NNCA 5H4ZA 1N4XL 1QFHA 4NT6A 3ULUC 3OL2A 2QSVA 1T03L 3T0XA 4YBQD 1LVEA 3MCLH 2AANA 2BMKA 4FQIH 2X0VA 1N26A 3VD9A 4TSCL 4AQZA 1CBJA 2C4FU 4FQPA 3D3VD 1I3GL 1QHQA 4X4MA 3SE9H 4LLVB 1SM3H 3MMEB 2H32H 4KMQA 1DUYA 3GXNA 3CSYA 4Y19E 3REWB 4HVBA 1GMEA 3V5HB 4XCNB 4OLWH 4IKJA 1SFHA 1MFEL 2ZUQC 3K1KC 4WWOA 1OP9A 2YSTA 3KYNB 3CNKA 5DHMC 4HEMA 1WBXB 2YD0A 5AKSA 4DVRL 4G71B 1S4IA 2P47B 1BXUA 1QP1A 2UVFA 4EVNA 2Y7OA 3S5LA 3VGEA 5IQ9A 1HH6B 5ECGA 1H5BC 3OHXB 4ZW5A 4LEOB 1MCJA 3S34L 3NABH 3ULUE 4M4RB 3MODL 4PRDB 3STLA 2VZUA 3PV6A 1KIPA 4H8WH 1Z7JA 5EF2A 3S88L 3FO2B 1A8ZA 4GUOA 3ZSTA 1N67A 4U3CA 1L5GB 5LGJB 3CVHB 1XGRA 1QSZA 3TA3B 4KBPA 4KJQC 1D7DA 3OKNA 2ICWB 3BPLC 1QLFA 5CHNB 2FT7A 1AO7E 2QSCL 3RWFA 1WCQA 4N26A 5FYKH 2XWJA 1F6AA 3PGDB 4FQXB 3IMTA 3ROLA 4NO0B 2Q7YA 5IEHA 5J6SA 1F4XL 1PG7X 3LNIA 4TSBL 2ZD0A 1EWHA 1ZCRA 2OL3L 2A9NH 2WO3B 35C8H 5F96L 4DEWA 5HHME 2BVTA 5GGVY 2D9QB 4NZJA 4JM4H 2VSKB 3VXSE 3OKYA 1GGCL 2XFXB 1EO8L 1B2YA 1G5GA 1AGBA 4A66A 2R1WA 4WEBH 5A2CA 5C0GB 5IFJA 3MCKA 3FCBA 4Y7OC 2EZ0D 3TA4D 3VFRB 5CU5A 5FB8B 1X9RA 3P4LA 4FAAB 5BQDA 5IMKB 1BF5A 4OQTA 1D3CA 2JE8A 2BOLA 1BLIA 1HOCB 2GJRA 1XWVA 3CFEA 5HJ3A 4M6OL 5TPWH 2PYFB 3QFJA 3S96A 2CIIB 1U41A 1UD2A 3DTDA 4P4RA 2CBPA 4LEBA 1AXTL 3C09C 2DQJH 4LNRA 2WB1A 5F93C 1P6AB 3ISWA 1CGTA 1R5IB 1L0QA 2QV4A 43C9A 2CDEB 2R39A 3R06B 2XV6B 3T2NL 4AYFA 2ZJSH 5MHSD 5E9AA 1DBKH 1HL8A 2X4NA 3CMOL 3FU3A 1ZA3A 4FQ1L 4UTBH 1BZ7B 2X0WA 4GAFB 4ZODA 2A73B 1WD9A 4DP4X 1WFTA 4JM2D 2OMTA 1RUML 2PMZA 4IMLA 1YQVL 3TIDB 3NCJL 2MTPA 3DWTA 4ZPTB 1FN4A 4FFVC 4MHHI 1KIRB 4HKBB 4NQCB 5DHVH 4WW1B 1SEQL 2HPTA 4I0PA 4WFHD 3TT1L 4FLRA 1M6UA 3BT0A 3QAZB 1KYOJ 1MFCH 2IAAC 4N2HA 1J8KA 4F2ME 2AJUL 4DOHE 5KSBB 4I77L 3MLUL 2C9XA 4DQAA 3BP7B 2FJFB 4NJAL 1NSNH 4U1SA 3MJ9L 1F11A 3OM3B 5KAQF 5AAWA 3FOLA 4Z3GA 1ZHLA 1CCZA 1MFAL 1IILE 1GCYA 3BO8B 3MRKB 3ML8A 1GGBH 1F3DJ 3C5XA 2HFFB 4GSQA 3GTTA 4FQCH 4LU5H 3FTXA 4QAMB 1X5JA 1IM9B 5HGBA 5JPNB 4QEGA 2ZQKA 4A63A 4Q0XH 3QG7H 2I7SA 4FQQB 4DH2A 4ZFOA 1GMIA 4NQEA 4PRHB 3PCYA 1KGCE 4MAUH 3U0WH 4NCDA 1A4KA 1JGUH 1VPOL 2X0UA 3FB7B 3QQ3A 5BZWB 4LIQH 4M6MH 5TK2A 1OANA 4HJGA 2F2HA 1I4FA 3L5WB 3N42B 4FMVA 4X8GA 3GNMH 1KTJA 4GG6A 3EOTH 3EO1B 2V37A 3CN4A 5I2IA 2OJZH 3IKCB 3PJNA 1IBYA 3E0GA 5HYSG 2DN7A 4PHZA 4PY8J 4LPTA 2YC1A 4Y2NA 3WFHB 2R8SH 2I07B 4LLMB 1IE4A 3NRPA 3VRIB 5DJ2B 3B83A 1SJHB 5C0CE 4MJ6A 1H6TA 1JZGA 4QHNA 4XOEA 2XWZA 4YQXH 2G30A 1EHXA 4MNGB 2MPAL 3VFWA 1TPXB 3ARFB 1JFQH 4PJ9C 5CILH 2XACC 4BSVA 1NEUA 1X7QB 4GW5B 2JKNA 4PS3A 5ESVB 4M7LL 4CW1A 1CTOA 2DRUA 4ZTPL 3MXWH 2EADA 1E6JH 4POUB 3OAYK 4J4PA 3K4ZA 4WW2C 5IQNA 1BAFH 4CC1A 5LNDA 1UA6H 2ZX7A 4GUPA 1A6ZB 5HPMB 1KN2L 3QJSB 5FOBB 5LCVA 2DWEA 2GT9B 4WO4B 2IOOA 4JVUA 3BZEA 2Z7UA 4LSQH 1U3HA 4IBTA 2JELH 2DIBA 3I3EA 3L2MA 4HC1L 1OM3H 2VMDA 3UH8A 5JOFB 1F58L 1MY7A 5I74B 4DQOH 1KB5H 5ADOH 4KDTA 5KBDA 4YX2L 3C9NA 1WA0X 2AJZB 3RVVD 1OAQH 2QGEA 4JQIL 2DDQL 3GGWA 1UH4A 3RY6C 1GPOH 3DV6B 3LNGA 5JHMA 1XGPB 1M7DA 2FBJL 1BEYL 2ZP0T 2VXVH 1KFAH 2DLTA 1QEWB 5L8JB 5EUKA 1ZLSH 2Y2TA 1NCJA 5BPPA 1EZLA 1U8CA 2DIEA 4S2SB 5JHDB 4E5XB 5A43C 1NCCL 1NFDE 3UYOD 1PKQE 1O6TA 3VCLB 1OCOB 4KDWA 4BZ2A 4R4FL 2F8XC 4XHJC 1RK0B 4FABL 2BNQD 2MOQA 1NH6A 3MRIB 4EXKA 1UXLA 4JRWA 3VW3H 5J6HB 4Q7DA 1V5JA 1FZKA 2R7EA 3LY6A 1FL5B 4RGMC 3ASWA 3WIIH 3ET9F 1GS7A 4LCYA 4PTTB 1JK8A 3LZLA 4G6MH 2AV7B 4P2QD 1RD6A 1R3KB 4XAWL 1DEDA 5CWSB 4NFBA 2CBQA 4JKKA 4PI0A 4AXWB 5HDQL 5L6YL 2VM9A 3CX5K 3P9LA 3RWIB 1H3VA 3KNBA 2A1WL 3L08A 1AG6A 2GG1A 4PV8B 5K93A 4CSTA 4D8PA 4ZMTA 4RX4D 1FO0L 2Z91A 4E41D 2VMCA 3NZHL 1HHJA 1SMAA 3LPWA 3HAEB 3LKSA 2VLJB 4KTGA 1P7HL 5F0MB 4JB9L 1YEIL 1QQDA 2HLFC 5DXWA 1C16A 4UAOB 4PRPA 1WUZA 2NNXA 2OR8A 3MLRL 4IJ3B 1OF2A 4JRXA 4IRSD 4LCUB 1NGYA 5JW4N 3P40A 3N1QC 2HKFL 1MCCA 1QATA 3E2HC 4P23C 2R69A 1L9MA 1DJYA 1AFVL 2A4CA 1Q9LA 1HXYA 3PWNA 4LCVA 1A7OH 2R2CA 3O11A 1YYLH 1PLGH 1YUHA 4M7ZC 1HNYA 3M46A 2OKMA 3UAFA 4ZPVA 4G5ZL 4EN3B 5IHLB 2J6WA 5EZLB 5F9OL 1BFTA 2PABA 4G5AA 4JFHE 4O9HH 4D8OA 4MZIA 5D1QD 3TT3H 3C6LB 1P4BL 1HDMA 1T04A 2AABH 2YBRB 3F85A 1HIML 2G0LA 4YJZL 4WKZB 4JFVA 3HC4L 1G7MB 2CK0H 1CXFA 4U1LA 4LSSL 5A6MA 1M9WA 5T33L 3VO0A 5MI0B 2VXSH 3MACH 3HZMB 4QXUH 3ABMB 2ZX5A 1E5ZA 3TVMB 3ZGIA 2OZ4A 3SY0A 3A23A 1EO5A 5ADPL 3LH9A 3GSUA 3MR9A 3S36L 3LKOB 5JOPE 1TETH 3F00A 2VXUL 2KZWA 4HF5H 5E6IB 5FECA 4CVXA 1I9EA 3T9WA 1JXJA 5M7QA 4YC2C 1MRDH 4X6BA 3MPCA 4HZLB 2ICEC 1OTTC 4YHOL 3KGUA 4IGBB 4LCWA 4J3OF 5AL0A 3O3AB 3WN5B 3J8F7 3SQRA 2WLJA 1HILB 5BV7H 4YDVB 2DQIL 2WUCL 3SOBL 5EEXA 1JXFA 2EE2A 3GM0A 4OCXH 3BZFB 1BJ1J 1EHKB 4MMYB 2NW3A 1F8TL 3I9GL 4O02A 4HUKB 1OD9A 4HUUB 1ITCA 2F74A 4NEHB 1WUNT 4QKXB 4Z7UA 5FYJU 4XVUD 2YN5A 5A1AA 1X7TA 2NY2D 2JI3A 3H4FA 4PV9A 3CFJB 5EA0L 3LIZH 3T2LA 1S46A 1G4MA 3DO3A 1KELL 5ESAB 3V0GA 3Q2NA 4PLKD 3QIUA 3ARGC 3HE6D 4FKKA 5F8QC 4LT7A 2X70A 5E0QA 3CC5B 3P77A 5D7JB 4Z7NB 4BELD 3MRCA 3NSXA 2BP5M 4HLJA 2Q7NA 1W9XA 3TL5A 4APQC 2GTQA 1KEGL 1J86A 3UBHA 3FZUC 2PP8A 5IHUL 3NCYS 4PJXB 5E9DD 3RX5A 4JREB 3SDXA 3VSQA 1KTCA 3ECUA 3PAUA 1IM3D 5DSCB 3BVXA 2EDOA 1HQRA 2CJTA 5IHZA 2WLNA 1KJ2B 5I8KH 2HT2D 1A9EB 4UM8A 4WJ5B 5D2NB 4DP6X 3SSGA 1PW3A 4GKNB 5AW2B 5JLZA 2MNWA 3AZUA 2HX9A 5F7HA 3PWPD 3UTZB 2H9GB 4DEPC 1ETJA 5TGBA 5IESL 4LHUB 3SQBB 3DI2B 2LGNA 4GEIA 1OCRB 1KY6A 2VDOH 4I8DA 4GI9A 3VFSA 5DVPA 1FAIL 5FA4B 4YFEA 1I7RA 1DL7H 2JB6A 4E36A 1R3LA 1UJ3B 3FFCD 3QHFH 4HT1L 3BGMA 2F08A 2F54D 4E2OA 3KJ6H 1WEJL 4PH8A 3VXQA 4YLBA 5CEZH 5HYSB 3ZGHA 4AGLA 4M62H 4P2AA 2NY3D 3MBWB 4MZ3A 2DLHA 4JCWA 5T5FA 3NP3A 1TZHA 4OQTH 4JGUA 2OZNA 5E8EA 5TE7L 2Z8RA 1JCKA 3NFPB 1OW0A 3CSPA 2IGFL 3RUGB 2NXZD 3Q06A 4N9GB 4R8WL 3ZDYB 2ZAIA 2WO2B 3QJVB 4MDJB 2D3VA 5DMIH 4GAYA 4AYBA 3T6QC 3VD1A 5KBNC 3N41F 1MCEA 4XWGL 5HGAB 2BC4A 3V8OA 2XIDA 5IB3B 4I4WA 4LLQB 4HKJB 3LN4A 3RURA 2EDXA 3EGXB 5E6UB 5IG7B 3FU0A 4HOZA 3CXDL 1D9KC 1F42A 4WV1A 1SOKA 2WLZA 4P0DA 1JERA 5AOMA 4GRWH 3VNZA 3HE7D 3BAKA 3T8MA 3GMQB 3RKDC 2GPZA 3RL2A 1MLBB 4FNPA 5HYJD 4Y19A 4KXBA 2WOYA 3F6JA 5BS0D 2Q76A 3AUWB 3FB5A 2CDFA 2PNDA 3D2TA 4Z7QF 5ABZA 3SGJC 1WSST 4GP5B 4AEHH 3Q2VA 3QQXA 1Q72L 4RGOL 4Y1TA 4MJ5A 3H2QA 3KWUA 4GRLD 5E2VH 3D39E 2XA8H 5HYIA 1T6BX 3NCXA 5EUOB 2E9IA 3QRFM 4Y2OB 4MD4B 5KYXB 5JA9A 5LDSA 1JPEA 2KERA 3T0EB 3AQDA 4OCRL 4P99A 3L3KA 3LSOB 4I1RA 4KQ0A 4K15A 4F8LA 1HHIA 3QZNA 4OCWH 4YE4L 3VH8B 1BQHG 1DVQA 4AIZB 2X7LB 3NACH 2XNAB 2P44B 4IU2B 5C09E 5SWSD 3TASA 3D09A 4LVNC 1UTDA 4RVBA 1OOWA 3F7RA 3LEYH 1ONQA 3RZCA 1T1YB 3NJVA 2X09A 1UACH 1ZHBB 3H9SE 4NZRL 1RPUA 4IBQA 1IC4H 4PGZA 5L2KE 1AO7A 4HIQA 2DWDA 3WHE1 4KNTA 1KPUA 1YNTF 1A7NL 2X6MA 5DK3A 1N10A 3AB0C 3KPNA 4L3CA 2G60H 3FUJA 4Y5XC 4AG4L 4GRMA 3C12A 1NCTA 3GZOA 5F1NA 4UQCA 1PZBA 4MXVF 3GSQA 4P9MH 4PWGA 4XVJL 2NSXA 1KWKA 5DEGA 4LQFL 3VXSA 2APBA 5FO8B 2ICWJ 4NBYB 4MB5A 3T0AA 3HG2A 2BFVH 4L48A 1G4RA 2ZZUT 1LD9A 1JPFB 1I53A 3APCA 2A38A 3PY9A 4QCIA 1GVIA 4AY0A 5LQBL 4LASL 3KLHC 4NI3A 4NZUH 3ZKXC 1YMHB 2Q1EA 3ZDXE 1ADQA 3Q0HA 4GO9A 3LQAH 2GI7A 2X87A 1AZUA 3HPLB 5BRZD 3S7GA 4OZIF 2OSYA 1TDQA 3AUVA 3DKHA 1YYML 5LCVH 1ZWIA 3KGSA 3VNYA 3QC6X 3MXVH 1H5BB 5FW8A 4HBCL 2LVEA 1S5IH 3IPEA 5FO9A 5DS8B 4CGUB 5E2TH 2P45B 1S7VB 1RUKH 3K6DA 3PRZA 1S9YB 4J3OD 2H1XA 3BHBA 1EDHA 3M1CA 4PCTA 5E8PA 1KT2A 4OZHE 3MAWA 3F12A 3RYMA 4NO3A 4EIGB 4BKLA 4RMVA 4BCYA 3A67L 3BEWB 4HHAA 4WJG3 1JPGA 1EMTH 1MFVA 1NCWL 3FO0L 3QIWB 4LF3A 4FFTA 3R0NA 4NO2B 2ORBH 5E4EB 1PVHA 3EYSL 1HX0A 4KROB 3TBWB 2ROYA 3H9YA 3QUXC 1BSIA 1HVXA 3GSWB 1H19A 4RFNB 1M2VA 1QI4A 4F2MA 3DX8B 3F01A 3Q2CA 3ZE2F 2OYPA 3RAJL 3PNWB 5INCA 2N56A 4N28A 5IMOA 1SJEA 3QZWB 5F7DB 2W91A 3GIZL 4M6AA 4RBPK 4BH7B 1E7UA 4HK3J 4LDEB 1JVOA 4S1RL 4RMUA 2JIXA 5C3TA 4AUJA 2HRLA 3AVEA 1E4KC 1Z2KA 1BCIA 2ZSWB 5FFLA 3WFEH 1ZKAA 5GSRA 4OGYH 4A2HA 4AWJC 2X9ZA 4V11A 1BP3B 1NC4A 4J2XA 1LE5A 3L3OC 5KWYC 5KN5B 4KI5F 3I6GA 3KJ4B 3VRLE 1RZJH 2DI7A 2ZUUA 1JRHL 4D0BA 2R2BA 5GGQL 3QHTC 4NM4H 1A6WH 5ENWB 4PRNB 3CIQA 5AENA 4R2GC 3QUYD 2XWBB 1MVUA 1X9LA 3HI5L 3EOAB 4EDXA 4ODBD 1G9ML 3AWEA 4K94L 1HJCA 5I6NA 1UFGA 4HDIB 2VITA 4Z7WA 5I1KH 3NCYP 2XVKA 1ICTA 3OSVA 2MFNA 3VFPA 2AXGB 5D5ME 5I1IH 4WY7L 5JIPA 5IIEB 2A74C 5C0CA 1ACZA 1LM8V 1DVFC 3DMMB 2OW6A 2R69H 3QUZA 4P46D 1QZ1A 3DDGA 1UVQA 1B4TA 3RWGA 3UTTB 2UWEF 4LB8A 2O26U 5ACZB 1F97A 3VDBA 3PHOB 4BD4A 1KXQE 4HD9A 4MTMA 1T2QH 3TN0B 4UOW1 1KJVB 2OMZB 5DD6B 1KCUL 1EGJL 5TD4A 1LQBC 4M8VA 5D7IB 3V0JA 2OTUB 4JFPA 1JIBA 3DJRA 4G6FD 4H5SB 2CR6A 1XO8A 1IAOA 4MXQD 1SNRA 3QPQC 3IJ7A 1IIKA 3BDYL 4FJYA 5EIVA 4A2LA 5C1MB 4FG2A 2XPZA 3A6OA 5TQ0L 4ZTOL 1XD1A 3J27A 4UQ9A 1WA1X 1Z9LA 5H37G 3WG7B 2OZ4H 4KK8C 1GGIL 2D03L 4U6HA 5I16B 3PWUA 3QVAA 3WS6A 4F57L 3BZ5A 4NN7B 3QNXA 4H8QA 4JO1L 1T66D 2B1HH 3PIQA 1QSED 3VTAA 2GEQA 2VR4A 1OSPH 1OP5H 5EZJB 5J12B 3QDGB 2W9DH 3OKEB 4JFSA 5F7FA 1XF5B 3BAJA 2ZXBA 5CIPA 4PJ9A 1I8MB 3RIAF 3E6HB 4UV7H 3E9TA 1LE9B 5FF6A 4JFFE 1HZLA 4Q89A 5FLUA 1NFDA 3DV4B 1PKQA 1K3IA 5E08L 4NDMA 4ZMWA 3HZVA 2N7BA 3WEMA 3HZYB 3OKOB 4OM0H 4WW2A 1N59B 1OVZA 4PJEF 2GFBB 5I19L 2CRIA 2VW7A 4W4OC 4Y0GA 2EE0A 1MELA 2XG4A 4O02H 5K33A 2PW1A 3O4LB 3BKML 1UZ8A 4ZUWB 2IWFA 4NWUH 4ZZFA 3HJEA 2AQPA 3P3YA 1FNEA 3NP4A 5C2BL 5EOCH 4L5FE 2WWMC 2COQA 3IDYC 2VH5H 1J0IA 5G5DA 3MLXL 3VGFA 1CG9B 3FU9A 1DFXA 1A6TA 1U8KB 3EOBB 1PZ5B 4XE5B 4TNVK 5EOQL 3Q6FA 5K39A 3MA9L 5EC2B 5C0EB 1MRFL 2V5TA 3PWVA 4PGDB 5FA3B 2C26A 3AITA 3O2DA 4IBLT 4H1LA 1WWWX 4X2UA 5I18H 3FW6A 5EZPA 2V17L 3TBYB 1ZHKA 3MV9D 4L4VE 2R1XA 1QFWH 3F58L 4M93C 5I1GL 1XEDA 4UTAA 4P48A 2GTZA 4FQ2L 3U79A 2X40A 3PG2A 1WISA 3MUGA 1XR8B 4X5PA 3KWVA 3NSJA 3ZYIA 4S1DD 2X4TA 1ZT4A 5FLVA 1ZANL 3MJWA 4TRPL 4GQ9L 4XO3A 3D1MC 5AD0B 2F53B 1N64L 4X7FC 4XVSH 4XGZA 3MX0A 4G2AA 1CFMA 2PCPA 3NAAL 1HE8A 3B4NA 4PJGE 5IV2A 2V0AA 1QR4A 3GKZA 4PCSA 3PS6A 3VFUA 4HKZB 5HYQB 5KVFL 3L9BA 5GSVA 2VLME 1GZPB 4I18C 2VUOA 4ETQA 4A6YB 4DK6A 5TTRA 1CFTA 1WAAE 5KSAC 1ZVHA 4N6RB 3P3UA 1FYTD 1FJ1A 3QCTL 1KLFA 4HIIA 2VNCA 1KNOB 5KVDH 1R3JA 2G2NA 2R27A 3CVIH 4HMCA 1NA8A 1WIOA 1DDHA 4M48L 3U2SB 1FH5H 1IEBA 3FCSB 1B0RA 4I0CC 4P5TB 3VFTA 1VEPA 2Y1YA 3AY4C 3BUDA 1RZGB 4U3SA 4F24A 4D7PA 3PE9A 2QJDA 4P23A 3AFLA 2QT6A 2MNUA 4I3SH 2CUIA 4YK4C 3CQQA 2ED8A 5CJ8A 1ID5I 2WLKA 3B2VL 4BXVA 3RFZB 5HSFA 1Z0NA 1UB5A 4R7NB 2AZUA 1AKJB 2AW2A 1OZUA 4AKOA 3A4EA 2O61B 4K8RC 4X6FB 1OTSD 1R9FA 1VGEL 1ND0A 2BNRD 1RZKC 4PJ7E 3WEAA 1VFBB 2QZQA 1J0ZA 4HEPA 3UYPB 3BIKA 4NC2B 3KXFE 5ID1A 4MMXB 3U4BH 4HIXL 4OLYL 2ZOLA 2BFGA 4XB3A 4HPYH 2E7LC 3DO7A 2Z8VC 3BPNB 3P0VL 1XZ0A 2J8HA 4LSTL 4WI2A 4PGBA 1NOFA 1A4CA 3L3JA 4LPXA 2A9DA 3CIAA 3ULUH 2V9UA 4QHPA 3V0AC 1PYWA 2IH1B 3A4FA 3UAJD 3FHEA 3S3SA 1J11A 1IBDA 2CGYA 1QABA 5D2LF 3V6ZA 5GZOA 2R2EA 4YLCA 3WTYA 2ODHA 5C07D 1HK6A 1PGRB 1TJGL 4F7MB 3UROR 2F19L 1KIQA 3NN8B 1EEQA 4HPOH 3W0WD 2DKSA 4XC1L 2BRRH 3QI9B 3RHWF 3SIKA 4OFKA 4WAFA 1RJYB 4F80A 5JR1L 1TJXA 2PCXA 4AH2B 5JORB 3SKOA 3D34A 3ASNB 4UT9L 5HHXL 3I9IA 4LOFA 5DJXB 3FQXA 4L1DA 4PP1D 5FHAH 1S7RA 2NR6A 3NEEA 5DMYA 1CD1A 1DEEB 2FX7H 1MLCA 1B0IA 2FH8A 3WSQL 3BUPA 3LHAA 4Y1AD 1M6OB 3LEVH 1EUTA 4PWIA 5D93B 1TZOA 5D6DC 5GRJH 3IE4A 3QCVL 3VU2A 3FFOA 4KRNA 3ZT6A 3FK3A 4GY4A 5TK4A 1QBBA 3C75A 2YA2A 3ZE1E 1LEGB 4PRHE 2HLEB 1X5FA 3OMZA 1YEKH 4GFXA 4LMQI 5JHAA 3C5JB 3B56A 3W39A 5J06A 3V0IA 1K4CB 4FFZA 4Q4EA 5EO1A 3ARGB 3LKRB 4ZD3L 2F58L 4HCFA 3V0FA 1MHHB 4PB0H 1NBVH 2GHWB 5HY9A 2XV2A 4U1GB 3TP4A 2YXWA 4YHIA 5JIIA 4F7CA 3OF6A 1T21B 2D3LA 4AENB 3P2DA 1AC0A 4ZS6D 4J39A 1L0XA 2IO5A 5HI3D 2X4PA 3EZ8A 3HB3C 1YEFH 3OAZH 4ZAKC 5LHDA 3OQ3B 2F1AA 2OJ1A 4UQ2A 1VJSA 1SXCA 3PGCA 4F58L 2IV9A 3QQ4B 3WEXB 4JFDE 1DQDL 4MX7A 3HEIB 3W5MA 1N6QH 1IBGL 4YXKH 1LNUA 5I73C 1YNKH 1GJUA 2B3IA 3L3GA 1CICD 4UQ3A 4PD4J 4N3TA 4KJYB 1BPVA 1JZDC 1AQ8A 2EDEA 2K7PA 5CAYB 1RULL 2AGJH 5ISZB 4PFEA 3QJUB 1XL4A 3EUDA 5E6ZA 1N18A 5C09A 1TZIA 5EBMB 4MBRA 4X0KB 1I1AC 4NUPA 2O6FA 3BP4A 3SO3B 2AMGA 3QUKB 1MIEH 1JWUA 1BDYA 1PKOA 2R23A 4TTGA 2XRAL 3WNJA 1FHNA 3DTXB 4FRWA 4PWHA 3H9SA 1JXKA 1MQKL 1CFVH 5L2KA 5LG1A 5J3HC 3KYKL 1AGFA 3V5KA 3S4SB 1G1YA 5I17B 3WLWC 1FYHB 2V5RA 4XNXL 4AE1A 2V8MA 2CG9X 3NIFF 2X4SA 3PP3K 4PUBL 4ONGH 2VZOA 5I26A 4XP6H 5F9JA 3VXMD 2ATPB 4ZXBA 2FEEI 3CE1A 2JH2A 2OCCB 1D9KB 3GK8L 1BZ9A 4JN2A 4JZJB 43CAA 1MAML 3T0DA 3JWNC 2BIOA 2YMXH 3PAYA 4AYEC 5JXED 3DUSB 5EU5B 1KB9K 4BDVA 2QHRH 1IMHC 1C12B 3U7YH 1IAIH 4UQDA 1L7TL 2AQSA 3H3PL 2E7BA 4CGTA 5CCHE 3AQZA 3CGTA 1FQ9C 4F7KA 1AS8A 3OZKA 4G8GB 4UYPA 3W1ZA 3AQXA 4GAAA 2NNAB 4FEIA 3MYJB 2VLRB 3SKMB 1D6EB 4MZ2A 1CL7H 4B3VA 3IRZA 3GRWA 3EYOA 4UDTB 2NLJB 1JGVH 3RGVC 3V7AE 4YPGB 3UJIH 5IJBC 4G7SB 3BPCA 4XPTL 4Y5XA 1WZAA 4RFOL 5CJOL 2IPKB 2XQ0A 1CT8A 3PDOA 2K8QA 2VXQH 3BP6B 4KHTH 4NQXB 4OZHA 4B9GA 2JFCA 4WZ9A 3UZVA 4FYSA 1YHPA 1KBWA 2J55A 2CK2A 5DJ6B 3MDJA 3BT2H 1P1ZA 2Q6WB 3JWNE 4WFEE 5TE4L 4XMXA 2X2IA 3LQMA 3FQTB 3IBOA 3GHEL 3CCHB 2EYSA 4JFEE 3UO1H 3VXRB 3VXUB 4ZFGL 1KG0A 3KLLA 2N1TE 4HA1A 4CUCA 5CIPH 5B8CA 3QBTB 1BQLH 3DPBB 1SOQA 5D1ZI 1CDCA 1UWGH 1YMMD 5LXGL 4L1TA 4PGEB 5D4JA 1E9PB 4WI0B 2WTOA 1TFPA 1XXFC 3L7EB 3A6BH 3SDDA 3THMH 2WM0A 1NPJA 3UJJH 3AACA 1I7ZB 2QMJA 4NSKA 3R1GH 1KXVC 4TPRH 1OAYL 3TO2B 1VHPA 4DGIL 3AXHA 2QQLH 2BVQA 2J12B 3LNDA 1ZJAA 1YN6A 3X1BA 4BSWA 4EUPG 4YSEA 1N2RB 5DFAA 5A2LH 1ORSB 2KQMA 3AGVA 3EJPA 5A7EA 3MLZL 3UBXI 2C5DC 2XOTA 1GL4B 2HUEA 2Y36L 1I9RH 4XPFH 1C08B 1DVUA 1KY7A 3WENA 2VKWA 4LVOB 1KLUA 1N12A 5B38B 4I9WD 4J3BA 4MBOA 3O2DH 3EYFA 3QUXA 4N2MA 1NLDH 4PSRA 5EIIG 5A16A 3MRMA 3DVNA 2X4QB 4X6CE 2YPKB 2P80A 4G1EA 3H8NA 4PGCB 4FFWD 4QRPB 5HGDA 3ARSA 2HG5B 1MEXH 1ULVA 3PABA 1S7UB 1IB5A 1RUQL 4UTAH 4ZUVB 2EUZA 4OJEH 4YDKH 2HYMA 5HVFB 4WIQA 3N85L 3RVUC 2HFEA 4A2DA 5E9NA 1KJ3H 1MCQA 3CVCA 3ZBMA 4ONFH 1E4KA 1TFHA 2V2WA 4N0YH 5CSZB 4BFOA 4GT0A 1J8HB 1KXQA 4AEFA 1O7SA 2HLAA 2XI9A 3FCTB 1OLLA 3BWUC 4Z7NE 5J0BA 2XN9D 3W9EB 5GRZA 5F88B 2M26A 3U9WA 2DTMH 4O58L 4W9FC 5BRPA 2EAEA 4P4KB 1HCZA 4EQ2A 1DSYA 2JQAA 1DLHB 1HAWA 1I3RA 4DWHA 2FIKA 3IFNH 3GMOA 4PJXE 5EPMA 5BOJA 2I5YL 4MXWL 1I9JH 1XR9B 1HT6A 3MKGA 5DLML 2JSFA 3VD4A 3O3BA 3B3BA 5EBWB 1MFMA 3U6RA 1HINL 1F4WL 4GSDH 2CLZA 4XMVA 5FK9A 5B21A 1BQRA 5JW4Q 3SKJH 4R7DB 2VC2L 3O3EA 2DS4A 4JRYB 1IUZA 4ZX3A 1CIUA 3CHSA 3NEXA 2QADB 3V6FB 3D18B 2R4RH 2ZOKB 3QG6B 3ULAB 2D7QA 3FUKA 3QDJD 2VUKA 4JFFA 4KKAC 4P59H 2DQ6A 3T3MF 1CZ8L 1PZCA 2EXTA 4KK9C 5FHBL 3TO4A 5JXAL 1S7SB 3V0DA 1CK0H 1TCMA 2BIQA 3U36A 3L8QA 4LOEA 2P5WB 4GPVA 5IBTH 3WFCH 2MQ3A 3VU1A 1L0YA 4OGXL 3G6JA 5K1VA 5KYWA 2CUHA 3O45B 3O3DB 3RBSA 2WLLB 1DVFB 3FQ2A 4MCYB 5HGHB 4JGNA 3II1A 3MLSL 5BJTA 1K85A 1D5XA 5B4MD 2UZYB 4JY5L 5ILTL 4ELKB 4LCCC 4BUGA 1M42A 3MLYH 3T2OA 3V0HA 2VDQH 4JHZA 5AYTA 3BUQA 4X9IA 4DVBB 3G5XB 4N1CA 3MRHA 4LAQH 2KT6A 4L3EE 1BD2E 4FKEA 3CUPA 5EFIB 3IETB 4KKCD 2PPDA 2CHWA 4AKPA 3LHPL 4OQ1A 4V2CB 1UH3A 4DN4H 2OK0L 1VF5C 1E50A 4CRPA 1S7QB 4L4VA 3ML9A 3TFBA 1VACB 2FD6L 3OG4B 3REWA 2VABB 1ZMYA 4XCNA 2V3EA 4Y4FD 5DJAB 1T7WA 2GTWB 1F3DH 1EFXB 3WXVH 3KYNA 3TPKA 2K9FB 3PF2A 4YHYB 1E8XA 3RX7A 1WBXA 2W1NA 3L45A 4W4OA 1PX8A 1VENA 4TQEH 1UUSA 1HH6A 1CD8A 1TQCC 2J8UF 3B2UC 1PFOA 4LEOA 4PJGA 3EBGA 4XBEL 4RWYL 4Z3TA 5GGVH 1SY6L 4M4RA 4PRDA 4NHCH 4PJAF 1PG7W 5I15L 5GS0L 2ZCKH 2KQNA 3S8GB 3NTCH 4GRWF 1WAAA 1L5GA 2HCZX 3CVHA 4CDHA 4ONOA 4FQHB 5F1KC