4O00A

Crystal structure of the titin a-band domain a3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
SERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Titin
publication title Crystal structure of the Titin A-band domain A3
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 18
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o00A01
2GK0A 4YDIL 1DQTA 3AAZB 2LU7A 4L1DA 4Z0XB 3UX9B 4WUKL 4GAFB 4WJ5B 1RIVL 1F8TL 4ZNEA 1DVFD 4JFFB 2ENYA 3RWGA 4BSJA 4L9LC 4XRCB 3WIIL 5E2TL 5FEBA 4BFIB 3TBWA 2Q86A 3TPUB 3UTZA 3ALPA 1E4XI 4Z7WF 5D2LB 5ESVB 1MUJA 5LAXB 1NFDB 2P8MB 2AV1B 2ERJC 2J6EL 2CIKA 1BFOB 4F57H 4HG4K 2CKBL 1NC4D 1MFDL 3IU4L 5BQ7A 5C0AE 4DFHA 5T3XE 3A6OA 5JPNB 3QUYD 2XKNB 1A5FL 3BOVA 3KGRA 1MI5A 1U8QB 4Z7WB 5BRZA 1OB1B 3VA2C 5DDHB 1R5WA 3RWIA 2VISA 3ZE0E 1EEYA 3VGAB 2KL6A 4I9WE 3PWUB 3WDHA 4Y5YC 2NY6D 3O3UN 2DQFA 4RGOL 5C71A 2O5XL 4OLVH 5DMYA 4ODBD 1HE7A 4JO2L 4ODSL 2W0PA 3QIBB 4L3EA 1NMAL 4RAVA 5EOCJ 3MV8E 4JKWA 3D2UB 5HYFA 4DUWA 3MRRA 4JPVH 5AAMA 4FNLH 1CFVH 4NFDA 4CJ0A 5I71B 5GIRA 1K8DA 4JFYA 1I1RA 3X3FH 4JPWH 1AJ7H 1BMGA 2VABB 3BT2H 3GJFA 3Q5YA 4PJGE 2H3NB 5CJOL 5GISL 2CDFA 2X42A 2B0SL 3P77A 1IGFL 2R2EA 3ZDYF 1G7LB 4UB0H 5IMLB 1ZLSL 4HT1H 3OAYH 4LF3A 4KK6C 3O6FC 3BWAB 1UADC 3MRMB 4U6YB 5E8OB 5T5FH 3MRQA 5IJVB 3C6SA 1EMTL 1CDIA 5TFSH 4G6ML 3V0AC 1BGXL 3WD5L 2GJZB 4AEHH 4PB9L 5IVXE 1U93B 4WWKD 4P4KC 2EH8H 3QHTC 3U7YH 1LO5B 4Z7UF 3T0AA 1KJ2H 3G5VA 2P7TB 3QEQB 4S10A 3MSPA 3FAXA 5C0CE 5I1GH 4G7YL 1CL7H 5DS8A 4WU7A 4KDWA 1IC7H 3ZTJG 3GMQA 3VJ6A 5B39A 1MCWM 2BRRL 1KCSL 1ZT7A 2YK1H 4GBXB 4R4BA 4HXAH 4YBQC 4J3UA 5FV1L 2ZOKA 3QIWC 4QRTA 4NQCA 4HKXB 1IQWH 1AKJB 4PRNB 3WO4C 1KPRB 3I9GH 3PIQB 5DGQA 3RGVC 2ZZUT 2BSED 3MA7B 5EORL 1T66D 1ZWIA 2XWBA 3W9DA 4PJAF 2UUDH 3RTQB 1NBYB 3GSXB 35C8L 1QRNE 2NR6D 4ZXBA 4HUUB 4C83A 4L4TA 2JCCF 2OP4L 3ARQA 2G75A 4HCRA 3QDJB 3WS3B 1M7IB 2NNAA 4BA8A 3QUKB 4PJAB 5CJQH 3PNWB 5IGXH 2G5RA 1QSFD 2MWCA 4XMLL 5JOFA 2VC2H 1TPXC 8CGTA 4HGWA 1BLNB 3EYSL 4D8PB 3B9VA 4O2CA 3ARFB 5E8PB 4MQ7B 1QFHA 1U92B 3GBNH 5L9DL 3WFDH 4PB0H 5T5NG 2I9TB 1MY5A 5F9JB 1ZS8B 4CN6A 3NFNB 1YEKL 1UWXK 4LGRB 4YPGA 1YEFL 3T0BA 3BH9B 4JFFD 3DX9B 3TZVA 2R8SH 2H2SC 3ZDXF 4PJ5A 4XPAL 4YGVA 1DN2A 5FM5O 4OIBA 4R4NC 4XVUC 1QYGL 4I48A 4F3FA 1W8OA 3HAEG 4J8RA 3P9WB 3HRPA 1B6UA 2ZCHH 3MJ7A 3VWJC 1BBDL 5ENWB 1ZAGA 5CKGA 4OCRL 5KSAA 3E1F1 5I9QC 3MRBA 2Z8RA 5GS0D 4KK5C 5E00A 4R2GB 4XX1E 2A1WH 3MRIB 4CW1A 1BD2B 5L2JB 3WFHA 1RIUL 3X12B 3A67H 4UAOB 1U3YA 4OFKA 3BAEL 3MRCA 3ALWA 5C8JB 1KEMH 4K3DH 3TM6A 1S78C 3TBSA 1G7MB 4X7DC 4G8FB 1FNLA 2GJJA 4LK4A 5JUEL 2VDKL 3EZ8A 4WY7H 3UTSA 4CADA 3ZKMC 5IHZA 1QRKA 3QIBD 2HH0H 3BKJL 4NKIH 5FAAA 4OD3L 3D2UD 1WIUA 2WV3A 1DUZA 1SYVB 4MJIA 4HUKB 3E2HC 3NH7L 3O2DL 3EYFB 1XR9B 3QFJA 3QWRD 1OAYH 4WO4B 2OXGA 4P46A 4XP6L 1FN4B 2WQRA 4PV9A 5DGRA 2VLRA 3ARSA 1CU4H 4U1JA 1NBQA 4DZBA 4Y4FC 4P4KD 2VLLA 5KVMC 3L5WB 3O41B 2HFTA 4XTRD 4L8SA 4RGNC 2DQHH 1GJIA 2X40A 4X98A 3LHPL 4D3CH 1RSFA 4EJ1C 1I9IL 4ZUWA 1BFVH 1UH3A 1UB5B 3K4DA 1J1PL 4MCYB 5C09E 4YHYC 3UTTB 4K9EL 3MNWB 2VXTL 3MCLH 4M6OL 1OP3K 4HBCH 5E56A 4KGJA 3LRSA 4Y2DA 5E8EB 2VXSH 2R69L 3QEQD 4XAKE 4UTAH 3MV7A 2R1XB 1K5NB 1C7SA 1NGPL 3CH1B 5D7JB 1U8JB 5IQ9B 4NRZA 1KBGH 2UWEF 3HZVA 1VFAA 3CX5K 1SVCP 4G9DA 1IFHH 1ZGLM 5D6CA 2CPCA 4X80H 3PQYE 2CJUH 4GBXD 3NCYS 4HC1L 5EC1B 4GW5B 1CGWA 5C0EA 2NPLX 4PJHE 4QF1A 5FM4A 2VAJA 4HJ0D 2VL5B 2DQDH 5ANME 1MJ8H 4PGBA 3TJHD 1GGIH 1UWEL 2HFGL 3T1FB 3W2DL 3NA9H 3PGFH 5BJTB 3CVHA 2Y36H 3QDJD 4JQIL 5DHVH 2VAAB 1T22B 4H25B 2WWKT 3FFCE 3E8UH 3LN4A 2WINA 4P9HC 1CXFA 2VL4A 1U6AH 2WMPA 5C0IB 1G1YA 2H2SD 2YPKA 5L88L 2Q6WB 1T1ZA 5MERA 1QO3A 2B1HL 3T1WA 2FX7L 1A3LL 3KPQB 3EFDL 1R3IH 5D71L 3MBEA 3PJSA 1FYTE 1KCUH 5IKCB 3FN0H 4FXGB 3SDYH 1ZK9A 2YEZB 2EDBA 4LCWE 2D0FA 1A3QA 1FQ9C 1G7QB 4ZUVA 3U4AA 1SEQL 1NL0L 4PJFA 5MENB 4OTXL 4EIGB 2DAVA 3KPPA 4Z7VF 4ZO8A 4PJEB 3RU8L 3MREB 4HGMA 5HGAB 2D2OA 4FQPA 3NACL 2XNAB 3D39B 1MHPL 2P5EE 4XXCC 2IBBA 1U8HA 4HIJA 2BSTB 5GS2H 3NZ8B 1BD2D 2RCSH 5GXBB 4W70A 3RVWC 3BQUA 1TQCB 1J05A 4ZD3H 1G9NC 1CDBA 2YUXA 1A1OB 4OZ4A 5EUOE 5SWZE 5IMKB 4GRMA 4XMKH 2IC2A 1LEGA 1LD9A 1W0WA 1BZ7A 9CGTA 1F42A 4PS4H 1QP1A 5GGUA 4PP2B 1AP2B 4O58H 4Y4FD 4P0DA 5HVGB 2D7MA 2E27H 5E5MA 4RGND 2COQA 5CZXC 1R3HA 4L29A 3D1MC 5IVNA 4WO4D 2CDEA 4N0CC 4ONOA 1P4LA 3RFZC 2N7AA 1DQML 4ESKA 1YC8A 1FCGA 4OM1H 1OHQA 1DEEA 1KENL 2O5YL 2AJ3A 3TT3L 1QKZL 5JXEA 3JWNC 2E3VA 1I3UA 1F6AA 4F58L 4GRLA 1GZQA 3T3MF 2R0ZL 2UZXB 4OB5L 4FFYH 3UTTD 4IMLA 1SBBA 1QG3A 3MPCA 3NFSH 4JDTH 5I15H 2AJSL 3ZT5A 3KPRA 2HN7A 3LCYA 1D7FA 1GGBH 4L3CA 4GUPB 4YIQA 5F9WB 1HZHL 2GEEA 4JCLA 4XNXL 2Z31C 3T2QA 4TRPH 1B2WL 1ACYH 1K2DA 3MLVH 4H0GA 2F8OA 1P7QA 1RFDL 1P9MA 5D7JD 5KVGH 4NYLA 3O4LE 4KZEL 2RJMA 3U30B 1IAIH 1F6FB 4JY6A 5BMFL 4ETQA 5D1QC 2CGRH 5DJAA 2DMBA 3W5MA 1IEBB 1PZ5A 4ZS7L 1XF3A 4PBVC 1M4KA 1HWHB 2XV6B 5EZOH 5DD3H 2EYTB 1OSPH 3UTOA 1O7VA 1IM3A 4PGDA 1MJUL 2FD6L 3K46A 3CXDH 1A6PA 1BBJB 2R4SH 1A4JB 1TXKA 3L3OB 5FYJD 1YPZE 5T1LA 3RVTD 4K23H 4I5BB 2VN4A 4Q6IA 4NT6B 1ZGLB 4KQ3H 4PRAA 2ICES 4HGKC 4XB8A 5FO8A 3TYFA 4HPOH 3CNKA 1FVDB 2OL3H 1T80A 2B5IB 1A14H 3HA0A 3QQ9C 4YHML 1FLRH 3H9ZA 1WV7T 2PXYA 3GK8L 5IVZA 4PJ9C 1DLFL 3BUTA 3DV6B 4HLJA 3V5KA 3QCUH 3U4BH 5C86A 2YPLD 1FVEA 3ULUC 5DJCB 2FBJL 1I8LA 3KS0J 3MRNA 4AEEA 1H8NA 3ULVC 3FMGL 1I7RA 4Q0XH 2L7JA 5K59E 3B83A 1SJHA 5MEND 5D7LB 1ZHBB 3MO1A 4UT9L 2IH3B 4O51B 1DBJL 3IDGA 4P3DB 5I8CA 3C2AH 2OK0H 4ZYKA 4E42B 3FB5B 3D39D 5FFLA 1A64A 4JFXA 4QOKA 3UBXB 4LASL 4TSCL 4H5SA 2GKIA 2EH7L 1RI8A 2VNCA 1BQHA 2ICWI 4NO3B 1EVUA 1F4AA 1OW0C 2BY3A 5EUKB 5T5NF 2X4OB 5DEZA 3EDKA 4ZTPL 1NJ9B 3CDGA 2XOTA 3O11A 4X5XB 1OAZL 3QQ3B 5FCUL 4X5WA 2VB5A 4K7PX 4JHBA 1FCCA 3F12B 2JJSA 5CEYB 1R3LA 4EOWL 4OCMC 3S5LB 3O45A 3MTRA 2NTFB 3OKOB 1CD9B 1TETH 1JP5A 3CPLA 5DR5H 1M7XA 5KOVC 3CSPA 4X6EA 1B4JL 5FGBC 5INCB 2WZPD 3MV11 4F7CA 5CD3B 3HLAB 2DQCL 1WAAA 3SJVE 4Z7QF 3AREA 5FGCE 1U42A 4ONHA 4DGIL 2VSDA 5DMGD 1NEZB 4L8DA 1XH3B 3STZA 3PF2A 4DAGL 5GJSL 3SDCA 4MDJA 4GMTH 4I0PB 4D9LL 3AXLA 3MLRH 4YHKL 5I0ZA 1AHWC 3WS6C 1H15B 2IH1B 4XMPH 3TIDA 2DLIA 4OZGF 2CRZA 5DRWB 3EKCA 2BY2A 4K71B 3TVMA 4JGMA 1AI1L 3EOAB 4OIIH 1YMHA 1QBAA 1VACB 2JJTA 5F9OH 3QPXH 5LBSH 1WWWX 2HT3D 2G5BA 3MNVA 1T89C 3QNZA 3QWOB 3S35H 2IPUK 2OMNA 5EOTB 1SYSB 2BSRB 3V7AE 1PQZB 3BRFA 5C0AB 5DO2D 1Q38A 4FHBD 5I1IL 5F7DB 1I7UB 1A2YB 4UQ2B 2HRPL 5DC0A 4U05A 4GQ9H 3TIEA 2YRZA 2JTDA 5IB2A 3OKDA 2HAZA 3VXQB 3IFLL 1JYWA 3M17A 4DKDC 4NO5A 3RZCB 3UYRL 2FJGB 2FX9H 5GGSY 2VDRL 5ESAA 1X5YA 3MV8B 2E6PA 4XC1L 1DZBA 2C1OB 1ERNA 5BS0A 1OP5H 4M93C 5AG9A 1IEHA 1AD9B 2HTLC 1ONQB 3EZJB 2BK8A 4PJGB 4XWGL 5CIPB 1FZJB 5E1AA 1KCRL 4PRBB 2I9LB 4POYA 5C0ND 2VITA 1ZA3B 5KJRL 2D7NA 1CR9H 3KYKH 2GITA 3BD5A 3QR2A 4JHAH 5D7LD 5F44A 4ONGL 3CH8A 3H42H 3G6AA 1N5AB 2P5WE 2BY0A 1A7QH 1MAML 3T8XB 3S3JA 5IVXB 3K4ZA 2ARJB 4Z6AT 4NJ9L 1FFPB 3QCVH 1HYRC 4JVWA 3WNLA 1T4KB 2ADGB 3MRHA 1KPUB 5JQ6H 4JQXC 3G6DL 2WBWB 5LQBL 3P4MA 2GYSA 3N85L 5C0CB 1GC1H 5ICXA 4GAGH 5DUBA 3RBSA 2AK4E 1KNOA 2W65B 2NW3A 4MCZB 3SGDH 1OCWL 2BX5A 3AY4A 3MJ9L 5JORA 4X4ZA 5BOZG 1QVOB 3JVGC 3GI8H 4PY7A 1AR1D 3L6FA 3HR5A 4KHTH 4MXQD 4BZ1L 1ZV5A 3FRPG 5DZNA 2NY1B 1XF2A 3CGTA 1VA9A 1AC0A 1CE1L 3BDYH 2D4DA 5DJYA 5BXFB 1BX2A 3SBWC 2P48B 2EYRA 2VLKE 5SWQB 3P0GB 3T08A 3VE0A 1WZMA 1XGTB 1ZTXL 1T03H 1U8NA 1QRNB 4L5FH 1G6VK 2Y07H 4LCIH 2Y9RT 2GCYA 4U0RC 4L8CB 2E6QA 1UM4L 1JCKA 3KWWB 3KG5A 3SE9H 4M7JL 3T2PA 4I0PD 4I18A 1ZA6B 5C3LD 1QR1B 4WUUA 3S36X 4OGZA 3TN0B 4CMMA 3NZHH 2VDPL 4XNYH 1ORQA 1S9WA 1LO3L 4X8JA 3KPOB 1U9KA 4OGAC 2O5ZL 2AJZB 2BMKB 1W0VA 3OKMA 3TGXA 5I2IB 5E2UL 2DRUA 3QXWA 2Y6SD 4ODHL 2R15A 2EDKA 3IFOA 2RQ8A 1AXTL 2GY7B 1XR8B 4CBPA 3UYOD 3H8NA 3RWFA 2AK1L 1INQA 1KF9B 5E70A 2Z0BA 3NABL 5FOJA 2V17L 4GKSA 5DK2B 3ZKXC 3VXMA 3UPAA 25C8L 2D3VA 2XY2A 5EZIH 5CJXC 1I9JH 2FHBA 5DWUH 3RGHA 3KLDA 1N26A 3FOLA 4FTVA 1L7TL 3MRGA 5F71A 4IIQB 1KTDA 4YFLF 3X14A 3OB8A 3B43A 1UCBH 4FQCH 4KRLB 1UYWH 4QRRA 5F88B 4FXKA 5TF1L 1F13A 3TV3H 2V5RA 4GG6A 1PKOA 2CDGB 3L9RB 1RZIB 3I02A 1SEBA 1VFBA 3F6LA 3GIZH 1CG9A 2ED8A 5GGSB 1RULL 4AQOA 3RZCD 2ZPKL 2HFEB 4OI9A 1KV3A 3MV8D 2ZNWA 1S7RA 1YNKL 4I77L 4TNWF 1EFXA 3HS0B 3QDME 5I1EL 1RVFL 4HHAB 4KHXH 1HHJB 2WK2A 3MCKB 4YDJB 2EZ0D 2XKSA 3WFEL 5E24E 3QB7C 2E9IA 1Q72L 4LIQL 4H1LB 2ZUQC 4OLXL 1YNTB 4M8QB 4MGXA 5FECB 4UILL 2CLZB 1QLEL 3GSNB 4GW4A 2VZ1A 4R26L 1A6ZA 1WLHA 1LO0L 4NM8H 4P2RE 5C09B 1JGLH 1UFUA 4PJ7A 5D7SH 3X13A 4G8GE 3OKEA 3CAFA 2EE3A 1K6QH 5KSUA 1L0QA 2WP3T 2F19H 5C0CD 1WBXB 1NANI 4XNQB 3UO1L 4D0CA 4F7MA 3VRIA 2WBJB 3BN9D 4M7KH 5DFVC 2R4RL 2V6HA 2W07A 1A6TB 4QCIA 4C55A 1H3GA 4LAQH 5T33H 1CFNA 2RGSA 3EYQD 5GRYA 4JKLA 2FDBP 5JIHA 2AEIT 3PQYB 3HI6H 2R0KL 3GMRA 3BKCL 4WHCA 1LGVA 4PJHB 4LMQI 1VESA 2NY1D 5E8DL 1RZJL 1BFSA 3B9EA 3J8F7 3MNZB 4XPFH 5ANMB 5FA4A 5CSZA 4YHIA 4APQC 1ZSDA 3QO0B 1NFIA 1CFTB 3V52H 5D2NC 5J13C 3TWCH 1QRND 1H0DB 4WI4A 4Y4KC 1KGCE 3VXNB 3ARZA 4ZG1A 2XZQH 3QHZH 4HS8H 4Z0BL 5TQ0L 4WI2A 5IMMB 3QAZC 4TSBH 3W0WE 1JHTB 3FFCB 1H3PL 1CXKA 2GI7A 3CFEA 1C5BL 1RAMA 4PRPA 5FYLH 3WJJC 4G8IA 4JPKH 1HK6A 1VB9A 5ACZA 2A9ML 3D25A 3CFDA 4DZ8B 3TN0D 4ZUTA 4OGYH 2XY1A 3KPTA 4RFEB 1HXMA 4HCRH 1MCQA 1Z3GH 4WI9A 1BWWA 3OV6A 4IS6A 4MJ5B 1FYTB 5E9DA 4YAQA 1H5BB 3VI3E 3H3PL 3HI1B 3NVQA 3S3PA 4LCWB 1IKFL 3QEHB 4UTBL 1TQBB 4HFWA 5CBAB 1A7PL 2JK5B 1LE5A 1T5WB 1IBGH 1HSAB 1HSBA 5DT1L 3VH8G 4MA3B 1R5IB 4RWYL 4P57B 4NHUA 1K9TA 3S6CA 5KZCD 4IHOB 4Z7OF 2E9BA 3PWVB 1WSST 1OAKH 5FV2A 2B1AH 1T7ZA 2P5EB 1GH7A 5HHPA 5LGJA 2OI9B 5C0JB 5KSVB 3WXWL 4FQJH 1C5DB 2FX8H 1K4CA 2Z93A 2NY3B 4IMKA 5HYIA 3MACL 5JOPE 3QDGA 3SCMB 4H20L 5FGRA 4XPBH 1RUAH 5SWZB 5EUOB 4AIOA 3PV6B 2R2BB 2W9EH 4K07A 1TZIA 2X4QA 2MPAL 1P7KB 4OLZL 4XP4H 4PLKC 5I19L 5EU5B 1NSNH 1DVFA 1Q94B 1OT1A 4EZMA 3ZE1F 1HILA 1MI5E 2GJ6D 2GSGA 2LU3A 1MOEA 4KKNA 4XVTH 2GFBB 1NC4A 3E3QC 2R2CA 1IC4L 3UPRB 3VDBA 2FWOB 3U1SH 1ZHKA 2Y06H 5IBTH 3QUYA 4LKXB 2W91A 2Z4QB 1I1YB 3T77A 1CICC 3MJ8B 4UDTA 2ZUYA 3P0VL 1CGVA 4F57L 4JKPH 5TDNB 3M1BA 2HYMA 3IDYB 3MV9D 4QGTA 1S7XA 3HNTH 1EAPB 5J8OA 1I4FB 2NY0B 1GGCH 4PTUA 4E41D 4PJBE 2IMMA 5C09D 5DFVD 1ZLVK 1NCAH 3SQOH 1OD9A 2AXFA 3RNQB 4ZPVB 3PDOA 1SQ2N 2NXYC 4O5LH 4NNPL 4XAKD 4OAWB 1O0VA 4Y8AA 2A0LC 3IVKB 1HQRB 3O3EB 4NWTH 3CLEH 3IFPB 3HPJA 3X11A 2FB4H 1K4DA 2HT4C 2WBJD 3UJIL 4M6AA 5HGDA 1JPFA 1IILE 1KSRA 3O4LB 5DEGA 1IAKB 5L6YH 3ZHLA 3GI9L 1ND0A 4JPVL 5MEQA 2DI7A 3X3FL 1YPZF 5DMJB 5JW4M 3REVA 1NDMB 1OGTB 1AGCB 4AENA 4N8PA 5BV7L 4JFZH 4HJGB 1NMCC 4JZOB 3T2OA 2FECI 3IJHB 3MLXH 2H6PB 2VDLL 4XBGA 3VXUE 1WK0A 4KUZH 5T5FL 1YPZB 4LP4A 5GRUH 5CHNA 2J8UE 4MNHA 2DMKA 3TFKC 5JR1L 5TFSL 2V5SA 3FFCD 1MCWW 3TESA 3MGOA 3OB0H 2EH8L 4TTDC 1MELA 1PLGL 1U8KA 3UZVB 1DBML 3ES6A 1KJ2L 2IBGA 4FQXC 4CN4A 5HYQB 1T6VN 2X6MA 5K59F 4NNYA 3FO0H 3CK0L 1CL7L 5DFTA 4JFPA 1FYTD 1L9MA 1RZ8A 5IEKA 5IIEA 3ABZA 4L4TE 3IDMB 5EBWA 4UBDC 1HIML 1MLCA 4LCWD 2EIZA 4HXAL 3B9KC 2JJWA 4F9PC 2YMXL 1E4XL 3G5ZA 1IQWL 4XP9L 3I9GL 2DWEA 4QO1A 2P8PA 2YRLA 1Z0NA 2LABA 4HG4J 4HWZB 2F58L 3QXVA 4S1QL 4X7TA 4OSUH 2OR9L 3NCJH 1CDGA 5J9PA 4DW2H 1A3RH 4N0RA 3RY5A 3Q1SH 3GSQB 4LLWA 4PLKD 4K9EC 1QSFA 4LCCB 4AEIH 1Q9WA 4HULB 2O61A 2NY3D 4MMXC 4PJXF 4O2FA 4UUJB 3QJFA 3S37L 4PJ5E 3HPLA 1TVHA 4U1HB 3O8XB 5SWZD 5E4EB 1DUYB 1PY9A 2VC2L 4Z0XA 4F7PB 4WJ5A 4NQXB 4X7FC 5HYSA 4JFFA 5E95B 2AERT 4BFIA 4NQDE 3GBNL 1AY1H 2GAZB 3TPUA 5IFJB 2F53D 5D2LA 1I3RB 5LAXA 1NFDA 3V8CA 2AV1A 4P9HH 1S7SA 5TDPB 5FYKE 2R8SL 3SJVB 5JPNA 5FGCB 2XKNA 4HAFA 3AU1B 1D3CA 5J57B 2J1KA 1U8QA 2Y23A 1OB1A 1VGKA 4HH9A 1TJIL 5C07D 1J7VR 5DDHA 1WT5A 2DWDB 3PWUA 2A0LD 2NY0D 2ZCLL 4IOIB 4QXGH 3UROR 4MHHI 4PUBL 2A1WL 4BZ2H 1CLCA 4ZO9A 1IRAY 3O9WC 3QIBA 1NCBH 1AFVH 1KEML 4K3DL 4G3YL 1U3HC 3D2UA 3LB6C 2VLRE 1RK1B 5EOCH 1FNAA 3GB7B 4DJMA 1FH5L 3QWRA 2VABA 5HDQL 2CXKA 3O4LD 4OQ1A 5FKAB 5ETUB 1LWRA 4ELMF 3STLB 3L7EB 3RTQC 3TJEH 2CO7B 4YO0B 4OV5B 2H3NA 4K7FB 2PTTB 1G9NH 2VIRB 1YZZA 5DVNA 1G7LA 5IMLA 5KG9B 1PKQE 4LLUB 1FAIH 3BWAA 3MRMA 4U6YA 5E8OA 1RJCA 5IJVA 1ACZA 4PY8I 1CU4L 3OPZH 4LLAA 1YEIH 2GJZA 1U93A 4M7LL 1ZEAL 5DJ8A 2H32H 3EO0B 4HQQH 1LO5A 1I8IB 2P7TA 3QEQA 4AJ0A 1CK0H 4Y5XC 2CLRB 1E6JH 1ZVSB 3MRJA 2GUOB 4QHKI 3MCLL 1C1EL 3TA3B 4OCSH 2PO6C 4JVPA 4UTAL 1JYXA 4NZRH 4GBXA 3OR6B 1FFOB 5EDXA 5ABDE 2BY1A 2CD0A 1T83C 1KBGL 4HKXA 4P48A 4PRNA 1KPRA 3PIQA 2B7DT 3MA7A 2H2PD 4PRDA 1KB5A 2CJUL 1EGJL 5JMOC 2GIYA 5JHDE 1XF1A 1YA5A 1NBYA 3GSXA 3BP5B 4PR5B 4HUUA 2DQDL 3S34H 4HUWB 2P5WB 1ORSB 1MJ8L 1IGCH 5DRNB 3QDJA 3MMEB 3WS3A 2Q7YB 1M7IA 3SE8H 3QUKA 4TPRL 1CD8A 1GGIL 3PNWA 3IXAA 4GXVL 3IJSA 1EX0A 3NA9L 3DUUB 3OKKB 3ARVA 1BLNA 3L5JA 4D8PA 2AK4B 3GJFK 3MLWL 4JE4B 3E8UL 4XBEH 4MQ7A 4HD9A 1HI6A 1U92A 5FUOH 5I8EB 2I9TA 4PJFE 5B4MD 4B50A 1XCQB 5CP3H 1ZS8A 3NFNA 4GMSH 2FEEI 3DX9A 2D0GA 1R3IL 1QFWI 3PWNB 2X7LB 2XT1B 5FGSA 2CR3A 3NN8B 4G42B 2DQIH 1SY6A 3FN0L 2VLKB 3SDYL 4PJDE 2JLLA 1F58H 5ENWA 4ERSH 3SJVD 5HVHB 2ZUWA 3MLTB 1FC1A 4M5YH 3GSWB 4FP8H 3ARWA 3HNSH 1G7IB 4JM2F 3LZFH 5D8JH 5KW9H 1BD2A 3T0EE 5L2JA 5B3JE 4RMWA 4TVPH 2BVPB 4OZFB 4POUB 3X12A 3ULUH 1U3HD 1BQLL 3BPLC 3LQMA 4UDUB 1LNUB 3VGDA 4XHJC 3ULVH 4KDVA 7FABL 2VERN 3BIKB 5F1IB 1G7MA 1XIWB 4G8FA 1YEDA 4KMTH 3U7AA 1QHOA 5D9SA 1RIHH 1S5IL 1VEPA 4P23D 4ORZC 2PW2B 4Y4FA 2FHCA 4XMKL 3SKOB 2ID5A 1BHGA 4S1RH 2K3TA 3EYFA 5E6IB 4KZDH 1FRGL 4KRMB 1N0XL 1DN0B 4YDLB 4LVHC 4WO4A 3S88L 5D6DC 1TVBB 3IAPA 5FF6A 3CX5J 3PABB 1DJSA 1P4BH 5JNYB 1WFTA 2E27L 4TQEH 3L5WA 3O41A 3OXSA 1N4XH 2BNQE 3G9AB 1B88A 1P69B 3IDNB 1MH5B 1D5IH 2O26U 4NKDB 1V8HA 4N1CA 4S1SL 4MCYA 1UB5A 2YR3A 2JF1A 3UTTA 3DJ9A 5B8CB 3MNWA 2KBGA 3WIHA 4NRXA 5C6WH 1S7WA 5E8EA 3QJHB 1EJOH 4U1MB 4QXWA 3RIFK 1IL1B 1QEWB 1EHLH 2R1XA 2YD4A 4MVBC 5C0GB 1K5NA 3G6JE 3EDJA 3MBXH 2Q76B 3CH1A 1GGTA 4JDTL 2DQGH 1A6WL 5I15L 5D7JA 1U8JA 5IQ9A 1A8JH 4XCEB 3TA3D 3QDMB 3QQ4A 2CSPA 3EJJX 1NCDL 3F7YB 3ARXA 1LDPL 5L8JB 2AJXH 4EKXA 4OGXL 5EC1A 4KVCH 4GW5A 3A6CL 1UXSB 1UZ8B 1CLZH 2MFNA 3EW3B 5E94B 2VL5A 1IAIL 5D96C 5IBLC 2VN7A 3D9AH 3KVQA 4LLVB 2OZ4L 1OPGH 4JN1H 4C4KO 3VWKB 3B8SA 3HFMH 3MZTA 4JDZB 3ZT6A 2OTUB 2ADIB 3C6LC 2W9DL 4ODUB 4LPWA 2P5WD 4M61B 4P2RB 3UJJL 4HKJB 5BJTA 2Q20A 4L9DA 5KS9F 4XP5H 1T22A 1T7VA 4H25A 3R8BB 2DBLL 4G8GB 3QI9B 2X4RB 2H8PB 5HI3C 1RV6X 3SDAB 3FB6B 5C0IA 4JO1H 1GSMA 2Q6WA 2AK4D 2WWMC 5DA4A 5I30H 3LD8C 1ZT1B 3OWEA 4N8CL 4CU7A 5IKCA 1WTGT 1PBYA 5EBMA 4OLYL 2YPLA 4FXGA 3SDDB 3VFGL 4Y2OA 3V4UH 4YDKH 2BDNL 1G7QA 4LDEB 3OSKA 4Y16C 5B21A 5ADPH 3DYMA 1WEJH 3U4BL 5MENA 2J5LB 4K3EH 1ADQL 2VLKD 5CILL 3WN5C 5IB3B 5LVEA 3D87B 4PJEA 3HE7C 4TUJB 4RFNC 1JWMB 1CLOH 3WXVL 4AMKL 3MREA 2IBZX 5HGAA 3WEXB 4XHQA 4OF3A 4JGUA 4U3XA 2XNAA 3D39A 5JA9A 4LQFH 1MWAB 1Z2KA 5DC4B 2M8XA 3NA4A 2PW1B 4LSUL 3V5HA 3ARDC 3PHQB 4JR9L 3W0WB 4IRSC 2BSTA 5HHOE 3NZ8A 2HTKC 4C58B 3C2AL 3KYMB 1E4JA 1INDL 4F15B 1INEL 3UDWA 1A1OA 4ENED 4XPTL 4LSQH 4NFBA 1XIWD 5T3ZH 5IMKA 1G7PA 2DQTH 3SGJC 3BD4A 4X6FB 3HZKB 1HQ4B 1X5FA 4PP2A 2KZWA 1N64L 3CLFL 1AP2A 3KYOB 2ZSWB 3C5JB 1S9YB 2KH2B 2BHYA 3C08H 2C4XA 5EU3B 4A6YB 5E6ID 1TETL 1JZ2A 4NN6C 5DR5L 1IT9H 1PAMA 3CC5B 3QG7H 4KJQC 3WDJA 1TNNA 3X3GH 1LMKA 3LH2L 2LVEA 5CJBA 3V4VL 1U0QA 3HCVB 4X7SL 2GK0B 1PG7X 1T7XA 1KACB 4YHOH 3ILPA 1DFBH 1FORH 1EIBA 4KDTC 1FGNH 1UACH 1CXIA 2YPVH 3KPNB 2EICA 3ARGC 3H7LA 3QDAA 1MEXH 4GMTL 2X4PB 1JRHH 3K1DA 2XN9E 4QNPE 1BJMA 1JGDB 4GUPA 5J06A 3RKPA 3VFPA 4HAGA 4RNRB 2R56L 4YBLB 5A40E 3DVNB 4U1KB 3TT1H 1MI5B 5IHLB 3F8UB 1R5WB 3QUZD 1KCLA 3RWIB 4D0DB 3CFKA 5IUSA 2IALB 4NRYA 1FO0L 5LBSL 1E28B 4F7EB 4PJBF 3LEXB 3KR3L 1IEBA 3S35L 5DQDH 4AM0B 1XEDA 2EYTA 2LTQC 5FUCE 3VWKD 2NXZC 4RAVB 1BBJA 1Y0LB 1A4JA 2EECA 4NHCL 4XC3H 4M48H 2ZJSL 4PJBB 3VFOB 4P2RD 1HNFA 2WWMD 4I5BA 3OBAA 4NT6A 3UC0L 2EE9A 1V7NL 4G8GD 2DF3A 3PL6B 1JZ4A 3QI9D 3SDAD 3V6OA 5CSBA 2NYYC 4CNIB 1FVDA 4OUUB 3QUMB 4YPJA 2NY5H 1XGPB 1BQSA 1Y6NR 4I3RH 1BVLB 1T3FB 3O0RL 2FX9L 4Y16D 2X89D 4U1SB 4MAUL 3DV6A 3MRQB 3HR6A 1PZUB 1RUKL 3R0NA 3SDDD 5DJCA 3ROOB 4O2EB 3KS0H 1CFBA 1WF5A 1N5YH 3LKPB 3VG0H 1Z9LA 5DFWH 4NC1E 5D7LA 1ZHBA 5DZOA 3WFBH 2IH3A 1EO7A 2ZSVB 4O51A 4OT1H 5ISZE 4HEPG 5DJ6B 1D9KC 1VEOA 2G60L 3VXUB 3WHE0 4E42A 1CR9L 3FB5A 3KYKL 3GMQB 2XA8H 5CUSL 2J8UB 4KJWC 3UBXA 1A1MA 3H42L 3V6FA 4LLYB 4NO3A 3W0WD 4DGVH 1B6DA 2IAMC 1GIGH 5EUKA 5ITBL 4O9HH 1NJ9A 1AD0B 3QQ3A 1ZWIB 2FATH 3F12A 3S4SA 2YA0A 1YECH 5CEYA 5HDOA 3ECBB 4GAGL 3OKOA 5GRJL 3REWB 2YN3A 1T7YA 4LHUG 2AXJA 4EN3C 2EDJA 1A7RL 4L4TB 2ADJB 3Q0HA 2AXHA 1BQHG 3DMMB 5AZEH 4KPHH 3GI8L 5INCA 4IDJH 5CD3A 4S0SD 1ED3B 1MFCH 4D94A 3HLAA 1JGUL 3QNXB 5LCVL 2E7BA 4X9HA 4PPTA 1QBLL 1AHWA 4Q9QH 4BYHA 3ZHKA 4U0QB 3FHAA 3ARGD 5GZOD 1OSZB 1F8TH 1XH3A 3LSOA 3WIIH 3FN3A 5CS7A 3ARYA 3OQ3B 4E5XA 4I0PA 2OQJB 43CAB 3NAAL 2AKRB 5D1ZB 5GSRB 3IU4H 5JOPD 1H15A 2IH1A 4UIMA 2X4SB 1WC7B 1GPOL 2QL1A 2AS5M 4X4XB 3CUPA 2BCKB 5DRWA 4F3FB 2A9NH 3OKLB 1Q0XH 4J8RB 4X7EC 1GAFL 1X5IA 1B3JA 3EOAA 2SEBB 4A2MA 1VACA 1NDGA 4NQDB 2X9WA 5KSAB 2NY4C 3K0WA 4YHLH 2JELL 3QWOA 4RGOH 4BH7B 1BOYA 2O5XH 3QHFL 1L4IA 3IGAB 3LKSB 4OCXH 1W8NA 4DUXA 5EOTA 4HJJL 4RRPA 2BSRA 2NXZD 1PQZA 4ODSH 2CUIA 1RZJC 3MRCB 1NMAH 4NUJB 2XWJB 3MOAL 3QH3B 5F7DA 1I7UA 4EXKA 4GG6E 1A2YA 3JTTB 4UQ2A 3MUGB 3DOSA 1UEMA 1IVLA 2D31B 5DWUL 4LGPB 5F96L 4H88L 1NH6A 1DUZB 4MA8H 3VXQA 2MSPA 1S3KH 4L1HA 4G6AC 1IGFH 2EC9T 2R1WB 1SJVA 2J12B 3RZCA 2FJGA 3PL6D 3K81A 4FQCL 1ZLSH 4BQ6A 5EIQA 3MV8A 1FL3B 2VLRB 5CEZE 4I3SH 1FSKC 4U1JB 3RDTC 1EMTH 3TO4C 4G6MH 3BVNB 1BGXH 2C1OA 4XCNB 5J12B 1UJ3B 1T0MB 4PB9H 4NUGL 3PGDB 1AD9A 1LHZA 1TDQA 4M7ZB 2EE6A 1HYSD 4RAUB 1ONQA 1FBIL 4M43L 1PEWA 4PJGA 4AZ8A 5CIPA 1FZJA 4D9RE 4BFEA 4PRBA 4G7YH 4L3AA 2I9LA 5EH1A 1I1AC 1BREA 4WEUD 1AXSB 1F4HA 1ZA3A 2ATPB 4F8TA 1PKQB 4J4PC 4I3GA 5F8RC 4OFIA 1VPOL 2BRRH 1NAKL 1N5AA 3T8XA 5IVXA 2ARJA 3MQIA 4J3TA 3VXUD 1FFPA 3A0OA 2GY5A 3DRTA 4NRZB 5KVEL 3GM0A 5DD0H 5IR1B 1W2KT 1KPUA 2APXA 2I07B 2X1PA 1J8HE 3CCHB 5EORH 1OL0A 5C0CA 3R8QA 2OS7A 5J11C 1JGLL 5D7SL 35C8H 4M7LT 4P3CH 2W65A 5FYJU 3O6MH 4MCZA 3LVEA 2V5YA 1EERB 2OP4H 3LQAL 5GSVB 1X4YA 2D9CA 1TZGL 1H9VA 2UVEA 4M7KL 3DXAE 1KTRL 4JDVB 4LPCA 1I3VA 3VMOA 4XMLH 3DMMD 3QULB 5L0QC 5JHDB 2VUOA 3LN4B 3UXFA 1NAMB 5ECJE 4OM0H 1XGTA 5JDJA 5L9DH 4H0IA 3VD7A 1KJ3L 1QRNA 2IQAB 4XPFL 4OIAA 5KAQG 3P4NB 4XNUL 2K1MA 4Y5VB 4L8CA 2ATKB 3KWWA 1YEFH 1PG7W 1FG9C 4PJFF 4WV1C 3V52L 5HHNB 5JW4Q 4K55A 4HS8L 1K3IA 2VXQL 4Z77B 5D1ZD 3TN0A 4JJHA 4JEGB 5F1SA 1BBDH 4XVJL 4ELKB 6CGTA 2FO1A 3KPOA 3N1QC 2DTML 4PJFB 3C60C 2AJZA 1I1FB 4LSPH 2K7QA 2Z92B 5I2IA 4HCRL 4LLMA 4O4YL 1RIUH 4NQDD 1XR8A 4TVSa 3I84A 3BAEH 1JZ5A 2DOCA 3BKYL 2OCFD 2NY2B 1F02I 5DK2A 5H2BB 2FEDD 4RDQF 4PJDB 5FYKD 5JUEH 2CLVB 2VDKH 3QIUC 4LPUA 5BV7C 2PTVA 1QFOA 4OD3H 3F6IA 1IBGL 1BPVA 2Y7QB 4RISH 2QKIB 2QQNL 2UY7A 3T0EB 5HI4D 3O2DH 4IIQA 4NO2B 1MF2H 3TO4D 5F88A 1X5JA 5FM5M 2R1YB 5GS0H 4JFED 2ICEA 3L9RA 2CDGA 1RZIA 4RBPK 1V3MA 3MLYL 3ORJA 5E5MB 3NIGF 5GGSA 1CVSC 3TBTB 1CTNA 4OLWH 1EZVY 2GK2A 2HFEA 1S7UB 2CDEB 5FKPB 3K2MC 5IK3B 3VD4A 4KKBC 4J12A 2GJ6A 1I9IH 3EUUA 3HS0A 1NSNL 1J1PH 4YC2B 4HHAA 1MCLA 2AJ3B 1HHJA 4J4PD 2VXTH 4M6OH 4YDJA 5I1CH 1E27B 1CGXA 2MTPA 1J10A 4LDLB 3QYCA 4XVTL 3DX8A 4H1LA 5JDSB 3PDGA 5I75B 3WNPA 4FQLL 1YNTA 5K9QG 4M8QA 3MV9A 5FECA 4QRSB 1A22B 2BNQB 5IBTL 2CLZA 3QXAB 3LRHA 3GSNA 5GPRA 4E41A 4H0HB 5D70H 1EAJA 5C09A 2A38A 4HC1H 2W0LA 5ID0B 5F7MC 1LE9B 5HGHB 1RUML 3HNTL 2HG5B 4IRJB 1T0PB 4L4VE 2OTWA 1QFWM 1WBXA 1GYAA 3SPVB 3G6JB 1NCAL 4WHDA 5DJAB 2F74B 2J6EA 1A6VL 2WBJA 2AABL 2CKBA 2QADC 3MUY1 5I6XC 2X05A 2XPGA 4O5LL 1A6TA 1J0JA 3RI5K 1H8OA 5ACLA 3FZUD 3HI5H 3PQYA 5F21B 4XGZB 3QUXC 3F58H 3QBTB 4PGDB 4JQIH 1Q9LA 3KLSA 4FN0A 5IW1A 4PJHA 3QCTL 4PJCE 3P11L 5CJ8A 2L0DA 3DGCR 4XNZC 4JJ5B 3MNZA 4PTTA 5ANMA 1EO8H 3PWJB 2VLMD 1TJGH 5JHDD 4V1DE 2B1HH 3PUCA 1F4WH 2FX7H 3QO0A 1CFTA 3EFDH 5D71H 1H0DA 5TDOB 1ZKAA 1ZOXA 1FVCB 1D5BB 3SCMC 1JPGB 3EOBB 3FFCA 5HHVH 5JZ7D 5IJKA 1UA6H 1YDPA 3QPQC 1SEQH 2X4NB 1IAOA 1NL0H 4KUZL 4PD4K 1NCNA 1XT5A 4NZUL 4OTXH 4DZ8A 4RFEA 2P49B 5EO9B 2XTJE 1HKLL 1GZPB 3NACH 1A7BA 4MJ5A 4R90H 4MLIA 1MHPH 2VUYA 1FYTA 3D0LB 1JFQH 1H5BA 4PG2C 3CVHL 3HI1A 3W11C 1MAKA 2X70B 5JIPA 5I8CB 4LCWA 1FP5A 3V6ZB 3QEHA 1AC6A 4WTZG 1E4KC 2JK5A 2Y5TB 1CT8A 2ZG1A 1T5WA 2NY2D 4H5SB 1HSAA 5ERWB 4LRNH 4MA3A 1R5IA 4P57A 3IDIB 3BPCA 1M7DB 4X9GA 2C4FT 3CDGB 4IHOA 5A2JH 5HXMA 3PWVA 4DN3H 3VG9B 5SX4H 1HHIB 4BSWB 3EAKA 5C0JA 5KSVA 1U58B 1R3LB 2B20A 2D7QA 3O4OC 5HHOB 1C5DA 1WAAF 2F5BL 3T0ED 5F89A 4OSUL 3NCJL 2VKXA 4EBQL 1WWBX 3CPLB 1A3RL 3ET9F 4KKBD 3Q1SL 3GDBA 5SWZA 5EUOA 4QY8B 2R2BA 3MLUH 4ZO6A 1P7KA 1DQMH 5EU5A 4F7CB 4X4YB 3OTTA 3IJYB 3MGAA 1NGXA 2O5YH 3WNMA 5J56B 3U0WH 1YY9D 3CDYA 4LPVA 2I25N 1S9XB 1G9ML 3R4DA 4M1CC 1UWGL 3GMMB 3INUL 3K1KC 2D7TH 1R24A 3H9HB 2GFBA 1J12A 3GM8A 3GKWH 4MDJB 2FWOA 4WU5B 3UPRA 1E6OH 1G7JB 3D69B 2AJSH 3E6HB 1KTKE 3IKCA 4LKXA 4H26B 7CGTA 2Z4QA 1I1YA 1PSKH 3MJ8A 4XNXH 4LU5L 3QEGH 2G2RB 5TDNA 3NGBB 3IRZA 1EEUA 5C07A 4QNPF 3C5SB 1RFDH 4JN2B 5DUPL 2BNQD 3FQXB 5ICZB 2CMRL 4WI5A 4ODVL 4FFWC 1A7NL 1I4FA 4KZEH 3TLRA 5FYLE 1K3ZA 1GOGA 3MYZA 4IOFC 1LO2H 1SJEB 1BVZA 2Y1VA 4R7DB 5BMFH 1A9BB 2FECL 2YWYA 3RPKA 3HB3D 4W6XB 5HGBA 3LQZB 2ESVE 1PX3A 3RNQA 1FDLL 4ZPVA 3RUGE 4ZS7H 2XN9B 4ZS6C 5J7CC 4LLDA 4IRJD 4OAWA 1HQRA 3O3EA 4FMKA 3UJTH 3IFPA 3QQNA 5JW5A 4UQ3B 3UZQA 1S8DA 3PP3H 3O4LA 3WIHH 5KTEL 1IAKA 3UMTA 5E7BA 5C6TL 4KKAD 5AYQA 1WUNT 4ZPTB 4WFGE 3KPLB 1IQDB 3DIFB 1BECA 2ICWJ 1FL5B 5IB2B 1NLDL 3VDAA 1NDMA 3TJEL 1OGTA 1AGCA 2JB5H 3RVVC 4HJGA 4EXPX 1F4YL 4JZOA 3VA6A 4YHMH 3GK8H 3IJHA 4WWID 2H6PA 4OD1H 1DLFH 5CGMA 4PREB 5IWLC 1YPZA 1OOAA 2QQLH 1L7IH 3K8LA 3ZZ1A 3VW3L 2FBJH 4ZOEA 3V0VB 3FMGH 1EXUA 3BMVA 5MI0C 4HQQL 1NBVL 4UT9H 4X6BB 2HA1A 3KJ6H 5HYQA 3HKFA 1CF8L 2VXUL 1DBJH 2Q8BL 2VITB 3TPKA 1T1XB 1E6JL 3D85D 4N8VG 3B9DA 1PW3A 4XP1L 4EI5B 2EH7H 4NNXA 5DJZA 3SE4A 3P9MB 3IDMA 4OD2B 2JKXA 4ZTPH 5CKAA 5KAQF 4MWFB 1OAZH 4Z18A 2YD1A 1MRFH 4BK4A 5ISZB 3WNOA 4Y4HB 1JVKA 5IB5B 2NW3B 4WCYL 4J1UB 4P5TC 1KIPB 5TF0A 3ZKQD 1B4JH 3DI2B 5HHOD 1IGCL 4LCCA 4UUJA 1RPQA 4HX1B 2DQCH 3BP7B 1MVFA 1DUYA 3RWCA 5JW4R 3JZ7A 4F7PA 1LO4L 3ARTA 1MQKH 4NQXA 4NWUL 1DEDA 4DAGH 2P1YA 2O93L 2CUHA 4PJ8C 5FUOL 4D9LH 2GAZA 1MIML 2GCYB 3SKMB 2WUBL 4LVOB 3TEUA 4ZSOE 4G9FE 4YHKH 1VADB 1I3RA 3NPSC 5E99H 1V7ML 4YDVB 1ROWA 3W5NA 4FFWD 1VKXA 3SJVA 5CGYD 3WIFB 1C12B 1J87A 2OR7A 3AU1A 2DQIL 1AI1H 3BKML 1ORQB 5E03A 3DTXB 3DROB 4P2QE 1JNNH 2XA3A 4YBHA 2CO6B 4KK8D 2DWDA 1D5ZB 4ZS6D 4M5YL 5GGRY 2WW8A 1CDUA 3RI5F 5C08E 5BOPA 4AIXA 2OL3B 3LZFL 5D8JL 3U79A 5KW9L 1MJJB 4EQ2A 1MCCA 5I1IH 4RGNE 1OWWA 2XN9D 4P23A 3LMJL 2HRPH 1URLA 5DJ0B 1RK1A 5HD8D 3ZKNC 3GB7A 3HUJA 4RQQB 3D5OF 2E7MA 4U2YA 5HPMA 4GG6F 5GJTL 4JREB 5ETUA 3STLA 3L7EA 2PNDA 1CFSB 4YO0A 4PFEA 4Z7NF 3DSFL 4K7FA 2PTTA 1CYGA 1OQOA 3ROLB 2VIRA 3UYRH 5IV2B 3VRJA 1ZGLP 2VDRH 3OZ9L 2FZ3B 4NZTL 3S96B 3WCYA 4LLUA 3T4YB 1IGTB 4FQ2L 3SY0B 4EUPA 4NN5C 1SEBB 4HF5H 4Y5XA 5CBEB 5MHSD 4LL9A 2M2DA 2XFXB 2NZ9D 5GS2D 4HS3B 4XWOD 5FUZH 1P5UA 2RAMA 3EO0A 3BP6B 5JQHC 1ETZB 1FZMA 1I8IA 1KCRH 3RNKB 4ZAKC 1TTGA 1UM6L 2DYPB 2X1WL 1F90H 2CLRA 1ZVSA 5KJRH 4RA3A 2GUOA 1D5MB 2DD8L 3QEUB 4ONGH 1OARL 3TA3A 4PYHA 1IM9D 4PJ7F 4QGYA 1TVDA 1EHLL 5JXAL 3VDCA 4NJ9H 3OR6A 1U36A 1FFOA 3MBXL 3IT8D 1JWSA 5FYJE 4JLRB 4HUMB 4EI5D 2H26B 4KI5F 3N85H 1MCRA 1JUFA 4ZQKB 2FEEL 4HMDA 1UM5L 2AJXL 2EDFA 1QFWL 1UWXH 3L3DB 3FQRB 4U1LB 3BP5A 2EIEA 3JV5A 4JCMA 3MJ9H 4PR5A 3NIDE 4YK4B 4HUWA 3LN5B 4XBPB 2P5WA 3D9AL 4YHPA 1ORSA 1RU9H 5DRNA 5ISZD 1I7TA 4Y4HD 5BVJB 3MMEA 3CVIL 2Q7YA 4JO3H 3HFML 4QCIB 4YLQT 4HLZG 1CE1H 1J8HB 2FHFA 4JM2C 3DUUA 5HYJE 3OKKA 2YPLE 4WFHD 4HZAA 4FZEH 4P9MH 2AK4A 1ZTXH 1NC2B 4U1GC 3GSRB 5I8EA 5DC9B 5HVFB 3WJLC 1XCQA 1UM4H 3ZKSD 5DQ9B 3LPFA 3RY6C 1A1NB 3HG1E 4M7JH 3DXAB 3KLHD 4K8RD 5I30L 3PWNA 2X7LA 1RMFH 2GSIB 1IEAB 1IC1A 3NN8A 4R4FH 2VLKA 4BUGA 3JTSB 3EJZD 4G8IB 2O5ZH 3VXTB 4KUCF 3MLTA 2A6KB 5CEXB 3GSWA 4M4PA 5E2UH 2EYSA 2D0HA 5I0DA 1UZ6F 1G7IA 1U95B 1WFUA 4QXTB 2AI0L 4GAYA 1AXTH 4YJZL 3B2VH 1X44A 2BVPA 4HUXA 4OZFA 1XGUB 1DTUA 4CMHC 12E8H 4LQFL 4UDUA 3NABH 3HAEH 2V17H 1HH6B 3BIKA 5F1IA 2NW2B 1XIWA 4X99B 4EQ3A 3QSKB 2P44B 4HFWB 3RWDB 2YC1B 2XQBL 1HSBB 2PW2A 1NCTA 3ARBC 1OP3H 4OCWL 4NHUB 1L7TH 5T3ZL 3SKOA 2DQTL 2ZUSA 3DLQR 5E6IA 2RR3A 1B0RB 5LGJB 5TF1H 1DN0A 4MA1C 5D1XC 4LLQB 1TVBA 5BZWB 4CAGA 1K4CB 1WZ1H 2E8ZA 3PABA 3VD3A 4R0LC 1RULH 3UYPA 1NKOA 2X09A 3I6KB 3FB8B 5JNYA 4RZCA 2ZPKH 1H3TA 5SX5K 1YNKH 1AE6L 2YS4A 4OCNC 4P2OC 1CCZA 1D6EA 2HFFB 3IDNA 5I1EH 1MH5A 4X83A 1DVFB 1YEJH 3QP3A 5T3XH 5EBGA 4HUNB 3WFEH 5B8CA 5GGVL 4GRWE 1DFBL 4R97B 1Q1JH 3OX8A 4FMFA 3QJHA 1UACL 4LIQH 2DYPD 4U1MA 4OLXH 4HK0B 2YPVL 1QEWA 3HC0B 4UILH 1A0QH 1D6VL 2Q76A 1QLEH 4KJPC 3PWLB 4HWEL 3T77B 2C26A 4DVBB 5IQ7H 4R26H 5C2UB 1EZVX 4OZIE 3QUZA 3MRLB 2Y72A 2NY6B 3TT1L 2MQ0A 3C5ZB 1UXSA 1UZ8A 1R5VB 4PGJA 3T3PF 1QHPA 3LDBB 3SO3B 4LLVA 3UO1H 2RHEA 1LQSR 4PLJD 3VWKA 3VXSE 2R4RH 4JDZA 4B7IA 2OTUA 2ADIA 2P45B 3WHE1 4ODUA 3ULUE 3C09B 2R0KH 4M61A 5CIPH 4P2RA 2P4AB 3X11B 4AL8H 4HKJA 1K4DB 3ULVE 4P2YA 2B8OT 3MYJB 4G8GA 3QI9A 2X4RA 3SDAA 5E8DH 1RZJH 4M3KB 4M48L 4I13B 4L4VB 2CK0L 5F7UA 3FB6A 1WFOA 1QOKA 3TYGL 2E9JA 1NC2D 1T2QH 1ZT1A 1OF2A 2X89A 4O00A 1HN1A 1L6XA 4JZJB 4KRNA 2W0FB 3I6LE 1EH9A 5D7LE 2NY5L 3SDDA 2IFFH 2K7PA 1H3PH 3DXAD 4WWKB 4KWUA 4PJCB 4XBGB 1DQDL 3I3DA 2WLYA 1UJTA 1MVUB 1P6FA 1FZKB 3H9SE 2A9MH 1SVZA 2FJHB 3TVMC 5KANI 5IB3A 4V1DB 2R2HB 5GS1B 3CJJA 4NP4L 4TUJA 4FZ8L 1BP3B 4XB7A 2IGFH 1T6WA 2AEPL 1IZJA 1N5YL 3AC0A 4N90E 3UEZA 3WFBL 3U4EB 2PW1A 3PHQA 4N1HB 3W0WA 2HMIC 1CDYA 1IKFH 4OT1L 2QSVA 4UTBH 1A7PH 1RZ8B 2EDEA 3DVIA 3KYMA 5IEKB 2XA8L 2DLFL 3D0VB 4Q74A 4DCQB 4RWYH 5JIIA 1MIEL 2XTJB 4K3HA 4O9HL 1NPUA 3WHXA 4D2NA 4X6FA 3HZKA 1HQ4A 5DQJA 3B9AA 2DJ4A 1C08B 2BVQB 3WXWH 3KYOA 2FGWH 2ZSWA 3C5JA 1B9ZA 1S9YA 3GIVB 5J3HC 4BFGA 4X7TB 2EIDA 4LKCB 5J9PB 4A6YA 5JW3H 3EHBD 1SBSL 3CC5A 2QV2A 3IS1X 2CRMA 2MPAH 2P46B 4L9LB 5I19H 5AZEL 4KPHL 4HKZA 4DEPC 5GRZA 2KQMA 5CLTA 5D2LF 4AYFA 1I8MA 5TE4L 3ZLQC 2XXCB 3RVUD 3D3VE 4Q97A 2ERJB 1X3DA 4PJIE 1ZLUK 5BVPL 4Q9QL 2E7LC 1JF1B 3MRPB 5HYSB 3KPNA 4WGWB 1IC4H 5D72L 3MR9B 5GZND 5E08L 2X4PA 3TNNB 1ZVYA 2XI9A 1JGDA 3P0VH 1U8PB 3E0GA 1S7SB 1OTUD 4RNRA 4Y5YB 1UC6A 2E6JA 3LQAC 4LVNC 2BC4B 3DVNA 4U1KA 3BYYA 2A9NL 3DX7B 1Q0XL 4HIHB 1G6RB 4HH9B 1U8LB 1PX4A 1VGKB 3AB0C 3HZYA 4KQ4L 4D0DA 2OXHA 3RQ3A 2DB8A 2IALA 2E7CA 5BW7A 4KXZI 1E28A 4F7EA 4YHLL 3GNMH 1NUFA 3LEXA 3C5ZD 4NNPH 3NPZB 1N6QH 1U3JA 4OCXL 2QSCL 4AM0A 4RFOL 3RUGF 1UKQA 3UJIH 1Y0LA 4JG1L 5I1JL 3GI9H 4PJBA 3VFOA 3N1MC 6FABH 2ESVB 4H1LH 3WO3B 4PYGA 3O6FB 5IESH 3OR7B 4RMUA 3VD5A 3RUGB 3PL6A 1MAJA 4CNIA 3GFUA 4MA8L 5BV7H 4OUUA 4L4VD 3QUMA 5TH2B 1AXIB 1S3KL 1KG0B 4LSRL 1XGPA 4P4KB 5KSBA 4ZXBC 4Y8DC 2AXGB 4JG0L 4JKKA 1BVLA 1T3FA 2VDLH 4U1SA 5DK0B 3IDXL 4MJ2A 1ZVHA 4I3SL 5JR1H 1SMAA 1QLRB 3ROOA 5DF0A 3V0WL 5DJ8B 2VDQL 4O2EA 1PLGH 1DBMH 1W72A 3RKDC 3LKPA 5GGQH 5K9OB 1MHEB 4V1DD 3VFRB 3CK0H 2ZSVA 3MRJB 3QIWB 3IRPX 3WLWC 3H2WA 2XYCA 3WO4B 5DJ6A 2ZOLB 3RGVB 3VXUA 1IGJB 3CD4A 1BEYH 2J8UA 3TZVC 4PLOB 3TO2B 4OQTA 4LLYA 1HIMH 4P5MA 2YMXH 1HNGA 1E4XH 3RJDA 3ZE2F 1WIOA 5DD0L 1AD0A 4XP9H 1Y6MR 2A77L 5DSCB 3DSNA 4PRDB 1U8IB 1KB5B 2D7OA 5B38G 5KSAC 3L3KB 2XTJD 2F58H 1XCTB 4S1QH 1FGVH 2OR9H 3ECBA 4P3CL 3REWA 3AM8A 3O6ML 1TPXB 2ENSA 4L3ED 2ADJA 3UBXG 1WWCA 4DKEH 2J8HA 5CP7B 5E4IA 3DMMA 5TQ2L 5FO9A 5F7EH 5GGTA 1CIUA 3S37H 1ED3A 3IXAB 3IJSB 2W60A 4U6VL 3QNXA 4YQXH 5F1NB 3RX8A 3VXRE 1CQKA 1OSZA 3P3YA 3S5LG 4OM0L 4QHLB 1HI6B 2VLJE 1C8PA 5FK9B 4V2CB 2PETA 2OQJA 3F7VB 1AGDB 3VWJB 43CAA 2AKRA 1LVEA 5D1ZA 5GSRA 2CR6A 4W6YB 3CMOL 4GLRI 5AEAA 5DRXA 4P46C 4XCYB 1X4ZA 5I9QB 2X4SA 1WC7A 5EIIB 4X4XA 4ONFH 2BCKA 4JPIB 3OKLA 3AUVA 4KMQA 3WFZA 1NEZG 1TJIH 3JV6B 2DKMA 4L8SC 2SEBA 3EIFA 3U83A 5C0BE 3S35X 4NQDA 4GG8A 2ZWLT 4LCUA 2ZCLH 4ZSOB 4G9FB 4LSPL 4WTXA 4BH7A 3RAJL 2UZYB 3IGAA 1QNZL 4NPYB 3LKSA 4PUBH 4Z5RB 1A6AA 3BGFC 1VHPA 2OJEA 4Y2DC 4W4OA 1OAXL 1QZ1A 1G9EA 1JZ8A 5ALBH 4J2XA 3GSOA 2X5PA 4NUJA 4G3YH 3V7MA 4NM4H 3E2HB 2XWJA 2A2QT 3QH3A 4QHKJ 5B3NA 1YEDB 3JTTA 2YUVA 3MUGA 4P2QB 4RGMC 1A4KB 4GQPH 5D9SB 1FH5H 4Y19D 3BX7C 1JPTL 4UIKL 2D31A 2VZTA 5HDQH 4RMRA 5FYLD 5C08B 4Y4FB 4I1NB 3WLBB 2FIRT 4RISL 2GJ6E 4JFEA 2ESVD 4RRPG 4KK6D 4C57C 2R1WA 3O6FD 2VO5A 1UH4A 4RGNB 1MF2L 1B0GB 1JZ3A 3CFJB 4EVNB 3O3AB 4DVRL 5FF6B 1FL3A 5IF0B 5GS0L 4YHYB 3BVNA 4XCNA 4WI3A 1UJ3A 1H3VA 1T0MA 5C0RL 4ODXB 3PGDA 3MV9E 3OXSB 4MS8C 3DWTA 4M7LH 4OLWL 3RKDD 1ZEAH 2P8LA 4Q9BA 4RAUA 5IB4B 5IT2L 3SHSA 4E41E 2APTA 5CINL 3QISA 4WFGD 4FFZH 3SEPA 1DL7L 1AXSA 1FLTX 5I1CL 4OF7A 3BWUC 2ATPA 2EXYC 4LCYB 1PKQA 4NRXB 1C1EH 1S7WB 4YBQD 4MXWL 1AGBB 1YEHL 3RIAK 3MBEC 5L7XL 3QIWD 5IB1B 3O3DB 3RGVD 3TH3T 4XT1C 5IR1A 1BWMA 3QQ4B 5C2BL 2BVYA 2I07A 5DA0B 1NFKA 3CCHA 1N59B 5DD5H 1I85C 5EBLB 3CDCA 5D70L 4WW2C 1EGJH 4RCAA 4B5EA 5D2NE 4ZFFB 4IM8A 2WIIB 2F5AH 1D5XB 3R1GL 1CBVH 5HDBF 5GRXG 5F6HI 3N50A 5GSVA 2HJKB 1I3GL 1G9MC 1I8KB 4TPRH 4JDVA 2H1PL 4GXVH 4U2ZA 2IG2L 4KK9C 3HI5L 2UY6A 3BQUC 3F58L 3QULA 4K7PL 5JHDA 5DD6B 3MLWH 1NAMA 3G5YB 4N9OB 3ILQC 1KIUA 2AJUH 3Q5OA 5I74C 2IQAA 3NIFF 5EU7E 1EO8L 3P4NA 4KI1A 4Y5VA 5AZ2L 2ATKA 1TJGL 1F4WL 4R4ND 4RWHA 4XVUD 5HHNA 4QXUH 3N06B 4PJEF 4D0BB 3VWJD 5EBMB 5HYJB 2YPLB 4Z77A 2C1PB 4JRXE 1PG7H 2XZAL 3VGGA 4N0UE 2X2YA 5HHVL 4ELKA 1UA6L 3I6GA 3UP1A 3QRFM 4KK5D 2ZG3A 1I1FA 2Z92A 3S8WA 3N0PB 15C8H 4Y2DD 5FDWB 3HG1B 5JXEC 1PDKA 3H3BC 4GRLC 3K3QA 4HDIB 3MGTA 3GGWB 4R90L 1BQLH 1S78D 3ZT7A 3V79C 3SO5A 4G9FD 1JBJA 2XIDA 2BZDA 2I60H 7FABH 1JFQL 4LARH 3V5HB 1BIIB 5H2BA 3ZKMD 2DJUA 4PJDA 4GXUM 2CLVA 3PE9A 3L5IA 1S5IH 3K2UL 4DKAA 5SWSE 2H32B 5E1HB 4LRNL 1EVTC 1P9MC 1TJHH 1G7PB 2Y7QA 1IKNA 3E3QE 2QKIA 3EOYG 3KDMA 4P2QD 3T0EA 3MRDB 4DN3L 4NO2A 1FRGH 1N0XH 4WDIB 3S88H 5C08D 5C7XH 1YEGL 2F53E 3DETC 2XQYG 2R1YA 1SY6L 1HH9B 1QPPA 4MS8D 3FAWA 4YEFA 4KTEL 3HMWH 4U1NA 3TBTA 4OFYD 4KV5E 1F11B 1CDHA 1S7UA 5FKPA 4HXBH 2FH8A 3MLUL 2PCPB 3GSUB 5IK3A 4BKLB 2YKLL 3VFSB 4S1SH 4WW1B 5C07E 3NCMA 3U0WL 1E27A 4Q6IC 3BZEB 3ILPB 2Z31B 2HJLB 1XZ0B 4N9GA 2D7TL 4FQIH 2DQUH 5KN5B 5JDSA 5HHMD 4GRWF 3GKWL 4UV4L 4QRSA 1A6WH 1E6OL 2DIBA 2BNQA 1DR9A 4I2XE 4Y89A 3QXAA 4ZNCD 1UT9A 2PXYC 1PSKL 1P4IL 3VFPB 3KYNB 5D1QB 5KANG 1NCDH 3QEGL 1LDPH 3BDBA 1M6OA 2YOCA 3VFTB 1T04B 4OGXH 3A6CH 5ID0A 1LE9A 5HGHA 3VRLF 43C9B 4GRWB 2IANE 4LHUB 4U6XA 5A2FA 2HG5A 1LO2L 2EXWC 4IRJA 4I4WB 2MCG1 2OZ4H 3CFKB 3GMLB 4NRYB 4H1LG 1QD0A 3SPVA 3G6JA 2F74A 2XQYK 4Y0GA 2W9DH 4PD4J 2BOCB 3UJJH 2F54E 3FOMB 4OZIB 1YNLH 4XGZA 3UJTL 4JFHE 5J89A 2CUMA 2DBLH 1CFQB 4ZTOL 5F3BB 3LS5H 3WIHL 4JJ5A 2X9XA 3HMXA 1X5KA 4PJ9B 3PWJA 4ZFOB 3VXSB 1EHXA 4B41A 2JJSC 4CU8A 5I17B 4N8CH 5TDOA 1MRDL 1JE6A 4AG4H 3FJTA 1OVZA 2JB5L 3FRUA 1FVCA 4OLYH 3B5HA 1D5BA 3VFGH 1JPGA 2BDNH 4OD1L 3EOBA 2X41A 2YWZA 4CL7A 3ULSB 3BRDA 2X4NA 4PG2A 2QQLL 1L7IL 5HYJD 3ESUF 5I1KL 5CILH 1ADQH 2EKJA 3MJ6A 1HHGA 3AREC 5EO9A 4AEFA 3BRGC 2VR4A 4LEOB 3WXVH 4AMKH 5FO7A 3D85A 1GZPA 3SE3A 3EGSA 4TN9A 3D0LA 4LSUH 3HG1D 3KJ6L 4JR9H 3SDCC 5I73C 1KYOK 1PJ9A 3RVWD 2X70A 5IBUB 3VU2A 1NFDF 4QLRA 3V6ZA 3H9SB 4KRPC 5EZLA 1JGVL 1INDH 2Y5TA 4KTYA 1INEH 1A1MB 1FPTL 4XPTH 3V6FB 5ID1B 5ERWA 3IDIA 1M7DA 4IRZH 2QR0B 1MRFL 1U3ZA 3WNKA 2R9HC 1N64H 2VMFA 1HHIA 1QSEE 3CLFH 2VKWA 4BSWA 3S4SB 2JJTC 3BD3A 1U58A 5IFHL 2IPUG 5HHOA 5CZXD 2D7PA 1KJMB 4N0CD 3ZL4L 5DI8A 4PIRF 3I50L 3IETB 3ALXA 4QY8A 5AWNL 3BPOC 3ZDYE 5T1LD 3LH2H 4MJ6A 1YN7B 2ARWA 1H3UA 3V4VH 4CVXB 4X4YA 4PGZA 1QFUL 4X7SH 3HNVH 5F9AC 1HHHB 3IJYA 1ZANH 4OZFH 1ZLVH 1UVQA 4EIZC 1AHWB 1S9XA 2WSKA 4XVSH 3JXAA 3FQTB 1NGYB 3HC4H 3GMMA 4GXUN 3RIAF 3BGMB 1MQKL 3LSOB 3H9HA 3LRGA 2IF7A 5A2KH 1GVIA 4WU5A 4Z7UE 4M6ML 4E5XB 3D69A 1G7JA 1QUNA 5H35B 3E6HA 2Z31D 3AVEA 4H26A 2MJWA 1J1XL 5E99L 3KPSE 2R56H 1I9RH 4UIMB 4UOW0 3RJQB 2G2RA 4DN4H 3D3VB 3C5SA 4JN2A 1J0ZA 5DHVA 3CUPB 3FQXA 3VGHA 4PJIB 5ICZA 2EXWD 5GQBA 4MMZC 2HT2C 5D5ME 2XXMB 1MPAL 1X5GA 5D1QD 5FYKU 1SJEA 4R7DA 5EZJA 4EI6B 1A9BA 2YUWA 5AD0B 3QA3B 1JNNL 1NDGB 1FO0H 3LQZA 5A16B 3HUJE 4J3VA 4QHMB 3KR3H 4OF0A 1T2XA 4LHUD 2XN9A 5FHAH 3ZE0F 4F9LA 5INDB 2EEBA 5C0FB 2AVGA 5IOPB 2EDRA 5IEHB 1JV5B 4UQ3A 3MODL 1Q9KB 5CD5C 1JHKL 2W92A 3ARRA 1FE8L 1DBAL 4NHCH 2JCCE 1MREH 2ZJSH 1EFQA 5D93C 1MCHA 4R3SB 2W1NA 1UH2A 3DPBA 3UC0H 1V7NH 1KT2B 1WISA 2PYFB 4ZPTA 3KPLA 2DS4A 1IQDA 3DIFA 1FL5A 3D48R 3O2VL 4JQVA 3QQ9D 4M02A 4M93B 2QSTA 4PJ9D 3HZMA 3AY4C 3O0RH 3VXSD 4PJGF 4PREA 4MAUH 4TVPD 1N8ZA 3V5DA 1C16B 5IHUL 2BXZA 3ULUD 1ITCA 1JWUB 1RUKH 1ZHLB 4HF5L 3ULVD 1U41A 1TNMA 3ZDXE 1BVKB 3V0VA 5CZVL 5FUZL 5IVXF 3FCTA 1OGAD 3TBVA 3WKML 4X6BA 1IM9A 4QYOB 2IMNA 1F90L 1T1XA 2G60H 1MCPH 4NN7C 1KELL 1MCFA 4B53A 1JN6B 3DECA 3LOWA 2Z8SA 4QTIH 5CUSH 3I6LD 4NFCA 1RZKH 4EI5A 3P9MA 4J23A 1TMCB 4YZFE 4I18C 4OD2A 1U8MB 5C1MB 5ITBH 4KJYB 4NQEE 3DRTB 5FA3B 4MWFA 3PP4L 3H9SD 5I8KH 2QEJA 4YEEA 4LAJH 8FABB 1NBZB 3G04A 1O5DT 1FG2B 2RB8A 5ISZA 4BK5A 4Y4HA 5GRJH 5IB5A 4S0TD 4ODTH 2X10A 4JANB 4J1UA 3SGEI 1A7RH 4N90D 1A7OL 4TSAL 1KIPA 4OBRA 1X6NA 4Y1AD 1N7ML 1RU9L 1VEMA 3BH8B 3UTPE 4JO3L 1MCOL 2FLRT 4HX1A 1JGUH 1OM3L 3B2UC 3U0TB 4POZC 3BP7A 5LCVH 1QBLH 3UAJC 3EOTH 1MWAH 2J88H 1HXYB 3Q3GB 1CGUA 4FZEL 4P9ML 5AAWA 2HKHH 4NOFA 4PLNC 1ES0B 4G8EB 3OJMB 3RP1A 4CVZA 4XZUB 5FB8B 3SKMA 3NAAH 4QRPE 3VMNA 1VADA 5DUML 1FNEB 1NGQL 3LY6A 1HKFA 4YDVA 5BS0D 2E8YA 1JPSH 1GPOH 4PP1C 1Z6JT 4Q9RH 1J0HA 1RMFL 3WIFA 4PRHE 1C12A 4G80B 1GAFH 4TULH 3VXRB 2WIMA 4R4FL 1R3KB 4EDWL 3DTXA 3DROA 4A6YH 1JJUA 3D3VD 3FO9B 2VLJB 5DD1L 2UWEE 1D5ZA 3ZKXB 2JELH 3QHFH 5EPMA 2OL3A 4HJJH 4XPHL 4LLMB 5CD5D 2MMXA 2APFA 3B2VL 5E8NB 1MJJA 4WVRA 4NSKB 4G5ZH 12E8L 1AR2A 2VWEC 3MOAH 4YNYB 2B2XL 1O7SA 5JPMB 4X4ME 4GS7C 3LV3B 4LRIA 5DJ0A 4FABH 5C9JB 4CN1A 4XCFL 5KZCB 5C0BB 2CXGA 5IG7B 2IWGA 2NY5C 4RQQA 5F96H 4H88H 2AQ3A 4MQSB 1CFSA 1UXWB 1EA9C 2PF6A 3ROLA 4IOSD 5IV2A 3EYVB 2FZ3A 3PWPE 3S96A 4KI5C 2WANA 1KCVL 1C5CH 1CD0A 2ICEB 3T4YA 1IGTA 3SY0A 1WZ1L 2HTLD 5CBEA 2XFXA 4NUGH 2R29L 2LVCA 2YZ1A 5CGTA 4HS3A 1KN2L 4UT6H 1FBIH 4M43H 3V6BR 4NGHL 2MHAB 2BNUA 3SGKA 3BP6A 2ZUQB 2YZ8A 2GJ6B 1ETZA 3RNKA 3ZO0A 5I8OL 2VOTA 2DYPA 3L3IB 3OF6D 1YEJL 3AS0A 4M9PA 5T3ZD 5H94B 5T3XL 4URTB 4KKCC 4MAYC 1VDGA 1D5MA 4Z7VE 2NCMA 3QEUA 1Q1JL 1VPOH 3DX8B 1NAKH 1MNUH 1WICA 3WSQH 5TJWK 3MV9B 1KC5H 1A0QL 1MHCB 2V2XB 5KVEH 3WL9B 2NX5E 3GJFH 5IQ7L 4K2UH 1L0YA 3OXRB 4JLRA 3QUMH 4E41B 2H26A 4FQQB 4ZQKA 1IE5A 4WNQB 1KLUB 2FL5B 3CZJA 3OG6B 3L3DA 3FQRA 4U1LA 1JZ6A 1OTSC 3S9DB 4RMTA 3LQAH 2OTWB 3LN5A 4PJHF 4XBPA 4N5EC 4GAJL 1TZGH 2YUZA 2EC9U 3B2UD 5BVJA 2CKBB 4UMGA 2XPGB 1H3XA 2AGJL 4APQB 1J8HA 4AL8L 5D2NB 5J13B 1GGYA 1Q9LB 1YMME 4IJ3C 5IW1B 1MFAL 2Y25A 3EFFB 1NC2A 1KJ3H 1GRWA 3GSRA 1A6UH 4PTTB 3QAZB 1KN4L 4XNUH 4Y7MA 4XH2B 4OQTH 4PP1D 5DQ9A 1A1NA 4KROC 4U4BA 2VDNH 1JK8B 4WFFE 3DXAA 4MD0A 1XAUA 1AGEB 1I7ZB 1T2QL 2FR4B 2XG4A 3T3ME 4IMKC 2GSIA 1IEAA 5F7NC 2VXQH 1F3RB 2FLBT 1JGEA 4OLEA 5CCKL 1HCFX 2IFFL 3Q6FB 4OGAD 4XVJH 1Y6KR 1YDPB 1EUUA 3JTSA 4NOBA 1WCBA 1IAOB 2DTMH 3QXDA 1UG9A 5TE6H 3VXTA 2A6KA 5CEXA 3B6SB 3VXRD 1U95A 1XGYL 3P4OB 4QXTA 4O4YH 4MA7H 1CLYL 2VLJD 3PHSA 1ZLWK 2IGFL 5CLWA 2VQUA 3ELAT 3BKYH 1XGUA 1FHGA 5GGRA 2J2ZA 4U33A 3RRQA 4HZLB 1HH6A 4JRXB 5L8LB 3AGVA 2IQ9H 4N0UB 1G0DA 3GRWA 1J1OH 3GSVB 3QUYC 2NW2A 4X99A 3GUTB 1DBKL 2K9UA 3GEWB 2EKSA 1WCQA 2YC1A 3JUYA 3DI3B 1L9NA 3RWDA 1CT8B 5TPWL 2QQNH 3BPCB 1J0YA 5JO5A 5C0BD 5EUOF 1DCLA 4NKOB 3ME0A 4JZNB 4OZFG 1B0RA 3A6BL 3LKNB 3P0YL 4Z76B 4LLQA 1DQQA 2FGWL 5BZWA 5JLZB 2PTUA 2JB6B 5F89B 1AO7E 2PKDA 3MLYH 2AJVL 2QHLA 5JW3L 3BPNC 1LEIB 5EWIL 3I6KA 3FB8A 4U3CA 3CFBB 3K80A 5SWSB 1S9KC 4YXHL 3HE6C 1NANH 5I1HL 2HFFA 2FNBA 4MAYD 1IZKA 1NGXB 1X5LA 4N0YH 1GHFL 2C5DC 3RWJB 2F53B 2WNGA 5DVMA 5AUMB 1R24B 3RL1B 2DM2A 3PGCA 4HK0A 4FQLH 4OFPA 3HC0A 2KZ1B 4OCYL 4OJFL 3IKCB 1EUTA 3MXWH 3PWLA 4DVBA 2ORBL 5C07B 4NCC1 1F2XK 3MRLA 1QSZA 2D9QB 3GBML 1RUMH 4G7VH 3C5ZA 5IHBA 1R5VA 3DVFA 2VYRE 3F7PC 3I3BA 5HGBB 2CQVA 4NDMB 2QQKH 1A6VH 2AABH 4I2XB 1GL4B 4LSTH 3GNML 3DRQB 1DBBL 4LLDB 1N6QL 3BIAX 1NLBL 5KSBE 5JW5B 2Z35B 1CE6B 1S9VB 1TTUA 2EC8A 2D4FA 4XNMA 1CZ8H 2NY7L 3QCTH 1S8DB 3P11H 1T66C 3Q6GL 3MYJA 2IANB 3WMSA 1NMCB 4APQD 1J5OL 4L4VA 6FABL 4MD4B 4Y4KD 2NR6C 5IESL 1RZFH 4MNQE 5T1MB 4Z7QE 2N4IA 4JZJA 3GSNL 1CL7I 2F54B 1FZOA 3LKOB 3ZYZA 5D7IA 2W0FA 3JWDL 3M07A 3RHWK 5LGKA 3NCCB 4WWKA 1QLFB 4PJCA 4FQXB 1MVUA 3MZGB 1FZKA 4NZUH 5K9JH 3DVGB 5GRVK 2FJHA 3O2WH 1T1YB 4JGJA 4V1DA 2R2HA 4OZGE 4MX7B 5GS1A 1DANU 2H9GA 1EXUB 4R8WH 4P49A 1HKLH 3IAGC 5D4QA 3OAUH 5GGQL 2M26A 3FT2B 4Z78B 3B9KB 3CVHH 2WLZA 3U4EA 2OJZL 2APVA 1A21A 3TBYB 1Z9OA 4LIQE 1NAMH 3P2TA 2X4TB 1BEYL 4NNXB 5DJZB 3TH2T 3D0VA 4L8BB 1EJ6A 4JRXD 4DCQA 4XAWH 2IPTH 1NGZB 1KPVB 4KMLB 1MJ7L 4KTDL 3V9FA 5GS0C 4JFDE 1S7VA 2YRPA 1OTTC 5EU4B 4WTWA 4J3OC 1C08A 2BVQA 1WT5C 5LXGL 3VGAC 3GIVA 2F5BH 5ALCL 5F9DC 4LKCA 1FGVL 4EBQH 3MV01 3HE6D 3NCFB 2E7LA 2NQCA 4KKLC 4DKEL 4L9LA 3QIBC 2FH6A 2QHRL 5F7EL 3MA9H 5ICYB 5DJ2A 1QSEB 5SWSD 4YQXL 5I71C 3BHBB 1G9MH 3P9LB 1UWGH 1YJDL 3RWCB 1FNFA 3INUH 4IDLA 1JF1A 3MRPA 2Q8AL 4KVNH 3OMZA 1IGIH 3MR9A 2BXYA 1CICD 3WUWB 1NGWB 2EIBA 1BFTA 3QZWB 2V7HB 3IDUA 3TNNA 1F4XL 1U8PA 4LU5H 4DUVA 4ZUSB 4XTRC 4Y5YA 1VKXB 5DUPH 2CMRH 4FQ1L 2BC4A 4ODVH 1A7NH 1YEEH 4ONFL 5J1AA 1DLHA 3DX7A 4HIHA 3OAZK 1G6RA 1GOHA 1U8LA 3HHRB 3O9WB 2NXYD 4Z7UB 2C4FU 5D5MF 3DHJA 1FDLH 1W0YT 1U3HB 5CJ5A 1FC2D 2EDQA 2QBWA 1RUQL 2EDTA 3KPSB 2HT4D 3TP4A 3HUJF 3RVXC 4WI8A 4JFEE 1FFNB 4Y19A 2E9WA 3BFOA 2D03L 4P23B 5ALBL 1P84K 4CRPA 5D5MB 4GBXC 4NM4L 1P5VA 5KTEH 3FT4B 2C3GA 5BZDB 5C6TH 1AQDB 2ESVA 3HUJB 4HJ0C 1RHHB 3O6FA 5HPMB 3OR7A 2DKSA 1DQJB 1NLDH 5L2KE 3RUGA 2IAND 2VZ3A 4U6TA 1V05A 3KLAB 3TJHC 3B4NA 5E6YA 5TH2A 2UYLA 1F4YH 1KG0A 4P4KA 4TUOA 3VRJB 3PHOB 2AXGA 2E7HA 4C56D 1RZ7L 3NFPB 5LG1A 3TFKD 2JCCB 5DK0A 1CWVA 2F54D 3AMLA 4Y5XB 1CGSL 4EUPB 1BJ1J 2ITDA 3VW3H 4JFHD 3SOBH 4F2MB 4TTDD 3P30H 1QQDB 1QLRA 3W9EB 4FQXD 4ZFZB 2PO6B 3MRKB 1NBVH 1FZMB 1HINL 5K9OA 2YBRA 3ARFC 5LGHH 1CF8H 1F3JB 2VXUH 3K8KA 4LVEA 2Q8BH 1MHEA 3VFRA 4FFZL 2R0LL 4RX4D 3QIWA 3GKZA 1HOCB 2DICA 2ZOLA 1K8IB 3RGVA 5K9KB 3ETBF 4UBDD 1IGJA 4XP1H 3JUZA 4G6FB 5EO1A 3B9KD 3HMXH 3TO2A 3RX5A 5JW4N 1OTTD 3ZHDA 5I16A 1NEUA 2A6JB 1JWSB 1KCKA 4YZFF 3C2SA 1JI2A 1UB6B 4QHNA 5DD5L 1JUFB 5DSCA 1RJYB 1U8IA 1PY4A 2OBGA 2BOBB 3L3KA 3IAQA 2VLME 2KKQA 1TCMA 1XCTA 5BO1L 2B4CH 4WCYH 2F5AL 2F9BT 4R2GC 4KKLD 4MD5B 4CKVX 1CBVL 5B39G 2OYPA 2HLAA 3ZSSA 32C2B 4YHPB 4UAOC 2V5TA 1I7TB 5CP7A 1I9EA 2WWKO 4NQEB 2BVUA 4TUKH 4DGYL 3ZTNL 3SKUD 2C7UA 5F1NA 5DHYB 4F7TB 4U1IB 4YHNB 1EEZB 1LO4H 4NWUH 3I2CL 2DL2A 1U91B 4QHLA 1CGTA 3EYOB 3O3BB 1QSED 4PRIE 2AJUL 1MIMH 4X6DA 5FK9A 2WUBH 3U46A 4YX2H 2HJFA 3BISA 3F7VA 4MJ4A 1AGDA 3VWJA 1V7MH 4WO4C 4XCYA 4QXUL 5CWSB 4FXLA 5EIIA 3GHEL 4YXKL 4JPIA 4QT5B 3BKMH 1PG7L 2ARJQ 2CH8A 2A74B 3JV6A 3BPLB 3S7GA 5DVLA 2Y5EA 3RVXD 4ZSOA 2EYSB 4M6NH 4G9FA 4QRPB 4JAMB 2KUTA 2Z91B 1MRCH 3SN6N 1VGEH 15C8L 4GAYB 4NPYA 5FDYA 4Z5RA 3O9WD 1AQKL 5EU6E 5HY9B 4HUXB 1RJLB 1X6LA 1NMBL 3LB6D 3LMJH 4OLUH 4PRHB 2I60L 3MRFB 3KPSD 4LARL 5JOEA 1AKJD 4ZODA 5D7JC 2E5EA 5TGBB 5EFIA 1GCFA 4P2QA 1A4KA 4MXVE 3TZVD 1DP0A 4LVHB 2UWEB 3RTQD 5GJTH 1B90A 3C8KB 1X5HA 3I3EA 5C08A 1TJHL 3WLBA 3DSFH 2R0WL 3RHWF 1UEYA 1FIEA 3WKNA 2BNRE 2ITCB 3G5XB 1N3NB 3GJEB 2HRLA 3OZ9H 4QKXB 1B0GA 2MKWA 2X1OA 4NZTH 1R3JB 2VXVH 5DTFB 4OFYA 3CFJA 4ZDHB 3O3AA 4EVNA 5C7XL 5F93C 2DM3A 1XGQB 5C70A 4FQ2H 5IF0A 3BE1H 1MQ8A 4Z95L 4RZCB 4ODXA 5DXWA 3HMWL 4UT7H 4MSWA 3RVTC 1YQ2A 3ARFD 4HXBL 3CU7A 1D6EB 5IB4A 3RPIB 3JV0A 1UM6H 5ELIA 3IF1B 4GSDL 2ZNXA 1IAII 2V9QA 1AH1A 2PO6D 3PWPB 4GKNB 4LCYA 2XTLA 3QG6A 2DD8H 1I85A 3OX8B 1OARH 4WW2A 3BEWB 1AGBA 5I76B 4FQIL 4M1DL 1T20B 2JJUA 1X4XA 3GMNB 5JXAH 2DQUL 2I27N 5I1LB 4YR6B 3UZEA 5FOBB 4P5KB 2EDOA 1MCKA 5IB1A 3O3DA 4BQCA 5J6HB 3QO1B 2V2TB 5D96B 2H45A 4G6FD 1PYWA 3SDXA 1N59A 5EBLA 3QUZB 4NC0B 2YD2A 2HWZH 1R0AL 4ZFFA 4R2GD 1UM5H 1QFWH 3C6LB 4K94H 2WIIA 1NUGA 1D5XA 4Z7VB 3U0PB 2G9HA 2JJVA 5FHBL 5E2VH 2EDYA 4Z7OE 1WQVT 4JHZA 3L1OL 3O6LH 2HJKA 3CVIH 1P7HL 1I8KA 3B8YA 2HVKB 2NX5B 1SHMA 4AIZB 3L95B 2GTZB 4LFHG 1AIFB 3T2NL 4WHYG 1YNLL 3DARA 3LD8B 1TQCC 1BZQK 3JWOH 1M05B 4NQED 3UDWC 3LEYL 1EEQA 4MQTB 5DD6A 3VD9A 1QR4A 3G5YA 3LS5L 2GTWB 3GO1L 2DDQH 4LOUC 4NBXB 4YHZH 3BJ91 4Y16B 1OF2B 3ZE1E 3JV4A 2DQEH 4RA0C 3B3IB 4RIRB 1RJZB 3WN5B 3DGGB 4AG4L 5ADOL 4KC3B 1Z0MA 4D0BA 3HE7B 4RFNB 5HYJA 1YMMB 2C1PA 4HWBA 3UTPD 3BSZL 2XACC 1EK3A 4XXCA 5DMGC 3M8OL 5E5RB 1SMOA 3ARDB 2OX5A 4IRSB 3EDEA 2AI0H 5FDWA 3HG1A 3MOQA 1KTLB 4XHJD 4HDIA 1MHHB 3GGWA 4RBPH 4PBXA 3KNBB 5DMKB 4G6JH