1BAWA

Plastocyanin from phormidium laminosum
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
b'ETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
molecule tags Electron transfer
source organism Phormidium laminosum
publication title The structure of plastocyanin from the cyanobacterium Phormidium laminosum.
pubmed doi rcsb
total genus 24
structure length 105
sequence length 105
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1bawA00
1JZJA 1ZIBA 5AFAA 1N70A 2GC7C 4YSCA 4GP4B 3FQYA 2YARA 4N4YB 4ZK8A 2WO2B 2WO3B 1NIAA 2HX9A 1L9QA 2FWLB 1L9OA 4JHUA 4WKXA 2H5UA 2TSBA 3AW5A 1J9QA 5I28A 3FU7B 4YSEA 4CSPA 3AG3B 2W88A 1E67A 3NYKA 2GBAA 4M3HA 4DP5X 1EZLA 3TBBA 1MDAA 2EIJB 3T6VA 2PLTA 5I5JA 2GI0A 3ABGA 3AG2B 4A68A 2J56A 2PCFA 1VLXA 2AZAA 1GY2A 2XWZA 5I6OA 1AZBA 1WA1X 2VM3A 2VSMB 1A3ZA 1ET8A 2XV3A 2UXTA 4YSOA 2FNWA 3X1NA 4EF3A 2XLLA 1PF3A 3SQRA 1NWPA 2CJ3A 5B7MA 6PAZA 1X9RA 2P80A 2VW4A 1RCYA 1FA4A 2PP7A 1B3IA 3GXUB 4YL4A 2UXFA 4G7QB 4KO6A 1IBYA 2W8CA 2MRYA 3IBOA 3IN2A 1AIZA 4JHVA 2GB2A 4P5SA 2A3TA 5IY5B 3G5WA 3WNJA 2BZ7A 4KNUA 2YAOA 1UATA 3SBQA 2PPDA 5B7FA 4G70B 4HCFA 1OE2A 2XV0A 4DPAX 1OCCB 7PAZA 2JXMA 4E9QA 1BYPA 2R7EA 3NJLA 3ASOB 1DZ0A 4BWUA 1JVOA 3FSAA 2EINB 5B1JC 5I6KA 1NTDA 4N8UA 1TEGA 3V9EA 5D4IA 2J57A 3FSVA 1BQ5A 3MBWB 2EIMB 1ZIAA 2XVBA 1ET7A 1GY1A 3T6WA 3CVBA 3DKHA 4DP8X 1A65A 4K9JA 1NIEA 1NICA 1TU2A 1QNIA 5PAZA 2CALA 3X1BA 1NZRA 1PLAA 1E5YA 1SDDB 2IDUA 2XYBA 5E9NA 2E86A 3DIVA 1JZHA 1IUZA 4BDVB 1AG0A 1GR7A 3ZX1A 1XB6A 5AKRA 5I5IA 3AZUA 1E30A 4KO7A 4HCGA 2WSDA 1PAZA 2XUWA 1BQKA 2JFCA 1AQ8A 1KDIA 1AG6A 1CC3A 2DYSB 2I7OA 1M9WA 1W6WA 4QKTA 2DWTA 3H56A 1GS7A 2CCWA 5B1BB 3TA4D 1V10A 3PAUA 1J9SA 4DP4X 4DP9X 2YAPA 1HAUA 1JERA 1L9PA 3KW8A 3RYMA 4QLWA 4YSDA 2FQEA 1AACA 2PPAA 1WA0X 3WIAA 1N68A 5TK4A 5TK2A 1J9RA 1ET5A 2IWEA 2BWIA 2Y69B 1KYAA 3NSCA 1A4AA 4GY4A 1KCWA 3EH5B 3QJRB 4BWTA 2YAMA 3NJHA 4KOBA 3GYRA 4YSSA 4BK5C 1JXDA 1PLCA 1SFDA 2CAKA 2YXWA 3NSYA 4AKOA 1IC0A 3OQRA 2VM4A 5AZUA 5I6MA 4KNTA 1AZUA 2B08A 4HHWA 1GSKA 5FC9A 2LLNA 3TU6A 3N55A 1PLBA 5B1JA 2QT6A 2OV0A 4E9XA 3TASA 1SDDA 2BP8B 3ASNB 4YSPA 3FU8A 3EH4B 3PAZA 5EHFA 2YAEA 4BXSV 4M4RB 4BDVA 4CSZA 4TXVB 3QJUB 3SBPA 1ADWA 2MTAA 4A66A 2DWSA 3ERXA 3T6ZA 3WG7B 1AS7A 3DTUB 1I53A 4HAKA 2BP0A 3NJGA 1BQRA 3EHBB 2VN3A 5B1KA 2HX8A 3OD3A 3BVDB 4L0PB 1J9TA 2UX6A 3FQ1A 1L9RA 6PCYA 1V55B 4HIPA 4E9VA 3HB3B 2QPDB 1L9SA 2H3XC 3CG8A 4E9YA 2DY2A 1CYWA 1NPNA 1OCZB 3WNIA 4NERA 4F7KA 2IWFA 3MX0B 1JVLA 2PP8A 2I7SA 2XX0A 3S3DB 1SHXA 2Y1AA 3IN0A 2BW4A 2P80D 2YXVA 3FPXA 2CUAA 1GYCA 4E9WA 1SFHA 2XXGA 1PMYA 4HALA 4AX3A 3T71A 3UAAA 4E9RA 2OCCB 1KV7A 2XU9A 1JZIA 1ASQA 4A2EA 1NIFA 1NDTA 2TSAA 5F7AA 1SHWA 5PCYA 2IDTA 3AY2A 4HZ1A 4UANA 1HFUA 1X9UA 3OMNB 1XB8A 4FAAB 5F7BA 1R1CA 1KGYE 3PCYA 2FT8A 4AZUA 4G72B 3ZBMA 2YAFA 2BP8A 3UAEA 2EILB 2YAQA 2DYRB 2ZOOA 4WTQA 2X88A 4DP0X 2HXAA 2CBPA 3SBRA 1F56A 1AZNA 1ZV2A 2I85A 1AANA 1M57B 1BAWA 2PPFA 4DP1X 2IDSA 2BWDA 2HZHA 3PPSA 1J5CA 1PNDA 2FQFA 2YQBA 1KBWA 2Q5BA 3EF4A 3NJJA 1ZDSA 1AZRA 2ZWNA 3L45A 4G7SB 4GYBA 5B3SB 5I6LA 2PPCA 3S8FB 2PPEA 1RKRA 1CUOA 2X87A 3FT0A 2HRGA 2OJ1A 1ETJA 3H4FA 1AS8A 1AAJA 1URIA 2HLEB 1XB3A 2GIMA 4FA7B 1RZPA 3NSFA 1ID2A 3AG4B 2UXGA 3V9CA 5I5MA 1PZBA 1ZPUA 4YSQA 3C75A 1MZZA 1GS8A 4DPBX 1BXAA 3PLYA 3HEIB 3UACA 3NT0A 2R7EB 3GDCA 1PNCA 1CYXA 3NP3A 3FSWA 1SNRA 1W6LA 2Q9OA 4NAJA 3TBCA 1L9TA 4YSAA 1PCSA 3S3BB 1FFTB 1AR1B 3T9WA 2HRHA 1NIDA 1OCRB 2H47C 1AOZA 4X4KA 2BO0A 2VW7A 1JZGA 2AZUA 4KNSA 5B1AB 5I6PA 1ILUA 4A67A 4YVNA 1FWXA 2XV2A 3ZDWA 3BQVA 4HCIA 2IDQA 3D12B 2IWKA 4A2DA 1JOIA 1A4BA 2FJSA 2N0MA 3QJTB 3QJQB 2UX7A 1MG3C 4AKPA 1AZCA 8PAZA 1JZEA 4AI7A 1NPJA 4DP6X 3T6XA 3X1EA 1WS8A 1JXGA 3FSZA 1A4CA 7PCYA 1BXUA 1OE1A 4KO5A 5D4JA 1GW0A 1BEXA 3CVCA 2JKWA 4F2FA 3FU9A 1MG2C 5D4HA 1E5ZA 1HAWA 1TEFA 1MZYA 3N2JA 1W8EA 4YSTA 2FT7A 3IEAA 3IE9A 3X1GA 4YVUA 1DYZA 4ENZA 3QQXA 3U25A 3ABLB 4KOCA 1V54B 2BZCA 3CZUB 2IAAC 2FQGA 3WI9A 4UF7C 1QHQA 2RACA 4P5RA 3NJNA 2AANA 1E65A 1BYOA 3NJIA 1OE3A 2FT6A 3OMAB 4E9SA 2PP9A 2GHZA 2BHFA 1NWOA 2QDVA 4BXVA 3NP4A 3WKPA 5LDUA 5ANHA 1WS7A 1CURA 3H4HA 1QLEB 2FQDA 4UAHA 2EIKB 4GXFA 3OM3B 4W1TA 5I6NA 3UADA 3PAVA 2UXVA 5A7EA 3NSDA 2IH8A 3CDZA 3FPYA 2IH9A 3QJVB 2PCYA 1ASOA 1J5DA 1SF5A 1EHKB 3CVDA 3NJKA 3PXLA 2DV6A 1ILSA 1KCBA 4MFHA 1A8ZA 2HX7A 3UGEA 3ABMB 3FQ2A 1KBVA 2FTAA 3FS9A 4GP5B 3S3CB 9PCYA 3EH3B 4DPCX 2GC4C 4Q8BA 4PCYA 4DP7X 3X2QB 4NB7A 1M56B 1NINA 3X1FA 4E9TA 1GS6X 4DP2X 3KW7A 4G7RB 2ZXWB 4A2HA 1IBZA 1OF0A 1SF3A 4YSRA 2YAHA 1WA2X 2GSMB 1OCOB 2XXFA 2B3IA 4AKQA 3QJSB 4HHGA 3ZIYA 1OOWA 2QDWA 3S8GB 3FU7A 4GP8B 4KO9A 3JTBA 4G71B 4RH4A 3AG1B 1JXFA 2AFNA 3OMIB 3UABA 5I26A 1AS6A 1KDJA 4Q89A 4PAZA 3QPKA 3NJMA 3NJFA 1TKWA 2ZONA 3FYIB 4YSUA 1SJMA 5B7EA 2BP0B 2AVFA 1PZAA 2QPEB 2J55A 1WAEA 2VMJA 2VSKB 2NRDA 2XX1A 4F2EA 4JKNA 3FYEB 2VW6A 3CDZB 1NIBA 3ABKB 1ZDQA 1JZFA 1PY0A 4BWWA 3JT2A 4A2FA 2J5WA 3WKQA 1T5KA 1YLBB 1BXVA 1ASPA 1IKOP 2IDFA 1XMEB 4A2GA 4W9ZA 1RZQA 1PZCA 1OV8A 2BW5A
chains in the Genus database with same CATH superfamily
4AENB 1ED3A 2HTLC 1VFAB 2Z34A 1N70A 5EBMB 1HDMB 5HGDA 4ZK8A 3RHWK 1N9PA 2Q20A 3QJXA 4HK0B 4P5KB 4Q6IC 5DTFB 2L4OA 3UAJD 2X38A 1EZVY 4Z7NB 4RQQA 5ESAA 4ZUUA 2H5UA 5HHMD 2RFXB 4C59B 5MENE 2AAVA 2NY1D 4QTFA 3UDWC 1JIBA 3FU7B 1JNNL 1ZJAA 4CSPA 5C07E 1GYUA 1IX2A 5J3HC 3T4AB 3RU8H 4AE1A 5GS2H 1QRKA 5HTSA 1SXAA 5CGTA 4PJ5E 3ZQWA 4L8DA 2VLJB 1UKTA 4LU5L 1UKQA 1TVHA 4EI6B 1MJUH 4JFFB 5I8CB 3MRJA 1Z5YD 1BZOA 4RMSA 4YUEL 4CA4A 1MLBB 4K94L 2XTJD 2MCMA 4G9FD 1R3KA 2NTSP 5TE7L 4CJ0A 3OPZH 2UUDH 4IDLA 5LDSA 3F85A 1H3UA 3P3RA 4NKQB 2YXMA 5F6IB 3QEGL 1U8KA 1IEBB 4AQ1A 4N5ED 4NAQA 4OZFA 3WUWG 3BHBA 2O6CA 2HKFH 4XXDA 1UCBL 2P5EB 4V1DB 3S2AA 3IFLH 1J8KA 1PLGL 3D4CA 4UV4L 4B27A 3B5HA 1T22A 2G5BA 2IJ0C 2NYYD 2A99A 2BZ7A 3U0PB 3QEHB 3CFTA 4LAJH 5CD5D 1UATA 3SBQA 4TUKH 4DPAX 3A4FA 2BP3A 2VR7A 4ODSL 2KDGA 3OG4B 1WZAA 3IXAA 5DVOA 4AEEA 1IIKA 4NSKA 4FRWA 3WN5C 3NZHL 3M86A 3MBWB 2DIJA 3MSPA 1I1YA 4ZUTB 4DGVH 1JWUA 1NLBH 4K9JA 5D1XD 4IKLA 3A67L 1LMKA 4NHUB 1R3IH 5T1KD 5B39G 3PHOB 2A6JA 4G8GB 3D2UB 3TWCH 1AO7D 4JFUA 4CVWA 3L3OB 1YEJH 2WHVA 4LDEB 2DQ6A 1NKOA 2IFFH 3IGUA 1U3HD 4PS4H 3TONA 2YD8A 1E30A 3Q05A 3K81A 1IGFH 2WSDA 3MRNB 4OF8A 5K9JL 1DN0B 1BQKA 3VFSA 4FFZA 1B0WA 4WVRA 1JD9A 4ZMTA 2DLTA 4MNGE 5FHAH 3SDDC 4AH2B 2ENQA 3F7KA 4TVSa 1MCRA 2WYTA 2WQ8A 1ZVSA 3C9NA 5DQJB 4DP4X 4WI4A 4YHYC 4DP9X 2MOVA 3ML9A 3ZJAA 4Z7OF 4F2ME 3IU3A 2C7UA 2PPAA 2Q6WB 4MZIA 2V2XA 2A77H 1J1XH 2EYSA 3VXRE 1MCSA 1CL7L 4YEFA 4WFHD 5EOTB 3D08A 5I74B 4GRMB 5T1KB 3ZTNL 4APQC 4ELKA 5IW3A 1H3XA 2PO6B 1E90A 5JYLA 1JK8A 1NOFA 4Y4HB 5SV4A 1W15A 3NCYS 2XN0A 3MR9B 4NQCD 5F7UA 4RRPM 1U8HA 5I16B 3PGDB 4TVUA 4JFDB 1CL7H 4BQ6A 2VUOA 4WU7A 4FKEA 5EEWA 4IU2B 1KT2B 4KROD 1FPTL 1WP6A 1QYGH 1KYOJ 1RK0A 4KNTA 1MI5A 2AV1B 2MJWA 4RSVA 1M2OA 1ZA3B 5EU6D 3FTWA 2CUIA 4JVWA 3MA7B 1JF1A 3G6DH 5C3LD 1SDDA 1DFBL 4TQIA 4EBQL 1NCDH 1ZV5A 1UVQA 3CHPA 1NC2A 2KLTA 3K46A 5CLZA 1UACH 1M7XA 2F1EA 3DGGA 4F7CB 2X6MA 3RAJL 2WBJC 2VOTA 4WEBL 5ACZB 5FEBA 3EZJB 2MNWA 5FK9B 2ZWZA 2YN5A 1UT1A 5FGBA 4LSVL 3KWTA 4DGIL 4ANVA 2UX6A 5IVZA 5BW7C 1UXWA 1V55B 4ZFQA 2ZSVA 3ZY7A 3F05A 2X3AA 2EXYC 1Q72H 3RTQC 1QO3A 2XWXA 2DQJL 3FU5A 1OCZB 3OF6D 3ARDA 3QPXL 1BGXH 1JV5B 4JN1H 2WLZA 3FQRB 3PWVA 5ENWA 5C0AB 5ESQB 3AU1B 5KYUA 1JDDA 2FATL 3HZVB 4HWEL 5JHDA 2J71A 5D1QD 3N40P 1QVOA 4UNUA 4M3KB 1ED3B 2CDEB 5IW6A 3X11A 4D0BA 4OLXL 3TH4T 3FQWB 2OCCB 1QFWH 3BSZH 2VJ0A 1HNYA 4OLUL 5KYNA 4A2EA 5DTFA 3U83A 2X7LA 1C5DB 1F00I 1E8YA 1ZTMA 3HHSA 2XXMB 2X70A 4FXLA 1JPGA 4ZI8A 5DVKA 3B9KD 5AWNL 3TNNB 5KEZA 3DPBB 4R7NA 1H3GA 1OGTA 4RX4A 4U3SB 3LV3A 3ZO0A 5GJSL 5I19H 2HKFL 1WK0A 4Y2OA 1B0GA 3GZQA 4GIAA 4V1DE 3RZCA 2CRYA 5DD6B 2IO5A 3OXSA 4EVNA 3S5LG 1ZLUK 4JCMA 4XBPA 1DN2A 3RX5A 1X5FA 3US0A 5H94B 5G2NA 4EI6A 3EJYD 3M8OH 2OMTB 4HJJH 2HXAA 2GTZB 4HUNB 4PRID 3SJVE 2QLYA 4F91B 1UC6A 4CAGA 3ZDZB 5A3IC 3S5LA 4EAEA 4PV9B 1MJUL 2IF7A 4LSTL 1WQVT 2EH7L 2FQFA 2R2HA 1THCA 2Z4QA 2Q5BA 3HMWL 4ZAKB 3RB7A 4A2LA 4AQ1B 1OAUL 5KW9L 1NCTA 1B6DA 2QV4A 5D1QB 3S4SA 4ZX4A 3LZFL 1U6AL 4ONFH 4ZFZA 2HRGA 2B20A 3Q43A 5BZWB 1MIEH 3CXFA 1AS8A 3UTZA 2EDNA 1AAJA 1BFVH 4XO8A 1FL5B 2AI0H 3N42F 3OJ2C 3BGFB 1ZPUA 1TMQA 1RPQA 3L95A 4ONOA 5DWUH 4Z78B 4MMYB 3CK0L 2F54B 2A6KB 1S7WB 3QVAA 4A6YA 4YDJA 3CBKB 3D0VB 1MFDH 1KNOB 3IU4H 3TFKD 5AUMB 1SNRA 3SKNB 3SYOA 4PJGB 5HHOB 2P26A 2GAZB 4PRIB 1PSKL 2UVEA 1H3WM 1YUHA 3JWNG 2Q7YB 3P0YH 2H47C 3O2DA 4KNSA 2WN3A 1NAKL 4G6JH 1BWMA 1F13A 2GEEA 2WLLB 3V4PA 3Q7JA 2YD5A 3QXDA 4ABQA 3TN0A 3IDXH 3DUUA 3IFOA 3KVPA 5E6SB 1PZUB 1BAFL 2H4EA 1A4BA 2CHZA 5CMAB 1F58L 5T33H 4FMVA 1OAQL 8PAZA 4EDWH 4XVJH 1J8HD 5ETUA 1NPJA 5GS1B 3M6DA 4GKNA 1AFVL 2ZYIA 3ZE2B 4PJBB 3VWKB 4ABVA 1I85C 4HFWB 2YR3A 4PTUA 3PJSA 4PIBA 1V3JA 1A3LL 4BCZA 5JHLH 2HT3C 4PY7A 1LO3H 1MG2C 4MS8C 1E5ZA 5AW9B 3N2JA 4NP4H 4TQ8A 5F7KC 3AT8A 5E0QA 1FRGH 4JY5L 1FZMA 3ARGC 1HC1A 1T4WA 4UAOB 5CWSA 3RWCA 3X14B 2WVUA 2I24N 2B0SL 1BQUA 2JH2A 3N91A 3QNXB 3MOAL 4FNPA 4K3DH 4KZDL 5JQIB 4TNGA 4Z95L 5F44A 3HBGA 1G6RH 1TU2B 3WL9A 2WBJB 3JYCA 4HIJA 4GT7A 3T65B 2EYSB 4JL2A 4H1LA 1DBJL 4PLJD 1NEUA 1TJXA 2OM5A 3BPLB 3ROOB 5DC9B 3UROR 1IM3B 4FFYH 3TT1H 3H9SE 3I6LD 1T04A 3RX7A 4HGMA 3V0WL 2BHFA 5L2KD 3TO4B 3CQFA 1M7UA 1VERA 1WS7A 1GJUA 4ZTOL 4PLOB 5F7MC 4MWFA 1QWUA 1TNNA 4WU7B 3GI9H 2AJVH 5D7IE 3QWRA 3UADA 4YHML 4HMEA 4CMMA 4FG0A 4RMTA 1B9KA 4L1HA 4J6RL 3FPYA 1K3ZA 3TJHD 4DH2A 5SWZD 1FAIL 3E3QC 2D9CA 2BSCA 1XEUA 5IF0A 3D06A 2QVTA 3SDXB 2OMYB 4BKSC 3TA3D 4P3CH 4PJAA 2PO6C 3TBSB 2QZ5A 3OR6B 4FQXC 5J12C 1MJJB 2W92A 3IWVA 3VCLA 5GRVL 2ATKB 3K8MA 2BIPA 2PCXA 2FWOB 3ASWA 4IDJL 3X1FA 1RAMA 2A9NH 5INCB 3OKNA 1HYSC 4MCZA 4Y2DD 2K4WA 4HU2A 5JOPD 1DFXA 4FI8A 1SF3A 4IRJB 2R0ZH 2Y7NA 3EJUA 5CHNA 1TQUA 1JPEA 3B83A 5F97E 2CNZA 1QLRB 1DP0A 2NT0A 4JPVL 3PIQB 5CBEA 3VXQA 5FPIA 3HPJB 4PRHA 4KY1L 1BVOA 3TVMA 2JI1A 4BUGA 1YG9A 3G5XA 1DJGA 4ODTL 3VI4A 1OWRM 4QIRA 4JM2F 5ESQA 5G5DA 2IQAA 3BD5A 4LRNL 1V7ML 1VIWA 2A6IA 4KHTL 2FHBA 3ZRFC 4UNVA 2HB0A 1N6VA 2IPUK 2NSXA 2VDQL 4D0BB 3FCGA 4L4TA 1OVZA 2AQTA 5IB5B 4RWYH 4BH7B 4CMHB 1M2VB 4YDIH 2XBZA 3HG3A 3S35L 4NRYB 2B1HL 1S7QA 1KG0A 3B9KC 3P9MB 5A2AA 3SYQA 5AVZB 4XN5A 2YOAA 3DPBA 3KE0A 3K6OA 1XCWA 1AFVH 2YXFA 1D9KC 4B7IA 5A2BA 1FBIL 2VN7A 5E6IC 3RDTB 3W5MA 5L6YH 1OAQH 3ZHKA 4MMXB 3H42L 1KEGL 4WV1A 4TUOB 4NQXB 2CLRA 2ITDA 1VFUA 4ISVA 5J57B 1XTMA 1XCTB 3REVA 3VI3F 4L3FA 4GINA 1PZCA 5CUSL 4LLWB 4PV9A 4FOMA 5GJTL 3RPIB 4ZAKA 1XIWB 5JUEH 5T5NF 2N4IA 3GXTA 3Q6FB 2C9RA 2D9QB 3D4YA 3L1OH 4GFTB 4QRUA 4FNLH 5I1HL 2O6FA 4JZOB 3S4SG 2CDGB 4XP9L 3K8LA 1N18A 1OQXA 2W0FB 4IMKA 1Q38A 5ITBH 2H0PA 2JJSC 1BECA 5KBPA 4WY7L 5EEZA 5EO9A 4RIRB 1FF5A 2ODIA 4L8SB 2BNUA 3ATEA 3T3ME 2A77L 1S9XB 5SV3A 3SDAD 4U7SA 2F54A 5I5JA 5F7LB 4MJIB 1E6OL 1MI5D 4B9GA 3WV0A 5IMLB 3BE1H 5TQ2H 2CRMA 1GIGL 1GY2A 1I7ZB 2CBMA 5HPOA 3HLAA 3B2UC 4FGMA 5D2LB 5D9SB 5IFAH 4DCQA 3RDTC 1FE8H 1NWPA 1CTMA 4MNHB 5DFTA 1FLRL 1NFDB 2VW4A 4FXGA 4KXAA 5HYQA 5SWSD 2J73A 4NUGH 3RNQB 5TQ2L 4OF5A 1KN4L 2XQBH 3D2TA 1RHHB 1XIWD 4FC3E 1IAMA 2IH3A 3T2NH 4IHOA 3VM5A 2XA8L 4K8RD 3NDZE 3UYPA 3GINA 4LCIL 5EZOH 1A7RL 3L3HA 2ZOLB 3U4BH 3EJQA 4Y5XB 1SGKA 1SBSL 1E4KA 4HWNA 2F5BL 1HINL 3DMMD 2VC2L 3B7UX 3NRQA 5ITBL 5MERA 1YDPB 3IJ7A 4KK9C 4HT1H 4PTUB 4DETA 2BSSB 4LPVA 5E6RB 2JB5H 1QFOA 4JFXA 2GW5A 2XG5A 3GDBA 3ARGD 3ULSB 4ZQTA 1A3RH 3RWCB 4C56A 3X14A 5CJ5A 4CC4A 4DP8X 5DEFB 5D7IB 4KVPA 4I89A 4JFEA 2EDTA 4R0LC 1TU2A 1E4XI 2JELL 4QYAA 5I18L 5KSBB 2RMNA 3HZKA 1DSYA 3Q0HA 1E5YA 1VEMA 4QGYA 4IEFA 4N1EA 2VXVH 2LE9A 3P2TA 5CD5C 2XG4A 4WFEE 4N8PA 1XFPA 1JTOA 1MIML 3IJ8A 3T3PF 1B2YA 1XZWA 4WI5A 2LHAA 4DZBA 5EU4B 1T04B 5DJCA 3ESMA 3W39A 1ADQA 1ACXA 1BAFH 3RVTD 1M6UA 2ZT9C 4DK6A 5FLVA 3UBXG 3SGEH 2VDKH 4OFKA 4CKVX 1WFMA 2VDOB 3NDYE 5F1IA 3CPLA 3SO3C 1ZHBA 3SKOB 3UTSD 4DN4H 4C55A 2P44B 3V4UH 5BNXD 2DWTA 5IR1A 2CCWA 2VLME 4OZGB 5AB0A 2Y07L 4GO9A 4JX0A 3QUYA 5FR3A 3OV6A 2H1XA 4QHLB 4JM0A 4YUEH 4X8CA 4HZLB 3BWUF 3W0WE 1G5AA 2WXJA 2WYHA 2CO7A 4N90E 1SJEA 1W0YT 4QXGL 3SOBL 2VO8A 5IQ7L 3OR6A 4AWJC 3A24A 4WKZB 3EO1A 2F19H 1DDHB 2WVVB 1B9ZA 2Y69B 4P2QE 3VCLB 2NUTB 4ZD3L 1ZE3C 5BZDB 3MJ7A 2ICWB 2LU5A 2YAMA 5SWZE 2X4NB 2ZNWA 2DQEL 4OZGF 2VJXA 1NDMB 4PJHB 4MDIB 3OG6B 4PREA 5FUCE 3WDIA 4HS8L 5DSCB 4PV8B 3H9YA 2CAKA 1HXYB 1ROWA 2QADC 3LPGA 5TGBB 1OAUH 3DECA 4LSQL 1ESOA 3ARYA 3FB7B 1WVZA 3CLEL 3TESA 3D51A 3PIQA 5IB4A 4MJ5A 4OIBA 5C0JB 4KJYB 3TPUB 2FEJA 4OY9A 3AXLB 3ULUE 2CE6A 1IC5L 5LN4A 4D3CH 3SY0B 3PU7A 2WB1A 1U8MA 4RRPA 2IPTH 5CZKA 4MCYB 4DQOH 5H4YA 2Y1VA 2X4TA 4HU8A 4CU7A 5BO1H 1DVFC 1DCLA 3VXME 5GGSB 1OGAE 3RWIA 3GBNH 4JAMA 4ADIA 4L3AA 4BH7A 3SJVA 3HE7D 1RUMH 4HC1H 4JZJC 3BUYB 1GYWA 3F65A 4KXZI 1P5VB 2FIRT 2WTPA 3GIVA 2XQYA 4M1GL 3NIGB 3T0EC 3ZE1F 2Z92B 3U9UA 3HB3B 4Z8FL 1E27A 3S37H 4X6DF 3KBFA 4LCVA 2NY6C 4TNWK 5FYLD 3WNIA 5A40E 4LLVB 3JZYA 3MLRL 1U8PB 3P11L 1G9NH 3NCFB 3TT3L 2E7HA 4Z7UE 4L9DA 1HILA 3ECUA 1OTSD 1P6WA 1T7VA 2I7SA 2V17H 2VN6A 3UXFA 1WCQA 5C0IA 2B14A 2CO2A 1JPSL 2CJUH 2KS0A 1BVLB 1IGTB 1T5XA 4J3WA 4WWID 1HNGA 3OGCB 2FYYB 3CWGA 4OFQA 4HX1A 1NAMH 3F12B 1NCBL 1F4WL 4WNQA 3TIEB 1JZIA 1TPXB 3K2UH 5DUBA 5C0BA 4FYQA 3UYRH 5DT1L 1TZHB 3IJEB 2AK4B 4X9IA 1T20B 1UA3A 4XN2A 5JHLL 4FYSA 1BZ7B 2QVFB 3WNKA 3QQDB 43C9A 4G9FB 1KBGH 1R1CA 3PHQB 3RWFA 3DIDA 5ANMA 1FVEA 2V3DA 4G7YH 4QTHB 2LTQB 2NW2A 3LKNB 2W07A 4XMWA 3MZTA 5CLXA 4C58B 4J3UA 1HS6A 2C34A 2E3VA 1IZJA 5LGKA 3IDXL 5E8NA 5FO7B 2CBPA 1UCBH 3F5WA 3QUKA 1RZ7L 2OA9A 3AUVA 3VFTB 2NNAA 4NJ9L 4I0PC 4JK0D 3UJIH 4AUYA 4ZJ9A 3EFFA 2VSDA 3FCTA 2NY6B 3SCMC 3DOSB 3GO1L 1TTCA 2VABB 1H9VA 1Q0EA 1MCOH 2QQKH 4P23D 3V0JA 4PBVC 1MFDL 3ARBC 3TP4A 3KPNB 3GB7A 1I7UA 4JO3L 4KK5D 4YFDB 1XMWA 3NCCB 4IHOB 3UYRL 3AQZA 5AW4B 5FUOH 4FQHB 5FW8A 1WZ1L 2ZOLA 1T2XA 3HPLA 5BRPA 2HLAB 5GS0D 3GJFH 3V0FA 4PJ7B 2FZ3A 4FQIH 1EQWA 1H6UA 1YDPA 2BNQB 3BVXA 3JQOB 4PVMA 2KZKA 5SWSE 3FU3A 4HXBL 2J8UF 3PP4H 1HQ4B 4UAOC 3CSYB 3L81A 1CFBA 2G60L 5KVGH 5HHXH 4BSWB 1OAXL 4PWIA 4PJEF 1OP5K 4ZUVB 2WQXA 5C0RH 5AW3B 3O6FB 4RFEB 1OCRB 1MCCA 4N5EC 1ZK9A 2ZJSL 1ZRUA 1JXKA 1ILUA 1DLHA 4K3JL 1KCUH 4PB0H 4Q9CA 4QJ4B 2OI9C 2AW2A 3B2VH 3F2LA 3TO4D 1MAJA 1UWXK 2KZWA 2XNAB 1MHCB 1RVFL 1DVXA 4MNQE 4POUB 3QIBC 5MENA 2V33A 2JCCF 5C2UB 1T83C 4L0YA 4PUBL 4JFSA 3SGEI 1F90L 4Z1PA 5JXEA 2EDLA 3U82B 3FQTA 4KO5A 5FYJH 3PQYD 3CFQA 3PWPB 2AJ3A 2OYPA 6FABH 1EEZB 3JWOC 2AQSA 1HXMA 4RVBA 4EQ3A 2WWOA 2XN9A 2DWDA 3RVVD 3QUXB 3B7RL 3WXWL 5BRZB 4P46D 1XH1A 1OARL 3HAEG 3O9WC 3ETBF 4NQCB 3ECQA 4ENZA 1Q9LB 5TQ0H 2Q8AH 2Q10A 1LYQA 4ODUB 5KWYC 1YMHA 2IAAC 4U3HA 3A4EA 3SDYL 1XF2A 3A4AA 4JFYA 4ODSH 4XNUL 1PZ2A 3VXUB 4HG4K 4Q9QH 1E28B 1UT2A 3EKCA 1IEAB 5KBLA 5DEZA 1EZVX 2WUBH 4NX0A 4CBZA 3IGFA 3B9EA 3IJHA 3OWEA 3MXVL 4BA0A 4HA1A 5CJXA 1PLGH 5J1SC 2ZAHA 3L3IB 3IXTA 2BK8A 3H7LA 3EYVA 1BZEA 4Q4IA 4OJYA 4XP4H 5IQ7H 4LMQE 4UQCA 2WXMA 1N8ZA 4W1TA 4M02A 3S96B 5I6NA 1HXYA 3CIAA 5KVFH 3GI8H 4R97B 3NSDA 1EPFA 5FB8B 3V0VB 4GIOA 5GRVK 4P0DA 4KXBA 1R3HA 4PJCB 1EHKB 5ERWA 1A7OH 2FRGP 4EIGB 1RFDH 4PGDB 2P3YA 3UGEA 2X0VA 4JUTA 4N20A 3ABMB 1FNLA 3HZYA 1UZ6E 3QE5A 3L6FB 1OT4A 2FTAA 2CLVA 1JYXA 1ZVNA 3CV5A 1QEWA 2GSGA 4FFVC 4DPCX 1KTDA 4MCYA 4Q6IB 2BJMH 2WNXA 4Q8BA 3L13A 4PJDB 1M56B 5GGTH 4YHNA 2F6AA 2R51A 3Q48A 1TQBC 4EEEA 5ESVA 1E9QA 4Z0XA 5BOZG 1FPTH 1M3JA 2YGQA 3R0NA 4QKXB 1CLYL 3MLWH 5DURB 5EOQL 4WUUA 1WAPA 3SEPA 2ZYHA 5DK3A 3FNKA 4PJ6A 3ZIYA 1EK3A 5JDSA 4U1NA 1ZLSL 5ICUA 1FL6B 2ZICA 3TF7C 4YFEA 4GEJA 2FH8A 4R26H 4G71B 5IESH 1OAZH 8CGTA 1K5NB 1CJYA 4OZHE 2XPZA 1U95B 2UY7A 4DGYH 1NGXB 3GXPA 5F3FA 5SWQB 5DYOA 4XN7A 3MRJB 2N0KA 5ISZA 4A6YL 1SOKA 1EHLH 5JW5A 4Z7NE 1T0OA 3ZHLA 4NQVA 1QUNA 4UUJB 5FHBH 4ACPA 1PZAA 3AGWA 3OKLB 4OZFB 4JKPH 3J2PA 2JJTA 3WJLC 2ADFH 2P5EA 4IM8A 3C8DA 2BSRA 1EXUB 1AGDB 4PRBB 1CN4A 5ANMB 1MKFA 2DEXX 3MV9B 4I48A 1EZUA 1FHGA 4C57C 2VMEA 1Q9KB 4I0PA 5DUMH 1F11A 1EAJA 3A47A 1RZIB 2VLRD 4Y2NA 5FO7A 2VXTH 3TZVD 2B77A 1KXTB 4DT2A 4W9ZA 1E9OB 2EXTA 2YUWA 1TPXC 4P2RD 1LEIA 4J3OF 2QQLH 2X9XA 5FYKD 4OM1L 1G6RB 1U36A 2FCBA 1AQMA 3TJEL 4PJXA 3KPLA 5DMJB 3WAJA 2FL5A 2R83A 3ZYJA 4YO0B 4J3OH 4JHUA 2IDCA 3BD4A 3GJEB 3BKMH 1AZZC 5EOCL 2AXGB 2QPFA 3NEOA 4Y88A 4ZQKB 4MHHI 5F1KC 5EBWA 2A9ML 2ZUUA 1OW0C 3A6CH 3MV7A 3PHOA 4G8GA 4XB7A 4D9QD 4OCXH 1BD2D 2CJSA 1DBMH 2F61A 5I76A 2JNZA 4H0LC 3ZW3A 3FO2A 3MRBA 1I8LC 2CR3A 1WV7T 5I8EA 3PV6A 4QF1A 2PLTA 3OBAA 1R17A 4QOKA 1IBGH 4NCC1 3B8YA 2ZXGA 3ZK0A 2PCFA 5BV7B 4APQB 1P4LB 3NABL 1SM3L 2JCCA 4O58L 1DN0A 3UBHA 2TAAA 1CDIA 2XZCH 2DYPA 5L4IA 1J8HB 2WQUA 4TV3A 1INEL 3PWPE 3K2KA 3CHOA 2HH0L 1TITA 3JTTB 4L5FH 1AQHA 2YPLE 5JR1L 4ODVH 4HPHA 4G59C 3BRGC 1NQBA 2EVGA 2ZOKB 2GB2A 5C09B 4GG6F 4P5SA 2V2XB 4PM1A 5H2BB 5KTEL 3WKNA 3U46A 2YAOA 3BJ91 3IAQA 1CDCA 3WD5H 4FADA 3OAWA 5ICZA 1E4WH 1SRDA 3JV5A 4CKQA 2PTTB 3RFZB 1RU9L 2AAAA 1HXMB 4U4BA 5FA4B 3MRKA 4OGYL 1BFOB 2R23B 2OYKA 5DO8A 4K3EL 3ZHNA 4R0LB 4KI5E 1NFKA 2XIDA 5G4MA 4FEMA 3ZE0E 5AVWB 1UJTA 5C7XH 1IC4H 1HE8A 1WCBB 4RDQF 1CGWA 1B90A 2YD7A 3DKHA 3KJ4C 1COBA 3WFEH 2BDNH 2DWYA 3OKKA 4UBDC 5LAXB 4OTXH 4BZ2H 3MA9H 5C08D 1PLAA 4N0UE 4YFLI 1KJ2A 1LQSR 3WD5L 5IROA 1IUZA 3T08A 2HJFB 3BVNA 3LXUX 3GKZA 5A16B 1FUNA 3QDGA 5I5IA 3P4LA 1K8IB 1WBXA 3US9A 3DGGB 3COOA 5E08L 5HGAB 3ZDXE 4ZX6A 1QUPA 1T7XA 1H15B 5IM7B 3CVIH 5KVEL 1RK1B 4YLQT 3T0VA 3IDYB 3FQ4A 4YDLC 2NQCA 4FQPA 4XPHL 2BINA 2JKLA 2R4SL 4XPBH 4XZ4A 3S96A 4LB8A 4J7RA 2WNGA 4HXAH 4IBTA 5BXFB 1ZPLA 1R6VA 2QKSA 2ZG1A 1AY1H 4PCKA 3VU2A 1O6TA 3A3YB 4LLAA 3VXNA 3OTTA 4H5SB 4M8VA 2ENJA 1IAKA 1RSFA 5JPMA 3JZ7A 1QO3B 4S0SD 4HSAC 4PGDA 5F93C 1I7TA 1QZ1A 3AACA 3L9YA 1KCLA 5AW1B 2L7JA 3BGAA 3KGUA 3FFDB 3EZ8A 5E8DH 1NC4A 1VSCA 4FFVD 1ET5A 4MB1A 4TN9A 1HQRA 2EH8H 1SXNA 2YUZA 3AU1A 3JWNE 4WJG3 1A4AA 4GY4A 4UIMA 3V0WH 1CF8H 3IMUA 3QJRB 2VITA 3L5XL 3L16A 1FG2B 4YDNA 3EBGA 1PFOA 2ADGB 3BKML 1I8IB 5GSVB 2DF3A 2ZF8A 3FW6A 5GRUL 2V6HA 4G8IA 2NLJA 4S1RL 1EDHA 2B1AL 2EKSB 3SODB 1KTLA 1G6RL 4KI5C 4FLRA 1P2CB 3ECBA 4O2CA 4HWZB 5KYYB 2C4FU 3KM2A 3RGVA 2QGDA 3P54A 2YUXA 3IDGB 4NWUL 4LQFH 2VZUA 1JCKA 3JUYA 4H8WL 4R4BB 4KRNA 4OQTH 5B1JA 3SKMB 5I8OH 5JW4M 4S1DC 3MRMA 2MQCA 2OV0A 1G1CA 3Q1SH 3RWHA 4JEGB 2X4RA 4L3CA 5DD6A 3MNVA 2XWBB 2IVFC 4U1LA 4WHCA 4X8JA 5EHFA 1TVBA 1XBRA 2EIEA 4GBXA 4DHLA 1BX2A 2CPUA 4XI5D 3WTVA 1NEZG 3ETBJ 4HD5A 2VXUH 4J1UA 5INDA 3TCLA 4UDUB 3WG7B 2VDRH 1VAHA 3GHEL 3BCDA 2W81C 3SPJA 4NQVB 4JKWA 1JHKH 4LT7A 4W9IC 3GUTB 3QQ9C 1SYVB 1ONQA 1ES0A 2JCWA 1FV1B 3OKLA 2KDYA 4P48A 2Y36L 4XO3A 3QG6A 3TM6A 3FTGB 1NBYA 3DVGB 4MVBD 3HE6C 1HL9A 1CI3M 3BGFC 2IH1B 1UB6A 1O7DE 1S9VA 3C5SB 3U6XS 3LZLA 3RWJA 5IHWA 2YBRB 4PJ5A 2BFVL 1CYWA 3UTSB 3LKPA 3ULVF 1XZ0B 2RCSL 1ZT7A 2XN9D 3GF8A 5IOPB 5MEPA 1CVSC 4P23B 2W9DH 2MH4A 5EZLB 2B59A 5DD1L 5DZVA 3WNMA 5E8PB 1E9OA 2YXVA 3L4XA 2V7HA 5CN3A 2Y6SD 2G4GA 3K1KC 3D0VA 2J6EA 4OUUB 4XNBA 5IVXA 2J8HA 3SDDB 3HTLX 3CFBA 2UZYA 4GAFB 4E9RA 2JJSA 1CK0L 1V3KA 4PJGA 2NY0C 2IXQA 4JM2A 4N0FA 2ZPKH 1YUHB 2CWRA 3RG1C 1SHWA 3MRFA 2WINA 3LB6D 2EDKA 2AXGA 2WM0A 2YRPA 4MD0A 5GRJL 5E56A 3U7WH 2ZKMX 4OF3A 3WUWB 4AZUA 1TQSA 5E7FA 3L3KA 4N86A 3QYMA 3ARFD 1RZJL 2CUMA 4GQ9L 3WS3A 4Q6YA 1NLDH 3ZPDA 1A7QL 1CFVH 2IANB 4L2LA 4PJBA 2AEQL 3BP6A 4NZDA 1F56A 2I85A 5DUPH 5KSAA 1EDQA 1GA2A 2RGSA 2HTKD 3CXHJ 1UA6H 3F7LA 3NCYP 3PPSA 4JREB 1J5CA 4O51A 4RAUA 4DPRA 5ADOH 5EWIL 3KYOB 1H5BB 4ANKA 5LKNA 1F6LL 4LZKA 5I9QC 2UY6B 1T0MB 2HP4A 3FQNA 3V95A 1BCIA 3SDDD 3L4YA 3TH2T 2V3FA 3F7QA 3M1OA 2QSCL 3VVVA 3QDAA 2WBJA 4JG5A 2HSIA 1J48A 4N2KA 3TO4C 5F7EL 3VXSB 4O2FB 4UQAA 3CDGB 2DH3A 2BIHA 3AITA 2H32B 5EOCH 5BW7A 1GJIA 4OAWB 5EOCJ 1S7VA 3RI5F 3SIKA 1CYXA 2LOEA 1ADQL 4OJDH 1JZ4A 2P24B 4R0LA 4JW3A 4JG1H 2IMMA 3ARDC 1O9VA 4CVXB 3FU0A 4UT6L 3OX8A 1AOZA 1R9FA 3AGVA 1S9YA 5AKVA 5E00B 5I6PA 4F3FB 2VXTL 4KPHH 1GGBL 3SGJC 3CC5B 1TF4A 4O5LH 4PP1D 3AM8C 3VD4A 5K9OA 5EULV 3VXRD 2GVYA 5E1IA 1XCXA 1XR8B 3KS0J 2Z31B 3PWJA 2ZG3A 3Q1EA 4XOBA 3JVGC 4IYKA 1T2JA 3DIFA 4GMTH 1A4CA 1MCJA 3G04A 3P0GB 1NJ9A 5C0CE 5JTWA 1F6AB 5FGRA 4ODWB 5KS9E 4LIQL 1K6QL 2X5PA 4I0KA 1JFQH 4JKPL 2GCYB 4KUZL 4MAUH 2KT6A 3JSSA 2H32H 5IJKC 1A66A 3EFDL 3DJZA 3HFMH 6CGTA 2H3NA 3SDXE 1FCGA 4XN4A 3CJJA 3QFDB 1MFCL 2HUEA 4OT1H 1MRCL 4FQXA 2E46A 2YZ1A 5B38A 2HPOA 1A7BA 2OMWA 1N67A 4AMKH 4LHQB 2GUOB 3SDCC 5C0BD 4MQXD 5KZCB 3CQPA 3CU7A 4HIIB 4PGEA 2O61A 3MJWA 4HBCH 2WLIA 4G6KH 3HMXL 3O11B 3OMAB 3QARA 4FXTA 5CR1A 2BRQA 3RPKA 2YEZB 2GHZA 3WE1A 4D9QE 2UYLB 2OSLA 4OZHA 1F2XK 3C8KA 2DM3A 5E2UH 3H4HA 2FQDA 25C8H 2D7TH 2GK2A 1TQWA 4Y5YB 1M2VA 4GSRA 2NOYA 1OTTC 1Z2KA 4XRCA 3THML 4MYPA 5T1DL 2AK1H 1N19A 4ZFFB 1S2EA 5GSRA 5E2TL 3D0AA 1KIPA 1XCQA 4HKBA 4M7LL 3JTSB 4QXGH 1K2DA 3SOBH 4X7TB 3G6AB 4OGXH 4AQZA 3VWJD 5FOBA 4IMLB 4UT6A 3VYPA 3WY2A 4IIQC 4F7EB 4AL8C 2FGZA 4QRPB 3CSTA 5CU9A 3H7BB 3FJTA 3PP3K 4MSWA 4ONHB 2AABH 3AT9A 5IFHL 5I17B 4NT6A 1XCTA 3MJGX 3W56A 4NB7A 4DN4L 1NINA 1MCPH 5HJBA 1G7JA 4XVSH 3AWFA 4JFWA 2G5UA 3TBTA 5DJXA 1TCRA 4NQQA 1ONQB 1WFUA 3NJXA 1ES0B 4HKXA 4JY6B 5D1ZC 2TRYA 2AEWA 3FHAA 1C8PA 5AB9A 2JJWA 5HY9A 1OSZA 3K0YA 5BVPH 1URLA 4EN3A 4JZOA 1I9JH 4UMSA 3RWJB 3TZVB 1LM8V 5EC2A 1LO5A 5ID1B 4DTGH 1ZWIA 3IKKA 2FYVA 1K5WA 2X2JA 3UTSA 5F7WC 2OXGB 3QWOB 4D7PA 5I18H 3HC4H 1FVCB 3MNZB 4ODTH 3V6ZA 1BG1A 4ZOAA 4G8GE 5MEPB 1BWWA 3QQNA 3HZ3A 1OARH 1A14L 3LH9A 2JKXA 5KG9B 4DFHA 5IMLA 1B0RB 4WWPA 4KJQD 4JDZA 2ZOUA 4M8QB 1I9RH 4MD4A 2EE3A 4B9JA 4PJFE 5HHME 1AXTL 1MCBA 3Q8EA 3GSOA 4UV4H 3NPSB 4U2ZA 1CT8A 5GS3A 1X3DA 5IUCA 4AVHA 4QRRE 3BUPA 1K85A 1GYVA 3H3PH 3ZTEA 2FD6H 3MUGB 5F9WB 1EEYA 2DOCA 1NANH 3NIGF 3OSVA 3QEGH 3QUML 4D9RE 2IPTL 3K4AA 3EGDA 1TQBB 3SCMA 4Y5XA 5D96B 1GAFH 4LDOB 3WE6A 2R4RL 3GM8A 2C9SA 2IDFA 2E5EA 3RWGB 1DJHA 3ARBA 2N7AA 4A2GA 2DN7A 1FE8L 5CF3A 3SPHA 5J6HA 1HN1A 2BW5A 2RH0A 4P57B 4OF0A 4LKCB 3KYOA 3MRPB 3EIFA 5E9DB 3SZ6A 1RL1A 4KKCC 3LD8C 5J6GA 2F53E 1S78D 4RFOH 3ESUF 4F8NA 1DQKA 4PRPD 4PGBB 4ERSL 4ENEC 3ZUCA 2XWJB 4PJ8A 4QHUA 2BNRE 3Q2NA 4FQIL 5KJRH 2XZZA 4IKNA 4NBZB 5IBTL 4R7DA 4BGLA 2K9FB 3UTTA 1D7DA 2F9BT 3EOBB 1U8JB 3KG5A 4NQTA 4HIQA 4O2FA 2VN4A 1UFGA 1DVUA 4UT9L 5IQMA 3MBEA 3QDMA 1F1GA 1IKFL 4DO4A 1N0XH 3BUTA 4XBEH 1IC7L 4AMXA 3R1GL 3QI9B 5J12B 4WCYL 3FO0H 4NQDB 1WA1X 4PG9A 1USQA 3IS0X 4PWKA 1EVTC 5KVMC 2AERT 4PJGF 5DF0A 1T21B 4NJ9H 2AHIA 3OX8B 3RUGA 2VWEC 2VDOL 3F84A 1MHPL 1T83A 1XGTB 1F4YL 4BKTC 4LEOB 3NESA 4YXKH 3JVGA 3UTPE 2I9LA 2QSVA 4QHLA 5K9OB 3TBWA 2X4UB 3EJTA 1IM9A 2CO7B 2Z31A 5AAMA 3PWJB 3DK2A 4TNEA 1E7UA 1JNHA 1E9PA 1U8CA 4KNUA 1MELA 1KGIA 2B3RA 5DRNB 1JZDC 4RA3A 4LHUB 4R4FL 1I9IL 4HCFA 5HI5D 4Z7AA 5I1GH 2GQHA 2MNJB 2JXMA 2P4AB 3T0XA 1I9EA 4PYHA 2FBRA 3MV9D 2BS9A 4MMXC 3WIHL 2Y3NA 1P4UA 3MRGB 3T5WA 3KJ6L 2EINB 3P3TA 4WWOA 2CK0L 4N8UA 1TEGA 4HJTA 5F0LB 2DQUL 3FSVA 2EIMB 4TSBH 4ZO8A 5DZJA 4W9GC 3BMWA 3UERA 2WMPA 2D73A 3Q01A 5TGBA 4Y4HC 3RLSA 3BP7B 1H8SA 4H4NA 2G3ZA 4WSKA 5C07A 4DOHB 1QQDA 1ND0A 4CMHC 1TENA 4AJWA 5JHDD 2D0FA 5C8JA 4DW2H 4YIQA 3ULUH 2OK0L 1EEQA 1MLCB 2B9AA 5IB3B 5IB4B 1K4CB 2VSCA 3SDCD 2XQYK 1KELH 1V7NH 4YPGA 1JGDB 2IDUA 2GFBA 2WBKA 4GUPA 3LCYA 3KL3A 3RBSA 2AVGA 3ZTJH 4PJHE 1V3MA 1HE7A 2YEZA 2CHDA 4O9HH 4Q9BA 3DVFA 1ZT4B 4LCCA 4FHKA 3B56A 3VQ2C 2OMNA 2BVQA 3HN3A 2DYSB 4H44C 1MWAA 3MLZL 3ZDZE 3CFIC 3C87A 1ODAA 4HQQL 4PWHA 3BPCA 3HW7A 2GT9A 2Z92A 2OQJB 2X4PB 2BHYA 3EJCA 5C0GA 1KIPB 4XO9A 3U9WA 1S7TB 4R97C 1HAUA 1L9PA 4I18B 4WO0A 1W91A 2O1AA 1AACA 1OSEA 5D6CA 4E0RA 3G9AB 5A2JH 4JRXE 4LGPB 5E6ID 1YQ2A 1FFNB 4N90D 1MAMH 4S1DD 1B4LA 2CO3A 5HYIA 3MV8D 4L8BA 4R4NC 4WI3A 3CGTA 2ZX6A 1AP2A 3ARRA 3P3UA 2Z8WC 1MCEA 3EOTL 1I3GL 5AOJA 5HYEA 35C8L 1KZYA 4HS8H 5FFOA 1JXDA 4MX7A 5E24E 3BSZL 3PRZA 4X83A 2QHRH 5I0VA 5F96H 1KYFA 3PABB 1IEHA 3S37X 2B08A 5HDWA 4HHWA 1J87A 7TAAA 4ABWA 4U1KA 1ZWIB 1CFTA 4Y16C 4G6AC 2NZ1A 5FYKU 4HCRH 2WQVA 2DQFA 2BP8B 3SN6N 3V8OA 4U0RC 5I0WA 3ATBA 3NVQA 4FERA 3BZDA 2VZSA 1U41A 4GSDH 4LVOC 3SBPA 1KLFA 3DROA 4IRZH 1D7CA 2XZQL 2V2TB 1TKWB 1XD1A 1A6VL 4RMWA 4UM9B 4J3OG 3DTUB 3I02B 4HAKA 5F9DC 3KL5A 3BZ4B 4OI7A 4F93B 3HR5B 4EI5A 3CDYA 1HHGB 4J3OD 2UWEB 4WWNA 3L7FB 2YRLA 3R4DA 2BZDA 1A6VH 3VFVB 5D71L 1CGTA 5DJZB 2EE9A 4XXWA 5KVGE 4XVJL 3KNBA 5BRQA 4E9YA 4M7LT 5KSVB 4YXHH 5HDQL 1L0PA 3WBDA 1Z6JT 4B3VA 4LNRB 1NKRA 4E41E 3QJOA 4N8CH 3SOTA 1WO2A 3V79C 1XF3A 1TOXA 4U1JB 2BNQA 4JHZA 3ARSA 5C0CD 2OMBA 5IJBC 2CUAA 3EJYC 1YNTF 3H9HA 3LNGA 3PDDA 4N2MA 4P57A 4K07A 3ZQ9A 3FUFA 1U92A 1HH9A 1OW0A 1RULL 1TTGA 1FQ9C 1E3FA 2DJUA 3IU4L 1LJMA 4PLKD 5JIKA 2XU9A 3N43B 5DMIL 4ZUVA 5JOEA 1X7SA 1CXKA 2Z7WA 3HRZA 5LNDA 3NFNB 3QJHA 5TDOA 1WISA 1KLGB 5H35B 4MD5A 3R8BB 4B5ZA 3GLAA 5F7BA 2OBGA 1KGYE 1SBSH 5AOLA 5KJRL 1WTLA 4NKDB 4ZS6C 1HEHC 5DJ0B 3VNZA 2DL2A 3ECVA 1EJOH 3HN8A 1JZ8A 4XMZA 1UM4H 3QUZA 1DVTA 4F58L 2DQCH 5EU6B 3E8UL 4EIBA 3ARZA 5B4MC 5AKTA 1MH5B 3MUUA 1AC0A 1AC6A 5EBMA 3MRCB 4JZNA 3AREC 3QUXA 2DQGL 3OHXA 4LKXA 3TA3A 5FECA 1AZRA 4GYBA 3S0PA 3X12B 1UFUA 4I87A 1RKRA 4LIQH 4F33B 4MA7H 2PXYA 4MNQB 1YNKH 5DD3H 1AD9B 2ZCHL 4OSUH 2NY5L 5DJ8A 4ODUA 5F9OH 2FDBP 3W9DB 4FA7B 1KLUA 3Q2LA 4PP1C 3DV6B 4FMFA 4DOHE 4L4VA 5T3ZD 1XF2B 3AG4B 4Y9GA 5B22A 4QRQB 2F7QA 4MBRA 4LCWB 1DEEA 1E0OB 3WELA 1RMFH 1CLZH 4XP9H 5TF0A 4XHJC 1CD8A 1S5IH 5DS8A 4R4ND 2R7EB 1A21A 3RWDB 4KV5F 3IDIB 4G5ZH 1SXZA 2QZQA 2CIIB 3QP3A 5K59F 1W6LA 1BFTA 1ZHLB 2ZWKA 1L9TA 1QSZA 3BKYL 4JO5A 4U0QB 3DGCR 4WWKC 4YSAA 5FIEA 1FFTB 1AR1B 2BIQA 4UQBA 4PR5B 4FQLL 5ALBH 5JIMA 2VDMB 4WHDA 2FATH 5EUOA 1LO3L 2VDLH 1QATA 5HDBE 4BH8A 4F9LA 1JAEA 1FWXA 1H3PL 5D7IF 4AYGA 5EU5B 1GSMA 3QPXH 5BOJA 4HKZB 1CD1B 1JOIA 3MGTA 1BQHG 1VCBC 1J8SA 2CKNA 2GFBB 1HZHL 3F8UB 1D9KA 3O3EB 1CFNB 2Z6FA 2ZCKH 3DYOA 5M95B 3MV7E 4WNJA 4NZTH 3U1PA 1HXKA 4GG6B 1BM3L 4CN4A 5I0ZA 4WV1C 2J4WL 1RPUA 3SPIA 5FDWB 1D5MB 4F2FA 4OR1A 2C9VA 1M1SA 2DM2A 5EWIH 2AXFB 1EHAA 1I1AC 4LL1A 5IFHH 3BLBA 2PTUA 1IGIL 2JCCE 2O6EA 4GSDL 2F8VA 5I74C 4YDZA 4YVUA 2H3KA 2DQTL 4NHUA 4UT9H 1JBJA 2FB4H 4Q9RH 3INUL 3CFKA 2FHFA 3RU8L 2A0LD 3K3QA 2R69H 2VDLB 2WANA 1J5IA 4XH2A 1K4DB 5DD0L 3L9RB 1QYGL 5AVTB 1IGJB 1P4BL 1SMDA 1VEPA 4HUUA 4N1HB 4AEHH 1OHQA 1E8XA 2RD0A 3OC5A 1MIEL 4O02H 4WEMB 3RGBA 1C9SA 3NMEA 4FYTA 4YHOH 5EBLA 2Z9TA 3GMPA 1LP9F 1G1YA 1I3GH 5DMGC 3HAEB 2ROYA 2YGNA 3RY6A 5C2BL 2AITA 3IKCA 5F21B 3WMSA 3QIWA 4TSCL 5EDSA 3A6BH 4GBXC 1KUMA 2EH7H 3QR2A 1CFSA 3HMXA 1HEZB 3W57A 4BGDA 4Z7QF 1PY9A 3GSVB 1GW6A 1LO2L 4KQ3L 3SGKA 2SODB 3HNVH 2VXSL 4OGQC 5CP3A 3BD3A 4JHAL 3FS9A 3LPFA 1Q9KA 2J1XA 4YXLH 1XF5A 5C0EA 5JIIA 1JE6A 2WP3T 2XWTB 1G7IA 5AOZA 3CPUA 3VDAA 3ZL1A 5SX4H 1KCKA 4IRSA 1JK8B 1E4KC 5E4OA 3QRGL 3UIZA 3ZMNA 4NZJA 3T1FB 1XQ4A 2AJUL 3TNMB 1X5ZA 3HE7C 4GXVL 5DC4B 4G7RB 1RP9A 4XCCL 1KSRA 5K9JH 1WE5A 3VU1A 5FFGA 3GJFB 4DZ8A 1ZEAL 2ILLA 2XY2A 4LCYA 1I9RL 3DMMA 4F27A 5DJZA 4HOMA 4PJDF 2CKBH 4QYOA 4CBPA 1CD9B 3IBEA 3FTUA 1E2VA 4NCC2 4RGMC 4ZUWB 1PGRB 4R5VA 1HNFA 4Z76A 3H9SA 4GG8B 3IMBA 3NAAL 1NLBL 5KSBE 1TXKA 3V52L 1TLKA 3UPRB 3QFJB 1N8OE 4LSRH 1KDJA 5HGBB 3KCPB 4W4OC 3B34A 3H9HB 3J7HA 5BVPL 1DQQA 3E38A 4NP4L 1GZPB 2EYTA 3P69A 5HHQB 2NXZC 3BZFA 2OR9H 2VSKB 1Q0YL 5DHYA 2MOGA 3Q44A 4JKNA 4YQXH 1WIPA 2VW6A 3FB8A 4PJIE 5DD5L 5AB2A 2I69A 1D7FA 5J6SA 4N6RA 3LNIA 4NENB 2WK2A 4FEIA 3UG5A 1NCGA 2AABL 2DEWX 4OCRL 2YPKB 4A2FA 3J07A 4R7VA 3BUQA 5SX5K 2VR8A 1MI5E 1T5KA 2D3NA 3QO0A 1KACB 1G1KA 3QORD 3D69A 15C8H 2B5IB 4I8DA 5ENWB 3WHXB 3DX7A 3CZLA 2WQAA 3RPBA 3UEQA 4NYLA 2CKBB 4XMUA 3D39B 5TPWH 4IRJC 1EAPB 1GL4B 5DHXB 1J5OL 3RGHA 5CM1A 5ID0A 1I8MA 1IAII 3NCJL 3Q8BA 1I1RA 2X3BA 4LCWE 4ZSOB 4AXWB 1UTDA 3WGUB 1CXEA 5E0FA 1Y6KR 4QCIB 1HHIB 3QRFM 4UQ9A 3FQYA 1JMXA 4XX1G 1PZ5A 1XH2A 5I1DB 2GIXA 3DYPA 3VGEA 1C5DA 4OFDA 2DS4A 4UQDA 4B6ZA 1JYNA 4MNQA 4P46C 1KPRB 2WD0A 3ZKQD 1JPGB 1M71A 3U36B 2DLFL 1FZJB 3OKKB 4JJ5B 3W9DA 3JV4B 3WU1A 3MRQA 1JNNH 1N3NA 1PD1A 3GMMA 5I8KL 4JDTL 1TLMA 4YDMA 3RZCB 3NZSA 1K9TA 2NQ3A 1IJ9A 1IQWL 2VXQH 3MRIA 4HS6A 5FA3A 3F7RA 2AQ3A 1IKNC 5AAPA 2J56A 2WSKA 5HGAA 2W38A 4JGUA 3S5LB 3ZVVA 3ZT6A 5KW9H 1RK1A 4L1SA 2JWYA 2FR4A 4IU3B 3CVHL 2XLLA 2OXHB 1PF3A 1SLXA 4PTTB 1X9RA 3W81A 5AVXB 1BVKB 3PHAA 3KDPB 1SLWA 1E5CA 3VXNB 1F6FB 3R18A 5EU5A 4LDCA 3NCMA 1J0ZA 1OL0A 1NEZA 2IFFL 4XNAA 3L5JA 3O41B 4BYHA 5IVOA 4M5ZL 1HHHA 2J3SA 5I19L 3FFOA 3PREA 1F97A 3LIUA 5HJ3A 4L1BA 3ZE1E 4HAFA 1OCCB 3GSNH 3U79A 2VYRE 1GGBH 2ZUWA 3NJLA 3QIWD 1FFPA 2J21A 4Y19E 1VFAA 3AB0B 4O2EA 1JTTA 3RDTD 2HMIC 5AUMA 2OZ4H 3IGAB 2HVBA 4HUMB 4OLXH 2MMXA 2ENYA 2WIMA 3H53A 4OD2B 5DA0B 5EU7C 1WWWX 4YPJA 4AIEA 2KL6A 3DX8B 2H2SD 2E6QA 3MRHB 3UL4A 3OKMB 2M8XA 3GSRB 4NIKB 4R4BA 5E7BA 1LL1A 3VGAC 1R34A 2DKUA 1O6SA 4LSUH 5TFSH 1Y1DA 2E86A 1JZHA 4G9FE 4X6BB 1X5IA 4L8DB 1X5HA 4JANA 5CCKH 3NRFA 4XNMB 4JFFA 4R2GC 2VNCA 3BDYH 4KO7A 3RY6C 3EOYG 3KYMA 5I1KL 2A6DA 5DLMH 1CXIA 5FM8A 1FL3B 5D5ME 2MCPH 3HAEA 4U1HA 1M9WA 3QDHA 3LRLA 4N22A 3QIWB 2KYIA 5CWSB 4U1IB 4PJHF 3T0DA 3CDCA 2WYIA 4U0RB 3ULUD 2YBRA 3BVUA 3VFUB 1AYRA 4FHBD 4NFBA 4LBEB 4HLZH 4ZAKD 4YWGL 4HKJB 1QSEA 3TV3L 3C5ZB 1XF5B 5EDXA 3LZQA 1B4JL 3KPSB 3QORC 1L0YA 2Q7NA 2AK1L 2RALA 4OH2A 2OTWB 3K2IA 1TZOA 3MRLB 1J0YA 4EN3C 1QSFD 3TPKA 4PRNA 5KVEH 1I31A 4DEPB 2NNFA 2NY1B 3BO8B 4NXSA 1PKQB 1Z3RA 4MXWH 1MCIA 5LCVH 4MWFB 1F1AA 2D31B 5LBSA 2OL3H 3FB5A 1AVAA 4TNWF 2IXQB 4DZ8B 3PWUB 3MBED 3QDMD 4LO9A 1WC7A 4ZUTA 2F54D 2V9TA 4PLNC 3DMMB 4PY8I 1AZUA 2FAUA 3BKCH 1DEDA 3MV01 43CAB 3NGBB 3UAFA 4JKKA 3C60D 4ANWA 3MMEA 1DLFH 3LEXA 4OGAD 1VKXA 5D1ZI 4ZDHB 1YJDL 3L3OA 3VW3H 2BLFA 2X9WA 4JN2B 1EIBA 3V10A 3C5XA 5F3BB 3HS9A 2GJ6D 3LMJL 4TLUA 3UPRA 4FQXD 2DDQL 2DMKA 2J72A 3MJ8B 3SPVA 3WOVA 1LMIA 2ATKA 1OLLA 3CZFB 4V1DD 4ALAH 3VXOA 1AS7A 3O0RL 4I3SH 5I82A 4TOYH 4MXWL 2VJ8A 3QBTB 4D7BA 1ULVA 3OKNB 4RGMB 3D39E 2YSSA 3EHBB 4OJAA 2HT3D 3MACH 3MV7D 4U6YA 2XWRA 5CCGE 3QEQB 3FQ1A 4UILH 3FB8B 1A4KB 1WLHA 4YAQA 2WGNB 1ZVSB 4ZXBA 5KTEH 4JPKH 4JQIH 5I2IA 2W80C 4WFHE 3W3BA 4YZFF 2ZCZA 2ALWA 1G9EA 2BXYA 4KTEH 4NQCE 4C56D 5E94B 4YMPA 1S3RA 2J6WA 4C83B 2K1MA 4OQTL 3S3DB 1NSNL 3OKOB 1A9EB 1RUPL 2VZ3A 4Y4KC 2ZKYA 3ZUNC 4PJAE 4DGVL 5H8DA 1S7VB 3B2DC 5F3HB 2ZX9A 3RL2B 3HI1B 4C47A 5EUKB 3SDCA 1TETL 5E2WH 4JRYB 3PGDA 5GGVL 2CGRL 3NZHH 3T71A 3UZVA 1CPUA 2WTRA 3GXNA 4HIHB 2YPLA 3TEUA 3U7YH 5CJQH 3C8HA 3K72A 3WEXB 4DVBA 1WH0A 1HHJB 1T03L 1HKFA 4OJCA 4N5UA 2Y9RT 1KBPA 1YN6B 1TCMA 4G72B 2XPGB 2ZKXA 3GMRB 4XZUA 4HLJA 3U7YL 1FGVL 4CVZA 4NQXA 3DIFB 2X88A 4B9PA 5IKCA 2WOYA 4D0DB 3O3AA 3WS6C 3U0TA 1AKJB 1QRNB 2AKRA 4XHJD 1DDTA 3GIZH 4NPYA 2Z3FA 3D3VA 4L37A 4W6YB 4LCUB 2VR5A 2C4FT 5TE7H 3LS5L 1QFUL 3OB0K 2ZZUT 3QUMB 4X5LA 4D8PB 3VGHA 5I6LA 3ULUC 4TSAL 4WW2C 4KK6D 3WSQH 3MOBH 3W11D 1RK7A 3R8QA 2YQ2A 2APTA 3ULVL 4RAHA 1NGZA 1OAJA 4XPAH 4ZYKB 4V11A 4M7JH 5IW1B 4F8QA 2V5MA 5KS9B 2VGLM 3FQRA 4HAGA 1ID2A 1UZGA 2H26A 1DUZA 5FV1L 4ODBD 1CFQA 1PG7H 3DSNA 1T5WB 3O9WB 4H0GA 4LLQA 3LVTA 4KMTL 5HHNA 3HNTL 1D5IL 1Z7JA 4BZ1A 3V4VL 3P3YA 1DQMH 1ZCRA 1NBVL 2BHZA 2UYLA 3FB6A 2R9HC 4OZHB 5T3XH 3U2IA 2PUQT 1IC4L 3TC9A 2I27N 2XRAH 1YPZE 4M1CD 1ZS2A 3FQWA 4HULB 2NNRA 4ZUSB 1BOGA 1CDUA 3MLSL 4FZ8H 3B1TA 3ZMEA 3ESOA 5B1AB 2AZUA 3FUHA 4YK4B 4NC1C 4R26L 1WT5C 3EJRA 3I50H 2IV9A 1FH5H 3J27A 3DPDA 3M88A 3MYJB 1XCQB 4HKBB 4MAYC 4NN6B 4BK5A 3ZDWA 3GK8H 4D2NA 5CEXA 2VLLB 2IH3B 4A2DA 2R2BA 3EO9H 3RQ3A 3L3HB 4J8QA 1MRFL 5ABZA 4DUWA 3CLWA 1Q94A 3ARVA 4FQ2H 5H94A 1OE1A 5D7KE 2AK4D 2Y36H 1GRWA 2WOBA 3FOMB 2QQKL 4UCFA 1C5BL 3O8XC 3KPSE 1YVLA 2EADA 3TBTB 3GO1H 2BRRH 2VE6B 3K6DA 5D7LB 4I13B 4P4KB 4X50A 1D6VH 3BDXA 1KXVC 1EZSA 5HYJD 5IFJA 1DO6A 1B2WL 5HY9B 4YSTA 1CR9L 2H45A 3GRWL 3AUWB 2V4LA 4FLHA 15C8L 3TZVA 3QQXA 3U25A 1FNEA 2FJUB 2VQTA 4KOCA 4ZODA 3VVWA 4ZMPA 3Q1SL 1FL5A 3BSZA 2JQMA 4L1TA 3HZKB 4P59L 3KPMB 3UTQB 4YDLB 1FVCA 1E6JL 4TUJB 3AABA 2XG4B 4JFVA 3MCLH 1KXQE 2Y06L 2OMUA 3PL6A 5JNYB 3WO4C 4E9SA 3VRLE 3VSQA 3NUKA 1UD8A 2QDVA 4BXVA 3BO8A 3AQDA 4IOIA 5ANHA 2KERA 5LDUA 4K5LA 4LCWD 4PRDB 1Y6MR 4DFIA 1BD2A 1KPVB 2FH6A 2GK0A 3GSOB 3MLUL 1OHZA 3QUZD 2P8LA 5IQ9A 3LZRA 1NSNH 4UOJA 1ASOA 5C9JB 5D8JH 1G94A 3MUGA 2MQ0A 3MLVL 3S7GA 2HX7A 5DHVA 2YPVA 4LARH 4MB4A 5AVRB 2CKBL 5GS1A 3S3CB 1CGVA 3PFUA 3HUJB 4J27A 1DDHA 1WWBX 4Q97A 3VXPA 2F74A 5C09E 4G83A 2B15A 3B37A 4PJFB 3MJ8A 5HHMB 2XKNA 1HKLH 3SPVB 2C1OA 4G7VL 5CJ8A 4XP6H 4I1RA 4B95C 2Z31C 5AAMC 1FSKC 1GS6X 3HG1D 3NACL 4LLDB 2HJLA 3HZMB 4KJPD 4A2HA 4YHIB 2MHAA 1F90H 1BV8A 3L4UA 3VM7A 1QR1A 3I6KA 4CN1A 4M43H 4IBSA 3EH1A 3MREB 4FLQA 5C3TA 5GGSY 2ZWSA 1SVCP 2YLKA 3WL9B 2ESVD 3Q9PA 4HIJB 1S7UB 1RIHH 3TPUA 1P5UB 4DVRL 5J56B 3TFBA 1JXFA 3AG1B 5IB2B 2P8MB 1BLNB 2Z35A 4U6HB 5CO1A 5DRXB 4AY0A 3CXDH 6TAAA 5G55A 3FBKA 4FFZL 4NQDA 3NCEB 4YHOL 4K73A 4HXBH 5FF6A 2AVFA 4OV6F 4GRWF 4DAGL 1PZ3A 3OAZK 1D5XA 2QGBA 4WUKL 2E59A 1IILE 5CSZB 3K0WA 1R33A 1W0VA 1UB5B 3INUH 4UQ3A 4V2BA 4X9FA 4Y9BA 4XC1H 2OMYA 5GGVY 1ZGLB 2QQNL 2WTOA 1E5UI 1LGVA 4L5FL 5DEGA 5DRNA 5KSUB 2RAMA 3KVDD 5J1AA 3FTSA 4U1SB 3MGOB 2C3XA 2OMVA 3KGSA 4JQVC 1Y07A 1IT9H 3QGVA 5DJDB 4F15C 3T3PB 4LLMA 3OGCA 4Z0BL 1S4IA 2E7DA 3FT2A 4LCUA 5E5UB 4U49A 3L3JB 4JR9L 4U1GB 4EIUA 2NW3B 4TTDD 5FYLE 1L9QA 1OQOA 3MO1B 1JZ2A 3LYRA 4F7MA 5CGYC 1XDTT 3QDJA 3WFCL 5TH2B 4DK5A 2EKJA 2QADD 2TSBA 2EEXA 1LO0L 2PWHA 1Q1JL 1YYCA 2XZAH 5AQ0A 3HPJA 4PRHB 2IADA 1DANT 3AG3B 3PDOA 4FNQA 2NW2B 5KS9A 3QIUA 4M3HA 4GUPB 5LQBL 1MWAH 3RNKA 1ZMYA 5BCAA 4OFPA 2GI0A 4MDJB 4S1QH 4WFED 4UV7H 2CJUL 2WWKT 3MNMA 3V52H 4Q52A 2Y23A 3DI3B 3QNFA 5JPNB 3JWDC 5B7MA 2APBA 3TX4A 2ZUQB 2X1XR 4RDQG 1VFBA 4CC0A 2UZIH 3RJQB 1QPXA 1K8DB 4Q0XH 4HJGB 1EO8L 2PWDA 4E0RB 1LK3H 1J05A 4FQHA 2Z1PA 3G6JF 3G5WA 1L3WA 2DIBA 5GGQH 2XQBL 1AI1L 1NCOA 2XV0A 1EFXA 5BUGA 1OTSC 2IV8A 2YN3A 3FOMA 2DQGH 1LEKA 3RVWD 4CL7A 4AGNA 1DQLH 1JNLL 3U4EA 4P5TA 3VYNA 4YHZH 5DDHB 1A9VA 1NTDA 4EXPX 2ZYRA 4Y16B 3P73A 1UJ3A 3LMJH 3BE1L 1YY9C 3C5ZD 4ZOCA 3UMNA 1FG9C 2OTUB 4JRXB 3T6WA 4QDGA 2CDFB 4JM2C 2YC1A 1ZT1B 1MVUB 1WD9A 3C2AL 4JVUA 5D96C 3QUXD 3QB7C 3TIDA 1GCFA 2JJUA 2G75B 3SQOL 1WZ1H 4M4RA 2YK1H 3N1FC 1T1WB 3QIWC 1KLFB 2XN2A 2X4SA 1AXSB 2O5ZL 3M17A 3P77B 4X5RA 1U58A 4YDKL 5I75B 2SEBA 1QNZL 3OKEB 4U7KA 2MKLC 1AG6A 2X89A 1ITBB 5GZOD 1SVZA 2WWKO 1UYWL 3ECWA 4I0PD 3HR5A 2BSED 4NFCA 3APNA 3A21A 2ESVA 3D33A 4GAGH 3QUZC 4QKTA 2DM4A 3H56A 3QQ3A 4JFPA 3RKPA 3MBEC 1RZ7H 4BQ9A 5L8LB 2YAPA 1JERA 3AC0A 4P2OB 4YSDA 1ETA1 5IK3A 3AREA 4MJJA 3SYAA 2WP3O 1H5BC 3NK3A 3PV7A 3TA3C 4KVCL 4M5TA 5CN1A 3UYPB 2N3JA 1FNSL 1YC8A 1QMUA 4MJIE 5EUOE 3D3VD 5JLZB 4ES9A 4QTIL 1HCVA 3ABZA 4QXUL 1QX1A 2Y07H 2JV6A 2NR6D 4L4TD 1FO0H 3MAWA 2GY7B 2J12B 4XE5B 2FSEA 2NTFA 1Q0XH 5I0XA 4UDTA 4WENB 4KDWA 4F57H 1A1NA 2EDOA 1CGXA 4BFKA 2PKDA 1NDGA 4YSSA 5GGRA 4JPSA 2JB6A 3HRZB 4LESA 2P49B 2EE0A 1KLGA 3LN9A 1GSKA 5H35A 3VMNA 4DAGH 2ICWI 2DJMA 2IIJA 4X7EC 2V5YA 5ERWB 3CH1B 4RWHA 4HV8B 1PD0A 4W9CC 4K9EC 5T1LB 3LOWA 2OCJA 4JPVH 1RH8A 3QULB 4DGWC 2JK5B 3KWWA 2H9GA 5BOPA 1XGQB 5I23A 5EU4A 2MTAA 4DKAA 1JZ5A 2DI9A 1MCQA 2L7UA 1U93A 2OMZB 1X7TA 5LWYH 1JV2A 5CZXC 1CDHA 3LVEA 2VLKB 3G6JE 5T5NG 1G9MH 3KLDA 1TVDA 2JMRA 3HG5A 3EOTH 1FO0B 3P4NA 4AZ8B 3L17A 5MP6H 2FO8A 3OHXB 3W38A 1J9TA 1KB5A 1TG8A 2NDFA 3T77B 4A7UA 2YGPA 5JO5A 6PCYA 4I5BA 3WJJA 1WFTA 1IGMH 1XGUB 4F33A 5EF1A 5DJ2A 5GXBB 4KWUA 1SEBB 3L3GB 4A04A 4Z3JA 3BJLA 2GTWA 4Z77B 2X4OA 5GS0H 1UEYA 3JUZA 5DO2D 1PG7X 5EU6E 2H2PD 2FX7L 2JE8A 4P46B 4M6OH 1DL7L 4NCDA 1K5NA 4PJ8C 3I9GH 1CFMA 4U6TA 4KGLA 3VJ6A 4AX3A 2BW4A 4FD0A 3WEMA 5C0AE 2X05A 2ICWA 4XOCA 5D7KD 2PMZA 5DMGD 3UZEA 4JGMA 3INOA 3VD3A 5C08A 1SFHA 1GTNA 1BEYH 3UAAA 1XVSA 3AQYA 4PV8A 3L3JA 4TUUA 3MLTB 4WNSA 1NDTA 4DNLA 1YPZA 4F7MB 4RGNE 1RZGA 4U6XA 5EZIH 4J4PA 4X9YA 3U9PL 2CU9A 1EXUA 3BWAB 1DBJH 3DETC 1J10A 3EDDA 3MYZA 2MSPA 3MV9A 4XNQB 1I1AB 4X5XB 1YMMB 4JB9H 1IGYA 3FMGL 3H54A 3NQIA 1AGBB 3KPOB 4OM0H 5FGCE 3II1A 4X7SH 1PQZB 2A4ZA 2ZXQA 7CGTA 3B3BA 1SEQH 1X6LA 5C86A 5FDWA 3V4VA 2KPNA 2WLHA 2WKLA 3UJIL 1P9MC 4WHYH 5EUOF 3SJVB 2AXFA 1UEMA 2J1ZA 1CDGA 3D18A 4B9ZA 1NFAA 2PPCA 5JHAA 2EZ0D 2QPSA 4FQCH 1CUOA 4H8WC 5EN2B 4TVPH 3U9UB 2BX5A 4M1DH 3FZUC 1ETJA 5KBKA 2B9BA 4PRAA 2ENSA 1IAIL 1JYVA 3TO2A 1PD6A 1ZTXL 1ZTXH 1XF4B 1R5VB 1XB3A 4ZW6A 3C09C 1CDBA 1G7MA 1TT6A 4AVJA 4MRCA 3BH4A 4FQCL 4J6IA 4AV5A 1PZBA 1UKSA 3FO2B 1GS8A 2HUHA 1OGAB 4PWGA 3UBXB 2VLJA 2HVKA 4XH2B 5GRWA 5C0IB 3L9RA 3HEIB 4Y1AE 4Z5RB 4L3EE 3BX7C 4QOKB 2EVHA 5LGHL 3IGLA 1AQDA 3IDJB 2JCCB 3WMQA 4PI2A 3CIQA 3FSWA 1ZLDA 3O8XD 4X7SL 2EIZA 5E1QA 4ICWA 2P8PB 1N0XL 2HKHH 3IETA 4XBEL 3T9WA 3O4LB 5DK0B 2OTUA 4JRXA 2BO0A 3L4TA 5HHOE 3SSGA 2D4FA 4V1DA 4HGKC 3WNPA 1BZ7A 1HEZA 1RJYA 3LIZA 4N26A 2XV2A 4LVEA 1RJCA 4WFFD 5KOVC 2ZOKA 3EBHA 2R0KL 2YMXH 1GC1H 2W07B 2H6PA 3KXFE 4TTGA 2ZCHH 5F9OL 5ALCH 5DYFA 1KIQA 5AB1A 3HRZC 4IBYA 1SVBA 35C8H 4NQUA 5T1MB 3GMLB 3HB3D 3M17B 3P77A 3WAKA 1XH3A 3IXAB 4YEEA 1BZ9A 2OZNA 1QI3A 5CSBA 4OCYH 2EP6A 4KXCA 1FN4A 3ISWA 4IBZA 4X8XA 4JO8A 3WIHA 5I6XB 1REIA 1DQVA 3GB7B 1MVFA 1RZFH 5GRYA 2DD8H 1U8IB 2H7WA 3OLDA 4POZC 1B0IA 2FD6L 2RACA 4LF3B 4HWBL 2MKWA 4RAVB 3MN8A 1AQKH 4FJZA 4G43A 1A6UH 5F7YC 3BVWA 3BH9A 3HE6B 4JPWH 1FGNH 2YKKA 4RGOH 5A2CA 5E1AA 1C16A 1K8IA 1WBXB 5LGYA 1NWOA 3CSYA 1VESA 3HHRB 3PE9A 4ZMYA 3WKPA 4Z7QB 4QAMB 1RZ8B 3DARA 4UAHA 1Q9OA 2W0LA 1QW9A 4LLYA 3VXSD 5JIPA 5DHYB 3WFHA 4XCYB 2YJQA 3CDZA 3DX1A 4C4KT 5JW3L 2P9RA 2GBVA 4E41A 1X5JA 4I9WE 4NKMA 3GBEA 1JHTB 4Y4FC 5EA0H 5JPMB 3FT4A 5E2WL 3GQFA 1DBAH 1EJFA 4RMQA 3FQUB 3W82A 4TNVF 5IEHA 2HG5B 1MHHA 3C6SA 2PW2A 1SXCA 1ORSB 2LLLA 5HJGA 1NCCL 2NYYC 3Q6GH 4G8AC 4UIMB 3TYGL 4A7QA 2Y22A 4J23A 2AQRA 1FG2A 4A39A 3WDHA 3KW7A 4LOUC 4TM9A 3VDCA 1CLVA 4JG9A 4QRRD 3QDGE 5FW6A 2A73A 4Q2ZB 2DWDB 2YA0A 1A6WL 4D9LL 1XGUA 4I88A 3S5YA 4EDXA 4JE4B 1NCWH 2AV1A 4JMXA 3QJSB 5AOMA 4CDGC 2WLYA 3OQ3B 2RFXA 4YXKL 3PJLA 3FZUD 3JV4A 1TIUA 5MI0B 4EBQH 3NH7L 1YPZF 3MRMB 4KO9A 4YH6A 4P5TD 5AD0B 1NAKH 2E0PA 3G9VA 4IBWA 5T8IA 5CU5A 3SB3A 2CHNA 3ZSTA 3OAYH 4TF4A 2ZIDA 2C3GA 4Q89A 1M6OA 5DCCA 3HLKA 3NJFA 4NGHH 5BRZE 3CFEA 3FYIB 5C08B 5E2UL 1HL4A 4PSPA 3FFCA 8FABA 5ACZA 4MA3B 2QPEB 4HW6A 1NGYB 1DVFB 2QSTA 3FTGA 2P5WB 4XWOC 1BVKA 3V0VA 2A74C 5F9AC 3HS0C 1PX8A 2HFFB 4X6DA 4AMKL 1W0WA 5EORH 3ZDYE 4NDMA 5D1ZB 1MJ7L 5EZOL 1JF5A 1EV2E 2OZ4A 4ERSH 2B39A 1JS4A 5CKGA 1G9HA 1WDAA 2DQHH 1QPKA 2QMJA 3QR0A 5EBGA 2ZKHL 1KTDB 1PQZA 5EZLA 4HFUH 3V0AC 4E5XA 5ADPH 1DSWA 4DP6X 4YWGH 3ARFB 5IP4A 4RRPG 4O2EB 3E8UH 4FNSA 4JO4L 2DQCL 3MCYA 2FX7H 4G80A 4L3EB 4X4XB 4BFIA 2ORBL 4AIZA 4PJCE 5BMFH 1R3JB 4JBSA 5EB9A 3O9WD 5B3NA 5DRWA 5E1GA 3EO0B 3VXTB 3AROA 1D9KD 5A6IA 2WINB 1CWVA 4JFOB 2O5XL 4U6VH 3OKMA 5I0YA 1P4IH 3TO2B 3W9EA 3LV3B 3ALPA 4WJKB 3BGMB 3EYFB 5I28A 5FYLH 1TJGH 3T0WA 4KGJA 4CILA 1E67A 2E47A 3NYKA 1R5WA 1FNGA 2IPUG 4Y2OB 2X6UA 1O6SB 4PJDE 3O81A 4QNPE 2WN2A 4GQRA 1NGXA 1AXTH 2KKQA 3GLDA 1LDPH 4URTB 5TE4H 4L4TE 1QFWL 2YWZA 2D8KA 1UM6H 2XTJE 3BH8B 1FAKT 4H25A 5DZNA 3V6BR 3FAXA 3V2AR 3V4PH 4KVNH 1PDKA 4K55A 2VSMB 3AT0A 3C09B 4TNVK 1XGPA 3D0LB 1QUNB 4U1HB 2AMGA 3CSBA 2CHXA 2H41A 4RZCB 1T0MA 2NPLX 3TBYB 5D1QA 3VQLA 4GH7B 5CGYD 4PB9H 5JDJA 1R3LB 5DK0A 4XOEA 1CGSL 4B9YA 2YEVB 3KLHD 1RJYB 4KO6A 3II3A 1IBYA 4EI5C 4YNYB 5EF2A 1PAMA 3IN2A 2IMNA 3V0DA 5EEVA 4LPXA 1EO5A 2H6PB 3APMA 3RTQD 2CG9X 2RA1A 1KXHA 2XSKA 3BP4B 3D4GA 4TVPL 5EOTA 2JKSA 5L9DL 3CFNA 3KLAB 5D5MB 7PAZA 3GSQA 2EUWA 4I3RL 4ZFOA 2A83B 1Q0XL 3NN8A 3O6FD 1L5GA 4E68A 2HRPH 3ES6B 1DZ0A 5KYWB 2WLNA 1BQLH 3P1VA 1PKQA 4QXUH 1PSKH 4KTGA 1DHKA 2COQA 2GAZA 3KPLB 3RE0A 1ZIAA 4ZPVA 2BC4A 4B9IA 3GPSA 4G1MA 2BOCB 3FMGH 2NY0D 4U31A 1BQHA 3KPRE 1DBAL 5E00A 3VGDA 3VTAA 4F3FA 4FNTA 3MMEB 2E7MA 3MA7A 3QG7H 5DC2A 1NICA 3DUUB 4N9OB 2G4EA 4WDIB 2MPVA 3D5OF 3IRCA 5I76B 1RIVH 2NXYD 4JN2A 4BFJA 1EWHA 4GLRH 4NZUH 5E99H 5IIEA 1XB6A 1XGRA 5E1AB 1NJ9B 3H85A 4M6MH 1IGCL 4M3JA 4Z3IA 3V5KB 3IWUA 1S3KH 4M29A 4FMKA 5FK9A 1RURL 4QT5A 1AIFB 1MFEH 1F86A 2ZAIA 1A6UL 1OOAA 1IRAY 3H0TA 4OCSH 1R46A 3G6JA 2WXGA 2CO4A 1V10A 4Y4KB 3WUZA 2XA3A 3QUXC 3TXAA 1NGPH 1JHTA 3QFDA 3VX1A 1HCYA 4QLWA 1OGPA 2DZEA 2I5YL 2ZF9A 3FQUA 4RDBA 2D7PA 3ARDB 3NCJH 4JDEB 1TMCB 3T65A 4WIQA 1CGYA 1QG3A 3S36L 5JYMA 3V7MA 4N0YL 4BQCA 4M8UA 4C83A 3KEDA 1WRFA 1FP5A 5D2LF 2Z8VC 1BBJA 1QVOB 3FF8A 3QEQE 5FYJD 5F3HA 3D9AL 5HDRA 3GYRA 3RL2A 3TLRA 4G42B 2R39A 3VG9B 3X11B 4J3BA 1T1YB 1WYJA 2V5TA 1BAGA 4PS4L 3EXJA 3NSYA 2YPLB 3V6OA 1KCSL 5C08E 3SDAA 3MFFB 4HPOL 2RR3A 2X40A 4DN3L 2CJTA 2AJZB 4XT1C 1UD5A 1GOFA 2J1YA 3MLXL 5JQ6L 2BVUA 3DX2A 5DHMC 4LHUG 3L7EA 3OC8A 5EV7A 3WXVH 4ELDA 5AD0A 3S88H 1RZJC 4F9LC 5BS0B 4PJAB 3UIYA 3BWUC 3FU8A 2Q1EA 4W9LC 2B0SH 3DUHA 4MAYA 5IKCB 5I17A 2B16A 2GTZA 1A02N 3BT0A 1RJLA 5IMKB 1AKJA 1QRNA 1U9KA 3EUUA 1G7JB 5KN5A 1UH2A 4LFHD 2BP0A 4N2BA 4NPYB 2VRAA 1BQRA 4U1MB 3CZJA 5ICXB 3S98A 2Z4QB 4LSVH 5C0FA 3L5XH 2AF2A 3P4MB 3V0IA 4XVSL 1VACA 1LWJA 4BHUI 4BFEA 3NCWA