1BAWA

Plastocyanin from phormidium laminosum
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
ETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of plastocyanin from the cyanobacterium Phormidium laminosum.
pubmed doi rcsb
source organism Phormidium laminosum
molecule tags Electron transfer
molecule keywords PLASTOCYANIN
total genus 24
structure length 105
sequence length 105
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1bawA00
1PZAA 4AX3A 1NIBA 4A66A 3GDCA 4KO7A 1KDIA 3BQVA 1NPNA 3T71A 2XVBA 4GP8B 3FU7B 2EIKB 3WKQA 3QJTB 3OM3B 5TK4A 2BP8A 1DYZA 2AZAA 4M3HA 2P80D 4JHUA 1GR7A 3FU9A 1AZNA 3EH5B 5I26A 4BWUA 1PNDA 1ASQA 1PY0A 1J5DA 1A4BA 4E9VA 1SHXA 1RZQA 1MG3C 3MBWB 5D4IA 3CDZA 4F7KA 3IBOA 3D12B 1L9RA 1QNIA 3ABKB 1PZCA 1IUZA 3FQ2A 1WS7A 1OCRB 4HHGA 9PCYA 1HFUA 2X88A 3FSWA 1PLAA 2FT7A 3PAUA 2PP9A 5ANHA 3FSVA 2PPEA 2Y69B 3DIVA 3NSDA 4W1TA 4NAJA 2JXMA 3WKPA 5E9NA 3T6VA 3SQRA 2NRDA 1WA0X 1AANA 4E9WA 2W88A 1ZPUA 1RKRA 2J56A 4N4YB 3UAEA 2GHZA 3H56A 4A2GA 3FSAA 5AFAA 4PAZA 1F56A 2E86A 1KV7A 4YSAA 3C75A 2I7OA 3GYRA 2XV2A 2FQDA 1XB3A 2YAMA 4M4RB 4P5RA 2VN3A 4WTQA 3TA4D 4E9QA 2QT6A 4X4KA 1E65A 2HX8A 1JERA 1WS8A 2BP8B 4EF3A 1BQRA 4YSRA 2IDTA 3NJKA 4HHWA 4YVUA 1J5CA 2CCWA 1OE1A 1OF0A 1OCCB 4G7QB 5I6LA 1SFDA 2YXWA 3QQXA 3AG2B 3HEIB 3AW5A 1E30A 2CUAA 2QDWA 3JT2A 3S3DB 1ADWA 5B3SB 3PCYA 3OMIB 1NPJA 3AZUA 4BDVA 1JZJA 1I53A 1NIAA 3TU6A 3NYKA 4DP7X 3SBPA 1MZZA 3GXUB 4QKTA 5FC9A 3S3BB 1SNRA 3FS9A 3X1EA 3QJRB 1BYPA 3NP3A 1AG6A 2HXAA 3CDZB 1BAWA 1PLCA 2GSMB 1KCWA 4HCIA 2FTAA 2TSAA 1AAJA 5I5JA 2J55A 3T9WA 1WAEA 3NJIA 2BP0A 4NB7A 1L9QA 3ZBMA 4YSSA 1JOIA 3IEAA 1JZGA 3X1BA 2HX7A 2UX7A 2XX1A 1JXGA 3RYMA 2HRHA 5B1JA 4GY4A 2TSBA 3NSFA 2H5UA 2UXTA 3FSZA 2X87A 2DWSA 1GY2A 2VM4A 2FT6A 5I6PA 2UX6A 2Q9OA 2DY2A 2IDQA 2BO0A 2FWLB 3CZUB 2VW6A 3UABA 3N55A 5A7EA 5I28A 1J9RA 2CJ3A 2EIMB 4P5SA 4F2EA 2MTAA 2IDFA 3WI9A 2OV0A 3DKHA 4MFHA 2VW4A 4RH4A 3ASNB 3CVCA 3ERXA 3UACA 1GW0A 1ET8A 4E9TA 4KO6A 1NZRA 5B1AB 4N8UA 2QPDB 1M56B 1E5ZA 1KGYE 3AY2A 1PCSA 6PAZA 2N0MA 3FT0A 3ZDWA 2EILB 3EF4A 2HX9A 1ZIBA 2FJSA 2WO3B 4A2DA 3OMAB 5LDUA 4A67A 2IAAC 4ZK8A 3PAZA 1HAUA 2PCYA 4DP2X 4AKOA 1E67A 2AZUA 2XWZA 4E9SA 4DP9X 4A2FA 2PPDA 1ILSA 1ASPA 1HAWA 4GP5B 3UAAA 4FA7B 2VSKB 3ABLB 2PP7A 3EH3B 3X1FA 3NSYA 2YAPA 4F2FA 4E9RA 1T5KA 1WA1X 1BQKA 2YARA 7PAZA 3NJFA 3T6XA 2IH8A 1ZDQA 3G5WA 1SDDA 1BQ5A 5AZUA 4G71B 4HAKA 4G72B 1AQ8A 2YQBA 2XU9A 2VM3A 5B1JC 5I6KA 1EZLA 1JXDA 3IN0A 2EINB 3FQ1A 3IN2A 2FQEA 4HCFA 5PAZA 1KBWA 5B7EA 3NJGA 5B1KA 5AKRA 2LLNA 2BP0B 3DTUB 2HLEB 2XLLA 4KNSA 3ABGA 5TK2A 2UXVA 5EHFA 1OV8A 1GS7A 3IE9A 4YL4A 3S3CB 2BW5A 2PPFA 2QDVA 4YSTA 2PPCA 1FFTB 2IDSA 1OCOB 1ASOA 3FPYA 1FWXA 1OOWA 1OE3A 1JZIA 2OCCB 1PLBA 3AG1B 2GBAA 1PF3A 2ZXWB 4A2EA 1TU2A 1ZIAA 1J9TA 5PCYA 1XMEB 3ASOB 4GXFA 2OJ1A 1AZCA 2ZOOA 4Q89A 1L9PA 6PCYA 2AFNA 1CC3A 1JVOA 1TEFA 1X9UA 4YSEA 4CSZA 2YAQA 1M57B 3OQRA 4KO9A 3X1NA 2GI0A 4ENZA 1AR1B 1IKOP 3SBRA 1BEXA 2FQGA 3H4HA 1EHKB 1OE2A 1XB8A 4DPCX 1AACA 3CVBA 1PNCA 2BWDA 1JZHA 1IBYA 2B3IA 1V54B 3WG7B 4W9ZA 1L9SA 4YSDA 4DP0X 1NIEA 1V10A 5B1BB 1MG2C 3FU8A 1AZUA 4YSUA 4BDVB 3WIAA 2I7SA 3FYIB 2GB2A 4BXVA 3QJUB 2XV0A 2PP8A 5F7AA 2ZWNA 2J57A 4UF7C 3JTBA 2MRYA 3PAVA 1NDTA 3UADA 2WSDA 4BK5C 2BHFA 1QLEB 4A2HA 2VW7A 4KO5A 3EH4B 4HCGA 2IWFA 2AANA 2IDUA 1ZV2A 3NSCA 3FPXA 5I5MA 3OD3A 1SHWA 2GIMA 2HRGA 2XV3A 2FNWA 1SDDB 3U25A 4QLWA 4G7RB 1AZBA 1GS6X 4A68A 3TASA 3AG3B 3QJVB 2I85A 2YXVA 3BVDB 2YAOA 1TKWA 1AS6A 2VSMB 2P80A 2CALA 3CVDA 3ABMB 2IWEA 3MX0B 3NJMA 3OMNB 5B7MA 1A8ZA 3PPSA 4JKNA 2XXGA 2GC4C 2PPAA 5F7BA 4AKQA 5B7FA 1QHQA 1PAZA 2Y1AA 1SJMA 5I6NA 3TBCA 1GSKA 1BXAA 3L45A 1L9TA 1PZBA 4HZ1A 1J9QA 4DP1X 4UAHA 1ET5A 1PMYA 3EHBB 2JFCA 1L9OA 3N2JA 4FAAB 1AZRA 1XB6A 1AIZA 4DP8X 3T6ZA 2BZCA 1IBZA 3KW7A 3V9EA 2R7EB 1W8EA 1URIA 7PCYA 1A3ZA 1AOZA 3UGEA 2BW4A 1TEGA 1IC0A 2BZ7A 1N70A 4YSCA 2W8CA 4AKPA 3FU7A 2UXGA 1CYXA 1ZDSA 2XYBA 1AS8A 2XUWA 4BWTA 3NT0A 4E9XA 1UATA 1SF5A 4DP4X 1GY1A 3NJHA 1GYCA 1SFHA 4KOBA 1JXFA 1W6WA 2GC7C 2YAHA 4GYBA 2YAEA 2IH9A 2YAFA 1NICA 3NP4A 4TXVB 4AZUA 1NIDA 1CUOA 3PLYA 3CG8A 4UANA 2IWKA 1MZYA 1ILUA 2H3XC 2DYRB 1NIFA 1V55B 1B3IA 1KBVA 3QPKA 2WO2B 1JZFA 4DPAX 1A65A 4HIPA 5I6OA 1OCZB 2AVFA 2R7EA 3S8FB 2H47C 3S8GB 5D4HA 4KNTA 3KW8A 2BWIA 1ET7A 5I6MA 3ZX1A 4YSQA 2EIJB 8PAZA 4YSOA 2UXFA 4G70B 2RACA 4DP6X 1BXUA 1X9RA 1R1CA 3T6WA 4PCYA 4DPBX 2A3TA 2XXFA 1NTDA 1NWOA 1A4AA 4AI7A 5IY5B 1WA2X 3SBQA 2CBPA 1ID2A 3PXLA 1CURA 4BWWA 1ETJA 4L0PB 2DYSB 3HB3B 3QJSB 3NJJA 1CYWA 1AG0A 1KDJA 4G7SB 1BXVA 2FT8A 1N68A 4HALA 1JZEA 1E5YA 1YLBB 2ZONA 4Q8BA 1KYAA 3FQYA 4CSPA 4YVNA 1SF3A 2CAKA 3H4FA 1KCBA 3AG4B 1RCYA 1VLXA 3TBBA 3WNIA 3X2QB 4BXSV 5I5IA 1J9SA 4KNUA 2FQFA 4WKXA 1MDAA 2QPEB 3QJQB 4GP4B 4NERA 1DZ0A 3WNJA 1NINA 4K9JA 1GS8A 3V9CA 1NWPA 1M9WA 2B08A 2DWTA 2XX0A 1RZPA 1BYOA 1JVLA 3NJLA 2VMJA 2JKWA 2PCFA 3X1GA 1A4CA 4E9YA 4YSPA 4KOCA 1AS7A 3FYEB 3NJNA 4DP5X 4JHVA 2Q5BA 2PLTA 1FA4A 2HZHA 5D4JA 2DV6A 1W6LA 2J5WA 3ZIYA
chains in the Genus database with same CATH superfamily
1GZPA 4FD0A 3D7PA 1HOEA 5GS2D 2M2DA 5ECJE 2KDYA 4GBXB 4GQ9L 2EXTA 3WOVA 1WUZA 3M17A 1PQZA 1XEDA 3WE6A 2Z7ZA 2FEEL 2ADJB 4QLRA 1PSKL 3G5ZB 1Z0MA 2MHAB 5CLTA 2PW1A 4FQLH 4P4KA 5DEFB 1FHNA 1JYXA 5ITFB 1QLRA 2BCMA 2WUCH 4GKLA 1JWMA 4LPUA 4QMEA 4UNTA 4F7MB 1TJHL 3OPUA 3ALXA 3VD0A 3U9UB 4Z7QB 4MAYD 5E2JA 1ZAGA 2ARJA 3EYUH 2DKMA 5JPMC 3P11H 4XBMA 1JHTB 4H1LA 3Q6FA 4JE4B 2YN5A 5CCGE 1YEHL 1R5WA 1YPZB 5FYKE 2DBJA 4U3SA 3S0PA 3TN0A 4F9PA 1PLAA 2QQLH 2R2EB 2B5IC 3O8XA 3OKNB 2Y7MA 4RX4D 2J1KA 5EUOF 3WKPA 2WVVA 3E6HA 4ZPVB 4P9HL 3BFWA 3MUUA 4JM2D 5EU6A 3U2SB 4N4YB 5K9JH 2QKIB 3FFCB 1YQ2A 4JKLA 1J0JA 2WBJA 3JUYA 3RFRA 2Q8BL 3WFCH 3CX5J 2I7OA 5D8JL 4Y2DD 4PWJA 2NX5D 2PWFA 3UFIA 5D7KE 2Z31C 1RLWA 4ISVA 4F91B 1Q72L 1U2CA 1TLMA 3GD1C 4MAUL 3SB3A 5IOKA 3FB8B 1UWGL 4LFHD 3NJKA 5D1XD 1TSRA 1EGJL 2ZKHL 5H8DA 2C9RA 4DKTA 3E1F1 4CVUA 3EBHA 4G9FB 4AZ8A 1OF0A 2FL5A 4O02B 5ALCH 3WTSA 3VFTB 5M95B 1QFPA 5IJDC 4PI2A 1ODUA 4FQ1L 2M1KA 3O8XB 1TU2B 2ATKB 1U93B 4P2OD 2MCAA 4RISH 3LXUX 1HSAA 3NFSH 1OSPH 4YFLF 3T2NL 3BZFA 3QJRB 1O6VA 4WVRA 4P2RD 3CN4A 1BQSA 2A74B 1V7ML 3EOAB 1ZGLA 3QR1A 4IIQA 4N22A 2TSAA 3ARBC 3VFWA 1ZGLM 2Y06H 3WNOA 1UM5L 2CK0H 1XGUA 2NY4D 1XGTB 3PWLA 3G08A 4OQTH 4WTZG 4PGDA 3L5WA 4PP1D 1ORSA 3FN3A 4PJ6A 2OCJA 4Y5XB 3VTTA 3NIGE 4PS4H 5I1GH 5TQ0H 1MCIA 1DJXA 3EDDA 1PCXA 2A0LC 2HT2D 3BQUB 2NUPA 4DUWA 1J12A 4LPTA 4F7CB 5D2LA 3MCKA 4DQOL 1I1YA 5TH2B 3L2LA 2X87A 3UYPB 2QQLL 2DY2A 3DETC 4G2AA 1NLBH 4NQDD 2BY3A 5DD0L 3BSZA 1LWJA 2ADYA 5ADPL 5TE6L 3OXRA 4MBOA 4MKMA 1XSKA 3MLYL 2PCXA 1B4TA 1ZVSB 1BWMA 2VAJA 4MAYA 3N41B 3TV8A 1N18A 3GXIA 3DKHA 1MWAA 5D7KD 2F7OA 4N28A 5DHVB 2CBMA 5I0YA 4MNQE 1ZLUH 3MLXH 2QR0B 5EU7E 1CD1A 2X6MA 2BMKB 5LXVA 5IB3A 2VLKA 4NRXA 4G6ML 1J8KA 5GS1A 2J6EL 3U79A 2EIZA 2WLIB 4KTGA 3EF4A 3SKMA 2X6AA 4L1DA 1T03H 4NQVA 1HH6B 2W1NA 1DQJA 3FO0H 4LSSL 1BFSA 5CP3A 3SKJH 4ZK8A 1XR9B 2RHEA 2VH5H 3IJYB 1E67A 4PJFF 3QXVA 5D72H 5E5UB 3VFNB 1WITA 2BOCA 4X6BB 4JFPA 3IAGC 1CQKA 4YK4C 1ZLWH 1FSKB 2XN1A 5GGTA 4A2FA 3T09A 4P07A 5DD3H 3S2CA 4WY7H 2J5LB 3FH8A 3T2NH 5FCUH 1YVLA 3ML8A 4K3JL 5DA4A 1I7ZB 4GAJH 2C5DC 5D1XA 1SMAA 5L7XH 4PG2C 3GIVB 3RPKA 4FI6A 3EZJB 3WIFB 1QRNE 4U1MA 4G71B 4HOMA 4Z8FH 1SY6A 1GMIA 1NANI 1L7TL 3PE9A 5FUZL 2RB8A 1NCOA 3BVNB 3MZTA 1U8JB 3FQWA 5T1LB 2IPUG 5L9DL 3BVWA 1UWGH 2HVJA 4HQQL 4XNBA 3CC1A 4R97B 4CVXB 2HLEB 4HJJH 1GC1L 1KIRB 2LLLA 2XG5B 1EHLL 4Q4EA 1NSNH 2BIIA 4XC1H 5LQBL 2ZXBA 3BSZL 4LXFA 4WWKC 3H85A 3SCMD 4FFVD 4RWHA 2IIJA 3GMOA 4GRWB 3I3BA 4YZFF 4MNHA 1D7BA 1Z5YD 3FPYA 3K8KA 4NFBA 1J1OL 4P0DA 4TQPA 1OE3A 2H6PA 2DH3A 4QRUA 4X7FC 1EX0A 4GUPA 4I1RA 3UDWA 5TQ2L 2Z0BA 1PZ5B 4H1LB 2QEJA 4OIIH 4OD1L 2I5YH 4TVPH 1RZKL 3CUPB 5AG8A 3ZJAA 3ASOB 3QYCA 3NAAL 4UYQA 4FTVE 4N85A 4M4RA 4X5WB 4HPYH 4PRIE 5GJSL 1F8TH 1V3KA 3SCMA 3QO1A 1ZS2A 5F7LB 2JB5L 5IG7B 3UJIH 1AQDA 1F97A 4GW5A 4KO9A 4MDIA 4LLYA 5GRXG 2XV6B 4N0YH 3SE9H 4OZFG 3WJMA 4CJ0A 4H1LG 1OAXH 3B3IB 4ABUA 4DPCX 3CVHH 5DD6B 1KTLB 4EDXB 1RPKA 5D4QA 1R47A 2B4CC 4PJHA 4DP0X 5AW5B 4QRPD 4UTAA 2DDQH 4OUUB 4ZOEA 4LIQL 4RX4A 4AUUA 3HAEB 4HHAA 4UM8A 3WO4C 4ZYKB 1UOKA 3S34H 4UQ3B 5HPMA 3C87A 4PBDA 2FHBA 4OZFB 2NY2C 4GXVL 5EUOA 3RGVA 3TBSA 1UH4A 4EVNA 1KGCE 1EBPA 1IGJB 4NAMA 2ENJA 4ZOAA 3BUTA 1JPSH 4JG9A 4F7PA 4P3DB 3WFCL 5JUEH 2DLFL 2BSRB 2H6UA 4HDIA 3TH2T 5DVNA 5ANMA 1AQDB 3D6GA 3O4OC 4GW5B 5I8OL 4K8RL 3QUXD 3CFEB 2LU3A 1RL1A 3II3A 1CR9H 4HUWA 4W81A 4XP4L 4RZKA 3HUJA 3VRJB 5C3TA 1EDQA 5IQMA 4QT5A 3MO1B 1MJ8L 1UT9A 2XV3A 5J12B 1FNHA 1PG7X 4HVBA 3WE6B 3LEVL 4M1CC 4Y19D 1UZ8A 1PAMA 4GBXA 3FUEA 4ZMVA 2ZF8A 5E6ZA 1Z3GH 3L9RB 1EZSA 2CPUA 4EJ1C 3HE6C 4OZFA 4KY1H 4R7NB 5AVZB 3SDXB 3UPRB 5B7MA 4H7VA 5IOPB 4YZWA 5I16B 2NOYA 3ARFA 2R1XA 1NBYA 3OKYA 4MD4A 3AB0B 4AJVA 4WO0A 3G04A 3QNXA 4LFHG 2OJZH 3OSKA 4LLQB 1KPUB 1RZ7L 2BVEA 1HHJB 3J2PA 4CVWA 3QQDA 3D2UB 2NDFA 4LBAA 3B9VA 5AVXB 4ZD3L 1S9YB 5I1HH 2W94A 5A40E 4HUCA 3V2AR 2Y7QA 3P73A 1FZMB 2MJWA 3PL6D 2WWNA 3UL4A 2F19H 2HH0L 5CXPA 3VJ6B 3W39B 4GI6A 1YMMB 1QSFA 2C1OA 4KGJA 1D2PA 1XF4A 4JO1H 5T3ZH 2P49B 3BCFA 5H37H 2MIZA 4YBLB 2WV3A 4NQDA 3W5NA 4Z95L 5EC2A 5DJ8B 5LGKA 1OSPL 4E9LA 4QYOB 1NCJA 3L9EA 2VC2L 2ED8A 3N44F 5CWSA 5IW6A 2ZP9A 1B88A 1KCKA 5EPMB 1H3GA 1EV2E 1XT5A 2P3YA 4PRHA 2NLJB 5FYJH 5CGBA 3ZDZF 4A7UA 5GXBB 2F08A 2FLBT 3IJYA 1JAEA 3BOVA 5CJ8A 4L3EE 4EUPH 1K72A 2K7PA 3R8BB 1U36A 4J3OF 3KDPB 3VXOA 4RAVB 2Z7WA 1YEEL 3RFZA 3THML 2DLIA 2V2TB 3QA3B 4S1SL 4B53A 3D09A 2HKFH 4NNXA 3WIHA 1RZJH 3VJ6A 3G6JE 5DMGD 4LASL 1S9WB 4GKSB 2BMKA 1K4DA 4GNKB 3BKJH 1XGQB 2H0PA 2JNZA 4XNZC 3NA4A 4YHIB 3DHJA 2HFFB 3PWPA 1L3WA 1MCRA 5A3ID 1IL1A 3MR9B 2UXFA 3GO1H 4BV1A 1MH5A 1SVZA 3LQAH 5FA3B 1JD9A 3N85L 5J9PA 1NC2A 4GG8A 1LNUB 2A9NH 2BOLA 1TQWA 3TYGH 4P9HH 4L9DA 2FWSA 1ADQL 4RAVA 3EOBB 4MB3A 3KJ6H 2WLLA 3UPCA 4KTYA 5KJ7E 1PZSA 4XMPH 2KI6A 3V7AG 1BAGA 5LVEA 3IYLW 4LPXA 5EU3B 4C4KO 1KT2B 3AGWA 3BKCL 3BXNB 3HW7A 4NUJA 2W9DH 4TLSA 3HAEG 2V8LA 3C12A 4R90H 4HWZA 4XPAH 3L7FA 4BCYA 3BH9A 3I02B 2O6CA 4JFEB 5CEYA 3LZFL 2WN2A 4HALA 2HAZA 4K7PH 1MH5B 1YLBB 2VDLH 3ZKQD 3V4PH 2W92A 4XMLH 4Z18A 2W0LA 4YVNA 4GIAA 3UH8A 3CFBB 3CX2A 1BIIB 1WDAA 1F3JA 5DD5H 1DCEA 3KXFA 1FORH 2UVFA 4YC2B 2MNUA 5TTRA 1L9NA 1QA9B 4MCMA 2B08A 1E2ZA 4GT7A 1JVLA 4OM0H 2JKWA 2CBQA 3T0BA 2YZ8A 1A4CA 3CCHA 2YEVB 3ZL2A 4MZRA 2FVNA 3H3BC 3O9WA 1YEGL 3AAZA 2Q5BA 1PVHA 2LGNA 2PWEA 2X6BA 3AREA 3M45A 2HZHA 4WEEA 3NCFB 1O9WA 4XX1G 1D5BA 4Y5XC 2J5WA 3LRSB 2JE8A 3OKKB 4FTDA 2VDKB 4BRVA 1IC5L 3MCKB 4POZC 3GGWA 4IDLA 4PVLA 1A1NB 1MIEL 4JPSA 3WMSA 5AAWC 4UI2A 3S34L 4IEFA 4WK2B 3R19A 1WPCA 1A6VH 3B3IA 4HJSA 2WBJD 5TK4A 3IDXL 3LRGA 1BVLB 4M3HA 5KW9L 3MXVL 2F0CA 4KK8D 4GLRH 3KYMB 4LHJB 1TZ8A 2HA1A 1TJXA 3QNYB 5B1CA 4JPKH 2OS7A 4OGQC 4B96A 2OTPA 1A4BA 1MJ7L 2R0WL 1VIWA 5CCKL 2HSIA 4KKCC 4F7KA 2M8XA 1AOHA 2MWCA 5J3HD 4I77H 3VI3B 2BWQA 5D5MA 5JZ7D 4YQXH 2RCSH 4IKLA 5FGCE 3UTSE 3N9GH 2YRPA 3DWTA 1SBBA 4J3UA 1U8PA 1FLRH 3IVKA 3IVKB 2X6UA 4W1TA 4O2CA 3JZYA 5LWYH 2HUHA 3PJSA 2NDGA 5DTFA 5TQ2H 3HZVA 2NSMA 3QZOA 3FCTB 3UBFA 1Y7VA 3F8UB 1NCNA 1OAUH 1HHGB 2AGJH 2FB4H 3FQXB 3FUIA 4XNYH 3W1ZA 5IBUG 3UTTB 2QADB 5AKVA 2IANB 3B37A 3IXAA 4TUJA 3U0TB 1N4XL 2P28B 2ZWYA 3HUJB 5DK0A 1AZZC 1I1AB 3MGOA 2VN3A 2EEBA 3U0WL 4U1MB 4NO5A 5K9QI 3KWVA 1JHKH 3DDGA 5AVVB 2XPGA 4GOSA 4YVUA 3WO3B 2XZCH 3U6RA 2CLRA 1HI6B 5GSRA 4CJ1A 4OZ4A 1IGJA 3K72A 1I3UA 1E6JH 3Q1SL 4MXVE 3RVWC 1UASA 3AW5A 3LNEA 1K5NA 2QDWA 4JO2L 2N59A 4Z23A 3D0LB 3NCYS 4JO4H 2AV1A 4QKXB 3WHE0 4CA4A 2OP4L 1JMXA 2XN9D 2NW3A 2FCBA 3S3BB 1SNRA 4O9HL 1G7QB 3HB3C 3CHRA 1OB1B 3NP3A 4PJHE 3L5JA 2IVFC 4U1GB 4GAFB 1IKNA 3M1CA 4TUUA 2GITA 2GT9B 2CA3A 1WAPA 1SZNA 2HJFA 3BP4B 4B3VA 5ABZA 4AY0A 2DBLH 3MRIB 2J88L 1FFOB 2E74C 5F2FA 3UGUA 2PO6D 4U1NA 4EN3C 3EZ8A 1OHQA 3QG7H 1FBIH 4AQ8A 2HX7A 3QO0B 3CFCH 5IREA 4NI3A 3SIKA 3IF1B 1PQZB 3ZHFA 4IBVA 3V4LA 2H5UA 1AGCB 4PRID 2HLAB 1T80A 1BX2A 2AQ2A 4JKMA 3BKYH 3MMEA 4JNXA 2J1ZA 4EDWL 3N41F 4FQHA 4XXWC 4DK5A 4LSTL 4P23D 1Q0XH 1T66D 2EE6A 4MCYB 4QGYA 1DVXA 2GTZA 4MNQB 2R9HD 2LVCA 4HSQA 3VXTB 1MAMH 2PO6A 4G6JH 5TE6H 2CO6A 2XZAH 2JJUA 4JFOA 3FB7A 1CFSB 3R7QA 5IJVB 1YMMA 3EFDH 3ERXA 2DQTL 3T2LA 1N9PA 4L9LA 3VRLE 2AQRA 1Q8MA 4IRZL 6PAZA 5T33H 5C0GB 4NWUL 5J0BA 1CDBA 4WW2F 2WQVA 3QQNA 2IMMA 2A74A 1FL5A 1ZIBA 4A2DA 5IT2H 4PRNB 2GJ6A 1Q0YH 3MZGB 1HAUA 1MIMH 2CWRA 2ZXAA 3DA0A 3FOLA 3TT1L 2NY5H 8CGTA 5I16A 1TOXA 1P5VB 5ENWA 4ZX5A 4JQIH 4UIMB 3C8HA 3NCJL 3W0WD 1T2JA 1N19A 4CVZA 2NZIA 1JS4A 3ABLB 4NC0B 5C70A 3BD4A 3AB0C 4UIMA 2VMCA 3HC0B 5GRJH 2JLLA 4IS6A 1J1XH 2IH8A 4H8UA 3WEBA 1BMZA 1DQJB 5DFAA 1T21A 3CVHL 1I8IA 1OGAD 2OFQA 4EOWL 1OW0C 1GYUA 3MV7B 4LE8A 1IGCH 2KZKA 2W5PA 4DEUA 1KBWA 1WWAX 5B7EA 1YMHA 4UV4H 2H1PH 3TN0D 2W60A 2G60L 3ZUNC 4G6FD 5GJSH 1JPFA 5EO9A 5DJXB 4BE5A 2IFGA 4CKVX 1OV8A 5JIQA 1I8UA 5D7LE 3STZA 4GT0A 2X4OA 5D8JH 4OB5H 4TQHA 1OGSA 2C9UA 1OCOB 1KFGA 4HUMB 4PTUA 5CEXB 2PO6B 1J11A 1CLZH 1EXGA 3JWNH 2WLNA 4FFYL 4QRPA 4K3EH 5IQ7H 1LM8V 2C26A 5AB9A 4XH2B 4G42B 1X4YA 4JANB 2HFGL 3U9WA 3NFPB 2BVYA 1PKQE 4I2XA 1ZIAA 3DSFH 3LXBA 1J9TA 4KC3B 4F8NA 1F1AA 2H0JA 5AW1B 1JWUB 1XMEB 1JK8B 1TDQA 3BP7A 1JNLL 3VXQA 5ISZD 4JFDB 2L4OA 1ROWA 4D9LL 3MUJA 1I3GL 1MFVA 2J7LA 4IK7A 4G7YH 3B7SA 4JFZL 4WFFE 1CC3A 3HZ3A 4LOUC 3HFML 3NCCB 2A73A 3ZQ9A 4BFOA 2ZYSA 5A2KH 1NM9A 5AYQA 4ENZA 3S4SA 4O58H 3QDGB 1KBGL 1TTUA 4N0CC 3QUGA 1KIQB 1GJIA 4KITB 2FBJL 2D7QA 3L08A 4ZZFA 1RERA 1P2CB 2NQCA 4ZW3A 5F96H 3S6CA 2WZ6A 4FXKC 4NZRH 4F7TA 3X17A 1P4UA 3V0AC 4PEEA 3UGXA 2GBUA 4FYQA 1X5GA 4LNRB 1PZ5A 5FGBC 4XP5L 1U92B 4KMTH 4UTBL 1XFPA 3QZPA 1EGJA 4FEIA 4V2BA 3WIAA 3JV6A 4NT6A 2P8LB 2CR3A 4FL4B 4UB0H 4WI8A 5F0PB 1ULVA 1J05A 3H3KA 4IOFD 2BFGA 2VLRD 2ZWNA 3I9PA 1OHZA 3HAEH 4EN2A 2VXSH 3CFUA 3F64A 5FW7A 1QBLL 1TLKA 3O2VH 4Z7QF 4TPRL 1NCBL 2YEZA 2I32A 4XN8A 3VI4B 3QNYA 1ETB1 1QLFA 3Q3GB 3VWJD 2VDPL 1OSEA 2V37A 2Z92A 1R46A 1X4XA 3DRQA 5CGTA 3OPZL 3QS2A 2PR4H 3WEXA 2MEJB 3T77A 4ENED 1CN4A 1IM3D 1GIGL 4MMYB 1EFXD 1RUKL 2OYMA 1CLOL 4M8VA 3S7GA 3SDAC 3EYSH 1QSFE 3L4UA 4ZG1A 4QNPE 2PYEE 1CB4A 1DVZA 2KPWA 4OJYA 1AGFA 2OMWA 5FW6A 2RD0A 2Y3NA 3QE5A 4N2GA 2AI0L 3FQ4A 3Q9PA 2FDBP 1JYVA 1YDPA 2IWEA 3O4LA 5F3BA 3OMNB 1JRHI 1QO3A 2E6JA 3Q6GH 2J1YA 3R06B 2BOCB 2OCFD 4X6BA 2BH0A 3CHSA 1BVZA 5F7HA 1JF1B 1QA9A 1BXAA 3GDBA 2EIDA 4JM2F 2H0FA 1EHNA 3W37A 3FUMA 4YFLI 3EHBB 2Y2WA 1FF5A 2G5RA 3O0LA 2EDJA 1DFXA 4M43H 5I8EB 4FAAB 4ODSH 1X5XA 4OLZH 3CNKA 4JFVA 4MQXD 3T3PB 1CICD 4WU7B 4OCXL 1OPGL 3IDJA 1PGRB 2ZIDA 4LCIH 5I8KH 3EBAA 4HD9A 3FMGH 3WAJA 4D9QE 4O51B 5E24E 4MDJB 1E5AA 1V7NH 4Y19A 3DIFB 1K3ZA 2Q6WB 2BSCA 1RPQA 4NHUB 1XAUA 2PWHA 1XL4A 1S7TA 1XQ4A 4L1SA 2SEBA 2F9BT 3UBXI 3SKUD 1AFVH 3TO4B 5JHLA 1GZQB 3L3KA 1Z5LA 1IAKA 2YAHA 3ARBB 3RVVC 3SJVA 5FUOH 2CK2A 3V0WH 1N8OE 2OJEA 3RLSA 1D5IL 3MOBH 5HHQA 1BOGB 4XMZA 1CGWA 3KYNA 5KVEL 5FDYA 1W0VB 5BUAA 4XNQA 1GGUA 1IC4L 4JS7A 5AVQB 3JWDL 3QP3A 1JZFA 3F7KA 2E7LC 4NKQB 1CZ8H 1FL5B 5EUKA 3QI9B 5DUJA 5BMFH 1KN2H 2KBGA 4OD3L 1IEBB 2ZWZA 3GJFB 4ZAKB 3UBXG 4BZ2A 4P5KA 4X83A 3BAXA 3VI3F 4JM0A 5IVZA 4I4WA 5LKNA 5DXWA 2AK1H 4HKZA 2DM3A 2ICEC 3UO8B 4LAJH 4HX1A 3BN3B 4L8CB 5T1KA 2UZPA 3O11B 4WZ9A 3QQ9D 1BHGA 3LIUA 4ODUA 4WUUB 1E42A 4Y4KB 5D96B 3MRKA 1KENL 3M86A 4NN5B 1FAIH 5KG9B 1CURA 1CQYA 4N5ED 3SE6A 3U36B 1YEHH 3VFTA 2XWJA 3HB3B 5E99H 5JQ6L 3WTYA 1K6QL 3P11L 1SGKA 4KTDL 3V8CA 2CZNA 3QUYC 1CFTB 2RQEA 3KJ4B 2NUPB 3VD4A 5HDRA 3UCRA 1PLGL 2VSDA 4GEIA 3Q7JA 2QBWA 5HDQH 3X14B 3RY4A 3AWFA 3FK3A 1ZHBB 4LLWB 4MXQD 1IGTB 3GMPA 4OM1L 3U4EA 3D85A 4W9LC 1PSKH 3D2UA 5GRWA 4IMLA 4NERA 1CDJA 1ZE3C 2F8VA 2H4EA 3FFCA 4M3KB 4Z7OE 4G9FD 1F1GA 3EADA 4F92B 1KGIA 4Q6IC 2WZ5A 4AUYA 3EYFA 4RETB 2XX0A 4ATWA 3MV8A 5IHWA 1Y6NR 4XBPB 4DGVH 1I8KA 2FHFA 4A7GF 1OT2A 5L8JB 4Y4FA 5HVFB 5KVFH 1TQBC 2YD6A 4NZTL 4XMWA 1FNAA 2J8UE 3RA7L 3IRCA 1WCBB 1HSAB 1SJVA 1PTZA 1QFHA 2XI9A 4JQIL 4Z78A 1X7QB 1NFDB 4ODTL 1KCSL 3UDWC 4AYSA 5CHNA 2ICWA 5IMKB 1A9EB 5ID0A 1GC1C 1C5DA 2COQA 5J4MA 1KXTB 1UKTA 4XCNB 2D9QB 3RKDD 3VH8B 4HUWB 1JD7A 2CR6A 4WFFD 3HMXL 3UAFA 5T33L 3QPXH 1PG7H 1ZK5A 1DJGA 3WY4A 4WUKH 5HHPB 4YPGB 1S7XB 1OWRM 3D87B 3L6FA 3T77B 4FHJA 2A2QT 5I1LA 4UMGA 5D4IA 4XAWL 4LF3B 3OZKA 4GKNA 3EJRA 2R1YA 1PW3A 4U7KA 1L9RA 3WKYA 5BS0B 2VC2B 3TNNA 2IQ9H 1D5BB 2BM3A 2WZPA 5IM7A 1JJUA 1FL3B 1R5IB 1RVFL 2IOMA 2WTRB 2WVVB 3K3QA 3MA9L 4LB8A 4A6YA 5JQHC 1D2OA 1OTTC 5KVDL 4Y4HD 5JA9A 3QW9A 3UPAA 2PPEA 4ZI8A 4J6RH 4ADGA 2NZ9C 2R15A 4RWYH 1AGDA 1UZ6F 1GIGH 3QFDA 4G3YH 2V5SA 4UINL 3OR7A 5GS0L 5E00B 4PP2B 2OXHA 4AENA 25C8L 3RUGB 2WXFA 2YPLA 4J2XA 2ERJB 4NM8H 5T3XL 1X6LA 4JVPA 4PJEF 3K5SA 4XMKH 1QI4A 1TIUA 3VXSE 3ULUC 2E86A 5AYUH 1NEZB 1ZHKB 5LN8A 2X2JA 5T5FA 5KS9A 2FR4A 3ECBA 1NCBH 1BEYH 1L0QA 3DUSA 1Y18A 4ZQKA 3V4PB 2IALA 5JW3L 4R0LB 2BSTB 4X4KA 3INUH 1INDH 2NY3D 1QHOA 4O2EA 5KUMA 1ZVNA 1P7KB 1I1FA 3HLKA 3QUMH 4TSCL 5C0BD 1IQWH 1R5VA 4FZ8L 3TCLA 4QHUA 2B8OT 1SFDA 3RY5A 2JV6A 5DRXA 3GGWB 5AWNL 1JWUA 2YPLD 2ZF9A 4JO5A 1OGAE 3J27A 4EIBA 5C09D 5EZLB 2IEPA 3FQUB 4BDVA 1NIAA 4U1HA 4OJAA 2FX9H 5DEGA 3RWJB 2KLRA 3O9WB 4O58L 3C60A 2JCCE 2CDFA 3CFDA 3C6SA 2R1WA 5KSVB 5EBWA 1G1OA 1NAMA 2VR6A 1Q9OA 4AYID 4PR5B 4HOZA 1EDHA 3CZEA 1CIDA 1UA7A 4I9XA 4YHIA 5GGUB 4XBGA 2HJLB 5HVHC 5I8CA 1MRDL 4RDQF 5HVHB 1QFUL 1LK2B 1N4XH 4F9LA 3VTAA 1MXGA 3SCMB 1UXWB 4ZMQA 3MLWH 4J39A 3IDMB 3N04A 3NSFA 5FHAH 2WXNA 1A25A 4M8UA 1XZ0B 4J3OC 5I0DA 3F12A 3HMWL 1HEJC 1L9MA 4YDJA 3TFBA 4MKTA 2RIKA 5L4FA 4JRYB 1OAZL 4MZ2A 5E8OB 4YBHA 3SGJA 4GO6B 3HC4H 2VDKL 2XN9A 3O11A 3SBWA 4AMKH 4MJJA 3PWNB 1XDTT 3DARA 3KWWB 3MRCB 4X8CA 1IB5A 1N6VA 4CNIB 2Y3AA 4GBXD 5BOZG 3FHAA 1AO7B 5IB1B 3ZKMC 4G59C 2LT9A 2WTPA 4DKAA 2ZOWA 3CVCA 2OK0L 4N26A 1CE6B 4NRZB 3CIQA 1LK2A 1YYCA 5DS2A 2YGPA 2FYVA 2WNXA 3L3DB 3L2MA 3ZZ1A 1OP9A 2P8PB 12E8L 1ZTMA 1NGWA 3GKWH 3O6KH 4XB3A 3UYRH 1RSFA 3K2UL 4MD5B 3BRGC 2FJSA 1VJSA 2WO3B 1BXXA 4H13C 3E3QE 4JFDD 4G6AC 4A38A 3NCJH 5KBKA 3RWJA 1MCFA 3NCEB 4U1KA 2CO6B 4JFOB 4JM2C 4R83A 4XPHL 4ZFOA 3HHSB 2X09A 2VLJB 4P4RA 3ZVVA 4BD4A 3FAWA 5TPWL 4IOSD 1ILSA 5CFHA 2Y07L 2ZOLB 2VLME 2XG4A 2JCCF 4DO5A 4LARH 1Q9WA 3CZFA 5ICYA 1XGZA 3NSYA 2E59A 2Y1ZA 5DC9B 3ZLQC 3G5YA 3IGLA 2YARA 1V3JA 2DQHL 3FULA 3DV4A 2UZYA 2F1AA 4HUVB 3JQOB 3G9AB 4QRSB 5CZXD 1FORL 3U48A 4WI9A 2XU9A 4ZUWB 5FCSH 1YY9C 2ERJC 4WQOA 3S96B 5I71C 1E4XL 3TFKC 4LP4A 5HDQL 3SDCD 5D1ZB 5E8OA 3VFVB 2VJ8A 2WWKT 3TWYA 1JF1A 1NPUA 5AKSA 1UG9A 1N3NB 3S3CB 5FB8B 3NK4A 3F5WA 1AHKA 3NIDF 4XCEB 4GINA 2DQUL 3KYNB 4I1NB 4PH8A 2ZKWA 3X11B 4WIQA 1FWXA 4WTXA 4PJDF 5LN4A 3W5MA 3KPPA 1CWVA 4FQQA 4DCQA 2FJUB 1KENH 4HFWB 4WWID 4JW3A 4RFEA 3SOTA 1CYGA 5E6RB 3NIGB 4NJAH 1U3ZA 2Y6SD 5D2LB 3OHXA 1WHPA 3TC9A 3JUZA 2DWEA 3M7OA 3NIFB 3QRGH 4KH9A 1T1WB 2EIBA 5FYLH 2AHIA 1XV8A 4OVUA 1FH5H 5CGMA 1TITA 4G11A 2OM5A 5GZND 3RB5A 3BN9D 2CIKB 3MO1A 1F90L 3X1NA 1BG9A 2WKOF 5JZ7C 3QUXA 1XGTA 3PWLB 2VWEC 3Q8FA 2RFXB 1AACA 3ILQC 4GW1B 3QEUB 4AEEA 3IU3A 4HV8A 3SOBH 4TRPH 3D8MA 2OBGA 5C0RL 3E6HB 1A14L 3GWJA 4K4KA 1MEXH 5MERB 4N5UA 2ILLA 4BEIA 4Z1PA 4JFFB 3HMXH 5AWNH 2MCPH 3TONA 4ONHA 4AYFB 4P5TB 2BCKB 1U2HA 4J3TA 2P5EA 2YD5A 5DHMC 3QUML 4HISA 2NZ1A 3FYIB 2GB2A 1E40A 5G5DB 3QIBB 1DBBH 1AVAA 1LMIA 2OX5A 5FX3A 1M6UA 1O6SB 5JW3H 3PAVA 5FDWA 4ADIA 2HT2C 3RA7H 1QLEB 5AUMB 2R23B 4IMLB 4LLDA 3GB7B 3O6KL 5DA0B 1CGYA 2LABA 25C8H 2AANA 2Z31A 3OQ3B 2ZPKL 5GS0H 3O41B 3QG6A 3NSCA 2NY1C 4HU2A 4PJBA 3QAZC 3MLTA 3VRLF 4ODSL 4WWKB 2E0PA 3WIFA 3B1TA 2AP2A 1AZBA 3OKOA 3RRQA 3U46A 1KPVB 1E9PA 2NX5A 3ARQA 3MKGA 3VXQB 3U2SA 1BJMA 2W07A 4RMBA 3E8UL 3BVDB 2TRHA 4YH6A 2YFNA 3CSBA 5C0BE 4C83A 1R24B 3F58H 4DERA 2K6WA 4DW2L 4BUHA 3B5GA 1C16B 2VDKH 4KY1L 3LIZA 4NZDA 4PTUB 2VKWA 4KVNH 3U9PH 3PWPE 3AJ7A 3UTZB 5GIRA 2VISA 4GRLD 5I6NA 5K1NA 2GAZB 4B5EA 1MI5B 3IPEA 2WNKA 4JY6A 3QXWA 2Q10A 3HI6H 3RWEB 4MJ5B 1J9QA 4XBPA 1P1ZB 5EBMB 4NRYA 1P2CA 1EJ8A 2OTWB 2N0KA 2WLIA 5DF0A 2XCMC 2EZ0D 4PCKA 4W4OC 4AV4A 1MSPA 2QV2A 2W38A 3GRBA 4DP8X 2AMGA 4MJ2A 2EADA 1URIA 5L2JB 1KJ2H 5I8OH 3OX8A 4FFZH 2NTSP 2QGDA 4JFED 1BECA 4PJDB 2VDLB 1F58L 1QHPA 2MNWA 2VAAB 2W0FB 4L4VA 2L7UA 4MA8L 4KHTL 1ZVSA 5EB9A 4ABVA 5TE7L 4Q2ZB 1HSBA 4GAYA 4GRLC 1JUFA 3SQBA 1SFHA 3UBXB 5DURB 4GYBA 2MKWA 3T3MB 4CDHA 4GMSH 4UIKL 2P5PA 1ZA3A 3NIFF 4Q97A 3LDBB 4W6XB 2OSYA 4WWNA 5D2NC 3VXUA 4ODBD 3RTQA 2H2SD 3MV9E 2ZCLH 3ARUA 3VFGL 3ZO9A 3BCDA 3DPBA 1LE5B 4PRDB 2FIKA 1A6WL 4PV9A 4M93C 1QR1B 1INDL 1OGPA 4DPAX 3PIQB 4MD5A 3BC9A 5E6ID 1FN4B 3SKMB 3KS0J 1ET7A 5K59F 5ALBH 2V7HA 1CGSH 1GOHA 1XD1A 3X3FL 1CXLA 3FCUB 5AZEH 4FCAA 1KJVA 4C47A 5HYIA 2VR5A 2YBRA 1ZXQA 1RIVH 3ZDYB 1BXUA 1IU1A 3T6WA 4PCYA 5CN2A 6CGTA 1DBML 2VZ1A 3ECUA 5HGHA 5I75C 3IDGA 4FQ2H 4LVNB 4XVOA 2CJSA 1KTJA 4JZJB 2CNYA 4D2NA 1NWOA 1NKGA 1MWAB 5IY5B 5F8RC 3D08A 5DZJA 2H2SC 4ZBJA 4WFGD 5FYJD 4LDOB 1M2OA 3P4MA 4KX7A 2ITDA 4P2OA 1E5UI 1D6EB 2JK5B 2KMWA 2OSLA 5EOCL 1TR7A 3WELA 5J06A 2BINA 4W68A 3QCUH 5EWIH 3SZ6A 3NFNB 3CXDH 1FE8H 1N68A 4I7ZC 1IEAB 1RPUA 1IGYA 1ZANL 2X3AA 1ZEAH 4PJAB 2ZONA 3P4NB 4FQXD 2HKFL 1UXWA 2X1PA 2YXMA 4R7LA 2XFGB 3DI3B 1VGEL 2CAKA 5IJKA 3TBBA 4XO4A 2YGNA 4ZFZA 3MOAH 2VE6A 4NXSA 3U30C 1URLA 2E3VA 2FQFA 4H8QA 5AW9B 5D93C 1IT9H 4LMQI 4Y9FA 1KJ3H 4M6NL 1A2YB 4XN5A 2GY5A 5F1OB 1TTRA 4NDMA 3QIUC 1TJGH 4XCYA 1NBVL 1XTMA 2IGFL 3CGTA 3FO9A 2Y25A 1UD5A 2OMZA 3S2AA 1OGAA 3LVTA 4A63A 1RK1B 5BVJA 4BINA 4JHVA 3IMWA 2WK2A 1J0ZA 2IJ0C 4PJGA 3JV0A 4TF4A 4LVNC 4Z7VE 3I3EA 4FXKB 4KKZA 1KLUA 3PDOB 2Z64C 1NGYA 1QX1A 5AB0A 2PUQT 3LOWA 1VCBC 1Y07A 2P46B 4JCMA 1MCWW 1JV5B 1DLFH 1NPNA 1UVQB 1QD0A 1FVEA 2BIMA 3ZYZA 1SXNA 4JKPH 3WKQA 5AW8B 1G0YR 1JBJA 4DJMA 1BPVA 3N44B 3AY4C 1FFOA 3RI5K 3OB0H 5AUMA 2JELH 2N1TE 4JR9L 3KPNB 3EFDL 4XPBL 1ASQA 4NM4H 1IGML 5IHZA 1RZ8A 3H9HA 1JK9A 1ONQB 1SHXA 3HRPA 4BFKA 1S7UB 2D4DA 3U4BL 4FXKA 3HFMH 2GCYB 1DVYA 1OCRB 4P57A 5J6HB 2NYZA 3WEMA 4ODWA 9PCYA 1C8PA 3FSWA 4D9QD 1XL6A 4HXBL 5ANHA 3S4SG 1JPST 5D6CA 5CD3B 1A64A 4DQOH 4F33B 4NAJA 3FUJA 4Y1TA 1SN2A 4I3GA 5GGQH 1I8LC 5LNEA 4W9IC 4N0RA 4OLXL 1M2VA 3U4KA 1WAAE 1J0YA 3H56A 4JK0D 1KSRA 2A4ZA 4BZ2L 3FSAA 3KLLA 1UWEH 5AZEL 1P4BL 1QWHA 1MY5A 3L6FB 4R4FL 3GYRA 1ZCRA 3EJQA 1PX8A 3LRLA 3S88H 4WTQA 4L18A 2QT6A 4LSVH 5GS0C 1JNNL 3SJVD 1QEWB 1IC4H 1SXSA 1T2QL 4ES9A 1EAJA 3FT9A 1WD9A 5KYWB 1OE1A 3W11C 3GSNA 4IRSD 1X9QA 3CPLA 4Q9BA 2P8MB 3UBHA 5IFJA 4AXWA 3EFOB 2EVGA 1DQIA 3MJWA 1XCQA 4JO4L 2JCCB 1HEZA 4UT6L 4YGAB 3GZKA 4PRPE 5GRJL 5DUMH 5B3SB 3LCYA 2V2XB 3IJ8A 2APSA 1OTSD 3MHZA 3NCMA 4HIIA 4CU6A 4Q6KA 4ESKA 5E70A 3MV9D 3PGDB 5ALCL 1PKQA 5JXAL 2F7QA 3ROOB 1Q1JH 3ZK0A 2HKHH 3ZYIA 4JFFA 4DNLA 4YDKH 5JO5B 5D7JB 2C3WA 1AG6A 1BAWA 1I9IL 3QEQB 2EABA 1U8IA 1Q72H 4ZW8A 4AYDC 3QDJB 2IQAA 1PBYA 2AQTA 3GMMB 4P2OC 4FLRA 1A4JB 3UTSA 1XGRB 1Q1PA 1KJ2L 3K0WA 3CC5A 3EJUA 5CZRA 5T1KD 4OQTA 1WAEA 4L8SA 4U1IA 2W60B 5J1AB 5J56B 3MJGX 1UTDA 1CF8H 3AWGA 5DFTA 2X9ZA 5GRZA 3BPOB 1T83C 3ZN6A 4NQXA 1J8HE 2D7OA 2JB6B 3KCPA 3U1SH 4F37K 1P53A 4E42A 3GK8H 3N5AA 3IKCA 2UXTA 3OZ9L 3QULA 2Q3XA 4KVNL 4LL1A 5F6IB 2BNQB 3P3TA 3PDGA 4YR6B 2WXPA 3GLEA 4OB5L 3IFOB 5I6XC 1I4FA 3BSZH 3U36A 4P2QB 3B2MA 5LQBH 3GZQA 1WFUA 3AREB 4IKNA 3DBXA 1MAML 4JGJA 4PRBA 5TD4A 3RFZC 4NKDA 1YA5A 5I28A 5CKAA 3MRQB 1E4HA 2P5WE 3F58L 3L3GB 4G7VL 5JNYB 4MSWA 2CLVA 1MI5E 3HC4L 3K2IA 1H3TA 1MWAH 1P0SE 5FA3A 2PXYD 3SCMC 2R4SL 1FSKC 4QDGA 2QQKL 1AD9A 3F00A 5EC1A 4KKCD 3TJHD 2V5TA 4D0CA 3SKNB 3SKNA 3EUUA 5BZWB 5J3HC 5DVPA 1G9EA 1K8IA 4YAQA 4GFXA 2E7LA 4X9IA 4YUEL 1TT6A 1CD8A 2EILB 2FBRA 3I2CL 4LGSB 4YHPA 3MRGA 5A2CA 4GAGH 4UILH 2OMYA 1J1PL 3PWPD 4KXAA 5CP3H 3Q48A 5DD3L 3JVFC 1VGKA 5HGDB 2Q1EA 2WXLA 2VXSL 4B9KC 5MEQB 2XN9B 2X2UA 3TT1H 3LZLA 5T1DL 1GZHC 4MSWB 1L4IA 3HBQA 3QORB 2J1XA 4Z7UE 4ZO9A 2NY4C 3GS0A 1IE4A 1MHHB 5AL8A 1AYOA 1MOEA 4NKDB 7FABH 4XP9H 2PKDA 3UIZA 1P6AB 4OLUH 2KQMA 4O2FA 3KPLB 3NTCL 4OF7A 3CD4A 4M7ZC 1I1RA 1OAYH 2Y7SA 1HDMA 3IMSA 3BQUA 4JVUA 3M07A 5MEOB 1BQ5A 1P6FA 1AGEA 2A9MH 2DH2A 2J71A 3P2BA 4RMUA 2AK4E 4CSTA 1JXDA 1OZTG 4YHLH 4YS4A 3ZDZB 3HPLA 4G6JL 1RZFL 4FNLH 4H4NA 4Q6IA 5EBWB 4L37B 1MREL 1YPZE 3MLYH 5TGBB 3ARSA 1QSEB 5SX4H 2XA8H 1OTSC 1Q0XL 3GC3A 2EVHA 4FNSA 3EOAA 2Y7NA 1ZGLB 4Q9RL 3DVGA 3NZ8A 4GMTL 4UT7L 3EH1A 5ICXB 2AEWA 3M8OL 3AUWB 4LESA 3WBDA 2VL5A 4BQBA 3B5TA 1NLDL 1P9MC 3C5SB 2VLLA 5EULV 2JQAA 5CBAB 4I3SH 2X4TB 3VYPA 4X4XA 4WNQB 4R2GD 1DQLL 1P9MA 1T22A 3LNDA 4P5TD 1G9NC 1AKPA 4QO1B 4FABL 1YAZA 4JPIA 4B6ZA 3F12B 4ZXBA 2EUVA 3MFGB 5CR8A 1G43A 1DN0A 3MC0A 3P77B 2YD3A 1NBQA 1X7SA 3JTTA 5B38B 2X6CA 1ZT1A 2Y06L 1FFPB 3EDJA 4LRIA 1BM7A 2EDRA 3O3AA 4OZGE 4OZGF 3Q2CA 4MMXB 4NO5B 5B4MC 1TG8A 1F11A 2JCWA 2ZWKA 4A37A 4HKXB 1X5HA 1JV2A 1IKOP 3H4HA 1RFDL 1F4WL 3ARDA 2BLFA 1CXHA 1UA3A 4S2SB 1DUZB 3WG7B 1M05B 4YSDA 3QPXL 3VSQA 1WIUA 2BVQB 4RFEB 2R1XB 5C92A 4UTAH 1EVUA 2WQWA 1LJMA 1R3JB 3IMBA 2J4WH 3D85D 5ACZA 4FI7A 1KYOJ 4BDVB 1E7UA 5I74B 3CE1A 2EKSB 3QJUB 3FAXA 1ZY9A 5DWPA 4RCAA 1L0XA 3GTVA 3OAYK 2EXYC 3Q6FB 1AY1H 1TENA 1E5BA 3QWRA 4QHNA 3WHXB 2WSDA 4QRPE 2FX7H 3RDTB 3SPGA 5DJYB 4ODHL 3LNFA 3RWCB 4ZW5A 4KV5F 2XOTA 1NMCB 4Y4HB 1SRDA 1TNNA 4FXTA 4ZD3H 3RVXD 1THCA 3BRFA 4APQD 2GTWB 3QJOA 4QLWA 3F7PC 2FH6A 3PNWA 3GJEA 1KLUB 3PDOA 1FVEB 3TBVB 1MQKL 2XVGA 4X8GA 2IO5A 4C4UA 4ZMLA 3VMOA 3OHXB 3INOA 4HKBA 3RWFA 1ODAA 1CVRA 2WB7A 3OAZK 1P7BA 1K6QH 3HHSA 4FQJL 1QABA 3NEOA 2W9DL 1BFTA 1HWWA 4LPCA 4AGPA 1PX3A 1MFDL 1HCZA 4AKQA 4X6CB 1IJ9A 2K8QA 4AGQA 5DLMH 5D7LB 3BISA 3KLAB 4EO5A 1XH3B 5DGRA 1W0YT 3RNQA 4JFHD 3BFQG 1NCAH 3PGFL 3QIWD 5GGSA 3NESA 1YUHA 3ME0A 1DQKA 1FZKB 4KXCA 5BV7C 3HFFA 3K1DA 3OXSA 4MCZB 5IMMB 2VJXA 1KN4L 3LKNB 1XD0A 1OL0A 3EYVB 5BVPL 2C9XA 2G3ZA 4KQ4L 4MZ3A 5JHMA 2W8CA 3BPCA 3L3JA 3Q5OA 5DO8A 4P5TC 2X9WA 3K4ZA 4NYLA 4E9XA 3C6LA 3VFMA 1DVSA 2C3HA 2FYYB 4N2HA 5HHOD 4PJEA 4GXVH 4BZ1L 4WW2C 1GVIA 1U41A 1W72B 3ALPA 4TULL 4S1SH 4U2YA 2XG4B 5AVRB 3QZLA 2ROYA 4LIQH 3NP4A 3ZTJH 2HT4D 3U0PB 3Q1SH 4EUPA 4V1DE 3P9LA 2IWKA 3D69A 3J07A 5DJCA 4QOKE 3WIHH 3BMVA 3I74A 2F6AA 2OYKA 1K4CA 2YPLE 2Y5TB 1A65A 2Z8SA 3AQYA 3L4CA 4PRNA 3H9SB 3SQOL 1OCZB 3LKNA 4JLRA 4AC4A 4PRPA 4KNTA 2CO2A 3BLBA 1IGTA 1TTGA 4LU5H 4XPAL 5FFLA 3UAJC 1YG9A 5MI0B 1GA2A 3C2AL 3BO8B 1M1XA 3GRWL 5HHOB 3QDJE 3FONA 1ZHNB 1AKJD 3V5KB 2JQZA 4P9HC 4Y89A 3C6SB 3QNXB 4BHUI 5DS8A 3MNMA 3VXUB 5CF3A 3RUGE 1RZKH 3LQAC 3IFNH 5I18L 3QA3A 3VTMA 5I1HL 3V0DA 2ZXGA 4JKWA 5ETUA 5AOIA 4LLVA 2RMNA 5AOLA 1FYTD 4XMTA 3UYPA 2OJZL 5AZ2H 5FGSA 3SDAD 5D1ZC 2WLZA 1B2WL 3D05A 4JHAL 5GZNA 4UBDC 5TDOB 3DURB 3MFFA 3VO0A 4F7CA 5F7DA 5IW3A 4HK3N 2XDHA 4W4OA 2W0FA 3M7FB 3M8OH 3QJSB 4L4VB 5JOPE 4E42B 1ESOA 3VGGA 4QYOA 4MMZC 4G7SB 1FO0B 4Q2ZA 5DJDA 5KAQF 3WN5C 4PJ5B 2IFFL 1D5MB 4FERA 4IBZA 4YO0A 5SX5K 4LCUB 3ZT6A 4AYGA 1NFKA 2O4EA 5DSCA 2PMZA 1CPUA 3RBGA 5HYQB 5HGAA 3BGMA 2Q2LA 2VZVA 1P1ZA 1H8NA 3VX1A 4C8XA 3EYQC 4KK9D 5GGUA 4QXUH 1MI5A 1CGXA 4XWOC 5K9QG 1FNSH 3L13A 3MRLA 2RA1A 5DT1L 5SX5H 4AOFA 4FA8A 5MENA 1AH1A 2RBLA 4GSQA 2YLHA 1BF5A 2XICA 1TJIH 1W0WA 4NGHL 5A16B 3AY4A 3GRGA 3MRQA 4L2YA 4K7PY 3MTXA 3MNWB 1YDPB 3KYOA 4MGXA 1LO5B 5D4JA 4P49A 4GIOA 4DWHA 4I0PA 1KACB 2ICEB 3LKRB 5SV4A 5IMLB 2GFBB 2NNAB 2HCZX 1CG9B 4L29B 5IR1A 1C16A 1KYUA 1P7QA 4OF3A 3QH3B 1UD3A 4OF0A 5DRXB 1BM3L 3IXTA 5T3ZD 4PJIF 4A66A 1YY8A 1BZ9A 2AXGB 4NKOA 5D9SB 1G7JB 1NFIA 2XVBA 3I2CH 4MMYA 4WWPA 2JVUA 1HQ4A 1E28B 2EYTB 3QJTB 2XZZA 2Z31B 4ORZC 5AALA 4YHML 1C7TA 3HNVH 3HJ0A 5IQLA 3MLTB 3FHQA 3KGSA 2X6VA 3F7VB 3P0VH 2DQJH 4JAMA 4ZQKB 4WI4A 5EZJB 1UOVA 4YLCA 4KQ3H 4L2LA 1PLGH 1U8HB 2EDQA 2VABA 3LZFH 2C1PB 2BNRA 4EXPX 4F15B 4HS3A 1GKEA 5CLWA 3IBOA 3ZL4L 1HHGA 2ZUSA 4XXWA 1QNIA 4HW6A 4ZXBB 1E43A 2XRAH 4LL4A 2NY1B 5ABDE 3RB7A 2GJZB 2GJZA 4D7PA 3BGAA 3NA9H 5GRUH 3QDMB 1U93A 1N5YH 1J8HD 5E1AA 2PO6C 4R4NC 2Y69B 2LW3A 3DIVA 4LSPL 4MNHB 1MNNA 1GAFH 1Q0EA 4M03A 4BKTC 5E9NA 3REWB 2MPAL 3DVGB 5GZNC 2OR9H 4P2CG 3WFEL 5I1JH 5DO2C 5H2BA 3Q8EA 5K69A 1E4KA 2OMWB 2ATPA 2Z6FA 5FYLE 1NFAA 3AACA 4XNMB 5I73B 2EACA 4PGJA 2ZSWB 4KJWD 5T1LA 2NY6B 4JREB 3QHZL 3S36H 1JWSB 2P26A 2WXMA 5E6SB 3ARGA 5DHXB 1OP5K 1WBXA 4MDIB 4A55A 3VFRB 5SWZA 3BAIA 4LASH 1Z9OA 3SDYH 1JERA 5ESAB 1J8HA 3RIFK 2HN7A 3UJTH 1NGYB 5EIVA 1MW2A 4N90D 3UC2A 1CIUA 3LAFA 1Q1JL 2WWMC 2YPVL 3F84A 4XVJH 1KMGA 2VDOB 2WC7A 3C2SA 1F2QA 2DQFB 3HG1E 4H20L 3K2KA 1MCDA 3WTTA 1JGEB 2JKLA 3FOMA 2OSXA 3CV5A 5E4OA 1SOXA 4PGCB 1EEYA 4CC4C 3ORJA 3FT3A 4MBRA 5IF0A 1EANA 5KYYB 4AQEA 2CQVA 3UEQA 3X1EA 2CCVA 2NW2A 3K0YA 1EAQA 1C9SA 3NZ8B 1VFAB 1BZQK 1CGTA 5ABAA 3V0JA 4UDUA 5F7EH 3BUYA 5KSAB 4WEMB 2DJMA 3R7RA 1RUAH 1EO5A 3BUQA 4OI9A 3NDYE 3BWUC 2VZTA 1ZLUK 2K4WA 2H2PC 3ZL1A 3ZR6A 4CAGA 4NQUA 3NFNA 2DM2A 3UG3A 1MCPL 2O1AA 5C0BA 1S9XA 3SGDI 3OF6D 2HRHA 4CDGC 5B39B 3ZYOA 1OF2A 5DHYA 2ORBL 4NEHB 3EDEA 4NC2B 4F8PA 1TFHA 5E8PA 4UM9B 3GUTA 3NABL 5D7JC 1N2RA 2AXHA 2UX6A 4YZFE 4PW9A 1Q9WB 2IDQA 3CZFB 1E3ZA 2AEPH 2XZAL 2FWLB 3KGUA 2VW6A 1BP3B 3PFUA 3ZKXC 3V6OE 1NOFA 4Y16C 5I1EL 3QQ4B 5C97A 1PD1A 4P3CL 1QFOA 3VGAB 5AEAA 1M7UA 3AS1A 1CXIA 5BRZB 3KPRD 1TZHA 4G8FA 1LEIB 4P2YA 2R29L 3NPSC 4G5ZH 4RGNE 1U30A 5DJXA 5GS1C 1E4KC 4PJFA 4PYHA 5EZPA 4X6CE 4PJ7E 3QFJD 2WQUA 1KF9B 4KFZC 1EJFA 4LHUB 2A74C 2QSCH 4IRJA 4OY9A 4UTCA 2IC2A 5C0AA 5J11B 2BY1A 3GMRB 2HVKB 3MLUL 4X9GA 3H9SD 3MNZA 2VDPH 1G1KA 2OW7A 5DVLA 2CUIA 3CU7A 1WSST 4OGZA 4ZT1A 2LR4A 2V3EA 3VB9A 2XWZA 3DSNA 2EYRB 1QG3A 3HE7A 4CUCA 2C3GA 1NMCC 3L3GA 1OLLA 3EJZD 4JQXA 4H44C 5HHNA 1JDCA 5HHNB 3OXRB 1ROCA 2PP7A 4KI5D 2V5MA 3QFJA 1WZ1L 4DKFH 3GSNB 1MPAL 3MREB 1NBVH 1A9VA 4F57L 3BESR 3TEXA 1H5BC 2GG1A 4QXUL 1A7PH 5ESQB 2J8OA 5FA4A 1AQ8A 4L4VE 2VM3A 5I6KA 1ITBB 5F93C 1P4LA 4F15C 1DUYA 1RK0B 5DQJB 1UWXH 3OJDB 4UQBA 3VAEA 1WFTA 3MN8A 3O45B 4WJ5B 4XZUB 4HJ0C 3MGAA 4YBQC 1RU9L 1BPLB 1M2VB 1A4JA 2IFFH 5K1VA 3UTSB 1I3GH 3CXDL 3IE9A 2GKIA 1F45A 3VXUE 4MXWL 1CFSA 2ZX8A 1TMCB 2CUMA 2H1XA 4PUBH 1A7NL 1EFXB 3ZDXB 1HHIB 4CSSA 2WAQA 3ESMA 4O02L 1JZIA 2NXYB 2WHVA 3TM6A 4FYSA 1T6WA 2CRYA 1L7IH 1R0AL 1QPKA 5E8NA 4XXDB 1WBYB 2MPAH 2QADC 2WP3O 2JCCA 1CLZL 4OZGB 2IMNA 3IFNL 5I18H 1L5GB 2CLZA 3BQUD 4WCYL 5DK3A 2HLAA 5I1IH 2NUTB 1WD8A 1U8KA 2X5PA 5GRUL 1RUAL 4N8VA 2HFEB 1I7RA 4PRAA 3CAFA 3PV6A 2EIEA 2VDMB 1TEFA 3QIUB 1JPTL 3QDGA 5DI8A 1CGSL 3APMA 4HQQH 1CDIA 3LX9A 5L2JA 2GI0A 2CKNA 4ONGH 3VXNA 2OYPA 3UC0H 1A6WH 4Z8FL 1GTFA 3M17B 3N3EA 4S1RL 3VWJA 4ACPA 2BWDA 1VZGA 1IBYA 5JOPD 4FQ1H 1QLFB 4X2UA 3AXIA 2JJVA 1Z9NA 3FJTA 4H20H 1V10A 4J3SA 3D39D 1S7QB 1SJHA 4UIKH 3BQUC 2ZKHH 1EGJH 3JSSA 4CU8A 5HGGS 3UMNA 4X98B 1ZHLA 2QZQA 4PLJD 4LSQL 1KY7A 2VMDA 4NWTL 2J44A 1GRWA 1MFCL 1YQVL 2X4QB 3PU7A 4HJTA 4GS7C 5LNGA 2DKSA 2HUEA 1HZHL 1ZS8A 3H0TB 1JHTA 5A7BA 2X38A 5EZJA 1IFRA 4FHBD 4U1JB 4F7TB 5IT2L 1YO4A 3FCBA 3LD8C 4FE9A 3L8QA 3ARVA 3B8SA 3EIFA 3TJEH 1N59A 1NCWL 1C08A 1HZKA 4KX8A 2G3NA 3G3LA 3SGEH 2W65B 3CN0A 3ULVD 1DSFL 4YDVA 5H4ZA 5MI0C 3FFCD 1BFOB 4ZS7H 1B0RB 4ORGB 4U4BA 2ZOTA 4GI8A 3KNBA 2VSMB 1PY4A 3CDCA 1NDGA 2P80A 4BUQA 3Q2VA 2JTDA 2NUTA 4FTVA 1DBKL 3QZWA 5ES4B 4DUVA 4NN6B 3GEFA 4P48A 3LVEA 5C0JA 5G5DA 3QAQA 4RRPA 4TQIA 4Y2DB 3T08A 2DKUA 3ARFC 3VYOA 1A8ZA 2X53A 1G5AA 2GVYA 4WI2A 4IOIA 4GUPB 1YYMH 4KJPD 4JZJA 4V1DB 5B7FA 3QWOA 5L2KA 5DR5L 3N0PB 3MRLB 1MCHA 3L45A 4DEWA 3C6LC 1X6NA 2E56A 4LT7A 4YXHH 3RHWF 2X4RB 3JYBA 1VEOA 2NY0B 3S5LG 1Q9KA 4RMWA 1FBIL 3WXWH 4NQQA 4L8SC 3CZKA 3MA7A 1JYWA 2VT0A 3CJJA 4KZEL 4N1EA 2F1EA 4FP8H 2N01B 5J6GA 3OWEA 1VPOL 1YZZA 4PRPD 1HH9A 1KV3A 2YC1A 5AW4B 2HVJB 3GSXB 4PG2A 2UZXB 4L1BA 5MENE 3K6OA 5I73C 1FRGL 3BZ4A 5FHBL 1NAML 1NDMB 2R2CA 4UOW0 5ACLA 2XYBA 5FLUA 2XUWA 3IJEB 1JCKA 2F5AH 4HJIA 4O9HH 1DZBA 4OCNC 2KH2B 3GPEA 3RZWA 5EOCJ 3O4LE 3AXLB 1W6WA 2B3RA 2PYFA 4BA8A 3HNSL 3S35X 5DT1H 4X5QA 5SWZE 2WQ8A 3DK2A 3MACL 4I5BA 5FO7A 3CG8A 1EH9A 3P2DA 3VH8G 3HC3H 2H3XC 4FQCL 4BGLA 1N26A 1IMHC 4RSVA 1KCRH 1HEHC 5K33A 5BOJA 1KBVA 1UXLA 2CXGA 3U4AA 2WOYA 5FFGA 5MEPB 3UJTL 5HI5D 3SDYL 1LO2L 5D1QD 2K4AA 3D0VA 3ZZLA 4HBCH 4HD5A 2V0AA 5IHBA 5D1ZA 2YRZA 3MNZB 3MOQA 2R7EA 2WSPA 3GLAA 3L9YA 3O0RH 4P23B 3T3PE 1P1VA 4D8PB 3HRZC 3K71B 3QCUL 4YDZA 5EWIL 4H0LC 2A4CA 3VSUA 2VLJD 2KYIA 3L5HA 4MZIA 4G70B 4XNQB 2BVPA 1OB1A 35C8H 3DX3A 2YUXA 5C6PB 3A22A 2OR7A 1RIUL 4DESA 3K6FA 1F4YH 3ATDA 4AI7A 3S37H 3ZRCC 1B4JH 1JNHA 3RNKB 5HHMB 1S7RB 2JJTC 4OZIA 3KWXA 4FCHA 2EH7L 4NHUA 4YDMA 4ACTA 2O6PA 5GRYA 2QELA 4LVHB 5I74C 1AG0A 1NCCH 3C60D 3RVWD 5KSBB 3RWIB 2Z4QB 2UZXA 2UWEA 4DKEH 5FLVA 1ZRUA 4APXB 1SQ2N 3PNRB 4JRFA 3WDIA 5F9DC 2FUQA 1R3IL 5E7FA 4AG4H 1WZMA 2WGXA 3FQYA 5JW5B 2XTJD 4Y5XA 2OR8A 1G7IB 1WJ3A 1XMWA 3FQNA 5JYMA 2B1AH 1J9SA 3DUHA 1MDAA 3R1GL 4NENA 4YHMH 1MUJA 3TV3H 4K9JA 4XPGL 2OTWA 1O5PA 4XPTL 5MHSD 4E41B 2P5WA 4OUOA 2ARJQ 3V4VL 1B0IA 1A66A 1YN7B 1TVHB 4HJGB 3HE6A 2E7HA 3PY9A 3P3SA 3GBNH 4Z7OB 5LJYH 4FZEH 1TVDA 3NZHL 1WWWX 2ENSA 4JHZA 1FA4A 3LDBC 1D7CA 4KK6D 4WFGE 5CEZD 3O3DA 2ZXDA 3DBSA 2WINB 3TBVA 3R4DA 2YK1H 2X4NA 4OKVA 3V10A 4D0BA 1BGXH 4MWFA 1NIBA 3STBA 1RJYB 4U05A 3GDCA 1CK0H 2H32A 2ZD0A 4UUJB 5CEZL 1RZGA 1YNTF 5CIPH 1OWWA 4U31A 1VESA 4TYUA 3AM8A 4Y4HA 1AMXA 3OC5A 3ZE1E 1WGOA 1DE4B 4ELMF 4R2GB 1PYWB 1OK8A 1CL7H 2WLHA 4Y1AA 4X4YB 4Z7NB 1MFBL 3OKEB 1BREA 4ZUSA 3ECQA 2YUWA 1QSFD 1U95B 1AGBB 1JGVH 1A6AA 3BZ5A 5LGHL 4PRIB 4LGPB 2A5UA 2QTVA 4UT9H 1ZT7B 1RUQL 2CJTA 4ELKB 3IKKA 4J23A 3D12B 3G04B 3O9WD 1JN6A 2YEZB 3JWNE 3N43B 3MLVL 4LQFH 5D1QA 3QPQD 2YPKB 2BJMH 2C4FT 4KGLA 3T3PF 3HZYA 3HZYB 2CBOA 3L95A 4R3SB 4XVUD 5CUSH 2BNUB 2A77L 3BD3A 3H53A 3EG9B 2FT7A 3TJHC 4F3FA 4ZFFA 4HIJA 5BUGA 2P7TA 4DZ8B 1CDHA 4Y5YB 2F74A 3LS4H 2OZNA 1F4YL 5IB4A 2ICES 2NRDA 2ZAIA 5ELIA 1IBDA 2O30A 4MXVF 5AW0B 4CBZA 3VXNB 1NCTA 1DDTA 1OSYA 5I0WA 5MERA 1MW0A 3UAJA 2HG0A 4BFRA 2FHCA 2NZ9D 3ZT7A 2V9QA 5EN2B 5C71A 4LL9A 2ZUQC 4LCUA 2E46A 1II4E 1E65A 2HX8A 3SPHA 2A73B 4B9PA 4POYA 5CHNB 5BW7C 4XVUC 3QUMA 4HHWA 1FVDB 4YHLL 5KSBE 2CCWA 1OAQL 3L1EA 4G7QB 1J87A 1TCRA 5E8NB 2FX9L 3LPFA 2E47A 3PQYB 1EEZA 4M3JA 4PJCE 1MVYA 3QQXA 5F6HI 5F7UA 3QZMA 3AG2B 3HEIB 2YSSB 1COBA 5FYKH 3S3DB 1MEXL 2DJSA 5L2KD 1NCDH 5E7BA 5ICXA 3NTCH 2EDFA 4JBSA 2I25N 3TU6A 3WS6C 1MHCB 1IILE 4J3VA 2BS9A 2D31A 4M1CD 1JE6A 4P2RE 4N20A 2Z3FA 2P5WD 1BYPA 4GKNB 2HXAA 4JE0A 3FUNA 1YEWA 3VWKC 1R3KB 1Y0LB 2GSMB 4GRLA 1NAMH 4G5AA 5DZLA 3LB6D 3JBG7 1MLBA 1R9FA 1U8JA 3FQWB 3KXFB 2J55A 5D5ME 1JRHH 3K91A 1J1PH 2CKBB 3HTLX 5FEBA 1AE6H 3JV4A 4Y1SA 3VXPA 5HYQA 4NQCD 1U8MB 4X8XA 4YHNA 2J6EA 1CLYL 1D5XA 5E23A 3ZDXF 4Q74A 3BIAX 2IAMC 3WKML 4JFEA 2ITDB 3WO4B 3QEHB 4J6RL 2DWSA 4PJGE 3U2JA 4F2ME 3ARED 2AK4A 1FL6A 1FL6B 2JIXB 2ZX5A 2YRBA 4Y1AD 3A6OA 4DIXA 2XIDA 3V6ZA 4ETQB 3QDJD 4M48L 2OSWA 3WXVL 1G7PB 4N3UA 1RURL 5ADOH 3KPQA 5E6YA 1GSMA 3VXPB 2VRAA 3AT0A 5J9PB 1RI8A 5DUBA 3CK0H 3GBMH 3BAEL 4DH2A 5IQNA 4L37A 4QRQA 5CGYC 1M56B 1O7DE 2DQGH 1UM6H 4PD4K 1IBHA 4U6HB 4MMXC 1LEGB 2A4EA 3DVNB 1A3RL 1NAMB 2ZKXA 3PG2A 1HQRA 4KY2A 3QEQD 2Q2EB 3CFDB 4YLQT 5IW1A 5FGBA 2WJ7A 3BP5B 4M1DH 2R4RH 3TBWA 1AO7A 1U58A 4K55A 5GS3A 1RIHL 4A39A 2WXIA 3RU8H 4ZDHA 1PJWA 2ZCHL 2J8UB 4WHYH 3SDCA 1TJMA 3T04D 3ATAA 4GP5B 1G7HB 1M7DA 4RGOH 1JG9A 4AK2A 3WN5A 4FQIL 3TZVD 4YUEH 1U8CB 2J25A 3MKKA 1GHFH 4NP9A 3OL2A 2AQPA 4ZX4A 2WSKA 3UC0L 1D5XB 4G72B 2XIIA 4JRLA 3X12B 1LDSA 2X41A 4IGBD 2QQKH 2ENPA 1A1OA 5CMAB 4HCFA 2GITB 4WU5B 2ITEA 1JDDA 4LGRB 5I8EA 4IBUA 3T3MF 2G0KA 4MHHI 1JPTH 1T0OA 3QRBA 1TETH 1W8OA 4AQEB 4XVTH 5EHFA 1EZUA 3G5XA 1GS7A 1QWNA 2NSQA 3E8VA 4WI0A 43C9B 3QUZB 4K9EL 1AI1L 1Z2KA 3FTGB 3D0LA 1NFDE 3BMWA 4I0PC 5FO7B 2DQDL 2FWUA 3TZVC 4C4KT 4QRRA 3MODH 3OHXC 4O00A 1WIPA 1U91B 5TFSL 2XN9E 1JZ2A 1MVUA 1L0YA 4LPWA 1CF8L 5CZVH 4GXFA 3RIAK 1YNTB 4Q89A 2F54A 4N2EA 2D7TH 2AFNA 3FRUA 3IETB 4X7CC 5CILL 1Z3RA 4CSZA 4WFHE 3X3FH 1G9HA 4R7DA 1PYWA 3B1UA 4RFOL 2VUYA 2J43A 2D7MA 2XWDA 4Q58C 4OIAA 2OMVB 4HGWB 2KT6A 3PXHA 4ZO7A 4HF5H 1SXCA 4XTRD 3MLPA 2EE3A 4Q56A 3BT2L 1E90A 1PNCA 3GLZA 3DOSB 3O6ML 2WUCL 4ABQA 1DQML 5JPMB 4HULB 2JXMB 2Y24A 2YD9A 2YJLA 2FSEB 4PWEA 1DL7H 2L7JA 2IG2H 3FF8A 3HZVB 3AU1B 3BDYH 3NQKA 3PL6B 4FZ8H 1H5BA 3WDHA 5C9KA 1QO3B 4L0YA 2DQCL 2J12B 4Y4FB 2WXKA 3MJ6A 2Q7YB 5TE7H 2QVFB 4TVPD 4W9JC 1E6OH 3JTBA 4L4TE 2FL5B 1BIHA 1RXLA 1JIBA 1FCGA 3BUIA 1WAAF 1IV8A 3KM1A 3MGTB 1G6VK 4W70A 4UQIM 3B6SB 4WKZA 2X4PA 4XN1A 4AQ1B 4AGLA 1AGBA 4IOSA 3RTQC 4WJG3 3VXRA 5HPOA 2IPUK 3X14A 3VA6A 4XP1H 2F18A 2X4PB 4M43L 3DPDA 4GRWF 5MEOA 5HVGB 1G6RH 1PZUB 4A68A 1L5GA 4Z0BL 3QNZA 4QTHB 5EU6B 1WFMA 5EF3A 2IH3A 2YXVA 1ZMYA 4UAOC 5F1NB 4Z9KB 1V3LA 3WFBH 1IX2A 3ZT5A 1URZA 3JTSA 4AH2A 2X4QA 4K5PA 2CG9X 3MX0B 3NJMA 4J4PC 5FYJE 2WTOA 3DMMB 1T83A 3LIZH 3SYQA 3QDAA 4UDTB 1W0WB 3ZYJA 2HWZL 3OSVA 2IGLA 4BFIB 3F5WB 4PP1C 1S9VB 2NNFA 4NLAA 1B2WH 3G5VA 1JYNA 2X4SB 1Z9SA 4FJZA 4HZ1A 4MJIE 4QR7A 5AZ2L 4TL5A 1BAFL 1YN7A 4PGBA 5TQ0L 3MJ7A 3KR3H 1SXZA 1CLOH 2GJ6D 2R9HC 4JG5A 5KWYC 3GTNA 5K9OA 3C09B 5HGAB 3WJJA 1K8IB 1J0IA 1JGLH 1JWMB 3ZE0E 4WO4C 1R3LB 4LDLB 2FH8A 1M7XA 5EDSA 1YEKL 4R4ND 2Y0SA 4PJ5A 3S37X 2BZ7A 1CFNB 2WXHA 3UO1L 3QIUA 3LNHA 1V7MH 3FU7A 5F3HB 2DPKA 3BJLA 4X7SH 3WS3B 2B0SH 2BFVH 4YC2C 1SOQA 5CSBA 3NT0A 4FEMA 1J18A 4MCNA 1SJEA 4HWZB 1EUTA 4BYHA 3I50H 3WV0A 5CM1A 5IQ9A 3LEXB 1KXHA 4WDIA 3CWGA 3AQDA 4Y7OC 5AENA 2GSGB 2WY3B 5IHHA 2XQYG 2WW8A 5C0FB 2TAAA 4KKLC 4N2NA 3MV01 4Q6YA 3L5IA 4TXVB 5F7KC 5A6IA 1NC2B 4GG8B 1QUPA 5HI3D 3OF6A 5HJGA 2GK0A 2ZWSA 4R8WH 4FNTA 2K45A 3N42F 1X7TA 3SE8L 4XPFL 2YS4A 1YN6A 5CBEA 1T66C 3H55A 2OPCA 2BX5A 3OJDA 4WU7A 3D1MC 5J11C 2PCPA 2FJFA 5CBEB 3O81A 3HA0A 1C7SA 4IIQB 43CAB 2Q8BH 3B4NA 1CD9B 1H0DB 2EEFA 2N56A 4AM0B 1IZJA 3DUUA 4BK8A 2VDQB 5TF1H 2Z7UA 4XO9A 3ULUD 1GZHA 4X9BA 1T0MA 4U2ZA 3CX5K 4X4MA 4WDIB 4U0QB 2JK5A 3ENEA 2ATKA 3WCYA 3ZMNA 1ID2A 1USQA 3HI6L 2ZSVB 5AD0B 5AD0A 4BH8A 2AJSL 4BWWA 1NDGB 3CHPA 1UJTA 2IAND 5IQ7L 4BSWB 4DO4A 5E4IA 2NNCA 1Y1UA 3MV9A 3FB6B 4JG1L 3TBYA 2C9PA 3K6NA 3F3HA 3U4BH 1BXVA 1KYDA 1JGDA 1CFNA 2FE0A 1WBZA 5F1IB 1JZEA 4P46A 4R5TA 2NXZD 1UADC 4HJEA 4XBGB 3M46A 5I8CB 1H8OA 1T0PB 3E8UH 4L48A 5ID1A 4A2LA 1RCYA 1ID5I 1ZXKA 2H3KA 3CN2A 3D3VA 4PJ8D 3LPPA 5FYJU 3TNMA 3WJLC 4EZLA 3G08B 2COVD 4Z7OF 2DTMH 3VG0L 3VRIA 5JPNA 3DO3A 3KH3A 3UG5A 3NJLA 2ZPKH 1TZHB 2JQMA 2XBDA 1Q9KB 3BPNB 3EW3B 5DHDA 1HYRC 4NQEA 4HAGA 2ZAGA 3S5ZA 1BQUA 1J05B 3T5WA 4FC3E 3BAJA 2AJZB 2F7RA 4QOKD 2HTLD 2P8LA 4JPVH 2APTA 4XWGH 3UBXA 1V7NL 1R5WB 1EMTL 3N40P 2NTFB 2ADGA 2NY5L 4FFZL 4L4TD 1AQKL 1LHZA 4OIBA 3V52L 5H35B 5DDHA 1N5AA 2B20A 4L8BA 4PFEA 3V95A 2AEQL 1FNSL 1H3UA 3DGCR 4OLZL 1KJ3L 2GIXA 1O7DC 3OM3B 3BEWB 3VWKB 1UGNA 2EAEA 3QCTH 2DMBA 5HI4C 1A4KA 2P80D 4QAWA 1L6ZA 5EOTB 3VWJC 2HMIC 3VI3E 1YECH 2ADJA 1IM9D 3GBEA 1ZEAL 5IB2B 4QJ3B 2AQSA 4PSRA 5GRVL 1LK3L 3GINA 2HT4C 5AOKA 5HDBF 4Z3IA 3PJSB 1JF5A 2YWZA 3QEGL 4MLIA 1MVUB 2K0RA 3DRTA 3SGKC 3CXFA 4JFHE 3QDGD 1PD0A 2BDNL 4F33A 3EO0B 3LHPH 3PAUA 2PP9A 3VW3H 4UQ3A 5HHMD 3PV7A 4UQCA 3POHA 4ERSH 4Q9QH 4U3SB 4HZAA 4S2SA 4EDXA 3QUZA 3L3HA 4NDMB 1AANA 2GCYA 3I9GL 2BS71 5E2UL 1HL5A 4PJHB 2R8SL 4PTTB 3VRIB 4R7XA 1S7UA 4ZS6C 1OSZA 3DXAE 5KANI 3MV8E 5BNXD 2DF3A 3VXRD 4XNDA 4PIBA 5HHXH 3VXRB 1T1WA 3QAZB 1BWWA 2H32B 1GPOH 5I17A 2BP8B 2QLYA 1TXKA 2AMUA 4RBPK 5CZXC 2DLTA 1MHEA 1I31A 2JKIS 4PWIA 3FTSA 3JV5A 3O3DB 5DJAA 3S98A 1ZLWK 1DR9A 3GSNH 4NN7C 1QP1A 5LAXB 15C8L 2AABH 3ELQA 4I13B 4YNYB 3ZZSA 1IC7L 5JHDE 3HE7B 4QJ5B 1JZJA 4OLUL 3KLHD 4P5TA 1QATA 4MJ4A 1MZZA 3PYCA 5A1AA 4OCMC 5JOEA 3DETD 3G5XB 2O6EA 1Y6KR 5TDPA 4PWKA 5FK9B 5T1DH 3STZB 2G9HB 5D7HA 3L3IA 1LO0H 1F00I 1QVOB 3TF7C 1U0QA 2D2CC 3O4LD 3ILEA 1L9QA 2J21A 1RH8A 2PTUA 3MCLH 5F70A 3GMNB 4QNPF 2J8HA 1USZA 2Z4QA 2X40A 5GJTL 4NM8L 4XGZB 5T3XH 1BVKB 2DD8H 3WIIH 2KL6A 3ISWA 1JXGA 5EEVA 3KG5A 4QRFA 3TP4A 4TSAL 4K5LA 1Z9MA 1SEQL 4OFVA 4ELDA 4IMKA 2PABA 2AJXH 3PWVB 1AI1H 3SO3C 3QIBC 3GXDA 2QSVA 2VR7A 2GFBA 2NNAA 5DJ0B 3RURA 2PN5A 5EEWA 4QY8A 3LJ3A 4HT1H 5JDSA 3MNWA 1B4RA 1RVFH 1X5FA 4P5SA 5F88A 2H1PL 1QNZL 2MTAA 3VFUA 5HDBE 2KC0A 2OL3A 4MJIB 5DJ6B 5SV3A 1DFBL 1GGIL 9CGTA 3ZSSA 4ZAKA 2C9SA 1GMEA 3GM0A 2AJXL 3ARXA 3U7WL 4Z3HA 4LOEA 4E9TA 1PZDA 3RJOA 4BK5A 4QIRA 1FHGA 3S96A 3I6GA 1DVFB 3BUPA 2N0MA 3P3RA 4TQEL 3UZVA 4L9LB 3ZGHA 4X5LA 2BNRE 2JKJA 2HX9A 4KRMB 3RFZB 4NQCE 4MJ5A 5AOZA 1CK0L 5CEZH 1CBVL 3VU1A 3B9KA 3I02A 2AJYL 2OMXB 4NFDA 1KCSH 2MPVA 3C5JA 4XPHH 4RDBA 1IAIL 2I9LB 1A3LL 1FYHB 4URTB 4Z7WA 3RWHA 3ZY7A 1CLVA 3KVPA 4P2QE 1I1YB 1F3DH 5TH2A 3NCXA 3PWUB 5IESL 5IVXA 5KVFL 2WJ5A 1A5FH 1UA6H 3QNZB 3CBRA 4QTHA 3ROLA 3S8WA 4BQCA 2J72A 2ZCKL 4U6VL 1SDDA 3BLPX 4KK5D 2QQNL 3L5WB 2Z35B 1T7XA 1F0LA 4G8IA 2WO4A 2QMJA 3VFWB 1ZE3H 1O0VA 2P8PA 4HA1A 4K7FB 4OZHF 4M5YH 1Y0LA 2VDLL 3QYMA 1KXVC 3T65B 5BRZD 1FH5L 3BW9B 5KN5B 5JO5A 3HN3A 1UH3A 3OGOE 3ET9F 3ZHNA 1AO7D 2DAVA 1G7PA 1FFTB 2CIIA 1SXBA 5F6HJ 3BKCH 4HKJA 1WG3A 4GQQA 4XC3H 4ZFFB 4HIXL