4RGNE

Structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
220
structure length
220
Chain Sequence
DIVMTQSPSSLTVTAGEKVTMTCKSSQSLFNSGNQKNFLTWYQQIPGQPPKLLIYWASTRDSGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYTYPLTFGVGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQDGVLDSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
molecule keywords Enterotoxin type B
total genus 48
structure length 220
sequence length 220
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnE01
3QUMB 4PJXA 4GQ9L 4XCEA 1KIRB 2BOCB 3F7YA 5CIPH 1QSEA 1IQWH 1R5VA 1T21B 1EHAA 2D9QB 4G8EA 2VQ1A 5FM8A 3NZHH 1D9KB 3WO3B 1X44A 1N6QL 1F8TL 4NGHH 2P46B 3QUKB 1I9JH 1B0RB 4NO5B 5DD5H 4WTXA 3BAEL 4X4YA 1U8MA 1UM5L 1JZ6A 1Z0NA 4TQEL 1JYVA 3L95A 4JQVC 3VXNB 3TLRA 1WT5A 4QRQB 2OR9L 3N0PB 3VXQA 3E8UH 5D1ZB 3W5MA 5FGBA 1HH6B 3OAYH 4FN0A 4X80H 3VFMA 4HKZB 4XVSH 3W11C 3T1FB 5I66B 4BM7A 1NGZB 2YRZA 3QCUL 1NH6A 5ACZB 4KK8D 4PP1C 1KCRH 5KSAD 1OAKL 1P84J 5F7LB 3MV7E 3ZT6A 5HTSA 1LE5B 2A74A 1JPFB 1T3FA 2VLRB 3MLWH 1CK0L 4LEOB 5C0JA 2FCBA 2O26U 4JFHE 4MNHB 4P46D 3RWDA 4ZG1A 3H42L 2C3HA 5I18L 1F58H 5TE6H 1TZHA 3TN0D 1AO7A 3HKFA 1E4JA 1UCTA 1YEDB 1WBXB 3RJDA 4H20H 4AIZB 4FXKA 4MCZB 4JO2L 3GJEB 2D9CA 1EMTL 4XP4H 4P2QE 3RVWD 2OJEA 3P9MB 2X70A 1SEQL 4PG9B 5DJDA 3GBML 3KYMB 3R8BB 2J8HA 4F8QA 1A7OH 4LPCA 2NX5D 5CLWA 1OSZA 1ZAGA 2NMSA 5ACZA 1E4KA 4GG6B 2HH0H 1JYNA 1N3NB 2BNQE 2IQ9H 3MMEB 1J1PH 3QZWG 4S0SD 4JPWL 1DUZB 4X98A 5J1AB 5FF6B 3RA7H 1BQHB 3F7VA 3D0VB 5B38G 5DRNB 4JHBA 2FD6L 3D85A 1CE1L 3L7EA 4GRLD 3O9WD 4X4YB 3GMPA 4BK4A 4OI7A 3SDXF 3RWIB 4HS3A 3KPRB 1SJHB 5DZLA 3AGVA 1I1AD 2RBLA 3EOBA 1N5YL 1OGAA 5CZKA 2MCPL 1CGSL 5M94B 1IQDB 1I8LA 3VG0L 3RWCA 1MCEA 4RFEA 4ONHA 1MAMH 4XCNB 3WNOA 1A7QH 4WNQA 3CXDH 2DWDA 5E8PA 4J1UA 3RAJH 1XF4A 1G0YR 1FFQA 5F97E 5INDB 4WHYG 1B88A 4TVPH 4AEFA 3JBG7 1A1OB 3RL2B 3GO1L 3BWUC 4FFZH 3FB6A 5FUOH 3P11H 3O6KH 3QIBD 4Z5RB 3KJ6L 1GGBL 2CDFA 1XF2A 1KNOB 4OZIE 5GHWL 3T3PE 1SBSL 3I50H 1U3ZA 3N85L 5ITFA 5EU5A 2J4WH 1MIMH 3HMXA 1T7YA 2XYCA 1D3CA 4XXCC 3RWJB 1FIGH 3LH2L 1D9KD 4BFIA 4YDJB 1MFDH 2NYYD 4WEBL 3GMQB 2EE9A 4N8VA 4D0BA 4KROB 1NKOA 3NIGE 3KPOA 1JTPA 2CRZA 4HIJB 3MJ8A 5SWZD 3U7YL 1U3YA 1IQDA 1BGXL 1P7QA 1I7RA 2J12B 4LKXA 3MR9A 4K7PX 3CX2A 3RWIA 1IZJA 3O2DL 3EYUH 5HGBB 2JELH 5FECB 5TJWK 3S36H 3C08L 5CBAB 4XVTH 2C9AA 1MHPH 1B4JL 4PJAA 5ESAB 4APQC 4ZMAT 5I1HH 3L3JA 5BZDA 1XF5A 4I0PA 2JTDA 3GK8L 3ZL4L 3B3IA 1QBBA 5LG1A 3HZKB 2WSKA 3O3DA 4FABL 3QIBB 4PBWD 1I8IB 3RY6C 4HJGA 2DM2A 4LLQB 3GB7A 5D5MF 2J6EL 3KVQA 1RK1B 1AE6H 2X4UB 2VDRH 4HT1H 1S9WB 5A2JH 1KT2A 1SYVA 1ZGLP 1QRKA 2Y5EA 4YHZH 3O9WA 1DVFA 1GIGL 2EC9U 5IFHL 2EZ0D 1MQ8A 2NY3C 3L5WB 4XMPL 3KPQA 3FO1A 4HC1A 3SHSA 2DQHL 1VFAA 3AREA 3VGBA 3V52L 1JBJA 4U1SB 4MDIB 4D0BB 1FNSL 4HK3J 5EZJA 1TZGL 4M4RA 4OQTL 4RSVA 4ZXBD 3L3IA 2A74B 1BM3L 3QHZL 2G9HB 5F7UA 5GQBA 1QBLH 5JQ6H 3TNNB 1FO0L 4WU7B 4F7CA 1YQVH 5IB5B 4IRSC 5I1GL 3H7BA 3QUYC 1IC1A 4HMCA 3CDGA 2O61B 5IMKA 3VFGL 1HQRA 3O6FC 4G8GA 1INDL 3JUZA 4PRIE 4XMPH 1WAAE 5DJZA 5DXWA 5EWIL 4HMDA 1NBVH 3NFNA 2F8OA 1EEZB 1BFVL 4K3DL 4K23L 1BX2A 3RBGA 3VXOB 1CIDA 4F15B 3SGDH 1KIPA 2FECI 4NWUH 4NO5A 4U1HB 2R56L 4M6ML 5IROA 2AK4D 1AGFB 3S4SG 3LS4L 1FNFA 1UXSA 4R7DA 4ALAL 1KB9J 2CMRL 2RQ8A 1H3TA 3VCLA 4JGUA 4LSPH 4JFEA 5FKPA 5MENB 1G9ML 1IEAB 2BNRB 1URLA 2VDNL 4PJHB 2X89D 4KDTA 4Q97A 2NW3A 1WQVT 5GGVH 3V0WL 3U79A 4OCNC 1YEFH 4Y2DD 1MPAH 1RJZB 4Z7OF 4NZUH 4XHJC 4FQCL 1E28B 5LAXB 4NOFA 4NUGL 4NQED 3G9AB 3LN9A 4GQ9H 2YXMA 4IDJH 3BP4A 3K4ZA 3MJ9A 2CKBA 5I17B 3VFUA 3VXSE 4MQTB 4PJ7B 2UWEA 1N7ML 3SQBA 1YPZF 2QSCH 3PWJA 4TVPL 3OAUH 4U1SA 1QRNA 1KACB 5MEOA 3L5IA 5DJXB 1BVLA 3ILQC 2VO5A 1U92B 1EZVY 3DUUA 1NEZG 3O11A 5IESH 3AROA 2BNQB 5GJSH 2I9LA 4OI9A 4OBSA 2ARJQ 2OXGA 4P4RA 5KSAA 1D6EA 3K81A 1CG9B 3HRPA 5DWUL 3MGOB 2D7PA 4OCMC 3MLVL 1S7RA 5ETUA 4X5LA 3IDUA 1AJ7L 4JO3H 5F7WC 4NKMA 1YEDA 1CDJA 2J4WL 1CICB 3GJFB 5IQ9A 2PYEE 2X10A 3ARZA 5BJTA 4WVRA 5F89B 2IPUG 1D6VH 4D0CA 2ESVD 1A7PH 5C0BE 1XCQB 2HN7B 1B4RA 4UDUB 1CFNB 4MA7H 3B2VL 3JTTB 3MRBA 1DQDH 1DQJB 3MODL 1LE5A 3ECBB 1KGCD 4QYOB 1J8HB 1IKNC 4OD2A 3FN3A 4KQ3H 4DGYL 1C5DB 4JO1H 4WUKH 3QG6A 2VLJB 2F8XC 2NXYB 3HI5H 2WBJD 3K7UA 4J8RB 3HUJB 2XKNA 4KXZI 1A3LH 4UT6L 4BZ2L 3ULVD 4HHAA 4PP2A 1CFVL 3RVTC 5TDOA 1I7RB 5F7EH 4ODBD 5FOBA 3P9LB 1IGTB 4EI6B 3B83A 1DDHA 2XZQL 2DBJA 3QCUH 5CBAA 4HBQA 4FXGA 3P0GB 3SBWA 5L9DL 2EEBA 2WM0A 4F2MB 4LKCB 2PW1B 4PJBB 4X80L 2ICWI 1I85A 4FS0A 4G3YL 1HHJA 5HPOA 3OXSB 3TYGH 3OKNA 5EOCJ 4KK5C 3H9SD 1GRWA 3O11B 1NMBL 4KROC 2OP4L 3DYPA 3FOLB 3LD8C 5D1XC 3OR7A 2R8SH 2GSGB 5EORH 3M8OH 3RUGF 3GSVB 5GSRA 3F12B 3F6IA 3IKCA 4IOFD 1IGIL 2XN9B 5BVJA 1CXEA 2VAJA 1ZHKA 4JQVA 3U30C 4HG4J 3MV11 2IANB 4MHHI 2X4SA 2B4CH 5GS3A 1U58A 3G6JA 4FTVE 4FQ1L 3RIFK 1KJ2A 3U4EA 5E8PB 3D39E 1GZQA 1KPVA 2VLMD 4KJWD 3KYAA 3LQAL 4MA8L 1A4JA 1NFIA 3QXUA 5DJ0B 1IEAA 2VZ3A 4DQOL 1OF2B 2NY4C 4OKDA 2D7OA 4TOYL 3DMMA 3GGWA 3D39D 3ZDZF 4HEME 3T4YA 2IH3B 5JW4R 2VXTL 4YHLH 3VFTA 1HKFA 1NCDL 3NPZB 2EIDA 2ERJC 2C7UA 4IEFB 3WSQL 4TUOB 4PJIE 4Z7VB 1J7VR 3ZKND 4KK9C 3RHWK 4X7CC 2OL3L 5AUMB 3BKJH 1BREA 5CHNA 3ARVA 5CIPA 4GS7C 5BZDB 3QIBC 1JFQH 5DJ8A 3D69B 4JFDB 3LRGA 2BERA 2R9HD 2OK0L 5J1AA 3K1KC 1LO4L 1ACZA 5IHZA 5I1EL 3GIVB 4NGHL 1MIEH 2Q86A 4PYGA 4YIQB 1WGOA 4X6BA 43CAA 4IRZH 5DMIL 1DN0A 4LARH 4ZTOH 5C71A 1MFAL 1G9NL 2FR4B 1MI5D 3HMWL 4NCC1 4AY0A 5FCSH 2YMXH 2XWBB 3HC3L 1C5BH 3UPRB 3P73B 4R4FH 1VACB 2PR4H 1JHKL 1Q8MA 3WIIL 5HXMA 4WHCA 4PTUB 3SE4A 4XPHL 2QLVB 2C1PB 3CZFB 5ICXB 4HUMB 4G8FB 4JZJB 1K8IA 1WBXA 3P77A 1MFEL 1QD0A 1P4IL 4EDXA 4ONGL 5CKGA 4UV4L 1INQB 2O5YH 3CFKB 1LQSR 2H2PD 3FMGH 4HIHB 4QY8B 3L5JA 4ZAKD 5KZCB 1MCNA 5ILTL 3MA9H 3B9DA 3TPUA 2ZUWA 2FX7L 3WIHA 4HIXL 1U8LA 3QPXL 1K2DB 3S6CA 4CMHC 3ILPB 3MV7D 3BKMH 4NM4H 4LLMA 3VFVB 4TUOA 4LSQL 5IVXA 2V2WB 4KV5E 5M7QA 4ZFGL 1A1OA 3K0WA 5GS1C 5DGQA 3ZE1E 4F9PA 1CDHA 3ARBD 2WIIB 1RMFL 1RUAH 7CGTA 2OLDA 2X5PA 3BRFA 2CJUL 2FJGA 2GK0A 2NY2B 4PRPB 3TCLA 3OKOB 2EE3A 3OGOE 3BZEA 1K5NA 5HY9A 4IMKC 2EE2A 4I77L 5E8EB 4MQXD 1JRHL 2NY3D 1N8ZA 1X4ZA 5C0CB 4NC1C 5CS7A 2ICEA 3QH3A 2W91A 3GI8H 1G9EA 1UM5H 3QCTL 4I9WE 5JA8B 2KBGA 5GJSL 2E27L 5D7IE 4ZFGH 3D0LB 4HWBH 3OTTA 5DF0A 3STLA 1OW0C 1MCPH 5I1AA 4JDVB 1BBDL 4YO0B 1OAXH 3UC0L 4GW4B 1JK8B 2GSIB 5EU6D 3MCLL 4IRSD 5JTWA 2C5DC 2HKHL 4HJJH 3H9ZA 4G9DB 1LEGA 3SDXA 5HHNA 2W60B 5CCKL 2ZUQB 5DJ2B 2H9GB 3BZFB 3OBAA 4L29A 1S5IH 3QA3A 1TMCB 3PHOB 4Y88A 3SCMB 1J8HE 5CKAA 2BVQA 3QNXB 5GGVL 3JVGA 2ICEB 3QEGH 3OV6A 1JZ8A 1U8QA 2OR7A 5LXGL 1ZE3C 4L3ED 1J05A 4LASH 1V5JA 3UJJL 4HXBH 5FB8A 4MHHG 5LGHL 4PRPA 5FYJU 1WIOA 1LVEA 3BQUD 3BP7A 3IXAA 1DVFB 4TSAH 2FLBT 4LCIL 4XNYL 1HKLL 2WIIA 1D6EB 4R4ND 2VUOA 3AXLA 5I2IA 5L7XL 4FZ8H 3O2VH 1NGWA 4J3TA 1CLYL 3BP5A 4YR6B 1KG0A 5JW3L 4OZHE 3T2NH 1GH7A 5T3XE 2A6DB 3O3UN 5EOQL 4HKZA 4J8RA 1L6XA 3MNWB 4NP4L 5FO9B 3JUYA 1WBZA 4JY4B 1EHLH 2BSTA 4JN2B 5F89A 4BQ9A 4GRWB 3FTGB 4GMSL 5DTFA 2JKXA 3ILQD 1W72L 2XN9E 3X3FH 1XH3A 3JTTA 3MRBB 3BVNB 4ZAKA 1JZ5A 3HI1A 3ARGC 2VH5H 4EZMA 4UU9A 4H20L 2Y07H 3GUTB 4DN3H 2GAZB 3FN0H 1KCKA 1AD9A 1Q9KB 1V7NL 2SEBB 3H8NA 3P9LA 4FTVB 1EO8H 4WI3A 4Y16C 2Y25A 2K1MA 2BVQB 1MCCA 1X5FA 4XCEB 2VR9A 1MRCH 2HTLC 4R97C 5D1XA 1ZLWK 4PLJD 1CVRA 3V7MA 2VLRE 5EIIB 5D2LA 4U1NA 4X8JA 3G5ZB 1FNGA 2AJSH 1CLOH 3MCKB 4EEEA 5CWSA 2EYSA 3GSNH 2WBWB 5JNYA 1N2RB 2AEIT 4P2QB 5MI0B 1AP2B 4QRQA 2BNRA 2F9BT 1Z9LA 5ADOL 3N50A 2DMCA 2AQ3A 1RIHH 4PRDB 2HT2D 5FYKL 4OAWA 3FFCB 1CGSH 1RJZA 3G6JF 4WIQA 4UQ2A 4ONFL 2I24N 2OL3H 3D2UA 3LSOA 4X9HA 1CBVH 1RZKC 1DSFL 4U1LA 1X6LA 5IHBA 5E8EA 4XH2B 2UY7A 1K6QL 2YBRA 3QNYB 1VFOA 3MLUL 1A4KA 3OKOA 5ALCL 1CGVA 1A4JB 3JV5A 3KPQB 1HQ4A 1FVCA 3WLWD 4YHPA 1BLNA 3S88H 1U95A 4A2LA 5DHXB 3S35H 3KPRE 4N1HB 4PJ9A 4CMMB 3GMPB 3NFPB 2D31B 4PV9B 3TWCH 1N59A 5DRXA 1WITA 4UTAH 4LLDB 2YRPA 5DI8B 1BQHA 3F7VB 4JO1L 4Z7NE 5KVDH 2YN5A 1R5WB 2DLFL 1F4XL 4YFLF 3LKNB 1JK8A 4W70A 5LGJA 2AXHA 3REVB 3MV8B 1YY9D 1FYTD 1CGTA 1ZS8B 2VH5L 4TSBL 5SWQB 32C2B 3AREB 4JFPA 3BWAA 4X8JB 3MROA 3OHXB 5JLZA 4PRNB 3T0AA 5F6HI 2CLRB 2YPVL 2W9EL 3JVGC 4L4TB 4C55A 1AHWA 1IFHH 2GFBA 1GC1C 5GS0C 3EDEA 5E08H 1KIPB 3P73A 4FQIH 5DQDH 1HILB 1M7IA 5FYJE 2N56A 2VZTA 3C9NA 3BFOA 4OFKA 5ALCH 2I27N 1AP2A 1U42A 5I71B 2W38A 3FT3A 2MCPH 3S96B 3MJGX 1QSFD 4O9HH 4EUPG 1HOCA 4UTBH 5MEPA 4GS7B 4K3JL 2MJWA 3CH1A 5FYJH 2QKIB 3WFHB 2OJZL 2ED9A 1NGWB 4UQ3A 4YJZL 1S9KC 5DMYA 1UXWB 4JM4L 3RWEA 4JFFA 5ITFB 5EUKA 4ORGB 5T1KB 1P4LA 4OD2B 1E4XH 3QIUB 1H5BC 2C3XA 4G8IB 5ADPL 2CO6B 1YMMB 1J1PL 1ZLVH 1LE9A 3QEGL 1PW3A 3QZWA 4YR6A 4FTVD 4K55A 3MJ9H 2VDNH 5F9WB 3IXTA 1S9VA 3GSWB 5I2IB 1UG9A 4HIJA 2Y5TA 3KPPB 2DL9A 2EYTA 5EBWB 1A3RL 2QQLL 1W72A 4HKJB 3B2VH 2UZIH 3QDMD 4L4TE 5KSAB 4PB9H 1RHHB 3ARDC 3DRTB 4QNPE 4PRNA 1X6NA 1EPFA 3DXAB 1I1AA 4M8QB 3VFPB 3CMGA 5GZNC 1NFIB 4YK4B 5F1KC 3T77B 3BWAB 4JY6B 3BEVB 3EO0B 4X5XB 3QIBA 1YNLH 3HAEA 4KI1A 1JZ7A 3V4UH 3FKUS 4DEPC 4XWGH 2DI7A 1BZ7A 4WY7H 1XF5B 4DOHE 4POZC 1L7TH 4HLJA 3S34L 1YQVL 5D1QC 1U93A 1BPVA 3VE0B 2MCG1 1IAIL 3MLZH 3DVIA 1NFKA 1R24A 5TF1H 1VPOH 1AC0A 1GC1H 3BDBA 3QH3B 4LLWB 2RAMA 1CD8A 4F57H 1Z3GH 4CVXA 3RZCD 3ZDXF 4OLWL 5DMJB 5LBSL 3D0LA 1I1AB 1CGYA 1I7ZA 4JPVL 3SCMD 4OGYL 4ODWB 5DVMA 4YXHL 5EB9A 5ITBL 4U1HA 4M03A 4M6NL 2XTJC 3BKML 1LO3L 3W0WB 5JR1H 2IALB 5I1KL 5ADPH 4F58L 2O93L 4P2RD 3DXAE 1KF9B 5ILTH 1YN7B 3EUUA 3IU4L 1NCNA 4XZUB 4QRRA 1F4YL 1OGTB 5ISZD 5C92A 1I8KA 4Y4HB 3GHBH 3TPUB 4GKNB 3HR5B 1QO3A 3VD3A 4YHYC 1U8KB 1ZA6B 2J5LB 4HW6A 3NCCB 4J3OC 3KGRA 1BZ7B 3BI9X 4IIQB 3S7GA 5AG9A 5KS9A 1CZ8L 1NAMA 4PJCA 3EO0A 1NEZB 2YPKA 1QFHA 2BY1A 3STBA 5KG9B 2IBZX 4S1DD 4FTVA 1ORSB 1AO7B 1KCVL 1ZVSB 5TPWH 5E2WH 4NNPH 4XWOC 2Z31A 2BRRL 5AZ2H 5C0GB 4YDIH 1JF1A 4PGCB 5FHBH 3EYQC 4HCRH 2UUDK 5HHOB 1KCUH 4Z7QF 1KTLA 3RY5A 4KTDH 3WNLA 3DUSA 3K3QA 2PO6D 5E56A 5FV1L 3ZSTA 3ISWA 3T0VA 5C0NC 3MROB 3FFCE 5JXEA 1UFUA 1X9QA 3F7YB 1YMMA 3RGHA 2A9NL 3I2CH 5J89A 1A02N 1NGQH 2H32H 3IDJB 4Y4FA 2HFTA 4JFFB 3BP5B 5ACLA 1D5XB 4I0CC 3FZUC 3QSKB 3U9PL 2YRLA 5C0BB 3HC4L 3GRWL 1MWAL 2IH3A 3BPOC 4EOWL 4WFED 2HMID 4GRWH 3OKKA 5TH2B 3VH8G 2WUBL 1IAMA 2I5YL 2P42B 2X4PA 3OG6B 2VQ1B 2YD6A 1SJEB 4G9FE 1HINH 4HUXA 2IGFL 5ID0A 2EDEA 4IDLA 3SPVB 4U1LB 1QSFE 4N8CL 4TUJB 2P5WD 4PJCB 1KXTB 2X42A 2I60H 1G6RA 1D5BB 2LU7A 3QA3B 2HFGL 1G7JA 1IGYB 4PD4J 4HLZG 3AC0A 4RDQF 3SDXB 4L4JA 4P5KB 1VGKA 3T4AA 3ELAT 4OIBA 3QJHA 4NWTL 2GHWB 4LU5L 3IFNH 5IF0B 2Y7QA 1Z5LA 5J13C 5E00A 5E94B 4HIEB 5TF0A 1JPTL 5BVPH 4HC1L 1NDGB 2BNUB 4P59L 3DIFA 1S78C 1V05A 5L2JB 5KVEH 4QWWD 1EO8L 1N6UA 4M00A 2H32A 3OKNB 1KLGA 1OVZA 3VMNA 1U6AL 4YHPB 2XWJB 3B9KB 4HLZH 3C5ZC 4JE4B 1KN2L 4D8PA 5L0QB 4P3DB 2X4NB 3M45A 4CVXB 5HI4D 2IANE 4BQCA 4OLXL 1RUML 3GSXB 4JDTL 3TA3D 4IHOA 1BIIA 2HFEA 4JRXA 3T0EC 2X4SB 1BX2B 3HG1E 2EDXA 4HZLB 3TNMB 2FECL 2IANA 3VWJD 4K3HA 4XP9H 4OKVB 3G04A 1BVKB 1J1OL 4M7LT 4OM0L 5C7XL 3VFWA 2FIRT 2VMFA 3VDAA 5CJXA 3V4VH 4HULB 4P5TB 4P4KB 1QQDA 4EIZC 2OYPA 4DCQB 2CLVB 2MTPA 4CVZA 1HHIA 4KUCF 2B5IC 4UAOB 2YZ8A 3H3BC 3MXWL 4MJ2A 5T1KA 3RDTA 3QPQC 3MLVH 1M4KA 1BFSA 4X6DF 1ZOXA 4AH2B 4X9FA 1CFSA 1XGYH 4OCWH 4OM1H 1T2XA 5D7SH 4Z95H 5D71L 5D1XB 3HPJA 3AU1A 4AG4H 2P8PB 1EH9A 5HGGS 5JHDE 4JG0H 3IGAA 3MLYH 2FSEA 5GSVA 1U8OB 1N6QH 3MCG1 4ODSL 1LEIA 2OK0H 3MLTB 2V2TA 4P9MH 5IWLC 1ZLSH 4D0CB 4NC2B 3QFDB 2ORBH 1NAML 4P2YA 1AKJD 1IBGL 5GJTL 5B38A 4I48A 4R97B 4CJ1A 1NCBH 2HKHH 1N26A 3EDFA 5D2NB 4DQOH 4B53A 5C2UB 1GGIH 4XAKE 3C6LB 1A6TA 1R3KA 4RWYL 3STZA 1I3RB 4Z7UE 3V4VL 4OBRA 2BHUA 2QKIA 1TVBA 3RGVA 4RGNB 4NM8H 4JHWH 2AJYH 4ODHH 3BO8B 3G5YA 5FK9A 4IRJA 5DT1H 3V5HA 3FB8A 3KNBA 3D9AH 3ME0A 5IBTH 5D1ZD 5I8CB 4YX2H 1RUMH 4JDTH 5EU3B 2DYPD 3CDCA 5IM7A 4GLRH 1U8MB 4O2FB 3WHXB 1T03H 1P6FA 1RU9L 4KTEL 3U1SL 4K8RL 5GIRB 1J8HD 2PYEB 1XR9B 3BKYL 4ZNEA 5IMMA 4O2EA 5FHAL 2CLRA 1INDH 1HEZB 3NN8B 4M93B 3ALWA 3O3BB 4H88H 4S0TD 1CLYH 4Y1AE 3ROOB 2R2HA 3FO9B 1ED3B 2J5LC 3VFSB 3PABA 5T3XD 2NR6D 2O5XL 4XMLL 1MVFA 3QJFB 4KY1L 1KCVH 3GIZL 1DBBH 2NY0B 2D7NA 4OB5H 2OQJB 1TCRA 4HX1B 3BP4B 4WW2B 3KYNB 5DURB 1ZHKB 1F4HA 1A9EB 3NFPA 1M6OA 3MA9L 2DBLL 4FG6C 4HIEA 5D1QD 4ZPVA 4NQVB 3TH3T 4Z7QE 2FWOA 4P5MB 1GHFH 2X40A 3AS1A 2R0ZL 4I0PD 4CN6A 5JW5A 4YXLH 1BHGA 1NGYA 4BZ1H 2MFNA 4NN5B 2XI9A 5F1SA 4DGYH 4V1DE 4OQ1A 2YD2A 5IGXH 1KCSH 4CUCA 4Y5YA 1XZ0A 4KKAC 3RWGB 1PLGH 1NUNB 5K93A 3IRZA 1V7ML 1HH9B 1MFAH 3W2DL 4L5FH 3LCYA 5H2BB 3QI9C 3LQZB 3MLWL 4WI9A 4LLQA 1B9ZA 1N2RA 3SOBL 5EC2B 2OL3A 4I8DA 3O41A 3CD4A 4KKLC 1DTUA 1FLRL 2IG2H 4XBPB 1WUNT 3TNNA 4OZIA 2ICES 2YPLE 4O2EB 3QRGL 1QA9A 2GJZB 3MPCA 4E41D 4KTEH 5HBBA 1CBVL 4WV1A 3MRHB 2VXVL 4L9LC 5J12C 1YNKH 3GNML 5DFVC 4ZOBA 3TH2T 2DWEB 4GJTB 3SEPA 1P7QB 1SYSB 2DQIH 1ZSDB 1WWAX 4LCWE 1IM9B 3V6ZB 3TBTB 3VWKD 2W0FA 3SO3B 4YUEH 4NSKB 4CVWA 5FYKE 1N0XL 2HTKD 3GJFK 4R4BB 3V6FB 3VMPA 1J0JA 1MI5E 2CR6A 4CAGA 5FA4B 1TVHA 1MIML 5EO9B 3IGAB 3CVIH 2YS4A 3UBXA 4LSSH 2CIKB 4YE4H 3VJ6B 2YD8A 1CIUA 1NUDA 4X7TB 5HHPA 2P24B 1S7TB 4Y4KD 3T0BA 5F88A 2FATH 3GB7B 4MJ4A 3R0NA 2RB8A 3SDCC 1MY5A 2NW2A 1UWEL 3LY6A 4QGTA 3CFCL 4K23H 4YDJA 2ADJB 1G84A 1Z9OA 1TNNA 2LFGA 1HSAB 3MUZ1 1QP1A 1S5HA 1JVKA 4JDZB 4XRCA 2G75B 1MF2L 4M1CD 3TC9A 4L4VD 4UILL 3BHBB 1FBIL 5DUPL 4FQ2L 4FABH 4JFXA 5DK2A 3KAAA 4OCSL 3TYGL 3GMOA 5CJBA 3MXWH 1IMHC 2R0WL 2V7HB 3ZHKA 4RX4A 3TN0B 2EH7L 1CDBA 1NLDH 5EOCH 4GAFB 3A6BH 1Y6KR 1PKQA 1OSPL 4LF3B 3MLXL 4FNLH 3S3JA 2VUYA 2EECA 4LP4A 2DAVA 4X7EC 5KANG 3HCVA 3QULB 4JZOA 2BHYA 3QCVH 1LO0H 2X4TA 1RFDL 3U9UA 1MJ8H 5SWZE 5EBGA 4G6MH 4CW1B 1T21A 1YMHB 4O00A 3QEQD 2GEEA 1A3LL 4RFEB 4U3CA 5IFHH 1OPGH 3HI5L 2HT3C 2A73B 2XG5A 3BHBA 3BYTA 4JKLA 2X05A 5F1NB 4XHQA 1M71A 4I5BA 1HHHB 1ZGLM 4J2XA 5E9DA 2J2ZA 3F7RA 4OCRH 4OIIL 2EICA 2ADJA 3HNSH 4OGZA 1JNNL 1D6VL 5JOFA 1NC2D 1EERB 1DL7L 4QHUA 1RZIB 4XB8A 4XVTL 1I8MB 3MOAH 4NJ9H 3DIFB 3QUXD 1RJYB 1EO5A 2CK0H 7FABL 2F53E 1GCFA 4ZO6A 1HZHL 5ERWB 3NIDE 3DGGB 5FDWB 4J6RL 2BZDA 1DP0A 2X70B 5IMLB 1C7TA 1U8HA 2JCCE 3OJVC 1DBBL 2XXMB 3E6FB 3VI4F 3MLZL 4PGDA 5E03A 3BE1L 5T33L 2A0LC 4RFNB 3S3PA 4HUVB 1D5XA 5F3HB 4D9RE 2LAAA 1D5BA 3MYJA 2ZG1A 5IG7B 2ATPB 2HRPH 1CD9B 1AQDB 4PJDE 2VZSA 5EU6B 2DQTL 1VA9A 4NZUL 2GKIA 4NZDA 2X7LB 2CKBB 2IAMB 1X5ZA 5GZOC 3QQ3A 4K07A 4HH8A 1A2YA 4Q9QL 3P77B 3KDMA 4ZO7A 3NZHL 4G8FA 4JZJA 5HGDA 3P30H 3WXVH 2IG2L 3WDHA 1YYML 2VXTH 3TEUA 2MNUA 5F70A 3H9SA 4F9LC 1UB6A 1YYLH 3MRNA 1OAUL 1M05A 4F7EA 12E8L 4I4WA 1I9RL 4S2SA 5JZ7C 2NY7H 2FO4B 5FKAA 4LSQH 3UO1L 3OKYA 1DLHA 1HILA 5CEZD 2GW5A 2XY1A 4LHUG 5CEZH 5KG9A 1QHOA 2VDOH 1JWSB 2VTFA 1BBJA 3MUGA 3BEWA 3BH8A 4K94L 4WV1B 1S7QA 3T4YB 5I16B 2VR4A 4P57A 2GCYB 3K46A 2P5EB 1MCOH 35C8H 1PQZB 1GYAA 2Y6SC 1KCSL 4TULL 3BIKB 4R2GD 5DJXA 2OZ4L 3EYFA 3M17B 3GO1H 3MA7A 4UB0L 3W39B 2CDGA 1HHGA 3LHPL 4XPGH 2V5MA 4X9GA 4Z7WB 1NLBL 3EYSL 5GGRB 1RUPL 3RWHA 2APXA 2K7PA 4ZFOA 4P48A 1ACYL 1C5BL 1UM4L 4Y4KB 3SGKA 4KJYB 5IB5A 1DVFC 3CFEB 3FB5A 5JPNA 3HMWH 3D87B 3OXRA 4BFEA 5DQDL 1VGEL 2LABA 4KXZH 5D1ZC 3N1FC 4MNQD 4U6HA 3H7LA 3GSUA 1FVCB 4U0RB 5MP6L 2ZPKH 1XF1A 1HHKB 1VFAB 4IMLB 4OSUH 2VITA 4KH2A 2PW2A 2HFFA 4NC0B 2BVOA 4JHAH 4TTGA 4BSJA 2GJ6B 1XR9A 4TUKL 1WZ1L 1CL7L 5C6WH 5IMMB 4X0KB 3RA7L 1F90H 3EFFA 3K80A 3O4LB 3QYCA 5DRZB 3PDGA 2XY2A 3V2AR 1JHLL 1U58B 3U1SH 1X5GA 1CDIA 1BAFL 1KTRL 4J4PC 3VXSD 4FXGB 5T3XH 3M1BB 3UJIH 1MWAH 1CD0A 1MCKA 1CT8A 2HG5A 3VXRD 2CGRL 3MLPA 4OZHA 4KK8C 5CGYD 1CGXA 1A8JH 3V4PL 1HQRB 1MHPL 4G8GB 1IGCL 5DUBA 1PKQB 4K71C 5E6IA 3F8UB 1QRND 4KKCC 5ICYA 4Q9QH 2R0KL 1KELH 4RRPA 3MNZB 3BZ4B 2Y06L 4P4KD 3UAJD 1A6TB 1R3KB 5TQ0H 2WQRA 3MC0A 2F53A 3O3EB 4NKIL 3TN0C 3V0AC 5FXCH 1HHJB 1PG7L 3VXMD 5B38B 3L3OB 2BXYA 3QNZA 2EE6A 3EOAB 4WU5A 5FCUL 5ISZB 4AIZA 4M02A 5EPMA 1AGEA 2VZVA 3KNBB 4QRUB 1FQ9C 4HXAH 1FO0H 2ZG3A 4FQQA 1WFOA 1SY6H 5D7IA 2NZ9D 3LPWA 1BD2B 2Q8BL 3GMQA 3LOWA 5HYFA 4P4RB 1P53A 2VQTA 3KXFA 4FA8A 1BOGB 1KELL 5DA4A 4YGAB 3KPNB 5AWNH 3B5HA 4JFFD 2L7UA 4HGWB 4DKEH 3X13A 1AI1H 3LS5L 5BCAA 1B2WL 1BEYL 1I3VA 6CGTA 1Q94B 1NFDB 3PWUA 4HH9B 1TVHB 5JQHC 1DN2A 4XNMB 4X99A 4YFLI 5HDQH 4LSSL 1FL5B 5EPMB 1UYWL 5F3BA 3HC4H 3O8XC 4WHDA 3MBXL 1JHLH 4XTRD 3C09B 4P23D 4WHTB 5ETUB 3VWKC 4RZCA 1MLBB 2HFEB 3SO3C 4ZTPL 2YWZA 1T0PB 3KYKH 4OUOA 4WDIB 3D5OF 2OJZH 2VL5B 2A6JB 3OKMA 4JPIA 5LGKA 5CJQH 5I76A 1AXSB 1B6DA 4QRPB 5EOQH 2VIRA 1ITCA 1KJ2L 1Q72L 2UYLB 4IRSA 2Q20A 3FOMA 1FZMB 2DB8A 4HK3N 4CN1A 1TITA 5FFLA 5DJ2A 2HLFC 4FFYL 3C5JA 3SDCD 2DQFB 3P4NA 2FO1A 3UBXG 2IQ9L 4FQHA 4S1QL 4NKOA 2VLJD 2R0WH 5D70L 1BWWA 3CVHB 5DFWH 2YD4A 2KDGA 2DLHA 5DLML 4JJ5B 4JR9H 2VLLA 4FZEL 1IC7L 4NQCD 1T1YA 4R3SB 3MRFA 1HQ4B 3GMLB 8CGTA 5J1SC 1GPOL 2J7LA 1XGUA 2GJ6D 3L1OH 3VH8A 32C2A 5DEFA 5T1KD 2VDKL 3TA3A 5JW5B 3MRGB 5IIEA 2W9DH 5HHMD 1F4XH 4NHUA 2Z31C 2E9JA 4IOIA 1N7MH 5K9JL 1NMAL 1BF8A 4YBQD 1F4YH 4XXDA 5HY9B 3C60C 1I4FB 3U0WH 5DJZB 4S1SH 5E00B 5E94A 2NXYC 3CFDB 5MEQB 4FFVD 1ERNA 2IBBA 1MOEA 3T1WA 3LAFA 3CFBA 1ETZB 5I6XB 4DOHB 2JB5H 4HK0A 2QBWA 1EJOL 4B50A 5I1DB 4UNTA 2EIBA 2BOBB 1G7IA 3EJYC 4M5YH 2CUHA 1AQKH 1A7QL 5IVOA 2E27H 1B0WA 1S9YA 2NX5E 4ONFH 5HYSB 4GRLB 5HYEA 5FYKH 5IFAL 3MRMB 4U1KA 2NX5A 4OCYH 3NCBB 1N3NA 3BQUB 3EZ8A 2HVKB 4ZUWB 5FYJL 5EZOH 2WWMD 1GC1L 4YHIB 1JGEB 2D7QA 2MQ0A 5I1CH 2EZ0C 1NC2B 4MQSB 1WFNA 1WIPA 3FB8B 1M05B 3TVMC 3G5VB 1GGUA 1SVZA 4JG0L 4Z7WE 4OIAA 2I26N 4KTYA 1H15A 2ADIB 1VGEH 2JK5B 5KSBF 5A16B 3WNMA 4MNGA 3W0WE 3G5ZA 3X14A 5FUCE 2FGWH 3RFZC 4YDLC 2APVA 4F37F 4MJ5B 3WUWB 5HHQB 5C0FB 4Y5VA 3S37L 2FR4A 1ZTXH 4BSVB 2NTFA 3DI3B 2YPKB 4F7PA 1BM3H 4TTDC 5BZWA 4QXGH 4YPGB 1AIFB 4XB7A 5FA3B 2EDRA 3PWNA 3ZT7A 3VFRB 4IS6B 5F3HA 2CKBL 3MRRB 4EDWH 4X8XA 2AS5M 4NQXA 5I1JH 2RGSA 4NNXA 3W81A 5F7MC 4G6JL 4BQBA 1X7QB 3DSFL 1S7XB 4X6CB 3SO5A 4E5XB 1N64H 4R6UA 1FO0B 3ARXA 1YC8A 1WBZB 4JY4A 2R1XA 3QXAB 12E8H 2ITCA 3CC5A 1LK2A 4QTIH 3P4MB 1TJGL 5HHOE 3MODH 2XKUA 3OB0K 2EKSB 3MRMA 4U1KB 3VXRB 4I9WD 4PLKC 5GS0H 2X1QA 2DDQH 2UY6A 4EKXA 2CSPA 1T0MB 1LO4H 1FDLL 4ODWA 4QXGL 4RGNE 4Y19D 4PJEB 2E9IA 4JAMA 1M71B 3WFBL 5A2LH 3RUGB 1A14L 1VEMA 4FP8H 5J6GB 5IJKC 2EEAA 4U1JB 5HHXH 2FD6H 2JB6B 5D2LE 5FUZH 2JELL 3GDBA 3QUMA 1MNUL 4PJXB 3OKLB 1H0DB 3RI5K 4BH7B 1QNZH 4DTGH 3BKYH 3WJJC 3QUML 5ISZE 4PJEF 1CXIA 4O58H 1MQKH 4UIKL 5T33H 1VKXA 4JRYB 1KXQE 3IJYB 5IJVB 1CLOL 2AEQH 1FC1A 1HHKA 4RFOH 3C6SB 3UTSA 4NHUB 2FL5A 2IC2A 4K2UH 5C0AE 3VXRA 4JHWL 2Y36L 2JJSA 4GQPH 4K7FB 4OF8A 3HC0A 5F93C 2F19L 4NO2A 1QSFB 1EGJH 3BSZH 2AJUL 1Z5LB 5TE6L 4E5XA 3RGVC 5LQBL 4KKBD 4QOKE 1H0DA 3EOBB 3RTQA 5FO7B 1T1WB 4M7KH 2P5ED 5D9SA 2IH1B 4NC1E 3VGGA 4JRYA 4Y89A 4HV8A 3QCTH 4PJEE 5JHDD 3LN4B 4GG8A 3ZKXC 1MVUB 4M6MH 3O4LA 3IB4A 5DRZA 3RUGE 4J4PD 3QIWC 1EHLL 3RWDB 3LKRB 2HJFA 4LVOC 4H0GA 4PGJA 2QQKH 1T80A 2XKNB 2AV7A 4X7DC 2OCFD 4P5TD 2VDKH 3NBNA 4M61B 4L9DA 4QRPE 4UUJB 1RZ8B 1AY1H 4JZNA 4G43A 4NKDB 3UP1A 4KZDL 3QDGB 2RR3A 5D6CB 4JDZA 4XRCB 4HF5H 3UAJC 1B6UA 1Q1JH 2LU4A 3BPNB 5DQ9A 5H8DA 4LGSB 4U4BA 3Q0HA 3MACH 1PZ5A 3CFJB 3TBVB 4Q0XL 2YPLB 3ARFC 3C2AH 3MJ7A 4H1LA 3HG1B 5A2FA 5GGTA 2GJZA 1JYWA 3QDJB 1RUKL 1OB1A 3MRRA 1NMAH 3MRJB 4PJFE 5B39A 1P69B 4KDWA 2HRLA 4PTTA 4IOFC 1FH5L 4C56E 3X14B 4LCWB 4JFPB 1MAKA 5KJRL 1T1WA 1OARL 2MKWA 1Q0YL 5FO7A 5KSAC 2DMKA 2XTJE 1BJMA 4LPTA 3RZCA 3PP3H 2UVEA 2YXFA 3TBSA 2Z31B 1D5MB 3ZLQC 4DAGL 5I30H 4LMQI 1NAKL 4PJ7A 5FDWA 3CX5K 4QHLA 1K3IA 2PKDA 2ZUTA 1ZLUH 1SM3H 1KCUL 1SYSA 3GMMB 3V0WH 3ARFB 4OZFB 3CU1A 5K33A 4BH8A 5HDLA 5JHDB 4IIQA 2GUOA 4MD5A 1ADQH 2NY4D 1RUQL 3VXMB 3EO1B 3IVKA 3G6DL 1BLNB 1B2WH 1BEYH 4O4YH 4XTRC 4U7KA 2DQIL 4I5BB 2Z35A 1OAKH 2P8LA 4KC3B 3MV01 3BKJL 1ORQA 1I8KB 4Y4HA 3V5DA 5TQ0L 4FQPA 4Z76A 4UT7L 2X4QA 1A9EA 3NIFF 3RPIA 4U6YB 5E1HB 4KI5F 1A6AB 3NFNB 1LO2H 2EDWA 4HXAL 3B9VA 2HLAA 4LIQE 1WV7T 1P2CA 3VFOB 2GTWA 3WJJA 5ADOH 4PJFB 1RD6A 3RDTC 4C56B 1PY4A 5AAMA 1CCZA 1YEIH 4GMTH 1G7PA 4AEEA 1XCTA 2VB5A 4Z9KB 3RVUD 1J5OL 4WENB 3VWKA 4XXDB 4NT6B 1OCWH 3KLAB 5J1TC 3VW3H 4RMQA 4XBGA 3BPLC 3CK0H 4S1RH 4UQ2B 1CICD 1U8PA 1MLCB 1UENA 3HRZB 1G6VK 3QUYA 3KHQA 1AI1L 2HVJA 3F6LA 3MLSH 5D7JD 3TVMA 1F2QA 3ZE0E 3IDXH 2MMXA 3KR3H 3KPSE 2R29L 4J3XA 1PG7X 3NH7H 2Q6WA 3HNSL 3LB6D 5KANI 3UJIL 2XQYG 4WWKD 4X6CE 4NUJA 2DQCH 2VDRL 1NFDA 3PWUB 4HH9A 5F8QC 4CDGC 5D71H 1W72H 2FGZA 2DQEH 3B2UC 5T1MB 2DTML 3PP4L 5CP3A 3ARSA 3CLFH 1FE8H 4YDVA 3ULVF 4PJ8A 3ZDXE 5J12B 3MUGB 1MLBA 1S7SB 5MP6H 3RIAF 5ESQA 5CD5C 4E9LA 1NCWH 2JK5A 2NZIA 1H15B 1PD6A 5DUMH 3EW3B 3ZYIA 5DMKB 3K4AA 1ZANL 2NYYC 3U6RB 4V1DB 2VL5A 2CDEA 1EZVX 5C6TH 5EZLA 4N0CD 1T89A 3CSPA 1F13A 5C0IA 5KSBB 4PJXE 4DKFL 4R96A 3WD5H 1HCVA 4NKMB 4GG6E 2IF7A 3PWPA 4M48L 1T0NA 5F9WC 2X1OA 4MQXC 5C0AA 4X6CF 1I3RA 5DUPH 2XA3A 4NT6A 1JN6B 4LVHB 2ZNXA 1C08A 2AV7B 4PJBF 1QBMH 2HYMA 3OG4B 1XF3A 4NO3A 1XCTB 3T3PF 3I85A 1HHIB 5E8DH 3NABL 2MSPA 1JZ4A 5FIEA 4OJFL 3WIFA 2O5YL 5AZEH 2Z91A 2F58L 3ZL4H 4FFWC 3ZDYF 1DCLA 5IP4A 1RZGA 2IBZY 1A6WH 5CJOH 3U0PB 3VXUE 1HE7A 5IMOA 4EVNB 3ARWA 4W4OA 3I3EA 3VGEA 1MEXH 2O5ZL 4XCFL 2CPCA 4FRWA 3P11L 5F7DA 1DFBH 4JLRB 5B39G 3WFEL 4WI5A 2CIKA 3L3OA 4F7MA 4EXKA 1UH2A 1HXMB 3DYOA 2NCMA 2WP3T 1EEYA 3MOQA 2XNAA 4PY8J 4RIRA 1QUNA 3FB6B 1IKNA 5FGRA 3D1MC 3GIZH 1X4XA 1ZLUK 5CAYB 4F80A 5EC1A 1K3ZA 2JJSC 5F9AC 3OL2A 3BQUA 4XVSL 4R7DB 2DJ4A 1DBAH 2V6HA 2Z9TA 2Q1EA 1JGVL 3O81A 3LMJL 3MUJA 3R06A 4J1UB 4KDTC 5LCVH 4FMKA 4H8WL 5F71A 1QA9B 4LP5A 4ZFFA 4A2MA 2DI9A 3VDCA 3BQUC 2AV1B 4PLKD 1G7IB 3IDMB 4Y19E 5LAXA 3T8XB 4OF0A 3QQNA 4XC1L 2FEDD 5GGRA 5AZEL 1MI5A 4BUHA 2CJUH 4HCRA 2D7TH 4R0LB 2CDGB 1YUHB 2MPAH 3O6ML 1UZ6F 2VJXA 3KHOA 1FAKT 2HLAB 2OR8A 2OSLB 1RHFA 3I6LE 5CGTA 3DJ9A 3L3DA 2VDQL 1L7IH 4C57C 4WUUB 5L8LB 3C8KB 4WO4B 1X5XA 1J12A 3RPIB 5I6XC 3GSUB 1FL6B 4NQSA 1K9TA 1PEWA 1S7QB 4RISH 2HVJB 1BIHA 1II4E 1QSEE 5CSZA 3QISA 1U8LB 4UDTA 2VC2H 4GG6A 3O4OC 5JHLL 5ENWB 1AH1A 3WO4B 1FZKB 1DQQB 3K4DA 5HDOA 5SV3A 1Z0MA 2A6KA 3SQOL 3IT8D 4TPRH 1KBGL 4XC3L 1G7QB 3HFML 4M62L 5IF0A 5DD0L 3FMGL 1KJ3H 2Q8AH 3Q3GB 4O02H 4N0YL 2NXZD 1R3LA 3BUYA 3KYOA 1T83C 1E4WL 4ELMB 3ZYOA 1IGIH 1BWMA 1PKQE 3QUZD 4PTTB 2W92A 4LBEA 4Y2DB 1FSKB 3V79C 1S9WA 3LIZL 1H5BB 1K4CA 4Y16A 2W65A 3V7AE 2ZKHH 1WZKA 5E6ZA 1YJDH 1GOGA 1FORL 5K9OA 1W0WB 5E2VH 5CINL 2WLZA 4HS6B 4XVUD 2KH2B 1EHXA 4OD1H 2WQ8A 1PZ5B 4L3AA 5D1QB 4LVEA 4W6WB 1LO5A 2A6JA 2Y1VA 3F7PC 3SDYL 1U8OA 1UH4A 3IFPB 1NGPH 3QXVA 3UBXB 4WU5B 4YHKH 4UBDD 5T3ZD 1OTSC 2HKFH 4KJPC 1RV6X 4MA3A 2F53B 3QEHA 5HVHC 4UILH 1L0XA 4OZGA 5BV7L 3BISA 4ZD3H 4AEIL 4FQLL 1RULH 5GS1B 4KI5E 2YOCA 4KQ4H 4ZUWA 4PJGA 2FX8L 1AQDA 4LRIA 5HYQA 4WI8A 3TWCL 2BSRB 3GSOB 4EN3A 4JCLA 1S7SA 4Y1AA 1HNFA 4ALAH 3LRHA 2VDQH 3VXPA 1SJXA 1D9KA 4H0HB 1F5WA 1LO0L 1JMZA 2CKBH 3FRPA 4ZUTB 1VFUA 4ETYA 3BPNC 3O8XA 3P4OB 1QTYT 1CFQA 4HDIB 2WBJC 4ZS7L 3AS3A 4J3SA 3ROLA 2VLKE 1DE4A 3PGDB 5ABDE 5KSVB 4XPFH 4QRUA 5GISL 2QSTA 3IFOB 4XP1L 3NVQA 4PRHA 4BZYA 3T65A 4MMXC 1Z9SA 5HHVH 4L4VB 3BIBX 5JPMB 4B0MM 3QULA 4DW2L 5I71C 5EOTA 3DMMB 1BJ1J 3WN5B 5J4MA 4UUJA 4GAGH 4Z8FL 5A2IH 4PJHF 4S1QH 1Q9OB 1DQMH 5GS0D 1FLTX 2C3WA 4CADA 5BS0D 4M8VA 3HZYA 4MDJA 4U2ZA 1PKOA 3LKRA 4PJ7E 1DQLL 4JCMA 5I75C 3TT3H 5I8EB 5MERA 5IWLA 3X12B 4IRJC 4U6VL 4XP5L 3O8XB 4ZO9A 5D1XD 3ULUL 5DR5H 3HNTH 1UCBL 5GRJH 4XCYB 2CUIA 2ZSWB 2W9LA 4N9OB 4QLRA 1RUKH 4MCYA 1UACL 4QXWA 5DK0A 1P7KB 4ZQKA 1RULL 5EO0A 2NW2B 1AGCB 4MB3A 4BSVA 4ZUTA 3SBWC 4UOW0 4JPIB 1ZT7A 3U0WL 1A9BA 3B6SA 5TDNB 3WUWA 1OQXA 4XI5C 4XNUH 4HIIB 3B9EA 3FONB 5E95B 3VXPB 2VDML 1RK0B 3K8LA 4MAYA 1GSMA 4QYOA 2H45A 4PJ5D 3RVXC 4L4VE 4HBCH 4Q2ZB 4G6KL 4OZFG 3T2NL 1JF5A 2Y5TB 4L4VA 1ROWA 4GW5B 1KCLA 4DZBA 3VFGH 1U6AH 1MSPA 1FGNH 3GSRB 1Y6MR 3QUXB 1MWAB 1DE4B 3MZTA 2YD9A 1KEGL 1JF6A 1QSED 1IC7H 2XRAL 4PR5A 4OLYL 4KWUA 4JREC 4X6CA 4HS6A 1FNLA 3ZKNC 1FNEB 2HWZL 3LB6C 3X13B 3T4AB 3LKQA 3INUH 3FO2B 5FYLL 4L8CA 2DJSA 3VXUD 1YEKH 1L7TL 1ZWIB 2VABB 1J0ZA 3KXFB 4DN4H 1U3JA 4TNWF 4POYA 2OJEB 5FGCE 4MD0A 2AGJL 3ORJA 3SY0B 1AHWC 4G6KH 4G80A 2VZOA 1MJ7L 2K7QA 3K8KA 4HBCL 4K94H 5C6PB 5KVDL 1DLHB 3PQYE 4M1DL 3GKWH 5CD5D 1JN6A 5J9PB 4RNRA 4Y2DA 2F54B 4H26B 4IDJL 4PJ9D 4WWID 3RZCC 1CG9A 3RWGA 2Z93B 3DROB 1CXHA 4DGVL 2AXFA 4Q0XH 3G5VA 4JKMA 3BGMB 1DQML 3P40A 1OAXL 2AEPH 3UC0H 5HYJB 1XEDA 4M6NH 4UQ3B 1NFDF 2ZUQC 1A64A 4Z7NF 1NMCB 4WO4C 4OGYH 4LCYA 1QSEB 1AIFA 2CRYA 1B4JH 3CX5J 4R0LA 5DEZA 3E8UL 4C56A 3LRSA 2E7HA 1FVDB 1WC7B 1QLEL 4NO0A 3ALPA 2BVUA 4FP8L 1JWUA 4WO4A 4LNRA 1BF2A 5IOPB 3TJEL 3OX8B 5H37G 3P4NB 4Y5XC 2B1HH 3RY6A 3C5SB 3NFSL 5EBMB 1TJIH 4RA3A 4MNQE 5E6YA 1WWBX 5H35A 4YLQT 4Q9CA 1T83A 3ZE2F 2ERJB 4LRNL 2BVOB 2IFGA 3ARBC 3IS1X 4AQOA 4O4YL 2F8VA 4L8BA 3HPLA 3PQYB 5DJAA 3RHWF 4BFBD 2FYYB 4RQQA 4HUUA 5IKCA 5I15L 5EA0L 4NNPL 1KIQA 4S1DC 3WN5A 2H3NB 3QEQB 4KKNA 2E7LA 2HJKA 3IAGC 2A77L 2JCCA 1WT5C 4N5EC 3IYLW 4Z6AT 1FL6A 1YECH 4NQSB 3DO3A 1CDYA 4AYFA 5L2KD 1Z2KA 4JKWA 2GJJA 2AGJH 2GTZB 1TTGA 3IFOA 3LKOB 4D2NA 1NAMH 4JVPA 5F7EL 1JPGA 3W9DA 3QO1B 3FO0H 5GSRB 1U8NB 3QHFH 3H7BB 4QXUH 5H37H 3IDNA 4E41B 5HVWA 2HJLB 3BRGC 2R0ZH 5CEXB 2FEDC 4WW2A 2FNBA 1OPGL 3QDMB 2FX8H 4QXTB 4UT9H 4CW1A 3L5XH 3IU4H 4PJ5A 4DJMA 2DQGH 1T2QL 5GGUB 4QF1B 4FQLH 4IOIB 3HCVB 4JZOB 4RBPK 3TJHD 3LRSB 1T0NB 4LRNH 3VA2C 3TIEA 2EDHA 4ZYKB 4LCYB 5EO9A 4ELMF 4R26L 5C70A 2B0SH 3NA9H 1R0AL 5I8OH 1FL5A 3P0VL 3FAXA 1JP5A 1HXYB 3WFDH 5DRWB 2HMIC 4ONOA 4RMTA 4KZDH 1DUYA 1FCGA 1IEBA 3EHBC 5TDOB 4A6YH 3MRDA 1KBGH 4XC3H 3MR9B 1QFWL 3AY4A 4JZNB 4HUKB 3QEQE 1JGVH 3QUZA 2FHFA 4R96B 1V3LA 2JIXD 2WWKO 1IGJA 3KWWA 3UTTD 1LO5B 3IFLH 3WBDA 1Z9MA 4R4NC 3BD3A 5F9JB 5F7HA 3O3DB 1NCDH 4NPYA 3T0EB 2N7AA 4O02L 2WZPD 1Y0LB 4XP5H 1P7QD 3GUTA 4I3SH 4NJAL 3ZKMC 3QIWA 1A6UL 4DGIL 1U9KA 4HKXB 3M1BA 1M7IB 3V6BR 4R90H 1S7TA 3CK0L 4S1RL 4OGXH 5IT2H 3VJ6A 4QRSB 3VW3L 4R9HA 1H8SA 1U3HD 5HHOA 4XC1H 1MFCL 1HIMH 4F33B 1YECL 1X5HA 3MRDB 2E5EA 2RIKA 1CFSB 1A6PA 2ZCHL 5ERWA 3U9PH 2ATKA 4G42B 4RX4D 3MV8D 5BV7B 2H41A 4KJPD 5CFHA 1FCCA 3QAZC 4XPAL 2Z4QB 4QHKJ 3G6AA 4TN9A 4P4KA 5EO1B 4LHUD 2R56H 1PDKA 4ZXBA 4W4NA 5HI4C 4DVRH 1JYXA 1NC4D 4LLDA 5DI8A 4C4KO 1EDQA 4OCXH 4ZNEE 3TA3C 3RDTB 4PLJC 4EBQL 1FGNL 3U0TA 4MAUL 3T0WA 4PJ9B 3QQ4B 5E5UB 3WFEH 2IFFH 2NY1B 4JDVA 1H9VA 5DHVA 3CFBB 5J3HD 1NCWL 4PJHA 1LP9F 1J05B 5H94A 4JG1L 3T0EE 3F5WA 1FE8L 2YBRB 2R1WB 3D3VE 3QNZB 3LD8B 3MRPB 4N1EA 1T0MA 4ZTPH 3EO1A 2I25N 3IVKB 4L29B 5BW7C 4JGJA 1VB9A 3CUPB 2FX7H 1MCDA 3PWPE 3V5DB 4O2FA 1RZJC 5IKCB 2P8LB 1RJLA 3I2CL 4YC2C 1IARB 1AKJA 2CUMA 4M7ZB 3SDYH 1T7VA 4JO4L 1QFUH 4PG9A 5M95B 1I7UA 4OFYD 2H26A 1R24B 4ZPVB 1QOKA 5H35B 1TVBB 1A6ZB 5C0BA 3EDKA 4FXKB 4MCZA 2XFXA 1RZFH 3GMMA 1BJ8A 1NDGA 5D2LB 3E6HA 5J8OA 4ZPTB 5TQ2H 1B3JA 3NZ8B 1KTDB 2VRAA 3DX8B 2P5WE 5C0JB 4MSWB 3WIHL 5C09B 3SKOA 3SPVA 2YSSB 4HWBL 3TT1H 4JRYE 4KRNA 2NY0C 2SEBA 4MXQD 4FQXA 3TCLB 3KPSB 3GJFH 4Q58C 3E2HC 1LEKB 3HI1B 2IMNA 4XP1H 4PB0L 3LKQB 1W72B 2BSED 2QQNH 4TPRL 5E2UH 2UWEE 5GIRA 4JFZH 3GEWB 3AAZB 1OSPH 1JWSA 4OCXL 3S98A 2D4FA 2H6PB 1QVOA 4ODVH 3RVXD 2Z92B 3V5KA 5HGHB 2UVFA 4PS4H 4A6YA 4V1DA 3QEHB 5EU6A 4TQEH 5HD8D 5JNYB 4IOSD 3EO9L 5KS9B 2CLVA 3X11A 4FQCH 3MRHA 1YEGL 2Z8SA 1FNGB 2NNAB 1KTKE 3QQ3B 5HYSA 3DVGA 1B0GA 4HIHA 4QY8A 3EOTL 1QLRB 4LEXH 3U7WL 3DO7A 1IAII 1LP9B 1BD2D 4MA8H 3NH7L 2FX9H 3OWEA 4ZS6D 2F19H 1KTLB 1X3DA 2A6IB 1KEMH 4U6VH 3IRPX 5E6ID 3UZVB 4DKEL 1TZIB 4ZPTA 5E70A 2OTWA 3PG2A 1FNAA 5T3ZH 1SVCP 1FG2A 4XMKH 3NGBB 4JRXD 3JZ7A 1F3DH 5GGSY 4MNGB 2HA1A 1SEBB 2PTUA 5KVFH 3KYOB 3X3GH 4LDOB 4N8VB 1GHFL 1YY8B 4MNQA 1MCPL 2E6PA 5MERB 1MREL 4PJGE 2K9UA 4NIKB 4PYHA 5LWYH 4P23B 1JGEA 4W6YB 1MJJA 1YEKL 3FQWA 1TQBC 3FHQA 4BUGA 1ZT7B 4AEHL 3QQ9C 2BRRH 2EIZB 1MUJB 4L8DB 5GGVY 3QI9D 4XPGL 2XRAH 3PWLA 1JWMB 3CVHA 4L8SB 1N4XL 1NJ9B 4JLRA 4WO4D 1U8KA 4CNIB 1U3HB 4OTXL 1VHPA 2IH1A 4R26H 3R4DA 4OD3H 5D7JA 1LDPH 1A6AA 1Y6NR 4CKVX 1MCOL 35C8L 4POZD 2P1YA 1GGCL 1EX0A 3MBED 5E7FA 3TCXA 1RURL 4HPOH 2CR3A 4UT6H 2VDOL 4BZ2H 4UTAL 3FOLA 1UEMA 4TSAL 4XCNA 1ORQB 2EC9T 4KMLB 2YD5A 3DETD 2DJUA 2P7TA 4WW1B 5DD3L 4OFPA 1XMWA 1T6WA 4NQCB 3IJSA 4CMHB 2Y4SA 1BFOA 1CFBA 3QFJE 2CQVA 3R06B 4OZGF 3SCMA 4LPUA 2J6EH 4N1CA 1BZ9B 5DC9B 4HS3B 2HTKC 3FAWA 5IM7B 1TQCB 1SEBA 2J8UB 5GRZA 3V6FA 3GK8H 1MFEH 1RZKL 3CC5B 1UT9A 5I18H 1UCBH 5GGSB 5GRJL 1WSST 3W9EB 4JZJC 1TZIA 2AERT 5SX5H 1EEYB 1EJ6A 3CLFL 3NA4A 4NQDB 3BW9B 4QRRD 5I1AB 5B4MC 4TRPL 3IFNL 5KVGH 4POUB 1OP9A 4V2CB 4YZFE 4BYHA 5TFSH 3UTQA 3WXWL 1QFWM 3NCEB 3ULUE 2YEZA 2BSRA 1E4WH 2GITA 3GSOA 4ISVA 5DYOB 4OQTA 2AK1L 2XPGA 3ZKXB 5D7SL 4F9PC 2I9TA 3S34H 4DUVA 1R3IH 3TJHC 4FHBD 4OGAC 1QLEH 2XWBA 4XP6L 4OV5A 5D6DC 5D72H 2AXJA 3S3SA 3HB3C 3RNQA 3KWWB 2BVPA 5FHAH 4U05A 3DMMD 3OKKB 5TH2A 1IM3A 4KRPB 3BSZL 2RFXB 5DD1L 1JPST 4XWOD 1XGQB 2BJMH 2F74B 5FYKU 3HA0A 3BKCH 3HE6C 4KHTH 2EXYC 1NC2A 1UWGH 4X4ZA 4P2RA 4I3SL 4IS6A 4XNMA 5FM5M 3VRLE 1G7PB 2L4OA 1C16A 5I66A 1XR8A 4GO6B 2G2RB 3BPLB 2AEQL 2R4RL 3GRWA 4QXUL 1NGXA 1BAFH 1Q0XH 2YC1B 1BOYA 5E9DD 4GKOA 1MCBA 1MFBL 4HV8B 4M4PA 1E28A 1TXKA 2FLRT 4M7JH 4XNQA 1QSZA 1MRFH 4MD4B 3FQUB 4MX7B 2DM7A 3FZUD 3T08A 5JXED 3BRDA 3HN3A 1GAFH 2F54D 1U3HC 2KQMA 4YDIL 3ROOA 4O9HL 4HPYL 4LCIH 4XNYH 4ODSH 5CSBA 1QRNB 4G9FA 1C1EH 2XWJA 2C3VA 3FN9A 3VGHA 5FV2A 4RBPH 4NN6B 2YR3A 3HC3H 4YGVA 5TQ2L 3LN5B 4NWTH 1IAIM 3ES6A 2X1XR 4PG2C 2ZKHL 3W5NA 4X6DB 1LEGB 5JW3H 1ZA6A 3OHXA 1RZ7L 1AGBA 2P45B 1UA6L 4Y4KA 2VLKB 5I8CA 3OAUL 3WL9A 4KPHH 4R3SA 3TBSB 3BPOB 1HYSD 2B1HL 3TP4A 6FABH 5L6YH 2XNAB 4LSVH 4YO0A 5CUSH 2FWOB 4P5MA 5AUMA 2C3GA 4WHYH 1YN7A 3NTCL 4LLUB 1G7MA 1FNHA 1LNUA 5GS0L 2D4DA 3IDGB 3PWVA 3AM8A 4NKOB 4NN5C 5JHLH 2AABL 3UBXI 5MHSE 3VFTB 3I6LD 3RWFA 3TO2B 5J11B 15C8L 5AYQA 3LDBB 4UNUA 3ARGB 2C3VB 3VFSA 4OAWB 3O0RH 5J6HA 4WI7A 4KK6C 1P9MC 4QRPD 3IU3B 3E0GA 5FKAB 3U7AA 2C4XA 1ND0B 1GGCH 3C09C 1EXUA 4QT5B 2CLZA 2Q7NA 2ZJSH 4I4WB 5C6TL 2FSEB 3VDBA 1UB6B 4XCCL 4F7EB 2EYSB 1QRNE 2WP3O 1A1MA 4XNQB 3DXAD 1IL1A 2Z8RA 4LSRH 3THML 3JWOC 3TJEH 4AH2A 4JM2F 4HMEA 4KJYA 4LAJH 5TDPB 5JUEH 1IAIH 4FQ1H 5AAWA 3V0VB 1YN6B 4OCSH 2FJHB 4LLAA 5GRUL 4JPKL 3DV4A 1OT2A 5DMKA 4I3GA 4Z7WA 3VWJC 3A6OA 1TIUA 5MEPB 3Q6GH 2XPGB 1KG0B 1YJDC 2R1YA 3ET9F 4WFHD 3PGCB 2FH6A 4U0QB 1E6JL 5E99L 5T5FH 1LILA 4NFBA 4NM4L 2X4OB 4J3UA 2VISA 4AZ8A 4WDIA 4L8CB 1J88A 4Z0BH 2BDNL 4UV7L 3QPQD 5GRXG 1DVFD 1U8HB 4MXQC 2ILLA 5KVGL 4KMQA 1NMBH 2GFBB 3CZJA 5C9JA 3BD5A 4R4BA 3SGDI 3QUXA 1U91A 3A6CH 1A6WL 5CJOL 2OTUA 2PN5A 4M5YL 3EOAA 2FIKB 4NZRH 1XIWD 3QDGA 4H25A 3RGVB 4OCRL 4OIIH 5DUBB 2CXGA 1JNLL 2FB4L 5FGCB 3DV4B 3NABH 1ZT4B 4ELME 5T5FL 3OJDB 3D3VD 3P2TA 3VMOA 4EI5D 2YMXL 2F5BH 3OB8A 5I17A 5GGRY 4LDLB 3A67L 5TE4L 4GUPA 4GMSH 4I13B 2XQBL 3VXTA 5I1HL 2X9YA 1OY3B 4F15C 4P3WA 3ARED 5FB8B 4YDKL 1R0AH 4ZS6C 3EGSB 2N4IA 5J6GA 3HZVB 3RX7A 3WIIH 4D8PB 3RL2A 1TPXC 1NBQA 4JAMB 1BZ9A 3U2SB 1NLDL 4L8DA 4M6OL 1MUJA 4Y5YB 5JORB 3BP6A 3U7YH 2A1WH 3TA3B 1FFNA 1LK2B 3J7HA 5EU5B 1JHTA 4YHNA 5BXFB 3QPXH 1JPSH 1OW0A 4DCQA 4MWFA 3FCTA 3B9KD 3QAZB 3PIQA 1YNLL 2F5AH 2E8ZA 1MHEA 4H5SB 5CMAA 1KJ2H 1MELA 4ZS7H 4WU7A 3ARFA 4OZFA 4F7CB 2CXKA 5DZNA 1UWXK 3LQAC 3LQAH 3TNMA 3CFEA 3FB5B 4RGMB 5FDYA 5CZVL 5D96B 2G5RA 3H42H 3FRUA 1JWUB 4QRRE 5FF6A 4QHLB 5IT2L 3UO1H 3PWNB 2BCKB 1K2DA 3UYRH 1NQBA 4NRYB 5AD0A 5ID0B 3DBXA 3M17A 3MA7B 4HUXB 1JGUL 4FG6D 4NZJA 5IVZA 1YYMH 2BDNH 3SE9L 5F6IB 5KOVC 5I8KH 2DYPA 3CFKA 3MJ9L 4PREB 3PV6A 3U36B 1T2JA 1YEIL 2NPLX 3DETC 4PD4K 4NHCH 3SKNB 2AJ3A 1QNZL 4DTGL 4ETQB 3P4MA 1J18A 1VESA 5D2NE 3O2WH 3WN5C 5IW6B 5I9QC 1ZVSA 4KI5D 4K7PY 4X6FB 1A14H 2DQUH 4LMQE 1IKFH 4EBQH 2A2QT 3U82B 2G2RA 1MFBH 2V9QA 5EULV 1R3HB 1X7QA 3V95A 3QJHB 1NSNH 2ZCKH 3NA9L 4ORGA 2WINA 4KDVA 3ULSA 4DZ8B 3PL6C 4M43L 1T1ZA 2AEPL 4LIQL 3V7AG 2ZJSL 4I2XA 1U2CA 2VL4A 4XBEL 3VG9B 1MH5B 3NPSC 1ZWIA 2F74A 4GKNA 3NIFE 1X5AA 2AXFB 2XZAL 4JKKA 3HG1A 3SDAA 2HT4D 1IM3B 1W0VB 1IFHL 4GRLC 3O9WC 4R8WH 4UDUA 4F7TB 3CFJA 3TBVA 1A6VL 4RGMC 5SWZA 3SE4C 3QB7C 3W2DH 3VXNA 2FO4A 4BSWB 5IW6A 2P4AB 4M62H 3CIQA 3DV6B 5CP3H 5MENE 3DUSB 2ED7A 1OAYH 5D72L 3TBWA 1DLFL 3KPTA 2XZCL 4I0KA 1XZ0B 4QTHB 1JCKA 1LEKA 4FFZL 5E4EB 3MYZA 3S37X 3C60B 3MO1B 3ARPA 2A6KB 2DM3A 1FAIH 1DQQA 2J88L 1UH3A 5DJYA 3IDJA 2KZWA 5C09A 4WFGD 3WFCH 4HS8L 3C60D 4ZOEA 4Y8AA 2B1AH 1DBKL 1XGYL 4NO0D 3RPKA 1VCAA 5AG8A 1D7FA 2VSCA 4HQQL 1QFWH 5DJ8B 3LN4A 4GG8B 1TLKA 2DQDH 4YBHA 1BQLL 4ZNCD 1RIVL 1UC6A 1I3GL 4X7SH 1R5IA 4ESKA 2NW3B 3VGDA 1FN4A 1S7WA 3LQZA 1NCCH 4LNVA 1ZVHA 3DX6B 1X5JA 3Q2CA 4M1CC 3AB0B 3HZYB 3RZWA 3ZKSD 1VEPA 2HFFB 1MHCB 4ZSOE 5JXEC 1ZHLB 4ZFFB 1AGFA 1RZIA 2Y72A 1HI6B 3SE3C 4X6EB 3OXSA 4BFGA 3O2DA 2B20A 5SWSD 3GRWH 3HLAA 2EH8L 1SQ2N 3G6AB 4JFDE 1J10A 5T1LA 3AMLA 5IBLC 3TYFA 3L7EB 4DK3A 5JPNB 1OAUH 1FFOA 4I1NB 1MRDL 3ZDYE 2CO7B 3JV6A 2ENSA 4P2OD 4ZUSB 3V5HB 3OAYK 4LLWA 3ROLB 1V8HA 5BQ7A 5KN5B 3ILPA 2GK2A 4OI8A 3HUJE 1IGFH 1P4BH 3MMEA 4YFEA 1S7XA 4F7MB 5EWIH 1IAKB 1QEWB 1EFXA 3ARQA 2HT3D 4NNXB 2OQJA 2YA2A 3F65A 4TTDD 1I1AC 4PJIA 1KYOJ 4HWZA 4GKZB 5EO1A 5LCVL 1XF4B 5EZJB 2LVEA 3N1GC 1YEHH 3OKEB 2KL6A 1HI6A 4HCRL 4QRPA 1UVQA 3T77A 3MLUH 2HWZH 2MKLC 2YN3A 5HI5D 2V7NB 4M48H 1OD9A 1CU4L 3GM0A 3TBYA 3IXTB 2N1KA 3GMOB 2M1KA 4WRLA 4RAUA 3X3GL 4NQUA 4LCWD 3GZKA 4S2SB 5HHPB 2QSCL 4U3XA 4PRBB 3UJTL 4D3CH 4D9LH 5J57B 1T20B 4ZSOB 5I0ZA 4PP2B 4OFIA 1G6RH 1UB5A 1CLCA 3HE7D 4N0UA 5EUKB 4J12A 1S5HB 1QKZH 1CDCA 5HHOD 1HSAA 1RVFH 3PQYD 3RU8L 3FQXB 1DDHB 2IAMA 4KRPD 3ARDB 1ZT4A 3QZWB 4LPXA 4E42A 1HKLH 1KGCE 2J6EA 4XX1G 5CIPB 1ZXQA 3ZDZE 2DDQL 1Q94A 2AAVA 1P1ZB 3KLSA 4YHZL 2OL3B 3GM8A 4RWHA 3BPCB 3L3KB 1G9MH 5DVOA 1D9KC 4KUCD 1YN6A 1W8OA 1AXTL 4Y5VC 1OSZB 1MF2H 4MA1B 3GMRA 4Y7MA 5CZXC 5F7NC 4EDXB 1UACH 3B43A 5JW4M 1N59B 4UT9L 3O45A 5I1DA 4F37K 2IPUK 4WTZA 1BIIB 4JRXB 4XVJH 1TTFA 4LPYA 5D7IB 3CCHA 3MV8E 3QFDA 1T7ZA 3UPRA 3P4LA 3VG9C 2W0FB 3CPLA 4YNYA 5E0QA 5SWZB 4MSWA 2DN7A 4GAJL 4Z7VE 3BH9B 4NN6C 1IAOB 1KN4L 5C08E 3D85D 4U49A 2A77H 2VKXA 1A7RL 4G6FD 3IKKA 5T5NG 2B2XL 4KKBC 3OXRB 1U92A 1T22A 4XHJD 1MHEB 5CMAB 2ARJA 5TE7L 1HOCB 3QJFA 2GI7A 1ZLVK 3MFFA 2H8PA 2H2SD 1RI8A 2HG5B 1KJVA 3VFOA 1CF8L 4D3CL 4D9LL 3PHSA 3ZTJG 1L9MA 4KGJA 2R39A 1FYTE 2PCPA 3AREC 3GMNA 5AYUH 5FYLD 3EFFB 3MUHL 5GGQL 4ODXA 4YX2L 3NCJL 4X0KA 3FOMB 3QDJD 4L1HA 3QXTA 1KEML 3SE8H 1ES0B 4I2XE 4GRMA 2R2HB 3FO9A 1K5NB 4H1LH 1Q9KA 3NCMA 4NM8L 5EN2B 2GAZA 5I0DA 1DANU 1INEH 1ITBB 3NN8A 1I9JL 3QXDB 3MRFB 3P0YL 3TO4D 3EOTH 4LEXL 2EIEA 2R4SL 4NRXB 3L7FA 3CCHB 4IRJB 5CBEA 3I84A 1T7WA 4JJ5A 2Z93A 4MVBD 3RP1A 2X9WA 2XA8H 3O45B 5DD6B 5SV4A 2ADGB 3T04D 3CAFA 1DQLH 4HD9A 1Q0YH 4MQ7B 5HGAB 1T1XA 43C9B 2ZNWA 4X7SL 4LLVA 4F8TA 5CILL 1BGXH 4NQCE 3K74B 1DQJA 5CGYC 4C56D 4LCWA 4RMRA 1C5CL 4D94A 4LDEB 5E9DE 4EN3D 3LZFH 4F3FA 3QUMH 4RDQG 1IC4H 5JIPA 1NBZB 3AB0C 3ZO0A 4P57B 4OB5L 4LARL 2NTSP 4TRPH 3ULUD 4HKJA 2AVGA 3CDFA 1BD2A 1SMOA 1L0QA 3DTXB 4BA8A 2W9EH 4NQDE 2DD8H 4X4ME 3OGCB 4RAUB 2X4UA 1T6VN 3BZDA 1SM3L 1I3GH 4O51B 5MEND 3MLTA 4NSKA 4O5LH 2V2TB 3B5TA 5FO9A 4GAJH 4FFYH 3T0EA 4XP4L 5C7XH 4R90L 2P47B 4G5ZL 3VXTB 1P1ZA 4NNYA 4Q2ZA 3QR2A 2FBOJ 2Q76B 3MREB 5ESQB 4LLVB 4K8RH 1JV5A 1GZPA 1CFVH 3QFJD 4HKBA 1JTOA 5J06A 3CLEH 3GMRB 5D7LD 3L5XL 3C5ZA 1HSBA 4URTB 1YZZA 3OJDA 5T3XL 1D5ZB 1EEUA 2VXQH 1VENA 15C8H 3HG1D 3WFHA 3IAPA 4L5FL 4KVCH 1CDGA 5C09E 1ZA3B 4KQ3L 1KN2H 3H2WA 3CGTA 4FQXC 1E4XL 4H8WC 1F02I 1DLFH 4OV5B 4TOYH 1EXUB 3RDTD 5C0EA 3K1DA 2D7TL 4R7NA 5DUML 1WCBB 4BJLA 3H3PH 4LGPB 3AUVA 3D48R 1CICA 3GJFA 4NFCA 5IQ9B 3KPRD 1PJ9A 3HLAB 4CRPA 1JGLH 5GGTL 3ARBA 3S36X 1O5DT 2DWDB 1I9EA 3PV6B 3U36A 4AQ1B 4I18C 4XBGB 3O2DH 4P23C 1KB5A 3DBXB 4K3EL 2EXWD 2AKRB 4XBEH 2ZCLH 2QQKL 5I19L 4ZTOL 2YA1A 5E6IB 2H8PB 1CTOA 4NN7B 4PJIF 2Q6WB 5J13B 1X5IA 2R29H 2FHCA 1Y18A 3FQTA 3WDIA 2AK4B 4LLYB 4N8CH 4NBZB 2X41A 1IL1B 2R2EA 1EMTH 5INDA 5I8EA 2HLFD 4XCFH 2N7BA 3G5XA 4UZGA 5I1LB 3L3IB 4MDJB 1SMAA 5LQBH 3BH9A 4NQCA 2BMKB 2NLJA 5C07A 1JGDA 1F6AB 2Y06H 1JZ2A 4OGXL 4KK5D 4YHMH 3HTLX 3MTRA 4ELKA 2GK0B 1N0XH 3LSOB 3D2UB 5T1DL 2C1PA 3CZFA 5ICXA 4N0CC 1G0XA 5HDBE 4Q9RH 2A83B 2QHRL 2JIXA 1BD2E 3UTTA 4KUZH 5GS2D 3OX8A 4Z18A 3HZMB 3R1GL 4U1MA 1CXKA 2RCSL 4RAHA 4GXVL 3JTSB 3IJHB 4JGMA 4MNHA 4YBQC 5I1JL 3G6JE 2G60L 4ZAKC 2ADFH 1OOAA 1CFTA 1MNUH 3HUJA 4P2OC 1NFDE 2NXYD 1P5VA 2R0LH 1FL3B 2X1PA 4HWEL 5DA0B 1QLRA 2EDKA 2PYED 3WFBH 2YK1L 3STZB 4KRMB 1RUQH 2BP3A 2ZPKL 3VWJA 4PGEB 1G7JB 4KJWC 4PPTA 1BJ1H 3ULSB 3P9MA 3UX9B 4DZ8A 1XGTA 3Q6FB 2ICCA 2ZUYA 3N1MC 4GT7A 2AK4E 4M1GL 2XXCB 3EJYD 1EVUA 3M8OL 1T20A 3FT3B 1IRAY 1E27B 3GI9H 2EDTA 1DBKH 3FQNB 1CZ8H 2V2XA 2VZ1A 4JY5H 4WJ5A 3FB7B 4X7TA 2FJGB 4F7TA 3IDIA 1SY6A 2XZZA 3E6FA 4LHUA 4G80B 1EO7A 4ZAKB 7FABH 2VN7A 1CWVA 1B0RA 4C58B 4PJCF 3VXSA 1QFUL 5IV2A 5IMLA 1ZV5A 2J8UE 5F8RC 2WLYA 4MJID 1CS6A 3ARTA 1M7DB 1ZHBB 2VXSH 2EDBA 4Y4FC 2YWYA 4HAFA 2BOCA 4HWUA 3OSKA 1RY7B 4KMTH 5GXBB 1KULA 5BRZB 2ITDA 3S5LA 1C16B 3Q6FA 5IG7A 1EEQA 1FV1A 3G6JB 4TSCL 3ZHLA 1UXWA 3HZMA 5IHUH 3VFWB 4OKVA 3K2UL 2PXYA 3QO0A 1AD0B 4JKPL 4HZLA 4JFDD 5SX5K 1A1MB 2H1PL 4NBYB 3T1FA 3L5HA 5LBSH 3IKCB 1AY1L 2YHGA 1UADC 3FCTB 2MPAL 3O6MH 1H3PL 5A2KH 3IJHA 3WLBA 1KLUB 5AWNL 1MCHA 3I02B 4L3EB 2Q7YA 5DJCB 2LV4A 5CJ5A 4HIIA 4FZ8L 1NKRA 4K3DH 4WWKA 4O5LL 1I4FA 5HYJD 4CJ0A 3PJSA 3TO4B 2NY5H 5AD0B 2VDMH 1UVQB 4N9GA 2H2PC 3KXFD 3SDDA 5IBTL 3BESR 3WV0A 2PCPB 3GMNB 3UYOD 3TF7C 5E9DB 1OF2A 4UIMB 3LH2H 5C0CD 3LEVL 3IJYA 2ZP0T 5IJVA 1LNUB 2FB4H 4WTZG 3EBAA 3X12A 3MRCA 3VU2A 4ZDHA 4LCCA 1SBSH 4YAQA 4NQDA 5BXFA 4HHAB 1OWWA 1AO7E 4C83A 5BRZE 4LSDA 5CGMA 3TPKA 2DQHH 4ZFZA 3KLHD 4WCYH 2XOTA 1UZ8A 4UV4H 2CK0L 3OJMB 1MRCL 1G9MC 4K3GA 4ZXBB 3MCLH 3WHE1 2VQUA 1EBPA 3F12A 3QWQB 4GG6F 4RFOL 5HVHB 5FYLE 4DN3L 2PR4L 4YHNB 1N8ZB 4OJFH 4HFWA 4OCLC 5LKNA 4MB4A 4MS8D 3TGXA 4XXCA 4EUPA 4PJBE 1YEGH 5DHYA 2Q7YB 1I1FA 2DKSA 3U4EB 1OGAB 4KAQH 5GRUH 1TPXB 4G7VL 2BK8A 3U0TB 2WW8A 3WHXA 4JG1H 4NFDA 4UT7H 2I9LB 1BFVH 1HSBB 1QLFB 1GAFL 5F3BB 1QPXA 2FJFA 1CR9H 2E9WA 4Y1AB 3LKSA 1LDPL 2X1WL 4IIQC 5DQJB 1N5AA 1IJ9A 1FGVL 1ONQB 3PDDA 5L7XH 3ARDA 4YHYB 1OM3H 5JDSB 2HN7A 1T1XB 1ADQL 1XCQA 2G5BB 3QIWD 1T03L 4U1NB 4M8QA 2A9ML 3JWDL 1MCFA 3WIHH 2WMPA 2JJTA 4JRWA 3JV0A 1WVZA 4WFEE 3PE9A 4QOKD 3SKNA 4P5TC 4Q9RL 3VXSB 3MXVL 1AFVH 3NACL 4MXWH 4RAVA 3TM6A 3O4LD 4XPTH 4HKXA 5JA9A 1JNLH 2EO9A 2EDOA 2X4NA 4XT1C 5B22A 2BJML 5HPMB 4I3RL 2R1YB 3DTXA 3IDYC 4JFYA 1DN0B 5DR5L 1ZA3A 4X6BB 1A6VH 3RTQD 2AI0L 3REVA 3UTPD 1REIA 5C08A 2R2BA 5BMFL 4B41A 5EA0H 1ODAA 1T7XA 1OGAE 2C26A 3TT3L 2QR0A 1IBGH 4PJIB 3WLWC 3MNZA 1E4KC 2G5BA 3WNKA 4OZ4A 2NQCA 5JDSA 1EA9C 2Q76A 3MRLB 2PF6A 3BW9A 3X11B 1CI5A 3N06B 5I1EH 1AXIB 1MY7A 4QT5A 3B8SA 1Q1JL 4PJFA 4QRTA 1J0YA 1UGNA 1ZKAA 2IALA 3S36L 5A1AA 1KC5H 4X6DA 4H0IA 4GW1A 5IBUG 1WFTA 3ES6B 2A83A 2X4QB 1JRHH 5DC4B 5CBEB 2ED8A 3TO2A 4NKIH 3TIDA 4QOKB 4PJDA 5C0CA 5C0RH 5K9QG 4Y16D 3OAZH 5IQ7L 1WBYA 4ELKB 3BGFC 2IWGA 3B5GA 2BOBA 1KB5H 4ERSH 1LGVA 1VSCA 4QCIB 4FOMA 3IU3A 3VCLB 2P8MA 1VDGA 3H9SE 3RWCB 5J11C 1G7MB 1F6AA 5FGSA 1FLRH 1MI5B 2APFA 4J6RH 3WS6C 3QDHA 1EFXD 2H32B 2EXWC 3AMKA 5I1LA 3V4PH 2LU3A 3MRLA 3DVNA 1M7XA 2GTZA 2B4CC 1NGQL 3T8XA 4Y1AD 3O0RL 5HVFB 4NCDA 2BVYA 2BY0A 3D85B 3KYNA 3VFNA 4O2CA 3WJLA 2W0KA 4LLMB 4JFFE 3I3DA 4YFDB 3U46A 5DHVH 2DQFA 4P2QA 5INCB 1WEJH 1ZT1A 2DKUA 4Y4FB 5A43C 2Y7QB 1OAZH 4KMTL 5SWSE 3SGKC 2LTQB 4DAGH 5I30L 1XR8B 3BO8A 3G5YB 4DKAA 4G5ZH 3QWRD 4JFYB 4PBVC 5GJTH 5B3JE 4V1DD 3FQWB 3GMLA 3VFPA 3UYPA 1GXEA 2DS4A 1C8PA 2GCYA 5DSCA 2NY6B 2PYEA 3HE7A 5I15H 4H1LB 3UTSD 3UPCA 4PTUA 1I9RH 4PJBA 2DBLH 1DBJL 2MHAA 2WNGA 5CINH 3QWOB 4ZOAA 1RFDH 4U0RC 3D39B 2E6QA 3EZJB 3QXWA 5TGBB 2KUTA 4S11A 3DHJA 3WUZA 5FOBB 1MEXL 3ARDD 4X99B 2HFGH 5IEHB 5GZND 3FFDB 3AU1B 1QZ1A 2ZUVA 5T3ZL 5KW9H 1A2YB 3R0MA 2V9TA 2FJFB 1T5XA 2ZSVB 3SJVA 3VI3F 3KYKL 4APQA 1KC5L 3VFVA 3KPSD 4N90E 1NGZA 3SE3A 3LQMA 1GZPB 3O6LH 3H0TA 3MGTB 1FPTH 3LVEA 1T2QH 4Z7OE 4ZFOL 2EDLA 3MBXH 1F3DJ 2UZXB 2XIDA 3BE1H 3ZKQD 5C09D 1P6AB 1T04A 4HJ0C 4PJHE 5L8JB 2JB5L 3WCYA 3HNTL 4W81A 1U8QB 5F1IA 3DX7A 4RAVB 3WUWG 3SGEI 2FEEI 5IVXE 3ARGA 4PJ7F 4YHML 3MGOA 1O7VA 5D7KD 2VR5A 4NWUL 2IPKA 4PRBA 2X9XA 3PXHA 4WJ5B 5A40E 1QHPA 4JN2A 3UXFA 3SCMC 3ESUF 1BBDH 5IB1A 4UNVA 5F9OL 4NRYA 1BVZA 2B39A 3PGCA 2XTJD 4K8RC 3ZTJH 1AJ7H 4JO3L 4DUWA 1QR4A 2JJTC 4BQ8A 5D2NC 4OV6F 2FGWL 3B3IB 2QADB 3PWJB 4OZFH 4NJAH 1JPSL 4E42B 1MWAA 3Q6GL 3PDOB 2IQAB 5DS8A 1BVKA 4FZEH 1UZ8B 3RIAK 3ZTNL 1WTLA 4G9DA 3OMZA 5IK3A 1JI2A 3QDAA 1KN4H 3U83A 2GY7B 4WW2F 1F00I 3S9DB 1KYOK 1OGAD 1PZUB 4XZUA 3ZYJA 3GFUA 4MB5A 1FYHB 5E7BA 1TQCC 4Z7VA 1JHTB 3L3HB 4OCYL 5DJYB 1H3PH 3S5LG 4ONHB 4UIMA 1QG3A 3GBNL 4XH2A 5JIKA 4PGBA 5E24E 4DEPB 3WLBB 3PWPD 4JVWA 4X6EA 4XVJL 1J5OH 4PJAE 5E2TL 5JOPE 4QHNB 1CT8B 2DI8A 4GXUN 4YK4C 4WNQB 1KLFA 1FBIH 4XCYA 4LNRB 4K9EH 4ZD3L 4AJ0A 3V8CA 5KSVA 4HIXH 1TZHB 1XT5A 3O6LL 4QRTB 4DGVH 1TFHA 2CK2A 2C1OB 4Z7UB 4IJ3C 1HWGB 2JB6A 2PXYC 2ARJB 2R15A 3GKWL 4NDMA 3DSFH 4K3JH 3T0DA 2P5EE