4O00A

Crystal structure of the titin a-band domain a3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
SERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Titin
publication title Crystal structure of the Titin A-band domain A3
rcsb
source organism Homo sapiens
total genus 18
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o00A01
4OUOA 1DQQB 2BDNH 1EAPA 3O3EB 4HXBH 3DJ9A 5HI4D 3VFNA 1FLRL 3ALWA 3MJ6A 3BI9X 2ZUUA 4JPVL 1VHPA 1KV3A 4HLJA 4KZDH 3BYTA 4AENB 1AI1L 2VWEC 4OCXH 3BRDA 1NBZB 5IQ9B 1ED3B 4OBSA 2FEEL 3EYSL 4LFHD 4TUJA 3FOLA 4JJ5A 2PXYC 3HNVH 2NY7H 3LSOA 3ARDA 1XF2B 1FAIH 4OF8A 3B9KB 1XIWA 3PWJA 3JV6A 1NGXA 5ESVB 4YXKL 3MRFB 3UMTA 1EUTA 2VXUL 3FFDB 3LCYA 3LB6C 2E5EA 3C5ZC 3GBNL 4NFDA 5I0ZA 3CDFA 4TUOB 1U8IB 1CDBA 4DQOH 1WEJH 3BPCB 5IMKB 3I85A 1CE1L 4IIQC 5DS8B 4CMMA 5FB8A 4U33A 2E7LC 5SX5K 2HT4C 3CMOL 2ESVD 4APQB 1OF2A 3D39E 3RGVA 1P1ZA 4N0YL 5C0ND 4LU5H 1WBXB 5H35B 5LG1A 3ABZA 5BS0D 3G9VA 4ALAH 5C8JA 3RPKA 1MFEL 5I1DB 1TIUA 1T2QH 2BVOA 4JFED 4L4TB 1I1YB 4QXGL 4MQSB 5J89A 1AKJD 4PGBA 4R7NA 1HK6A 3ZKMC 2PO6B 2BVPA 4PR5B 5AEAA 4HKXB 4JZJB 2Q76B 4Z7VB 3MPCA 4WHDA 5GZNC 1MFDH 4G7VH 1BVLB 4GG6E 1R0AL 1MHEB 4PRID 4O5LL 3CK0L 4U05A 1LK2A 5B21A 1HOCB 1UXSB 4QRQA 1ZHLB 1B0WA 2NLJB 3GSOA 3RZCB 3ZYOA 5D5MF 4P9ML 3Q5TA 1RJLA 5DF0A 5E8OB 4JM4H 4X8JB 3G9AB 3DXAB 3O3BA 5INDA 3GO1L 3LN9A 4RWHA 2EDYA 4JZOA 3SDCD 3IETA 4QRUB 4OIIL 1QFWL 2AJZA 5B39A 1N7MH 4PFEA 2X4NA 4ZUVA 3NVQA 4Y1AD 4Q6IC 3EOTL 1T21A 4ONGH 5CP7B 2CDEA 2CKBA 1J11A 3X13A 4X0KB 5K59E 3O2DL 2OP4H 1JYNA 2IANE 1DEDA 3TYFB 3V6FB 3HAEB 4YFLI 4J1UA 5ACLA 1JHLH 2ADIA 1DVFA 2AV7A 1FZKB 5H2BB 5GGRA 1I1FB 3MXVL 5B8CC 5BS0A 4J3OC 3S96B 3V0AC 3P4OA 1QNZL 1B2WL 1KCKA 5FYLL 4M1DH 1ZLUH 4CNIB 1LQSR 4HIJB 5SWSA 3U7YL 1B4RA 5FUCC 1OP9A 3OXRA 3RWEB 1Z9MA 3BQUC 2AXJA 1W8OA 4NO0D 3O41A 4LGSB 1GC1C 4PRIA 4X7EC 1ACYL 3F7RA 2J8UA 4EUPA 2GITA 1T1ZB 4CJ1A 5DD1H 3DSFL 3SBWA 3VGDA 1MELA 1MRCL 5L2JA 1YEGH 3MNVB 3BZDA 4P5TC 1IM3A 1K8DB 1EBAA 3VXUD 4ONOA 3DX8A 3WIHA 4EXPX 4GAFB 3GMPA 2BZDA 3TPUB 4HCRL 1YNKL 5I30L 5C71A 3MRRB 1X44A 4YEFA 1NMCC 5ADOL 5IROC 4P2QD 5MI0B 3HZVA 5SWZE 3JUYA 3U46B 2M2DA 2FZ3B 4X6FB 4LP4A 3A67L 2VZVA 3D87B 4MD4B 2NW2B 3UJJL 4JM2A 2FL5B 2QADC 1A7PH 4FXGB 3PGFL 4PJ9D 2HFGL 1LDPL 3MLTA 5E08L 5H94A 1A7NL 1F8TL 3PV6A 1K8IA 4G8GB 3JWDH 4NZUH 3CFCL 5FM5O 4OCMC 5GIRB 4DEPC 4KI1A 4U6TA 3WUWA 5ALCH 1S3KL 4L4TE 3KDMB 4L3CB 3EDKA 4DZ8A 3GB7A 3X11B 2C9AA 3MCLH 1IJ9A 4H5SA 5I2IB 3UAJC 1FH5H 4Z7VE 1AQKH 4XCFH 3RX5A 1H3PL 3FO1B 1CIUA 3QIBB 5DD0L 3CFKA 4XBEL 3H7BA 4NRYB 1CD9B 2ICWB 2UYLB 3OL2A 5IEHA 5I18L 1UCBL 5C0GB 3B5HA 3PNWA 5EOTA 3MR9A 4QHNB 4UILH 1HQ4A 2PR4H 4WHYG 3BP6B 3IKCA 2ARJQ 3C9NB 2R2BA 3G5XA 1DQJB 4V1DD 5F44A 3T4AA 1OCWL 3FONB 4G5ZH 3BUYA 4NO0A 1ZGLP 3DHJA 4HFWB 2J6EH 1W0WB 2YHGA 1H3TA 1MAKA 3RWDB 3S4SB 3UC0L 3AMKA 4YWGL 1LP9A 2IPUK 4NHCL 1QFUL 4F8TA 4Y19D 3VXUA 3UZQA 4WO4B 1PFCA 3U79A 3ULVH 3BESR 4N0CC 3EDFA 4NQXA 5FHAH 5FAAA 5HPMB 4NUJB 2CJUH 4FFVD 1HE7A 2X42A 4OD3H 4BH7A 3BAEH 5DJXA 3OKEB 5DJCA 1ERNA 1N2RA 5DJZA 1DN0B 4K8RC 3CC5A 1QSFB 3DSNA 4KTDH 5IMOB 2X4PA 1U91B 4I8DA 4OFDA 2G60L 4M6NL 1FDLH 1U8LA 1QFWM 2QSCL 3GIZL 4MDJB 2MKLC 1F97A 1PYWB 1AGEA 2CUIA 2VYRE 4JFOA 1A22B 1CWVA 1F13A 3ULVF 1PJ9A 4KQ4L 1OGTB 1KT2A 3K7UA 5F7YC 1S9KC 4F15B 5EIIA 5J3HD 2ZCKL 3ARFC 3FO0H 3MV8A 5B3JE 2Y7QA 3GSNB 2A1WL 3K8LA 1HHGA 1RZ8B 1QRNE 3SE9H 1CXFA 5K9OB 4UIKL 1BZ9A 4ENED 1MHCA 4X7FC 1SMOA 3BPOC 5DHXB 3SGKC 3TT3H 4NQDD 4K2UL 4GAGH 4PG9B 5C9KA 3BSZH 5C0EA 1Q38A 4NUGL 5DUBB 1GXEA 1GSMA 2R29L 3MLSH 2P42B 5BQ7A 5EFIB 1PBYA 4JANB 1EEZB 4X83A 2C3XA 3CXDL 1WF5A 3FMGL 1T2XA 4ZOAA 2FBJH 2IPKA 3LD8B 4RZCB 2IAMB 3D9AH 3L3IA 4BQ6A 1ES0B 1HXYB 4ZAKA 4BFGA 1HHJB 1GOHA 2PTTA 4M93C 4F9LA 1T1WA 3TNMA 4CVZB 4HT1H 3CVIL 4S1QL 3IU4H 3WD5H 5EIQA 3BISA 5F9JA 2EEAA 3GRWH 4UT9L 4U1JB 1A4KA 3PWPD 2QJDA 5DZNA 5DJYA 3VGEA 2C1OB 4H1LG 1MJ8H 2V5TA 1M7DB 3LEYL 3F65A 1LEGB 4IBLT 3FN9A 4M48L 1D9KD 4OF0A 5KSBA 4E42A 1UZ6F 5I71C 5EC1B 1LE5A 4PJDF 5AYUL 2A6IB 3TFKD 3HAEG 1KIQA 3INUL 1RUPH 1ZVHA 4JDVB 4FQQA 1C1EL 4I4WB 3U4BL 1OAXL 5D1XB 3NA4A 1AXSB 3PQYB 1PKQB 3CPLB 2YPLD 5HHVL 4M7LT 4NQED 3SY0A 3DMMC 3H3KA 4NM4H 4L3AA 3RNQA 4KAQH 3V6OA 3N06B 3SDYL 2V17H 4BH8A 1CDHA 5D96C 1MEXH 5CIPB 3OKDA 4NQDA 1S7TA 3IXTB 1FIGL 3TBYB 3WFEH 1D5BA 1I7UB 5HYEA 3WL9B 1T5XA 3U48A 1H3VA 4YDIL 4LOUC 2NY6B 5I1HH 4LIQH 4U7MA 2UY6A 5IFJA 2OYPA 3DUUB 5CUSH 3RL1A 4UV4H 1LO0L 1AE6H 1Q72L 4J7RA 2VR9A 3F6IA 3TYGL 3K81A 5ICYA 1WBZA 5L88L 3SDAD 2Y5TA 5CJ5A 5DWUL 4PJ7B 4MNQA 2UUDK 1QSFE 5MEQA 1DTUA 3MBEC 4EVNA 2W0FA 2HG5A 1KCVL 1PVHA 3CZFB 4BFEA 1MY5A 3LRSA 4OKVB 1KTLA 3Q6GL 4G80A 1ZE3C 1I3RA 2BMKA 2FX8L 3QJFA 5T1KD 1TVHA 4IHOA 2PETA 2Z91B 4HSQA 4P46C 4S1DC 5IB2B 2B1AH 1MNUL 5I75C 2FSEB 3NACL 5CJBA 1VB9A 5FHBH 3HC4L 1WWAX 2VXTL 1HWGB 2NY0C 1RIHH 5FF6B 4XP9H 4QRRD 4P23D 5TF1H 3RDTC 1GGYA 4XP4L 5DC0A 4KMLB 3VXTB 5IVZB 3V5KA 1CFVL 4ZXBA 3IGAA 4HC1H 4JPKL 3R4DA 3DURA 4MAYD 2EH8H 4K3DH 1U92B 4UUJA 3G6JF 1G0XA 4YNYB 2H1PH 4X7SH 4X9BA 2D3VA 1HDMB 2ZPKL 4QCIA 4Y88A 3HMXH 3WHXB 1I1AB 3HI1B 2DQHL 4X5WA 2UWEB 3ULUE 3L3KB 5C09B 5E5MA 2V2XB 3MLWL 4LL9A 3BWAA 4EDXA 2OI9C 5D70H 5MENA 3J8F7 3MNZA 1QBMH 3M8OL 5EZIL 3MACL 2YBRA 3ZKSD 1U8KB 3VDAA 2CSPA 5GGUB 1UEMA 4OAWB 4NCC1 4HUWB 1NCDL 2DQJL 4Y0GA 3WSQL 3MUGB 4HKBA 1S9XA 4QYOB 5DLMH 1E0OB 5GHWL 4YK4C 1A6WH 3FB7A 1KIRB 3OKLA 5FYKE 3MZGB 3CDCA 4GFTB 4B53A 4WWKB 1JK8A 1G9NL 3IF1B 5IBTL 3I6LD 3SDAA 4HBCL 4L8SB 2VO5A 4I9WD 1F3DH 5DQ9B 3VH8A 1RIVL 4LASL 1F3DJ 3KPNB 4IOSD 3HMWH 4ZTOH 1I85C 2X70A 2ADJB 1VKXA 3OV6A 2AI0L 4YUEL 4P5KB 2GCYA 3QFDB 3NFPB 4G8EA 3IRZA 5CHNA 1NFDA 2XWBB 1FRGL 3BIAX 3PQYE 1PKQE 4OBRA 4AIZA 4G6KH 4JO2H 3VGBA 4TSAH 5F1KC 4P2YA 4RMTA 5DZOA 1LNUB 4K3JH 3WFCL 2G75A 1KYOJ 4P23A 5FOJA 3VXPA 1U42A 2WBKA 3QXAB 4UQ3A 2XN9B 4BJLA 1P5VA 4ZYKB 3U0WL 3HC3H 1Y6NR 1NQBA 3QHFL 5DD5H 4JY4B 3VWKA 2P46B 1PKOA 5C2BL 1NPUA 3O4LA 1YEJH 5F6IB 1YECL 3AREB 4IRSB 3ORJA 2IBBA 3G6AB 4WW2B 5GRJH 4DUVA 3CFIC 5MHSD 2VDNH 1X5ZA 2HJKB 4XPAL 5CGYC 4PJ7E 3L7FB 1MJJB 3H9HA 1MCOH 4PY8J 5CZKA 1AHWA 4JPIA 2IGFH 4QTIL 2W07A 5E2TH 3ARBA 1FHGA 1N6UA 5EN2B 3HNSH 4U7KA 4U1SA 3QNZB 2HT2C 3DIFA 2R4SH 1KJ2B 3OJMB 4DKFH 2X4TA 1MCJA 3PL6D 5T3ZH 1EFXB 2I26N 4Z7NE 1IM9D 5LQBH 1A9BB 3VXSD 3Q0HA 3D48R 1R3KA 1WITA 1FGNH 2XFXB 5DQDH 1KBGH 4HS8H 1Q0YH 3O3DB 4KDWA 4AG4L 2VDOL 1JVKA 4XXDA 5J12B 1DFBL 3THMH 1JPFB 1T66C 2LAGB 4PJAA 1IKNA 1YN7A 3LKNA 3N1PC 3HR5B 3L3GB 3D3VD 1V7NL 2VDKH 3WJLA 3NGBC 4TN9A 2EC8A 4Z0XB 2N56A 3E1F1 5HI4C 1JNHB 5CJXC 3HKFA 3AAZA 5IF0B 5CEYA 1EHLL 2OJEB 4Z7VF 2H3NA 4UDTA 1YC8A 2W91A 3P2TA 4FNLL 4OV6F 5D9SA 1ZA3A 2WM0A 2Z35B 3HLAB 5E6IB 1LO4L 5IK3B 1RHHA 1INEH 3WS6A 4ZS7L 3UTSD 1DUYB 2YD3A 5LBSH 4XRCA 1A6VH 5D93B 1LO2H 1AY1L 5D71H 2EE6A 3CSBA 5C0IB 5F72S 4K71B 3V5HB 4BSWA 2COQA 1AIFB 5HYSB 2FX9H 2YD6A 4XXCC 4DN4L 3T0EE 5HXMA 2BFVL 4HV8A 4XAKD 2EECA 3G5ZB 3OMZA 3IDXL 3DTXA 3O6LL 3EDDA 3T4YB 3VA2C 4M03A 1E4XI 1WGOA 3WEXB 3ISWA 5D5MA 2AEIT 2C4XA 1EO5A 2GK0B 1M71A 1XF1A 4NKMB 3FKUS 4OT1L 4ELKA 3R1GH 1HZHH 1MAMH 2QKIA 4NNXA 5KN5B 5JMRA 1W72B 1NBVL 5BRZB 4MA3A 1HQRB 4QRPA 1U8HA 1A21A 2B8OT 5KOVC 5EO0A 3UYPA 1EXUB 3KVQA 5C0NC 1IM9A 3T8XA 4JFFD 35C8L 4D9RE 3OX8B 4JAMB 5D7SL 2VKXA 3HE7A 4D0BA 5C0AD 2M26A 4KTEL 4LVNB 4JQIL 2MQ0A 4ZO8A 1QEWA 3ZT6A 3LN4B 1FFPA 4DZBB 4AT6A 1CI5A 1UH2A 3VG0L 5CCKL 2XN9E 1C5BH 5F88A 1BQUA 5HHMB 3QI9B 3OZ9H 4OD2B 1IEHA 3FOMB 3T0WA 4F7TA 5KJRH 1ZGLB 1AGDA 1IEBA 2BNQD 2PYEB 2XZQH 1KEGH 4Y89A 2E6JA 2DQTL 4ODXB 4WGWB 1Y6KR 4NNYB 2F8OA 2CGRH 3X12A 4GRLD 2E9BA 1IGML 4OF7A 3SBWC 4XNMA 3VD5A 1P9MA 3AFLA 3VWJD 5B3JF 5JORA 3ZKXC 2F53B 1NCAH 3SGEH 4G9FA 4NQCD 4ONFH 3HUJB 2V2TB 2QR0B 3CZJA 4YO0B 2EYTA 1VGEL 3T3ME 2NY7L 2YK1H 1U8NA 2YA0A 5FKPB 3CVHL 3QUZD 4JREB 3RY4A 3SKNA 2LE9A 3TBVB 5TE6L 3SDCC 4K7FB 5ID0A 5EZOL 3JWOL 4OI9A 5FGCB 2EDWA 3BXNA 4WY7L 3UBXI 1A1MB 4KI5F 4Y2DD 3GJEB 3TESA 2LAAA 3MRNA 3OF6D 3QDJA 4JFQA 4ERSL 3OTTA 1Q0XH 1WEJL 2W9EH 2CO6B 4LCIL 5D7JD 1RUAH 1DDHB 4Y16D 3R8QA 3UTZA 1DQDL 2DTML 5LKNA 2OZ4H 1MREH 4L9LB 4AL8H 3HTLX 2AJ3B 1BEYH 2ICWJ 1JRHH 2VN4A 4LEOA 5MEOA 4FABH 1LHZA 2XZAL 1YPZB 1G7PB 4MSWA 3EJJX 1GH7A 1SVCP 5AG9A 3MLRH 5L7XH 1I3GL 4JO1H 4JRYD 1CR9H 3BH8B 3H9SB 2NX5B 5KVMC 2WWKT 5T1LB 4PB0L 4X5XB 4XNYH 3WNMA 2L4OA 2J2ZA 4LK4A 2PNDA 5I1JH 1R5WA 4RIRA 5A2KH 4YDLC 5ESAA 2MKWA 5L9DH 4ZG1A 2W92A 4L4VD 4OCWH 4PJBB 2VQ1A 2LU7A 3HNTL 3MLPA 2Z31A 3BGFB 4MJ6B 3U9UB 4ZMAT 3UPRB 4TNVF 2P44B 4JN2B 4NKOA 3ILPA 3PXHA 4WV1A 2YRLA 3JV0A 3V4VL 2OM5A 3UTTA 4NJ9H 3NIGE 4CVWA 4GRLA 3X3GL 2XXCB 2Z92A 4B7LA 3KLAB 5ICZB 1GPOH 2BNRA 1LD9B 5DHVH 3DARA 4CMHC 2OTPA 1BOGA 3MRBA 3WIFA 1MLCA 3RBSA 5IUSA 1XF4A 4JFDA 4DTGH 4ORGA 3C5JA 2ZUSA 3DI2B 1G9MH 3LH2L 5JOEA 1MFAL 5EBMB 2KBGA 1DQML 3KPRE 1NC2B 1NAMB 3FB8A 3DI3B 1HCFX 4OTXH 3RL2B 4Y2DA 1N7ML 4IIQB 4PJ9C 3V52H 1BWMA 1YMMD 3X3FL 5HYJE 4JZNA 4GSDL 3RIFK 3UZVB 4C54A 4MHHG 2YUZA 2FDBP 2R56H 5I1EL 3T0VA 4OGYL 3VXME 1GHFL 3S97C 2V7HA 2XRAH 3CSPA 4P9HC 1OTTD 3ZSTA 2IH3B 1T03H 1HINH 2XPGB 1TCRB 1A3LL 4PRPE 4JVUA 5KVDH 3GSUA 2PYEE 4KK9D 5IMMB 3BO8B 3U36B 4DAGH 2P1YA 5ACZB 2P47B 3RWFB 1KJ2L 4HBQA 5HHQB 2AK4B 2B2XL 4UT7L 2JCCF 5JHLL 1YEIL 1XGRB 2XWJB 2F53E 3QCTL 5EZJA 2AGJL 3HUJE 1J8HA 1CTOA 3D5OF 5C6PB 2D03H 3MROA 4PJGB 3F12B 3MOBL 3MA7A 5HJ3B 2VZ1A 5BVJA 2CLRB 4LSPL 4MJID 3K46A 3ZE1F 2ADGB 2HVKA 3ZDYE 4FA8A 2MWCA 1A6TA 4UV7L 2D7NA 2CK0H 4XCYA 1KJMA 3VE0A 2VSCA 4K3HA 4H88L 1E28A 3FO9B 4NRZB 3S8WA 4F9LC 3T65A 1E4JA 3ULUF 4RMWA 3U7WL 5B38B 4FFVC 3EFFB 2V9RA 1FORH 5HVWA 2CMRH 2HLAA 5KS9A 3ARVA 2EDOA 4Q6IB 2WNGA 1A7PL 5L8LB 4W6WB 3DYMA 1YPZE 1SVZA 5KANI 5JXAH 5HHOE 5LAXB 1F42A 1SM3L 1KB9K 1JTOA 3V5DB 2VE6B 3FB6A 5TE7L 3ZYZA 3IDJB 1ZTXH 1X5HA 5ALCL 1MHPL 3IDYC 4DVBB 4F37K 3H9SE 2HKFL 4HFUH 3TZVB 3QG6B 4X9GA 1GAFH 7FABH 1FJ1A 5DMKB 5CIPH 2AV1B 3GMLA 4CL7A 1N59A 1B0RB 1AQKL 5J3HC 4XCFL 3BPNB 4OCYH 4P49A 5FM5M 1PY4A 1TZHA 4YHOL 5FYLD 2J5LC 3FQWA 4Z77A 3K3QA 3TBTB 3BD3A 4UINL 5GS0L 4RGNB 1OQOA 3SDDD 3E6HA 4ENEC 1NUDA 2A9NL 2VWEE 9CGTA 2H2SC 3BPLC 5GRVL 3MV9E 5E03A 1JUFA 4QT5B 1JF1A 1I8KB 4PTTB 4N90E 2EXWD 5FA3A 2EYSB 5IQ7H 2NY1B 3NIDF 4M6MH 3PP3H 2R4RL 4WU5B 3D39D 3MXWH 1G7HA 4IOIA 1IKFL 1FYTD 1FFNB 4LSQH 5GISH 5EOCJ 3QQ9D 4I77L 4OLEA 2ED7A 1EJ6A 3PDOB 3QPQD 1NMCB 2RGSA 5CP3A 4HGWA 3BEVB 1OB1A 3B83A 2APFA 4IMKA 4E0RB 1Z5LA 1NCWL 1DE4A 4YX2H 3RRQA 2WIIB 5FHAL 1ZLVK 3LV3A 3RWCA 1NDGB 5FECA 2JJVA 1Z0NA 4G3YH 4URTB 1TNMA 2DS4A 1XGTB 2CJUL 5ILTL 2Z93A 1HEZA 4X4XB 4Q9QL 5JXEA 4UMGA 3DV4B 2E7HA 4KKCD 1DUZA 1UJ3B 3O9WB 3VJ6B 4PJ7F 4DEPB 1BFVH 5ISZE 2VC2H 4WJ5A 2PW2A 2XTJD 4RMSA 4YIQB 5BJTB 5I8CA 5DRXA 1S8DA 1HXMA 5D1ZD 1D9KC 2BK8A 1CL7I 3AUVA 3CGTA 4HF5L 2A9MH 1BGXH 3HPLB 3Q3GB 3MODL 3RWIA 5FXCH 3TFKC 4POYA 3P30L 2VXQH 3VXNB 4D9QE 4XCEA 1X5KA 3PE9A 3IFPA 1A64A 5F3HA 2AK4E 2N1KA 3M17B 3MLXL 5GJSL 4JFZL 5I8OL 3TCXA 4LMQI 5SX4H 3BH9A 3SDDA 4PJGE 3KJ4C 1KOAA 4MLSA 2P8LA 1RURL 2XA3A 4QWWC 5DD6A 5IT2H 4KUCD 1S7WA 5D72H 1Q8MA 4PBXA 4WFGD 3D2UA 1CTNA 4C58B 1XGUB 4NJAL 1UVQA 5C0DA 2VERN 1FZJB 2VDLL 1MRDL 1MQKH 4MD5B 3TEUA 4FQXD 1MUJA 2DQGL 2NW3B 2GT9A 2VLRD 3C2AL 3P9LA 1RUML 4QHMB 4GBXD 5IWLC 3EKCA 5DR5H 5I1AA 3GDBA 2HTLD 2Y4SA 3D39A 3GM8A 1TTGA 2UWEF 1F2QA 2K1MA 1B0GA 3CFEA 2DBJA 3IU3B 4H0GA 2VIRA 1T3FA 3P73B 5EU3A 3VMOA 4HCRA 4YPGA 3VI3F 4KZEH 4RAUA 1EVTC 1U3HA 1N6QL 5CWSB 1INDH 3SDAC 3MLUH 1BD2B 3L3DB 4OCSL 2P7TA 3VFMA 4AEFA 3SPVA 4CDHA 3LKSA 3TCLA 5D1QD 5FKAB 3HFML 2YC1A 2F8XC 1WBYA 3DV6B 3BDYL 4GG6A 1FV1A 2KL6A 2VISA 4FQHB 2DQFB 4CAGA 4RGOL 5CBEA 3V6ZA 1D6VL 2Z8WC 2FRGP 3WIIL 4HPOL 4LSTH 1FVEB 4UOW1 2B39A 5IHUL 5KAQF 4RGNE 1ND0B 1AJ7H 3ARFB 5FUCE 1YN6B 5TFSH 4WIQA 3VXQB 4PRDA 1KTDB 3QFJB 4LHJB 3MRCB 3HB3D 5JLZA 3LMJL 5IW6B 4MA7L 1U3ZA 3SDXA 5E8EA 1CGUA 1I1CA 2R39A 4L8DA 2GJJA 3VRLF 2YR3A 2PYFA 2YD4A 1V3JA 2DD8H 4XPTL 4NFBA 3BPOB 4MAYC 5DDHB 2E3VA 3SE3A 5GZOD 1ITBB 2FGZA 2GKIA 2W60A 4J12A 1FL3B 3RY6C 5D7IE 5EORL 1F4AA 1BF2A 4KAQL 5IB3B 5E24E 4JVWA 2VXSL 2V17L 1MRFH 5BO1L 1ZLSL 4MXWL 4WI7A 1MEXL 3LZFH 3IXAB 4HG4K 4GXVH 4NP4L 2LFGA 1CE6B 4P5MB 5C0BB 4OZIE 1AD0B 1CS6A 1EZVX 2IANA 4XMKH 4KXZI 3SE4C 4HUXA 4XVTH 3MUJA 5CLWA 3WXVL 5I1HL 4FQXA 4HEME 5CJQL 5CEZH 3GSWB 4KVCL 4KDTC 5B3NA 2CRMA 3KPSD 4P2OD 4G43A 1JI1A 2EIZA 1AHWC 2EIEA 2Q1EA 4WW2F 4M93B 3DRTA 1XR8A 3MRJB 3FQTB 5I15L 1FO0L 4PY7B 3RGHA 1L0XA 4EDWH 2DLEA 1N64L 1GGUA 2IQ9H 3UXFA 5BMFH 3FCTA 4DJMA 3GSQB 5B4MD 2OR9H 2WZPD 4A2LA 1RJZB 1ZMYA 4G8IB 4L3ED 3LEVH 1TDQA 3AY4A 4ZUTB 1DEEB 2DDQL 2EE2A 2FB4L 3CFDB 1IAIH 5I71B 4Z7OF 4FMKA 1EA9C 2FHCA 4I2XB 1NSNH 5ESVA 3KR3L 1G6VK 3MMEB 1YEEH 3FFDA 3E8UL 1ZT1B 3HRPA 4FTVE 5F89B 5HDOA 3KWWA 2CD0A 4NZDA 3L3HA 2M1KA 5IMKA 5SWZA 2DM4A 1D6EA 4N0RA 3QUMB 1UA6H 5ERWA 4HC1L 5DS8A 1ZHNB 4LLAA 3CMGA 4TSCH 5D96B 5LCVH 5KG9A 5L2KD 4LKXB 1BAFH 4K7PH 3SKMA 4K3DL 3G6DH 3OR6B 3TA3D 4PLKD 2DWDA 4XVSH 3OKKB 3REWB 1ZT4A 3HMXL 3NZHL 1WBXA 5H35A 1ZVYA 3TN0C 4XPGL 3DGGB 3BN3B 5CEXA 4Z7UE 3NA9H 3HA0A 4Y7MA 3OB8A 4RBPH 4L4TA 2L0DA 1I1YA 3TGXA 4U0RC 4YDJA 1UYWL 2W9DL 3OHXB 5D7LB 4S0TD 1A9EA 2VOTA 5DJDA 1BD2E 1UB5B 2PO6A 4BFIB 2HP4A 3QCUH 3MJ7B 5HGHA 5ENWB 4AM0B 2DI7A 3T1FA 2XNAB 1CDCA 1GC1L 1QRND 4F3FB 3V4UL 2VABA 5H37H 4Z7QE 1HHIB 3LKPB 1MHEA 5FM8A 2AJXL 3MBEB 3S88H 3O3AB 3RVXD 4OFKA 2X4OA 5JOPD 4TNVK 1CU4L 2Q86B 1UXSA 5ANMA 3TM6A 1FFQA 1QFWI 4R7DA 2NLJA 4ETQA 3PL6C 4K7PX 5FO8A 1YNLH 1CFNB 2W0PA 5GRXG 3CH1A 3KYMA 4P46B 2EXYD 4X8JA 5J0BA 1T7VA 3QFJE 4W4NA 3VFSA 4F9PA 1LE9A 1Q9OA 5I75B 5DJ0B 3GI9H 3T2PA 4MDIB 1I9IH 1GOFA 3ARGD 1T1YA 4QRUA 1DLHA 3RDTB 3ZTNL 4HUVB 3WO4C 3L9RA 2DM7A 1JNJA 4LGRB 4H1LA 3MRHB 2IG2L 4PV9B 1Y0LB 4K3JL 5I66A 2NTFB 2O61B 1CFTB 5C0BE 3C09C 4X0KA 1JPST 1MI5B 3L6FB 3RVVD 1P9MC 5L2KA 3HAEA 1U8OA 3HC3L 5FCUL 4M5ZH 5EO9B 1EO8H 2WBJD 4LHUD 3TA3A 2OI9B 4R4FH 3TH2T 5EUOB 1TVDA 3E2HB 4HX1A 3SGDI 5T1DL 1MHHB 2HKHL 4X6BA 3P0YL 1IQDB 1HNFA 1LO3L 1PD6A 3S96A 3MYJA 1RUQH 2P5EB 1EGJH 3LDBC 4PYHA 1GGBL 4YK4B 3HUJF 1JGEA 4OLYH 3UPCA 4HIJA 3PJSB 1L7TL 2GJ6E 4R8WL 2CDFB 2MMXA 5ELIA 3RWEA 1UQSB 2GTWB 2IGFL 4EI6B 3TP4A 1QRNA 1IGFH 2ZCHH 4UOW0 5CSZA 1W0VB 5GGTH 3DBXA 1RK0B 3UDWC 4X8XA 3O6FD 2P49B 1QHPA 4OLVH 3L95A 1MCBA 2DLFL 4GO6B 3UYRL 4DKFL 5J4MA 4Z0BL 1FFOA 2I27N 3DO7A 3MNVA 5E2UH 2EEDA 1NL0H 4I2XE 2VH5L 4MX7B 5GS2D 4UNTA 1FGNL 1JI2A 5T3XE 4XVJH 1OAKH 4MNGB 3GIVA 3C87A 1AGFA 1FZOA 2HLFD 1YPZF 2Z4QA 3FRUA 5C3LD 3P0GB 4OQTL 4WCYL 1E4KA 1BP3B 2ZKHL 3NFNA 1CFBA 1N5AA 4RGMC 2I9TB 1KGCD 4GRLC 3BVNA 4TUJB 3FOLB 4JJ5B 3LSOB 4PJBF 5D7LE 1NAMH 3VWJC 3AS2A 2ZG1A 4PJHF 3EDEA 2F19L 4I3GA 2WBJA 3SCMD 4AEIL 3HI5H 1RJCA 3UX9B 2C4FU 4YR6B 3JV6B 2CR3A 1NGXB 4JKKA 4X98A 3QIBA 4HQQH 1MJ7H 3K1KC 2AVGA 3QUZC 2QQNH 1CK0H 5KW9L 3ZDXE 5E9DD 1MIMH 2UYLA 2R2CA 4FMFA 5C0GA 4Y2DC 3MV7B 4R2GD 1FP5A 4QHNA 2LVCA 3BN9D 4CMMB 4I18A 1E4WL 2DIBA 2B4CC 1OF2B 5D7JC 3RGVB 1P1ZB 4Y16C 5C07D 4C83B 4HFWA 4YHML 4GQPH 5C8JB 1X5LA 3K80A 4O9HH 1MCPH 2BVOB 2QHRL 5FUOH 5F1IA 1H8NA 3M45A 1FQ9C 3EIFA 4TVPD 5AWNH 4PGBB 4R7NB 4P59L 1G7LA 2BVPB 3QH3A 5TQ2L 5JHDB 2YPVL 2DQIL 3QG7L 1IC5H 4HWNA 1JV5A 3QNXA 2BSSB 4ZOCA 1MI5E 1NEZG 3CD4A 1DLFH 1C16A 5C0RH 1AC0A 4X7TA 1ZLWH 5I1IH 4YE4H 2DLTA 1LK2B 3VD7A 3B2VL 5GS1C 4GS7C 3U2SB 1DN0A 4QRQB 2MCG1 4P3DB 5LGKA 2XKSA 3GSOB 2XV6B 3N1QC 1U91A 5EUOE 1WK0A 2HVJA 5BVPH 1WWBX 1RJLB 1MFCH 1BMGA 4R26H 4HD9A 2P5EE 4JKWA 4PG2C 1AGBA 3O3BB 5GQBA 2GY5A 1OGTA 1NCAL 2NXZD 4WFED 1WCQA 3IETB 3LKQA 2DQUH 2HH0H 5B39B 4I0PD 1KENH 3ZDZF 1RZ8A 2CH8A 3ROOA 2BXZA 2X4NB 4MZ3A 5E9DA 3I6GB 1N3NA 4ZUVB 4Z9KB 3GHEH 3X17A 5DMYA 1T21B 2CDEB 1RJYB 4PG9A 3X13B 5I76B 3FQNB 4J1UB 2ADIB 3NTCH 4WUKL 5CINH 5TPWH 1NKOA 4IOFD 1KCRH 3HG1D 5BS0B 3NFSL 3MLZH 4ODTL 3P4OB 3O6KL 3JTSA 3H42H 4ONHA 3OAUL 3WFBL 1OTTC 4RZCA 2IAMA 4TYUA 2AJUH 2WWKO 5JA9A 1A4JB 3EO1A 2AAVA 4XP1L 1R6VA 4Y8AA 1FGVL 1IC1A 1CDUA 4KK9C 4EOWH 4I48A 5T5FH 5DUML 2JB6B 2NY4D 5C70A 4TVSa 3OAZH 3O41B 5I1JL 3EYFB 3L5XH 3ZLQC 1U6AL 2WANA 4PRIB 4UIMB 2GITB 4OZFG 4FZ8L 2HFEA 1EEYA 3BD4A 1M7DA 1IM3B 1RZFL 4XPBH 3U0PB 1LEGA 3RVUD 3ZKXB 1CXKA 1UWEH 3DX8B 3F7QA 4LPUA 5DJ6A 5ALBL 1H5BA 1J8KA 3EJZD 3NCEB 4XGZA 4EBQH 1NMAL 2R0ZL 2A6IA 1QPPA 1V5JA 4IMKC 3HZVB 5I8KH 2F54D 4I4WA 3MV7E 3A0OA 3ILQD 4JFHD 4JM2B 3DHMA 1AR1D 3MGOA 4DTGL 2CUHA 4OB5H 1G9ML 3CXHK 3MLTB 1RY7B 1CXEA 3PV6B 1GJIA 5F7DB 2FJFA 2VZUA 4Y1AB 2F15A 3WUWB 4OZHF 3TBYA 1IC4H 1I7UA 3WL9A 4DZ8B 2NY5H 3GB7B 3O8XD 1T22A 2DJ4A 4V2CB 2E7MA 4H5SB 4XP6L 4PGCA 3F7VB 5JHDE 4N5UA 5A40E 1OP3H 1DBMH 3EYUL 3HG1A 3CFKB 1J0IA 2YRPA 5IMLA 3H7BB 4AYFA 1SJVA 1WTLA 2YKLH 5EWIH 4IRJA 5IEHB 5FIEA 5D8JL 5GRUH 2DL2A 1JPTL 5EOTB 3MR9B 1V05A 5A2FA 1EVUA 1HQ4B 2FJGB 2X1XR 4LEXL 3RIAF 3SDDC 3BP5A 3MNWA 2EDJA 4CN1A 4YDLB 1A3QA 3HPJA 4IDLA 4DGIL 2R2BB 3G5XB 1WC7A 2GTZB 4LF3A 4K94H 5DJAA 4TULH 3BUYB 3CZFA 4NO0B 3ZO0A 4U3XA 2EXWC 1JYXA 1BBDL 1WUNT 3V4PL 2BVTA 4AEHH 5DRZA 2Z8SA 1LP9B 1WZKA 3KJ6L 3VXUB 4CMHB 2UZYB 4K23H 2GSGA 3UO1H 1ADQL 2FSEA 2HRPL 3FFCD 5GXBB 3QPQC 2CK0L 2ZNWA 1JGDA 1S7XB 1D5MA 2XWTA 4NGHH 3CVHA 5IVZA 3IS0X 1KJ3H 1T2JA 2YS4A 2VAAB 5DJXB 5DJCB 1N2RB 1RZKH 4NNPL 5DJZB 1CQKA 3CC5B 2ESVE 4PJ9B 1JFQH 4YNYA 3SQOL 1S7RA 4ODVH 4G6MH 2JELH 4KKCC 1PAMA 1U8LB 5E4EC 5BS0E 1CZ8L 4U2YA 3S3PA 5L8JB 3QB7C 1AGEB 4JFEE 5JXAL 2XTJC 4XNZB 4Z5RA 1S7SB 1D5ZA 1ACZA 1OSZB 4OCLC 1ZTXL 2Q6WA 5FUZH 5EIIB 5F8QC 3IJSA 3MJGX 1CVRA 3CSGA 5D1ZC 5GGUA 1VSCA 1DZBA 5E99L 1T7YA 1QKZH 4GW1B 2Y7QB 2WUCH 1X9QA 4YHKL 2YZ8A 1KELH 1I7TA 4PRIE 3MX0A 4G6JH 2WK2A 1BZ9B 4K07A 1MHCB 1VESA 4M7LL 3T0EA 2FGWL 4KKAD 2AQ3A 2FWOB 2O5XH 5DQ9A 4OFVA 5C0EB 5IGXL 1CBVH 3PWVA 1XGQA 4GW4A 3KPNA 2BSRB 3JWNC 4ZQKB 4V1DB 5HVGB 3ZKQD 1YZZA 1PEWA 2ADJA 2XKUA 2EKSA 5BQ7B 5EBWA 1FNGA 1RZJH 3T0AA 3NFPA 4FQXC 1OSPL 3HI6H 3FRPG 4GBXC 3KS0J 2GFBA 1A3RH 2P8MA 1IAOB 2YD9A 4RCAA 2HTLC 1PGRB 4JJHA 5GRVK 3NIFE 1JE6A 4LSQL 4N8PA 4XC1L 5CJ8A 2E7BA 4P3CL 2QLVB 5HYFA 3G08B 1T1WB 1MLBB 5ESQA 3TNMB 4Y1AE 1OGAD 3FJTA 4N9GA 4O4YH 3VD4A 1UKTA 4RISL 2XN9A 3F6LA 3ZL4H 5HYQB 3D6GA 5D1QC 1A4KB 4HXAL 5DJYB 4PRHD 1VCAA 5TGBA 3NCCB 3H0TA 1K85A 4UZGA 1OW0A 3EHBD 2VC2L 3EDJA 5KSBB 3CLFH 3IDYB 4ZS6D 3G6AA 1KIQB 4UU9A 1YQVH 2IFFH 3W82A 4FQQB 3N9GL 4PP2A 1TJGH 1CLOH 3MJ9H 3L7FA 2MFNA 1MJJA 1OM3H 2D7TL 2J5LB 1HWHB 2VXQL 3HB3C 3SY0B 1OP5H 2BY3A 3S37L 1BWWA 1OQXA 1UKQA 3RNQB 2VTFA 4GAJH 4BH8B 4IM8A 4BKLA 4XP5L 4GH7B 3BPLB 4TOYH 1T89C 2OXHA 3OKDB 1R5IB 1KLGB 1S7TB 1WIOA 3ET9F 4NQDB 5GZOC 3LHPL 3QNZA 2X4QB 3ZE2E 1T5XB 3EO0A 1KJ2A 3M1BA 3UTQA 3B4NA 2ZUYA 3VXUE 1X5JA 1A9BA 1CD1B 1MCWW 5D72L 2MQ3A 2R0LL 5F7LB 5IB1B 4YHPB 3QWOA 5IFJB 3O3DA 5GPRA 4P2QE 3QUXD 3RL1B 1EK3A 3HRZA 1TJHL 2Y06L 4NOBA 2I5YH 5ICYB 1WBZB 1J5OL 4P2OC 2C3GA 4RA0C 4TUKH 4ISVA 3ULVD 4MNQB 5MEQB 3L3GA 1RAMA 1IVLA 4Y4FD 5EB9A 2CRYA 5IR1A 4Z0XA 1INDL 5EU5A 2YWZA 1JNHA 2HG5B 3QEUA 5IF0A 3LRSB 1OARL 4KFZC 1AXTH 2DMBA 1KTLB 5F6HI 5B4MC 2CDGA 2Z35A 3HLAA 4G80B 1I3UA 3QEGH 3QJFB 1TVHB 1NANI 4IHOB 3ZDXF 4MS8D 3G04A 3KYKL 4ZTPH 2VZSA 2UZXB 1D9KB 4QO1A 4RMUA 3V5HA 4PB9H 2WV3A 2E27L 4JHZA 1IGCH 3VMNA 4CRPA 2P8PA 4LCCA 3V5KB 2AW2A 4ZXBB 3IGAB 3RHWF 3ULSA 3DURB 2OK0L 4NBYB 2YPLB 3O0RL 4V1DE 4UUJB 3WEXA 4GAYA 5FA4A 3VGFA 3WFDL 3KJ4B 5IM7A 3KPRA 3MOQA 3BKYH 4XX1E 1IFHL 5KN5A 5DD3H 2BY0A 1RMFH 2BRRL 2D9CA 3QXUA 1MRFL 1P53A 4PLKC 4EDXB 1QFOA 5MENB 3TVMA 5HYJA 4JRXD 4Y19E 4GXVL 2YBRB 3S35H 1MWAH 4KROD 4NCC2 4JAMA 4HWUA 3UBXB 4U1MA 4UTBH 4HKBB 1S9XB 1GGCL 1PG7H 1TETH 4XVTL 5JW5A 4OLXL 4X6CF 3VXMA 1DBKH 3LN4A 3OKLB 4I0KA 4JHAH 5EUOF 4DZBA 4FP8H 1VFAB 4HS3B 1KXQE 1JK8B 4U7SA 4OGXH 3SDAB 3FOMA 2H41A 4TNWF 3BKJL 4PRPA 3VH8B 1B4JL 2XOTA 3VXRD 1YJDH 5C0CD 5LXGL 2PYEA 2JIXD 2F58H 4JR9H 1VEPA 2DQEL 3RVXC 3E0GA 1J1PH 2OJZH 2X70B 4HKJA 3EGSA 4NNYA 4LNRA 5KSBE 1A7RH 1VKXB 5TE4L 2GCYB 4S1RH 2NZIA 1J1XL 4UBDD 3ZTJH 5CHNB 5HI5D 3VMPA 1A14H 3I84A 1WT5C 2F53A 5T1KB 3I02B 2V2TA 2HT3D 2EXYC 4AIZB 3OB0H 3S35X 1IAIL 3KAAA 2CRZA 5F9OH 1K4CA 2LU3A 3ARGC 1PG7X 3K1DA 2G75B 4QRRB 4P23B 4B7IA 5CJOL 4HJJL 4NQDE 3PIQA 5LGHL 4NC0B 4UQ3B 3VFUA 1TTFA 5HDBE 4C57C 4UI2A 3ELAT 1TNNA 4P4KD 3IDGA 1OWRM 1HILA 2Y1VA 1CVSC 4MQXD 4K7PL 4XZUA 3G6DL 3U9PL 2C4FT 2APVA 4L9LA 4RNRB 2GAZB 4U1IA 3DWTA 2WBJC 4P9HL 2VZTA 4U4BA 5HHOA 2JJSC 1G7PA 3AXLA 5F71A 1MSPA 3LS4H 4LARH 4ZNCD 3NA9L 1Z6JT 2Y36H 4OZ4A 3BH8A 4XX1G 4O2FA 1AHWB 3MUY1 3BE1H 1VEOA 1ZEAH 1N8ZA 5E00B 5IJKA 3ARBB 1CGXA 3LQZA 5BW7C 5J8OA 4I18C 1OPGH 4XMPL 1UWXK 6FABH 4U1SB 3PWPE 3EW3B 1NDMA 3DIFB 3GMRB 3U9UA 2QQLH 5HHXH 3UPRA 1U8PB 2X4TB 3RI5K 3N85H 4X4ZA 5GGQL 5C0CA 1H3WM 1RIUL 4M62H 3QSKB 1NAKL 3O6FC 3MV9A 5DT1L 2I60H 1NKRA 1MPAH 3RAJH 3V0WL 2PXYA 3KLAA 3AROA 1FL5B 1JCKA 1LD9A 4XXDB 2R2HB 1JYWA 1SHMA 4N68A 3UJIL 3PXJA 2YPLE 4PJAB 4NQEE 5ACMA 3LKNB 5AZ2H 1LEKB 2HLFC 3T0BA 1TZGL 3C5ZA 1NC2A 1P7QD 3OPZH 2A6JB 2P48B 3HE6D 5E94A 4TRPL 3AAZB 3C6SA 1TPXC 5CEYB 2CR6A 2H3NB 1ZS8B 4UDTB 5D9SB 4IIQA 1ZA3B 2KDGA 4XHJD 3NZ8A 1FPTH 2ADFH 1MCQA 2E7LA 4MHHI 1YEKH 3TH3T 1RUKH 2CLZA 4G9DB 3WYRA 3I50H 4ODSH 4HLZG 4DOHB 4UQ2B 4BSWB 5ISZA 2CKBH 4ZNEA 4Y2OA 3SCMC 5ABDE 1I9RH 4OLUL 2IH3A 2FHFA 4HV8B 2RCSL 5TF0A 2XPGA 3DTXB 1TCRA 5IJVA 2A77H 2EO1A 3P11H 4PLNC 1EGJL 3EYQD 2QQQA 4OZGB 5IMMA 4C4KT 3BO8A 4FQ2L 4PJCA 3CSYB 1M71B 3RWFA 3FO2A 4R2GC 1UM5H 1WICA 4WI8A 5C6WH 2MPAL 2IADA 5HHQA 3BN9C 4ELKB 1FO0A 3PG2A 4NNXB 3K2UH 3LIZL 1XGRA 4PJFB 5FDWA 4PLOB 1JNNH 2ZCHL 1U8HB 5EO0B 4H8WH 4OGAD 4PJGA 1IM9B 4RFOL 1UWGH 5HJ3A 3T8XB 4PTUA 1ZVSA 3QJHA 3UJTH 2OS7A 4RWYL 4D0BB 5E2UL 4QRRE 3UTPD 1QEWB 4EUPH 1FFPB 4AT6B 3RFZC 4XVJL 1OAKL 5F88B 4YHLH 1NCBL 2XT1B 4NRZA 5H8DA 4YPJA 3WO4B 1AGDB 3LRHA 3WIHH 2G2RB 3ALPA 1IEBB 5FYJH 3D3VB 2NNAA 1JWMA 1FN4A 1BF8A 2Q8BL 3ZZ1A 1P7QA 3SO5A 3P0VL 3G5VA 3HE6A 1X7QB 2EDFA 2VUYA 1IAIM 5JW3H 4NN6C 3C09B 4YHZH 3DX6B 4MWFA 5SX5H 3B9KD 5LAXA 5JORB 1YYLH 2JK5A 1JZ3A 3UTSB 4G9FB 8FABA 1EMTL 1U8NB 3V7MA 4XMLH 5I8EA 5B8CA 1CGYA 3HMXA 4X5LA 4BQBA 5LWYL 1JWUB 4WI3A 2YWYA 4LQFH 4J2XA 5DMKA 2AV1A 2NXZC 1U3YA 5ID0B 4Z18A 1B0RA 2DTSA 5IOPA 1LK3L 3LDBB 3AU1B 3PWNB 3T2NH 3I6LE 1ROWA 3QPXH 3BXNB 2FIRT 4HQQL 4I9WE 3KPOA 4YBQD 4POUB 1MCIA 5F96L 3DNKA 4I0PC 1WFNA 4M43L 3UBXG 4APQD 4OCRH 1SEBA 3QDJB 3KLDA 3BQUA 2P5WD 4PS4L 2V2WA 2J88L 4UB0H 4JM2F 3QDHA 4Q2ZB 3UTZB 2X2YA 5BZDA 2DI9A 5MEOB 4LEOB 5C86A 4ZPTA 5D7IA 3X14A 3DLQR 4WU5A 1Q1JL 4IOFC 4MSWB 2IF7A 4P5TA 2AJYL 5T3ZD 2MJWA 1KEMH 1FFNA 1L9MA 4JFFB 4LDLB 3WHE1 1BQHG 4FZEL 4OZIA 3PDOA 4I3SH 3N1MC 2NY3D 4LSRL 4L5FL 4RAVA 2WIMA 5AWNL 3MBXH 4KWUA 1XF3B 3MOAH 1RZ7L 4EI5D 4K3EH 1R5WB 5EA0H 4RIRB 2WIIA 4A6YL 3QWRD 5ESAB 5DHYB 1KG0A 3RZCD 4RDQF 2R1WA 1C7TA 1IC5L 2NY4C 3WBDA 4GMTL 3ZHKA 2EDNA 4NKOB 3LRGA 1DLFL 4W81A 4WFHD 3QXVA 4WV1B 2IBZY 1EDQA 4RGMB 4G8FB 5IFHH 3DXAD 3DETD 1J05B 4GRLB 3OJDB 4FXLA 5A16A 5MHSE 4G42A 3VWJB 2BNRB 3EFDH 5BJTA 4GRWE 3RVUC 3QEHA 3KPMA 2B0SH 3MRBB 3WIFB 3S34H 4R26L 4MZ2A 4D0DA 4KHTH 3RA7H 3EJZC 2BNUA 1KPVA 4I13B 4OZGE 4XH2A 1XF4B 1YEHL 4JFDB 4AMKH 4ORGB 3C5JB 3ZE2F 3QUZB 4IMLB 4NN7C 1PSKL 1LP9F 1YEFL 4L4JA 3ILQC 4I3RL 3FB8B 5JQ6L 1R3HB 4RQQA 1AR1C 1YY8A 4XAWH 4PJFE 1NC4D 2IMMA 4Y2DB 4HULB 1S5IL 2YMXL 1PDKA 2P45B 4FTVA 1NJ9A 1ORSA 1KCUH 3VXSE 3VGAC 2P5WA 3W5MA 3S6CA 4C56D 2X1QA 1Q9KA 3O8XC 2QL1A 3KHQA 4MD5A 1ZA6B 2HWZH 3GKWH 3QIUD 2NW3A 2V7HB 2BVUA 5CINL 1RZIA 4ODWA 2IMNA 5AYQA 4L9DA 5IW1B 1F6AB 4WTXA 5KVFL 4YHNA 5D2LB 5EOQH 4Z7UA 1A7OH 1DBJH 3GI8L 3D3VE 3H42L 3GSUB 1IQWH 1O7VA 1JGUH 5CWSA 2HJLB 4TQEL 3RNKA 3N50A 3TLRA 1X5GA 4EI5A 4L8BA 3MCKB 4K7PY 1XGYL 3P9MA 2E9WA 4FG6D 4EOWL 3QWRA 4OQTA 4L4VB 4GS7B 4UNVA 3UTSE 1SJEA 2DKSA 5EZJB 1J8HB 3ESVF 4DGVL 3FHAA 3MROB 3DV6A 4KI5D 2EE9A 4YGVB 4FQHA 2HVKB 1A6TB 4ORZC 2BHYA 4M00A 4XCYB 1FVEA 4XVUD 4XAKE 2F5BL 1ONQA 3L5HA 2EZ0C 4NM8L 3ARFA 1EBPA 3KPTA 2EDXA 3T65B 1IC7L 1KTDA 3QFJA 4JPWL 3MRCA 4G8GD 2UVEA 2ZNXA 3WNPA 4R0LA 2HLAB 3U4AA 2ZCLL 5KS9B 3KPQA 4PJXE 5DDHA 4OB5L 3RY5A 4JN1H 1FL3A 2R8SL 2CLVA 3HZYB 1YMMB 1J0YA 1T6VN 1UGNA 2UVFA 5KANG 3FB6B 3IXAA 3JVGC 4JFFE 2DB8A 1CE6A 4P5MA 5C0BA 2BERA 2PW1B 1FNLA 1A6ZB 5E7BA 4LMQE 4JLRA 5C0AE 1FJ1B 1NCNA 3GMLB 3QIUA 4JQVC 5DZLA 1L0YA 1N59B 3GSWA 1DBML 4NKDB 1TZHB 3FQWB 3LS5L 4Z77B 2DQDL 4YXLH 5KSBF 1HSBA 3SN6N 4X7CC 43CAA 1JHKL 1VEMA 2BNQE 4D3CH 5TDOB 2X7LB 3MRJA 3FQTA 2H26A 4GXUN 3E6HB 3VFGH 2FNBA 1JNLH 4U1HA 4WDIA 1F4XH 4KKAC 5IIEA 4QXWA 1E4XH 1JF1B 5FA3B 2GJ6A 3NPSC 4KRNA 4JB9L 2Q87A 4K94L 2IH1A 3VXOA 4NQCE 1BM3H 1CGVA 4ZUTA 2XG5A 4IOIB 4MJIB 1NUFA 4M1GH 3RU8H 2O5ZL 5HDBF 4YEEA 1AFVH 1CGWA 2ORBH 3K74B 1F3RB 1L9NA 1NEZA 4HGWB 4I2XA 1Z5LB 3UO1L 1DE4B 3MMEA 5FECB 3LV3B 3RWCB 2AK1H 3GSVA 2MQCA 1QZ1A 3DMMA 4NGHL 4JG1L 1X5FA 1A7BA 1VFBB 1WAAA 2X10A 4R97C 1KIPA 1ZHNA 1A6UL 5F7WC 5I6XC 3T04D 3OR6A 2B5IC 2PW2B 4ELME 1JFQL 3HR6A 5BV7H 3S98A 1C12A 4ODVL 3O2VL 5I8CB 1NMBL 1QLEL 4KHXH 3JWDC 4AEEA 4NSKA 1JYVA 3EHBC 3O4OB 5D2LE 4JRYE 2C3WA 3CX5K 1TTUA 4ZS6C 4J8RA 4FFYL 3EYOA 5ADPH 1BZ7A 3ME0A 3OHXA 4JVPA 5I0DA 1T4KA 4PRBB 4LCCC 3IFPB 5F9AC 2IALB 2AEPL 3ARSA 5F3HB 1ZT7A 3VFTA 1TCMA 3WKMH 4PV8B 1MAJA 1WZLA 4L4VE 3O2WL 5C6TL 1MOEA 3IJYA 3SDDB 1CLYH 1S7QA 1Z2KA 3FAWA 4G6JL 1KSRA 2P8LB 1CL7L 5E8DH 1H0DA 5M95B 5D2NC 1FNEB 4MNHA 4NZTH 1S7WB 4DW2H 4B5EA 5K33A 2R9HD 3D2UB 1UVQB 3IFLL 5C0DB 4ZODA 1CYGA 3CH8A 3BUTA 3P9LB 1MCFA 3GK8H 2B1HH 3D39B 4E9LA 1B0GB 2LU4A 3IS1X 3QUXC 1FE8L 5EU3B 2H2PD 4YPGB 1N5YL 4RAUB 4MDIA 3VG9C 3RDTA 4AIOA 1VPOL 4HUVA 4OZFA 5C0FB 2A73A 3ULVC 5KSUA 2P7TB 2O5YH 3LKSB 1YMME 4XPFL 2A74A 4Y4FC 3TCLB 2UZIH 3PP3K 4G6AD 1NGYA 2YC1B 3MA9H 4O4YL 2AXGA 4GG6B 3LQAH 1LO5A 1URLA 3WXWL 1MI5A 2VISB 4QY8B 4PY8I 5CBEB 3V6ZB 5E7FA 4D2NA 2Y25A 3BMWA 3PDDA 5GGVL 1F4HA 1BREA 2Q8AH 4ODHH 3FN3A 5EUOA 4MS8C 3TT1L 3MJ8B 2CK2A 1CGSL 1RPQA 1J0JA 1MHHA 3CLFL 3PP4L 5D1ZB 1S9WA 1S7VB 1X5YA 1L6ZA 2IWGA 4PRDB 3QXWA 1R3IH 2R2EA 3D85D 1NFDF 4H20L 3SDXB 5J1AA 4L8DB 4BZ2L 4YHYC 2PYFB 1OM3L 2FATH 4WNQA 2B4CL 2UUDH 3FN0L 3BRFA 2FYYA 2NY6D 1UQSA 1BFTA 2VDRH 1UM6L 4TOYL 1RV6X 4MJIE 1DL7L 4Y5XA 4GMSH 4GKOA 4OFYD 3SOBL 5J13C 4XNUL 1M1SA 4I5BA 1AO7D 5DO2D 2IANB 3OKNB 2ZJSL 4HUXB 2R69L 1TVBA 4FQXB 2VLRB 4GT7A 4GBXB 5K9JH 4GKZA 4XCCH 3PHOA 2YA1A 4KROC 5HDQH 3EZJB 1L7IL 4QHLA 4G43B 2EIZB 3W81A 4PP1D 2XA8H 1KPRB 1QBLL 4KK6D 1ADQA 1XR8B 3I75B 4M3JA 2I5YL 5L0QC 1Z3GL 3FCTB 1ZKAA 5IP4A 4BZ1L 5FGSA 5JZ7D 4U1NA 1MVUB 5EULV 5I9QC 2AEWA 2I9TA 2I07B 2OL3B 4WFFD 3DUSB 5IFAH 2DBLL 5IEKA 4UBDC 5HI5C 2CQVA 2HT3C 5FYLE 4YR6A 5DUPL 4Z7WE 3FHQA 4RX4A 1P4IL 2ZUXA 1NFIA 1QP1A 3KWWB 3L3HB 1I1AD 5SWZB 1DSFL 1D6EB 3GMMA 3OXSA 5ERWB 3MV7A 5C09D 4PJAF 5KG9B 1FNSL 3O45A 2WAHA 5CMAA 3SKMB 4F7PA 4P4KC 1KCSH 4UDUA 3HZKA 4HWEH 1JPSL 2DWDB 2GEEA 3BKYL 4MCZB 1ZT4B 4MQXC 2AQ1A 2CXKA 3MRLA 2XZZA 1FYTE 4C83A 1QOKA 4LSUL 5CEXB 1RMFL 3QRGL 3B8YA 5J56B 4NWTL 4Z78A 4YDJB 3F58H 4N0UE 1A9EB 1A7QH 4WWKD 4P57A 5DJDB 1VDGA 3DO3A 4XB7A 5JHDA 1ZHKA 5HGHB 1N0XL 4JY5H 3STZB 3KPSB 3T1FB 3L1OH 2FO4A 4LSSH 5CD5D 2H32A 1YYMH 5FGBC 2VABB 1F58H 4PRNA 2BSSA 1FLTX 1D7FA 2EH7H 2MHAB 3SGEI 2CKNA 4HZLA 2F74A 5CJXA 2X4OB 3VFOB 3U2SA 5ANMB 4OSUL 4CUCA 2XTJE 3FRPA 4P3DA 4OZGF 4R7DB 4ETQB 5T5NF 5DGRA 5FO8B 2ARJB 2K7QA 3CH1B 3QAZB 2F5AL 3KYMB 32C2A 5EBGA 3VFSB 5E0QA 2RR3A 1LE9B 1Q9OB 4PJFF 3I6KA 1OAZL 1ZANL 3SDXE 4XC3H 5DMIL 4XXCA 1T1YB 1DLHB 3MQIA 1ITCA 5JMOC 1WIPA 3L9RB 3Q5YA 5JPNA 3C6LD 4H1LB 1UACL 1D5IL 1BBJA 1JRHI 5I66B 3I6GA 2ZSVA 5FFLA 4M7ZC 3EO9H 2IPTL 3HE6C 3QCVL 4M7JH 1RJYA 5F7MC 4YXHH 3ARED 5GSVA 4WFGE 2APWA 5I76A 4MAUL 5L2KB 4XHJC 2H6PA 1U8OB 4NN5C 3FQNA 2VLRE 3RWHA 2CIIB 2ESVA 4EEEA 2Z8VC 3TA3B 3W11D 5DRNB 4FN0A 4HX1B 5F9WC 3KXFE 5E2VL 3BZ4A 4PYGA 4X6BB 5KTEL 4HUMB 5CZVH 4ZFGH 2Q7YA 3MYJB 3OKMA 4JFEA 2WUBH 1G0DA 3LS4L 1RFDH 1AKJA 1JGEB 1XH3B 4N8CL 1A4JA 5CEZD 1KFAH 3GMOA 5IG7A 3EYQC 2XZCH 1ZWIA 4JG0H 1EFXD 3Q48A 2JB6A 1P6FA 1QRNB 2LV4A 3EYFA 1T83C 5CSZB 1OPGL 3DBXB 4OLWL 5IVOA 4UIMA 1WZ1L 3CCHA 3L95B 1PZ5A 3H3PL 3TWCH 3A6BL 1KPUA 5GRWA 1FFOB 3DO7B 4OGAC 3U0PA 3CU7A 1P4BL 5T33H 4WI6A 2WWMD 1C5CH 3GIVB 4L1DA 5EO1A 1AGFB 1FZOB 2GJZA 4YZFE 2VDQL 1EERB 5BZWB 2Z4QB 3SDCA 3FRUB 3GNML 2J4WL 3GJFB 4QRTA 5E6ID 4KUZL 3L5IA 4JDTH 4M3KB 4FFZH 4X9FA 3OPZL 1FG2B 3NFNB 3VA6A 4LRNH 5F7DA 1N5AB 1IBGH 4U1GC 4Y1AA 4CBPA 1O7SA 4YQXL 1F4YL 5KSAD 2E8YA 3CU1A 3BVNB 4D8PB 4EQ2A 4U1LA 1HCVA 4GKSA 1CDGA 3B9KC 2HTKD 4HPYH 4PD4K 1RUKL 3W0WD 2WBJB 4LHUB 1CN4A 3F7VA 5I19L 2L7JA 3M07A 3KPSE 3GBMH 4RMRA 3NCJH 4X98B 4OV5B 3BKCH 1NLDL 4EN3D 1X4XA 2FJHA 3CAFA 1KC5H 2WMPA 1PX3A 3QHZH 5HHPA 5F7EH 3Q1SL 4PUBL 4NKIH 4YBQC 4C4KO 1T5WA 5ANME 2FJGA 4APQC 4I18B 4Z95H 1QYGH 4MCYA 2VNCA 1A1OA 1DQLH 2DQCH 3NBNA 2GTZA 5GGVY 5IVXA 3BP7A 1N4XH 1J12A 4L3EE 4KMTH 4JO3L 3QA3A 1BLNB 1YUHA 4ESKA 3O6FB 4ODUA 4NQTA 1JJUA 4ZPVA 2VDPH 3SGJC 5F1IB 4JZJC 3LVEA 2AJVL 1G7LB 3QH3B 1FLRH 4O02L 5AAMA 5JR1L 2NY3C 1P4LB 3A6CH 4YBLC 3DYPA 4ZO9A 4P2QA 1S7XA 1AI1H 2R0KL 1JV5B 5D4QA 3QNXB 4EI5C 1C16B 4XWGH 1TQBB 4X7TB 2VAAA 5L2KE 1T7XA 3MRIA 3RZCC 1TPXB 1EV2E 5D2LF 2J1KA 2VLMD 1F6FB 2OL3L 3QQ3A 4U1KA 2X5PA 5FYJL 4PJ9A 2RB8A 2ATKA 2K9UA 3OKYA 2HVJB 2AXHA 4YXKH 5JW3L 3DETC 4YHZL 2VXUH 1JF5A 3CNKA 3K8MA 3MUZ1 3QHTC 3U1SH 1AGBB 3VW3L 3OWEA 1S7SA 4NWUL 3WDHA 2XI9A 3GBNH 5DJ2A 1OSZA 3W0WA 4DN3L 1CCZA 2D7PA 3QUYD 4JCLA 2C3HA 4HIEB 1CE1H 3LKQB 5E6ZA 2VITA 3CX2A 4GW1A 4LPTA 3Q5OA 4MQ7A 3ROOB 3LKOA 1FCGA 3CMOH 4R0LC 5E9DB 1N3NB 2XY2A 4N0YH 2H2SD 1GZPA 4MXVF 4OGZA 1S9YA 2FWOA 5JOPE 4R2GB 4PJ5D 1MFEH 1BJ1H 5DSCA 2VL5A 4AH2B 5JUEL 3AS3A 4QXGH 1BJ1J 1YEDA 1IL1A 2BSRA 2Y07L 4ZQKA 5ICXA 4V1DA 5I73B 4OFPA 3DVGA 1X6NA 1C7SA 1PEZA 5KS9F 1J87A 1RI8A 4QLRA 2NX5D 5T1LD 1YA5A 2P4AB 2QQKL 3QIUC 1E6OH 3IAQA 3JTSB 4ONHB 4MA1C 1IAOA 2QBWA 1R0AH 4Y19A 1KEML 4OM0H 2FLBT 4BZYA 3EO1B 1NCCL 2YA2A 3B2UD 1WWCA 3G08A 2W0KA 4I48B 4U31A 1MLBA 1MJUL 2PCPB 4P9MH 4K3EL 1GOGA 2DAVA 3O81A 4CU7A 5CP3H 5DEFA 4FG6C 5DEZA 4FQLL 5HYQA 4DWHA 3EOYG 3AGVA 2HFEB 1EEYB 4H0IA 4KI5C 5J1SC 2DMCA 4HIXL 1CT8B 3BKML 5DJ6B 1H5BB 3T3PE 2RJMA 4KMQA 1A5FL 1QFWH 4NQSA 4F7CA 4XGZB 2H8PA 3HCVB 3EFDL 3G5YA 5SX4I 4XVUC 4WI5A 4B50A 1UC6A 4L29A 3BD5A 3S34L 3SKJL 3EOTH 1Z0MA 4KC3B 4JQXA 3QUYA 1RVFH 3MGOB 3IKKA 4I0PB 4YDKL 1MFNA 4Y4HD 1HHHB 3H8NA 1SYVA 3P77B 1WFOA 1EGJA 5FO7B 2FJFB 4Q9RH 4QEGA 4QWWD 2BRQA 2OCFD 1B9ZA 3MXVH 1R5IA 1KLGA 3HHRB 3RIFF 5DURD 2X4QA 4JCMA 2YXFA 1IZKA 1QNZH 3DX7A 1NCTA 1TQCC 3VFWA 1B2WH 1T22B 3B8SA 5FYLH 4KJQD 2X9WA 4OD1L 4PGCB 1CD1A 1KN2H 5BOZG 1J1OH 1F4WL 1G7QA 3U7YH 3QIWD 5IB1A 4YHPA 3HG1B 5IMLB 2Q20A 3U6RA 4IRJB 2VLKD 3I9GL 1Q94A 4LKCB 1UB6B 1ACYH 3GSRA 3QUKB 5LJYH 5I17A 1FYHB 2E7CA 3PWLB 1GZQA 3BP5B 3MNWB 3DSFH 1OL0A 3HPJB 1MRCH 5IHZB 1WC7B 2YSSA 4LF3B 1KGCE 5DJAB 5A2JH 4JKPH 5HGAB 4LSDA 2PUQT 3H9ZA 4HCRH 4F57L 1PLGL 1YNKH 5I30H 3OSKA 1KF9B 4HS6A 5ADOH 2YPKB 3QQ4B 3PWPA 5DRZB 3S5LG 3TIDB 3TNNB 3TBSB 3TC9A 3VGGA 2VDML 5ETUA 4HWZA 1KB9J 3A67H 3UJJH 3T77B 4JKMA 5E1HB 5TDPA 2GSGB 4F58L 1D9KA 3PGFH 1S78D 1HKLH 2HFGH 1LDPH 4HHAB 5E9DE 5SV3A 5E08H 1A7NH 1JGDB 1F8TH 5T1MA 4U3HA 1TJIL 1D5MB 2XWTB 4NN7B 3CVHB 4LHUG 4GQ9L 3FT2B 1OAYH 3LAFA 1T7ZA 2YD5A 4J4PD 1S3KH 2YPLA 4NQEA 4X9HA 5E8PA 1II4E 1NGQH 3STLA 1G9MC 4Y4HA 3VRIA 1S7RB 4ZUUA 5C07E 4H0HB 5L6YL 3TZVD 3VGAB 3QQNA 5F7NC 1K6QL 4BK4A 5DD0H 4XBEH 1MQ8A 1OAQL 4Z5RB 2W0LA 3O8XB 4F37F 1D5ZB 3IYLW 4TVPE 5I18H 2Q6WB 4M5YL 5IWLA 4GG6F 3IJSB 4ZD3H 5DI8B 1G6RL 3UBXA 4Q0XH 5CILL 3QIWA 3CDGA 3EYVB 4E5XA 4GXUM 4UTAL 4M02A 3WN5A 5EUKB 1I7TB 4HIIA 3T0EB 1VFAA 4HS3A 4YXLL 3RUGE 2NY1D 1ZLVH 2GQHA 4X9IA 4D3CL 3PWVB 1XGQB 4JFYA 4YWGH 4GW4B 1QLRA 4OCNC 1ORQB 1IAII 3QDMD 3SDXF 5J6HA 4A6YA 1BJ8A 4NHCH 1F4XL 1QFUH 5SV4A 1T1XB 2R0WL 4Y5XC 5DYOA 2Q3ZA 1BQHA 2EKSB 4LLQB 4U6VL 2R9HC 5EBWB 1FNGB 2DLHA 3P4LA 1IAMA 4I1NB 2GFBB 5T1KA 1BM3L 1SEQL 2P8MB 4WFEE 3I02A 3FAXA 1JGVL 4M4PA 2GY7B 2EDDA 3SEPA 4KUCF 5I1CL 5BCAA 5K59F 2VR4A 5GGRY 2H2PC 1BIIA 4OM1L 1AR2A 3NN8A 5ESQB 4QRRA 2OR8A 2G60H 4N9GB 3O9WD 3GFUA 2QSCH 3GIZH 4FRWA 4F33A 5I74C 4MAYA 4KRPD 2AP2A 4G6AC 2MCPL 4KQ4H 3C60D 3RY6A 5TGBB 4QXUL 3H0TB 5ECJE 4N1HB 1SJHA 4NBXB 3TN0D 3HG1E 1ZHBA 4LPXA 4WUUD 1BPVA 4RNRA 2GAZA 4KTYA 4NFCA 5BV7L 2A1WH 3K4DA 2O93L 2ZOKA 4NZRL 3SE4A 4UU9B 3L7EA 4UIKH 1Q9LA 4PP2B 4K2UH 2VZOA 1NGPL 5ADPL 2D7QA 4KDTA 3AC0A 5TQ0L 1V7MH 1XMWA 4WHTB 5CGMA 1NBQA 1BQLL 2XQBL 1IGIL 4NUGH 3MCG1 5E00A 2R29H 3WKML 4BKLB 4EZMA 1SBSL 1XGPA 1KUMA 4QRSB 4HUNB 2NY6C 3GMRA 3CXDH 1CLYL 3EO0B 2EDTA 1U8PA 3M1BB 1I9JL 3UTQB 2CXGA 3NPSB 3QDMA 3NABL 4YZFF 1U3JA 4ZFZB 1UENA 5DO2C 3BT2H 3QWOB 4TVPL 4Y8DC 1A47A 1FL5A 4ZUWB 1RU9L 4KPHL 2R2HA 3HRZB 3MGTA 2F54E 4KVNH 4NT6B 3CLEL 3CVIH 4S1QH 1E6JL 4JFHE 4QOKD 1XAUA 4HK3J 2WP3T 1KTRL 4ISVB 4PP1C 1LEKA 4HWBL 4KK6C 5IR1B 3LEYH 4YBHA 5EU5B 4Z8FL 2A6JA 3AM8C 1BIHA 4JHWL 4XI5D 3QEUB 4FXKB 4NKQB 3FL7A 5C08D 5ID1A 4JFPA 4PJIB 1ZS8A 5KSVB 4NO2A 2UZIL 5JZ7C 2CDGB 5AYUH 5I6XB 3INUH 2B5IB 2ILLA 3W2DH 3LQAL 4G9DA 3U4BH 1OAXH 4H1LH 3G04B 4AZ8A 4HG4J 1UCTA 3TN0A 3ZE0E 5HHVH 4UQ2A 5C2UB 4S1SL 3U30C 2EDEA 5AAWA 4ODHL 5DK3A 3HAEH 3S36L 3ZYIA 2P8PB 4LCCB 3BRGC 4RMVA 1G7JA 2NZ9D 1Z9LA 4O58L 3ULSB 4WI9A 2XICA 4MJ2A 4OZGA 2WQ8A 3UTOA 3WJJC 4YDIH 4GAYB 5FA4B 3C8HA 5GRZA 1I1AC 3CSYA 25C8L 2X4RB 5CZXD 5I1KL 5IM7B 3KPRB 2DMKA 1KB5L 3DRQA 5J6GA 4Y4KD 4PJFA 1MCRA 3QEQD 1X4YA 2E6QA 1LO0H 2X9XA 3TVMB 5HYJB 3PL6A 1Q72H 4PREB 4WENB 1QA9A 1U95B 1ETZA 4DKAA 3TYGH 3VXSA 3QRFM 5L88H 1A0QL 1FAKT 3FFCE 5DWUH 4U1MB 4JKLA 4KQ3L 5JW5B 3KLHD 3VXMB 4WWKC 4XCCL 1IGTA 1KCVH 1YC7A 1MFBL 1GRWA 3VG9B 3DECA 1PQZA 4ZFFB 2KUTA 3V7AG 3R06A 4OF5A 3Q6GH 1JZ8A 3DROA 4PRPB 2G2RA 2FX8H 2DYPD 4HKZA 5CD5C 2BDNL 3D3VA 4Y4FB 1IEAA 4HXBL 4LLVA 2B20A 4HKJB 1X7QA 3EGSB 4LNRB 5SWQA 1MNUH 4FQJH 3I3BA 5GSRB 5C08A 3DX6A 3NACH 2VXTH 4KZDL 1NBYB 4OCXL 4OLZH 3ARPA 3UTSA 2YOCA 1CFVH 4YJZL 1MCEA 3OJVC 4N0FB 3HNVL 4JPKH 1JWUA 1FAIL 3BIKA 4N1CA 1K4CB 1C5DB 3AU1A 3PWNA 2ZPKH 2ZUQC 3PIQB 4BQ9A 2ZZUT 4FS0A 4YHYB 3VFUB 3C6LC 3MLWH 3IDGB 1CICD 4DQOL 1A6AB 1HILB 4BFBD 3M8OH 5EZIH 3AREC 4IRSC 3RTQD 4Q2ZA 4M4RA 4XZUB 1NCDH 2DQJH 4PJXA 4WW2C 3UDWA 2RIKA 3DGCR 5J13B 5DJ8A 4Y4KA 4U1IB 3QEQA 4K9EH 5GHWH 4LU5L 3W11C 5HHOB 3AXLB 5J9PA 3EOBA 2NTSP 3ZKND 4ALAL 1G9NH 4HUKB 5IBTH 4JFFA 4OZ4B 1T2QL 4KROB 1MCWM 3FQRB 4K3GA 1P69B 1H3GA 4O2FB 1RIVH 4LASH 5F8RC 3BHBB 5C0AA 1OGAE 1XF3A 1N8ZB 4QHKI 4PJIE 4HUUA 3LQZB 2AI0H 1MFDL 1P2CA 4G7VL 5DHYA 4YUEH 2FECI 1NDMB 2EYRB 1WVZA 4PRHE 1P7HL 2DYPA 2BNQA 1FRGH 5C0CB 3VXRB 2JIXB 5EDXA 5I9QB 3S7GA 4G8FA 3LN5B 3MV9B 3ARTA 1J05A 5CD3A 3RVTD 3OJDA 1JZ7A 1CDJA 5E1AA 2PXYB 3VWJA 2HJFA 3WFCH 15C8H 4LLMB 4HK3N 5I1LB 1KN4H 4NQCA 3WCYA 4GLRH 3IJHA 5GRYA 4JM4L 1ZV5A 1ZAGA 2WWMC 2R1YA 2APXA 3WKNA 4LSVH 3U0WH 4XHQA 4LVOC 3QUZA 4IMLA 2NR6D 2Q3AA 3C5ZB 3QHFH 5E94B 1R3HA 5D2NE 2J7LA 3C6SB 4ZSOB 2GSIA 2WLYA 5E6IC 4D94A 4EXKA 4F8QA 5DFVD 2X41A 3NZ8B 3OF6A 4P4KB 5D93C 3L5WA 4ONGL 1HH9A 3S9DB 4Q9BA 2CLZB 2BP3A 4AIXA 4QKXB 4WI2A 4XPAH 5D7JA 5KSAC 3GSNH 2EEBA 2OP4L 4Y16A 2HTKC 3MLVH 1JHLL 1ZA6A 5ISZB 3DYOA 5J11C 3ZSSA 4ELMA 2HFFB 4QTIH 5IVNA 5IW1A 1F6AA 4ZFGL 5CZVL 5IJVB 3ULVE 2GHWB 5D2LA 4JRYA 3E6FA 4EN3C 3MLYH 4M1DL 5A2LH 4PJCB 3B9AA 1M4KA 2HJLA 3P40A 4JFXA 3FO2B 3ULUH 3BWUC 2IADB 3MCKA 5HVHC 1FO0B 1N26A 4AY0A 5GS1A 4L4VA 4J6RH 3JZ7A 5FDWB 4AG4H 1D5XB 2VDOH 1DFBH 1F45A 3LPGA 3QDAA 2E6PA 4YGVA 1MVFA 5DD1L 4PTUB 1ZVSB 2K7PA 4WW1B 4KJYA 3QJHB 3QO0A 4LLDA 5HYIA 1YEGL 2QSQA 4PG2A 5FYKH 5AUMA 5DA0B 4JY6B 5DVKA 4R4BA 1VADA 4FNLH 2BJMH 1A2YA 1LO4H 1Z9OA 2NNAB 4ZS7H 1JWMB 1FN4B 4BUHA 1P7QB 2FH8A 1J0HA 4M7ZB 3G5VB 3HE6B 3ARDD 2NXYD 1R3JB 3WDIA 3LOWA 1UXWA 1AY1H 4MWFB 4JDTL 3HZYA 4FFZL 4N5ED 4FHBD 1YMMA 2ED9A 3MUHL 3JWDL 2JK5B 4G6FD 4JRXE 1XIWD 4NZUL 4DN4H 2V6HA 5EU4B 2BFVH 8FABB 3IDXH 3O6LH 4JREC 2D0FA 2PW1A 5F9WB 1A6ZA 5JPMB 5F6HJ 5I8EB 3AVEA 5B8CB 3KYNB 1DCLA 1RULH 3RWJB 3MCLL 3RX7A 1FH5L 4ODBD 5IOPB 4JQXC 3QUYC 4OUUA 4HZAA 1I7RA 1T0MA 4NKDA 4CJ0A 3GBML 4MB5A 4OT1H 1INQB 3KPOB 1M05A 1OTSD 1NBVH 4HAGA 1SEBB 5C0CE 3VXRE 1L6XA 3RGVD 5TDOA 1KC5L 2X7LA 1U8JB 4YFEA 1T04A 5J1TC 3BQUB 2V2WB 2ZP0T 3NCYP 4KY1H 1JWSA 4TTDD 4UILL 35C8H 5D7SH 4Z95L 1VGKA 2PR4L 5BZDB 2NY2D 4NBZB 1IT9H 4KTEH 5FYJU 4JQIH 4ZPTB 5D7IB 1T6WA 3X14B 5F1NB 4G5ZL 1S9VA 4KMTL 4L8CA 4P5TB 3WNNA 2DLGA 5EOCH 5CCKH 5IV2A 1RK1B 2J6EL 3MV01 1BQSA 2M8XA 4MJIA 1J7VR 5J57B 4OZIB 1WJ3A 4S2SA 4DUWA 4RAVB 4ZSOE 4C59B 3ULVL 4OI7A 2DQTH 4BYHA 3HC0A 3BGFC 3GMQA 3B2UC 1IGMH 2QADB 1KG0B 3VD9A 5C92A 3A6CL 2R1WB 4QGTA 3IFOA 4OD3L 3B43A 1VFBA 4XWGL 4U6YA 3BAEL 4U1GB 1VGEH 4BSJA 3CVHH 4ZNEE 43C9A 5A16B 4KTDL 3O2DA 4WEUD 5TE6H 2EICA 4G42B 4XBPA 2HN7B 5EZOH 2JE8A 1FDLL 3JWOH 3QEHB 3KPMB 1V3MA 1NLBH 4WY7H 4LIQE 4D0DB 3U1SL 2BNUB 1KPVB 4PJ8D 4LPWA 4R9HA 4XH2B 1X3DA 4ZOEA 1CD8A 2C3VA 4PJCE 4ERSH 5KOMC 1REIA 4PRBA 2IALA 4RRPG 4LCIH 4Z7NF 1G1CA 3FO0L 2IC2A 4RQQB 1DQDH 4XB8A 2DTMH 4PV8A 4LPVA 1YY8B 4D9LH 4Z7WA 4LDOB 5MERA 1DVFD 2XZAH 3SE9L 4M1CD 4Y4HC 4FTVB 1NJ9B 1ORSB 4MB4A 3TT3L 4GAGL 2P5WB 1FNEA 2KZWA 4Y5VC 3BSZL 1I3GH 1K2DA 1Q9KB 3G6JE 3I2CH 2FR4A 4MA8H 1FVDA 3W5NA 3OKOA 1J0ZA 1TFHA 4KJQC 4M9PA 4PB0H 1RZIB 3MLSL 4ODWB 1U41A 5SWSD 4N8VG 4TPRH 3KXFD 3QIWC 3SHSA 1HH6B 1FYTA 4YHNB 1E6OL 3L3OB 4Z7UB 3WN5C 2FBJL 3HNTH 3N0PB 2NY3B 5CFHA 3D9AL 4YBLB 4OM0L 4N0UA 3KHOA 3RNKB 3V4VH 4EI5B 5C0FA 2GK2A 3BW9B 3VI4E 4L8BB 5E56A 3X3GH 3P9MB 3ZE0F 1I7ZA 3D0VA 1X6LA 4HT1L 5DVOA 5IESH 1SJEB 3CXHJ 2NYYD 3IU4L 3WD5L 4Q97A 5FYJD 4WHCA 2ZG2A 4QY8A 3GRWL 2G9HA 3TO2B 3D25A 3MRQA 1IARB 4KRMB 1MJ8L 1N0LA 2VLJD 4AQ1B 3LH2H 1MFAH 3BZFA 1DQMH 4JM2D 5HGDA 3MJ8A 4NRXA 4CU6A 3IDIA 1ONQB 5D1ZA 1S7VA 4YH6A 1S78C 4X6DA 5KVEH 1F11A 4PJ8A 1RUPL 3PV7A 5HGBB 4R96A 4N9OB 3X3FH 2VSDA 2OTUA 4GSDH 4R0LB 3KYOA 4MXQC 1RVFL 3CDYA 3KPQB 5I1EH 4J4PC 4WEMB 1Q9WB 1NC4B 4OGYH 4NM4L 1GCFA 2CLVB 4HMEA 1GHFH 1CDIA 2DM3A 1I8LC 4Q9RL 3DVIA 3TZVC 1C8PA 4RFEA 1JMXA 3WFEL 1A3LH 4C56B 4HJGA 4JLRB 3OKNA 3BPNC 3UTPE 3UCRA 3QIUB 2VLRA 1KN2L 2YD1A 4GBXA 1J1OL 4LIQL 4MA1B 4RGNC 2OSLA 1KJ2H 2A83A 3KXFA 1HSBB 2B2XH 4UT7H 43CAB 5CUSL 5JHLH 1VACA 1YEIH 4UV4L 1KPRA 1W2KT 1AE6L 3QCTH 2AGJH 3I75A 3QNYA 4AQOA 2H26B 4U1HB 3MOBH 4WDIB 2FIKA 5IIEB 5FOBA 1LMKA 4LSPH 5E5UB 2NY1C 4W70A 3T3MF 2GJ6B 4UV7H 5D1QA 1MVUA 2QHLA 2IH1B 3VXOB 4KKLD 5CGTA 4H88H 2I07A 4JKPL 2OL3A 3DUSA 4V2BA 3ECBA 2D31A 5IB5A 3IVKB 3WE6B 3U7WH 1HHKA 2VLJA 1G9EA 3T0DA 1WFTA 3LKRA 4IS6B 1NEZB 2R23B 4LPCA 3IRPX 2B1AL 2YXMA 3F8UB 5FHBL 3ES6B 1RIHL 1HKLL 1YDPA 3GSVB 4XP9L 4MD0A 5TF1L 3PF2A 1SM3H 3DMMB 2P5WE 4MYWB 1UJ3C 3O9WC 5HD8D 5IBLD 5TE7H 1OAYL 5EU6D 1KIPB 1MHPH 4Y5YA 1KXVC 4KU1A 3MTRA 1EPFA 1T89A 4KRPC 2HKFH 2EH8L 5JDJA 2A6DB 1NGQL 3BDBA 3C60C 3QISA 2H1PL 6CGTA 4X7SL 1C12B 1F2XK 1TQCB 3NCFB 3GJFK 3LEXA 1QO3B 4MCZA 5T3ZE 1UH4A 3MV8D 1MH5A 4NSKB 5HPOA 4YHOH 3JSSA 3B6SA 2ZWLT 4KV5E 4PJIF 3SQBA 4UINH 5EC2B 5GS0H 2A0LD 4J8RB 3SKOA 2X6MA 3EYOB 4KKBD 1BZ7B 4L1HA 5D70L 5F3BA 2NY5C 1QBML 2VZ3A 1RQ5A 1T4KB 2A9NH 3T2QA 1W72H 4ZD3L 1ZT7B 1BJMA 3VFTB 2I25N 2A6KB 4Q0XL 4ZUSB 2V9TA 3STZA 3KPSA 3NIGF 4P2OA 5DLML 1B6UA 4LLUA 4U0QB 3V8OA 1A6WL 3IJYB 3VFRB 1S7QB 1PG7W 2VMFA 3Q6FA 4WFHE 2R4RH 2BOCA 2MHAA 4CN6A 1H0DB 1SMAA 2XKNA 1IKFH 3DXAE 4MNHB 1C08A 3VFOA 4I77H 5EZLA 4NYLA 3HMWL 1DJSA 4ZTOL 2ARJA 4ZAKD 4YDVA 4K94C 3BGMA 4L3EA 1NCWH 1CFSA 1I8IA 2LABA 1KNOA 1QQDA 2X05A 2QEJA 3QDGD 5ILTH 4R3SA 2NY0B 1IILE 4GKNB 4LRIC 4Q9QH 1K5NB 4MMZC 4G6KL 4MQTB 4JO2L 3QXDA 5DHVB 4OZFB 2A73B 4TSAL 5KSUB 1I4FA 2A74B 1NGYB 2AXGB 4UAOC 4XI5C 1QVOB 1LO5B 4C56E 5EU6A 3C8KB 4HF5H 4J3TA 3OAYK 4PIRF 2OLDA 3MODH 4LLYA 1RZKC 3P30H 2CIIA 5DD5L 1HNGA 4GUPA 5DRNA 1QSED 4YAQA 5K9KA 1YEJL 3MLXH 4JFZH 5GJSH 1S9WB 1RHFA 5I8OH 2JCCB 3FQUA 4MB3A 5GRJL 2PF6A 2R2EB 2VDNL 1H3XA 5J1AB 1RURH 1WWWX 3TJEH 1XH3A 2NZ9C 1MCOL 4WNQB 3DPBA 1V7ML 4NJAH 1X5XA 2VDLH 1MRDH 3ZDYF 2FYYB 4YHIA 2DQGH 3GHBH 5E2TL 3C2AH 1RUMH 1YNTA 5CZXC 4KI5E 4GW5B 1A1NB 4CVXA 3HNSL 4Y5XB 5DMJB 4Y4KC 4I5BB 5HI3D 1K9TA 2R4SL 5T3ZL 1YMHA 5LQBL 2FD6H 1TVBB 1N6QH 1HI6A 1WT5A 4GKZB 4QXTA 5DQDL 3PHOB 4MNQD 4OCSH 4QHLB 1KBGL 3BT2L 4HS8L 1Q0YL 3UROR 4G8GE 1RZJC 1W8NA 3KLHC 2WSKA 3HFMH 3QDGA 4KVNL 2XIDA 3THML 5BZWA 3MO1B 1WAAE 2WP3O 1FSKC 5JIKA 3ARGA 3BDYH 4F2MB 2X4UB 3P4MA 3GJFA 4Q58C 4RGOH 4NDMA 1F3JA 2ITCB 3RBGA 3S5LA 2O26U 3F5WA 2VDKL 1D6VH 4U1NB 5I74B 2OX5A 3WIIH 3IB4A 4HPOH 1FG2A 5GGSY 1F00I 5F1OB 5IHUH 2R1XA 2EO9A 4D8PA 2LTQC 4OF6A 5IEKB 1INEL 1H3UA 3LMJH 3W2DL 4MA7H 1FVCA 1U2HA 4LHUA 4UNUA 4ZXBD 2JJTA 5LBSL 4X6EB 1A6VL 2JJSA 2W1NA 4OQ1A 3MREA 4XPTH 1LO2L 1QSEA 5D71L 1CG9B 2EDBA 4OV5A 2FX9L 3OGCA 1J88A 5EORH 5ITFA 1NFIB 3U83A 1G6RA 2VXSH 3D85B 5BO1H 2X09A 1ZLSH 4MXWH 3P4NA 1G0YR 4XPHH 3FTGA 3GMMB 3OXSB 4NP4H