1BAWA

Plastocyanin from phormidium laminosum
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
ETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transfer
molecule keywords PLASTOCYANIN
publication title The structure of plastocyanin from the cyanobacterium Phormidium laminosum.
pubmed doi rcsb
source organism Phormidium laminosum
total genus 24
structure length 105
sequence length 105
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1bawA00
3PLYA 2I7OA 1JZFA 4BXSV 5I6LA 1J9RA 1IKOP 2PPEA 3NP3A 4KO7A 4M4RB 3PAZA 2DWSA 3NSYA 1AR1B 2VN3A 3JT2A 1FA4A 2EIMB 1EZLA 3IE9A 1QNIA 2B3IA 3TA4D 5AKRA 1PLAA 3QJRB 2UXFA 4BWUA 2LLNA 1ZPUA 3AW5A 3NJGA 1E5ZA 2MRYA 1OE3A 1AOZA 2VSMB 1MDAA 4YSSA 4N8UA 3FYIB 1GS6X 2X87A 3UAEA 4HIPA 2BWDA 4FA7B 2ZOOA 1ZDQA 5D4IA 1L9SA 2JFCA 2FJSA 2PP9A 4UF7C 4DPBX 5B7FA 3BQVA 3S3BB 1OE2A 3ASNB 2EILB 4BK5C 2WO3B 1BAWA 1AG6A 1NINA 1PMYA 4DPAX 1XB6A 4YSAA 1QHQA 2IDSA 1NPJA 3IBOA 5I26A 3IN2A 1ET8A 1IUZA 2UX6A 3EH5B 1ILSA 1XMEB 1FFTB 3FSVA 1FWXA 3NSFA 3QJSB 4CSZA 4YSUA 2IDUA 3WKQA 2YAFA 4G71B 1J5CA 2UXVA 2BHFA 4HCIA 2BP0B 5B1JA 1ZIBA 2CALA 1MG2C 1JVOA 2IH8A 1NICA 3NJHA 1OCZB 1PZAA 3WNIA 4HHGA 1KBWA 1GYCA 3WG7B 2PP8A 2GBAA 4DP1X 2CCWA 2J55A 1SF5A 1W8EA 1L9RA 1GS8A 3S3DB 2BP0A 2BW5A 3FU9A 4Q89A 1KDIA 1JZGA 2IDTA 3QJUB 4G72B 3QPKA 1KYAA 5IY5B 1KCBA 1W6LA 5B3SB 3ZDWA 1A3ZA 3FU7B 2CJ3A 2I7SA 4DP8X 1AZUA 1ASQA 3FU8A 1L9QA 3UADA 3WKPA 1TKWA 2Q5BA 3CVCA 3FSAA 2XV3A 4DP4X 5I6NA 1M56B 1A65A 1OCCB 4WTQA 3FU7A 3S8FB 3RYMA 3UACA 1GR7A 3D12B 3OM3B 1L9OA 5I6KA 1BEXA 2Y69B 4G70B 2IWFA 1DZ0A 3X1FA 3QQXA 3OD3A 4F2EA 2FT7A 5I28A 3V9CA 1WS7A 8PAZA 3WNJA 4BXVA 3CG8A 1JERA 1MZYA 5TK2A 1NIFA 2AZAA 4CSPA 1ASPA 3ASOB 1ETJA 3ABGA 4AZUA 2CBPA 3FPYA 3H4HA 1ASOA 2FT8A 1PY0A 1SHXA 5PAZA 4E9QA 2XX0A 3OMIB 4YSDA 2HXAA 4KNUA 2GC4C 2I85A 4FAAB 2AZUA 2YQBA 4GP8B 5B1AB 3NJIA 3T6ZA 1BQKA 3QJVB 2PPDA 4YSPA 2XVBA 1GY1A 3MX0B 1M57B 1ZV2A 2J56A 1AZRA 4DP7X 2YXWA 1NWOA 2QDVA 3EH3B 1CC3A 1NIBA 2HX7A 4HAKA 2CUAA 4YSCA 2FQEA 3OMNB 1J9TA 3GDCA 3WIAA 5A7EA 2PP7A 2H3XC 3ZX1A 5PCYA 5I5MA 1JZIA 1GS7A 4PAZA 4KO9A 1I53A 4YVUA 4KO6A 1XB3A 2PCFA 1A8ZA 3SQRA 4KNTA 2FT6A 3FS9A 3AG4B 2UX7A 2XU9A 2AANA 1PZCA 1B3IA 5I5JA 3ERXA 2DY2A 1JXDA 3QJQB 4GXFA 1AZNA 4UANA 2YXVA 2BW4A 4PCYA 1BQRA 2XV0A 4UAHA 1IBYA 5F7AA 1PCSA 2QDWA 1HAWA 2BP8B 1N68A 4HHWA 3X1BA 3NT0A 5AZUA 2GSMB 2TSBA 4YVNA 4AX3A 1PLBA 3FSWA 4KOBA 1WA0X 2XXGA 3X1NA 3NJMA 1AS7A 1NWPA 4GY4A 1JZHA 4YSTA 4N4YB 2BP8A 3EH4B 4AKQA 4X4KA 2PPFA 2X88A 5FC9A 2FQFA 2YAQA 3BVDB 2RACA 3AG1B 3FQ2A 5B1JC 1XB8A 3L45A 1AS6A 1NIEA 2AFNA 4DP2X 3NSCA 2J5WA 1NPNA 4JKNA 3NP4A 3CVDA 2AVFA 4E9TA 3CDZB 4E9YA 4KO5A 4W9ZA 3ZBMA 1OCOB 1WS8A 2DV6A 4BWTA 4QLWA 2OV0A 3T6WA 1SJMA 7PAZA 4G7QB 1EHKB 3X2QB 1BYOA 2YAOA 2B08A 1AS8A 2QT6A 4JHUA 5B1BB 2VW4A 1AZBA 1X9RA 2YAEA 3FT0A 3NJJA 1RCYA 2YARA 1NTDA 1ADWA 3FSZA 4A2HA 3IEAA 2TSAA 1AZCA 2IDQA 3TBBA 2DWTA 4Q8BA 2PPAA 2GC7C 2VSKB 3SBRA 4AKOA 1CURA 1J5DA 2DYSB 4F2FA 2WO2B 2P80D 4BWWA 1PNCA 4NB7A 1OOWA 3PAVA 1CUOA 4GP5B 1AIZA 2FWLB 1WAEA 1SFDA 3N55A 2A3TA 2VM3A 3UABA 5E9NA 2Q9OA 2GHZA 2HX9A 4EF3A 1V55B 1OCRB 4E9VA 3NJKA 1AACA 3KW8A 3TASA 2FTAA 2WSDA 2IWKA 1E67A 2EINB 1E65A 3G5WA 1L9PA 3FQ1A 2GB2A 3NYKA 5AFAA 1SDDB 1NIDA 2ZONA 2ZWNA 4DP5X 1URIA 5I6OA 2IWEA 1VLXA 1RZPA 1YLBB 5I6MA 1SDDA 1R1CA 2E86A 1KGYE 4DPCX 1WA2X 4HCGA 3S3CB 1JZJA 2J57A 1A4CA 2BZCA 4GYBA 3T9WA 2NRDA 5B7EA 6PAZA 3S8GB 1X9UA 2CAKA 2H5UA 2H47C 4JHVA 2XV2A 7PCYA 4DP6X 3TU6A 3V9EA 4A2FA 2EIJB 5B1KA 1QLEB 1M9WA 1BXAA 1V10A 2YAPA 3OMAB 2JXMA 1L9TA 4HALA 4A67A 3NJNA 2PPCA 3TBCA 2YAHA 3ABLB 2EIKB 4E9SA 2XWZA 1JXGA 4QKTA 1RKRA 1SFHA 1OF0A 2PLTA 3X1EA 3FPXA 2IH9A 1TEFA 2XUWA 4A2GA 2QPDB 1ET5A 1PZBA 3PCYA 2P80A 6PCYA 3HB3B 3NJFA 1F56A 3T71A 1IC0A 3FQYA 4E9WA 2W88A 2N0MA 9PCYA 4W1TA 3CZUB 2QPEB 3ZIYA 3SBPA 2FQDA 3X1GA 3EHBB 4G7RB 1ZDSA 2GI0A 1BXVA 2BWIA 3WI9A 3PAUA 1N70A 1NDTA 1JXFA 3JTBA 4K9JA 1E5YA 5I5IA 2UXGA 1GW0A 1SF3A 1TEGA 5F7BA 2VW6A 4F7KA 1KCWA 3NSDA 2DYRB 2IDFA 4YSOA 3AG2B 4BDVB 3CDZA 4TXVB 4A66A 3AG3B 1SNRA 2XYBA 2XX1A 1KDJA 4DP9X 3ABKB 1JVLA 1HFUA 4E9XA 4BDVA 3EF4A 2GIMA 1OV8A 5B7MA 2XXFA 2FNWA 1RZQA 4E9RA 1KV7A 5EHFA 3H56A 2BO0A 3OQRA 4HCFA 4YSRA 1A4BA 1BQ5A 3C75A 4A2EA 3PPSA 4NERA 3U25A 4P5SA 3DTUB 3UGEA 2FQGA 1AG0A 2W8CA 1DYZA 1KBVA 1JZEA 2YAMA 3ABMB 5D4HA 4YSQA 2UXTA 1CYXA 2R7EB 4KNSA 1AQ8A 1MZZA 1SHWA 1ILUA 4AKPA 3FYEB 2VMJA 1HAUA 3CVBA 3N2JA 1BYPA 4ENZA 5D4JA 2HX8A 1MG3C 2R7EA 2MTAA 3AY2A 1W6WA 1ID2A 1UATA 2HRGA 3T6XA 1PLCA 2VM4A 1OE1A 1T5KA 4YSEA 5TK4A 3SBQA 2OCCB 4M3HA 1J9QA 1AANA 1GY2A 1BXUA 1PNDA 2IAAC 2XLLA 4ZK8A 1IBZA 1ZIAA 2HZHA 3H4FA 1CYWA 4DP0X 4NAJA 2ZXWB 1PF3A 3HEIB 1NIAA 1PAZA 5I6PA 2Y1AA 4L0PB 1E30A 3KW7A 2HLEB 1V54B 2OJ1A 1GSKA 2JKWA 5LDUA 1J9SA 3GYRA 3NJLA 1AAJA 4YL4A 4AI7A 3AZUA 1JOIA 3QJTB 4GP4B 1ET7A 2HRHA 5ANHA 2VW7A 3T6VA 3DIVA 3DKHA 1WA1X 3PXLA 4KOCA 2BZ7A 4A2DA 3MBWB 4HZ1A 3IN0A 4MFHA 3UAAA 4A68A 1TU2A 4RH4A 4G7SB 1A4AA 4WKXA 1NZRA 3GXUB 4P5RA 2PCYA
chains in the Genus database with same CATH superfamily
1EBAA 4F7EA 4L4VB 1JZFA 1ZLUH 3K6FA 3V0EA 3SY6A 1A6VH 2ZX5A 4Y4KC 4HHAB 2ZSWA 5FHBH 3FXIC 4U1HB 1EZSA 1GSMA 2BS71 3L9EA 4OIIH 5E8EA 3ZZLA 3OKKA 5IESH 5CNHA 4H0GA 2VIRB 1JGEB 4NZTL 2JIXA 5DMIH 2LLNA 2F5BL 3AW5A 2VR7A 4DOHE 1E0OB 2YRZA 4ZMAT 4P2QA 1VRSA 2HRPH 2ZTBA 2V7HA 2RQEA 4X5QA 5HI3D 4RX4D 5C0DB 2YS4A 3WJJA 3U79A 1I1YB 2JFCA 4DPBX 2YPKA 3EIFA 4UF7C 1TPXC 4WHDA 4ZO7A 2NYYD 3LH2H 3VQMA 3P11H 4HEPG 3ASNB 1SUHA 3T4YB 4HMDA 4N1HB 3OWEA 4ZW5A 4NPYB 3WD5L 3P4NA 3GMRA 4HCRA 3MV9D 1FFTB 4KVCH 2E27H 5D1XA 3J8F7 2OW6A 4RQQB 4ODSL 3LQAL 2YD9A 2HFGH 1NFIB 2PTTA 3ARED 4EOWL 2NY5H 5ALBL 4R3SA 4PLNC 5JHLL 1KFAL 4U6VL 1H9DA 2OJEA 2A5UA 4M5YL 2XVLA 4E36A 1AGFB 1HEZA 5D9SA 2CCWA 4FNLL 1HWGB 5CXPA 3P1VA 1XR8B 1IQWL 4G72B 5JNYA 3D2UD 3MDJA 3OKOB 2QHRH 2VO5A 4WV1C 2CIKB 2JKLA 1PLGH 4OZGF 3V55A 1DQMH 5F7WC 4GO9A 2VAJA 4MAYA 3WGVB 1I9IH 4JN2A 4IRSD 2X6AA 3I2CH 3G5XB 1M56B 1DUYA 1JPTH 4DERA 5T3XE 1F4YH 2ZUSA 1V05A 1A1MA 1BEXA 3Q2WA 3D51A 3VGGA 1A0QL 2GEEA 4HXBL 1ZVYA 1LO5A 4TL4A 1E27A 5E9DB 4JVPA 4R8WH 4L0YA 2X41A 4ZMWA 5AW1B 4U1JA 4QOKE 3QJFA 5ALCL 4ZS7H 2VDKH 4HKXB 3QWOA 4NO0A 2BDNH 2WJ7A 4GSDH 4P4KD 5CUSH 3HG0A 3BPOC 4OD1L 2XX0A 2PTUA 3BXNA 3OXSB 5F3FA 4S11A 1RJYB 4DO6A 1GAFH 1VZHA 5EEZA 2AJZB 4U31A 1NFDF 3NJIA 2B0SL 1BQKA 4FTVD 4IDJH 4OIBA 2XZAL 5DUPL 5B8CC 3PL6A 1ETA1 4I2XA 4A6YH 3DDFA 4WLCA 1M57B 1OPGH 3E80A 4BSWB 1FVDA 2IPUG 3SPVA 2J72A 1YNKH 3PNWA 5E4EB 1UH3A 2PCFB 3K4AA 3VFOA 5D7SL 4YE4H 3TLRA 3IGAA 4IKIA 4UBDC 2LABA 4IRZL 4XBEL 2YK1L 4U1GC 1FO0L 1B2YA 1YC8A 4XX1G 5EORH 1X7QA 4H20H 1F1GA 1U8QB 2R4SL 3ULVD 2NLJB 2R69A 4AJVA 5AVVB 2H1LM 2OP4L 5F7FA 4KZDH 4ZMOA 2VDLL 4HG4J 2OQJA 4O02L 2JKNA 3D4CA 3SDXE 4HC1L 1QLEL 2CM6A 2BCMA 5DJ6A 5K9QG 3P9LB 2YXMA 4N9GA 3AXHA 4HJUA 1JMZA 2HWZL 4PCYA 4XPHL 3VXUD 3LRKA 3V95A 3ZO9A 4BEIA 1G7QB 5I1JL 2VWEE 2X3CA 4GG8A 1Q90A 4M8QA 4PR5A 4UQEA 3QHTC 1Z9PA 5AZUA 3VNZA 5HHOE 3WY3A 4H8QA 5IFJB 3EJRA 1JTPA 3FB5B 3HC0A 4F57L 3L5XH 4BCYA 3O8XD 4LEEA 5FA3A 3NJMA 5KTEH 4YQXL 2X4OA 1M7IB 1NWPA 4Z7UA 5K5YA 1M7DB 4QJ3B 5ESQA 3QA3B 4E0RA 1JFHA 4RDQF 1BVKA 2IG2L 3WHXA 1VGKA 2BFGA 4HUVA 4Y1AE 3D34A 3QZLA 4JPSA 2I9LB 4NKMB 3NIDE 5C07D 4YNYA 1PKOA 2PXYD 3VWKB 1IKNA 1BVLA 3QNFA 1KZYA 5AW8B 2FO8A 1TJGH 2A6DA 4X5XA 4NJ9H 4I88A 1I9JL 3LIZH 1S7QA 4QLWA 4BWTA 5HVHB 1V7NH 3D7PA 1HN1A 3L1OL 4NNPL 5IMLA 2V6HA 2H6PB 5AAWA 3TH4T 3ARBD 4MBRA 1ZLWH 1DZBA 1YYLL 3BO8A 2N0KA 5J6HA 3VFGL 3K74B 4Z3IA 4QRRD 2GTZB 5IJDC 4AIEA 3BH8A 1FNHA 5C08A 1CR9H 1IAKA 3DYMA 4G3YL 4HXAH 3T8MA 4M7ZB 4DN4H 5D1QE 2EEXA 2VMEA 4PJDF 4MVBC 3WUWA 2AV1A 1J5DA 1MFEL 1QTYT 2WO2B 5DHEA 4U1IA 3MRQA 1YNTA 4HK3J 4U6HB 5I19H 3B6SA 5IVZB 4XBPA 2VB5A 4OB5H 1ZK9A 4N87A 4TF4A 3CU1A 4L29A 4PJCF 1CWVA 1FL5B 1TVHB 4LLMA 3IAPA 5J6GB 2C9UA 1BD2D 1V8HA 1F00I 4G9DA 4X4XB 4ZFOL 3TF7C 5KAQG 1MH5B 1W0WA 1S7VA 3C9NA 4TLKA 3DI3B 5AUMB 3JV5A 4OFPA 2L7JA 5IP4A 2TAAA 3JWNC 1O9WA 3ATEA 3RU8L 4D0BA 2Q7NA 2VXSL 3NYKA 1YVLA 5BCAA 4BZ2A 1BJ1J 2NZIA 3CZFA 2R2CA 1CQYA 2BFVL 1QO3B 3HS9A 1NMAL 2H2PC 3GXIA 4Z3GA 1RHHA 3ULUC 2IC2A 4IQHA 4RFEA 5GIRA 4LCIH 4AENB 5EIIA 4N25A 2Y5QA 3T2NL 1YEEH 4MXVE 2BNQE 5E8DH 2YXFA 1F4XL 1H8NA 2NT1A 5T3ZE 2PWGA 3S3CB 2AQQA 4PEEA 3QR0A 1A4CA 2DQMA 4ZPVB 4CRPA 5FV2A 4JGUA 3ESMA 3IDUA 4WTWA 3MNVA 1FO0B 4CKQA 3QCVH 3E8UL 2ED9A 3RPKA 3PGFH 4P5TA 2QMJA 1PG7L 4WUUB 5ITBL 1X9QA 2VDLB 4O02B 2NY0C 4GJTB 4EXPX 3UIZA 4FN0A 3KJ6L 1I8IB 1M1XA 3CSBA 1WH0A 3R8QA 3PP4L 1QLEB 2VERA 3O0LA 4ZMQA 4L9LA 4HIIA 3BLBA 4WDIA 2NY1D 4H5SB 3OMAB 2G3MA 1P6FA 3UL4A 2ROYA 5EZJB 4R90L 4YC2C 3X3GL 4ONOA 2DLTA 5CP3A 4PJ6A 3WJJC 2AXFB 43CAA 1GZPA 1JXGA 1P4BL 3D85D 4JUSA 2VLJD 4K8RD 4L23A 2D3JA 4P4RB 3EZ8A 1FC1A 3QUYB 4GUCA 5F21B 4JY5L 1KCVL 2LAAA 1PZBA 5BPPA 1YY9C 3NN8B 2CUHA 1VHPA 4KKBC 3ATDA 3PCYA 4PJBE 3REWB 3UTTD 4ALAC 5I1EL 3K0YA 3KYNA 4B9IA 3G6DL 3TV8A 4O51A 4G6FD 1CT8B 4B9PA 1FH5L 5D1XC 4NZTH 1N2RA 2F5BH 4KKCD 2UUDK 3CZUB 4ZDHA 4FMFA 2E56A 2BCKB 1QSFE 5I76B 5JORA 1VERA 2F7PA 3S5LA 4G8IA 4I18B 1ORSB 1A66A 2YWZA 4O2FA 4JR9H 5F7BA 4QHLB 3DGGA 3QUXD 2P8MA 3VTMA 2OTWB 4PRPD 3WD5H 1A9EA 4IS6A 1ZLDA 4AZ8B 1RULH 3WL9A 3N04A 5LBSA 4XRCB 2JKSA 4MXQD 1NLDL 2XX1A 4LBEB 4IHOB 2P5WB 4JHWL 3LQAH 3ABKB 4ODSH 2YMOA 5IHUL 3EJCA 4HUUA 4EOWH 5ALBH 5DVMA 3KLAA 5JHLH 1KFAH 4U6VH 4M5YH 2BVQB 4PJFE 5CZXD 2VRKA 3ZHFA 4FNLH 3MBEA 5BO1L 4ZFFA 5EFIB 4UOW1 2RMNA 1X9LA 3IVKB 5C0CB 1IQWH 1JYNA 3IJHA 3AXIA 1SXNA 3DHUA 3N50A 4I89A 4YSQA 5IEHA 1AR1D 4ZFOB 4XBGB 5D93C 4AY0A 1GCYA 2X4SA 4TNVK 1NGQL 4R2GD 2Y72A 4QD2E 5IBTL 1QVOA 3PL6C 1AKJB 5HHOB 1BREA 3CN2A 4P8QA 3KEDA 4AW4A 5C0BB 3UZVA 4YFLI 1N5AB 1NGZB 3DRQB 4K3JL 1EAPA 4K7FA 4FI7A 1A0QH 1PFCA 4HXBH 5D6DA 1SQMA 5E2UL 3AY4A 3RPIA 3EJYC 4NI3A 3D33A 3QYMA 2HRGA 2PO6A 5CGYD 3LPOA 1S7XB 5ALCH 5E08L 4IBVA 3MRIA 5D6CA 3RAJL 1KPRB 5HYFA 3UAJD 3UXFA 3E1F1 3I02B 3LNDA 3WTXA 2WYHA 2CPCA 4OD1H 2B8OT 4MJ4A 2WW8A 1W72L 4XNQB 2YD2A 1GC1L 2B0SH 3CAFA 5DUPH 3WY2A 1LEIB 2XZAH 3CFDB 1E30A 2OJ1A 4ATWA 1DANU 1I3RA 3NUKA 4I4WB 5D71L 1K72A 3LKPB 4R97B 2HKHL 3LPFA 5DRWB 3QQ4A 3S37L 4IBWA 4OFYD 3PXLA 1WA1X 4IOIB 5FX3A 2BZ7A 2ROXA 4YHKL 5L4IA 5D7SH 1OB0A 2XY1A 1DBBL 4HZ1A 4UQBA 2EDXA 2Q3XA 4IRZH 2YK1H 4XBEH 4DGYL 3JWOL 1FO0H 1X4YA 4HULB 3SJVA 4GKZB 3T0ED 4JLRB 1I1FA 2X0VA 5D1QB 2EIZA 2W07A 2R4SH 2PF6A 1KBGL 4ZQTA 4OZIF 1RZ8A 3CVHA 2OP4H 2HJLA 3MR9B 1G6RL 4J3OD 2A77L 1LP9B 2VDLH 4O02H 5TDOB 1ZHLA 5BV7L 1HQRB 4IU3A 1FH2A 3KE0A 3EG9A 4HC1H 1QLEH 2ITCB 4X80L 3GXFA 5ISZD 3CX5K 2HWZH 4XPHH 1IKNC 1KYUA 3X11B 4PJFF 5I1JH 1IMHC 2NTFA 1YUKB 1PVHA 4KJWD 1JS4A 2DYPD 5LO7A 1OHQA 3GEFA 1WFTA 3L3GA 5T1MB 3DARA 3C8KA 3WKML 3IMUA 2G5BB 1KYDA 3T04D 2K4WA 4GQPH 3VFWB 4FQQA 4PI2A 4F57H 4N2OA 2NY2B 2BOCA 5AVUB 1G7PA 1U2YA 4YQXH 3QIBD 5E6IB 1RU9L 1YN6B 2YD0A 5B7FA 3CU7A 3FQRB 2DQIL 3ZTEA 2WO3B 5A2JH 2IG2H 1C1EL 1E2WA 1UZ8B 4TMPA 4KKNA 3T8XB 3KM1A 1IGYA 3HHSA 5C0NC 5HYJB 4AEHL 5E56A 1DVSA 2PW1A 2GFBB 2WQUA 1EGJA 3BLPX 5C92A 3QXAA 4B41A 1I9JH 4KI1A 4RRPM 3DX2A 3RNQB 2VL4A 3L1OH 4NNPH 4AQAB 5F1KC 2QVMA 4LFHG 5GGRA 2QKIB 1PZAA 1YYLH 1U6AL 3WG7B 3RWJB 2MH4A 3JV4B 4JDTL 3VFGH 4XTRD 4WEMB 1CI3M 4HLEA 5KJRL 1BF5A 1G1KA 2B4CL 5JHDD 3HR5A 1KYAA 5I1DA 4XNUL 1SMOA 4ZX5A 4WZ9A 2I9TA 3FU7B 4YBQC 1WZMA 4UT7L 4WNSA 1X5HA 4B9CA 4G3YH 1AR2A 1WFNA 4ZUWB 5A3IC 4Q9QL 3RRQA 3VU1A 2ZSVA 4KKAD 4GKNB 1MFEH 4Q2ZB 1KGWA 3R4RA 4PJHB 2CRIA 3MLRL 3SGEH 4PJBB 4KK5D 5AYQA 4WTQA 4GMTL 2XWBA 1L9OA 4PBDA 3QFJA 4UAOB 2DLIA 2UZXA 4M7JL 5BQ7A 5C2UB 3COOA 5DMJB 2D3VA 3BHBB 3K4ZA 4XMWA 1EEYA 4ZTPL 1NIFA 3OPZL 4MNQD 3TNMA 4W9KC 3RU8H 2WKOF 4B5ZA 4DEWA 3LQMA 2VXSH 2ERJB 5DQJB 4BFBD 3U30C 3MNMA 5DJYA 4HGWA 5DZLA 3IRCA 4UDUB 1TZ8A 4KNUA 4LCCA 3N91A 3DK2A 4LOVA 4I9WE 5DJ2A 2BFVH 2EEDA 1GJWA 4L4TE 1NMAH 3MO1B 4ZS6C 1SY6L 3ZRFC 3T2NH 5IQ7L 3GTVA 5SWQB 3L3JA 2QQNL 1RJLB 4WI7A 1FCGA 3KPOA 1F4XH 4YDJB 1UCBL 5LVEA 1TTAA 1YJDL 3S37X 3H0TB 3APCA 1WIOA 2FB4L 1EAQA 3E8UH 4NQVB 1GA2A 4NUMA 1MI5E 4Y4FC 5PCYA 3ELQA 4JDEB 4BKTC 4ZFGL 2R8SL 1PG7H 3LYRA 2J8UB 4NN6B 4BFIB 5ITBH 1G6RB 4RLDA 1BQHA 2YWYA 2WXOA 3UROR 5BV7B 2R1XA 3U0TA 3NSXA 4B9KC 1K8IA 3KJ6H 1XF2B 3CZSA 3PP4H 3E6HB 4KFMA 1MWAA 1EJ6A 2A2QT 4BKSC 3HB3C 1F3DJ 1XXFC 5CSBA 5HGAB 4ZZFA 4R90H 1LQSR 4PGEA 3X3GH 1XAUA 1MAJA 3OV6A 4UAHA 1IAIL 1P4BH 4YPGB 3S8WA 2A6IB 3CH1B 2DKUA 1LMKA 1Q1PA 3P3UA 1T04A 1HAWA 4PFEA 4JY5H 1O0VA 1KCVH 4ELMF 4MSWA 3EYFA 3T1FB 2ARJB 3M1BB 3FW6A 5I1EH 3G6DH 4F20A 1WBXA 3IXAA 1U95A 3LKOA 4EN2A 1IC5L 3F6LA 4FOMA 4L3EE 1W2KT 5E8NB 5DFTA 5E2TL 1FH5H 1DDTA 4JRXA 4PSPA 4EPSA 5I0WA 3MRKB 4PJXE 5DJAA 5C0AA 5E94A 3FQ2A 1Z0NA 3PF2A 3WDJA 1QFHA 3CFCL 5M95B 3WLWD 2P8LB 3RVWD 2AF2A 3BT0A 3D52A 3IU3B 3V9FA 3O3BB 1NCDL 4QHKI 3HVDA 2GJJA 4MJIE 2AVFA 4H1LA 2WNKA 2Z1PA 5E5MB 3ARPA 2Z8VC 1JHTB 3ZDZE 5L2JB 3T6WA 2OKMA 3IJSB 2DWXA 1TYRA 4X50A 2X1QA 1K4CB 4W9JC 1MCDA 4Y9FA 2QSQA 4U3SA 1RZGA 4OCRL 5CSGA 3B7TA 3LXAA 5HGDB 2CBQA 4R4BB 1IAOA 1NLDH 2X6BA 5DHXB 5I66B 4JHWH 5TDPA 5KEZA 4S0HA 3T2PA 4ZZKA 4NENB 3T3PB 3T2LA 3DROB 3L7FB 3FSZA 3SDDD 2IDQA 5D6DC 3TO2A 2D31A 2ZOLA 3RVVC 1ZK5A 4I0PD 2GC7C 1P84J 1OKEA 3AY4C 5DJDB 4AM0B 4BKLA 4FHJA 1A7RL 4PREB 2DYSB 1LE9B 4BWWA 5BO1H 4H0IA 3HE7B 2ZKYA 3UZQA 3WYRA 1VF5C 3GXMA 3VD3A 3RVUD 2GHZA 2XFGB 4URKA 5CF3A 5I1LB 4WO4B 1SXZA 2C4FT 1D5MA 4PRHD 5SWSD 1B88A 1NGQH 4LKXA 5FLUA 3PWJA 5IBTH 2OX5B 2K4AA 1IO4C 3DPBB 2WSDA 2X70A 1O9ZA 2XG5A 3AB0B 3OKLB 4PJ7E 2NMSA 1L9PA 1TQBC 4K3JH 5AFAA 4AL8L 3G6AA 1E50A 1T0NA 4L1SA 1G7LB 4LCYB 5E2UH 4DP5X 1OY3B 3N44F 5ABZA 2A83A 2ICES 2WXRA 3IPFA 5GSRB 5E08H 4RAVA 2EYRB 1UEMA 4URTB 4GAFB 3RAJH 4V1DD 4XN1A 3GGWB 4HPHA 1P53A 1W72H 5HTSA 2HFEB 3ARYA 4CN1A 1GC1H 3NRQA 4JEGB 1E28A 3GXDA 3JWNG 3H3KA 3KLSA 3P4LA 2ZZUT 3L2NA 3BEWA 2OR7A 2NR6A 2Y7LA 1VEPA 3C60A 1JPFB 3ECQA 4LPTA 5D71H 4KKPA 4XCNB 2HKHH 2EDNA 4HV8A 3S37H 3IDMB 2B7DT 1KTCA 4EI6A 1N7ML 2HPTA 2BSDA 3CFIC 1KT2A 4YHKH 2RBLA 1C5BL 4XMPL 1DBBH 3DTXA 3HPJA 4HWBA 4IJ3B 3CX5J 3NJVA 3VXOB 4DGYH 2GJ6D 3JWOH 3CZJA 3P40A 1Y18A 2YAHA 1PZ5A 4E9SA 3C2AL 4KBPA 5IIEA 3NIGE 1KBGH 1F11A 3D69B 4LF3B 1J12A 1SYVB 3RL2B 5BRZA 1G6RH 2YGVA 2A77H 3UYOD 1CBVL 1NGYB 3IYLW 4LSTL 5BV7H 5GGSB 1JN6A 2LU3A 5K33A 4LRNH 5KSUA 4UTAA 4X80H 3QG6A 2P80A 3G5VA 1JTTA 4H8PA 4M8UA 2J7LA 2YD8A 5G4OA 5IVXF 1ANUA 4G80A 4F92B 4F3FA 1ZCRA 2KPWA 3DVGA 4ONFL 1OP3H 3PWPB 2K7PA 3HE6B 4K4KA 1NFAA 3L1EA 5HGGS 2N0MA 3GJFB 4L18A 4PRAB 3WKMH 3DURB 3DO4A 4Z3FA 1XCQB 1XGQA 1E42A 3LKQA 4J28A 5KSBE 3L3DA 2OI9B 3FC8A 4E41D 5IMKB 2XA8L 2ZUUA 3VM7A 3BPLB 5C0FB 2AMGA 1RU9H 2AK4E 5B3JF 1BCIA 2FEJA 4QRFA 1ES0B 2I32A 4JUTA 4U1MB 3QUML 3MLXL 2LU4A 1C1EH 2RH0A 3MBXL 1RK7A 4WRLA 1CE1L 3VFNA 2IDFA 3REVB 3PV6B 3PREA 2GUOB 3CDZA 2QTVA 4AEHH 4BRVA 1UD3A 2VGLM 4JANB 4XNZB 1DE4B 5IF0B 5F9WB 4X6CB 4YO0A 3AWEA 4M61B 3OGCB 1UOWA 2KBGA 3H9SA 2NUPB 2QLYA 4LOUD 5C0IB 1KLFB 4XNMB 3SO3C 1I8LA 3QNXB 2GIMA 3AS3A 3NZ8B 4PGCA 3QFGA 1CXIA 1R5IA 1U6AH 3TO4A 3ZKMD 3CFQA 4Z0XB 4JDTH 4K9EL 3KXFD 4A2EA 2FECI 2BSTA 5IR1A 1D9KD 1XF5A 2ESVE 2VITA 5CZKA 2B4CH 5DHVB 4KK9C 5DTFA 3UC0H 4HU8A 3QGVA 2NY3B 2ICWI 3FZUC 4XNUH 5MEQA 1AG0A 2JTDA 1T7YA 2HN7A 4KRPC 4P3DB 4UT7H 3NTCL 5KYNA 5IMMA 5IG7B 4Q9QH 5L2KD 5HD8C 5DGQA 4LCCC 1UB5B 3NEOA 3X14B 1KPVA 4O4YL 5AL0A 3MLRH 1BW8A 5CN2A 2EVHA 3KPSA 1DO6A 5ESAB 3VYPA 4LLUA 3WO4B 1S5IL 4EEEA 5B38A 1ZGLB 3ZTJH 2XJLA 1E4KA 4FJZA 3TT3L 4UTBA 5AOJA 1NKRA 3GO1L 3N42B 3ZUNC 4J8RA 1AP2B 2FLRT 2CJTA 4M7JH 1HH6B 3G04A 2EVIA 5I18L 1N12A 2Z4TA 4PB0L 4PJXB 2ZWZA 4X2UA 3RWEA 4ZTPH 1Z9OA 3TIDB 1U8HB 4GRLD 2V5SA 4UQ3B 5BRPA 3OPZH 4KJYB 4AWJC 1OGAE 3EJSA 3MGOA 3OXRA 2G0KA 3FBQA 1BXUA 1ML0A 1KG0B 4ZK8A 3VVVA 2EO9A 3BVUA 3V5DB 3VX1A 2PCXA 1KTDB 3BVTA 3G5YA 3PAYA 1J9CT 3II1A 2EYTB 1AXIB 3CUPB 5IV2B 4PLJC 1IM3D 4Y4HA 1AHWA 3GSVB 1PAZA 4JPVL 5EIVA 5FIEA 2WQRA 4WNQB 5I6PA 1BA9A 5E4OA 1SY6H 4AEEA 1SOSA 4H2CA 5IQ7H 5H37H 2QQNH 4P2OA 4UM9D 2WQ8A 3AZUA 5I82A 3NK3A 1Q9WB 1BSIA 2OA9A 2YJQA 5IROA 5LBVA 1UCBH 1I3VA 1YJDH 4R7VA 4JGNA 3GMLB 2FB4H 2JLLA 1EXGA 3IN0A 1R24A 2PYEE 1F97A 1TU2A 3BW9B 2BNRD 3QH3A 4ZFGH 4N6QA 3GXPA 4U2ZA 5KBPA 3RGVB 2A9NL 2CQVA 5E0QA 3EXJA 3EO1A 4EZKA 3QQDB 3O6ML 3GZPA 3B83A 3GJEA 4PV9B 2VISB 1SVZA 1RZJC 1T2JA 3MRRB 4XMVA 5FDWA 3FUKA 3JBG7 1YMMD 1AQKL 2YLKA 4JFFD 3VXME 1FGNL 5FOBB 5G4NA 1IAIH 1T89C 3RVXD 3U9WA 2JJWA 3FTWA 5D1ZA 2QQLL 3NGBC 3Q5TA 4YJZL 2VDNL 3KPLA 3NJGA 3VO0A 2Y0SA 2WTPA 1ZRUA 3HTLX 3GSOA 1VFAB 4FFWD 5JMRA 4N2EA 1FG2A 2Z3FA 3F8UB 3JVFC 1EXUA 2KS0A 4KXDA 3DXAA 4U6XB 3IGKA 5E2TH 3O0RL 3BQVA 3QUMB 5FFLA 4IBTA 3CJJA 3QRFM 1BAWA 4DPAX 4HBCL 3SDAB 2F8OA 2VLRD 2G9HA 4RGMB 5I24A 3ZK0A 2CDEA 1NCDH 1A6UL 1B0GA 3EH5B 3VXPB 5DA0B 3TJHC 3KG5A 2K78A 1C7SA 1R6VA 5ANMB 4LKCA 3GI9L 1C16B 2FHFA 4I7ZC 1M9SA 4OZFG 4PTUB 5IT2L 1SHSA 2B5IB 5AVSB 3H85A 2DZEA 5LBSL 2CALA 5DYOA 2FYYA 1MG2C 4AUUA 1YPZE 4NT6A 1OCZB 3RDTD 4WHTA 3EYQD 1GYCA 4OCRH 1F41A 4JDZA 5HDRA 1ZKAA 4DP1X 2C9AA 1W8EA 3CQPA 4TUOA 4N0CD 1OGPA 2OL3L 3VD1A 1KEGH 4ODWB 4PB9L 3EBAA 1WCBB 5ERWA 2IDTA 3QJUB 1T5XA 3NACL 4QRUA 2IADB 1A3ZA 1NMBL 2MSPA 2XPZA 3C5ZD 4WI5A 5BUAA 4JAMB 3UADA 4ZW3A 1A7RH 4U1NA 3HRZA 3KLQA 1HZKA 3FUIA 3VGAB 3CHQA 4TNGA 2W0KA 3WFZA 5IBUB 2NX5A 3DPDA 4ABWA 4HUXB 4I3SL 3TPUA 4B9GA 2LU7A 1S9YB 1UB6B 2IF7A 8PAZA 3LH9A 2WBJA 3QDJD 4X99B 4NQDE 1DQIA 4NRXA 5TK2A 2HAZA 3MN8A 3O4LE 3C60C 1NUDA 5KSBB 43C9B 4YDVB 1K6QL 2GBVA 3LCYA 5BVJB 2X4PB 4MLIA 1ASOA 4OZ4A 3F04A 4AL8H 3LXBA 3HN5A 1JV2A 2BIPA 1DBML 3TBYB 1XX9C 4QIRA 1U30A 1WBYB 4FXTA 5EOQL 5D2NC 3FQWB 4XVTL 4A63A 5IJVA 5CN3A 4QYOA 5HHXL 4YSPA 1KBKA 1T0MA 4Z5RA 2NY6B 1PFOA 4N86A 4DP7X 1NWOA 3A0OA 4P23C 4KXAA 4B27A 1QPXA 1AO7E 4AIXA 3PGCB 3KPRB 3H2WA 3QORA 4XN9A 3OMNB 4X6DB 5IFHL 3OZLA 3SPIA 1P7QD 1MJJA 2CA3A 1T66C 4AJYV 2APTA 4APQA 2X89D 1DQVA 3FS9A 1ROWA 1T5WA 4GXVL 4OVUA 4RFOH 1N7MH 1OSPH 4PJIA 4HIHB 4JS7A 2DB8A 1C5BH 5LAXB 4D9LL 4XMPH 1T21A 5AW4B 5DO2D 1AE6L 1E4WL 4UANA 3AFLA 1YPZF 4G59C 3PIQB 4BUHA 1MVUA 3C2AH 1D5XA 4GEIA 3RZCD 2CDGA 2BHZA 1MXGA 2VDNB 3WENA 4OV5B 3HRPA 2V7NB 5IB5B 4YIQA 5BS0B 1J0YA 2F53A 1KIPB 2L4OA 4PG9B 1CBVH 3FN0L 4WW2A 2VN5A 4QTIL 4NO5A 5I1HL 1MHCA 4HT1H 1QI4A 1ZT7B 1MFMA 3CN0A 3BKYL 3K4DA 3VWJA 2YFNA 3WEMA 3FO2A 4N9OB 5FYKU 2HVJA 1MQKL 4ONFH 1W15A 3CLEL 4JY4B 4YSTA 4WWPA 4OCWL 3VXQB 3B7SA 3PWNB 4KK6C 1ACXA 3U2SA 4C57C 3UPRB 2DH2A 5FM5M 1ZT4A 3LY6A 1FZMA 1XSJA 4GG6A 1I8LC 3ESOA 1GVIA 4O2FB 1JRHL 3NSCA 5DEGA 2WANA 1W80A 2XA8H 3TO4C 3MCKA 5FA4A 4PHXA 2ZOTA 4LEOA 4KX9A 1H6FA 4CU7A 2C9VA 2HMID 3MLTA 4RMWA 3MU3A 4Q52A 5SWZD 4Y2DA 3U9UB 2BY2A 4E9YA 3QHFH 3ZBMA 1R3JA 3QUMH 3D18B 3MLXH 2OV0A 4GBXA 1F4AA 3MBXH 1BFVL 2P9RA 1CE1H 2ZAHA 4WFEE 5F2FA 1J05A 1XGRB 2JCCE 2R9HC 3FAWA 5DRXB 2OL3B 1UXWA 3LRMA 2ZNXA 4XCFL 5E70A 2Q10A 5C71A 5JLZB 2PYEB 2L3BA 3JTSA 4XNDA 5KYYB 4M1GL 2AXJA 3P4OB 3WKNA 3GXTA 1CLZL 1LO4L 3CPLA 1S78D 1THCA 3I75A 1XGPA 4XPFH 3QJOA 4M93B 2J2ZA 2AQSA 1BZQK 2W81C 4K9EH 2J1WA 5H4ZA 3I6KA 3BZ4B 4KHTH 1MFUA 4OM0L 3P54A 1E3ZA 4U7SA 4E68A 3P3TA 3LV3A 3U1PA 3B9EA 4YHZL 2HT4C 1OTUD 4L4VD 2VN7A 3NTCH 4NKOB 1MW2A 1U8IB 1WP6A 1V5JA 3PHQB 2X4UA 4O9HL 4DWHA 4XC3L 2BC4B 2FHBA 1S9KC 4MA1B 4O4YH 5G5DB 3VH8G 3OR6A 2QPUA 3BVXA 4J3OG 1NC4B 5CBEB 1OAQL 2FTAA 1P5UC 3IF1B 5GSVA 5GS0H 1S5IH 1KGIA 2QADB 4LOEA 5F8QC 3LEXB 2X3AA 5JQIB 2E8ZA 3TT3H 4BFEA 1EH9A 3GO1H 3BYYA 2Y5TA 1MCKA 3PHOB 2ED8A 2Z7WA 2D7PA 3Q9PA 1URIA 5I18H 3QQ3A 1I7UA 4PB0H 5AD0B 2AW2A 2Z4QB 5F6IC 4BGDA 4QRBA 1S4IA 2GITB 1XH0A 3GKWL 3MKKA 3HI5L 4AH2B 2Z8WC 2WLYA 4N2DA 1D6VL 3T2OA 1U58A 1WDAA 2R0WL 3NIFE 4LCUB 3BSHA 4B9ZA 4JPKL 2J57A 2WTRB 4L0ZA 5GZNC 2V9UA 1XL4A 3FTSA 3MV9A 4JPVH 3DUSB 4M5SA 4NRZA 3B2MA 4OGXL 1CFTB 2Q76A 5FWRA 4BUGA 3U4EB 5FYJD 1CGYA 2E9GA 5IW1B 5F96L 3AREA 5D1ZC 3FBKA 4Y2NA 2KQNA 4HSCX 3B9KD 1MY7A 2EH8L 4FYSA 3H7LA 1J5HA 1DJIA 5IB3A 1I9RL 5I0VA 1IC7L 1ZHLB 1ODUA 3TBCA 5FDYA 4YPJA 3D2UA 2BIHA 2A9NH 4QRAA 4RRPA 1MCJA 2O4EA 2WVSA 4LL1A 4EI5B 5ITFB 3SZKC 4A7TA 1PPIA 2IH9A 3O6MH 2WOBA 2XUWA 3KWWB 4CMHC 4MS6A 5K39B 1HJCA 1GTFA 1HL9A 3F00A 1M7XA 4ADGA 4LSPL 4N5ED 4IRSA 3C8KB 3N43B 5DI8B 2CHNA 5I23A 5ABAA 1UADC 4P9HL 4JY6B 1XL6A 4OAWA 1AQKH 1HHKA 2CO7A 5KANI 1FGNH 2WXKA 5CD3A 2QQLH 2YEVB 1J87A 4IHBA 4WI9A 2VDNH 4FNUA 3TBTB 9PCYA 2R83A 4ONGL 4OFDA 4TTGA 5E9DD 3DJZA 1YEFL 4W70A 1E9QB 1LYQA 4BE5A 1FVCB 2CGZA 2WWKT 3NA4A 4P4KA 3GDBA 4XOCA 5DD6B 3GS0A 3EDEA 3O0RH 1Y7VA 4D0CB 3HG5A 5FGRA 1HXYA 3TA3A 3WDIA 4FTVA 4HBCH 3ARUA 2C9RA 3BZDA 3LKNA 2XY2A 4W9EC 3W9EA 4LLAA 3VA6A 3PWUA 1AO7B 1X5YA 2J5LB 3K8MA 3B8YA 3GI9H 3P77A 1LDPL 1R5WB 1H3PL 3LS5L 4K3EL 4PG2C 3FO9A 5HXMA 5IT2H 2QSTA 5LBSH 4B60A 4FQXC 5GZOC 5GGVY 3JV6B 5HYQB 3NIFF 2F6AA 2P5EA 2WBJC 2WCPA 4KQ3L 1RERA 2ZX9A 4JKMA 1OIOA 2OMYA 4IJTA 3VU2A 4MJ5B 2O5YL 4HCFA 4J3TA 4XVSL 4HUMB 1M2OA 2OL3H 4BZYA 3PPSA 4PB9H 4Q9BA 1EDHA 3ROLA 5C7XL 3FFCB 2WP3O 3NACH 4ANKA 1NMBH 2AAVA 2O6DA 3WIHA 5JPNB 2E75C 2RFXB 3F83A 3QIWC 3VXUA 4OZGA 4IW4C 3MV8E 4XXDB 3QSKB 4PJGE 2GJZA 4YGVB 2RAMA 3FYEB 1KPUB 3CSFA 1HAUA 5HYEA 1MJUL 2W5PA 3ATBA 2Q87A 2QGDA 3F7LA 4HJ0D 4XWGL 2P46B 1TQCC 5LLIC 1A4JB 1XGUB 3QORC 2X38A 1FSKB 1K3ZA 3O3DB 3O8XA 4WTZG 2BSSB 2M83A 3R18A 4QHMB 4NRYA 5HDLA 3DWTA 3D05A 3RUGA 2IPTL 1M05B 3IB4A 4M3HA 5AG8A 1K6QH 3B9VA 1OPOA 1KCSL 1GGUA 3V6FA 1IBZA 1QP1A 1USQA 3GNML 3RURA 4ZSOA 5CBAB 4OIFA 5L4FA 4LIQL 3IDJA 4BH7A 1TETL 1QAWA 1DBMH 2ORBL 4M1DL 1S9WA 5C07A 4OY9A 2IEPA 1PF3A 3A4FA 3TTSA 2OAAA 4GUPB 4LPXA 1BZ7A 5EOQH 4XVTH 1NFDA 4K5OA 3TIEA 3AROA 3VWKD 1LM8V 5HHME 5E6YA 5HHXH 4G9FB 5LDUA 4AYBA 3S6CA 3C6LB 5HYIA 2JCCB 4XGZA 3ECBB 3LQZB 3NJLA 2KI6A 2PWDA 4JREC 5I9QC 3HI1A 2CK2A 3QDME 5ANHA 4F1ZA 1Y6MR 2A9AA 2KL6A 1UA3A 1LGVA 3O81A 5K1VA 2OXHA 3MBWB 3JYCA 3H9HB 3VWJC 1TFPA 1R3KB 5IFHH 1P5VA 4UIMA 3UO8B 5D96C 4B9FA 3ABZA 1F4WL 3VM5A 4UTCA 2XCMC 4GXVH 3V6BR 5KBDA 4Z6AT 1H15A 1BBJB 2IVFC 4L8BB 4YS4A 2W0FB 2YKKA 3P73A 1J9RA 2ZXDA 4D9LH 4R7XA 1XIWB 1MFVA 1AE6H 1E4WH 2VLLA 4EUPG 3SY0A 1VFBA 1XMWA 5C7ZA 3DIFB 2UXFA 4OFIA 3ARRA 4Y2DC 1M6OA 5AB2A 4F15B 1U4FA 1YUHA 3FN0H 1BD2A 1WICA 3HUJA 3LZQA 4OJCA 5I1HH 3RI5F 1FLRL 1BLNA 3BKYH 3SKUD 4HIEB 2CJSA 1NGXA 3QW9A 1MQKH 2C7UA 1G7IB 2G0LA 3F6IA 4UWQB 2DEYX 2VN6A 3CLEH 4LVHC 4IKLA 4N0UE 5DURB 1MQ8A 4OCWH 1QX1A 3WS3B 2ZKMX 1MCPL 4RA0C 3RGHA 4Z3JA 5D5MF 4PJGF 1SN2A 3N1PC 1B2WH 4HLZG 2X4QA 3ECUA 4MCZB 1ZY9A 5IMOA 5F9JA 3KPMB 3IS1X 1I8UA 2Y1YA 5FS5A 1JRHH 2W60A 5BJTA 3EJJX 1XMEB 4DK6A 1CFNB 5G55A 5TH2B 4LPWA 4YSUA 4HJGB 3II3A 3K2MC 1UZGA 1S3RA 2XN9A 2XG4B 3NDZE 4ACPA 3RKDC 4DZ8B 2BP0B 1BFVH 4AYFB 1XQ4A 2ZF9A 3L54A 4ZOEA 2EVFA 1Q4NX 3VD4A 1DHKA 4HHGA 2VSCA 2PP8A 2QELA 3WGUB 5HDBB 5FFOA 2UZYB 3FT2A 4XCFH 1MCFA 5TGBB 2IALB 2NW2B 3RWCA 5T5FA 1ZLVH 1U93A 1D5BB 1HVXA 1CBJA 2CUMA 1CLZH 1LO4H 4JJ5B 4LVOC 4DP8X 5D7JC 4PVNA 4EO5A 1WV7T 3OAWA 5EC2B 3FHQA 2A9DA 2HLFC 3D85A 3TEXA 2NYYC 4PWJA 2VLJA 4OM0H 5DFWH 2WNWA 4JFDE 5FECA 2R0ZL 1OCCB 1FL6A 3AU1A 3D12B 3LAFA 3BP4B 3WMSA 4YHZH 1IGML 1VADA 3DHPA 2WLLB 3F2LA 3QUYD 5DA4A 3X1FA 4PJCA 3PWVA 4O9HH 2X40A 4XC3H 4KGLA 3WNOA 3MRPB 1DBAL 2XWEA 2D2OA 5JUEL 2AZAA 1CU4L 2CGRL 1OAQH 1P7BA 2BJML 3BAEL 4U33A 2Q8BL 1ETJA 3ABGA 2X9ZA 3QCUH 4QOKD 1KXQE 2VL5B 4PW4A 5AB1A 1JZ2A 4B7IA 5DC9B 2D7QA 3HCVB 4J3VA 2CHZA 4FAAB 5T1LB 2HT2C 3T6ZA 2YJLA 3IDXL 4OF5A 3GKWH 3HI5H 5DRNB 4D8PA 1JGVL 2V2XA 2XVBA 2E8YA 1F0LA 3UX9B 1NDGB 3UJTL 2OFQA 1D6VH 5FGBC 1Q38A 4LLYA 2R0WH 3OHXC 3QUXA 4DPRA 4JPKH 1NPUA 1K5WA 4PRPA 2VXUL 2BVUA 5ACZA 4L4JA 2FZ3B 1TSHA 2BVOA 2FQEA 2FR4B 4ZUVA 1FFNA 2YPLE 3GDCA 3ZKSD 2H3XC 4OGXH 1U21A 5DLML 5MERB 2WQXA 1SHMA 4UU9B 1Z66A 3MGTA 2XFXB 5F96H 2DJUA 3U6RA 5FW6A 2XWRA 3ARWA 1AD9B 5KVEE 4IGBB 2ICEC 3L4TA 1HCFX 1T4KB 2ZKXA 4JQIL 3VXSB 5INDB 1FRGL 2EH8H 1AGBB 2N1KA 4AIZB 3SKNB 1I9RH 3NAAL 3ZDYB 1Z2KA 2XIIA 2YXVA 5JIKA 2APVA 4HFWB 3VSUA 1BQRA 1Q9KA 1LP9F 2FL5B 5B3NA 2MNJB 5C0CD 3ROOA 2K0RA 2VDQL 2BP8B 1N68A 3UYPB 3TA3C 2YFOA 4FQHB 4YVNA 1IEBB 1NAML 1JZ8A 5EBLB 1NLBL 1U8CA 4HU2A 1ETZA 3IKCA 2WYIA 1KB5L 3BSGA 3EDDA 3OAUL 4P9HH 5IK3B 1UGKA 2XPGB 2J1YA 5FO9B 1XGTA 1AKJD 5HHOD 4Z7NE 4GY4A 3Q6FB 4N4YB 4NYLA 5C0BD 4Z7QE 3EH4B 3CDGB 3GLEA 3GRWA 4JZNB 3UO1H 4ONGH 5FW8A 3RVTC 5AAMA 3HI6L 3V0FA 4YHPA 3T4AB 1YEFH 2BVYA 2X2HA 1LTXA 4Y16B 3UAJA 4HZAA 3VFVB 3U46A 4LVEA 2EC9T 3C08L 3KPPA 3SDCD 1HEHC 3CDZB 3W11C 2Q7YB 1SJEA 5EU6E 1HWWA 5IHHA 3BWAA 3T09A 4MB3A 4J23A 1J0ZA 4AQEB 4POUB 4C83A 3HPLA 3ZRCC 3AITA 4UOJA 4PRNB 3RG1C 4JHUA 4ZYKB 3OKYA 2OSWA 1RK1A 4MJ2A 3AXLB 3DO3A 4QCIA 3PWLA 1LDPH 1RCYA 1H3PH 3K2UL 3LS5H 4K3EH 4AV0A 4CVZB 4YX2L 4C4KO 4WWKC 1BG1A 3NFNA 3BEVA 4PRBA 1QEWA 1MDTA 2V5MA 3DVNB 3GMPA 2UWEE 3OKMB 3O8XC 4KQ3H 2VKXA 4WGWB 4CMMB 3IDGA 4MDIA 3ECWA 2G30A 4XVSH 4ZUTB 1QPPA 2J8OA 4RAUA 5HJ3A 5D1QD 3V5KB 1HYSD 4PP1C 1CD1A 4LLDA 2FWLB 3PG2A 1X6LA 3PABB 2WY3B 4EZMA 5C7XH 5EDSA 4I8DA 4UNTA 5HGHB 1RV6X 3CBRA 2EKSB 3KYMB 1MPAL 3NJXA 4KU1A 2WUCL 4ETQA 1OOAA 4E9VA 4QT5A 1LEKB 1CGUA 5FM4A 1MREL 2YC1B 3M17A 2DYPA 4TN9A 1C08A 4BJLA 5FO2A 4JX0A 4AMKH 4Q6YA 1J1OL 4QF1B 4R84A 5KVFE 2GBTA 3VDAA 2Y1VA 4QXTA 1WISA 4K7PX 4XWGH 2MCPL 4LDOB 2VZ1A 5BVPL 1GGYA 4MBOA 2OJZL 3DGCR 1NCJA 1PZ3A 4Z7WE 5ID0A 5I6OA 2DI7A 3QIBA 3WV0A 1JGLL 2IPTH 4NBZB 2W9DL 1AIFA 1Z0MA 3ELAT 1NOFA 1KCSH 4NCDA 3M1OA 4X8JB 2IPKB 3GNMH 1IAII 4E5XG 2FSEB 3BAIA 4LGRB 4LIQH 4MGXA 4PJ5A 4Z7QF 2ORBH 3EFFB 3OAYH 4FG2A 2BNQD 4DKTA 3JUYA 4XHJC 5ID1A 5HYJD 2ZOKB 3EZJB 1DEEA 3MRNA 5DHYA 4ZXBC 1F18A 3UTZB 4R0LB 4NZFA 4C58B 1BX2A 3G6JA 4TSBL 4CGTA 5JW4Q 5EO0B 1ZHNA 3CC5A 2R2BA 4KROC 2IANE 4DAGL 5GS1B 3DBSA 2O6FA 4C55A 2GBUA 4NN5B 5JHDA 3UTSE 2C1PA 1F4WH 3I3DA 2HG5A 3PFQA 1JK9B 5LDSA 2W65A 1OF0A 2VN4A 4OW6A 4WI0B 5F7HA 1GL4B 1NAMB 3SHSA 3O11A 4PCKA 2AKRB 1KB5B 4Y4KB 2H9GB 3MOBL 2JE8A 2Q1EA 4Y19E 1C9SA 2DQJL 5ACMA 5DJ0A 4X9GA 2DWEA 1U8JB 2FBRA 4W6WB 3LRSA 1OB1B 3BD3A 2GK0A 1KIUB 4UM8A 5EOCJ 1FG2B 2BSBA 3BFOA 2XZQL 4ACTA 4NLAA 1S7WA 5FKPB 2QPEB 1FLRH 1QLFA 4GAYA 4YAQA 4MNQA 4QTHB 2HSIA 5D7IE 2D3LA 1ZT1B 1KLGA 2X4RA 1Z5YD 2ATPB 2CNZA 1QSFD 1MCPH 3BT2L 5C8JA 3MJ9L 2UXGA 4LCWB 5CEZL 1GW0A 3FOMB 4TVSa 1SJHA 2CRMA 2DICA 4OCSL 5JQ6L 2FEEI 4NQXB 1W8NA 4F7KA 1CD8A 5I15L 1HWHB 3ULUE 4ICXA 2VM9A 2E7LC 3LNIA 3P4MA 2NUTA 4Y5VB 1XZWA 1U2HA 3PQYB 4YHIA 3CFNA 2IXQA 2R1YA 5J9PB 3MC0A 4ORGB 3LZNA 3X13A 3OC8A 4AGMA 5KYXA 4JKWA 1JVLA 2JKJA 4R7NB 2EEAA 3D0VA 4QY8B 1O5DT 5AENA 2J4WL 3V4LA 5EHFA 1YZZA 3BIKB 3VFRA 1JP5A 3EO0A 5FWQA 3GINA 3T3PF 3OG6B 1P7HL 4ZUUB 1S7RA 4NERA 1Z9NA 4KKCC 4AEIL 2D3NA 4MMYB 1U36A 4P2QE 2VUKA 3I6LE 5DJ8B 4PQXA 3KVDD 4LNRB 4BFRA 2VR9A 2F54B 1QBBA 3N40F 4WV1B 5AWNL 4WTZA 3VDBA 2R0ZH 4OI7A 4PJ9C 5I0DA 2ATKB 3QNYA 3QZWB 4JZJB 5LNEA 1IGMH 3X1EA 4BFGA 2R7EA 4ICWA 1TNNA 4R5XA 3G9VA 4U1SA 1DBAH 4UTBH 3T6XA 4JDVB 5JUEH 3KGSA 3QI9C 5JXEA 1CU4H 2CGRH 4YUEL 3BAEH 2BJMH 5D1XE 3BSZA 1JE6A 2Q8BH 4ABVA 1P4LA 1Q9OB 2K8MA 5CP7B 1HK6A 2ZXWB 2GKIA 5DVLA 4A2MA 3AACA 1VENA 2BZDA 4ISVA 1OSZB 4LP4A 3IDXH 2AMUA 2AAAA 1JGVH 4O58L 4P2CG 5DDHB 4C56B 2JB6A 4N8VB 4ONHA 3VSVA 2DJMA 3UJTH 3WE6B 2UY6A 3WN6A 3MYJA 5IVNA 1F3JB 2MHAB 3CHRA 3FT1A 3KAAA 5DFVD 5LNDA 2BVPB 3IGLA 1IQDA 3SEPA 3ZSSA 5GRYA 5T1JA 1KJMB 2R1WB 3FHAA 5KBLA 2M26A 3TONA 5DLMH 3AS1A 2VRQA 3E6FA 1TMCB 3SDDA 5AKSA 5IHZA 2VR8A 4K15A 1A22B 3VCLA 4I0PA 1KF9B 1TLMA 5KN5A 1VZIA 1MCWW 4L2LA 2BVTA 4JQIH 1JCVA 1FRGH 3D8MA 2GVYA 4M4RB 1OGSA 1Y1UA 3ATFA 3NAAH 4GUQA 5L8JB 1YAZA 5EU7C 5TJWK 3DUUB 2JTYA 3TA4D 2NYZA 4FTDA 3HE7D 1BBDH 3RWIA 1KBPA 3L5WB 4S2SA 3BAXA 1U8OB 2VDQH 5DQ9B 5E4AA 1ZPUA 4N0YL 4PRHA 3F85A 5SWSA 5DJZA 4FJYA 1NAMH 1WAPA 2VSMB 4WO4D 1J8HA 4ELMA 1NLBH 2H4EA 4I2XE 1KB5H 4HIPA 4K3DL 1RPUA 3F58L 4ALAL 1T20A 2HJFA 1H0DA 1ZDQA 2DJSA 1L9SA 1RZKH 3H42L 4Z7IA 2CBTA 1E9OA 4QNPE 5LGKA 3HLKA 1PX8A 1KB9K 3OVUB 4PSRA 2WLIB 4N3TA 1RUML 2DQUL 2XQYG 3HI6H 1RH8A 1QHQA 3IBOA 2Q0ZX 4DVBB 4GINA 3DA0A 2JELL 4OLUL 4V1DA 1KJ2B 1VIWA 1AYOA 3FH8A 4XODA 5GGSY 1UG9A 2EDHA 5HPMB 1XV8A 4DKDC 3C08H 3V79C 2VJXA 1UGNA 3LRLA 3HHRB 4G71B 2P26A 5EUOB 1A9VA 2Z91A 5B1JA 3ZE0F 2IH8A 1FN4B 2ZIDA 4KTYA 4X6CF 3MAWA 1WE5A 4P3CL 3TH2T 2H45A 1TKWB 1HDMB 3PHAA 2Y6SD 3VRLE 4P57B 2EE0A 4AQ1C 3K2UH 2AXGB 3MTRA 1D7BA 1KTLB 4YX2H 3BQUC 5LBGA 2EE9A 3VRIB 4HKZB 2I7SA 2V5RA 4TLSA 2GJ6A 1VJSA 3AT0A 1E6OL 4S1QL 2HKFL 2XOTA 4NIKB 4QXUL 2HTKD 3Q1SL 4Z7UE 4FFVC 5IKCA 2I26N 2CXKA 4PRDB 4Y19B 3UACA 5GGUB 1WC7B 3V2AR 5KVMC 1A4KB 4PH8A 4HWUA 4KTEL 5I28A 1MPAH 3MUY1 2WUCH 4JRYB 4F33A 4LHUG 4OD2B 3CG8A 4P9ML 3FN3A 1MREH 1Z5HA 3DV6B 3A5VA 3PWPD 1Z5LA 1ASPA 3N42F 4NQCA 3O9WD 3HE6D 3ZN6A 1MHHA 5EBWA 5F7UA 5F7DB 4GKSA 4MHHG 3WO3B 1PYWB 2MCPH 1A64A 3QZPA 4QGTA 2QEJA 4X4YA 5BVPH 1EXHA 4PV8A 2OJZH 3CTTA 3D39A 4FG6C 3DSFL 3CXDL 4P49A 4MD0A 4DGVL 2FD6L 1BOYA 2VAAB 3BPCA 1JGLH 2W9DH 3IJ9A 4PBWD 2CCVA 3QAQA 4J5VA 5C08E 2GTWA 3QO1B 4I9WD 4D8OA 1KCRL 4OFVA 1TJXA 2VQ1B 1KIRA 4HKBA 4F8NA 4HJEA 4MJ6A 5FKAA 4DETA 2R2EB 4YE0A 2FCBA 2X4NB 3VG9C 2KLRA 4RGNE 3H7BA 1RP9A 4YXHL 1LE5B 1QFWL 4KK5C 3MX0A 1BJ8A 2P24B 1FDLL 5I1AA 3SQRA 4LLVB 2XTJB 2ZYSA 3CCHA 4TSBH 3TJPA 4XZUB 1SXAA 4NJAL 3BUYA 4DAGH 3DV4A 2CO4A 4GXFA 4DGIL 1OTTD 2YMXL 1VKXB 1PX4A 2WQWA 3LSOA 3K5RA 1BHGA 1ADQL 2XV0A 4M7KL 2PYFA 3F6JA 4YC2B 3U4BL 2B9BA 4Z8FL 1FFQA 5F7NC 5L9DL 2NY3D 1PCSA 3DRTA 3DOSA 5L2KA 3FSOA 3AUVA 2G5RA 4KI5F 4CDHA 1RXLA 3VQLA 5HYSA 3MOBH 3ZQWA 1P7KA 3Q2NA 2DQJH 3SD5A 4X7TB 5AALA 1FZOB 1Y0LB 3B5HA 2CCLA 1CFQB 4BV1A 4L3ED 2XZQH 4CN4A 4LEBA 1DUZA 3CMOL 1OTSC 4GRLA 1UXLA 1ITBB 5CHNA 2P7TB 1G9ML 3ARDC 4I87A 4N6RA 2VR4A 2PN5A 1OAXL 2AV7A 1WT5A 4TV3A 4QHNA 5EPMA 2OXGA 1N0XL 2LAGB 5GRWA 3BT2H 4JM4L 2PMZA 3MJ9H 5CEZH 5IBLC 4GW5B 1IM3A 3KNBA 4MJID 4OCSH 5JQ6H 1O9VA 5M94B 2V2TB 5I15H 4JN1L 5LXGL 2QGEA 4G7QB 4U1LA 1MFCH 2ITDA 3ILPB 2WIIB 3VQ1C 2UV3A 1MRDH 1BV8A 3HZVB 3TVMB 1FG9C 3FT0A 3QXWA 4J3SA 2YARA 4OBSA 2P44B 4OF3A 5TF0A 2F7QA 3TBBA 1NCAL 1WFOA 1X5JA 4WW1A 1CDGA 4ILDA 4P06A 1TLKA 3HZYB 2QPFA 1E8XA 3EOAA 3R0NA 4AKOA 1OK0A 1SGKA 1HSAB 2J4WH 2WXHA 2Z1KA 2Q86B 2CHDA 5MP6L 5J3HD 3M86A 5JXEC 3IK2A 1T80A 3HOGA 3AGVA 3RGVD 3S4SG 1AIZA 2DD8L 2I07B 3VGDA 1MCCA 4RBPH 1DJYA 4AEIH 3LTVA 1F5WA 3JQOB 5GGQL 3V8OA 3TTYA 3RVWC 4K8RL 2Z31B 2Z34A 1FL3A 1S7UB 4JFFA 5AWNH 1J8RA 4YDIL 4ZPTB 3S96A 3JV0A 1PZ2A 2E7BA 3DSNB 3OBAA 5CS7A 3DBXB 4BD4A 5C6WH 5IJCC 1HXKA 1IGJA 1JV5B 3G5WA 4NRYB 3RUGB 3WIFA 4NPJA 1BFSA 3KWUA 2DQFB 2APXA 2YN3A 3QWQB 4WFFE 5IM7B 3H2QA 4AGLA 4Z0BH 1YEDB 2CU9A 3BE1H 4TTDC 1DJSA 4XP9L 5LGJA 2EE3A 5EO1A 2PXYB 3FTGB 3O6KL 1L0PA 4YBLC 1R1CA 2DAVA 3P2TA 3V0AC 4I0PC 4N2LA 3V6OA 3HKFA 4PMEA 1T22B 3JWNH 5IHWA 3SDAD 4U4BA 5DR5L 3L4UA 2ENJA 1UWXH 2BXYA 1A7BA 4U1KB 3ARBB 1JUFB 4V11A 4WAFA 3F01A 4NX0A 2N7BA 2XNAA 1TVBA 5EU5A 4O58H 4OJDH 3MRHA 4N2AA 2MQGA 4QRRB 5I1KL 2GJPA 1DLHA 4JHBA 4Y2LA 4WQOA 4X6DF 3NA9L 2ZP0T 4ZT1A 3RBSA 4JKLA 3RDTA 1X5AA 5ECJE 1ZA3B 2G2RA 3S35L 4DZBA 4JRFA 4POZC 4N5UA 2YAPA 4X6BB 3RDJA 3Q9QA 4NM4L 1AGEA 2Y24A 4JFHE 1JRHI 2ARJQ 1A02N 1QA9B 2WB1A 3C5ZA 4K5PA 1FAIH 4PP2B 1ZWIA 5GRZA 1S5HB 2PLTA 4DIXA 1MFBL 2FAUA 2FJFA 3MACL 4HUWB 1BIHA 5G4MA 1UUNA 1HJBC 4Z23A 4DCQB 4QO1A 3W9DA 5CU5A 1BLIA 3B8SA 5EC1A 4FQJL 1RMFL 5I0ZA 3QDHA 4GRMB 3HMWL 2KZBA 1KB9J 4GO6B 1WWCA 2BNUA 3C6SA 2W88A 1E7UA 4N0YH 3A4EA 1H8OA 1MFDL 1B0RB 3VD9A 2Z65C 1IGFL 1BOGA 4G7RB 1G1YA 3GRWL 1N3NB 1Z32X 4K3DH 1B3JA 4OZFB 3WI9A 4ALAH 4ENED 5IMOB 4TS6A 3H42H 4QYAA 4JPWL 5ICUA 1SOXA 4HQQL 4JPIB 2ODHA 1K5NA 4JFXB 5ICYA 2MQCA 1RUMH 2DQUH 2VW6A 1G4MA 1X6NA 4JO1L 3SJVE 2JELH 4OLUH 1W0VA 5DUBB 5L4MA 5MEPA 4RZCB 3IDYC 4POYA 1ZE3C 4MCYB 4PGZA 4AM0Q 1TOXA 1KIQB 4K73A 3FK3A 2NY6D 4BK5A 4NZDA 3WN5A 1FFPA 3RTQC 4PWHA 4QRTA 3TYFB 1G9EA 3KPRD 4Y8AA 3GRGA 3DC0A 3QP3A 4L3AA 2MFNA 3LKRB 3B2DC 1RZQA 1XWVA 1OT2A 2OMXA 1BJ1H 1IZJA 2X89A 4RVBA 4AVIA 4H25A 1HZLA 3QCTL 3EADA 4K3HA 3MNWB 4JG1L 5C9JA 3KZ8A 3QHZL 3SE6A 2FBJL 5KANG 4Z76B 2FUQA 1KBVA 3W5NA 3GSQA 5BXFA 2UXTA 2UVEA 1ONQB 1E6OH 1C8QA 3BGMB 4S1QH 2HKFH 2C3HA 4QXUH 3RZCA 3Q1SH 3ULSA 3UTTB 4Z77A 1K8DB 3VAEA 1SJXA 1RPQA 3PWVB 4MB5A 2BOBA 3WIHH 1UM5L 3GSXA 2VMJA 4I3GA 4EZJA 1AGCA 5FEBA 3MLZL 1MG3C 4NZRL 4XCYB 3JWDC 4KTEH 4XP6L 4HOXA 4Z78A 2LE9A 3L3OA 5HVWA 5I30L 2X05A 4XVJL 2B59B 1IGTB 3HC4L 4LCVA 4AK2A 4P9MH 5LJYH 1T5KA 1U42A 4IEFA 1FZKB 5TK4A 3WHE0 3GSUB 5D7KE 1NC2B 1AANA 1HS6A 3U4KA 5B4MC 1XZ0A 3N1MC 1ZIAA 3KBPA 4DP0X 4MTMA 3VXNA 2AQPA 5KSAD 3CXDH 2ICWA 4A6YA 4X4MA 3MODL 4DGVH 1JF6A 5I8CA 1NIAA 1WUZA 2ENSA 2FD6H 1KXTB 2CR3A 5SWZA 3B7RL 1OK8A 2EKJA 3LHPL 4GIOA 4XBMA 3ISYA 3RPBA 4KX8A 5ENWB 1KCRH 4PWGA 3GBDA 1AXSB 4G7YL 4XVUC 3BDXA 4NO3A 3BUIA 3DX8A 1CE6A 5C86A 4UQCA 4PS8A 1ED3A 5E2WL 2G4GA 3D07A 3D3VB 4LVNB 3Q8CA 1L0QA 4YXHH 1QFWH 2NSXA 4F27A 5IEKA 4AEFA 2OS7A 3EO9L 4Y4FB 2OMTB 3ZTNL 1FDLH 15C8L 2Y7QB 3QFJE 5DMGC 2PCYA 2KQMA 2PYED 4BH8B 3C8DA 5AB0A 2I7OA 3OWRA 3VE0B 1F13A 1L0YA 2XWJA 4MQ7B 4P46A 4NJAH 4F37F 5I5RA 4PRIB 1LO2L 3QIUC 3DJSA 4NQSB 1FYTB 3G7TA 1S46A 4GRLC 1AR1B 1N0LA 3KCPA 3QRBA 2WMPB 5IB2B 3ZGIA 1LK2A 3HZYA 1ADQH 4M7KH 5AKRA 5DS1A 1QUNB 3U4BH 4L4VA 3WTTA 5A16B 2VH5L 1URZA 3BLKA 5L9DH 2A74B 5DEFB 3W56A 5I0YA 3GSRB 3AQZA 1G9NL 3WFEL 1HESA 4HHAA 3MRCB 1E5ZA 1I85C 2CBOA 4U1HA 5FYKE 1JYVA 4F2MB 1AOZA 5L0QC 3QEQB 1HL5A 2XQYA 3VJ6B 2IBZY 2N4IA 1NC4D 2VIRA 4PW3A 2EDYA 3ZQXA 1JGEA 2PP9A 1U91B 3GMMB 1NCOA 2C9XA 5CEXB 1BZ9B 3CMOH 2J1XA 4MX7B 2UYLB 5C0DA 4YHYC 3SD2A 1G9MH 4Q6KA 2JI3A 1I1YA 2UX6A 5TE7L 3LIZA 2WB7A 3MLUL 3P69A 1OAXH 2H2SC 2BSED 3X17A 2HVKB 4OZFH 3W0WE 1N0XH 4GRWE 4A7VA 5CLWA 3UZEA 3Q5OA 4RSVA 3T4YA 2X4TB 4Y88A 4NPYA 4CSSA 2VNCA 3BGAA 3MRDB 3LXUX 4JN1H 4J3UA 1JVOA 5I73C 2NCEA 1NICA 5LXGH 5JIHA 5CD5C 5IB4B 4EVNB 1KSRA 1OAZL 4ZO9A 5FUCE 5FYLL 4RQQA 3SB3A 1RL1A 3T0EB 1NFIA 1S9XB 3WE1A 2V17L 1XF1A 3VXRB 1DQLL 3QPKA 2FEDD 4WFHD 2WXJA 3VH8B 4OIAA 1NCAH 2A1WL 1PDKB 2F9BT 4MLSA 1AGFA 3EOBB 2AS5M 2OYKA 4GS7C 2BS8A 4GQZA 4R4NC 5MP6H 1XR8A 3ZU8A 2ZUQC 3LXCA 3IFOB 4JRXE 1J48A 1R47A 4OM1L 4EI5D 1JDDA 3MRMB 5C0AE 5ISZB 2DD8H 3X12B 2FJUB 4LPCA 1L9NA 2W59A 4X5LA 1JSYA 3OKOA 5EIQA 4ABUA 2CIKA 2A7BA 3QDGE 1Z3GL 2MIZA 2G60L 4G70B 5GGQH 3V6OC 1C7TA 1HH9B 3US1A 1M53A 2Z92B 4K8RH 1E4JA 1TQVA 3KBHE 4W9DC 4LEXL 3VTTA 4YDIH 3G5XA 5DUML 5A2KH 1JWUB 1TTRA 2N1TE 1G7JB 1LVEA 3WXWL 1XGYL 1JF1B 3BISA 4DNLA 1T6WA 3J07A 5E9DA 1UACL 2CDFB 3EF7A 3O4LD 2XV6B 2BIMA 5TQ2L 4JFWA 1IRAY 5K9KB 3LZRA 3INOA 4HKXA 1D5IL 1Q9LB 3HFFA 4M6NL 4XP9H 3EYOB 1HI6B 4OLVL 1RUQL 3OB0K 3O6KH 3VMPA 1ZV2A 5EWIL 1EX0A 2ALAA 3C5ZC 3OXSA 3PYCA 2YXWA 1RJYA 3U2JA 2MOGA 2AJZA 1EVUA 4HAKA 3ZDXB 4YSCA 4EIGB 4HEME 1SDAB 1C5DB 3QEGL 2AQ2A 3WIAA 1QLRB 2KHAA 1AO7D 3BGFC 1JZIA 4BSWA 4R96A 1I53A 4GMSL 2C3GA 2PCFA 1V3MA 4PJAB 5GRXG 1BGXL 5I1KH 4WEUD 1EV2E 4S1DC 1D7FA 2W9LA 4WGKA 3NA9H 2DY2A 3S35H 3T1WA 2Z7YA 4NM4H 3KGRA 1U8QA 2NLJA 5GS3A 5BZWB 2HB0A 3PUCA 1ZGLM 2OZNA 2P8PB 3GBML 4TNEA 1MFBH 3JTTB 3MACH 1G6VK 3NRFA 2YUZA 4LSSH 1KJ3L 3B37A 2TSBA 3P9LA 5CEYB 3WXVL 4WY7L 1G0XA 3L4CA 3STZB 1G7QA 2V33A 4FQJH 1RMFH 1KN4L 2IFFL 2CMRL 4GSXA 4F7TB 4KVNL 4H0HB 1AS7A 3HMWH 4HK0B 1CVSC 2NY5C 1JJUA 3CZGA 2YR3A 5IFJA 3U1SL 4WK0B 4NCC1 1MFDH 2KZWA 3FB5A 1YEHL 5DS8B 1IGFH 2NNCA 3D4GA 1KCKA 4FLQA 5HY9B 1M7IA 5B39B 3GRWH 4AGQA 4CC4C 1M7DA 3EOYG 4W4NA 3FQUB 5A40E 1DJWA 1SOQA 3QA3A 1FAKT 1RY7B 1S8DB 5C6TL 3CVDA 3ZXAC 2OZ4A 3H53A 1NBCA 4HQQH 3GS4A 2VO8A 4XMZA 2I9LA 1FLTX 4NKMA 4K94L 3VWKA 4JO1H 1HQ4B 1XGZA 3TXAA 5EB9A 3UCQA 2B1OA 3SBWA 3ZE1E 4G9FD 5B1BB 3Q2VA 5CMAB 1VA9A 3C6LD 2X0UA 5BRZE 4S1RL 1OF2B 3SQBB 1JZ7A 5JHLA 1DJXA 2WLHA 1T3FB 2H6PA 2O1AA 1MY5A 3IEAA 2ZCHL 3L3OC 5DZOA 1XSKA 4XE5B 3GB7B 5HDBF 3SO3B 5HJGA 2IAMC 4L3FA 2GTZA 5DHDA 5FHAL 4F2FA 1B0IA 4XXCA 3VI3B 5JPMC 3L4WA 3QCTH 4JG1H 4WNJA 3QHZH 5KAQF 2CRZA 2BIIA 5KVGE 5FPIA 4G6AC 4EIZC 3OKDB 4KRPB 4EF3A 4J3OH 1UURA 2J6EA 4OF0A 3TT1L 2X6MA 3V5HB 1VCAA 1XIWD 3I6SA 4U6HA 5BNXD 5IJKC 4OZHB 2F08A 5IVZA 3F7VB 1OW0A 2C7FA 4QJ5B 3ARGC 3AT8A 1UM5H 3BI9X 1FL5A 1TVHA 3MLZH 4NZRH 4XP6H 1SDDB 3FT3B 4MNGB 5J6GA 4FNPA 4N24A 4X4XA 5LAPA 1J1XL 4XOBA 1MH5A 4XVJH 3BH4A 5C1MB 3HC4H 2O72A 5JYLA 3RWHB 5AUMA 1QFPA 2HFFB 3OPUA 1CTOA 3ARFC 5DURD 3FUJA 2F19L 4QWWC 1F3DH 2X1OA 5AAPA 3H9SE 4YFEA 1S78C 2L7QA 4HZLA 4P46C 3W0WB 1JZJA 3P9WB 1QO3A 1EERB 2ZWLT 4NWUL 2BZCA 4KITB 3L7EB 3MODH 5KJ4A 2F7OA 2UUDH 1QSEE 4HJJL 4AENA 4HVBA 4FKEA 3NEEA 1X4ZA 3LHPH 1NBZB 1R3IL 2QL1A 2WZ6A 1T0PB 1XT5A 4G7YH 4ZPVA 3GUFA 2YA0A 4DVRL 4IRZA 4EUPB 3CIAA 4A2FA 1FO0A 3NOIA 1H3TA 2Q2EB 5E2WH 3VFTB 4TSCL 4WUUA 3RP1A 4WSGA 2PPCA 3EO9H 4I1RA 1B6UA 1F1AA 4O02A 3ZTNH 2WQAA 15C8H 5D7LB 3GM8A 1UKTA 2XTLA 1Y07A 2XWZA 1RVFL 4JM0A 4XB8A 1I8IA 2VXVL 3ZE1F 4HC1A 3ML8A 3HS8A 4S1SL 4H5SA 3US0A 1LO2H 5EZJA 3KDPB 4LMQE 3B2UD 3QDGB 1INDL 2AXFA 4GT7A 3U1QA 2Y3NA 1ZS8B 3L95B 3OJVC 5AEAA 1AGDB 2VH5H 4QRQB 1EZUA 4MMZB 1GGCL 4NKIL 4P4RA 3QUYA 3QAZB 3WFEH 1G9NH 2WUBL 2M2DA 1UWFA 5EO9B 3NN8A 3REWA 1H0DB 3NGBB 2NXZD 2E59A 4KKRA 3LDBC 1NFKA 1CT8A 2DQTL 1QRNE 2VDML 2YSSB 4RMVA 2F8VA 4G6ML 3T3ME 4N2IA 1J10A 2JK5B 2X44D 3B7YA 4DKAA 3OC5A 2BCKA 1TEGA 5KJ7E 1B4JH 4JHAL 3R7RA 5I76A 4OQTL 1EO8L 5D7EA 5T1LD 1AFVL 5I16B 1TZHB 3VFUB 2ZPKL 4MQTB 5TE7H 2F7RA 2LR4A 3SKMB 5I74B 3MLUH 3GMOB 1LEGB 1LILA 3ETTA 5BZXA 4I18A 1ORSA 2YOAA 3F7YB 4XI5C 1SNRA 4OGAD 2WZ5A 1KDJA 4Q4IA 4G6KL 3VGHA 3HAEG 4QHLA 3DMMC 3MV7B 2AQRA 2OTWA 2BK8A 4AZ8A 3Q2LA 5JA9A 2Q6WB 1YQVL 2CWRA 5JIMA 4XRCA 4D9RE 1OAZH 3CSPA 1UM4L 4LBEA 5FYLH 5SX4I 1Z3RA 4IHOA 2V17H 4P5SA 1DQLH 3TX4A 5DO8A 3K8KA 4BM7A 3PDOB 2A1WH 1JZEA 1RZ7L 2YAMA 4MDRA 1F4HA 2BVQA 5DK0B 2VC2B 3RJOA 3VXSD 1D3CA 1AJ7L 3ZMRA 1CLOL 3QS3A 3DXAE 4XMLL 1AQ8A 1QWUA 3FUHA 5EFIA 5HVGB 3IVKA 5C0CA 4DQAA 1FGVL 4OM1H 4F24A 1N19A 1CI5A 3MTXA 3SCMB 1HHHB 3FFDB 1J5OL 2CO1A 4G42B 4ENZA 4ZX6A 4Q6IC 4ZFOA 1Z3GH 1DJZA 2G60H 2WLZA 4XBGA 2IH3B 4NEHB 3NQKA 3HS0B 4YDNA 1W6WA 1ID2A 4LEXH 1AKJA 5HHOA 1A5FL 1TNMA 1G5GA 5DUMH 3Q48A 3BX7C 4E41B 5C0BA 2OR8A 2WXMA 4O2EB 1N5AA 1NGZA 3WXWH 3DRQA 4G5AA 1XGYH 5E4EC 2EYSB 2XLLA 4Y7OC 3N06B 2YD3A 2XN1A 2Y23A 4AJWA 1UACH 3IMBA 3MUGB 3MNDA 4P04A 1S7XA 4UV7L 4OCXL 1VEMA 3L3HB 1D5IH 4M6NH 1KPRA 1JPSL 2O6EA 4IMKA 4OLVH 3V0VB 1IEHA 3OSKA 1CD0A 1RUQH 4Y16D 5D2NB 4U7KA 4OV6F 2GAZB 2DIAA 4OFQA 5K59F 1S7SB 1MRFL 1J1PL 3GYRA 3O2VL 5EWIH 3DX7B 1H3UA 4Y2OB 4XNQA 4EKJA 5HHMD 2WN3A 4P23B 4KOCA 1LEIA 3CFDA 4M48L 5DYFA 3QEGH 4I4WA 1OWRM 1A2YB 3QDMD 3LKPA 4MZ2A 3WCYA 3MRLB 1DVFC 5ES4B 5DRWA 4D9QD 3NRPA 1A4AA 2NX5E 3KXFB 4GMSH 3GXUB 4FQPA 1D9KB 1BGXH 2I25N 4MYPA 4CC1A 4HJ0C 4IOIA 3UBHA 3E2HC 1CB4A 2CLVB 3PLYA 2PYFB 1IX2A 3N0PB 2G9KA 4HH9B 4P5KB 4EUPH 1PKQB 1PTZA 2OCJA 3FUEA 4GKZA 4JLRA 5FLVA 5D1QA 4UV4H 3HG1B 3IE9A 2BSRB 3EGXB 3MR9A 5CAYB 1LP9A 3QRLA 3IKKA 5FO7B 5TDOA 2ALWA 3GBMH 1N6UA 1HQRA 2XVGA 2VOTA 3DX6B 3N5AA 3MQIA 1KJ3H 2ITCA 3NABL 4FEMA 1WTLA 2KUTA 1XH1A 3OSVA 1N26A 3WXVH 1MDAA 4W6YB 4WY7H 2VDMB 4MXWL 3X11A 3U82B 2XWTB 3LQAC 1KN4H 1SXBA 2CMRH 2IFFH 3SBWC 4KVNH 4HOZA 5T1MA 4KKLD 4HLZH 3T65B 2WVVB 4GSQA 2G5BA 2HUEA 3U1SH 4UCFA 2DF3A 1QBLL 2K6YA 3VFWA 4WI4A 5H8DA 1XB6A 4KWUA 1YEHH 1B9KA 1N4XL 4HWEL 2A9CA 3IGFA 4NSKB 4FD0A 4TQHA 1YN6A 2BS9A 2EC8A 3F7RA 3H6AA 4AYGA 3O3EB 4KZEL 5C6TH 4PJIE 1BFTA 3FQRA 1EAOA 4GB9A 1QSEB 4CADB 4QRPB 2IOOA 1UZ8A 5AKTA 2UXVA 3N3EA 4FFZL 3T8XA 4UM9B 2HJKB 3I6GB 5CJBA 2XYCA 3MJWA 2EXTA 4HWZB 2PW2B 4K94H 3OX8B 5HYJA 3NJHA 2GFBA 5CO1A 3Q0HA 4J4PD 4ZG1A 1UA7A 1YMHB 4ODBD 4PU2A 5E00B 2J55A 3EJZC 2BNRB 4S1RH 3FHEA 1GS8A 3IJEB 3CQQA 3RNQA 1KNOB 3L9RB 4AQAA 1JWMB 1TMQA 4KJQD 1KCUL 1XF4B 2VE6B 1G1CA 2QKIA 3TCLB 2ZCHH 3W1ZA 3RWJA 3BP7B 3JV4A 1QMUA 1MUJB 4N1EA 5FHAH 1JWSB 4IDLA 2DMBA 1UT2A 1YMMB 4HBQA 4TVPL 3FU7A 2AJVL 2AP2A 2AJYL 4ZUWA 4GG6E 2AQ1A 3K6IA 3ZRSA 4KTGA 1FYHB 4GKNA 3VFPB 1CQKA 4Q2ZA 1WS7A 4PJHA 3TT1H 4Y4KD 3WNJA 4PJBA 4X9BA 2DPKA 5AW2B 4E5XB 4BCZA 1TTCA 2FWOB 12E8L 3FRPB 1P5UB 3LJ3A 3FPYA 4EIUA 1QRNB 3DNKA 2AK1L 3BHBA 2AGJL 4FMKA 3OMIB 4YSDA 4Y89A 2Q2LA 2HXAA 1QKZL 1J1XH 3FH7A 1ZMYA 4K3GA 1UZ6F 2AZUA 2JSFA 2VLRB 4F7MB 5F7EL 2FECL 4RZKA 1A6AB 3BAKA 4FKHA 2G75B 2DLHA 3MMEB 5F6IB 4QHUB 5DQJA 5DZVA 3RL1B 2F19H 2ITFA 2OULB 4UDUA 3QYCA 4NO2B 4LSRL 2CUAA 4NWUH 3B2XA 3EKCA 4KK8C 4N0FB 1DQQB 5H2BB 3VD2A 3MO1A 2XSKA 3KBEA 5ECGA 4HJJH 2C1OB 4A7SA 5SWQA 1R3IH 5JR1H 1RJLA 4EN3C 2MTPA 1A8ZA 1UWEL 4KNTA 4YDJA 3ZE2E 3QUYC 1L3NA 3H0TA 1HOEA 1GXEA 2AANA 1A6TB 4DVRH 4PJIF 5C0RL 5HHQB 4YDLC 1GOHA 1GTNA 4NQVA 1CICB 1PZDA 4JDEA 1NUFA 4TSCH 4QDGA 5AW7B 1B6DA 4Q58C 2J8UA 4BFIA 3CHSA 1G6RA 1UH2A 3QWNA 3MA7B 1NMCB 3BVNB 3HLAB 1RVFH 2VXVH 4DUVA 2ENQA 3DK0A 1XF2A 1N59B 2EDJA 2XQBL 3E6HA 5SV4A 1T1YB 1WCQA 2E0PA 2F18A 3EGSB 4WW2F 3TN0C 4UZUA 1ZOXA 2GSMB 5FUOL 5HGAA 2F54D 2N56A 4CMHB 4FXGB 3BOVA 1THAA 1GOGA 1INDH 3QDJB 4QLRA 4YPGA 1MCWM 2A6IA 3CH1A 3OJDB 3AADB 4TL5A 4NKIH 1GGCH 2MKLC 4XH2B 4CNIB 3K7UA 4G11A 2PPFA 2YPVA