4EJ1C

Binding of nb113 camelid antibody fragment with the binary dhfr:folate complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
b'QLQESGGGLVQAGGSLRLSCTASGRTFSSYAMGWFRQTPGKEREFVAAITWGGSTTLYADSVKGRFTMSRDNAKNTVYLQMNSLKPEDTAVYYCAADGSQYRSTYSFRDKPDYGSWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrofolate reductase
publication title Mechanistic analysis of allosteric and non-allosteric effects arising from nanobody binding to two epitopes of the dihyrofolate reductase of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/immune system
total genus 34
structure length 126
sequence length 126
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ej1C00
3SDXA 4OM0L 1I7UB 2DLFL 5D2LB 5CHNB 5T1KD 2RBLA 4EUPA 4FABH 3GSOB 5MP6L 2R9HC 4Z8FL 2A6DB 1QA9B 4MJIA 2DQDH 2XOTA 2MQCA 1YNLL 4YHOL 1D6VL 4PGCA 4K3EL 5GRYA 1OAQH 4XCCL 4GSDL 4NQXA 1EBAA 1I75A 5EU3A 3FO0H 4NQEB 1RJZA 5DTFB 4JLRA 1FL5B 2V5YA 3L3OA 2IQ9L 2H2SC 2G5RA 1VDGA 4QHUB 1FAKT 1J9CT 1T3FB 1KG0A 3PHQA 4ETQA 2FYYB 5E6IA 5C92A 4FTVB 1Q9WB 2ADGB 1KXTB 2VRAA 1X9QA 2GJZA 2ITCA 2HT4D 4NQTA 3H6JA 4WTXA 4K94C 2QADC 3QIUC 3WYRA 4Z18A 4P2OA 3X12B 2CDFB 4NZRL 2VDKL 4QRQB 1ZA3B 1J05A 3ZE0F 4QGTA 1HI6A 3GSNH 4P5TB 3E3QE 2EXYD 3G6JF 5F96H 4L3EB 1ZGLP 4D3CH 4FQXD 4ZOEA 4DFIA 5AUMB 1T03H 5HTSA 5M7QA 4JJ5B 4ZPTB 4P59H 4XCNB 4DVBA 3QXDA 3VG0H 1G7IB 3DGGB 1Q72H 3Q5YA 5IEHB 1V3KA 2OI9B 1ZA6A 4KRLB 3O6ML 3MRGA 1FDLL 5IBLC 4U1LB 2VE6B 2AK4B 4ODUB 2P8PB 1UM6H 3G08A 4L29A 3ARDD 2XQBH 2DM3A 2RFXA 3GIVB 1G6RL 1RZJL 5IFJB 1CR9L 4PJEB 1OTSC 1UJ3A 5DEZA 3V79C 4EQ2A 1CICD 4UQ3A 4R9HA 3O3DA 2PR4L 1K4CA 4U6VH 4IOSD 2E7LA 1DL7L 5D6CA 2Y5EA 4WUUB 4MD0A 4CGTA 2MWCA 1HHKA 1KCUL 3S96A 2AJUH 4KGJA 4KQ3L 5EWIH 1F11B 4M7LT 2UVFA 3OKEA 4ZAKC 1BBJA 3STZA 5LQBH 4DVRL 3WUWB 3DMMC 4P4KB 4RFNB 3VW3L 3P9LA 4Y4HB 1OT1A 2R29H 1IJ9A 1T2QH 3RVWD 3ARGB 1R5VB 3RAJH 3CDCA 2GY7B 2R15A 4YXLH 4IOFC 5DFTA 3MLZL 5C0IA 2K7PA 1JK8B 1PYWB 2D7QA 5BJTB 4HPYH 1U91B 4DGVL 4YXHL 4NKDA 5DD6A 4PD4J 4RA0C 4P99A 2X44D 1YN6B 1WEJL 2ZG1A 3UYRH 4OFKA 3WLWD 2I07B 4OD1L 5HYSA 2XPGA 2XZCH 1B3JA 4KTDH 1C5BH 3OR7A 2QSTA 4YHLL 1CFSB 2X1XR 3CUPB 3EOYG 4CW1B 1CF8H 5JW5A 1A1MB 1FL6A 1U8HB 1PZUB 1S7XA 3H3KA 3FB6A 4AY0A 3L7FA 5F7MC 1JL8A 1B2WH 1HZHL 4Y16D 1A3LL 4BZ1L 2FIKB 3BKMH 5D7SL 3BJ91 4HV8B 4ODWA 2WZPD 4H26A 1JTOA 3GKWH 5F44A 2DDQL 3O3EA 2EH7L 4P9HH 4PGEB 3RI5K 2VLKB 3SDDC 4CU6A 2EEAA 5D1QC 3NPSB 3T4YA 5IVOA 1E6JL 1RZFH 1WZ1L 1AHWC 2ZOLB 4MA1C 1FYHB 3ZTJG 3BPOB 4PLJD 3AB0B 5DJCB 4OV5A 5IW6A 5I15H 5DHXB 2ARWA 4OGAD 4OM1L 3RWGA 5SWSD 5CJQH 4Q97A 3LN5B 1I9RL 2VZ3A 4NT6B 1CE6B 5FYJL 4XWGH 3V8CA 5C7XH 3DBXA 3H3BC 4OF5A 4WO4D 3SE9H 4LHUA 3BPNB 3QIUA 4DOHB 2Y07L 3BT2H 1FVDB 3NACL 4G6AC 3FO2B 1QEWB 4WHYG 5FO7B 1KN2L 5DEFB 3QWRD 4L9DA 2E27L 1QACA 2J4WL 3LKQA 3I6KB 1F00I 4YHIA 4JHAH 3K8LA 1JF1A 1NC4D 3TBVA 4LIQE 4OZGB 3BRFA 2H9GB 4XH2A 3SGJA 1QYGH 4F7CA 3DJ9A 3BXNA 3OXRA 1ZGLB 3X11A 1DR9A 4K07A 2F5BH 1Z0NA 4F7TA 4WHTA 3MXWL 3ULUD 3K1DA 1V8HA 4K8RC 4R4BB 4Y88A 2XKUA 4WU7B 3V0VA 4HIHA 5EBGA 4YXKH 3WO4C 3HAEB 5DJZA 4DN4H 3QZWG 1LO3H 1B0RB 3HI5H 2VABB 3UROR 1L7IL 5IM7B 1KBGL 1FH5H 4KK9D 1EJOL 3T77A 5CSBA 1CU4L 1BEYL 4KAQL 4X6CA 1IAKA 1AP2A 1KJ2L 5HDBE 3WNNA 1MI5E 1KPRB 4YDIH 4ZAKA 2ID5A 3DMMA 4PRHE 5BVJB 3RL1A 2FECL 4JKWA 1IQWL 1SJVA 4LMQE 3C8HA 1CTOA 3SJVB 2A1WH 3RHWF 1HYRC 1Q94A 3PWPA 1QFUL 5T3ZD 3U2SA 1A6VH 3P0VH 5I9QB 2E9BA 3VH8A 5HGBA 3UC0H 4I2XB 4WNQA 4X4YA 1SYVB 2Z8RA 3QFDB 2M8XA 3NCJL 4O2FB 1NCWH 2XKNA 2DQCH 1KLGB 4D8PA 5T3ZH 1AXIB 1GAFH 2J88H 1QR1A 3IU4L 2R23B 2B8OT 4X6BA 1O7VA 3RWDA 3TH3T 3HE7B 3OB0K 4U1GB 5EZOH 1VKXA 1F3JA 3FJTA 3O9WA 3WXWH 5D7IA 4CN1A 2YD5A 4UTBH 5ESQA 3LVEA 3T65B 1JHLH 2F53D 3KLSA 3DUUB 3O45B 1JYVA 3BP5A 1FAIL 4NKMB 3VCLB 2WBWB 4NQCB 1B4RA 2F54E 3QPXH 1EEZB 4X7EC 2IH3A 4D0CA 4FG6C 4IHOB 3HS0B 1MLCB 4XVSL 4MXQD 5TDNA 3D2UA 1IAOB 4XWOD 5TPWL 5DUPL 5K9OB 4OKVB 5IQ9A 1OAYH 5IV2B 5IGXH 4UOJA 4CMHC 3SDDA 1H3GA 5D1QA 3EYQD 3SEPA 4OGXH 3W2DL 4RMWA 5DC9B 3IDGB 1AHWA 1QP1A 3BH8A 5FOBA 3MACH 4NC1C 3ARPA 5IWLC 4G6MH 2ERJB 2C1OB 3RX8A 3GM8A 4K9EL 4RFEB 3O0RL 5DMKB 4ZXBD 3LHPL 4NNXA 1U3ZA 2YD7A 4KK6D 3F65A 4QYOA 4V1DD 3IJHA 4LSTL 5DVOA 1M7DB 1INEL 2W38A 2WQRA 4L4TA 1OTUC 3QDAA 3D6GA 4GUPB 4JFEB 3GI8L 4LCIH 3L5JA 2XZQH 1U8NA 3QISA 1UADC 5DQ9A 4LDEB 2AGJL 2BNRA 3N1QC 4OTXL 1R3IH 1RULL 2CRZA 2IQAB 3MV8A 5GGVH 5DMJB 3FFDB 1KELH 1TMCB 4PJAA 3LN9A 4S11A 3FQNA 2DRUA 3S98A 3E2HC 2IBBA 4GJTB 4P5MB 1BLNB 5D72H 2DBLH 4UOW0 3SKMB 1NDMA 1JMXA 4MA3B 3MUGA 4MNGE 3GJEA 2CRIA 2OL3H 4HKXB 3GBMH 1RUPL 4F9PC 4U05A 1VCAA 2DQJH 3ARED 4WCYH 4X5XA 2WBJD 2RHEA 3CFCH 4U1HB 1RK1B 3CD4A 1OGTB 4OUUA 2ATKB 2E7BA 1I1CA 4M7KH 5HVHC 3MRBB 3DRTA 5DHVB 4KDTC 4PGZA 5GS1C 4YJZL 5GS0L 4XPHL 1C5DB 1XH3B 4Z78A 1NGZB 1D6EA 3MTRA 1N5YH 1SM3L 5JHDE 5KOVC 3QEQE 2W9EL 4JRYD 1W72A 4NFCA 1WBZB 2H3NB 4NDMB 5BXFB 2R4SL 4U1KB 5EBMB 1NSNL 4PJXA 3TLRA 4WWID 3VFOB 4NWTL 2AXJA 2AXGA 5CZXC 4BSJA 4DZ8A 2YPLD 3IXAA 4TSCL 5IQ7H 3LQAL 1UG9A 1KB5A 4Q6IC 1U8OB 4PJBF 1W0YT 5HPMA 2FJGA 3NCCB 4FABL 3B9KD 5GS0C 3GSWB 3HPJB 5FUOH 5F7WC 4U6XB 3VXMD 2EKSB 2DQDL 2BNQB 4ELME 5IESH 2V2XB 3ZDYE 1YDPA 5BV7B 5EUOE 2EE2A 3U9UB 5DDHA 3S36X 4YNYB 1GGTA 3FO0L 4HIIA 5KSUA 1I9JH 2X5PA 4Y1AB 4M1CC 4P57A 3B8SA 1MUJA 4WFGE 1NC2A 5D1ZC 2VYRE 5I1KH 2ADJA 4GRLA 3UZQA 1S7SA 1RUKL 3AMLA 4K3GA 5GRXG 5DRWB 1AD0A 1GCFA 2X4OA 4LRNH 1A7BA 2MNUA 3VDAA 3VXRD 2R0ZH 3NMEA 1A3QA 2D9CA 3TPUB 1RIUH 3CFJA 5EOQH 4MVBC 1U8MB 1M71A 4QOKE 4P23C 1OM3H 4RGOH 3VFTA 1VGEH 4N0UE 3SDXB 2A77H 1AIFB 2Y9RT 4NC2B 2VQ1A 3HMXH 4EUPB 3MCKB 3HRZA 1N3NA 1J87A 3DYOA 3GSNL 3GSXA 3ZDZF 3JZ7A 4MJIB 3FT3A 2GJ6E 2X4TB 3P3YA 5F96L 4D3CL 2J7LA 1E27A 4JFDB 1T03L 1MIMH 4LGPB 2LAGB 2X2YA 4P59L 4D9RD 3AY4C 3ZHKA 3VG0L 1EJ6A 1RJZB 1Q72L 4OLYH 4TTDD 2QV2A 1QSFD 1OSPL 2C7UA 2X41A 2OSLA 4ZUUA 1UM6L 4JO4H 5IWLA 2XQBL 2MJWA 3VFMB 2ZJSH 1XGTA 4QNPF 5GGTA 2O5ZH 5A16A 3PHQB 4ETQB 4HS6A 5E6IB 1F4AA 1JWSA 4JJHA 1K85A 1YPZA 1YYMH 5J57B 4HDIA 4U6VL 5C3TA 5IW1B 3R4DA 4P2OB 2J1KA 4JFFA 1FNFA 2Q1EA 3KPQA 4DUXA 2AJUL 1J05B 5EWIL 1HI6B 4P2QA 1YEDA 4L5FL 3B3IB 2CDGA 4HAFA 1BFOA 1F58H 4AM0A 1NCBH 4OSUH 5LQBL 1I7RA 4LRIC 4FZ8H 3MLVH 4Z7WF 2EDJA 4BZYA 2R29L 3RA7H 3CFDA 1T2QL 4DVBB 1FL3B 2BSSA 2EDNA 4I77H 2KQNA 3RAJL 3C5ZD 3ABZA 4FZEH 2OTUA 4TSAH 5LKNA 4YXLL 5HHOA 5DMIH 3SBWC 1DQLL 3QDGD 5C0AA 3G08B 4L29B 5CBAB 3HR5B 5KANG 1A9EB 4HPYL 3QUMB 4P3CH 12E8H 4QRUB 1PQZA 3OQ3B 1KEGH 3GMOB 2UY6A 1G7PA 1UJ3B 1LMKA 1ZAGA 3U0WH 1OWWA 2VERN 3UYRL 3P4MB 3T8XB 3GB7A 5IHZB 1MFBH 3IFLH 2LU7A 1U3HC 2XZCL 1K4CB 4KDTA 1ZLWH 3GK8H 2Q8BH 5GS1A 3MV9D 1T04B 4IRSC 4KTDL 1C5BL 4MD0B 1OP3K 1XF5A 2WQ8A 1HHKB 5J12B 3WCYA 4RGNC 1Y6MR 4LCWE 1CF8L 4U1SB 1JGUH 3BWUC 4LCCB 3UBXA 1UXSA 5ESVA 1D5BA 3SQBA 3N06B 4JM2D 4BKLB 7CGTA 5TE6H 3IAQA 3IAPA 4EXPX 3Q3GA 3VD7A 2FO4A 5I73B 1WC7A 3EHBC 3KPSA 4XNZB 3ZKNC 3BKML 3S97C 4Q6IA 2YK1H 3U4EB 5C0JB 5A2FA 5DUMH 4NUGH 5T1LA 3TV3H 5F7HA 2W65A 3MRNB 3VXSE 2H6PA 3GKWL 5F9AC 3DUSA 1HCVA 2JB6A 2FX8H 4HG4K 1GL4B 5DWUH 3S3PA 1ZT4A 3AM8C 4TPRH 2VL4A 1U58A 4P9HL 3WEXA 1XCTA 4FQJH 1ORSA 4OIBA 3QXUA 3CNKA 5IG7A 1A7RH 4KMTH 4NO2B 1XR8A 5HYSB 3W0WE 1IAII 1RZFL 2GIYA 3U48A 5I76A 3FTGA 5I15L 5FK9A 5D1ZA 3E0GA 5DLMH 2HMIC 1MCWW 3QUYD 1FO0B 4I0KA 4MNQA 4MAUH 5CJQL 1FL6B 1OSZB 1KTDA 4XNMB 1YMHA 3A6BH 4XWGL 1J1PH 5JUEH 3IU3A 5C7XL 5CMAA 3FB6B 2NXZB 5ADPH 3L7FB 4YK4C 3SE9L 4UTAH 4YFDB 4PJGA 4P23A 4A6YB 3KVQA 1E4WH 3BT2L 3P2TA 2OYPA 2B4CH 4F80A 1RHHA 3H9SB 1RUAH 4XGZA 4GW1B 2FLRT 4MZ3A 1SBBA 2WWKT 1TZHB 3QUZC 4JHAL 3O3EB 1GOGA 3QUKB 1PAMA 5F71A 1G6VK 3VJ6A 2QEJA 3X14A 4MJ6A 2X4RA 3AY4A 1QYGL 1UH2A 3KPMA 5EN2B 3RTQC 1H3WM 2F5BL 4ODBD 4OZIA 3MUY1 4LU5H 4NO3A 5CIPA 5IW6B 1UFUA 1NH6A 4L8SA 3K3QA 3RWGB 3GJFA 5D5ME 3LKSB 3A6OA 3MV7A 5HYJA 5TF0A 3QAZC 4LCUB 4YXKL 4E0RB 5HI5C 3K8MA 3R0NA 2FR4A 2BMKB 2BOBA 3CCHA 1LO3L 4HUUA 3HI5L 4LHUB 2D0HA 2QADB 5H8DA 4XRCA 1FH5L 2G2RB 5D7JD 4HFUH 5BOZG 3HLAB 1WAAE 5DMGD 3VFRA 3QO0B 4YDIL 2WW8A 1WUNT 3LKQB 4XVTH 3NFSH 1HXYB 2NMSA 4HJGA 2IPKB 6CGTA 3BVNA 4X9HA 4WI3A 3UTTD 1C08A 3BI9X 1HDMB 4XPTH 1K4DB 2A1WL 5BQ7A 3BXNB 2J8UE 3LOWA 4K55A 3HUJA 4N0CD 4OLVH 4PB0H 3QP3A 4G5ZH 4L8BB 1J0YA 3P9WB 3U4AA 1A6VL 3P0VL 4WHTB 5GGSA 3T09A 3UC0L 4I9WE 4RRPG 2PYED 1Q0XH 2OCFD 4ZDHA 1VPOH 1GOHA 2YEZB 4N90E 3UTOA 4FQHA 1BJ1J 4OF8A 4ISVA 2I9LB 5EU4A 4DGYL 1NCWL 2DQCL 5DJZB 5CJBA 3L5HA 3W5NA 5T3ZL 4APQC 3WMSA 1U3HA 3VGFA 1GAFL 2J88L 4MLSA 2ADFH 1G7HA 4IRSA 4NYLB 5D7LB 2YXMA 1QRNA 2ATPB 3RGVC 4X6CB 1IAKB 2Q7YB 4U0RC 1ZEAH 2QHRL 5EZOL 1AP2B 3KPOA 2V2WB 3K2MC 2DM4A 3MYZA 1H3VA 3WXWL 2P5EB 4NZUH 1ADQA 5GZNC 2JJWA 2D7MA 3OL2A 4UTBL 3GMPA 3DMMB 4U1JB 2BVPB 1JHLL 4UT7L 2JK5B 1OCWL 1Q94B 3QDJB 5D93C 2R1YA 4X83A 3QH3B 5E9DD 3PWPB 3QPXL 4P46C 1I1FB 3O8XC 5CD5D 4HZLA 3BEWA 2ICWJ 3VWKC 3RVUC 2VLJB 4KI1A 5MERA 2JJUA 1DEEA 3TBTB 2XTJD 5C9JA 4WNQB 4X4YB 2XWJB 3RBSA 2UZXB 3MBXH 3O4OC 3AM8A 2DQFA 1OAYL 5IGXL 1UC6A 4D8PB 4ODXB 3AMKA 3NCYS 3U7WH 4ELKA 4OGXL 4S1QH 5DJYB 1NANI 1QR1B 3HN3A 2NY3C 5DO2D 4AIOA 4PRID 4X6BB 4OGYH 5CBEA 2JCCA 4G6ML 4KJWC 2D2OA 2CIKA 2QSVA 3C5SA 3HZYA 2PYFA 4ZD3H 4NKQB 5ICYA 4PGJA 5ESQB 4C56A 5EBWA 4XVUD 4Z7UB 4IMKC 1H15A 3OJMB 1EHNA 4X4XB 5B4MC 3O2WH 3BP5B 1FCGA 2P8LA 2XZQL 2YSSB 1X5JA 2KBGA 5F9WB 2IH3B 4D0CB 1EA9C 2EDTA 3D69B 1JNLH 2HT3C 2DBJA 2DLGA 1S7VA 1R3IL 5TDNB 5JXAH 1HQRA 3D2UB 1OLLA 2M26A 4HX1A 4UT6L 4KRMB 1KELL 2HFEB 5IQ9B 4R7NA 3SDDB 4RZCA 1I7ZB 5D1QB 5F7EH 4LPVA 5D72L 2DBLL 1J8HD 1N7MH 1EAPB 1AHWB 2DKUA 3BH8B 4MA1B 4EJ1C 5EULV 3RTQA 2OL3L 5DVMA 4E41D 3HB3C 1H3TA 3OGCA 3GBML 3K0WA 5L2KA 1WV7T 2P1YA 2AW2A 2P8MA 2DQJL 5J1AB 4WCYL 4M5YH 3G5YA 1DUYA 3CFCL 4JKPH 5ENWA 3IJHB 4XP5H 3VXUE 2WK2A 2C26A 2VDMH 1WCBB 2LTQC 1IE5A 4RFOH 4M7KL 4NC0B 2ZCLH 2R0WH 5J3HC 1AGBA 3BX7C 4X4MA 4YDJA 2JLLA 2VUYA 3FB8B 2DWEB 4U0QB 1X5KA 2YUZA 1N5YL 3GSVA 3RVTC 3HI1B 5C07D 1U8NB 4NJAH 3ALXA 1ULVA 3MCLH 4QHNB 3SDCD 1YEJH 2NX5E 3T3ME 2I24N 4H1LA 3FQNB 4Z9KB 2EIZA 5IQ7L 4MMZC 1NDMB 2X1OA 3MUGB 3VFPA 1OHQA 1BHGA 2NR6C 4TVSa 1EH9A 3PE9A 3LEYH 4B41A 5FUOL 1SEQH 4YGVA 5IESL 1ZLVK 2GFBB 1QRKA 3QDMD 5JPMB 3WO4B 4PJ9D 3BO8A 4G8GA 3QRFM 4PRBB 4APQA 3NZ8A 3L7EA 3B2VH 1NFIA 3DRTB 4KJQD 3GSRA 1I9JL 2P5WD 2VKXA 3ZSSA 3QO1B 3Q48A 2YA1A 4HBCH 3RGVA 5I1KL 2Y7QA 5KZCB 3VXTA 5FKPB 2D0GA 1W72B 3CPLA 1RZIB 2YZ8A 2W92A 4RMUA 4LRNL 1K8DA 4IM8A 4J8RB 2R0ZL 3UJJH 4PJXB 2NY1C 3C09C 4QXUH 5C0BD 4S0TD 4RMTA 2Z8VC 2VZOA 5KSBA 1RIUL 2CJUH 2XT1B 5EOQL 5HDQH 5TQ2H 1JVKA 1M05B 1SJHA 2VN4A 4RGOL 4IJ3C 1OM3L 1VGEL 2BFVH 1KB5B 2W07A 1AR2A 2OBGA 5HPMB 4P46A 3HMXL 3DWTA 3VWKA 3MGOA 5BO1H 1JGEA 3TA3D 1H5BC 4D94A 1GH7A 1IEBB 3AVEA 1QO3B 4CN4A 1YEKH 4HCRA 3N85H 1LP9E 1KJ2B 1MIML 1UB5A 5DDHB 1AJ7H 4LLVA 1BPVA 1X5FA 4OLYL 4HIIB 5KSUB 2PO6C 4PJCF 1VFOA 5C0DA 1RMFH 4G6FB 5FA4A 3ULVD 4P57B 3RWCB 5EZJB 4JO4L 2EDDA 1INQB 1MFDH 1NC2B 2UWEB 3F12B 4X4ZA 1ZSDB 4AENA 2ADJB 2ZJSL 1S7SB 3KYOA 2O5ZL 1NJ9A 2VITB 4OZFH 3PWJA 1PLGH 5L8KB 1IC7H 1I3UA 1CDCA 1DQMH 2UYLA 4Y4FB 3OKLA 1YYML 3ULVH 3T2OA 1GGUA 4IMKA 2DTMH 1OGAB 1M71B 2HTLC 2X4QA 5HYFA 4MSWA 2FHCA 2A73B 1LILA 3TO4D 4M93C 4HT1H 5KS9B 4WU5A 2A83B 1N3NB 2OTWA 1JTTA 3PJSA 2EIDA 3JUYA 1F58L 2J8OA 4PJDA 1NCBL 4OSUL 1O7SA 4RDQG 5KSAC 4FZ8L 3FT3B 1MHCA 3MLVL 3OX8A 3VGEA 2R1XA 2YD4A 4R97C 4XP9H 1E27B 3RA7L 4G9FA 2IC2A 3VXNA 4CMHB 5D7IE 4YEEA 5CEXA 3FB5A 4I77L 4JAMA 3FKUS 4FZEL 4TSAL 5DQDH 5DMIL 4GXUM 3QRGH 1U8IA 1X4ZA 2V5MA 4Y5XB 2DB8A 5INDA 1Q0YH 4XBPA 1QSEA 4P3CL 12E8L 5IHUH 1KEGL 3BKCH 1MCWM 4F8TA 3PQYA 4LFHG 4HS6B 3U0WL 3VFUB 1JWSB 1P4IL 1YPZB 1MFBL 1RUMH 3DXAE 5CUSH 3IFLL 4AT6B 3EYOA 1BD2D 2BXZA 2Q8BL 3GK8L 4XB7A 3WFZA 1AO7B 3DVNA 3S4SB 5CEZD 2NY6B 2VUOA 4DZBB 2NY7L 3B9AA 2I9TA 1KACB 4AH2B 1M7XA 2KPNA 1XIWC 4Q0XH 4Z5RA 2CDGB 1UVQB 1BFOB 4JDVB 1JGUL 1JZ8A 5GGVY 3ZE2E 5GRVL 3OAUH 2IPUG 2XI9A 4G80A 4ONGH 4R2GD 5FXCH 4XPAH 5EOCJ 5C0CB 3K80A 5TE6L 5CEZH 1XZ0B 3PWLB 3CFDB 4LLWA 3MRRB 3V52H 2BSSB 3CSPA 4J2XA 2YD1A 2EZ0D 4M48H 3NN8A 2YK1L 3VE0B 2VL5A 4LLAA 5DUML 4L4TE 1UACH 4NUGL 3TV3L 3GMMB 1NLBH 1JHTA 4S1SH 1YMMB 1VGKB 2K3TA 2FX8L 4WTWA 1G7PB 3L3KB 4ONHA 5DWUL 3BKYH 4LVHB 4TPRL 4FQJL 3GB7B 4OCRH 2X10A 4DTGH 1A7RL 4KMTL 4J4PD 4H5SA 3MV8E 5HVHB 3TBSA 1JNJA 1G1CA 2OQJA 5EOTB 2IAMD 2Z93A 1TETH 4Z95H 1D9KC 2IMNA 2Z8SA 2FD6H 2BCKB 2JJVA 2FWOB 4MAUL 4UI2A 3W11D 3UBXB 3FFCA 4N5UA 1D5BB 3A6BL 1FFRA 1J1PL 4YO0A 1WITA 5JUEL 3VFGH 5ADPL 3CFEB 4Y8AA 4B50A 4Z7VF 4UTAL 3Q3GB 2ZUSA 4ZUVA 4JGUA 1E4WL 4Q6IB 3CGTA 2B4CL 4L3CA 5ISZA 5T1LB 4QEGA 1RUAL 1EGJH 2W65B 5DD1H 3VMOA 2VZ1A 1MJ7H 3PGFH 1N8ZA 1EVUA 2JB6B 2X7LA 3RWIB 1ZVYA 1NBZA 2MPAH 3ME0A 2CKBA 3W5MA 3NCEB 4YHNA 5D7KE 1ZT4B 1U58B 1KYOJ 4WTZA 4C55A 3WJJC 3O4LA 5HHXH 1KCLA 4QRPE 4ZODA 2A38A 3L3IA 1N6QH 4ACPA 2D7NA 1ETZA 2PO6A 4L4JA 2EICA 4PJFF 4HK3J 4LU5L 1LGVA 2QQQA 4TUJA 1T7YA 4EOWH 3CXHJ 1F2XK 4MNQB 1EFXD 2EC8A 3FN0H 1CFVH 4HGWB 3BN9C 1GVIA 3IDMB 3TJHD 1IEAA 1MQ8A 1RUQH 2X89D 4FFVD 3IU3B 4ZO8A 5CMAB 5CEYB 1QBBA 2DLIA 4HXAH 15C8H 4NQEE 4ONOA 1CDGA 3MRMB 4P23B 4WV1C 1WCQA 5FYKE 3AS0A 4HFUL 3VA2C 3MRLA 5EO1A 1RHHB 5C08A 5SX4H 4HK0A 4XGZB 2AERT 5E8DH 4JY5L 2XNAB 2XRAL 4XVTL 4JFQB 3VI4E 5IB4A 3HNSH 3NFSL 3LRSA 2I5YH 1VACB 5KSAA 1MCQA 4BQ6A 3WBDA 3ZSTA 5DA4A 3TO2B 3VJ6B 3C6LD 4XPTL 5FM4A 1GIGH 3KPMB 1DBMH 4OLVL 1KUMA 4PB0L 4R4ND 2N7BA 2WWMC 4G5ZL 1R3JA 5L2JA 3IGAA 3Q5TA 5CIPB 5E94A 3GJFB 1Q0XL 5EZLA 1VPOL 1A7QH 5HYJB 3BW9A 4PPTA 3KS0J 1I1YB 3C2AH 3CCHB 1R6VA 2BOBB 4F37F 4FQLH 5JDJA 3OB0H 1FORH 4B0MM 2ADFL 1AY1H 2OXHA 3OZ9H 4F8QA 4ZPVB 5I1JH 3ULSA 3VD4A 2W59A 1ZEAL 4L4VD 3GBLA 1S5IL 3O2DA 1XIWA 4X6DA 4IS6B 5LXGH 4XI5D 4LKCB 4NZUL 3W9DB 3QFJA 3P4NA 3BRGC 3DSNA 4HJGB 4U2ZA 5I30H 3CK0H 4LVEA 4PRDA 3BVNB 1XGRB 1J1OH 1C08B 4JY4A 3S36H 4KDVA 1GJIA 4IRJC 4J3WA 3TCLB 4LQFH 3HUJB 3P9MA 1NAKH 3A6CH 1OF2B 1EHAA 1H3PH 1H8SA 5LGJA 1DFBH 3UPRA 4NKOA 4XCYA 3MBXL 1DLHA 1HH9A 3PHOA 3WJLC 2CDEA 3U7WL 4XBGB 3IDNA 4S1QL 1UKTA 3QJHA 3WLBB 1FVEA 1NCDH 1G7HB 4IRSB 4U6HA 4L1HA 5IB5A 5F1IA 2ZOKA 1ED3B 1KTKE 4HS8H 1D9KA 4YHYC 2AI0H 3KPOB 4RGNB 3VRJA 4WI6A 4FTVD 3ILPB 1JUFB 4HPOH 1D5XB 1WICA 1JWMA 4C4KO 4RMVA 1S9VB 1W0WB 4OLWH 1P53A 2NNAB 4O2EB 3MFGB 4KRNA 3O2WL 1HILA 5F1OB 5F7FA 4Q9CA 5DYOB 3CLEH 4NNPH 5I1AB 1CG9A 3VGGA 4LLMB 5TFSH 1XT5A 1JNLL 2MOVA 3QUXB 3FAXA 3ZYJA 4L3ED 1DEEB 4M8VA 3HI6H 5C9JB 5JXAL 4JPWH 2L4OA 1FZJB 3HG1E 4MA8H 1F6AA 4UB0H 3GRWA 3WJJA 4QRSB 3I84A 5F7EL 5JTWA 4ELKB 1FZOA 3KLHD 3KYNB 2AK4D 4WW1A 1N7ML 1K2DA 3ALPA 3C60C 1EZVY 2CMRH 3D18B 2JCCB 3L3HB 2GEEA 3SCMD 3GEWB 3M45A 4PS4H 4CNIB 2Q8AH 4PV9B 3LD8C 4V2CB 5IMOB 4M5YL 2PYFB 1R5IA 4PJ5A 4JKPL 5DGRA 4GT7A 2CK0H 5HI3C 2YWYA 3RKDC 2FDBP 4GG6A 4XP5L 5HGDA 2VDML 4MGXA 2HVKA 3RVVC 1ERNA 4I4WB 4YK4B 2ZCLL 1H15B 2R0WL 1UA6H 3QXAA 4WUUD 2EYSB 3BZDA 4OFDA 4WV1A 5IVXE 2AV7A 2EEDA 2ENSA 4F15B 3PG2A 3PWUA 1TVDA 4NJAL 5D9SA 3VI3E 2G60H 4KKBD 4LP4A 3T08A 3B5HA 3D3VA 3PNWB 3T0BA 4ODVL 1YEJL 1YEIH 1S7VB 1Z9MA 3QUZB 1HQRB 5CINH 4Y4HD 4ENEC 3DX6A 1A21A 3SKJH 4HX1B 4KTYA 2Z35A 1F45A 2CUIA 1BVKA 5E08H 3ARGD 4RZCB 5CCKH 3T0EC 3FRUB 3C6SB 3ZL4H 4ZYKA 3INUH 4GXUN 3RNKA 1HWGB 1TQBC 3RTQB 1WISA 3HZVA 1SVCP 4HLZG 3WNLA 5EU7E 3LEYL 3GM0A 1SEQL 4P3DB 2P8MB 3JWOH 4RQQB 2AEQH 3BIAX 2ZSWA 4OFIA 1WWCA 4J6RH 5MEPA 3QEUB 5AD0B 1ZE3C 3C08H 2BVYA 3I50H 4HS3A 4XTRD 4BK5A 3P40A 3B2VL 1AGBB 2YUWA 2XA3A 4Z7NE 2L7UA 5EIIB 5BRZB 4MQXC 1KNOA 4Q9QH 1UJTA 3H3PH 4HBCL 3L3DA 3TPKA 4OZIE 3EDFA 1KJ3H 2NQCA 2V17H 5ICXB 3UJJL 4QXUL 3V5DA 1GRWA 4H1LB 3CVHH 3T4AA 5TQ2L 2CJUL 4GBXC 5HDQL 3MV7E 4PJIA 5IBTH 1I3VA 4EDWH 4NN5C 4IRJA 4JY6B 2BFVL 4ZSOA 1FNEA 4L1DA 1A6PA 4G7VH 4TTGA 5DZNA 1XF3A 5EDXA 4P49A 3TNNA 3VH8G 4OF7A 3QNXA 1FNGB 1YY9C 5BO1L 2R39A 4YGVB 5IEKA 2VLKD 5CJ8A 1CLOH 1YEKL 5TH2A 3N85L 1T0MA 2G9HA 2AQ2A 1E28A 4LPYA 2MMXA 1AJ7L 4APQB 2ZNWA 3NZ8B 3L7EB 1NFIB 5DJ6B 2ZZUT 3GSRB 1RMFL 1GYAA 2R8SH 5EUKB 1MFDL 1CD1A 3LSOA 4FXGA 2Y7QB 4U0RB 3VXTB 3MJ7A 4NO5B 3MJ9A 2EE9A 5EBLA 1PLGL 1IC7L 5LGKA 4I2XE 1K8DB 5KW9H 3CSBA 3IXTA 1DQML 2VAJA 2XIDA 4F3FA 3ULVL 2EYRB 3EDDA 5DRNB 2O5YH 5HDOA 3RPKA 1NFDA 3CFBA 1WTGT 1IM9A 5CP3A 1DDHA 4PTUA 1UEYA 3FO1B 4HT1L 4D9LH 1XMWA 5A2JH 3O8XB 4NCC2 5B39A 2HTKC 1Z5LA 1C16A 3VWKB 2XACC 4X6FA 1OTTC 1P6FA 5MENA 2BVOA 4D9QD 1NGQH 3TBYA 4AL8H 4XP9L 4LLDB 3FT2A 5CD3A 5F7DB 5A40E 4LLVB 5HJ3B 3B6SA 5I1HH 2NY3B 1QPPA 3G5VB 1GPOH 3C60A 5DQDL 3QRGL 5FA4B 1RHFA 1BF8A 2QKIA 3WDHA 3RFZC 4P2YA 1Q0YL 2P47B 4LCYA 4PYHA 4AENB 3HC0A 2L7JA 5IHUL 4GS7C 5AAWA 1LVEA 1DUZA 3BKCL 2VDQH 5E8OA 5FDWB 5ICZA 5JR1H 1SJEA 4H25B 2FJFA 1IZJA 4NRZB 1RUML 5CUSL 3OKLB 3IDIA 1OP3H 2QBWA 3IDXH 1QBLH 2X4QB 3ECBB 2OJEA 1IZKA 1YC8A 4JFHE 2VNCA 1TVHB 4NRYA 4URTB 1T7ZA 4O5LH 1TJHH 4Y19D 5BS0A 4Q0XL 1JMZA 2MTPA 2FJHA 4PJDB 3OAUL 3FCTB 2CD0A 4QTHA 2OR7A 4ONGL 3WD5H 1MHCB 3SJVD 4GAGH 4XPAL 3L3GA 3R8QA 5CEZL 5SWZE 5GS2D 4G9FB 3VXNB 3MRDB 4RX4D 3T0EA 3FB5B 3BP4B 4C56E 4M48L 2J6EH 1QFWI 1UACL 1G9EA 5INDB 1NLBL 1CICC 1QSEB 4MXVE 3DX7A 3UPAA 1KB9K 1TENA 2CLVA 2ZUQC 3IJYA 5GS2H 1TNNA 5FA3A 5HY9A 3V6OA 3BKYL 4Y2DC 1C7TA 3F5WA 4JFOA 2R2BA 3CX5K 3QZWA 4Q9RH 4OCRL 4DTGL 4KV5F 2V5SA 1EXUB 1F4XH 3DVGA 1S7WA 2B7DT 2DLEA 3LEXB 1AE6H 5C0GA 3WL9A 2DF3A 3HE7D 3ROOA 4R7DB 3DVNB 5GRWA 32C2A 3MOAH 1QUNA 3GJFK 4HIEA 3VRLF 3QG6A 4Z95L 4WY7H 1WK0A 4OF3A 4NQDA 2FD6L 1MWAA 3UTSA 3RZCC 4LKXA 1VFBB 4G80B 2OMNA 3D39A 4JPIB 5L2KE 4GKZA 1UKQA 3VFGL 4C57C 1JP5A 5IVZA 4GBXA 4NQCD 3KLAB 3QNYB 3WIHH 5M95B 2HT2D 3TIEB 5F6HJ 1OAZH 4G9DB 4DFHA 4TSBH 2E7MA 3FQUA 1MCEA 3JV6B 4X4ME 4MCZA 1EGJL 4JG0H 4V2BA 1JHTB 5DD1L 1MJ7L 3PGFL 1HSAA 5FF6A 3T3PE 2X4PA 2MPAL 2Y6SC 3B9DA 3I6LD 1KPVA 2Z31A 4X7DC 1T4KA 2VQUA 3RWJB 5HHXL 4WI7A 3NZHH 3MCG1 1N6QL 3IFOA 5C8JB 3STBA 4P2CG 5DVLA 2OQJB 4P2RD 2Z93B 1C8PA 1AGEB 4EOWL 5J1TC 3U30B 1J10A 4POZD 3FN0L 4YPJA 1CFVL 4NBZB 5DT1H 2YHGA 3VMNA 3H0TA 1RUQL 4YO0B 2NY1B 3C09B 3KXFA 1QD0A 4JFED 5MHSD 4HXAL 1DP0A 5JXED 15C8L 5T1KA 2VXVL 5KVDH 2DYPA 4IJ3B 1RZ8A 3X3GH 4I3SH 4Y1AE 4Z76B 1KGCE 4UDUA 4L3CB 4NUJA 1PKQE 5ISZB 1A1NA 3DRQB 3BP7A 43C9B 3OR6A 4F7MA 5E8DL 5GIRA 4PG9A 2R2EA 3T1FB 1N8ZB 5IB1A 1H5BB 3HNSL 2I5YL 1NBZB 2CKBB 5DHYB 3KYMA 4O58H 1Z9OA 1X5YA 3C8KB 3ZHLA 2EDXA 2XWBA 1GIGL 3SE3C 2O93L 3L3IB 4WI9A 1DBML 4PJ7A 1ACZA 5KSBE 2PO6B 4OZHA 5F3BA 1BZ9B 1T0NB 4S10A 5DXWA 4TUJB 5JQHC 3LH2H 3C9NB 1F4HA 1DE4A 1A7QL 4HD9A 4OB5L 5E5UB 4QCIA 3O11B 4JFDE 4M8QB 3AC0A 5EU5A 3C2AL 4QWWC 4C59B 1R0AL 5DSCA 4FQLL 3BSZH 4OQTH 5DK0A 5BMFH 2EKJA 4MA7H 1FORL 1AY1L 1E6OH 3OZ9L 4PJHA 3TEUA 3D25B 3TH2T 2OZ4A 1DLFH 5E7FA 3K7UA 1HHIA 3MRLB 4JB9H 4QRRE 2BOCA 2OX5A 1BREA 2X70A 3BDYH 2CXKA 5LXGL 1A14H 1C7SA 3VGHA 4XP1H 3LRSB 4X7TB 5B3NA 1S8DA 5I30L 1EO8H 3QQ3A 4BH8A 4DEPC 4LPTA 3CK0L 5FGCE 1J1OL 3ZDXE 3ARDA 4LQFL 2ARJB 1NAKL 2AJVH 1R3JB 2X4NA 3A6CL 3IGAB 1H3PL 1QSFB 2RIKA 3I3DA 2BNQD 2F8OA 3OG6B 2CXGA 1DFBL 4U3XA 4R96A 2HG5B 5FB8A 4U3CA 1CICA 3KPNA 4I8DA 5C09E 3DTXA 4QRTA 1I3RA 4LEOB 1LHZA 1KIRB 3JVGA 3BKJH 1A02N 1LD9A 4Y2DA 3BW9B 3WDIA 5MI0B 3D0LB 1N5AA 1Y18A 1AR1C 1FFOA 3BZ4A 3RIAK 2WUBH 1NCDL 5D70H 1RJYA 1MJUH 3F62A 3ULSB 1TQCB 4HS8L 1IAIM 2V5TA 5F1NA 2AI0L 5FUCE 3SDXF 1XIWB 4X6DB 5C3LD 3CDYA 3RZCA 2NY2C 4HPOL 5KOMC 3P4NB 3SKUD 3MRKB 5E8PA 2HLAA 3DYMA 2V2TB 3PQYE 2R0KH 5JIIA 2A6KA 4JY4B 2BK8A 4GRMA 5T5NG 1KTRL 3C5ZB 5TDOB 3CLEL 4NNPL 2QJDA 4Z7WB 3EDJA 1EDQA 4MJID 5TFSL 4HIJA 1DQDH 4RAUA 4NKOB 3HI6L 4JPWL 3FL7A 4U49A 5DS8A 4XCYB 4HUKB 4MA8L 4EUPH 1DLHB 4UB0L 1HH9B 4KHXH 1ZT7A 2ICWA 2CDEB 1WQVT 1DCLA 2DD8H 1MCDA 4FNLL 3PDGA 1JI2A 1CE1H 2KH2B 2CMRL 2ORBH 2KUTA 2A9MH 4PS4L 2H8PB 4WI5A 2Q8AL 3VGDA 2DKMA 5E6ID 3CDGA 5GRUH 3PUCA 5I1LA 2WNGA 3IDUA 2CK0L 1MCFA 4KROC 1JWMB 5IJKC 3HHRB 5FO8B 3WIFA 1NKOA 5JPNA 1DVFC 5I1CH 1UA6L 4P2OD 4C54A 3LS5H 3BD5A 1HILB 1IGTA 4JVWA 3JWNC 4LDOB 5A1AA 1CG9B 2G60L 1LE5A 4XWOC 4RISH 2EDWA 1YEIL 2AV1B 5CINL 2WP3T 3SKJL 2XN9B 1CGWA 3MRIA 4M1GH 4MJ4A 3VDCA 1FZKA 5E08L 4GXVH 4D0DB 3L3JA 5CCKL 5FCUH 1FZOB 3NAAH 3SE3A 3ZL4L 1UM5H 1DANT 3NOIA 5H2BA 3INUL 3FMGH 1AKJA 1JBJA 1JGDA 2ZSVA 3RHWK 3H9SE 3RQ3A 4HJ0C 4KK6C 2WIIA 1ZLVH 1A6TA 5HYQB 3QUYB 3JWOL 2JIXA 4WO4A 2AEQL 3BMVA 1T1ZA 4J6RL 4PP1D 1L9MA 1CGYA 1ZT1B 3FZUC 3HRPA 3C08L 1HQ4B 3I50L 4LBEA 3QUMH 1D5MA 3K4ZA 1JNHA 3MRFA 4LOUD 4UQ2B 3RWEB 1MCPH 3QWRA 4WV1B 3O4LE 3ROLA 4Q9QL 3BQUC 3ESVF 2CSPA 3H3PL 3PWUB 2AVGA 5D9SB 1NC4A 5JIPA 2DJSA 1KJ3L 2V17L 4B5EA 5C0FA 3QQ9C 2CGRH 3KDMA 4JZJC 4NKIH 3JV0A 4DKDC 3DX6B 2GTZB 3QJFA 4OCSH 1XGQB 3CVHL 3NCYP 3KR3H 1W8NA 3K4DA 3W82A 4EDWL 4PRAA 3SDYH 4EXKA 3KPRE 4G7VL 3IS0X 4KXZH 3HZVB 3U0PB 5DRZB 4QHKI 4Y4KC 5CZVH 3NBNA 3O3UN 1R3KA 5K93A 1F4WH 4NZDA 3MLWH 4JDZA 5C08E 3ET9F 1CLOL 1PVHA 4WFED 4JFPA 3QA3B 4LGRB 4JRXE 2IMMA 4NRXA 4JFYA 1ZLSL 3F7YB 5D7JB 2R8SL 4UT9H 5JIHA 4FQ2H 3FQRB 4FMKA 3ZKMC 1IGCH 2NXZD 5KW9L 1MRFH 2EC9T 5FV2A 1QG3A 3BH9B 1OPGH 4XNXH 3V5DB 3CSYA 3T4AB 2VB5A 4KUZH 3SY0A 3UTTB 2O5YL 2DIBA 3CFKA 4PJIB 5GGUB 1S9YA 2YA2A 1ZHKA 3B9KC 4IRJB 4OUOA 4YWGH 2PTTA 4PRNA 4KI5E 2BVEA 3MA7A 4XHQA 5D7LE 3LN4A 2R9HD 4D9LL 1XF3B 2ESVE 4YBLC 3NVQA 1LDPH 2AJXH 1OP5H 3N50A 3NFPB 3TP4A 2ZUWA 2P5EE 1NGQL 3P11H 4M3JA 3RPIA 1F3RB 3QI9C 4C83A 2VOTA 1IL1B 1H0DB 4AL8L 3ISWA 1T0MB 3OHXA 5FHAH 1ZHLA 1HHGA 1P7QA 4BYHA 2H2SD 1Q8MA 5I1HL 1JF6A 1ONQA 1GPOL 1T2XA 1IKFH 4YHYB 1NDGA 4AIZA 5EBLB 3T0XA 3QNZB 3EJYC 4HWZB 2VDQL 5JR1L 1CGXA 4DKEH 4LHUD 5IJKA 2QADD 4PD4K 3QIUD 4X99A 1DVFA 1CZ8H 3IDXL 5FO9B 1QBLL 1ZHNB 1NFDB 3U82B 3CFBB 4BA8A 4PTUB 4O5LL 2P46B 5T5FH 4I3GA 1Z5LB 1C16B 4R26H 4K94H 5GGRA 43CAB 4X6FB 3MJ8B 1YNLH 4E42A 4K3EH 3WD5L 4XCCH 1LWRA 3TBYB 4GAGL 4GMSH 3FT2B 2DL9A 2YRZA 4UZGA 5CD3B 4HUMB 5IFAH 2GHWB 5E8EA 4Y5VC 1MI5A 3MJGX 3AXLA 5IBLD 3B6SB 1CQYA 3D48R 4WW2C 2VTFA 2J6EL 2YPKB 3C60B 4PRIB 3G5ZB 4PRHA 2QKIB 2EH8H 3V7AE 4OBSA 1FE8H 4V1DA 1OTSD 3RY4A 5IIEA 3HC0B 3PDDA 1DUZB 3UTZA 3DO3A 4IBLT 5E8OB 5ICZB 1N26A 1SJEB 3O6FC 1X5AA 4Q9RL 1LEGA 2QL1A 4NJ9H 5ITBH 2R1WA 4NSKB 4XHJC 1F4XL 3JV4A 3IVKA 1AE6L 1T83C 4LVNC 2OJEB 2HKFH 3DOSA 3MOAL 1N6VA 3D85A 4OV6F 3BQUA 2Z91A 1F97A 4NN7C 1VERA 4AK1A 4WY7L 5BS0B 4ZAKD 2VIRA 2V7NA 4Z77A 3DMMD 1XGUA 2FJHB 4QO1A 5J89A 4ZNCD 4QTHB 4JZJA 2ADIA 1I7TA 1FV1B 3L3GB 1S7TB 2O61A 1U8JB 4AZ8A 2C3GA 3QDJD 3MLSH 3WIHL 3PWPD 3T0EB 4WFFD 4MDIA 4F7EA 1N0XH 2ZKHH 4IOFD 1OAZL 2PTVA 4TSBL 4HFWA 3WHE1 2VLJD 4PRPE 2G75A 3MODH 3AREA 2WBJA 4Y4KA 4HWEH 4RRPA 3QXWA 1S9WA 5FA3B 4E5XB 4HMEA 2X1QA 3F5WB 2PR4H 2R2BB 3QZWB 2Z0BA 2NW3B 3NZHL 2BSTA 3DVGB 5D7IF 1M4KA 1S7WB 5ITFA 3BZFB 1EUUA 3WL9B 5J0BA 4G8IA 3MBEC 4J3TA 3SOBH 4HIEB 3UTPE 2HJFA 1P9MC 3QG6B 3TM6A 3VRIA 4DVRH 1GGCH 3SDCB 4LKXB 2FHFA 2APTA 3NCMA 5DT1L 3D39B 4OIIL 3PV6B 4GKZB 1DQTA 5I74B 2PW1B 1CXEA 3OXSB 2EDYA 1LO2H 2VAAA 4UDTB 4IIQC 1WBXA 4IMLA 5KVDL 3B9KA 3X3GL 4I3SL 3HNTH 2AABH 3DX8B 3FQUB 3DV4A 4DGVH 4R3SA 2AXFB 4MCZB 5I8CB 5K9JH 5HD8C 1X5XA 3D2UD 2Q86A 3WHXB 4HQQH 4MHHI 1V3MA 4X0KB 5FF6B 2X4PB 1A3RH 3QI9A 3SDDD 4J3SA 5D1QD 1T4KB 3PWNA 1FYTE 4PJ9B 1K8IA 1J88A 5JZ7C 3PXJA 2IWGA 2Z4QA 3BYYA 1EEUA 2DN7A 1CFNA 1FNHA 5GZOC 1A6AB 4MB3A 4OLXL 1OAXH 3G9AB 3ETBF 1YEGH 1WSST 4ZFOL 1Z9LA 1P1ZA 4QY8A 8FABA 3LH2L 5FECA 1P69B 4PBWD 4ZSOE 4HZAA 5EZIH 2WUCH 5EU6E 4JZOB 1V05A 1JZ3A 3R06A 4MNGA 3H0TB 3MNVA 4XAKE 2ZUXA 2YA0A 4FXKB 3KXFB 3BSZL 4OQTL 5BMFL 4HUNB 4MA7L 2DYPB 4G6AD 1XF2A 1NEZA 1E6OL 4PJAF 1YNKH 3OKYA 1T80A 1DLFL 2IANB 1YJDC 3N1FC 2VLRE 2BNRD 4JB9L 4UDUB 1BBDH 3RUGA 5DC0A 2UWEE 2DL2A 3OR6B 5CGYC 4F7MB 1BFVH 4PG9B 3BDYL 3B9VA 1MCRA 1KJMA 1A14L 4XP1L 1U8QA 3EYFB 3FQTB 3QPQD 5JHDA 3QEQA 1EO8L 1P7KB 1H8OA 1NGXA 3KYMB 1R3LA 5J4MA 3H42H 2F74B 1P4LA 5FYJD 4R8WH 4Y5VA 5T3XD 5B3JF 3KAAA 2AJVL 4WW2A 5I75B 4OZHB 3UCRA 4PIRF 5KS9E 5MEOA 4HH8A 4K8RD 3DIFA 1Q9KB 1LEIB 4PJ8C 2VISA 5IOPA 3JUZA 4GS7B 2Q76B 4JCLA 3BKJL 5T3XH 1VFUA 1I1AC 3O6FA 1CS6A 5EU5B 3GSQA 3JTTB 2F8VA 3OJDA 5DK0B 4PJXF 3NACH 4K8RH 3S6CA 4TRPH 1T83A 2WUBL 1MFEH 5D70L 1EBPA 4OLZH 1BQUA 4KKLC 4ELMA 1U0QA 4LNRB 5DK2B 1MJUL 4XX1E 3TO4B 5EB9A 1HHIB 1ORQA 1PX4A 3BAEH 5EUOA 5FKAA 2X70B 3OGOE 4N1EA 3MX0A 4NPYB 3QQ3B 2C5DC 4GO6B 1W72H 2R0KL 1MH5B 1T7WA 1HHJB 4OGZA 3MFFA 2OK0H 1AO7E 1MCIA 3CH1A 2H32A 1BIIA 2X4NB 4P3WA 4RIRA 3MZGB 1MCNA 3DX9A 1DQDL 5FB8B 3KPNB 1ITCA 1VHPA 2ZUQB 3VI4F 3DTXB 1KB5H 1B9ZA 1I3RB 3BP6A 3RY6C 4C58B 3D0VA 1LD9B 3TN0C 4Y2DB 3MV9A 4KHXL 5C0CE 1QHOA 1HEZA 4BJLA 1T1WB 4YHMH 3REWA 2DD8L 2RR3A 1CE1L 1NC2D 4LSQH 3MBEA 4KZDH 2GJ6A 3OSKA 3DHJA 4NGHH 5DRXA 1P9MA 2ORBL 2A9ML 5F1NB 3WFBH 2FX9H 5GRUL 5EO9A 2DQGH 4HC1A 2VWEE 1OGAD 2HLAB 3B2UC 3BOVA 4LF3B 4IRZH 1FC2D 2A6KB 3V6OE 4IIQA 3LS5L 2P42B 4GRMB 4OLEA 4PLOB 2RAMA 1DQJB 3HA0A 4TVPD 2VN7A 4FG6D 2VJXA 3LRGA 5DEGB 5IB2A 1X5HA 4YDVA 3STLA 4LSSH 1YY8B 3RDTB 3TZVC 4NQDE 3ZT6A 4M1GL 1ZT7B 4TVPH 4GXVL 2ICWB 4Q7DA 5FCUL 3NAAL 1G7QB 3B9EA 1UM5L 1MEXH 1N64H 4CVWA 3RP1A 1YPZF 3RKPA 3TYFA 3FMGL 4JKMA 3KJ6H 3MLXL 3K46A 4YIQB 1MHEB 1GC1C 2DLHA 3L1OH 4PY8J 4WWKC 4Y89A 5MEQA 4MDJA 3T0DA 2GW5A 2ITDB 4PGDA 3U46A 1R24A 4UUJA 1ZWIB 1Y6KR 1OTUD 1VB9A 4LSPH 5GGTH 5K33A 2NY6D 3GFUA 1MREH 4JFFD 5E8NA 1MCPL 3K2UL 1UZ6F 2IF7A 1MCHA 4JKLA 3SGEH 3M17B 3J7HA 1LE5B 4Z7VB 3LMJH 3NIDE 5ABDE 5HXMA 3PIQA 2CGRL 4NKIL 4N5EC 5E56A 1PEZA 5EIQA 5JOPE 1LK2A 4OCSL 2DQUH 3FN9A 4F2MB 3KR3L 1FZKB 3GMRA 3EFFA 5C0EA 3LB6C 4LCWA 2B5IC 3BEVA 3WUZA 5C0AD 4RBPK 4BZ2H 5H2BB 4Z7QF 1V7NH 1AKJB 4F7PB 1CYGA 5B38G 1JGDB 1YMMD 1UB6B 2ZSVB 4UIKH 5CZVL 2DS4A 2BSED 1A6TB 2KL6A 4MAYC 3CJJA 3SE4C 4PJ8A 1F4WL 1KIQA 3MLWL 5I2IB 2JIXB 1AXSA 1F6LL 2APFA 3QSKB 3B83A 1I1AA 4ETYA 3DI3B 4OZ4A 1FCCA 3PGCB 4PLKC 3VXSA 3GI8H 4CVUA 2GUOB 2NZ9C 4ZMAT 3ROLB 2W9LA 3ZYOA 5E5RB 1B6UA 4NHUA 4UT9L 3RL2B 2IH1A 4FQ2L 4PJ7E 3BGMA 1RULH 5T5NF 3U6RA 3HZMA 3W0WA 4N9GA 5I8KH 1JRHH 2J8HA 1IGCL 2HVJB 1CFQA 1KF9B 5C0FB 4M61A 3KDMB 1U95B 3U1SH 5CZXD 1I1RA 1OPGL 3QJFB 4XCEA 5L7XH 4XNXL 4DEPB 4KXZI 1A6ZA 2NY0C 4KUZL 3KPSD 4MQSB 4Q74A 3TIDA 4NHCH 1IVLA 3MRCA 2AKRA 2Q3ZA 4YWGL 1SJXA 5T1LD 1F5WA 5IVXF 3GMQB 3JTSA 2GK0A 5GS0D 2Y23A 3VI3F 4H88H 3VMPA 1LDPL 2AJXL 1GZQB 4PJHE 4U4BA 3P11L 4BELD 3RY6A 3OJ2C 1UXWB 2Q6WA 3N0PB 4YH6A 5FHAL 3ZE0E 1RZGA 2HLFC 4M1CD 1HH6B 4JFYB 3KGRA 4YC2C 3S3SA 2QSCH 5D1ZD 5ETUB 3G6JE 4PTTB 4PJGF 4K7FB 4MNQD 4P0DA 1IKFL 4L4VB 1CCZA 4LSRH 3F58H 2NY2B 5HHPA 2P24A 3GMNA 4MVBD 4K23H 1FBIH 4P23D 4X9BA 5E9DA 1CZ8L 5J6HA 3V7AG 1S9YB 4IOIA 5D5MA 4Z7NF 2PTTB 4PRNB 4YHZH 5ACZB 5I71B 3MROB 4M02A 5T5FL 4N8CL 4R26L 1G1YA 4K94L 3LKPB 4OZIF 3T1WA 4HK3N 5IFHH 2BSRB 3RPIB 1RZ7H 3S35X 3IF1A 3TZVA 1F3DJ 4GMSL 1WAAA 2Z92B 3OHXB 4M00A 5CWSA 1CVRA 5IFAL 5EC2B 1P7QB 3EZJB 3NGBB 3MV01 1S7UA 1PEWA 2Y25A 1RUKH 1AI1H 2EH8L 2W9DH 1FE8L 2H26A 4WWKA 5HYJD 3SPVA 2DKSA 5DI8A 2RGSA 2J8UA 4POUB 4I18C 3V5HA 4HXBH 1J0IA 4QF1A 5CIPH 4JZNA 2FSEA 3AS1A 4G43A 4KROB 5FHBH 5FOJA 5ITBL 4NJ9L 5E5MB 4X99B 1C12A 1DVFB 4WIQA 3GJFH 1HN1A 2QTEA 2HKFL 4F9LC 2C9AA 4CADA 3DI2B 1PY9A 1ZHBB 1HHHA 2EDEA 3VXQA 2C4FU 2APVA 4ALAH 2IEPA 3D87B 3HUJF 3EW3B 3DV6A 5GGRB 5ALCH 4I48B 2A6IA 4WENB 5DZOA 3SGJC 3CLFH 4ZFGH 1TTFA 3MLSL 5E8EB 3L5IA 1MI5B 4HH9A 4YE4L 1OSPH 1N0XL 4WFHD 2EDFA 2ZKHL 3P30H 3MODL 4PRHB 5H35B 2DQIH 4HWEL 3SCMB 5IIEB 3PP4H 4MAYA 3SE4A 4O4YH 4N0FB 4NN6B 1M1SA 5EIVA 4MXWL 5K9KB 1P6AB 1E0OB 1KCVL 3MO1B 2R1WB 4L8DA 4IRSD 1QRND 3IFNH 3TT1H 4NZJA 1S78C 3D85B 3SOBL 3BQUB 2Z91B 4RGND 1U92B 3P77B 2X1PA 4L5FH 3IKCA 1Q9LA 2DAVA 2VIRB 2D7PA 2V7NB 1GGCL 1ND0B 5SWSE 4HLJA 4JZJB 1TZGH 3MLTB 4Y8DC 4PUBH 3EHBD 3VFSA 1KJVA 3MGTB 1LO2L 3ZKND 5T1MA 2QR0A 1SEBA 1U2CA 1DQLH 3WKNA 1ADQH 1CL7H 3DO7A 3HNTL 2WINB 4S1DC 3P73A 3QUXD 5JMRA 2AABL 1MCJA 2OJZH 1RU9H 5I8EA 3MYJA 5K9JL 1N59A 4N8VA 5DFVC 3QDMA 3C5JB 4HQQL 5CLTA 1S9WB 2JCCF 1A3RL 5L0QC 5JORA 2F54B 3V7MA 2P5WA 4S2SA 4GKNA 5E7BA 4JGJA 5ITFB 1OAXL 3WS3A 1YEGL 3CVHB 3BD3A 2HMID 3BPLC 1UWEH 3O9WC 1IQDA 3ARUA 2W60A 4MXVF 3ULUE 4HUXB 1JPFB 4P5KB 5EZIL 5C0BA 2WUCL 4LVOC 4KC3B 4DK3A 4KRPC 2VKWA 2Y5TA 2OR9H 3OF6D 3VXPA 2FZ3B 1TLKA 1WBXB 4KHTH 3VGAC 3LPWA 4DUVA 1YNKL 3RNQA 3CC5A 1HSBA 2CO6B 5B39G 3BUYB 1BBDL 4YBLB 3VXUA 1EEYA 1FG2A 1BFVL 2EDRA 2Y4SA 3QUZD 3OMZA 1R3HA 5DD5H 3S8WA 3F8UB 3RIAF 5FUZH 3IFPB 3QI9B 1S7QA 4WEMB 5DJXB 5BZWB 4YDKH 4KKAC 3H42L 4XX1G 3Q6GH 5JNYA 4KK8C 4R8WL 1KCKA 4GRWF 3GUTB 3Q0HA 5KJRH 3RTQD 1AD9A 3WFCH 2NX5A 3MMEA 1A9BA 4WVRA 3OV6A 4PLNC 2VXTH 5L88H 5F89A 1A4KA 5T3ZE 3OPZH 4ODTH 4QY8B 3UTQB 1EK3A 2V7HA 4YHKH 4MWFA 2LAAA 3T3PF 3L6FA 3CX2A 1QFWM 5T3XL 2VSDA 4I18A 4XMLH 5HI5D 3S4SG 1NUGA 3QHZH 4KKNA 3U9PH 4L8CA 3QIBC 1A22B 5BRZD 4X6EB 1RVFH 4K8RL 3VWJC 4TRPL 1MFEL 4F9LA 1A7NH 4GRWH 4OLZL 3S88H 5CILH 1PX3A 3K74B 4G6JH 3BAEL 1ODAA 2ZP0T 1HKFA 4D0BA 2CLZA 3HR6A 1U8QB 1T22A 5JHDB 3SQOL 1NGXB 2G5BA 2P48B 1R3LB 2F53E 4UU9A 1W72L 4Y5VB 5DC4B 2OK0L 3IT8D 1BF2A 3NFNA 4HWBA 4ZNEE 4YHPB 4H1LH 1DQQA 1J18A 1JPGA 1HCFX 5MEOB 2GI7A 3KYAA 3DIFB 5F7KC 3ARBC 2V6HA 3GMLA 3ZTNH 1KB5L 1ES0A 4HHAB 4U6TA 1B0GA 2N7AA 4UIMA 4G8GD 1UWXK 4APQD 4HKBA 3UYPA 3O6FB 1NMBH 2C4XA 3SO3B 3GSQB 4YHML 4LVNB 4PR5A 4LSQL 5KSBF 4Q9BA 4KZDL 5GISH 1WBYA 4NGHL 4RNRA 1AGCB 4Y19B 3WE6A 4HW6A 1LP9A 5DJDB 5EUOB 3WFBL 2FX9L 5FKAB 4F58H 5A2IH 2C3VA 4I3RH 2DQGL 1YECH 1BZ7A 4V1DE 5F3HA 3LKOB 4ORGB 4IRZL 3Q6FA 4MCYA 2HRPL 4P46D 3O8XD 4ONFH 2UY7A 4ZTPH 1BIIB 2EYTA 4RIRB 1S9XB 3VWKD 4J1UB 3RVUD 4JPVH 4K3DH 4QOKB 1XF1A 4LSSL 3BP6B 5C86A 4DGYH 2BC4A 4N0UB 2NY4C 1MCKA 3FO9A 1I8IA 4X98A 3MQIA 4TVPL 1HEZB 2IAMA 2NY3D 3REWB 1MEXL 3AS3A 1N64L 1NPUA 1WIPA 4KJWD 1OB1A 2FECI 3MBEB 4GRLC 2QHRH 4HCRH 2GJ6B 3KJ6L 5EC1B 1HXMA 4GAYB 2QLVB 4GW5A 2DWDA 3L1OL 3V6ZA 2A2QT 2UV3A 1KT2B 1D7FA 4UT7H 4WGVB 1OCWH 2GT9A 3ES6A 4LLUB 4HUWA 4PJDF 5B4MD 3QBTB 5E2TL 4LSPL 5GGTL 4X9IA 4IIQB 1MREL 2YZ1A 4P5TC 3U0TA 1OWRM 1FZMA 5GSRB 2DI7A 4F37K 2HT3D 2CUMA 3DXAA 3LMJL 5J11C 4JRYE 5IB2B 4BSVA 1XF4A 4R4FH 3STLB 4LASH 2OI9C 1WWAX 1CT8A 3KLHC 1UYWH 3WXVH 4G9FD 4NWUH 2DQUL 5DD0H 2B1AL 2YPLE 1L0XA 1RIHH 3HB3D 4BZ2L 1P5VA 3TYFB 1V7NL 4P2RB 1QSED 2J12B 1EFXA 4UIKL 1S5HB 3LQZB 4TUOA 5IR1B 2EDHA 3X13A 3VXME 3T2PA 5F97E 2EE6A 1YEEH 1R24B 5GQBA 4PJBE 3O3AA 2K1MA 1QNZH 2X4SA 1HE7A 5IF0A 5J3HD 3BRDA 3M1BA 3QIBA 2WBKA 5I0ZA 1U8PA 3RVTD 4GOSA 3T2QA 2BX5A 3VWJA 5E8NB 2GSGA 5ID1A 3K81A 3KPLA 3RWFA 5C0NC 4KFZC 4P4KC 3W9EA 1AQDA 4Y4HC 3LY6A 1BOGA 3H7BA 1RK0B 5DVNA 5I8KL 1JRHL 3GGWA 4XMPH 4UT6H 3PIQB 1KIPA 1KCSH 4NFBA 4ZFOB 3DARA 3QCUH 3U1SL 4FFWC 4X7FC 3MUZ1 3VXRE 5L7XL 1EIBA 4LLQB 4J3UA 4JREC 4S1RH 3GMRB 4NHCL 5C0EB 4YAQA 1G7LA 4MJ5A 2P44B 4LCWB 3CZFA 3GBNH 2NR6D 4KDWA 2NY5C 3DURB 5C9KA 2LE9A 7FABH 4H88L 4Y2OA 1QR4A 3F7VA 3MRJA 1FVCB 3ARBA 5HGHA 1K6QH 2BNUA 1FJ1A 1I8KB 1PG7H 3C8DA 3RUGE 4U1NA 3E6HA 5JDSA 3U83A 4OZ4B 4Z7OF 3CFIC 4XPBH 3N9GH 3VXSB 4D9RE 4W6YB 1MIEH 3SGDH 1JJUA 2NTSP 5C0RL 3QT2A 2QSCL 5J8OA 1CFBA 1AFVH 1QSFE 5I19H 2VH5H 3IDJB 4NHUB 1B0WA 1TPXB 2IH1B 5TGBA 3BGMB 4EEEA 4QRPA 3FFCD 3HZMB 4LSRL 3F58L 5FGBC 2APBA 4N9GB 2NY1D 1RJLA 1CFQB 4WDIB 5J9PA 4M61B 3UBXI 1I7UA 5D2LA 2JE8A 4K23L 1FBIL 4W4OC 1YUHA 2A6DA 5INCB 4QNPE 3MRCB 4UV7H 1JF5A 1AQKH 2AKRB 1EFQA 4XP4H 1VEMA 5ISZD 4YHZL 3PP3K 3MRPB 1ZOXA 1TDQA 3NPSC 4TQEH 3SO5A 2VMFA 4NQEA 2YOCA 4KPHH 5ERWA 5IFHL 4QLRA 5DTFA 1RZ7L 2D7TH 2CO7B 1BQHG 1TCRB 1FL5A 2Q6WB 3TN0B 5D2NB 1JHKL 3KPTA 4NNYA 5I18H 1CQKA 5J56B 4KVNH 5HI4C 4JDTH 2PO6D 4XB8A 5C6TH 3WFHB 2CKBH 1N6UA 4M6AA 1Q9WA 4OF6A 5J6GB 3I75A 3QDGE 3V6FB 1AI1L 5I66B 2W9DL 5IVNA 1Q38A 4R6UA 4OKDA 5HHPB 1CBVH 5M94B 2NTFB 4HXBL 2PN5A 2P24B 4MZ2A 3GMNB 4QRQA 2XXMB 1ZA3A 5FHBL 2HTLD 4I0PC 4M7LH 5EU7C 4DCQB 5DURB 1A6WH 3H9ZA 1QLEH 2F5AH 3AFLA 4KU1A 4P5TA 1QFPA 4IOIB 3MV9E 4G42A 1MCOH 2M1KA 3ARTA 2FHBA 5DZLA 4ALAL 1YN7A 4JJ5A 4ZPTA 1C1EH 1NBQA 5KSAD 3V0AC 5ALCL 1G7IA 5EH1A 3LV3A 3F6LA 4PGCB 1FC1A 3ARXA 1EHLH 4IEFB 5TQ0H 3IF1B 4NQXB 5KVEH 4U1LA 3TZVB 4ODUA 3CLFL 5EU3B 4ZFGL 4JLRB 3L3OB 1T1YA 3NIFE 4PJEA 5JHLH 5JW3H 3P30L 5E2UH 1S7UB 4L8SC 2DOCA 5HHVH 2DQIL 5D6DC 1KG0B 2BZDA 1VA9A 3PP4L 2DICA 4O4YL 5DI8B 2X4UA 1T6WA 2J8UB 3V5HB 2ITCB 2GJZB 4QF1B 2FSEB 4GQ9H 4HIXL 4X6DF 1AC6A 3JXAA 1C12B 4RWYH 4J3XA 1KYOK 5JO5A 3IFNL 3TT1L 1U41A 1FGNH 1JZ2A 3WUWA 1DN0A 1HHHB 5IK3A 1XIWD 4P4KA 3VD5A 3V6BR 5FIEA 4Y4HA 3QFJD 3DV6B 4KJPC 1XAUA 1F8TH 2A6IB 3ARGA 5KAQF 5A2KH 3CXHK 4QT5A 1TZGL 4UINH 2VQTA 4PUBL 5LAXA 4XBEH 2JTDA 3QXDB 1JK8A 1AXTH 4JN1H 5BJTA 3O2DH 2E9IA 1ZA6B 4HH9B 3MRGB 5IP4A 1ADQL 1CL7L 4X8JA 5IKCA 2RFXB 2OJZL 1RU9L 8CGTA 1DANU 1YN6A 2IFGA 1V3JA 2I07A 1KENH 4MAYB 4OFYD 3P4LA 1KFAH 2WLYA 1I3GH 4UQ3B 1EEQA 1P4IH 2AEWA 3LQMA 1CFSA 3O3DB 4FFYH 2N4IA 3ILQD 1GZPA 3ARYA 5BOPA 1UWGH 3RY5A 3AAZA 4WI8A 3CUPA 5D6CB 5FYKU 2WSKA 4CW1A 2NY7H 1U8HA 1DBJH 3S96B 1D9KD 3HG1A 3IKCB 1UWEL 3OKEB 5DVKA 3GIZH 1BBJB 3STZB 3CDFA 1U42A 5ELIA 3G6DH 2CRYA 5FGBA 3RJDA 2FIKA 4BUHA 35C8H 2SEBA 3P9LB 1NAMA 2JF1A 2OR9L 4LHQB 4HV8A 3VFSB 4ZS6D 2NY0B 3S5LG 4W4OA 5T1MB 1A64A 3WFDH 4KHTL 2QR0B 5SV3A 1SEBB 1LO4H 5C0IB 1NCCL 4PGEA 2MKWA 3MLUH 4XNUL 2XWTA 4NKDB 5DD6B 1QSVA 2WLZA 2XN9D 5HBBA 5DD5L 2UZIH 1T66C 5FUZL 4HULB 5IVXA 2X9WA 1J1XH 2PW2A 3EZ8A 3CVIH 3HE6C 5DJCA 3GI9H 4YDKL 2P43B 2XPGB 2ERJC 3Q6GL 5E4IA 3UTTE 5KJRL 1CXLA 3OR7B 4GG6F 3WFCL 5AWNH 4YC2B 1JYNA 3BDBA 2VXTL 1BAFH 4NT6A 3WS3B 5L88L 3TYGH 3OPZL 3GRWH 1MRDH 4ODTL 3MRQA 3HKFA 5JW5B 4YHKL 1ZGLM 3BN9D 1DZBA 1S7XB 3DROA 2PYEE 5JLZA 1SMAA 2ED9A 4BQ9A 4XMLL 1PG7W 5FO7A 4FQIH 3QHZL 4HKJA 1OAKH 3U9PL 4I0PA 2HFGH 1RVFL 3I6KA 1T89C 1A7NL 4RWHA 1IGIH 3S88L 4ODWB 3RNQB 5CILL 3ZT5A 1HSBB 3D3VD 4G6JL 4H26B 4M9OA 4OZGA 5E6ZA 5ADOH 1FG2B 4Y0GA 2VLMD 5H94A 1ZGLA 5B8CC 1J0ZA 1S7QB 4TN9A 4H20L 3T4YB 3EIFA 1SY6A 4O00A 2AJSL 5JNYB 4YBQC 5DJ8A 1AD9B 4OV5B 2NX5B 3MMEB 4WU7A 1NGYA 1CD8A 5E9DE 2WV3A 4H8WC 5D1XC 3HAEA 4NBXB 5D6DA 4N0YH 1B0RA 2V7HB 1DSFH 3WO3B 1MOEA 3ZTNL 2XTJE 3L6FB 1N2RA 4XNYH 4I18B 3DBXB 4H0HB 1NMBL 3WFEH 3WNOA 2B1HH 4UBDC 4L8CB 5CFHA 1X4YA 3QIUB 4EIGB 1KPRA 2BVTA 4PRIE 5GISL 1F4YH 4PJIF 5BVJA 9CGTA 4JY5H 2XRAH 1MPAH 4YHIB 1FPTH 3ZLQC 1GGYA 3SJVA 4F58L 1JF1B 2WAHA 2IBZX 4D0BB 3TBVB 1XCQA 4EI5C 4I3RL 4XZUA 1YECL 4XH2B 1NMCC 2K7QA 2G5BB 4F7CB 4IRJD 1FNAA 4UU9B 3OXRB 2BY2A 3X11B 4W81A 4I2XA 4ONFL 4F7TB 4ZTPL 1CWVA 4O2FA 1DQQB 1JPGB 1PW3A 1KLGA 2DJUA 2YPVH 4JPVL 4K3DL 1BGXH 4AG4L 3V0VB 4HIHB 2R23A 4UIMB 1S9KC 5GGSY 2QQLH 1VADA 5IMMA 1J8HE 3T77B 4MB4A 3X17A 4EIZC 4PR5B 4OAWA 3T2NH 4HCRL 1WBYB 4E41E 1HINH 1S5IH 4RNRB 4YZFE 1LP9B 2FL5A 4ZAKB 3DUUA 1NFDF 4JQVC 3B5GA 4KQ4H 2C3VB 3RL1B 4NKMA 2JJSC 3S35H 4LHJB 3VA6A 1PSKH 3NIGF 4KMLB 2BHZA 4Z6AT 2LV4A 5AEAA 3MJ9H 3HS0A 1MLCA 3U2SB 5J7CC 3MLPA 2EYTB 5F7UA 2IPUK 5C07E 3SKNA 2XY2A 3VH8B 5HGBB 1NQBA 1NKRA 4ZUWA 5MEND 1UENA 4JFZH 4AEIH 4R4FL 1JE6A 5CP3H 4LASL 3GO1H 2XKNB 1UYWL 5L0QB 3WXVL 1Y6NR 4NWUL 3FO9B 5DD0L 3HE6A 4EN3C 4RBPH 2C1OA 1UCTA 3T0VA 3C60D 1RIHL 1NLDH 3RWDB 1JWUA 2P45B 4KKCD 1G0YR 3VFNA 1OB1B 3TVMC 4X80H 5EFIA 1NCTA 1F3JB 1HXMB 1M7DA 1VKXB 1ZS8A 3BPLB 5SWZA 3O9WB 2DWDB 2EE3A 1ITBB 3ZTJH 5D7IB 5HI3D 3RKDD 4OD3H 4LVOB 1YEEL 2XZAH 4KRPB 4ZUSA 4JM4H 4AQ1B 4FMFA 3QDME 1QNZL 2GT9B 1TITA 1Y0LA 5ANME 3JSSA 4NFDA 4OBRA 1NEZG 2VXQH 3U0TB 3VGAB 1FZMB 1GHFH 1T89A 5BS0D 2P5WE 2IQAA 4FRWA 3FFDA 4FS0A 2ZNXA 1OOAA 1JN6A 5TDPA 1BX2A 4HEME 5CS7A 4ENED 1BLNA 1EPFA 1RV6X 4XMPL 1XF4B 3SKMA 1KCSL 1WF5A 4WHYH 3QCUL 1CT8B 5B8CA 4W4NA 2J3SA 3DUHA 5C0BE 3T0ED 2YUXA 1B4JH 4HKXA 4S1RL 4YLQT 5FUCC 5FOBB 3ELAT 1HYSC 2NXYC 2MFNA 3GBNL 2YC1A 4J12A 4ESKA 1RK1A 1OGTA 5D1XA 7FABL 2ATKA 1U8KA 4NNXB 3X13B 3MRBA 2OTPA 5DHVA 4QYOB 4JQIH 1K6QL 4N68A 1XH3A 1PG7L 5IF0B 2KKQA 4L4TB 4KJYA 4XPBL 4U1MA 3N9GL 3M1BB 3QIBB 3UAJC 1MIEL 3UX9B 4MQXD 1WBZA 3VWJB 3R8BB 4NDMA 5DQ9B 3EDKA 2GSGB 4U1KA 5EBMA 5ID1B 3KPLB 3RWFB 1AFVL 5I19L 3ULVE 3TH4T 2VH5L 2AJYL 2BNRB 3W9EB 5KBNC 4FXLA 4ODVH 1BOGB 3ZE1F 6FABH 5I73C 3D39D 3MV8B 1JZ4A 2VR5A 3GGWB 4XNZC 4EI5A 3H8NA 4PJAB 4HGMA 4PJCE 2X9YA 1NUFA 1V5JA 1F02I 1V3LA 5HHMD 2MKLC 3GSWA 3KNBA 2HFFA 4YAQB 4BK4A 1G7LB 1MWAH 4MJ5B 4U6XA 4UV7L 1AQKL 2EKSA 2H2PC 3GJEB 4XP4L 2AJ3A 2JELH 2V2XA 4JO1H 4CN6A 1YY9D 3U9UA 4X5XB 4NM4H 1MLBA 4TQEL 4YNYA 3MRJB 3SGDI 5HGHB 4KPHL 2D7TL 4ODSH 4OUUB 4U1NB 1UGNA 4Y1AA 5FV1L 4HKZA 3O6KH 5K59F 1PKQA 5I18L 4WUKH 2C3WA 4KVNL 4Z78B 3MRHA 4JDTL 5K9QI 1D6EB 5FYLD 1HK6A 4PG2C 5C6TL 5DRWA 2CKBL 2DMKA 1FRGH 5LBSH 3TBWA 1XFPA 3S37X 1G9NH 4H0GA 3I6GA 1TJGH 3TPUA 4BFIA 4XPGH 2XY1A 1DBKH 1U8MA 4QRPB 4JQVA 3N1PC 4MLIA 3SDAC 5FYLH 3WS6C 1CBVL 3F6IA 1KV3A 2JJSA 3KXFD 5J9PB 4DZ8B 2AXGB 4QXGH 1AIFA 4PBXA 4O51A 5F8RC 3IXAB 2DYPD 4M7LL 3MCKA 3BYTA 3ZYZA 1A6WL 4YPGA 1QLEL 1YUHB 2F5AL 3QCVL 1BD2E 4NBYB 2IAND 2BP3A 2FJGB 5GRJL 2FX7H 4JO3H 3QB7C 1MCOL 3C2SA 2HTKD 5CEZE 1EO7A 4YR6A 2X4TA 4S0SD 4JFDA 1OTTD 3P0YH 4PJ7F 1C1EL 1JFQH 3HNVH 1QZ1A 4OZHF 4M7ZC 1YDPB 5ERWB 2YRLA 5E6YA 3QIWC 1EHLL 5TQ0L 3S3JA 2NY4B 1AC0A 5KVEL 5C6PB 4NNYB 4M1DH 4EN3A 3ZZ1A 4U1IA 4QRRA 3VFMA 5E1AA 1EERB 4CVZA 3EJZC 5JHLL 1MUJB 5JW3L 1NEUA 1WFOA 5E2UL 5FDYA 1JTPA 5FM5M 4GRLB 5HHVL 3I75B 3TVMA 1QPXA 1AD0B 2X4OB 4PJHF 2WANA 5IW1A 1WT5C 3B43A 3CFJB 4GQ9L 2HJLA 1ZLUH 3VFTB 4RWYL 3B3IA 4LEXH 5C09A 4G42B 2VQ1B 1FGNL 3HRZB 3GSXB 3MV11 1YN7B 1A0QH 5HGGS 5J11B 1FL3A 1OP5K 4M9PA 1F8TL 3R1GH 4W6XB 3EKCA 3LV3B 2OZ4H 5JA8B 3QULA 4UINL 3HC3H 1U3YA 3DGCR 2P7TA 4XBEL 4P4RA 1RD6A 5CBAA 3HR5A 1AXTL 4JN1L 1A9EA 4TULH 3QUMA 2M2DA 3O2DL 3TFKC 2CPCA 4QRUA 5F93C 3E1F1 3GMOA 1T1YB 5HVWA 2C7UB 2OSLB 3H9HA 4ZUUB 2DIJA 1XGTB 3P4MA 5A16B 3T8XA 5IHZA 3M07A 3F7QA 4Z7VE 1KENL 4Y2DD 1KFAL 2X4UB 1I3GL 1T04A 4KI5C 3WKMH 4FFYL 5EPMA 4HDIB 5JOEA 3FOLA 1UWGL 1QBAA 2BY1A 2W0LA 5LG1A 4U1SA 4JFFB 5TF1H 2YBRA 4LCCA 5JO5B 1DBJL 3I02A 3KPQB 1DN0B 5DR5H 2QQKH 2B0SH 4P2QB 1YEDB 4BKLA 5IK3B 1RZJC 3GIZL 3RZCD 4AM0B 3NCFB 2HP4A 1I7RB 4OCXH 1IILE 3G6DL 4E9LA 3DETC 4XC1H 35C8L 3RWHA 1BJ1H 2XQYG 4QT5B 3U4EA 5C0JA 4PJFE 4L3AA 5LAXB 3N1GC 5AYUH 3E2HB 4JREB 3MRNA 1X5LA 1PJ9A 2B39A 3WFDL 2OTUB 1MHHA 2PCPA 5HHOB 5C0AB 5DJ0A 4X8JB 1LO4L 2OLDA 5IKCB 2D03H 1PQZB 2A0LC 5HYIA 3MLUL 1JCKA 4NO2A 1CXKA 1X6LA 5E03A 3RDTD 2Y6SD 2UZIL 3BMWA 3U4BH 4KZEH 1NUNB 1J1XL 3G6AA 3CVIL 3GI9L 2X05A 1GZPB 4KY1H 5GS1B 3VFVA 5F7NC 3AAZB 1G0XA 2CR6A 2MSPA 1IAIH 2VXSH 4GW4A 4PG2A 4PV8A 1FO0A 4LSVH 1CD0A 1XF5B 5AWNL 1OSZA 1BAFL 4XNMA 5HSFA 3CXDH 5J06A 3TYGL 3REVA 3GRWL 1MRDL 4P9MH 3HG1B 4PGBA 5AG9A 3IETA 1UXSB 5ESVB 4XCFH 4A6YA 1MJJA 3SDAA 3WS6A 2SEBB 1NAMB 1AGFA 3QG7H 1A4JA 4FQIL 4KK5C 2EIEA 2FO4B 1WC7B 1OAKL 2R4RH 1SYSA 3H9SA 5F9WC 5L9DL 1G84A 2HFGL 4GW1A 2EDOA 3KPSB 5JW4Q 3UYOD 1INDH 1TZHA 1IGIL 3QUKA 2H6PB 5ADOL 4CJ1A 3DUSB 4K7PH 2XWTB 2YD3A 4L4VE 1VEPA 5EN2A 3WEXB 1XCTB 3T0WA 3QIWA 5IVXB 1ORSB 2PW2B 5IG7B 3FOMA 3L5XH 1XR8B 5KVFH 1AKJD 5D2LE 5I76B 3FTGB 2D4FA 3LKSA 5FK9B 5D1ZB 5DMYA 4LCUA 4QHMA 4E0RA 5IMLA 3MRQB 2JIXD 3EOTH 2BMKA 1UWXH 4N0YL 1DSFL 1KTDB 1YMHB 3DROB 3C87A 3RVXC 1WT5A 5JLZB 2XFXA 4XNYL 4QWWD 4TNWK 4F33A 3KPRA 2G2RA 1TVBA 2X1WL 3HLAA 1KSRA 3WFEL 2VXVH 4PJGB 4HKJB 2B1HL 4ERSH 4I0PB 2HYMA 3BGFC 3QO0A 2EXWC 4ZFZA 1WTLA 1HXYA 1NGPH 5E2JA 1F4YL 3MREA 2IPKA 3QPQC 1MPAL 1RIVH 4JRXA 1FPTL 1HDMA 3ULUF 1K4DA 4FTVE 2KZWA 1Q1JH 5H94B 3ARFC 3O3BA 1P84J 4L8BA 3X14B 4MJ6B 2X4RB 5CKAA 1KTLA 5IBUG 4O9HH 1U36A 1ZMYA 4DN3H 1CI5A 4OZIB 5DJ8B 5L8LB 4NO3B 1YZZA 4Q2ZA 1NGYB 5B38A 2YEZA 4L8SB 3BIKA 2I9LA 1EMTH 2FO1A 2YPVL 4OI8A 3QCTH 3MV7B 1BGXL 4OB5H 4OD2A 4L3EE 4EVNA 3ULUH 1E4KC 1DJSA 1N2RB 4NYLA 5D7LA 3CH8A 1R0AH 2FR4B 1AR1D 2QQLL 2I25N 5E2VL 2ATPA 1WLHA 2ESVA 4HUUB 4PREA 2Q7YA 2NLJA 4DAGH 2V2WA 2YN5A 4XRCB 2AK4E 2P5EA 3T2NL 4M62H 3VFRB 1HINL 4U1JA 2BVPA 1G6RA 5F7YC 4PJEE 2JK5A 2NY2D 3EYVA 4KQ4L 1J7VR 1XCQB 1MCLA 3OTTA 3QDJA 4XZUB 3QH3A 5CGMA 4ZFFA 3S35L 1I1FA 2V5RA 1PSKL 2ZG3A 4B7IA 1S7RA 2C3HA 4CDHA 5BQ7B 2VLJA 3MJ9L 1JI1A 4WUUE 2NYYD 3TBTA 3B4NA 3NPZB 2XWJA 5GGSB 4N8VG 1MRCH 1IGFL 4ZDHB 4ODXA 4JFZL 1IGJA 4U6YA 5DJYA 4FQHB 4AEIL 1U3JA 4ISVB 5EU4B 3GO1L 1EO5A 5E99H 2RQ8A 3V5KA 1U3HB 1VADB 1P7QD 3SN6N 5KVGH 3OJVC 2VR9A 1NANH 5IMMB 2ZPKH 3O2VH 1NLDL 1J0HA 1QRNB 4AYFA 4OAWB 5AZEH 1KC5H 4X80L 1LE9A 4Y4FC 25C8H 2FL5B 4Z7UA 5E00A 3AUVA 4OF0A 4X4XA 4OD3L 4KROD 3GMPB 2XZAL 4JM4L 5KTEH 2ICEA 4Z0XA 5GSVA 3HCVA 1DVFD 4LIQH 2YSSA 1CFTA 2E3VA 2GTWA 3D69A 5A2LH 2R1YB 2VXQL 2VO5A 1GHFL 2JJTC 4HZLB 3BEWB 5FM5O 3SKNB 5HDBF 5MERB 2HFEA 5GJSH 2DI8A 3PL6C 5LVEA 4ZUWB 2HN7A 1I7ZA 4OZFG 2DQFB 1EAPA 4CMMA 4Y5XC 3HE6B 5I1EH 1B4JL 1MI5D 5L6YH 4KH2A 4FNLH 3VU2A 2WMPA 2EDKA 5J1AA 4PRHD 5CBEB 1JWUB 4BFEA 4HJ0D 3VFNB 4RAVA 2CIKB 1KN4H 3CMGA 5L8JB 3C5SB 3HZYB 2NCMA 3JWDH 5EFIB 1RSFA 2FGZA 1ZS8B 5SWZB 1WCBA 5ICYB 3DPBA 4JQIL 3FB8A 2DWEA 3FZUD 4ZUSB 5EBWB 4C56B 2R2CA 2VLKE 2NY6C 3HI1A 4PRPA 5EORH 4RCAA 1Y0LB 3L5WA 4BUGA 3EFDH 2X9XA 3D85D 4KWUA 4QHNA 2P8LB 3BQUD 1OAUH 5KVMC 2Q7NA 5F8QC 1JN6B 4K9EC 4YBHA 3QQ9D 6FABL 1BFSA 5TDPB 1BX2B 3BPCA 3ARFA 5D96C 2W0KA 4R7NB 5EO0A 5B8CB 5I17A 5BCAA 1MJ8H 3KWWA 3PP3H 4DOHE 1MCSA 1MWAL 4MS8C 3FQXA 5HDLA 3OGCB 2YC1B 4Y4KD 2JELL 2GFBA 5L2KB 4LVHC 4JO1L 2VWEC 5JPMA 5ACLA 5D1XB 1ACYH 2FGWH 1T0PB 4NM4L 4PRBA 1U8KB 3G5YB 2IALA 2GYSA 3V6OC <