1BAWA

Plastocyanin from phormidium laminosum
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
ETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of plastocyanin from the cyanobacterium Phormidium laminosum.
pubmed doi rcsb
source organism Phormidium laminosum
molecule tags Electron transfer
molecule keywords PLASTOCYANIN
total genus 24
structure length 105
sequence length 105
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1bawA00
4G70B 1OE1A 5E9NA 1NDTA 1SF3A 5I5MA 1NIAA 1SFDA 1KBWA 2J56A 4KNTA 3EF4A 5TK4A 4BWTA 1IBZA 1AQ8A 5IY5B 5B7EA 4YVNA 2YQBA 1PLCA 1IBYA 1DYZA 1BXVA 3OD3A 1R1CA 3X1BA 3BQVA 5PAZA 1AACA 1AAJA 2GB2A 3FSWA 1PCSA 1PLBA 2BW5A 2YAMA 3GDCA 3CDZA 5B1AB 5ANHA 2YAHA 1MG3C 2XVBA 2EIMB 4YSRA 4ZK8A 5I5JA 3OQRA 3SQRA 1PY0A 2W8CA 3T6VA 1IC0A 3FU8A 1PZCA 5B7MA 4GY4A 4G7QB 1XB6A 4DP4X 4BDVB 1WAEA 4G7SB 4P5SA 1OV8A 2IDTA 1HAUA 3H4FA 1NINA 5B1JA 4E9TA 2H3XC 4GXFA 5I6KA 1I53A 1WA2X 2ZONA 2FNWA 4A2HA 2Y1AA 2YAPA 3AY2A 2HLEB 1SDDB 1A3ZA 2DV6A 2H47C 4UANA 2VM4A 1GW0A 4L0PB 2VN3A 2EIJB 2PPEA 1JZHA 1L9SA 1OCCB 2AFNA 3AW5A 3FS9A 2XX1A 3NP3A 1PLAA 2CJ3A 3N55A 3V9CA 5I6NA 2Y69B 1ET5A 3SBPA 1NPJA 2W88A 1AS7A 4UAHA 2JFCA 1JOIA 2TSBA 3X2QB 5EHFA 4E9QA 2CBPA 2J57A 3FPXA 4Q8BA 2UXTA 4HALA 2ZXWB 1AG6A 2MRYA 3H4HA 3NSFA 1B3IA 2I7OA 2XV2A 4JHVA 2VMJA 3S3BB 2HX9A 4BWUA 1BAWA 2YXVA 3TA4D 4CSPA 3UGEA 4HCFA 3AG1B 1AR1B 3MX0B 3FSAA 1JZGA 2BZCA 2DYRB 4PAZA 2QDWA 2IDUA 2YAEA 1V54B 1TKWA 3UAAA 2GIMA 4RH4A 5I5IA 2GC4C 1M56B 5I26A 2FT6A 2CCWA 4GP4B 3UACA 3QJSB 1X9RA 5I28A 5D4IA 4BXVA 1JZIA 2JXMA 2CALA 1PMYA 2YAFA 1SF5A 4DP8X 1CYWA 1MDAA 5B3SB 2QPDB 4AKPA 1DZ0A 3T6WA 1NTDA 2VSKB 2FT8A 2CAKA 3QPKA 4M3HA 1PNCA 3NJIA 5F7BA 2FQGA 2P80A 3SBQA 1KGYE 2VW4A 2QPEB 1BYOA 2FQEA 1JZFA 1UATA 3IBOA 1YLBB 1PF3A 4KNUA 3AZUA 3BVDB 3CVBA 3H56A 2HRGA 3D12B 2B3IA 5B1KA 2OJ1A 2UX7A 4A2FA 1TEFA 4AKQA 2AVFA 3FQ2A 1AOZA 4A2DA 3FQYA 2BW4A 1BQ5A 2GSMB 3CZUB 4UF7C 1A4CA 3FYIB 4E9VA 4E9SA 1NIFA 2FWLB 2PPCA 2XWZA 3FSVA 4G71B 1AIZA 1URIA 7PCYA 2VW7A 2VSMB 2VM3A 3EH4B 3FU7B 2UXGA 2BP8A 1RZPA 1ZPUA 1J5CA 1L9OA 3NJGA 3GXUB 2AZAA 1KCBA 2ZWNA 3OM3B 1XB8A 3IEAA 3ZBMA 5TK2A 1J9RA 1CURA 2YXWA 1E30A 3TBCA 1SFHA 1E67A 1GY2A 4YSTA 2GC7C 3ZX1A 1AZUA 2WO3B 3FPYA 1BEXA 2WSDA 1OF0A 2A3TA 3PAZA 1BQRA 9PCYA 3PXLA 3S3DB 3NJFA 3NJJA 2IH9A 1HAWA 2HX8A 2RACA 4DPAX 2PP9A 3ASOB 2PP7A 1V10A 2Q9OA 4N8UA 3KW8A 2E86A 3NSDA 2AZUA 2DY2A 3NSCA 4HCIA 2J55A 2I7SA 2QT6A 2HRHA 3WG7B 4HIPA 3ZDWA 3QJUB 2I85A 4KOCA 3X1NA 1ZIAA 2XV3A 4HCGA 1ID2A 1PZAA 3T6ZA 1JZEA 2XU9A 3UABA 4NB7A 4AI7A 4HAKA 1A4BA 1RZQA 3C75A 1SJMA 2EINB 1L9TA 1BXAA 1NPNA 4PCYA 1BXUA 3NJHA 1MG2C 3T9WA 4KO5A 1IKOP 4YSSA 4DP9X 3NYKA 3PAVA 1T5KA 1RCYA 3NJNA 4FAAB 4WKXA 1AG0A 1AS6A 1OCRB 1L9RA 1WS8A 2LLNA 3NP4A 5I6LA 2DYSB 4E9XA 1SDDA 3NJLA 1SHWA 1AANA 4A2GA 4ENZA 5I6PA 3JT2A 1J9SA 2UX6A 2PPDA 4JHUA 3T71A 1WS7A 2BP8B 1MZYA 3KW7A 2X87A 2IAAC 3DKHA 3S8GB 2XYBA 4HHWA 3NT0A 1TU2A 1N70A 2B08A 2OCCB 1OCOB 2HX7A 4YSOA 1E65A 1EHKB 4NAJA 2BO0A 2EIKB 3UADA 3ABLB 2OV0A 5LDUA 2PCYA 1CYXA 1QHQA 4M4RB 1J9QA 4W9ZA 4DPCX 5A7EA 4DP6X 2PP8A 7PAZA 1NIDA 1NICA 4YSUA 1J9TA 3NSYA 4KNSA 3CDZB 1ILUA 4DPBX 1ETJA 3FYEB 5AFAA 1A65A 3PAUA 1X9UA 1OOWA 1IUZA 3SBRA 2NRDA 2BP0A 3WIAA 5I6MA 1FFTB 2FQFA 3PLYA 2IWEA 2GI0A 2H5UA 3S8FB 4G72B 1OCZB 2XV0A 2EILB 1ZV2A 5I6OA 2IDFA 2P80D 2CUAA 1M9WA 3EHBB 3EH3B 1EZLA 1FA4A 1JXGA 1GS8A 1OE3A 1QLEB 2PPFA 3S3CB 4DP0X 4F7KA 3TU6A 4DP1X 1GR7A 1KBVA 1W6LA 2BWIA 1ET8A 2IDSA 6PAZA 3N2JA 1N68A 3TBBA 2XX0A 3V9EA 1AZBA 1ASOA 1ASPA 1NZRA 4DP7X 4JKNA 3AG2B 3UAEA 1XB3A 4AKOA 2BWDA 5B1JC 3FQ1A 4DP5X 4YSQA 3PPSA 5F7AA 2GBAA 3TASA 2JKWA 4E9YA 2FTAA 1NWOA 3RYMA 4YSDA 2UXVA 1ET7A 3OMAB 1NIEA 1L9QA 4KO9A 1ZIBA 4YSPA 2IDQA 4A68A 1ZDQA 1PZBA 4TXVB 4GP5B 4G7RB 4GYBA 2VW6A 3ABKB 1A4AA 4NERA 1NWPA 1BYPA 1CC3A 1TEGA 3CG8A 1KCWA 2FJSA 4HZ1A 4KO7A 2YAQA 4AX3A 5FC9A 1AZCA 4AZUA 5B1BB 1MZZA 4WTQA 1JERA 4K9JA 3AG3B 2BP0B 4N4YB 4YL4A 1J5DA 1GY1A 3CVDA 2X88A 4A67A 3T6XA 2FT7A 2J5WA 2QDVA 3HB3B 4QKTA 1GS6X 3X1EA 1PNDA 1WA1X 1XMEB 3WKQA 1ILSA 1KV7A 1CUOA 4MFHA 3FU9A 1E5YA 4QLWA 3AG4B 2DWTA 3CVCA 3OMIB 1FWXA 3JTBA 4EF3A 1NIBA 2IWFA 2XXFA 2HXAA 2TSAA 4HHGA 1RKRA 3QJQB 1W8EA 3WKPA 4BDVA 1SHXA 1V55B 1W6WA 4P5RA 4FA7B 8PAZA 3EH5B 3IE9A 3NJMA 1A8ZA 4YSCA 5AKRA 4YVUA 4YSEA 2XUWA 6PCYA 1L9PA 4BXSV 1OE2A 4A66A 4CSZA 1PAZA 5B7FA 2YARA 4KOBA 3QJRB 2AANA 3MBWB 1M57B 3ZIYA 3NJKA 1GYCA 2R7EB 3OMNB 3WNIA 3IN2A 1F56A 2PPAA 3PCYA 5PCYA 4BWWA 4A2EA 3L45A 3X1GA 1AS8A 1JVLA 2PLTA 4E9RA 3QJTB 2IH8A 1JZJA 2PCFA 3X1FA 2BHFA 2XXGA 4E9WA 1E5ZA 2BZ7A 2HZHA 3G5WA 1JXFA 2UXFA 2XLLA 4GP8B 1KYAA 1AZRA 1ZDSA 3DIVA 2ZOOA 3FT0A 1JVOA 1QNIA 2DWSA 3FSZA 2FQDA 1JXDA 1GSKA 1AZNA 3IN0A 1SNRA 1KDIA 2YAOA 5AZUA 4BK5C 1KDJA 1WA0X 3ABMB 3ERXA 4DP2X 2N0MA 2IWKA 2R7EA 4F2FA 4YSAA 2MTAA 1GS7A 3U25A 1ASQA 4X4KA 3FU7A 3GYRA 4KO6A 3ABGA 1ADWA 1HFUA 3DTUB 3QJVB 1VLXA 3WNJA 2WO2B 1BQKA 4Q89A 3QQXA 5D4JA 3WI9A 4F2EA 3ASNB 2GHZA 2Q5BA 5D4HA 4W1TA 3HEIB
chains in the Genus database with same CATH superfamily
5AUMB 4FQQA 1JF1A 5INDB 1N59A 4WI0B 4HT1L 2CDEB 4V33A 1YPZF 2CQVA 4JY6A 4KWUA 1KBWA 3FQRB 3PL6C 3EF4A 5ALBH 4M02A 1ZD6A 3L8QA 3NRPA 4L18A 4KKCD 4B41A 4HEMA 3B3IA 1P6AB 4Z7OE 4ATTA 3SKUD 4KY2A 4FTDA 1IEAB 1ZTXE 3IJ7A 3RUGE 2JVUA 5PAZA 2Y07L 2CGYA 4M93C 4WU5B 5T3XL 1R34A 3D4GA 1MNNA 3WY4A 4WI4A 4NKMA 3PGCB 4MGXA 1AY1L 5T1MB 3DYMA 2C26A 3DSNA 3K80A 5FECA 4Z3HA 3SDYH 1ZOXA 5D1QB 2HWZL 3NABL 1UWGH 3BFOA 2ED7A 1UUNA 3WBDA 1D6VH 2Z93B 2GUOA 5E8OB 3BZ4B 1E5CA 1I9EA 3QA3B 2EZ0C 3EF7A 3T1WA 2IAMC 1LK3H 1OAKL 3PV7A 2X6AA 3ET9F 2O26U 2IPTH 4NT6B 4GXFA 3U9WA 1P9MC 4NHCL 2OJZL 3ILEA 3MGAA 4ZZFA 1IBGL 2YMTA 2AEQH 4LRNL 1URZA 1XO8A 4MS8D 2H47C 3K6NA 4W9GC 3BW9B 4DGUA 5E6IB 1XAUA 4AM0B 1CGSH 3GLEA 2WAQA 4Y19A 3L2LA 4WFFD 2XN9D 5EOCL 2VLLA 2XKUA 4G6AC 4M5ZH 3SBPA 3WY3A 2J1WA 2GYSA 2NXZB 4LLDA 4DERA 5HDRA 5C0GB 4UNTA 4M56A 3S35L 3WNPA 5EHFA 4C4UA 4FG6C 5CJOH 5BXFA 3RNKA 4LE8A 3U0PA 3UTTD 5IHWA 1Q94B 4L23A 4GXVH 1M6UA 2ZOUA 5G2NA 3UPCA 1HXMB 2IBZY 4L1SA 5J0BA 5C0DA 5E5RB 4HUKB 1KNOA 1F3JB 4RAUB 5JZ7D 3ROLA 4CSPA 2N7AA 2BVTA 2VQ1B 3Q2LA 4JDVA 4KRLB 4K3EH 2F6AA 5AVRB 4X7CC 4YEEA 4OFYD 2NYZA 1J1XL 4AW4A 4IRJD 4QHMA 4HVBA 2EIDA 4PU2A 4G6AD 4MMXC 5GISL 4G9FB 1E9OB 1EJ8A 2WBJD 4FFYH 4KDWA 3M8OH 1XH1A 1NMCB 2K70A 1E2ZA 3F00A 5E9DE 4BZ2H 3KLHD 1ORSA 3MNVA 4XPTL 4IDLA 4JG9A 4HF5H 3APMA 2G0KA 3ETBJ 1X5GA 4DO4A 1M05A 1T7XA 1ZAGA 3TJPA 3HE7D 3QQ9C 4XP5L 5CN2A 1MDAA 35C8H 1HS6A 5DJCA 5I9QB 5KSBB 1MVUB 3BKCL 5AVZB 1F2XK 5T33H 4EUPH 4P9ML 4X9GA 1A7BA 1LEKB 5IK3B 2WIIA 1CYGA 5AVWB 1YC7A 3HW7A 4RAHA 4QRRD 1YYLH 4Y19D 4OFQA 2CIKB 1JV5A 5EZIH 5K39B 4BCZA 4EUPB 1S7TB 3UEQA 4WKZB 1PS3A 3LKPB 4N2CA 4NENB 1I85A 1D9KB 3AQZA 4WI5A 1U8PB 2BMKA 4CU7A 3WEXB 2UX7A 4PJXB 1X9QA 3IAPA 3T4YA 1NBZB 2AVFA 1EAPA 1BOGB 2NR6D 2ADIB 3PHOA 4H1LH 3PUUA 2PTTB 1G7JA 5DJZA 5SWZB 3E3QC 5A2CA 1A14H 4TUJB 3L95A 1AE6L 2BVOA 5GRJL 2EE3A 32C2B 5GZOC 2ZXDA 3PP3H 2VW7A 4FNRA 4P5TB 5EPMB 4ACPA 5LGKA 5K9KB 4E0RB 4U1LA 4HFUL 4JQIA 2GEQA 5B4MD 3GXUB 1BVNP 3LZNA 3CLFL 3RQ3A 5EF2A 4K3DH 3VWKC 4DK5A 2ZWNA 4X5RA 2GFBA 1YZZA 4S2SA 4BSVA 3T1FB 2EDFA 4GSUA 2E9JA 4BKTC 3LKSB 1KPVA 3ARDA 4Z7QF 5DWUL 3EYUL 1JGLH 2X6VA 2X4UA 3BDYL 4MCYA 3MV01 5ILTH 2Y6SC 4RMWA 5JW5A 2YZ8A 3QDMA 1F90L 1H6TA 2J71A 1A0QL 1JHTB 1P5VB 4LXFA 1BEXA 5ESVA 1S3KH 3CFDB 3PAZA 3CV5A 4JO5A 4ZMNA 5D6CA 2HN7A 5F6HI 1XF4B 4FLQA 5ETUA 1EWHA 9PCYA 1ACCA 4IRJB 1A66A 4I5BB 4YBLB 1OB0A 4UV7H 2IH9A 4YXHH 4C47A 2HX8A 1KB3A 4WWKA 3UBXA 4OQTH 4AMWA 3QZLA 1M7DA 3A6BH 2PP9A 1DQKA 4JJOA 5TE4L 3ASWA 1BWWA 3BFQG 1A7QH 3ZSSA 5D2NB 1PGRB 4F9LC 2H2PD 2VMEA 3I74A 4HZAA 4PLJD 1OD9A 1UXWA 5DJXB 4PQXA 3QO1B 4W9LC 1KCUL 3UBXI 2EYTA 4YO0A 3Q8EA 3WHE0 3VXNA 4KRPB 4XO8A 3E3QE 2O6DA 3D07A 4RDQF 1ZIAA 2NLJB 3G5XB 1KFAL 4UM8B 3CJJA 3FRUB 4Y5XA 3MFFB 4ZFGH 3U7WH 4Y5XC 1WEJL 4K3JH 4HJGA 3WNNA 5IOPA 2EDLA 3EAKA 3L3OA 1G7LB 4WGWB 1FJ1B 3VXUA 3BAEL 3L3OC 4KKLC 4HCRA 3V6OE 5C0FB 1G9HA 3KH4A 2NY6B 1T5KA 2WXGA 1PZ5B 1OP5K 1NM4A 1FYTB 1D7DA 4BBWA 1DSWA 4FFZH 1MNUL 5FKPA 3BW9A 3CFIC 3NP4A 4HUMB 2NY1D 5D1QE 3MLWH 5F7DB 3F01A 1ITCA 5B38A 3PP3K 4RGMB 1CLOH 1MHCA 1AQDA 1UGNA 3BD3A 3KW7A 1VZIA 2YPLE 4XMLH 3CSFA 3QAZB 4JGNA 1BM3H 4ZS6D 2JQZA 3C6LC 4OSUL 3Q2VA 4YDKH 4AC2A 5F9AC 2YPKB 3F6JA 2HT2D 3HG1B 5IF0A 4D9QD 3AREA 1AKJD 2J2ZA 4G8EB 4QT5B 4EI6B 4YDLC 3FCBA 3QXUA 2NXYC 2PCYA 3CZJA 4NJ9H 4TQIA 2EQDA 3NIGB 3ABZA 3D0LA 4KKLD 1ZJAA 4L9LA 2R2EB 2V8LA 4MMZA 3DJ9A 3SE8L 3JV5A 3VXSE 3OAYH 1B4JH 2VJ0A 1OD7A 4IIQB 2VZSA 4QUOA 5BUPA 3POCA 2X89A 2F54E 3BZ5A 3MACL 4Y1AE 2EEXA 1AMYA 2NRDA 3KEHA 4KXZI 3NIFF 2X0VA 1RXLA 4OF7A 3PLYA 5LNEA 5E9DD 4L3CA 1QSFB 3UTQB 5HHOB 1VFAB 4JM4H 4G6FD 4Q74A 2ZE0A 3MV7E 5JDSA 4OVUA 2MKWA 4EZKA 3QCUL 2CXKA 2VZUA 3UGXA 4TLKA 4WFFE 4ABQA 2ICWB 1WWBX 2FBJL 3FQWA 3SD5A 3HBZA 1KWGA 4R4NC 3RFZA 4MA1B 4JO8A 4KI5D 3SDCC 4NEHB 3R8BB 3T2PA 2VXTL 1XF5B 1EJOL 1T0OA 5DJCB 1J1XH 2P49B 3FB7B 4XN2A 2V0AA 4JDTL 4I8DA 3A67L 1QPXA 3IJEA 3K81A 3OAUL 3WMQA 4CW1A 3JSSA 5E5MB 1CGVA 1RL1A 3G6AB 5T5FH 3S37X 5JHDD 1XTMA 4IM8A 5BS0B 5LHDA 1MPAH 1OZUA 2YUZA 2B7DT 5JHAA 2VXVH 4A68A 2LLLA 1KYUA 1QYGL 2KDYA 3CG8A 1G0YR 3MKKA 3UJTH 1H3UA 1OB1A 1HZHL 3NFPB 4XPFH 1XGTA 5FGSA 1P84J 3RX9A 1MFCH 5KUKA 3N44F 1FVCA 1FN4B 3AG3B 3H2WA 4PVNA 4FERA 2D9QB 3FUKA 1FI8C 3CVDA 1R0AL 2BHZA 3T1FA 2A9AA 3MRKB 3GI8L 3LJ3A 3RUGA 3QJFA 5KSAD 1RK7A 15C8L 2ZKHH 4LFHD 5DQDH 4J2QA 3LEXB 1GJWA 3CVCA 3TH3T 1T4KA 3KPPB 3IPFA 2Z31D 1T6WA 2L8AA 1U6AL 2I32A 2XXFA 3ESPA 4JBSA 5EZLA 3K7UA 3VQ1C 1DLFH 4U4BA 4F8QA 3DYOA 4FABH 4YBQC 4DK6A 3PWPB 5ISZE 3GJFA 1IM3D 1E5BA 1T89C 3MMEA 5C09B 2YEVB 5TH2A 3RILA 4BH8A 1JWUB 3RUGF 2ZNXA 4N25A 5CINH 2IDCA 4WTZG 1JV2A 4JY4B 5I1EH 4FABL 3D06A 2DQUL 4GLRI 4P4KD 5C0AE 3QPQC 1E6OL 4OZGA 2BSBA 2CBTA 1SJHA 1MHPH 2WLIB 1PQZB 1ETB1 3DROB 3JV0A 1Y6MR 1YC8A 1PY9A 5GGTL 3QQ3A 4WHCA 3IFOA 2B4CH 1OL0A 2X1PA 4GQ9L 1CBJA 3QZBA 3WXVH 1YEFH 2Z8WC 1DVFB 4UT9L 1DVZA 2CK0L 4OD1H 1R24B 4WJ5A 4M93B 3OXRB 2FO4B 3KPRD 3B2MA 3FO9A 2CO6B 5MEOA 1RSFA 4BUHA 2BCKA 4UT9H 1YEIL 1DTUA 2BK8A 4G8GB 5F9JA 5BOZG 3FT2A 4NRXB 4UILL 1KIUA 3C5JA 4HWNA 3MRPB 3P4NB 3HMXA 4PJEB 3QJZA 1PZSA 1FV1A 2HFTA 1AOHA 1JGEB 2RTTA 4TOYH 2YRBA 1TO5A 2MHAB 2FJGA 2ZSWA 3ECBB 3KPLA 4JFDE 5E8OA 2IGLA 5AZ2L 4Z76A 3AXHA 1CN4A 4PJ5A 4K23H 2OMYB 1FZJB 2FB4L 1S78D 2OSLA 3GFUA 4HWBL 3ULVH 2MSPA 1OCWH 1NCCL 2QZQA 5IHBA 5HDBE 2EDRA 1MHCB 2JI3A 3VI4B 3DOSB 4MYPA 1OGPA 2O6CA 5JIPA 1MAML 3MV8A 4HWBH 3I9PA 5F7DA 3WFHB 2J56A 2XVGA 4PHZA 4F93B 2CO1A 3IFPA 2YQBA 1Q9WB 3BPCA 4O02L 4EUPG 2BH0A 1W0WA 4EI5D 5E8NA 4IDJH 1RK0B 1OT4A 4FQJL 4QXGL 4OD3H 1SXCA 2WZ5A 4TSAH 1NQBA 1JWSA 4HHAA 4K7FB 4HMCA 1PLBA 2HT4C 1ROCA 3KHOA 1U8PA 2BMKB 1T1ZA 2WTRB 5K9JL 5I23A 4L3AA 2YOCA 4IDJL 2AXGB 1P7QD 4JFHE 4LCIL 3CVIH 3ZGHA 2EIMB 1UWXK 3PY9A 1NAMB 3GMNB 5D7HA 3V4UH 2A9ML 3P4OB 3KYKH 1XZ0A 4J6RL 2FH8A 2FATH 4IRZL 4I1RA 1SEQH 1XB6A 2EEBA 1K9TA 1E2WA 4JZNB 1Z5YD 4N90D 1NOFA 3DSFL 3BQUB 2WJ7A 1U2YA 1OV8A 3LZLA 4J3WA 5CEYB 1F4WH 2PWFA 2XG5A 3EFDH 3SDDD 5HYSA 4LCUA 4NIYE 1MCWM 1I9JL 4XNQB 1OM9A 1UCTA 4RLDA 2ICWA 5FUZH 4XXWA 5J6SA 2V9RA 1FZOB 4LSPH 4MNQA 4WUKL 5DD0H 2D7OA 4G6ML 1KTLA 1TJXA 3QIUD 4GT7A 5E1QA 5C0IB 1A3ZA 5HDBB 1FZJA 2WCGA 3UJJL 5LQBH 3OF6D 2D7PA 1ITBB 2BY0A 1U8NB 3QR0A 2F08A 4WV1B 3FL7A 1F4XL 2ARJA 3RL1A 1T89A 4F9PC 2FLRT 5FB8B 3NP3A 1A6ZB 1UH3A 5IROA 3U7YL 2Y69B 4BCYA 3U4KA 3WYRA 3I75A 5LXGH 3LQZB 1X9LA 1YUHB 3DGGA 3QUYA 2BWQA 3GBLA 4JE4B 2XRAH 4ZD3H 2TSBA 4E9QA 4YWGH 4TL4A 3IDMB 1D9KA 3ARVA 1LO0L 4OZHA 5ES4B 5I1DA 2ZCHL 2Y7QB 4P5MB 1TJIH 3U6XA 1YQ2A 3AT0A 4E42B 4A7GF 4BGLA 4BSWB 1NA8A 3UCQA 35C8L 4N8VB 3LQAC 4LLWB 4W9DC 2DLFL 3G6DH 1E42A 1F45A 1RZ7H 3MA9L 3X14B 2ZOLA 1N8ZA 4NI3A 3HN5A 3OGCA 5CP3H 3SE9H 4K07A 2VDPB 3PABB 4HJGB 4DNLA 2VZOA 4X4ME 1YQVL 2WUCH 5D70H 5JIKA 4IU2B 4CGUB 3ZHKA 3UAAA 3EDDA 2GC4C 4JNXA 3DARA 4OJCA 3L13A 5FLVA 5T5FL 3FFOA 4F37F 5D1ZB 2H4EA 1SUJA 5FUCE 4IGBC 2PWGA 3N3EA 3EW3B 1K4CB 1ES0B 3WIIH 2YGPA 5E1AA 1L0YA 5EBWB 1XT5A 4LCYA 4LIQH 1EZUA 2JELH 1IZJA 2QPUA 1BOYA 2D3VA 2J1ZA 3M88A 3OLEA 5AW9B 3O3BA 4LPWA 3OJDB 3V6OA 3NAAL 1I3GH 1BQLH 2DH2A 3DRQB 2QADC 1ED3B 3EOAA 3IJHB 4DESA 4ENED 3ZT7A 1RZGA 2X0WA 1MWAA 4DUXA 3FCTB 3BPLC 1F11A 3AZUA 2VZ1A 5CF3A 3WS3B 4D7PA 1TEFA 1NGWA 2XA3A 2D7TH 5LJYH 1IEAA 2QELA 2I9LA 1QVOA 43CAB 1MCWW 1D6EA 4M9OA 4L8CB 4JFDD 1I3VA 1T7WA 2WKLA 2V9QA 3HE7C 5D2NA 5HPMA 2AJVL 1UCBL 4WO0A 4HJJH 4D7BA 2VWEE 3DJZA 1SN2A 2PPCA 3MUUA 5ITFA 2F7OA 5EU3A 1JPGA 1TU2B 4MXVE 4MWFB 1JGEA 4UUJB 3WJLC 4DO6A 4TUOB 2VXSL 2F2HA 2UXGA 3CXHJ 1RZPA 2A6DB 2A4ZA 1QABA 5JPNC 1RUQH 1NCDL 5C92A 2PWHA 1F6LL 1YECL 4GT0A 4K9EC 4FKKA 4FGMA 1CJYA 2H8PB 1KCBA 1CD8A 3OXSA 3OM3B 2Q87A 1QOKA 2RCSL 3ESOA 5ACLA 4R97C 3GMPB 2GITA 5DMIH 2EH7H 1R17A 1AJ7L 3GRWA 3VG0L 1SM3L 2JJWA 2ATPA 1CE6B 3QIUB 4X7DC 1ZHLA 2JSFA 5IR1B 3E2HC 4OZHF 4X9FA 5CS7A 4NXSA 4NX0A 5FGBC 5GGUA 4PJ7A 5IFHH 2HN7B 3B9KD 2N4IA 1S5HB 1DBBH 1CL7I 2SODB 3A6OA 1OP9A 2XKNA 3S8WA 4QHKJ 5ERWA 4LLVA 1W0VB 5C0CA 3GBML 1C16A 2MEJB 3OB0K 3QYNA 4OJFL 2AQSA 1AHWA 2BSSA 3EIFA 4KVPA 5D55A 4Q0XH 4AH2B 5CEXA 3QXWA 1RURH 3F12A 2MNJB 3MCLL 3QUMA 3GUTB 2AZUA 4JB9H 1S6NA 3BFWA 3LQAH 3ECUA 1NBZA 2NTFB 3W2DH 4FL4C 4Q58C 3QJUB 3BSHA 4UV7L 2PCPB 4YXHL 4MA7H 1IBFA 1ID2A 3KM1A 3SE4A 3VXRE 4S1QL 5DD6A 3UABA 2OTWA 4XVUC 4AK1A 3ZKSD 1IILE 4MD4B 4EN2A 3C6LB 3NN8B 4FFYA 5A1AA 1MJJB 4AUJA 3FO1B 5IEKB 1FN4A 2EUZA 2DQGH 1VEOA 2R56L 5LCVA 3P3UA 4JRYB 5E24E 4Z8FL 3O9WA 4G43B 2UWEB 3IE4A 1U4FA 3WTUA 3P4LA 5I6LA 4BSVB 5L2KE 4YE0A 4TNEA 5FCSH 1KTLB 4N3UA 3LNDA 3LPGA 2Q8AH 5L2KA 2ZCKL 1WZLA 5IP4A 4XNQA 2QVMA 2BP8B 4JFFD 5IBTH 1XR8A 1DHKA 1CDBA 3WFDL 1XGRB 1IGCL 1N0LA 5KYUB 3KAAA 1WZKA 4IMLB 3TP4A 3VFMA 2DLGA 1Z1WA 3DO7B 3SY6A 2BY2A 5AOJA 1AZZC 2CM6A 4LL1A 5KANI 4O9HL 3QJOA 2D03L 3DI2B 3AVEA 4JFXB 4M4RB 5ISZA 3TH2T 2WBJB 3MJ8A 3O9WD 5KZCB 2I9TA 2ZAGA 1OSYA 1UQSA 5KYYB 3L7EB 4W9KC 5LBVA 3DURA 1YVLA 3N1QC 2Q7YA 4B7LA 1XEDA 3KPRB 2J21A 2B9AA 4CAGA 5MENA 25C8H 2V2XB 2IOMA 2OMTA 1N4XH 3ELAT 4CILA 1ND0A 5F9JB 2HFEA 1U8HB 1ZHKB 4PIRF 4A7UA 1MIML 2Y5TA 3RTQC 2ENQA 1A4JB 3IRZA 1T3FB 4IBZA 3WMSA 2Y5QA 3PRZA 1QTYT 4O2FA 5IEKA 3S8FB 1CDHA 3TT3L 1HEJC 1AXTH 2UZYA 4DGIH 3B7UX 5FO8A 4PJ8D 1CGSL 2XV0A 3JTSA 3P69A 3SDXB 1EFXA 3D30A 1ZV2A 3MNVB 2IDFA 4FQXD 5J3HC 3THML 1P0SE 3BRFA 5IV2A 2QVFB 4N86A 4OGXL 3O6FC 4XN5A 2E7LA 3GB7B 4DP0X 9CGTA 4G6JH 3J8F7 1E5AA 3QXDA 4GO9A 1EEQA 2ESVE 1BWMA 1RP9A 1EZSA 2JKNA 5E1HB 2XTSA 1A9EA 1UVQB 4I0PA 1IC7H 2YD6A 4LVHB 1B4JL 3FKUS 2NZ9D 3WUWB 2EEAA 3UAEA 2BWDA 1UD6A 4N1CA 3VB9A 4CL7A 4IYKA 3EGSB 1NDMA 4B6ZA 3HFFA 5AVQB 2Z92A 3IYLW 3B7RL 4YE4H 1DQJB 4NKQB 5J6HA 3WIFA 2FR4A 4AGMA 1XF2B 5DO2C 2E59A 3OMAB 2BRQA 2ERJB 1I4FA 4KZ0A 1PSKH 3KXFA 1ZMYA 4JO2H 1K6QL 2AJZA 5FA3A 4GP5B 4NERA 2IH3B 1JZ6A 1NWPA 3RRQA 4YBHA 3LH8A 3VRIB 1R3JA 2B1AH 2XPGA 4Z7UB 4WWOA 2NSXA 4E9LA 3FH7A 4N5UA 3OXRA 3K6SB 2JIXA 2CR0A 2H6OA 2QPFA 4KMTH 4KKAC 1JERA 4AIZA 2VL5B 1FZKA 1A4JA 3CDYA 3EADA 3F6LA 4K7PX 2HTKC 5D1QA 1J5DA 4H13C 2NZ9C 1WAAE 2DIBA 2UVEA 1OALA 5CJXA 5IBUG 1X5XA 4AT6B 1OO2A 5GSVB 4GEIA 2XQYK 1JTPA 2W9EH 4NKMB 1XCQA 3Q5OA 3FU9A 3DUSA 5G55A 4EIBA 3KPRE 4FQJH 3FFCB 1T66D 5D71L 1KULA 4OCSL 4DTGH 1HL9A 3V4PA 1NCDH 1I8MA 1WUNT 1YMHB 1QTPA 3PWPA 2WVTA 4UQ2B 2GUOB 8PAZA 2ZX9A 1ZLUH 1JPSH 1U2CA 3NJMA 3F7PC 3S4SG 3P77B 4YSCA 2IANA 2VRAA 4R90H 1OAUH 3S5LG 1UVQA 1UXSB 1K8DA 1EQWA 1NGPH 2BS8A 1H19A 2ADJA 3LEVH 1VADA 3SQBB 5E9DB 3WNIA 4JPQA 5HYJA 2BJMH 4MJIE 4E9RA 4RISL 4O00A 2IH8A 4Q9QL 2QGCA 1P2CA 2H26B 4N0YH 4HMDA 3OKYA 3V5DA 1E5ZA 5C0RH 4HKJB 1T83A 2XPYA 5IG7B 1JXFA 2UXFA 3H9HB 3UTSD 2WQAA 2ZUYA 1KIQB 3RVXD 4DOHE 4IMKA 1U3YA 4RGOL 4M61A 4F8OA 1LEIB 2JTDA 3P9MB 2AXGA 1INEH 4DP2X 3L17A 4B5EA 3D09A 3QNFA 5GSVA 3QPQD 7FABL 4E0RA 3GYRA 4D94A 4YEFA 2P8LA 1IJ9A 3RA7L 1IAII 1GYVA 1TETH 2CRZA 3ILPA 2VH5L 2ZWZA 1PYWA 3DJSA 2QEJA 3TIEB 3ASNB 3FCSA 3BSZA 4P8QA 3RZWA 1YECH 3A6BL 2X05A 1XR8B 5FUOL 3TVMD 2EDWA 3DOSA 4JX0A 4OLYL 5DF0A 4LDLB 1HNGA 1HE8A 4GRWB 2BSTB 3E6HB 3MLVL 2P5WA 4OI7A 2AXFB 4M5YL 4EUPA 4B95C 4GRLD 1E8XA 5F9OH 4YHNB 2AEWA 4AIOA 1AQ8A 4GKOA 2JB6B 5HHVH 1VPOL 1OM3H 3V5KB 1QLEH 4PGCB 4L48A 4KJYB 4PJCA 5F1IB 1K2DA 2GJZA 3K4ZA 1LO2L 2I9LB 2BFGA 3F85A 4P4KA 3CBRA 4ZNEE 3EYQC 4G80A 4PWIA 5B1CA 3KYOA 3WIHL 4RGMC 3RPKA 2XWRA 1PKQA 3C60D 4H20H 3O6FB 4NM4L 1UB6A 4GKNB 2BW5A 2HRPL 4PLKD 2WXQA 1XGPB 3GI8H 5JR1L 5EN2A 1ZLWK 4C54A 4X50A 5AW6B 1DSFH 2APFA 2ITDB 3TVMC 3WUWG 2WOBA 3KGSA 1MQKH 3IDNB 3KGRA 3T6VA 1R3IL 4N22A 3UG4A 5KVEE 1CGWA 2W9DH 1HHJB 2WMPA 3U79A 2X4PB 3WKMH 4I88A 4Z7OB 2P26A 3DVNA 4JPVH 2BOCA 3NQKA 1PZUB 1IC4H 2JCCB 4MJ5A 1NFDE 2AV1A 5I2IA 4HH9A 5BUAA 4XNXL 3LKNA 2XKSA 3LNGA 5IMMA 2WLKA 4TQPA 5KJRL 2V7NB 5IV2B 1OK8A 4PJ7B 3BPLB 4R96A 2G9HB 4H25B 4GBXC 1RJLB 2VO5A 3ZK0A 5TH2B 4L8BB 2K4WA 5IHZA 3TBTB 3B2UD 4XODA 3L3KB 1CE6A 4CC4A 1A2YA 3L4TA 3EH1A 1RQ5A 1ET5A 4PI2A 2NUTA 3UBXB 5HHMD 4XX1E 1XIWD 2EXYC 5CFAA 1JOIA 1RAMA 4LU5H 4H8PA 3I85A 4Z3GA 5BVPL 2J57A 3NA9H 3VXSD 3GSQA 3WELA 3N42B 1SM3H 4IGBB 1SZNA 4BE6A 5C0EB 3WIFB 4M1CD 2FR4B 1LDSA 3HVNA 5I8EB 5I5RA 1I9JH 1HQ4B 1WFTA 2NQDA 2JELL 2Z4TA 3T04D 5I1IH 2Q20A 2CGRH 2DJMA 3FXIC 5F0MB 4PAZA 4D0BA 2IWGA 1MREL 5IB1A 1FNSL 5DZOA 1E9QA 3HZVA 4C56B 2XA8L 5DQ9B 1TKWA 1QHPA 4WWPA 4DZBB 4I3GA 4I48B 1JFHA 1HHHA 4FFVD 4EBQH 2AW2A 2NCEA 5E00B 3ZSTA 5JNYA 3WGVB 2GTWB 1FNSH 1QA9A 5D4IA 1LK2A 3C8DA 3FO2B 5EA0H 1HKLL 3GSNL 1BECA 3QJFB 1VACB 4DP8X 2QSCH 3P2TA 1P5UA 3MRHA 1OF2A 2H1XA 4AGPA 1YEHH 4PGDA 4WW2F 5AVVB 4AKPA 1DZ0A 4OLVL 1NTDA 3UTSE 1EXHA 3GNML 4FULA 4NO2B 1OGAB 4F15C 3CZKA 4ZOCA 3HNVL 4W9FC 5ENWA 2V37A 2VW4A 2OXGB 3GIZH 2J1XA 1UYWH 1X44A 3IFOB 1UENA 4OD1L 4P2OC 4QRRA 4D9RD 4X42A 2VL4A 4WI0A 1NAMH 3IGAA 4PJDB 3CCHB 4EDXA 5K9QG 1OSPH 4NQXA 1R75A 4A7TA 4XBEH 1PVHA 4G59C 4MJHA 5IQNA 4H0HB 1WF5A 2V7HA 3VFVB 5KYWB 1GXEA 1WFJA 2ZICA 1UZ6E 4ZT1A 2R23B 3QZMA 1BZEA 4I9XA 3UZEC 2AGJL 4AQEB 1CK0L 2YGNA 7PCYA 2XZZA 4R4FH 3ULUC 3PS6A 1ZPUA 5KAQF 1UURA 3LRLA 4N0FA 4O2CA 1L0QA 1WFMA 4NPYB 1UD4A 2HFGL 5D96C 3U4BL 5EORL 2R59A 4JCLA 1Y0LB 1GTFA 5T3XE 2ICWJ 2YD4A 4KFMA 5GJSH 2HLFD 3V8OA 4EOWH 1EGJL 4F1ZA 1OT2A 1Q1JH 3LIZA 4XO3A 1T5WB 2R9HD 4ELME 5D7JC 1Z2KA 4FLHA 5K1VA 3L3GA 3P73B 1X7QA 2ZPKH 4YLBA 1NUGA 3J2PA 3ZDZE 2XVLA 4GIAA 3I6GA 2FD6L 5LGHL 2FLBT 5GRWA 4C56D 3S3DB 4AYFA 2IMMA 4BRJA 2XG4B 3GKZA 5E5MA 4R8WL 4PM1A 3QUMH 5IT2H 4KK9D 3G08A 5CZVL 5JORA 5GSRB 2ENSA 4MLSA 3F12B 1XF5A 4HBCL 5JIMA 1RZIB 1ZEAH 1YNKH 5JXEC 3N1GC 3QIWC 2ZP0T 4OZFH 3J27A 4EKJA 3MODL 1NGWB 3L5HA 3SOTA 5L7XH 5KVEL 1WC7B 2JNZA 3VD3A 3DURB 2ZUWA 3EO1A 2R0KH 4HD5A 43C9B 1NLDL 5FX3A 3MLZH 4NN6B 1JZEA 5HHOD 4KGLA 3GJEA 2DKUA 2CHXA 5LCVH 3FT2B 3UO8B 1N10A 4WEMB 4AI7A 1E4XH 3HS0B 1E5UI 5C07B 1RZQA 2KUTA 5I30H 1QRNB 4U1IA 1NC2A 3FCGA 3FSOA 3GO1H 3NJHA 2AK4E 4NN7C 4P0DA 4JRXE 3KH3A 1A1MB 3O81A 1WG3A 2YBGA 2LHAA 4DEWA 1N6VA 1RUAL 1YNLH 4ERSL 3VRJA 4IEFB 4YHPA 1BMZA 3ISYA 3ULVD 3MNWB 2WC7A 2HVKA 1CDUA 2IO5A 3PFQA 2V7NA 4F8TA 2APWA 5JXED 1IFHH 1PY4A 3L3DB 1ZVYA 3Q6GH 4P2QE 3VD4A 4PJFB 3ARFD 2DZEA 2J72A 5DDHA 2C4XA 2E4FA 4GKZA 4PS3A 3TA3C 1Q8MA 5HPOA 3WL9A 5BRZE 2QV4A 4FI7A 2VMCA 1MWAH 4FI6A 1GC1L 5D6DC 2K7QA 5INCB 5I1LB 3S5LB 2WXHA 2CU9A 5CILL 1KGJA 4RX4A 1UOWA 3COOA 3I2CH 5IF0B 4PRPD 5KN5A 1KC5L 4KKNA 3UROR 3EJCA 4MXQD 3IPEA 5IJBC 2ITCB 2ZUVA 1IKNA 3E1F1 1MLBA 4FQHB 4HGKC 3ZKMC 4WFHE 3TTYA 1J9TA 3NUKA 3DX8A 5DJ6B 1CICC 3H53A 5FF6B 1N67A 1RLWA 2QHLA 2CCVA 2AJUL 2D0GA 1ETJA 1E28B 3QG6B 1AQKL 1OXYA 2OI9B 2R2CA 4G1EA 3G9VA 4OJYA 4U49A 1A65A 4V1DE 4HS6A 3UXFA 3BO8A 5FYKH 3VD5A 4RFEA 4RWHA 2XSKA 3ESUF 4YUEL 5G4MA 3VFRB 4FF9A 3ALPA 5GS3A 5HHPB 4ABVA 1J8KA 3UDWA 2W80C 3DXAD 5F7YC 2R29H 3LKOB 4UV4L 1LQSR 4WHTA 1WD8A 1FA4A 1SHMA 1QLEB 4MXQC 3TEZA 4WGVB 1XCWA 4BUQA 2BM3A 4PMEA 2CRIA 3S88H 3OKLB 1DBAH 4Y1SA 3STLA 3P02A 4PTUA 1ASOA 5LAPA 1QZ1A 3OKMA 4OLEA 1VSCA 1SOKA 3QQNA 4PY7A 3PDOB 1QFOA 2EIZB 2J6WA 1J8HB 2NNCA 4HPYH 4NQQA 1J10A 1MHPL 4HKBB 5EUOB 3L5WB 4WV1A 3TN0C 2OK0H 3L08A 4HUVA 4F7MA 3B37A 2JKWA 3VWJB 3MA9H 4QXTA 3I02B 3II2A 4AQ1C 1B0RB 4MCNA 3RWJB 2W60B 5DMJB 2BP5M 3WENA 3RYMA 4I5BA 4A2LA 2D4DA 1L7TL 3RFRA 1YYCA 4PG9A 2G0LA 3QQ4B 1EEYA 1PW3A 4YSPA 3KJ4B 2C1PB 3GTNA 1HHGB 2WKOF 3RIFK 1A4AA 5T3XD 1AKJB 1BYPA 3VFOB 5I1CH 4NQCA 1MW1A 2VAAA 5FC9A 4UILH 1MHHA 3ZTJH 3H9HA 1BAGA 2QGBA 4QHLB 4WFEE 4D3CH 3GZPA 3GMRB 3K2KA 1UHVA 5F7WC 2ADFL 2WCSA 1GY1A 2KMWA 3DX6A 2P28B 4Z8FH 5HHVL 1IEBA 1T03L 2YA2A 3CPUA 3L5XH 4ONFL 2FX8H 4YHZL 3NCYP 4ZAKD 4N0FB 3KCPB 4O2CB 1J0KA 4Y1AB 3LS5L 3QDAA 1BAFH 4JQIL 3QJHB 4BZ1L 4LPVA 2KBGA 3VW3H 1RHHB 1IBDA 1CF8L 1X4YA 2VO8A 4LCUB 1OP5H 3RDTD 3F83A 2K8QA 1HYSC 2P8MB 4J5VA 3CC5B 2XICA 1DQVA 1SHXA 2YZ1A 1MCNA 2HJKA 4XBGA 3VD7A 4PP2A 3ULUL 3H3PL 2G9KA 1QSZA 3SPHA 5JO5A 1PKOA 3DUUA 1ZHBA 4OLZH 5EBMA 3VTTA 2CLVA 3P11H 4PYGA 1BF8A 3QUXC 5C07D 3QUXA 5D5MF 1JUFA 2ICEB 5PCYA 4BWWA 1DANT 3KBHE 5GGUB 3V10A 4KHXL 4YDJA 4UU9A 5FYLE 4ZMVA 5LWYH 1EHXA 2FSEB 4JFZL 2AJ3A 3CUPA 3FB5B 2C3WA 2B1OA 1D5BB 3NOIA 1QI4A 3NZ8B 3RE0A 5HGAB 1E7VA 2EDKA 2OYKA 2YPKA 1UXMA 3HG1A 3MOQA 4WJ5B 5BVJB 4HIHB 2O5ZH 5GS0L 1JVOA 1CD1A 1HYSD 2A2QT 3HJ0A 4EMZA 3PWLA 2VN6A 4PJIB 3B2VL 3ARZA 4DGIL 4F8PA 2AK4D 5C0AD 5I1DB 3C5JB 4KPHL 5BNXD 4X9BA 1YAZA 1XCTA 4NP9A 4TUOA 3BPOB 4I0PD 1PD1A 4RMUA 4FA8A 3LEVL 3ZKXB 2CBQA 1HXYA 4S1DD 1MRDH 2VB5A 5CR8A 4BD4A 2BVYA 4Z7WF 2XC8A 2BVPA 3FFCD 1ODUA 5F0JB 5DFTA 1TYJA 2NY4C 4YFLI 4MQTB 4FQXA 3QEHA 3C2AL 1T20A 1X5JA 2ZXQA 1ZXKA 2W0FB 4W1TA 5DJ8B 4RGNB 3R0MA 1DVFD 4Z0BL 4Q6IA 4P46B 1IGJB 1GZQB 3MBWA 4L4TA 2VSCA 2W95A 4MKTA 1D6VL 1EEZB 2DEXX 4LRIC 4PS7A 1QTSA 4UIMA 3MNZB 4KNTA 4YR6A 4W6XB 1ZHBB 2BSRB 1HQRA 5CGYC 1MQKL 1CXHA 1FFOA 4YGVA 2H45A 4LHQB 4NRZA 4PRIE 4XPBL 4YVNA 2LTQB 3JBG7 4L1HA 1K2DB 2GJZB 3D0VB 1BXVA 3B9DA 3LRMA 3TEWA 1U8CA 2A4CA 2VWEC 3NZ8A 3W81A 2FHCA 2R27A 4DKAA 3HPLA 5DZLA 3AY4A 1EMTH 4UQAA 3AY4C 1LDPL 5IEHA 1WSST 4M1GH 4WWKC 4K94C 3SCMA 5ANHA 4BHUI 4K73A 2XVBA 5D2LA 3KR3H 2EH7L 4QYAA 1V7NH 4YO0B 4Y9CA 2FJHB 3KWXA 3V9FA 1S9KC 1CGXA 1UEYA 5DR5H 4AXWB 3DX0A 1F42A 3OQRA 4GRLC 5IGXH 3ZE0E 1WITA 5FGRA 1C08B 4BM7A 3WDHA 4TNFA 4QRUA 2CO2A 1ZLEA 3SB3A 4PJFF 3H4FA 3ZL1A 5CZRA 2CA3A 3EYQD 4HK0B 4X6CF 4LDCA 3CE1A 2WXIA 2G5UA 3EXLA 3GHEH 4V2CB 3X3FL 4A2HA 5EF3A 2K9FB 4I77H 1KJMA 3JYCA 1I7RA 5F7MC 2VZVA 1IM9B 5IMLA 4FMKA 2VM4A 4PCSA 4HUVB 3DO4A 3P77A 4YHKH 3LHPL 3QNZB 4QOKD 3KLLA 1NOAA 4HC1A 1B6DA 3SOBH 4JG0H 3RWDA 1RY7B 1FP5A 1HH6A 3UG5A 4K2UH 4EN3D 3D39E 2YN5A 2D2CC 1M05B 3SOBL 2EVJA 1KY6A 2VC2H 1BIHA 2C4FT 1AQDB 3ZQXA 4AWJC 1S7QA 3C6EA 4KH9A 3FPXA 3QQ4A 4KKPA 1ZTXL 4Y5YA 2WXNA 3WDJA 5A40E 3DXAB 2BIPA 1HKLH 3GSNH 4N5EC 2XV2A 4GMTL 1CR9L 3B3BA 3BEVA 5CEZD 3MLUH 4Z7WA 4LNRA 3BDXA 5C0NC 1ADQL 3SCMD 3FO9B 3MRJB 4GBXD 3FONB 3LN5A 4X6FA 2MOQA 4KX9A 2Z31A 3O3EB 4ZQTA 3TNNB 3FC8A 1NC2B 4TNWF 1VGEH 4G6KL 3PHSA 5H4YA 2ADIA 3PHOB 3FN3A 2FJHA 3BGAA 4GAYA 4TVSa 3AQDA 4X4MA 3ETTA 4XTRD 5C07E 3GSUB 1XWVA 1BFOB 2X3CA 4FQLL 1Q9LB 4U3HA 4BJLA 4ZMXA 1GH7A 4F91B 1KN4L 1JPSL 2JXMA 3QH3B 5I74B 3WTWA 1TMQA 4O4YL 2EXWC 4OCYH 2O30A 3ARGA 4PRPB 3DUUB 5IVXA 2CJTA 3CGTA 3MLXH 3QIBB 4F27A 4AY0A 5DMKB 5JIIA 2YQ2A 4U1KA 4F15B 5BRQA 5E6YA 1JI1A 1HL8A 2QBWA 1R33A 2AQ2A 3CFJA 2Y22A 1LO4L 3MRGA 4M3HA 2P80A 5F7BA 3T0BA 4WU7B 4XPHH 1B2WL 1MKFA 1SMOA 4JM2D 1ZWIA 1WD9A 4H25A 1DJGA 1GGBH 1JZFA 4N8CL 3STZA 5ETUB 1BSIA 3L3DA 1I1AD 3ECVA 1MI5E 4YK4B 3EOTL 3WN5A 1MWAB 3MROA 4IBUA 2WTPA 3CVBA 3VX0A 3H56A 3VI4A 4UTBA 1BF5A 2OJ1A 1LE5B 2ATAA 4ODTL 3NZSA 1QPKA 4P3CL 1CD1B 5IUCA 1EHLH 2IOOA 4ZFZA 1IAIM 4G8GE 3STBA 3U4AA 1G1OA 2OR7A 2BW4A 4FE9A 3M45A 4KV5E 3VXPB 4ZX6A 4ELMB 3CZUB 3VFNB 4QLRA 2JJSC 3IU3A 4TSBH 2X9ZA 4OFVA 4NO3B 4MS6A 2FWLB 1TO4A 4NPJA 4CVWA 3AXIA 3ILQC 4QWWD 4YXKH 1QUNA 3H0TB 3GS0A 4J3VA 1UWGL 5JUEL 5D72L 2OJZH 3LKRA 2YBRB 4FZEL 4BEIA 3CZSA 5KYYA 4GRLB 4FJ6A 3UBFA 4LEEA 1VGKB 3LTVA 1MRFL 1NMBL 2IIJA 2J5LC 3DYPA 4LOUC 1EFXB 2PYED 1I1AC 1XB8A 1WH0A 5LBSA 1QBLH 2NX5D 4KRPD 4NNXA 2DEYX 5A7BA 4URTB 1ZVNA 1H9VA 2C9SA 5FUCC 2HT3D 3DDGA 5BRPA 3OKMB 3BVUA 2XN2A 3DJTA 1VAHA 1FF5A 4GEJA 1I82A 3K74B 2GC7C 2VKXA 1FIGL 3RVTD 4Z7NB 1KTBA 1NAKL 4PH8A 3EJQA 5GGSY 1LO3L 4WENB 4M6OH 4PJDE 4LEXH 5CO1A 2ZJSL 2QKIA 1DVXA 1H6EA 5DEFB 3BAKA 4ACTA 4FQQB 4N9GA 1M6OA 1DL7H 2FWOB 2FIRT 3FAXA 3UAJA 3GO1L 3AU1A 2EVFA 4PJBB 4NAMA 5IFJA 3RX7A 2CDFB 2V2TB 2PP7A 2F5BH 4ZFOL 2VUYA 3BKMH 1S7SA 4JY5L 4AE1A 4JK0D 4QR7A 1A5FH 4G42A 4UNUA 4EI5A 4U3CA 1EAPB 3NFNB 5I0VA 5AOIA 3CCHA 2WJ5A 5F3HA 2QT6A 1XSKA 1WTLA 2HT3C 1Y6NR 2HRHA 4P2RB 3WG7B 4BSWA 5DJ6A 1UJTA 1O7DE 2E27H 4HIEA 3Q06A 1TSHA 3W9EB 3NCJH 4QTFA 3KM2A 1QFWI 4HWZB 1EAOA 4JW3A 5IJKC 1LEIA 1GCYA 3C5SA 1ZTMA 32C2A 3MV7D 1E9QB 4ANXA 4PCYA 4BGDA 2HYMA 1IKOP 2XFXA 4HDIA 1YYLL 1X5FA 1MCHA 1S9XA 2VQ1A 4MA3A 4YN3A 4WKXA 2G2RA 5MEQA 1KYDA 1OCRB 4QRRE 1MWOA 4TKWA 4NPYA 1VACA 3VI3B 1QRKA 2AERT 3MCKA 3BIKA 3D9AL 3GZQA 4JJHA 4RISH 1H3PH 3ZRCC 1FFPB 2PPDA 5FOBB 2FJFA 5IKCA 1BJ1H 4PBDA 3X11B 3RAJL 4HXBH 3ZO9A 3L3JB 1AD0A 2CRYA 2MCG1 1G6RH 4HCRL 5JPNB 4XMVA 3V0VB 1OCOB 4XNMB 4X6CA 3AFLA 4S1RL 1P4IH 3L16A 4ANUA 4Y5VC 2VN7A 4FXGB 2BO0A 2QTEA 3HC4L 5FO2A 4HWEH 3W5NA 1ADQA 5LLIC 3PP4H 3ENEA 5I8EA 3WHXA 8CGTA 5DUJA 1XGYL 4MA8H 4BELD 3H2QA 3DX8B 4MQ7B 3BQUC 1IQWL 1U3HC 3NBNA 3REWB 3LKPA 3W1ZA 5EC2A 3D3VE 1G7HB 2W65B 1A3QA 2QQNH 5T1LB 3ALWA 5DMGC 5DYOA 5B39A 4U6HB 1CI5A 4J3OD 2JCCE 4RIRB 5IB3A 2EZ0D 2XRAL 4ZD3L 2BP0A 1OTUC 5DYFA 1KGCD 5C7XH 3MYJA 3QDJE 5T33L 1H5BB 1TTCA 5CGTA 2VKWA 3HG1E 4LLAA 3HC0A 4J3OH 2P7TA 4RFOL 5BO1H 2YSSB 3BVXA 4HFWA 4LKXB 4MS8C 4PJAB 4QY8A 5AW3B 2IPKB 1EZLA 4B9PA 2YFNA 1MUJA 4MCZB 2VAJA 5A2KH 2ODHA 1EH9A 4G9DB 2CO4A 4GG8B 2GK0A 1E9OA 2NCMA 2AV1B 3O2WL 3PIQA 1VFUA 3SKJL 2JWYA 1AZBA 1ECZA 2ESVA 4KC3B 4PN6A 5IW6B 2DJSA 3KPSB 1IGFH 7TAAA 5ACMA 2V5YA 3DX9A 1BQHA 4L8SC 3BE1H 3GMLA 4KTDL 4MAYC 1RZKL 1DLHA 4PBWD 1S7RB 4MLIA 3O0RH 4GKSB 4LPUA 4BQ9A 3WL9B 2B2XH 2DI8A 2CDEA 4NBZB 3G6JF 1U3JA 4LLYA 5JZ7C 1XF2A 1WWWX 1J5IA 5I1HH 1L9QA 1XX9C 5AWNH 1BG1A 1N2RB 4OZFA 3NDZE 1P4BL 3ECQA 3QAQA 3RVUD 4BZYA 4DN3L 1PKQB 4ZTOH 4XMPH 1WBXA 5EU7C 4U2YA 1KLFA 2ZF9A 4AM0Q 5SWSD 2IQAB 1KY7A 4UZUA 4B97A 3ZTDC 4AZUA 5BVJA 2QTVA 3K6SA 3VD0A 1M4KA 2BP0B 5SX5H 4YL4A 4CVXA 1F13A 4N8VA 2FE0A 4XP6H 3N50A 4F24A 1M2OA 2VUKA 4JFOB 3QXTA 4GBXB 4GSDL 2JMRA 1IGIL 1XGPA 1DVUA 4MAYD 1SXAA 2ZAIA 4KK8D 4WV1C 3LH9A 3TN0A 4N6RB 3CFCH 4QY8B 3AACA 2E47A 5DEZA 3VG9B 5DD5L 3TO2A 3T0ED 2IPUK 1F5WA 2F1EA 1RKRA 1BIIA 4AK2A 1CBVH 4WW2C 2WCPA 3KE0A 3RU8L 4OM0L 2DMBA 4FC3E 1CXIA 2K78A 1IGYB 3BH9B 3WUZA 2CHDA 5E8EA 4HKXB 2PW1B 2TRHA 4AJWA 5L8KB 2XIIA 3O8XC 2DQEL 2K6YA 3MJ7A 4LAQH 4QO1B 4WZ9A 3P2DA 5CZVH 3L5JA 4OF0A 5B7FA 3PHQA 4PJAE 1NOLA 5CBAB 1ACYH 4W6YB 2AJSH 1P4LA 4GSQA 4XOAA 5DHMC 1YNKL 2BY3A 1AS8A 2GSIB 3DRQA 4G42B 1JZJA 4KU1A 3IXAA 1CXEA 5HYFA 1Y7VA 1A64A 5GZOD 2FBRA 5F9WB 2YMXH 1RD6A 2N1KA 1C5DB 4GP8B 4XE0A 3SKOB 3T0EC 1C5BH 4LPCA 5GRZA 5C9JB 2I60L 5EU6B 5B4MC 1XH2A 5BS0D 4KH2A 2WXFA 1MNUH 4NAQA 3RNQA 4B9YA 1KDJA 1AC6A 1TFPA 5LWYL 1MH5B 3D5OF 4AENB 3BD4A 3L7EA 4JFZH 4FXKB 5L2JB 4ERSH 3NGBB 4G9FD 1I1FA 4XRCB 4APQB 4IIQC 5E6UB 1HFUA 1I7TB 3P9WB 5DCCA 2EE2A 1U8IB 3APFA 3ILPB 4FZEH 5KS9B 3H2PA 2F74A 4YDIH 4OZ4A 4LLUA 2MQ3A 4Y16D 3ZTEA 4XWGH 3ZL4L 1XGUB 2W59A 1J8SA 1GZQA 3LD8C 5I5MA 3Q9PA 1CB4A 3QZWG 1XXDC 5HGDA 3BEWB 4JQIH 4ANWA 1BFSA 2LFEA 4FI8A 4H8VA 3W37A 2GJ6B 2OJEA 4PB0H 1QO3B 4HYTB 1MCOL 3QW9A 5CEXB 4OGAC 4UTAL 5F88B 3R4RA 1CFSB 3VNZA 4BINA 3FUIA 5LDSA 1U8NA 3F62A 2OMUA 15C8H 1AACA 1TVBB 3FSWA 1WWAX 2B20A 4K7PY 4KY1H 3FTVA 3WE1A 2O5XL 2V8MA 5EWIH 5DRZB 3EZJB 4UB0H 1IAKB 3OPZH 5C0GA 4XP4L 3M7OA 4P05A 4G6MH 3SDXE 4YPGA 1FZKB 2EH8H 5DD3H 3VI4F 1MY7A 5GXBB 4EQ3A 3GUTA 1RZJC 3CVHA 3QIBC 1VF5C 4FNLL 2HVJA 1QFUL 4DP4X 4DO5A 3QFJB 1EJOH 4E5XB 4L9DA 4FNSA 1MAKA 3N42F 4J8RA 3EJPA 4ZFFB 1XCXA 2OW6A 2ZZUT 5E94B 1HAUA 2NW3B 5JOFB 3U0TB 3ULVE 4MB1A 3QWQB 2DI7A 2X4NB 4OGAD 4R7XA 3CK0H 3FZUD 4LARH 3S4SB 3P11L 4E41E 2V5RA 3P2BA 1JNHA 3A67H 1XCQB 2DWYA 2ZUUA 3RGVD 5LKNA 2IPKA 1MLCA 2FX9H 5GGVY 5GIRA 4OM1L 1UOKA 5AQ0A 3RKDC 3Q7JA 5K9OA 1QX1A 1NCNA 3JWNC 4L0ZA 1YN6B 3RVVD 4NRYA 3RKPA 3B83A 1LP9B 3THMH 4KNQA 2CJ3A 5HHXH 5E6ZA 1VESA 5F7KC 1GGYA 5C7XL 2H6PB 2HLAB 5FV2A 3IB4A 3F7YA 4K71B 4KKBC 5FYKL 1HTYA 5IHZB 3KLDA 1YYML 3QIBD 5I1CL 3BISA 2ZXCA 1SJVA 5ESAA 3MROB 1H3VA 1MELA 4TNWK 3K2IA 4P57A 1R0AH 5I30L 2E7DA 1UQSB 1A6TB 1G87A 4BV1A 1XH3B 4LVNB 2ADFH 3LZPA 2HG0A 3N9GL 4D9LL 3D0AA 1T83C 1RU9L 2DQIL 3LVTA 4W9JC 3CLEH 4NQEA 5EFIB 1NCBH 2VSDA 5D1XE 5D1XC 3B7SA 4XBPA 3B2PA 3DVIA 5FWQA 1JAEA 3L2NA 4FADA 2FECL 4EN3C 4QGTA 2ZTBA 4MVBC 1EJ6A 2X7LB 1OY3B 5D4QA 5T1MA 2NY3B 5ADPL 4LQ1A 1JZIA 1KIUB 3IDIB 1KN2H 3JTSB 4N5ED 3MLWL 3HBQA 5FYJL 1CYWA 2OMBA 4X5PA 5B3SB 1S7XA 3BH9A 1Q0YL 4MCYB 3AMKA 1TZIB 4GMTH 2VSKB 4O02A 5AENA 3IU4H 3MRQA 4UBDC 4XNYL 4ZUWA 3ZGIA 1KYOK 1NGZB 1GZHA 5LVEA 4JG1L 1MFAL 3UTSA 3QUZA 3RX8A 2XWEA 3FQNA 1UATA 2FWSA 2AXFA 1SGKA 5CCJA 3UPAA 1PF3A 2BY1A 3SJVB 1O9WA 3MRMA 1E3XA 4UM9A 4KZDL 2WLNA 2VN5A 4I3RH 1OPGH 4HK3J 4KDVA 4KAQL 4OLYH 2F8XC 1C1EH 1F1DA 2W07B 1JF5A 3HC3H 3UTTB 1AOZA 3E6FB 4FYRA 4JMXA 4QRQB 2DLEA 4AQ1B 1FZMA 1C5DA 2WZ6A 3RZCD 3QUMB 1WFIA 4N2FA 5GZND 1MFUA 1T6BX 2E6QA 3VFVA 1XH0A 5CD5C 1F8TH 3ZRSA 4ONHA 3N0AA 2IH3A 3FSVA 4NQXB 4DIXA 4AG4H 3DXAE 5DJDB 4WUKH 2Q86B 1KWKA 4LNRB 2VSMB 4O2EB 2VM3A 4UBDD 4P46C 5CAYB 3ROOB 5CD3A 1RZJH 4HIEB 1DQML 1KTRL 4XCEB 1B0GA 1FPTH 1T1ZB 1MXGA 4UDTA 1IEBB 5KG9A 1ZE3C 1JPGB 2WKOA 4L5FH 5HYEA 3QEQB 2RJMA 4AEHL 3T3PF 4RGOH 2EDNA 2R29A 2FUTA 4OSUH 4HLEA 4XNBA 4YNYA 4HULB 3CDCA 2WBKA 5F3BB 4YSTA 4CKQA 2GK2A 4PRBA 2EEDA 1IM9A 3IFLH 4QRPD 4F58L 5IMLB 1M2VA 4QJ3B 3GSWB 2HPTA 4HUUB 1BGXL 2BNQE 2C5DC 3MV9A 3QZNA 3VGFA 1DQQB 1BQRA 2OX5B 2ZSVA 1OLZA 4OF8A 3ZZQA 4IJTA 3TBWB 5JPMA 1RIUH 3E2HB 3PXLA 3NJFA 2YPVA 3OR6A 3CXFA 3HLAA 4P46D 4TNGA 4G8IA 3RWJA 2WBXA 3BOVA 3HHSA 3NFSH 4HGMA 2H2SD 1O6VA 4JQXC 4MSWA 4WU7A 3V4VA 4FG4A 4L2YA 3QWNA 2Y1VA 3ZE0B 1NL0H 4KRPC 4M43H 3ZTJG 4OTXH 3APDA 4RZCA 4DK3A 3HHRB 4RAVA 1KLFB 3DX1A 4S1SH 2AJ3B 3U7WL 3FHEA 3UJIL 5C0CB 3GC3A 1UA6L 4RMVA 4KK5C 2WLIA 3PV6A 3ZDWA 4AIXA 2I85A 1IGMH 1DUYB 4WTZA 4F8NA 5GRUL 2DKSA 4F2ME 5I17B 4JS7A 1UEMA 2WTRA 1NJ9A 4OVVA 1KFGA 4YBLC 4NGHL 5T5NF 2ZYSA 4LL4A 3OTTA 1T22A 2E0PA 5I8CA 5KTEH 4NZ8A 4TYUA 4QTHB 3HIZA 3T4AA 4IMKC 4PRNB 3KJ6L 2DMKA 2PYEB 4B50A 4PVMA 1MCEA 4MB3A 5IREA 4JRXA 1AKPA 1U8QB 1QRNA 4OFYA 4U1IB 4Z7QE 1E27A 2DYSB 2COQA 2P5EB 4MXVF 4E9XA 4LPYA 5I8KL 4WTWA 4ENZA 2LU5A 1YSOA 1NCTA 4RETB 3UX9B 1IKFL 3IS1X 1WS7A 2YPLD 4TQHA 4YC2B 1HSAA 5DJ0A 3B2DC 2QQNL 1YEWA 5FO8B 3VNYA 4KHTH 2CCLA 2N59A 3FRPG 4W9EC 5FFGA 3NSJA 2B08A 3UCRA 2YPLA 4BQ8A 1GZHC 1DDTA 3EO0B 3F7KA 1L6XA 4L1BA 4PP2B 4HQQL 3V5KA 3ZMEA 3RL1B 4GQ9H 4MRCA 1CE1H 1CICB 4U1NB 2DQHL 5ICUA 1QP1A 5FO9B 1UWXH 5JW4M 1QHQA 1BQHG 4XR8C 1AR1C 1B3JA 2G5RA 5A7EA 5D1ZC 3DTXB 3ZUCA 5BS0A 3TWCH 4YSUA 2F53B 4H5SB 4P2QD 4TTDD 1ILUA 1RZGB 5E8DL 4BK5A 1BMWA 3CFDA 1ETZA 2CM5A 4G6KH 1HIML 4P23A 2XN9B 4M4RA 5L2KD 4IRSC 1A14L 3UBGA 4FCAA 1A47A 3V0DA 2P8PB 4AUUA 4G5ZL 5K69A 2F54A 4N0RA 5FK9B 1FL3A 3V0WH 4G82A 1DLFL 1FFTB 2V17L 3C5ZA 3X14A 3ZE1E 5IQMA 1HWHB 1TMCB 1LILA 1PU0A 1RUPL 5EU4A 3V52H 4Y9FA 4U33A 1II4E 3O2VL 5GGSB 3B6SA 1R5IB 1F4XH 5A2JH 1H8SA 2X3BA 4Y5VA 3TU6A 4DP1X 7CGTA 5T1KD 4TV3A 4NZFA 1I7ZB 5AWNL 2LVEA 3DO3A 2JQMA 4XPHL 1TNMA 2VABB 5D1ZD 1HESA 4L37B 3TBBA 2XPZA 5EIIA 1RJYA 5MEND 5GS2H 1CG9A 2WNKA 3VWJC 4DP7X 3AG2B 1DFBH 4AKOA 3QISA 5KS9A 4MXWL 5D7JA 3TPUA 8FABB 2P47B 3E38A 2GTQA 4DP5X 3QNZA 3PPSA 3HI5H 3BLPX 5EIQA 3D85A 5HDWA 3ZOAA 1Z9OA 4KKRA 3HRZB 3CU1A 2N0KA 2CIIA 1GA2A 2BOBA 2EAEA 2VLRE 1VGEL 1ET7A 3EJRA 1WE5A 4FYTA 3I6GB 1AYRA 3KDPB 4GAFB 3C87A 4JPIA 5HGBA 3TURA 4QXTB 3P30H 3QI9D 3HCVB 1XSIA 1S3RA 2ZXBA 1Z9NA 4HKZB 2VRKA 1KCWA 4HZ1A 5KWYC 1THAA 1BZ9B 4FTVB 5F7NC 3BAIA 4NP4H 1AI1L 4QHLA 1LQBC 3SKJH 5FK9A 4HEME 3F2LA 1S9WA 2A74C 3AAZB 3L4YA 2O5YL 4M6NH 1JSYA 1WAAF 3VXOB 2ZCKH 1G7IB 1UD5A 2IAMD 4Z3TA 2AMGA 3ARRA 2EEFA 1I8LA 3P1VA 4J7RA 4GAJH 1ILSA 2QV2A 3QYCA 4PB0L 5HDLA 5IM7B 1DVQA 4Y89A 3CHXA 3S98A 5E00A 3ROOA 2VIRA 5CD3B 2W92A 1N8OE 2BRRL 5ANMB 3VTMA 1JYWA 4X6CE 3VFPB 2PO6D 4HHGA 3S37H 3CD4A 1FFQA 3MRNB 4R7NA 3VFWA 3IETB 2ZXGA 5D7IA 4JZNA 4R97B 3ES6A 4Z76B 1IGYA 2QADD 4FNQA 5IVNA 5GS0D 1OSZB 1RURL 1TPXC 4S1RH 1NDGB 4N2NA 3CHPA 1DBML 4WEUD 2X4QA 1WQVT 4PJHF 3WTXA 4I2XE 4XMLL 3CN2A 1DSFL 1ZK9A 4Y4FA 1F56A 3BUIA 3MLSH 5EBMB 1IL1B 2PLTA 4GW4B 3Q44A 2DDQH 4PS4H 4GPVA 3OR7A 3HBPA 2YS4A 3MGOA 1FG2B 3H7LA 4MX7B 4V1DB 3QR2A 2FGZA 2LFGA 4EIGB 3DBXA 3RX5A 1AZRA 3DIVA 5LAXB 4LPTA 4AM0A 3CUPB 3FB5A 1QUPA 1DQLH 2J43A 4NJAH 5FYLH 5TGBA 4B3VA 4AQ8C 1RZ8B 5A2FA 3CMGA 5AZUA 2IV9A 3O8XD 4AVIA 5GGRA 4FZ8H 1WA0X 4S10A 2MPAH 2IWKA 4K5LA 3MLXL 4Z9KB 5ELIA 3SD2A 5AVTB 3MBEA 5E8PB 1FNHA 2ESVD 4NO5B 1ZA3B 1LO2H 1P4BH 2HUEA 2JQAA 1SY6L 4BFFA 3KLHC 2NX5E 3ABGA 4HUWB 4PUBH 4EE2A 2X4PA 3CN4A 2HRLA 4Z7AA 1ZLSL 2DL2A 2H0JA 4LHUG 2DD8H 1MAMH 2IMNA 3X3FH 3WLWC 1OB1B 2PWEA 5D7IB 2VOTA 1DDHB 4ODBD 4XZ4A 2VR8A 2YLHA 2VDLL 2O6FA 2DM7A 3MGTA 3CSBA 5FYJD 1GJUA 2VLJE 2D03H 4MNQB 5AALA 4A37A 1DJHA 3MXVH 1A21A 4X5XB 2WYHA 5FYKE 4ISVB 3TO4B 3L3GB 2APBA 1BCIA 3NABH 3P73A 1FUNA 3OPUA 4KQ3L 1FYTA 4G8GD 4OCXH 5EUOA 2NZ1A 4NHUB 1G7PA 2OZNA 3NIDB 4K71C 5EEWA 3LHAA 1AIFB 3OD3A 5GSRA 4P5KA 3HTLX 5FCUL 1VCBC 1P9MA 3E6FA 4QRQA 4AQ1A 3BP5B 4UTBH 3KCWA 2OSYA 5F44A 4U4IA 5T1LA 2ZCLL 3SJVA 2YRZA 1KBBA 2HAZA 2Y3NA 3CDZA 4NENA 1SJHB 5LG1A 3SCMB 3TESA 2AS5M 5DQJA 4J6IA 2OSXA 4P2YA 4N2GA 3R18A 3MREB 3VH8A 4IJ3C 1QEXA 1FRGH 5I5JA 3HLKA 3PJLA 1RZIA 4FX5A 2R2HA 4TUJA 2R69H 1R5WA 2CA4A 3WNKA 2D8KA 3VSQA 3IMRA 3N41F 4MAZA 1NBCA 2HH0H 1CPUA 2Q6WA 3S48A 2VDOH 4HOWA 3Q2CA 1B0GB 4H0LC 1I7ZA 2ARWA 2VQ4A 5GQBA 1XGQB 4FXGC 1ZANH 3PG2A 2JKJA 4GUCA 3TBSA 4ODUB 2YAPA 2A9NL 1K8IB 4FFTA 4X80L 1AE6H 4S0HA 4UANA 3HN3A 3FAWA 2OMYA 2UY7B 4JFSA 4UTCA 2UYLB 1BDYA 1EANA 3AABA 1UT1A 4J3UA 4TVPE 3FS9A 5J4MA 3AGVA 4D9RE 4P07A 2X4UB 3D6GA 1CG9B 3TVMA 1QQDA 4KMTL 1ZGLA 1KPVB 3ARDB 5AL8A 4I4WB 1DQIA 1YNTA 3SHSA 2YKLH 1P5UB 3MRHB 4PLJC 3IKCA 1YJDH 2P52A 4KVCH 1BJ1J 1ZPLA 4QHNB 2N1TE 4JPIB 4AC4A 4LSSH 3WJJA 2Y9RT 4OI8A 2MRYA 3FOLB 2BOBB 2ZKMX 4ZMWA 2X28A 1FAKT 2QLYA 2WKGA 1RULH 3LMJL 3W39B 1BAWA 1QR4A 5HHXL 3RWCB 4QOKE 4BA8A 1KB5B 2VR6A 1MFBL 1GW6A 2R23A 3MX0B 5EOTA 3WXWL 1F58L 4BK4A 3O6MH 4OM1H 1I85C 2F61A 3MJGX 4FN0A 3ARBA 1P7QB 3LH2H 1V54B 4YL9A 3ROLB 4RNRA 1HQ4A 3DC0A 3CDGA 1JHKH 3MREA 3QRGL 5CHNB 5H94A 3VH8B 1CVSC 3LEYH 4KKBD 1PG7H 3SDCD 4AMKL 4OIAA 5FHAH 5AW5B 5DT1H 3INOA 3MBXH 4QHMB 4IBTA 5AOLA 1AD9A 3BH4A 1TKWB 2BOCB 5IJVB 3KBPA 3DIFB 3F7VA 1DJYA 3N1FC 2QPDB 3DVGB 2QFRA 2EH8L 5DD3L 3MRQB 4ZUWB 3T6WA 2TAAA 2FT8A 3T0EB 1AGDB 3NK3A 3IRPX 4R7NB 1XMWA 2PETA 4JEGB 1BAFL 3U0WH 1FCGA 3VFTA 1PKQE 4MMYB 3PWVA 2GVYA 4ADIA 5I8OL 4GS7C 4Q6IC 3ULUE 4TVPL 1T4KB 1CLCA 3KPPA 1IE5A 2NXYD 4Z18A 2DMCA 2Q76A 3ARDC 3F6IA 4QCIA 3KPOA 4Z7QB 4F1SA 2IBBA 1IGJA 2C9PA 4L5FL 5KVMC 3FUDA 1ZWIB 4K15A 4MA7L 1ZT4B 1Q0YH 4TN9A 1JRHH 5IVZB 4HSAC 5I66A 1W9XA 3WNMA 4UAOB 1JD7A 1GC1C 3KPSE 3CFKA 1AXIB 3DJRA 4RAVB 3AREB 3JVFC 5CUSL 3H6JA 4Z0XA 4IHOA 1Z5LB 3LN4A 4IHBA 1UM4L 4V1DD 4WW2B 1Z6JT 1EEYB 3RDJA 5ID0A 5LN8A 3QUML 4HMEA 5IT2L 1HOEA 5I75B 4QD2E 4FRWA 3LV3B 4I9WE 5DU7A 1AFVH 3KWUA 1I1RA 3NJGA 2PCXA 5HD8C 5GGRB 5SWSA 3BWSA 3IJYB 1YY9D 4E5XA 1J9RA 4PJGB 4WUUB 3OKNB 1RU9H 3POHA 2YC1A 4L8DB 4AIZB 2PYEA 1LJMA 4QKXB 1A9BA 1FLRL 1WAPA 2IFGA 5CLWA 2EO7A 2FAUA 4PJ7E 1O6SA 3MRCA 3ZX1A 2BNQB 2MCPH 2I07A 3WIHH 3G5VB 2BX5A 5E6IC 3BX7C 1BD2E 4JO4H 3MV9B 4LCWB 2C9QA 4DPRA 1QR1A 1R5VA 4RDBA 5ENWB 3BI9X 1KLGA 1DFXA 2J7LA 4OB5H 3W2DL 3E0GA 5HHQA 1ACXA 2CR6A 1KXTB 4ZXBA 3VFGH 3GQFA 3MLYH 1A9VA 3U1SH 2CH8A 1UWYA 2ZG3A 1EIBA 3D18B 4HCIA 1QAWA 1K3IA 2J55A 2I7SA 3P0YH 4ZTPL 3VXRA 5FF6A 5E9DA 5HGBB 5IMKA 1FBIH 4J3TA 5JQ6H 1PZAA 2VDRL 1QMUA 4MD0B 3AREC 3ESVF 4RMRA 4NB7A 1HL4A 2ITCA 3E7JA 5FM5O 4G9FE 3BCDA 4NUJB 4U6XA 2OMWA 3UTZB 2FWUA 1YY8A 1T4WA 4O2FB 1IZKA 3QI9A 4OUUB 1UWEL 3K72A 4JFUA 5IQ7H 3P4OA 3MJ9L 1BVZA 4HH8A 4WCYH 3HAEA 4NZRH 5TF1H 5CCKL 3AADB 1OTSD 2G60H 3UJTL 2JLLA 3ZE2F 3DUSB 1JTOA 2HMIC 1JK9A 3MJ9H 3S97C 1LXMA 3RJQB 4AMXA 4Z3FA 3JT2A 4R7DB 4PWJA 4PW3A 3F05A 5TDOA 4GQRA 4A63A 1HIMH 1NC4D 1RJZA 3FTGB 5F93C 2XY1A 3MRRA 3CTTA 1ZHLB 2D4FA 3IMVA 1KN4H 4P5TC 1RLBA 1E3ZA 3K5RA 3AS1A 1V7ML 3L5WA 2WW8A 5I1JL 4PI0A 1E4XI 2BJML 5JW4R 4PGDB 2ADGB 1UJ3A 1KXTA 3L4CA 4PLKC 4YAQB 4DCQB 1AD0B 1ZHNA 5HGHB 3CLEL 3S37L 2QFPA 5EDSA 4JRXD 4K3EL 3NGBC 1NICA 2FEJA 1AP2A 2IH1B 5GGRY 1F1AA 4AEIL 3GI9L 4PRHB 4KMLB 3PYCA 3G5YA 4OIFA 3GUFA 4PLNC 3SDDC 1UCBH 2WBWB 4FQPA 2QQLL 1J9CT 4NO3A 3ULUH 1OOWA 3ARYA 4XWOC 2ISDA 2YD7A 4ELMA 3OHXB 4JFYA 5ESQB 3QIUC 3RGVB 5C2BL 2JKIS 1YY8B 3K1DA 2EO1A 4BFGA 1D5XB 1V3MA 4MJIB 1KEML 3ILDA 4NUJA 3DSNB 3ZZSA 1BXXA 2ZG1A 1U8KB 3M6DA 1JPEA 1NGYA 1GR7A 3M07A 4GRLA 3ZHLA 2BFVH 1IKNC 2LTQC 4LCVA 3GSRB 1H3TA 2AJYH 3FBQA 4QRTA 4MMYA 4JREB 4GG6E 2O61B 1MFCL 3C8KA 4M00A 2EIBA 3W5MA 4R2GD 3CFNA 4IRSD 3TZVD 3RTQB 2P5ED 2R8SL 2KYIA 1U2HA 4DVBA 3KYMA 4GFTB 2AJSL 3MCG1 3O41A 1MCIA 1G6VK 3QDJD 3RPIB 2J8UF 1KCRH 4JFFE 2B2XL 2OL3B 3L3IA 4NOBA 5MI0B 1K4CA 1R3LB 2EADA 4RGNC 5FYJE 1NWOA 4MAUL 1VFMA 1FAIL 5IMMB 4PR5A 2HT4D 2OL3H 3E8UL 1HT6A 3B5HA 2Q76B 1PZBA 2DM3A 4GYBA 3D08A 1QFUH 4WJKB 1TEGA 4LQFL 4M7JL 4ONHB 2R0ZL 3VO0A 1N7MH 4KO7A 3WLBA 4XE5B 1LWHA 3TT1H 1AZCA 4Q4EA 3DO7A 5BZDB 4AL8H 1QG3A 1PD6A 1IJNA 4NC0B 3UYRH 1HH9B 4YX2L 4R2GC 3UO1L 5HBBA 1Q1JL 4OF3A 5FS5A 4U1SA 4B9IA 2OMTB 3HB3B 2Z1PA 2KLTA 4UNVA 5EN2B 3O0LA 5IM7A 2Q7YB 5DMYA 4ZSOE 1E5YA 4CBPA 2XXMB 5C86A 2ZCZA 3AG4B 1BFOA 5JLZB 2AVGA 3CZGA 2PABA 3EO9H 3D8MA 4K5PA 3PWNB 4PWEA 2HXAA 2ED8A 4HT1H 2C8NA 5F7EH 1T1WB 4EEEA 3T77A 1NM9A 1GGCL 1PTZA 1T04A 3B34A 4NQSA 3G6JE 2G2NA 5KJ7E 3TYGH 3HZKA 3EH5B 4Y2DA 1U8HA 1ZHKA 1CXKA 2UYLA 1X5MA 2CD0A 2W91A 1A8ZA 2DH3A 2DM4A 5FM8A 3GGWA 1UKTA 4XMTA 3C12A 3PWUB 3BYYA 3K6DA 1D5RA 1PAZA 3HLAB 3KYKL 3VXQB 2UV3A 3P9LA 4EPSA 2NR6A 3NJKA 2WWMD 3IN2A 1NFIA 2PPAA 4OIIH 4JAMA 3MJ7B 4OCMC 3QUKA 3VFSA 5EBLA 1MHEA 3BGFB 3WV0A 4HU2A 2ZUSA 3JV6B 3CX5J 5C1MB 4L29A 4P04A 2VDKH 1JGLL 3OAZH 4LK4A 3P40A 3ARTA 3QHFL 5M94B 1G7HA 4JO4L 4XVJL 5CEZH 4JFPA 2YK1H 4X8JA 4CJ0A 1CFQB 1EO7A 2MTAA 2CKBB 3FU5A 5IMKB 2J12B 1RFDL 3OC8A 5GZNA 4ELKB 3HAEB 3HRPA 3KPMB 2YQGA 4X6DF 3UPRB 2RBLA 4W9IC 2VTFA 3VH8G 2JIXB 1P1ZA 5C0JB 1BQSA 4HS6B 3WI9A 1R3JB 4HBCH 4H8UA 3C6LA 3NN8A 2L7QA 3Q5TA 4M5YH 2XOTA 1NL0L 4XN9A 1YN7B 3MV11 5L6YH 4D0DB 1AH1A 1VGKA 2VMDA 4LO9A 3N5AA 1LK2B 2LW3A 1MFBH 3LKNB 2RGSA 3EBHA 4NWUL 3T09A 1ZVSA 3PL6A 1SFDA 1GIGH 3IDYB 4L3EB 4NWTH 3FQNB 5TK4A 4J3OG 1F41A 3DVNB 3SPVB 2Q3XA 1CICA 4U1NA 3I3DA 1F1GA 1PLCA 3SPJA 4ZUTB 2ZSWB 1IBYA 3ECBA 4HW6A 1DYZA 4LSVH 2TRYA 3U9PL 4ZNEA 4LU5L 4CMMA 6TAAA 5I16A 3KGTA 1LO5B 4X5QA 4YUEH 4KY1L 2ZF8A 5E9AA 1HQRB 3WTYA 3QZWA 4MNGE 4U2ZA 3DTDA 5CMAA 4N2AA 3L54A 4N2HA 3ZYJA 3K6FA 4RGNE 1TG8A 2Y23A 1MG3C 2OZ4L 2A5UA 5DZJA 2ADJB 2NY7H 5ID0B 2GAZA 4WW1A 5GISH 5D9SB 1XR9A 3BWUF 2DDQL 3Q3GA 5ESQA 1YPZB 3QT2A 3D52A 4PJ6A 4Z0XB 1IMHC 1R5WB 4UOW0 4UQBA 5B7MA 4LRIA 3BJLA 1TJGH 2DIEA 3L1EA 3LRGA 4HF5L 4ICXA 2R1WB 3QS3A 3FOMA 4BZ2L 5DHVB 4K8RD 3Q6FA 5DFVC 3DX7B 1KNOB 3L9EA 1E4KC 1TYRA 5KVDH 1YDPA 4XNUL 4QRTB 4NO5A 4U1GC 3DWTA 2H3XC 2ED6A 4ZRGA 5I1EL 4OY9A 4QMEA 3UERA 4MZIA 5M95B 2XTJB 1ONQB 1OPOA 1T1YB 1YN7A 1D7CA 3US9A 3L9BA 3O9WC 1SY6H 1JZ2A 1A4KB 2LU3A 3NIGF 1A9BB 5AVUB 2BERA 1AGDA 4EZMA 4HOXA 1ZLDA 4I9WD 4XXDA 3V7MA 4CMHC 4L0YA 3T0VA 2K0RA 4I0PB 3L81A 1VKXB 4B0MM 4DKFL 3U9UB 2YPVH 4GW4A 1FFPA 4YHIA 3TX4A 3KPOB 2ZWSA 3ZTCC 3O4LB 4XCFL 4PD4J 2H3NA 2UVFA 3MBXL 3QDJB 2Z6FA 1NC2D 4YJZL 1QD0A 2EDJA 2R51A 5C6WH 4FXGA 5JIDA 3FSAA 4K8RL 5F1IA 3O6FD 5BQDA 1D5ZA 3BP4A 2IJ0C 1UOVA 2OMWB 2MWCA 1DJSA 4F5CA 5B39B 3L4UA 3B9AA 4ZFZB 5DVMA 3MJWA 5AOMA 2GIMA 3HHMA 3S6CA 1V3LA 3LNEA 1KCSL 5IB4B 2PCPA 3QC5X 3OAUH 1MUJB 1CLOL 2ZYHA 4MCZA 1PMYA 4NLAA 2YFOA 3DBSA 2KLSA 4ZS6C 4HQQH 1TZOA 1PD0A 3VTAA 5MEOB 1IQDB 2CJUH 4UT6A 4QRPA 1KEMH 12E8H 1NGXA 4DHLA 3BMVA 5KOMC 1DQLL 5AVYB 5FYLL 3ZVVA 2QQQA 4OD3L 5DJYB 3BHBA 2M1KA 4HJUA 5IVXB 3SJVD 4JUSA 3NRQA 3K0YA 5C6TH 4AVJA 5D2LE 3AS0A 1IFGA 1QASA 3O2DA 2YD1A 3NRFA 4N87A 1FO0L 4HX1B 4LEOA 1JF1B 5INDA 1ZANL 3QUZB 5FM5M 4MDJA 4QHPA 5C08D 4DFHA 1CDGA 5GGVH 4MHHI 1TEYA 2ADGA 3IDYC 3I9GH 4XNDA 3REVB 3MC0A 2IQAA 5HGGS 4B9FA 5KSAA 1OKEA 2H26A 1KIRB 1OIOA 4UQDA 5AAWC 2L04A 1N0LB 1FORL 1WBXB 2GQHA 4U1HB 3PQYB 3WS6A 4ELKA 5MERA 3WFHA 1N2RA 1SN5A 2CUMA 3W9EA 4PJ8C 4ETQA 3NACH 4TPRL 2OS7A 2F53A 1SEBB 4MDRA 2WLYA 2W1NA 2AZAA 4PREB 4O9HH