4RGNE

Structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
220
structure length
220
Chain Sequence
DIVMTQSPSSLTVTAGEKVTMTCKSSQSLFNSGNQKNFLTWYQQIPGQPPKLLIYWASTRDSGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYTYPLTFGVGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQDGVLDSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
total genus 48
structure length 220
sequence length 220
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rgnE01
2LU4A 4Y88A 5DRNB 3K81A 4NC2B 4U6VL 3R8QA 5FYKL 3KYMB 5SX4H 3FKUS 4X7SL 3H9ZA 4XCFL 1ES0B 3LOWA 3DV6A 3TEUA 4XXCC 3R4DA 3QZWG 3EAKA 3MNVB 4P5KB 5KS9E 3ZDZE 2J4WH 3BQUB 2A74B 3FO2A 4GG8A 2XKSA 5T5FH 4L3EA 2XA8L 1Q0YH 4AZ8A 5KSAD 3BIKA 4Y19A 1MHEA 3SDAC 5HYSA 2NPLX 3VI4E 1NGPH 2JB6B 5CEXA 2H9GB 4FFVD 5IJVB 2Z8VC 1CDIA 1NL0H 2DQTH 1A5FL 1NFIB 3B6SB 1U8MB 1F5WA 1XR8B 4OCXH 4X7SH 3H3PL 4XCFH 4C56A 3P4NA 3VFTA 1K5NA 4PUBL 4OZGB 2W9LA 3OAZK 4DOHE 5ILTL 1AO7E 4JQXC 5BZWB 1OCWH 5J89A 4OCYL 1KCKA 4HUWB 3VFVB 3L7EB 4JO4H 1BREA 4PB9H 4ZFFA 3T1WA 4X6EA 2XA8H 4M62H 1XT5A 1I3UA 1D5IH 2YZ8A 3MA9L 1I9JL 4ZD3L 4CADB 2CO6B 1UYWL 3RWDA 1TQBC 2XNAB 2QKIA 4HMDA 5E00B 3GDBA 1UFUA 1A5FH 3K1DA 1X7QB 5DD1H 1KIUA 4XPBH 4FFWC 4PPTA 4WI4A 1MREH 4MJ6B 3QUZD 3C5ZB 3GIVB 5F96L 5FKPA 4HGWA 3SDXE 4AY0A 2FO1A 5ILTH 2YWZA 2XTJE 2AJZB 3AS3A 4PJXE 4U1JA 3LZFL 3HMXH 35C8L 1H3VA 2N7AA 3LQZB 4JDVB 1ORQA 2EDQA 4POZC 4F37F 4JQVA 3HZMA 4KTEL 1TTUA 1IAII 3V52L 3OR7B 4LLUA 3QIWD 4Q2ZB 2D03L 1A1OA 5CILL 5KOMC 1N2RB 4YBQD 4GAJL 4FQHA 3NGBB 3C5JA 4IMKA 4CMMA 1KCSL 1Q9LB 2PO6B 3LZFH 1P4IH 2HJLB 35C8H 1FDLL 1W0WA 4IRSD 2Q8BL 3KPQB 4Y5XA 1IKNC 4X5WA 3WL9B 2B4CH 3IETA 4E5XA 3V52H 4H8WL 4D0BA 5B38A 4KUCD 4HKJA 2D03H 4HKBA 3FRUA 3WSQL 3AB0C 4UT6L 4Q97A 2LQRA 4OB5L 3MV01 4PJ8D 4MXQC 3V6ZB 5E2TL 5L8KB 4IOFD 2VUOA 3JVGC 1MFCH 2HKFL 4P2CG 5LGKA 1VERA 2I5YH 5BXFB 4XMKH 3UPAA 3GSVB 3ORJA 5LJYH 2ADGB 3QUKB 3QCTL 5FM5O 3FONB 1FDLH 5C0GA 1S7RB 2YEZA 5DK0A 4TN9A 2Q8BH 3BKCL 4WWKD 2QEJA 4P2QE 1WC7B 3BPNC 1A6AB 3DXAE 1NCWL 4H8WH 2YD6A 5HYEA 2YD9A 1JN6B 1JZ4A 2G60H 1CFSA 3WDIA 3EYOB 4AK1A 2NLJA 2WIMA 5CAYB 4OB5H 2Q1EA 4PG9A 4AIXA 3MV8E 2Y5TA 4QHMA 5GS3A 3MBEB 1AQDB 5D7KE 3H9SD 1UGNA 3O6LL 4PY8I 1GGYA 5C0BA 3M1BA 4NQEA 1LDPH 1RPQA 4I77L 1IL1A 4ELKB 2BNUB 1HCVA 1BFVL 3BKCH 4KUCF 3E2HB 4LARH 1VESA 5GS1A 3E1F1 4AEIL 5KVEL 4ZFOL 1D5BA 1NCWH 3PDGA 2F8XC 3DV6B 1I3RA 2IFFH 2R1XA 3T77A 4LPTA 3WV0A 5F7FA 4MMZC 1XZ0A 2D4FA 4AJ0A 4GG8B 4LSQH 2XT1B 4L3EB 4DKEH 1Z5LA 4ZXBD 1S7QA 1PX4A 3O6LH 3BIKB 1UZ8A 5C0CE 4Y19B 3FRPA 4HXAL 3I3BA 1TITA 5T1MA 3SPVA 5HYSB 3DUHA 5CEXB 4I77H 1WWBX 1YQ2A 4LQFL 1BFVH 2ED9A 4RAHA 1OW0C 3ZYIA 4WFED 4C56B 2EDRA 3TA3D 3P4NB 2MPAL 3VFTB 1K5NB 3QUMA 3VXUD 1NBVL 4PRAA 3S7GA 5JDSA 3WFHA 3MA7B 1WFNA 1IGCL 4BSJA 2CKBA 4X4XA 3BKML 4ZFFB 4PJAE 1WEJL 4XNQB 3ZDYF 3O6FD 2EEBA 5HHOE 5E1AA 3U79A 5IFHL 4NM8L 5J11B 4K07A 4HXAH 2RCSL 2W0KA 5L7XL 3JV4A 3RWDB 1CFNA 1FAIL 2QKIB 4LQFH 3RIAK 1N0LA 4P4KC 5D1ZD 4C4KT 1RJYA 2OR9H 3BZEA 2XFXA 2WQRA 1CLCA 5I17A 2C4FU 5FKPB 4HGWB 1NBVH 3KPRD 2ZNXA 3T1FA 1IGCH 1D6VH 4U1JB 2R8SH 3S6CA 1WZMA 2QADB 5BO1L 1ORQB 5FFLA 5D7JA 5L7XH 3S3JA 1WT5A 2EXYD 4IRZL 1HILA 1FAIH 3QDJE 5H2BA 2YA2A 4LLUB 5HYJA 1C7SA 2Y9RT 1QEWA 3O4OC 4DUWA 2LTQB 4Y16C 1ZOXA 4ONGL 1A1OB 1ITBB 4MD0A 3O41A 1A0QL 4KKAC 2BOBA 5E7BA 5I2IA 4FQHB 5BV7L 1IM3A 3OF6D 4DJMA 3RIFK 1S9XA 3PL6A 1ZSDA 3C5JB 4OD1H 4CMMB 3QT2A 5E8DL 4KRLB 3C6LD 2YN3A 5DC9B 3VFPA 3VXME 1JPFA 5E2WL 1BJMA 4CRPA 4HCRL 4Y5XB 4IRZH 4L8SA 5CEZE 3DO7A 1SEQH 4X5WB 3UDWC 3IETB 4E5XB 1S9VA 4D0BB 1AH1A 5B38B 3O9WA 1YEEH 2UZXB 4ONGH 4HKBB 3ULVL 3TLRA 3FRUB 1A0QH 1FE8L 2X1XR 5IEHA 2R0KL 1QYGL 3HE7A 2HMIC 4FQ2L 3WDJA 4NQDE 1QSEA 3BO8A 5GZNC 4CAGA 3R8BB 4G5ZL 4A2MA 1SM3H 4ELMA 1PY4A 4K7PX 1A7NL 2ADJA 4Z6AT 1RIVL 3FCTB 4PTTA 1KIPA 2YEZB 4HCRH 1EO5A 2XQYK 4QWWD 5I1LB 3MCG1 3IFLL 4LVNC 5J4MA 1CFSB 3ESVF 3LKNA 2NLJB 4YBLC 1FE8H 3KYAA 1MI5A 2ZSWA 1T83C 4PG9B 2Y6SD 1QYGH 2Y5TB 4FQ2H 4QHMB 3U46A 5EORH 3SCMD 5JHDA 2HJFA 4Q9RH 3ARFA 2XQBL 4K7PL 4EI5B 5JQ6L 1B2WL 5J0BA 3EZ8A 4RBPH 2ERJB 5GGRA 5E6IA 5C0BB 2IANE 3M1BB 4NQEB 5HBBA 1IL1B 3PWVB 1ZHBA 3ARTA 1BJ1J 2EO1A 4UIKH 5FYJE 4Q6IC 1WVZA 2YXFA 4JHAL 3RTQC 2FGWH 3LEVL 3C09B 4NUGL 3ZYZA 1Z9OA 1YPZE 1D5BB 4P23A 4TRPL 1LVEA 4U1KA 3JV6A 1I3RB 1OT2A 2R1XB 4XZUA 3T77B 4NRXB 3VFMB 5DR5L 1CLZL 3BWUC 4WY7L 3EOBA 4QXUH 3P73A 5FECA 5DVNA 1VFBA 3TCXA 1R0AL 3SDAD 1Z5LB 4BH8A 1S7QB 2RR3A 5JQ6H 1B2WH 1UZ8B 1S5HA 5TF0A 4FN0A 4XP4L 5T1MB 3SPVB 1RUML 5M95B 3CXHJ 4PJEA 4K3GA 1AIFB 1MUJA 1S5IH 3D69A 4HPYL 4HX1A 3TVMD 1JK8A 4QCIB 3TIEA 4TRPH 5L8LB 4FP8H 1K6QH 4MZ2A 4LCWD 5JDSB 3JWOL 5DR5H 4NCDA 1NFKA 4WY7H 1N64L 1UWGL 3ETBF 4MCZB 1UH2A 2CKBB 4X4XB 1TXKA 5F7WC 1UC6A 1R0AH 3O3DA 5SWSA 2CIIA 3CFCH 2ZP0T 5D5MF 5IVXE 4NOBA 5E1AB 1KJMA 3UJIL 1QSZA 1A7QH 1RUMH 3JV4B 5D96B 3SGDH 4DGYL 4FFWD 1CFNB 3SKUD 3BRDA 4ZOBA 3DX9A 2IAMA 2VABA 4HPYH 4E41A 1RJYB 3KHOA 4RRPG 5L9DL 3BZEB 1DUYA 2XFXB 3B9DA 5AUMA 5I17B 1DN0A 1ZMYA 1D7FA 1KN2L 3P0YL 3QG6A 5EU7C 2RGSA 4LDOB 5DEFA 1N64H 3FL7A 1UWGH 4QRPA 3T3PF 4MMXC 3T1FB 1T89C 1VEMA 1DEEA 1Q9KB 4DN4L 2AJSH 3I3EA 3D3VE 5EBLA 5SV3A 1V3LA 1YQVH 5SWZD 3KR3L 2PUQT 3ZZ1A 3FHAA 5HVWA 2E9BA 5H2BB 5HYJB 3AC0A 1SJXA 1QEWB 3N50A 3IDJB 4MD0B 1IFHL 3O41B 2VB5A 3PHQA 2BOBB 5C08E 5I2IB 1BGXL 4YHIA 5C70A 1IM3B 3RQ3A 4XI5C 3RVTC 1JNNH 1KN2H 3PL6B 3VW3L 1ZSDB 3ARGA 3HZYB 3VFSB 2VXUL 4F7MB 1B90A 1JPFB 5HYQA 3VH8G 4DN4H 1I85A 4UQ2B 4D3CH 4M8VA 2DIAA 2DMBA 5BQ7A 3L5JA 1AXSA 3KYKL 3MROB 2D2OA 2NY2B 4L8SB 3JWNC 3K46A 1S9VB 5DJYA 2J6EA 1KYOK 3SDYL 4NSKA 3O9WB 4J6RL 3IYLW 5C3TA 5KVFH 2WZPD 1BGXH 4AEHL 1VHPA 3HE7B 3PWLA 3QULA 1QSEB 3VW3H 3BO8B 1A6ZB 3QFJB 2APXA 1X5FA 2QQKH 1E28A 1Z3GL 4JPVH 5HYFA 2FX9L 4XNMA 2VXUH 1Z0MA 2ADJB 4D94A 5HGHA 4U1NB 4ZS7L 4PTTB 4WFGD 3NFPA 1CDGA 4H5SA 3V8OA 1H8SA 3KYKH 3H8NA 4OZHF 5I16B 3OX8A 2V2WA 3DJ9A 3FOLA 3WHE0 1YMHA 3EYSH 4G9DA 3LKNB 5F7UA 4YE4L 1MI5B 5F21B 3K4ZA 2O5YL 2QHRH 2ZSWB 3D2UB 4AEHH 5E2UL 4R97B 3SDDA 3U46B 5GRVK 5JHDB 2HJFB 4GKZA 5DK3A 3ARFB 1O5DT 3UYPA 5GGRB 1Z3GH 5E6IB 2FX9H 3O2DL 4UOW0 3ES6A 1ZHBB 4MGXA 4M7ZB 4J23A 1CK0H 1KACB 3L3KA 2V9TA 2FD6L 4U1KB 4U33A 4ZUSA 3JV6B 1YN6A 2HRPL 3MJ8A 4KI5C 1KJVA 4XZUB 4NRYA 5EUOA 4YE4H 3THML 5EBGA 3EOBB 2IBGA 1E6OL 3P73B 5E2UH 5BVPL 3EYQC 5FECB 3STLA 5FM4A 1VFBB 4BH8B 1JBJA 4RMQA 2V17L 1S5HB 2X40A 5DD6A 4M93B 3QG7L 3OZ9L 2J12B 3RU8L 4F58H 1MUJB 3D69B 1VGEL 2WM0A 3V5DA 4HX1B 5I1KH 3VDBA 3DI2B 5EIVA 3HMXA 3TIEB 4TNWK 5D1QC 2FD6H 3MV9A 3MRNA 4PRHB 2EC8A 3ZL4H 4HS3B 4BELD 3HNVL 4HH9A 1VCAA 4RMVA 3THMH 5DJDA 5DD5L 5K9QI 3DBXA 3TF7C 5BVPH 1FVCA 3FOMB 1RI8A 1T6WA 3TJHC 3O3DB 5SWSB 2CIIB 2KUTA 5GGVL 2NZ9C 2X4NA 3L95A 1KJMB 4P4KD 3WN5B 4NQUA 1LO3H 3CXDL 5GHWL 1I7UA 3RU8H 2X89D 3UCRA 4X80L 1VGEH 3DX9B 3F12A 5DMGC 2IAMB 5FUZL 2VABB 4HWBL 4C59B 2HT3C 4M5YL 1TZIA 4QRTB 4TULL 4ZPTA 2W59A 1GCFA 4U6TA 1CXHA 4WNQA 1E4KA 3MV7D 1DN0B 1FFNA 4X4ZA 4PJ9A 4NC0B 2W1NA 4NQTA 5DEFB 5DD5H 4HT1L 4QRPB 3WUWA 5E03A 2GFBA 3CD4A 3WFBL 1A3LL 1DEEB 4LLAA 5GGVH 2BOCB 4TSAL 3D48R 4G6JL 5EBLB 3KLAA 1INQB 4Z5RA 4U2YA 4YZFF 5IVOA 2VDLL 5F7YC 5GHWH 4Y16D 2DJSA 5K9KB 4KKAD 1M05A 5FUZH 3SE9H 3AM8A 3K2MC 3FB5A 3PHQB 1XFPA 3OKDA 2F9BT 4TULH 1QG3A 3P30H 1RZ7L 4YHIB 4MAYA 1C5DA 1NCBL 1XF3A 5IJKA 3S35H 3ARGB 4HT1H 4IHOA 4WW2C 3I9GL 4BYHA 2DQFA 2EDWA 4G6JH 1Q0XL 3EFDL 5BQ7B 3BYYA 1AXSB 2Q7NA 3NH7L 5IMKA 5DJYB 4KK6C 3VDAA 4NSKB 4FZ8L 2HMID 3LKQA 2X09A 4XC1L 3M45A 4K9EL 4DKFL 3BX7C 1YEHH 1DEDA 2K7QA 3PWLB 1NCBH 3QULB 4QKXB 1MCWM 1FNLA 4LPVA 2DM2A 3L3JA 3QCUH 3CSGA 5FM8A 2EDEA 4EI6A 3QI9A 4XNMB 3I9GH 2NY3C 2P1YA 5DO2C 4Z76A 3HS0A 5HGHB 5ICXB 1QKZL 1MIMH 3ILQC 3NFPB 1FAKT 1S7TA 4H5SB 2YRLA 2W65A 3WE6A 5I8CA 5F1SA 3OX8B 2V2WB 3CGTA 5IW3A 3FOLB 1YMHB 3L3HA 4G9DB 4MB5A 1DQLL 4B5EA 4LHUG 4K9EH 1FL5B 3GBML 4M48H 3FTGA 5C7XH 5EU6A 3SDDB 5BS0D 5I8EA 4I18A 1SVCP 4GKZB 3VGAB 5JOPD 1AD0A 3AMKA 3TNNA 1T2JA 1MAML 3RTQD 3ES6B 3UPRB 3AY4C 1H3TA 3SGJA 1ACYH 3AXLB 4ZOAA 1XMWA 2C7UB 4OBRA 3L3KB 5C0AA 2FEDC 2V5YA 2RBLA 1IGMH 2YRPA 4P2OD 5E4EC 3T04D 2V5TA 1YN6B 3OXRA 3QQ3A 4LVOB 3MJ8B 4MQ7A 1KJVB 2Y5EA 4NRYB 1DQLH 5EUOB 1YJDC 5C0FA 1RAMA 2NQCA 3STLB 1R5IA 1DN2A 4OLWL 3FMGH 5C09A 4PY7A 4R0LA 4N0YL 2E3VA 5DD6B 1T5XA 4G6FB 1MAMH 1MCWW 4L8BB 2AVGA 3KPSA 3V5DB 5E8OA 4EVNA 2JF1A 3VG0L 5L2KB 4X9HA 3GJEA 4X7FC 3MV9B 3CZJA 2GK2A 5BRZA 2FR4A 4RGMB 4MQSB 4HH9B 5IBLC 1EERB 5FB8A 5DJDB 3DBXB 4R2GB 5MEPA 2YWYA 1FVCB 4UU9A 2DDQL 1KB9J 4OLWH 2NX5A 2MSPA 1FYTD 2X4NB 3L95B 5F6HI 4Y5VC 3GBNL 1EH9A 4N0YH 3TV3L 1RZJH 2ZPKH 3FO1A 2UYLA 1XGYL 1I7UB 2EH8L 2X4SA 2VISA 1NAMH 1UWEH 3F12B 3ZDYE 1JGVL 4FXKA 3VG0H 2Z92B 4JDTL 2XWTB 4M02A 1TZIB 3LEXA 2FNBA 1CL7H 3OWEA 4WNQB 5EBWA 1FFNB 3ALWA 4PJ9B 5DC0A 1QFHA 2M2DA 4X6DA 3RBGA 1KB5H 3EDKA 3WUWB 1W8OA 1OAKH 3VWKA 1QFUH 2GFBB 3VRLF 1QRKA 5JZ7D 5F1IA 3TO4C 2DDQH 5EZOL 5KW9L 4NC1E 4GXUM 2HWZL 3KLAB 4Z5RB 5E9DE 4I2XA 2EH8H 1CD1A 5DEGA 3RIFF 1QBML 1X3DA 2A0LD 4Z7OF 1ADQL 2CXGA 5JOEA 3RVTD 1AE6L 3FB5B 4HUMB 3OKDB 3ZTNH 4WFEE 5J9PB 1C5DB 4HCRA 2FGZA 3H9YA 3VXUE 1XF3B 1FNAA 2J8UA 1FFOA 4PLJD 1U9KA 4YAQA 3QWQB 5D6CA 3PG2A 2LU7A 3L6FA 5C07A 5FCUH 5KW9H 5EZOH 1K2DA 2ICWB 2HWZH 2DQFB 4S10A 1SBSL 4GRMA 4OIIH 5DRXA 1XR9A 2DLHA 3NIFF 2J7LA 4P3DA 4KRNA 1ADQH 1AE6H 3FQNA 3LKQB 4JM2D 4W6YB 4YWGL 4TVPL 2YD2A 3C2AH 5K93A 1N0XL 2P5WA 3QEGL 3KPRE 2ARJA 1B9ZA 2IBBA 3L3JB 4G8FA 1L6ZA 4EI6B 2JK5B 4DKAA 4WO4A 3UTSD 5ID0B 4Z76B 3HS0B 2F54D 4LSSL 2B39A 1SBSH 4H88L 4OGZA 4ZSOA 1S7TB 1MJUH 1CXFA 2W65B 4MB4A 3O6KL 3W9EA 5I8CB 3UAJC 2E8ZA 4LVHB 4BZ1L 4NYLA 5A16A 5DHYA 2HT4D 4CL7A 3L3HB 1QOKA 1A7PL 3ZKSD 1QSFA 4YWGH 4TVPH 3FTGB 3IFNH 2FX8L 4Q74A 5I8EB 4I18B 1NGYA 1N0XH 1WISA 3QEGH 3RVUD 2DAVA 2OM5A 1TTFA 4M5ZL 2IBZX 4F9LA 3TNNB 3VD5A 2AI0H 2NY5C 2MJWA 3HI1A 3O4LD 1JTPA 4LSSH 1KJ2L 4OFIA 4P2RD 4GMTL 2VXTL 4J2XA 5C0AB 1TZHB 4JM2F 4KI5D 4EJ1C 1QA9B 3O6KH 3BRFA 3UYRL 3OXRB 3QQ3B 2PN5A 1NMBH 5ANMA 4MQ7B 3GM8A 4U7KA 4XPFH 1A7PH 1RK0B 1D9KC 5C0FB 4OGYH 1R5IB 5HDBF 4ZO7A 4OFYA 5D2NB 3V5HB 5GZOC 5C09B 1P4BL 4G8EA 4PY7B 2XG4A 3M17A 4R0LB 1T5XB 5HGAA 3ILPA 3GKZA 4LRIA 1KJ2H 4ONFH 3KPSB 1NQBA 2VZ1A 4GMTH 2YOCA 5E8OB 4EVNB 1H8NA 4IDJL 1NFDA 1J0ZA 2QQLL 1R3IH 4CN4A 4ZO6A 2BSTA 2VL4A 5BRZB 3H7LA 3WKNA 2FR4B 5SX4I 3TJHD 1A22B 5FB8B 2NZ9D 4DN3L 4M1CC 3QHFL 3CNKA 4UU9B 2NX5B 4LEOA 3HAEH 3LHPH 4G42A 3VGGA 1Z9SA 4U3XA 5A2JH 5DMGD 3FO1B 2BY2A 2UYLB 3SKJL 1CR9L 4KI5F 1F11B 2X4SB 2HT3D 2VISB 2R2EA 3PDOA 5D5ME 1PKQE 2Z9TA 4W6XB 4IDJH 3BDYL 2LVCA 3AVEA 5I1JL 5DRWA 4HIXL 3WNPA 4XC3L 3X3GH 5HVHB 3LEXB 3U2SA 4XCNA 5CJOL 5EBWB 2QQNH 4B0MM 5D4QA 4IIQB 2X4PA 4X6DB 3S3PA 4F57L 1B3JA 3VWKB 4HUNB 3HC4H 4S1SH 5F1IB 1H3WM 3EHBD 3FFCA 3CVHL 3T3PE 5B39A 5CEYA 2GTWA 1CICC 4I2XB 4CJ1A 1CD1B 1ZLVK 1GIGH 4D9QD 1GOGA 3TJEL 3KYOA 1AKJD 3BDYH 2RHEA 1MF2L 5I1JH 3BZDA 1FLRL 1P2CA 4KI1A 3BWAB 5D72H 5CJOH 4PGDA 1XH3A 2FLBT 1S78C 4AEFA 2UZIL 3TIDA 4NZTL 4PJ5A 4LCWE 1F4WL 4MZ3A 3T2PA 2J8UB 1FFOB 4F57H 4YAQB 3QPQC 1JPGB 5D6CB 2P48B 2OZ4L 1DQTA 5C07B 3L6FB 5D9SB 4JKKA 4U3HA 1K2DB 1CXEA 1BZ9A 4UOJA 3D9AH 5DD0L 3CVHH 3NCJL 1CE6A 3MUGA 4GRMB 5INCA 1I8LA 4KK6D 4Y4HD 1TVHA 1NJ9A 1TJIH 5CFHA 1FORL 1XR9B 1ZWIB 1CFVH 4U0RB 2CPCA 4P3DB 4QHNB 4WV1B 3RHWF 1JYWA 3BMWA 1MCQA 4WCYH 3JUYA 1FLRH 3TPKA 4XX1E 1Q72L 2GJ6D 2MOVA 4MXWL 2UZIH 3Q2CA 1IMHC 4NZTH 2F8OA 1F4WH 2ARJB 4XVUC 2NY3D 2OXGA 5DO2D 4G8FB 1REIA 4PY8J 2GKIA 3ILQD 4WO4B 3R06A 3O8XC 4YLQT 4X9BA 5ECJE 5MI0C 4EXPX 5DD0H 4JRWA 3NCJH 5A1AA 1BVLA 4V1DA 4ZSOB 3DTXA 4NFBA 5SWZE 3TZVC 1FORH 5IMMA 2DI8A 3V6OA 4NYLB 4YIQA 5DHYB 3PWPA 2A6DA 5LGHH 1U3ZA 2XTLA 4OZHE 1CVRA 1Q72H 2VXSL 4GBXC 5JIHA 1NGYB 3BE1L 4HMEA 4XP5H 4OQTL 3QDMD 4KFZC 2I60L 5ISZA 3ZHDA 1UKTA 3M07A 1G7MA 3PE9A 4GQPH 2FEDD 3ZLQC 5FV2A 3TBSA 4PJCF 4HS8L 1KV3A 5LWYL 4Y2DD 1ZHLA 2DQCL 5ANMB 2C9AA 5MHSD 5FAAA 4RAVA 4OZIF 4M7JH 3MLYH 5FA3A 3GSOA 1WBXB 3IJSA 5D70L 2PW2A 5FHAL 4KVCL 4KDTC 2DWDB 3C8DA 5EIIA 3QUYD 5GGTL 1II4E 4JFDB 4G8EB 4JFEA 4XTRC 2E8YA 3M17B 4JRYD 1I8IA 1XEDA 3FFDA 2I60H 2BRRH 1UVQA 2IBZY 3KHQA 3ZKNC 1EUTA 3ILPB 4O58H 3KPPB 1ZT7A 1L0YA 4KV5F 2DYPD 4Y5YA 4WFGE 1P84K 1NFDB 3G5ZA 4MAUL 1DVFC 5LWYH 3OR6A 4J4PA 2QSTA 3WJJA 1KTDB 2BSTB 2BVTA 4GH7B 2KH2B 3BFOA 1T2QL 4WHDA 2MKLC 1R6VA 4IMKC 5EWIL 1I9IL 2H2PD 1PKOA 2A9ML 1VDGA 4X6FA 3LQMA 4LEOB 2WAHA 4D0CA 4G42B 4MLIA 1T2XA 3Q0HA 4ETYA 1MCNA 2PTTB 4NQXA 5A2FA 3PDOB 2R2EB 3R0NA 3EYFA 4HIEA 1NC2A 1QNZL 5T3ZL 3QIUD 5T33L 1ZGLA 2IEPA 4XXDA 4LPYA 4OBSA 5DRWB 5IEKA 5I1GH 5I1HL 5J13B 1MCOL 1XF5B 4XCNB 2DQUL 5FUCC 3WNMA 3IXAA 3U2SB 1X5HA 4I0PC 3PWUA 1T2QH 2J88H 1J0IA 1HHIA 2X4PB 2P8LA 5EWIH 4JREC 4JFZL 2R23B 2A9MH 4WEMB 1Y18A 3OXSA 4TOYL 1MCHA 4BH7B 3FFCB 1PG7X 3LN4A 3M8OL 4QEGA 1IC1A 5B39B 3MRGA 5CEYB 2GTWB 5T1KD 2XQYG 2IPTL 5F7KC 1T20A 3IF1A 4NZUH 1RUAH 1EPFA 1I9EA 5T3ZH 3VXRA 5T33H 4QT5B 3P4LA 2UY7A 1ONQA 4YZFE 2A83A 1CXKA 1P2CB 2MMXA 4U1MA 1FGVL 4PGDB 1XH3B 2B7DT 2VKWA 4NQCD 3TIDB 4PJ5B 4NKOA 4JY5L 1MHPL 4PR5A 3O2WL 4KRPB 4JM4L 1BZ9B 2R2HA 4TOYH 5DA0B 5DHVH 1BD2A 3M8OH 3VG9B 1CE6B 2EO9A 4QOKE 2QHLA 5INCB 3P4MA 4IOIA 4U1GC 4GAGL 1NJ9B 3B9KC 4MJ4A 1MFDL 5I71C 5IROC 4OAWA 3IT8D 5GS1C 3BQUD 1EJOL 4KK9C 4G9FA 3QQNA 1E4JA 2R0WH 2D0HA 3O11B 1FGVH 1U92A 4MQXC 4TYUA 3RZCA 1LD9A 2D7NA 2K9UA 1FIGH 2WBKA 4JY5H 2VTFA 3O2WH 1BQUA 1CBVH 5CUSH 5E5RB 1FO0H 4LAQL 4JM4H 5T3XD 3IKCA 3IXTA 1K3IA 2Y7QA 3V0AC 1BVLB 5C6PB 4MNQA 4NJ9L 4V1DB 4Z95L 3BUYB 3UTTA 3DTXB 4GAGH 1TETL 5IMMB 1MFDH 1AD9A 4PJFF 4XMLL 1CLOL 4YIQB 4HUVB 3PWPB 3FAWA 3PGCA 2A6DB 5I1CL 1EJOH 4GXVL 3CH8A 3LD8B 3W0WD 5IBTL 1YYML 1F8TL 5IR1A 1IAOA 4AH2A 1CF8L 3B2UC 3RUGF 3NFNA 2Q8AH 3T2NL 1T1WA 4N8VG 1T7VA 1I3VA 3A0OA 1UXSA 4LAQH 4N0RA 1G7MB 4HJGA 3WEXA 3HG1D 1JHTA 4NJ9H 5CEZH 1ULVA 4OLVH 2YN5A 1B6UA 2OMBA 1ZHLB 4XMLH 5D7IA 1CLOH 1TQCC 1D9KD 5BOPA 1RU9L 4NM4L 3SY0A 1RZ8A 5DQJB 5I1CH 1CI5A 4GXVH 1NAMA 5FA3B 3GSOB 1HKLL 2AV1A 3IJSB 5IBTH 5GZOD 2PW2B 2NTFB 5KVGL 1EXUA 1U93A 4JN2A 3RL2A 1P7KA 3S37L 5HDLA 4JFEB 4U6XA 3T2NH 1I8IB 3U7WL 4GKSA 1EVTC 1UVQB 4QXTB 2X05A 5FYLD 4AMKH 3WIFA 1KB5A 2NY6C 1ZT7B 4G3YL 1S3KL 5D7JC 3RDTA 4Y5YB 2CXKA 3G5ZB 5F93C 3WIHL 5I15L 3OR6B 2F8VA 3LQAL 2V9QA 2BNQA 3PIQA 5ICZA 4NM4H 1BFOA 2NY7H 2X9WA 1LO0L 2Z31C 1DBMH 3PGFL 5KVGH 4O4YH 5BS0E 4X6FB 3CDCA 3S37H 1ZGLM 4D0CB 3RJQB 4JJ5A 5DSCA 5JOPE 2LABA 3RVXD 4NQXB 4MX7A 5K33A 3EUUA 2A73A 3EYFB 4G3YH 1S3KH 4HIEB 1VFAA 2NY2C 5MERA 3KPNA 2FEEL 1ZGLB 1MWAL 3B2VH 4LIQL 1DP0A 5I15H 4LKXA 1D5MB 5IEKB 5JPMA 5J6GA 3IXAB 3SE3C 3PWUB 1HHIB 2A1WL 2WLZA 1LO0H 5CJ8A 2P8LB 3O3EA 1ADQA 3MACL 1Y18B 3OXSB 1TFHA 1AXTH 1NPUA 2NYYC 3MRGB 2P42B 3VRLE 3ZE1F 1PEWA 1T20B 3PXJA 2FYYA 3TM6A 2F53D 4OCNC 1OP5K 3VXRB 4U05A 4LIQH 2YD7A 3BP4A 1PLGL 1S78D 4QXGL 4WDIA 2CH8A 5DJ8A 1ONQB 3SGDI 2A83B 5DUPL 4RGOH 4U1MB 4Z7OE 4NKOB 1IBGL 4R97C 3T0EA 4P5TB 3BRGC 4N68A 1TCRA 4PR5B 4YHKL 2R2HB 5FOBA 2QBWA 3BN3B 4HBCH 4PLOB 1FYTE 4IOIB 5I8KL 4Z78A 3BAEL 3OJVC 3FO9A 3QIBA 5DHXB 4OAWB 4R6UA 4QXGH 4P23C 4MWFA 4RMTA 25C8L 4G9FB 5ITBH 1KGCD 4XVUD 5EU7E 3NIFE 4L1HA 1U92B 2V2XA 1JF5A 1BP3B 4ZUUA 3RZCB 1IBGH 3O8XD 1X4ZA 4NZDA 3HE6C 3P11H 5DLML 2BVPA 3IKCB 5EIQA 4GFTB 1QFWL 1WFUA 1QFOA 2Y7QB 3DV4A 4H26A 2O5ZH 4MNQB 5EOTA 1P69B 4DGVL 3MFGB 4C56D 2BRQA 2F5AL 1KEML 5DJ2A 5I0ZA 3PGCB 1T0PB 3HZKB 3SGKC 1KJ2A 3DI3B 4XBEL 3VXPA 5JIIA 4L3CA 4AH2B 4JFYA 4PJGB 5I6XB 4ODSL 1ZEAH 3CFBA 4HPOL 3DECA 3NFNB 4JN1H 3W9DA 4Z7VF 1T1WB 1GHFL 3SJVA 2BMKA 1UXSB 2DQDH 5DLMH 1HK6A 4UIMA 1QFWH 4HJGB 3WEXB 4HFWA 1CGSL 4DGVH 3OKLA 3DUUA 2X10A 3HAEA 3K7UA 5D7IB 3O2VL 5EPMB 2VITA 1KEMH 2XZQL 2PTUA 5FXCH 2IGFL 3SY0B 1RZ8B 1JE6A 1NAMB 3OMZA 2E9WA 3MV11 4OM1H 3QO0A 1EXUB 1U93B 4K94C 4JN2B 3RL2B 3QXVA 1EAJA 2OL3L 1P7KB 4Y89A 4D2NA 3ZKND 4GUPA 3MUHL 3C9NA 1UT9A 4HPOH 4U6XB 5KS9A 4HLZG 4PRDB 4GKSB 4URTB 1A8JH 1DVFD 5HDBE 3UTSE 3WIFB 1KB5B 5I1EL 3RDTB 2F54E 4MJ2A 3UC0L 1H9VA 5C0IA 1WWWX 1L7IL 3LKRA 3WXWL 1YDPB 3DVIA 1U8OA 2QSCL 3O2VH 2BZDA 2VJXA 3PIQB 2YA0A 5ICZB 2XZQH 4XVJL 2IGFH 4LHJB 3T0XA 4I1NB 3MOQA 2PXYA 5GISL 4F33B 4LGPB 4U1HA 4UZGA 4Z7UA 1IGYA 3WLWC 2VLJA 3HR6A 3P9MB 4IRJA 1S7UA 4F3FB 4JJ5B 1IC7H 4NKIL 1IVLA 2W0LA 4MX7B 4LMQI 1BEYH 2A73B 3IDYC 3O4LE 2Y36L 1VFAB 2VR5A 5MERB 4P2RE 3KPNB 2WIIA 3WXWH 2CRYA 4U7MA 4XBGB 4I0PD 1CQKA 2C3GA 4KI5E 5JPMB 3CVHA 4K8RH 5J6GB 2QSCH 2DL2A 3ELAT 4MDIA 4F8QA 2C3VA 3HMWL 4AG4L 4XCEA 1AC0A 5GISH 4YNYA 3LV3A 4JE4B 4WI2A 3F7RA 1IM9A 1CXIA 1SJEA 2XKNA 4JFFD 3SDXA 4PYGA 1V7NH 3C6SA 4NKIH 3IGAA 2E7HA 1Z0NA 2FYYB 3C8KA 4HEPG 2ADFL 3BH9A 4PJXA 3IAGC 4PD4J 5FV1L 1BAFL 1H0DA 1VFUA 2EDLA 4NPYB 4WDIB 5DJ8B 3I6KA 3WIIL 4FQCL 2NY0C 4OIAA 4RZCA 3WO4C 4QTIL 3KLDA 4LLVA 3EBAA 3HMWH 1MFAL 3T0EB 3GGWA 3OJ2C 5C0BD 1TCRB 4NQED 3ZHLA 2P45B 4F7TA 2NR6D 5FOBB 4IMLA 2A77H 3GB7A 4WUKL 3VGFA 5A2IH 3D85A 4HWEH 4Z78B 4NQVA 1NGXB 3D39A 5ALCL 4KK9D 3FO9B 1P5UA 2ADFH 1J11A 1J86A 3E6HA 4YBHA 1CGUA 4DGIL 1IEBA 3NTCH 2XYCA 5JXAL 4MQXD 4JGUA 3TT1H 4N1EA 3WIIH 4FQCH 3QDHA 1RURL 1N7ML 4RFOL 2P49B 2VLRD 2W91A 2WMPA 2NXYB 4ZUUB 4PG2A 5AAMA 2ZCHL 1Q8MA 2VDPL 2H1PL 2APTA 1NSNL 4F7CA 5HI5C 2F74A 2IALA 4CUCA 1URLA 2W9EL 5EG6C 3X12A 1MY5A 4WUKH 4H26B 5EOTB 4BK4A 3D18B 5JHLL 3ARVA 1GGTA 1JGLH 4F8TA 2M8XA 2Z0BA 4NO5A 4D9QE 5DJ2B 2EE6A 1B4JL 5JXAH 1KEGH 3SQOH 1KJ2B 3KVQA 3OAUL 1RURH 3B2UD 4DW2H 5J56B 3VXPB 5L0QB 1K9TA 3G04A 3CLEL 2VZUA 1XAUA 4BQ9A 5AD0A 5DWUH 3CFBB 3W9DB 1SY6L 1NSNH 2W60A 2YPKA 2COQA 3N1QC 4KZDL 3G5YA 3U4AA 5DJXB 2LAAA 4LCYA 4UIMB 3GMMA 2OJEA 3TBYB 1JHLL 4HFWB 5L2JA 4KROC 1VPOH 3OKLB 3DUUB 1JF1A 3HAEB 4K3JL 1N4XL 3QEQA 4XBPB 5EBMA 3OGOE 2VITB 5EULV 2HVKA 4NKDA 3LN5A 5GS0L 4ZAKA 2X41A 4PJCE 3RWIA 4S1RL 4AQOA 3QO0B 1AP2A 4X5XA 3WD5L 2GJ6E 5F9OL 1W0YT 2YPLE 3W2DL 1O7SA 4OZIE 1HHHA 4GUPB 1F00I 4LLMA 5F6HJ 1SY6H 5D7JD 2Q87A 5KS9B 2F58L 4YHLH 1NCUA 4KZDH 3IB4A 4NKQB 5HYJD 4RFEA 3V0WL 4XNYL 3BGAA 1JHLH 5C0IB 1A6VL 1Q9OA 2CLRA 1IZKA 2EDXA 4X7EC 4K3JH 1N4XH 4NGHL 4KV5E 4U31A 2ICCA 3MXVH 3PL6D 5DJAA 1RZKL 4FMKA 4N0FB 4MAYC 2PXYB 1JV5A 4DFHA 4S1RH 5MEND 5DJ0A 4U1HB 5IJKC 1YN7B 2EIEA 2J2ZA 1IGYB 3H0TA 4N0UE 2IH1A 2B8OT 4BZ2L 4H8WC 4PYHA 4IRJB 1S7UB 5I8OH 4DOHB 4JRXE 2F58H 1AO7B 3OKKA 2DQJL 2NY2D 2WWMD 1FV1A 5CINH 5I0DA 1N6QL 4PJAA 2OS7A 4XNYH 3O9WD 1A6VH 2WIIB 5CJ5A 5HHOA 3G6JF 1S7VA 3H9HA 5DHVA 3GZKA 3CVHB 3HE7D 4NGHH 5DFVC 3E8UH 4OLZL 1HEZA 4JPIB 4MDIB 2NW3A 5MHSE 2DBLL 4XCEB 1ZHNA 2HP4A 4YNYB 4HKZA 3LV3B 4N1HB 1JZ8A 4BZ2H 2NYYD 5I74C 1IM9B 1BVKA 3ROLA 1KIRA 1SJEB 2XKNB 3MLUL 4UUJA 3QI9C 3SDXB 1YY8A 2E7LA 3IGAB 1J12A 5LAXA 3WFDL 2XTJB 2NY1B 3BH9B 4PJXB 1J18A 3NABL 3ZYOA 3QXAA 1FO0A 1H0DB 1MI5D 4P2YA 3I6KB 3U0WH 4OCWH 3F62A 1LK3L 4Y4KA 1JTOA 1DJSA 3IDMA 1WIOA 4RZCB 5JHDD 3SBWA 3V6FA 3ZKQD 1RFDH 4Z77B 3ZKXC 3AU1A 1CL7I 1WIPA 1OAXH 3PWNA 3SO3C 5KAQG 3SE4A 4F7TB 4J3SA 2ZUSA 4IMLB 3GB7B 3B43A 4GXUN 1FG9C 4RX4A 3D85B 3SGJC 3WFDH 4P23D 2YD3A 4NQVB 3D39B 1F97A 5FGCE 1ODAA 4P4RB 2DLIA 3VXMA 3E6HB 3LMJH 2G9HA 2P5EA 4MNHB 1IEBB 4QHLB 5EC2A 1HN1A 3EJJX 3EYUL 4OF3A 1U8KA 4MDJA 1LK3H 3FB6A 4ZDHA 4ELMF 15C8L 2FO4A 4XH2A 1KG0A 3KAAA 4ONHA 3EYVA 3BKYL 2F74B 1LP9F 1TLKA 2IALB 5IB4A 3UJJL 1IILE 5GS2D 4S11A 3X12B 4JKMA 3KNBA 4PRIE 2D9QB 3E3QC 5JXEA 1EO8H 3RKDC 4J8RA 4NO5B 1I1YA 3LCYA 4FRWA 4DEPC 3P0GB 2C1PA 4GSDL 3U30B 3RWGA 4PJFE 4XNZC 4DUXA 5DJCA 2Z4QA 4U49A 4E42B 1G7IA 4KKBC 3G04B 5CLTA 4AM0A 3T0AA 4CNIA 4EN3C 4NQCE 3L3IA 1F4HA 5F6IC 5AD0B 4GW1A 3G5XB 2W60B 2YPKB 3TBTA 4WUUD 3FB7A 1G9NL 1NMCB 1BECA 1WFTA 3G5YB 3UJJH 4P3CL 4JFHD 4LCYB 3MV8B 2ENYA 3GMMB 2OJEB 3W11D 4E41D 2RB8A 3L5IA 3RUGE 5L2JB 1GJIA 5J06A 1TVDA 1JF1B 2D7PA 4FQIL 3QEQB 2IANA 5EBMB 1BIIA 2HVKB 4NKDB 1UWXH 2VXQL 4C54A 2ZZUT 4U3CA 3UEZA 2YBRA 3LN5B 3QWOA 4HSQA 2CQVA 4QRPD 4JDZA 4ZAKB 4YJZL 3RWIB 5TPWL 3O3AA 1AP2B 4X5XB 3MNZA 1YY9C 3MLVL 3CPLA 4PJEF 1OTUD 4RFNB 1HHHB 5EB9A 4LLMB 4XVTL 3AREA 4YUEL 2FL5A 3GMPA 4XPTL 2H32A 5CP3A 5BV7C 4L29A 4RCAA 5T3XE 4RFEB 4KKCC 5IW6B 3BSZL 2CLRB 3MJ6A 2DWEA 2GEEA 3JUZA 1RIHL 5TDNA 1G84A 43CAA 2VXQH 4M4RA 4OZGE 3ARGD 3GHEL 5A3ID 1JV5B 3W0WE 5DJ0B 1CIDA 1HCFX 4WRLA 1TMCB 4Q58C 6FABL 1P6FA 3ULVC 3WS3A 4XVTH 3EDDA 4R3SA 3I50H 4KK8C 2B2XL 4P59L 1FV1B 1JJUA 5TE4L 1FJ1A 3CK0H 4PJAB 3TH3T 3HG1E 1RULL 3RI5F 4CMHB 5IVXA 3BSZH 1N5AB 4G6KH 5HHOB 3KLHD 1S7VB 5DHVB 5KJRL 1A6PA 1EEQA 1RIHH 2VH5L 1IQWL 3PP4L 1M6OA 1HEZB 2NW3B 4HHAA 4LNRB 3GHEH 1FVEA 1YEIH 1ZHNB 3ARBC 3ARDA 4WFFD 4HKZB 2WP3T 1XGUA 4CDHA 2VMFA 4Q6YA 3ROLB 3NZHL 3AS1A 4UUJB 2XRAL 5LXGH 5HXMA 5TDPA 1YY8B 4MA1B 3RAJH 2MTPA 4P59H 2VLKD 4M1DL 4IDLA 5TE4H 3K80A 2WK2A 5FYLE 1KENL 2FX7H 5CJQL 1BWWA 1XGTA 4HGMA 4NP4H 3QXAB 5DD3L 1FO0B 1U8HA 4NCC2 1UM5L 3D3VA 3ZE1E 3V95A 4Y4KB 3SDDD 3IDMB 1IQWH 5FYKD 2O5XL 1F58L 3QDJB 5ETUA 3V6FB 1WWCA 1WLHA 2AXHA 1P1ZA 2PNDA 3FB8A 4HLJA 4TVSa 3WBDA 5J57B 3F65A 3AU1B 3F58L 12E8H 3PWNB 5C08A 3NZHH 4YXLH 5F71A 1C16A 1F3RB 2E27L 3EFFA 4X4YA 1WAAF 4M1DH 5D6DA 5HVFB 1KENH 4M6AA 3VXMB 1BF2A 2G9HB 5DD3H 5IGXL 5DMKA 2DB8A 4D0DA 5EC2B 5IB2A 4APQC 1U8KB 1VEPA 3QUXC 1TDQA 3FB6B 4PIRF 4ZDHB 3LAFA 2FO4B 4X6BA 2O5XH 1X44A 1F58H 1INEL 4P46A 4M43H 1KG0B 5EO9A 2BHYA 4ONHB 3EYVB 4LP4A 2YK1L 4LCCA 4OQ1A 4G6FD 1DLHA 5IB4B 1V05A 4TSBH 1JWUA 5GGSY 5H37H 4JPWH 1H8OA 5F89A 4G8GA 3LKSA 2DL9A 3KNBB 3JWOC 2C4FT 5F7EH 3H3BC 5IBUB 1OM3H 5C6WH 3MV9D 1W72L 3KGRA 5EUKA 2F53E 4J8RB 1A6TA 4WEBH 1I1YB 1T0NA 3S5LA 2FIKA 3NPSC 1LEKA 5CJXA 2C1PB 3QEHA 4R2GD 2WBWB 1X5GA 3RWGB 5FOJA 1WITA 1MCEA 2Z4QB 5DJCB 3OHXB 1G7IB 2YPVL 5CCKH 4CNIB 3WJLA 4YHNA 1W0VA 1N6VA 4QRSA 3L3IB 3LRSA 4GW1B 5I75B 1MCLA 1UCBL 1XCTA 2E5EA 3VD3A 1OARL 3LH2L 2V7NB 3TBTB 1S9YA 3FB7B 2HLAA 1VB9A 1NUGA 2AEIT 3REWA 4Z7VE 5E8EA 3VFGH 3WHE1 3O81A 1W72H 2PW1A 5I73B 2IANB 1LO4L 1BIIB 4JFPA 4QNPF 3SKMB 4PJ9D 1MFBL 1NC4B 5HJ3A 4TSCL 4UAOC 1KCVH 2YBRB 3QWOB 4JDZB 2GSIA 1GGBH 3DMMA 1KGCE 2AV7A 4IJ3C 3O3AB 2CKNA 2YUZA 3SKOA 3CPLB 1HHKB 4JFOA 3S36H 1YPZB 1IRAY 1HSBA 2DQEH 1UCBH 2F5BL 4TUKH 6CGTA 5J7CC 3LH2H 1RVFH 3FQWA 2VXVL 2YUXA 3SKNA 1XGPA 4M7KH 3GSQB 1BVZA 4ZFGH 2O26U 3NAAL 2OSLA 2DWEB 4C56E 4MAYD 1LO4H 2P46B 5TDNB 1OGTA 1MFBH 1AFVL 43CAB 4MVBC 1QLRA 4F37K 4JZOA 3GEWB 2QTEA 1DLFL 4YK4C 1F6LL 4UT9L 4AT6B 4QLRA 4YHYB 1ACZA 1WBYB 1AI1H 3VMOA 1SHMA 2YD1A 4X9GA 1MH5A 3SOBL 3WS3B 3C60A 2I25N 2VXVH 5KTEH 4PP1D 3RY6C 1FJ1B 3WNOA 5IVXB 3NAAH 4EDXA 3K4AA 1N26A 2YD4A 4N8PA 1PY9A 1M6OB 2VC2L 3MJ9H 3P0VL 2HH0H 3O0RL 3V7MA 3BN9D 1FVEB 3ARDB 1SMOA 3QI9D 4UT9H 4HF5L 5TQ2L 1O0VA 1OP3K 4OKVA 1CD9B 1U8QA 1XGUB 1FGNL 3O3UN 5TDPB 1MNUL 1MPAL 4GRLC 3I85A 7FABL 1JNHA 3HB3C 3RNKA 1J10A 3F5WA 4FQ1H 3I6LD 3W5MA 3ZT7A 2PYED 2AEPH 1XGTB 1GVIA 3V6OC 1U8HB 3OKYA 1GC1C 3GHBL 4ODUA 1UM6L 3D3VB 4YX2L 2I26N 3U9UA 1DTUA 2IF7A 3OAZH 5KSAA 5EU6D 2WBJA 4TUJA 3LD8C 4DAGL 5EA0L 5ETUB 3VWJC 5GPRA 4YHOL 3O0RH 1P1ZB 2HYMA 3FB8B 4PRPE 3GIZL 4BFIA 3ET9F 4PJIA 1RHHA 1TJGH 5F9JA 2PYFA 5C08B 2PKDA 3ULUL 1FGNH 5GRJL 3SO5A 1C16B 1ERNA 1MNUH 1MPAH 5C0AD 3EFFB 4X4YB 1U42A 1DBKL 4QRRA 2ICES 2X44D 3FQTA 3NMEA 4HMCA 5FUCE 5DMKB 3GHBH 1DZBA 3MLSL 4D0DB 5IB2B 3ZDXF 5KN5B 4M7LL 4I3RH 5IESH 5EA0H 2OI9B 1I7RA 4P46B 3UROR 4YHOH 3T3MF 4YFDB 3X13A 3HR5A 3GIZH 4OI7A 4LCCB 1EAPA 1DLHB 4DVRL 1JWUB 4CVUA 3ULUH 1GGCL 2XY1A 3KPSD 3LKSB 5GRJH 3RKDD 1D3CA 1FFRA 4JFFE 3HZVA 2AK1L 4XGZA 2OCFD 2GJZA 5CS7A 2HJKA 5BRZD 1SY6A 5EUKB 1A6TB 2HFGL 3CVIH 1T0NB 2EH7L 2X1WL 5I18L 3S5LB 1BQLH 1LEKB 1IGJA 2FIKB 3MTRA 4J4PC 4KKBD 5FYJU 3MLSH 3LS4L 1FH5L 4KMTH 3WJJC 3QEHB 4M7LH 1GPOL 2ATPA 1L6XA 4YHNB 1W0VB 4QRSB 5TE7L 2GY7B 3LRSB 5ID1A 5JW3H 1XCTB 3QIWA 4KY1L 5C0BE 5DUMH 1S9YB 3MRBA 3K4DA 4B41A 1LO2H 2HLAB 4F9PC 1GGCH 3DNKA 1D5XA 4OF7A 1GYAA 3REWB 2B0SL 4R90H 4POYA 4FXGA 5F9WB 1L4IA 5E8EB 5GJTL 3N85L 4FMFA 2PW1B 5ESAA 4GQ9L 4JFPB 3LY6A 3U9PL 5HJ3B 5I18H 4XCCH 4ERSH 4Z7QF 3P77A 2GSIB 4XNUL 2WINA 1YEKL 3DMMB 2BVUA 2AV7B 1FC1A 1OAQH 3QUZC 1GPOH 1MJ7L 3SKOB 2VLRE 1HSBB 2LAGB 5TE7H 5DQ9A 1XF4A 4M1GL 4NN6B 3OB8A 5IVZA 3SKNB 1PG7H 4NN5C 2MQ0A 2B0SH 1I1AC 3QNZA 1AGFA 5ESVB 1J5OL 2OSLB 3ISWA 4KXZH 4GQ9H 3Q6GH 3Q5OA 1OGTB 3U9PH 3C2SA 2IQ9L 4M7LT 1QLRB 4UT7L 4UNTA 5GRZA 4JZOB 5JMOC 1KLGA 4FXLA 1YEKH 5FUOH 3ULVD 5F7NC 1RHFA 4WWKA 4YBQC 1GXEA 1M7XA 4KK8D 3MODH 1WUNT 1MH5B 1J1XH 1TCMA 1X9QA 1KOAA 4S1QL 1OY3B 2J8HA 4HUKB 1Z2KA 4WVRA 5ICYB 4YGVA 2AJYL 2IPKA 3RWHA 2DN7A 4L9LA 3S4SG 4EDXB 4YFLI 1J5OH 4IRSC 4ZUWB 1INDL 4UI2A 2P5WD 2IQ9H 3PP3K 1UENA 3G6JE 3MZGB 5B8CB 4KMLB 1BBDL 1MCBA 3MOAH 4OKVB 1U8QB 1DL7L 3QB7C 3T0VA 3WDHA 1H5BC 4HWZA 3V4UL 5T5NG 1B4RA 1X6NA 1JNHB 3RNKB 3F5WB 4KDWA 3CMOH 1VACA 4OJFL 5D71L 1P5VA 3VDCA 4ZXBA 1QSFD 4ODUB 3U9UB 1MAJA 4PJDA 5KSAB 2WBJB 2R0ZL 5GGUA 1INDH 3MCLL 4TUJB 5E9DA 3ULVF 4NRZA 3F7VA 4KHTL 4JCLA 3EDJA 5CP7A 4WFHD 5CSZA 1A4JA 1D5ZA 5MENE 4BFIB 4PJIB 2LE9A 1RHHB 4FTVE 2OQJA 5F9JB 1DL7H 2PYFB 3TA3A 4YPGB 5ERWA 4JEGB 3VXUA 3GM0A 3EJZC 3PQYA 4V2BA 5IB1A 1FP5A 4QRRB 4OJFH 4RNRB 4WTXA 2XWJA 5D71H 1VSCA 3FQTB 4MHHG 4BFBD 3FT4A 2AJUL 4P9ML 5IKCB 4QGTA 4WGVB 5JMRA 1FNFA 4OFYD 1I7RB 2QQQA 5D1ZA 3N9GL 2UY6A 3QDGA 1OD7A 4ELME 1P9MA 4ZTPL 3QAZC 1FVDA 4UINL 2GY5A 4PV9B 3HZVB 1KPUA 4OTXH 1CGTA 5GQBA 3FQXA 3OB0K 1LP9E 3RDTC 5IJVA 2GJZB 2HJKB 4HIIB 1R5VA 1G7LB 3RKPA 1J88A 2GHWB 2AJUH 4P9MH 1E6JH 2PETA 3DVFA 5D7LE 3SDCC 3QNXA 2ATPB 5JHDE 3H2WA 1K8IA 2FH6A 3C08L 4M6NL 1CLYH 4NWTH 3TN0A 3L7EA 5ID1B 3QIWB 2OXHA 3N9GH 4BUHA 3MRBB 2UWEF 5C71A 5CLWA 1IC5L 4UINH 4CADA 1D5XB 3FJTA 4PGJA 4FXGB 3D5OF 3O6FC 2A9NL 2E9IA 1KJ3H 1OVZA 5E00A 3C6LA 3TNMA 1IE5A 5ESAB 4WWID 5ACZB 1YEFH 1YNKH 2N56A 4U4BA 5A43C 2VN4A 2Y23A 4HG4J 3C5ZA 3P77B 2WINB 4RDQG 3FFCD 2KDGA 3C08H 4LFHD 4LOUD 4K3EH 4AQ1B 4MA3A 5DQ9B 1XF4B 1PQZA 4KQ4L 4GT7A 4GLRH 4NO3A 4Y4FA 1B0GA 1CVSC 3P4OA 5IVZB 3ARUA 2XV6B 4PJEE 4XP1L 1FBIL 1MEXL 3UJTH 1CS6A 2A9NH 1AGFB 3QNZB 5L8JB 4MVBD 5BCAA 4FA8A 3R1GL 4WTZA 1QFWI 4BQ6A 2YR3A 4PJ5D 3DRTA 4KHXL 4GW4A 4YDKL 1P4LA 2AAVA 3V2AR 1KTRL 1DUZA 3QPXL 1KLGB 4KRPD 3B83A 4WWKB 3AROA 4LHUA 4HULB 5E8PA 3U48A 1Y0LA 2ORBL 2PO6A 4KQ4H 2YC1B 1IC4L 5KSBF 4Y8AA 4WUUE 5F1KC 1NMAH 1GGIL 1T0MA 2VL5B 4XP1H 4YGVB 4ETQA 4ODTL 4JFHE 4NWUL 1FBIH 2IPKB 3N1PC 1MEXH 4L9LB 3RWHB 4E41E 3SCMA 1YA5A 2A2QT 4WHTA 2EKSA 4HW6A 5I1DB 3QIBC 5CZVH 3R1GH 1YEDB 3ARRA 4LSTL 1QRND 5D5MA 2HKHL 1DBAH 1PKQA 4XAWH 5A2LH 3QPXH 4QRPE 2VDNL 1CE1L 4X0KA 1ZK9A 2RQ8A 3HB3D 3Q5YA 3EO1A 2J6EL 2ORBH 4V1DD 4HWZB 5F3BA 1IC4H 2OJZL 4OFVA 3RPIA 1GGIH 1J7VR 4ODTH 4NWUH 1VACB 1DANU 3PWPD 1FQ9C 1YEJL 3CXHK 5E08H 4ZXBB 1A6AA 2WWKT 2IFGA 3GFUA 4PJDB 2VLLA 4CN1A 5GGUB 5E9DB 1F4YH 3EYOA 1UQSB 4NRZB 3F7VB 3HHRB 4EKXA 2HKHH 4WI5A 5CP7B 1EJ6A 2G75A 5CSZB 4TQEH 3MBEA 1A4JB 1D5ZB 5ISZD 1A3RL 2VDNH 2OQJB 3FHQA 4F7PB 1BQHA 5LBSH 4JQXA 4TTGA 3TA3B 2VZOA 5ERWB 3BJLA 3VXUB 4QYOA 3PQYB 2OJZH 3F6IA 1NL0L 4ZO9A 1A4KA 4HXBL 2XWJB 1MCJA 4OV6F 1YEJH 4OCXL 1WAAE 3FT4B 4BQCA 3P3YA 1BX2A 1UXWA 3QXWA 1JHKH 1OCWL 1WWAX 5IM7A 1W72A 4JFED 4BSWA 1NCNA 4XWOD 4FOMA 5D1ZB 2NY4B 4JO4L 4PB9L 5GGRY 4KJPD 3RA7L 1A3RH 4WFFE 3QDGB 5EU4B 4M62L 1D5IL 1FVDB 1LILA 1HQRA 1TPXC 1KPUB 3BJ91 3KPRB 1WFOA 3FQXB 3HFMH 4NN7B 2VLKE 4J4PD 2B5IC 1R5VB 5DD1L 4HXBH 4XPBL 5HGGS 2X9XA 1MREL 1ZLWK 4JVWA 1RD6A 3TVMC 1IJ9A 3PJSA 5FYKE 3QNXB 3MA7A 1K8IB 3G9AB 3TN0B 4YDVA 5GIRA 3RA7H 4XNQA 3HMXL 1QO3B 4OZHA 1CQYA 4K71C 1NC2D 2M26A 1YMMA 5GGQH 3REVA 3CX2A 5HGDA 2GYSA 3C6LB 1L9NA 3TNMB 3N0PB 3WHXA 3S34L 1A7RH 4XPGL 1A1NA 1QHOA 3MREB 1IKNA 3KJ4B 5TFSL 4PGEA 5GRVL 4TPRH 3AS0A 3LB6D 3QJFA 1FNSH 4QNPE 5FGBC 2ZUTA 1U0QA 4MA3B 1JPSH 1PQZB 5IBUG 4NO3B 4WEUD 1B0GB 4Y4FB 1P4IL 3B5GA 1I1AD 3MJ9A 3P4OB 1KIQA 1U41A 3JVGA 4M61A 4UILH 4O02H 3VXRD 5EOCL 2AK4A 2R69H 5MEOA 1NGQL 1MJ8L 2X9YA 2B4CL 1DR9A 5GRWA 1OTTC 2OK0L 1LEGB 3S34H 1LGVA 5BVJA 1WZ1L 4XPGH 4UV4H 1JGUL 4NIKB 3DRTB 2EYRB 1ZANH 4GW4B 5TFSH 2WLYA 1P4LB 3BXNA 1DUZB 1J1PL 4RGNC 1MFCL 1NBQA 4LDLB 4QRUB 3L5XH 2I5YL 1BD2D 4XMKL 5E95B 4LHUB 5E8PB 1Y0LB 2HLFC 1Z6JT 1L0QA 1JMZA 5H8DA 2VLMD 1T0MB 1T7WA 5M7QA 4ETQB 1I3GH 5EOCH 4PJBF 3SCMB 1NGQH 1WZLA 4WHTB 2EKSB 1MJ8H 4G9FD 4Z0BL 2OK0H 2G60L 4H1LG 1V3JA 1WZ1H 4JVPA 1JGUH 3RZCD 5D5MB 1PKQB 1J0HA 2EDKA 1JPST 1J1PH 4X0KB 5C3LD 3ABZA 3FN3A 1MLCA 3EO1B 5TF1L 5HVGB 1LDPL 5F7DA 3UTTD 5F3BB 3QXDA 5EDXA 5AZEL 3RPIB 3FCTA 3DX7A 2MCPL 5AWNH 2FHBA 4LARL 1TVBA 4FQXC 5I1LA 3GNMH 2APVA 3SDAB 3CLFH 1CT8A 4PJ7A 4Z0BH 4PREA 5ITFA 2VLLB 2IFFL 3WKMH 1U95A 1OW0A 4HIHA 2G75B 1PSKL 4LSQL 1KCRH 1FZMB 1BBJA 4DKEL 2EXWD 4EI5A 3EJZD 3DURA 2SEBA 1BQHB 1I8KA 1LWRA 3CFEA 5TF1H 4MD4A 4QYOB 4LCWB 3U4BL 1ZAGA 1S9WA 3PWVA 4DZBA 5AZEH 4E9LA 2MCPH 3EDFA 1DE4A 1A4KB 1LEIA 5JLZA 5DDHA 4D8PA 1TQBB 5DGRA 4QOKA 1YJDH 4P4KA 1BX2B 1X5XA 4WJ5A 3B4NA 4NRXA 5HY9A 3VFMA 4JKPH 1UXWB 1EZVX 5GSRA 1U3HC 3U6RA 1EO7A 5IM7B 3SGEH 1W72B 4BSWB 3BDBA 3FQUA 1PSKH 2BNRD 4XPAL 3ZDXE 4HUUA 4HLZH 4ODWA 2OP4L 5AYUH 3RDTD 3B8YA 3T3ME 3RWJA 1HQRB 3U4BH 2B1HL 1G0DA 5F88A 4PLKD 1AIFA 5C8JA 5T1LD 2BNQD 3I6LE 4M3JA 4RWYH 3K0WA 2OR9L 2PYEE 4QCIA 3GO1L 4KRMB 3SDCD 1OLLA 3B5HA 4U1SA 5EU6E 4DVBA 4R96A 5F1NA 3PJSB 4Y16A 4X7DC 5IMOA 4MCZA 4M6OL 4YDVB 2F19H 4MLSA 4XPAH 5GIRB 4ODVL 1D6VL 3VMNA 2BERA 2R8SL 4P0DA 4OZHB 2OP4H 5DMIH 2YKLH 3DLQR 3QNYA 2G2RB 1YMMB 3NN8A 4X98A 2B1HH 3REVB 2UZYB 2G5RA 3GSXA 3HC0A 5HGDB 5LQBH 3WHXB 1A1NB 4P57A 2N7BA 3GO1H 5CGTA 4PGEB 1MOEA 1I1FA 3UDWA 4LDEB 2BSRA 1JZ7A 1DBJL 3QJFB 4Z7NF 5CKAA 4OD1L 2X1OA 3RNQA 3AB0B 4M6OH 4Z7QE 1G1CA 4OLYL 4ODVH 2BSED 1Q9KA 1KIQB 3E3QE 4M61B 4MA1C 4I8DA 3RZWA 2AK4B 3S5LG 5MEOB 1SEQL 3DVNA 5E70A 2HTKD 3IDJA 1YEEL 5BVJB 5BRZE 1C5BL 3IDNA 4LLDA 2ZJSH 1BFTA 4DK3A 3DUSA 3TYGH 3T0ED 3BPNB 3BXNB 1RUPL 2AEQH 3IS0X 4F7EA 4XMPL 1DBJH 4TVPD 2R4RH 1HH6A 3HZYA 3VFSA 4HC1H 1RZFL 4OLYH 1SM3L 1T83A 4F7MA 3MLRH 1U8LA 4UQ2A 4HZLA 1M7IA 2XY2A 3QIBD 1EHNA 1ZS8B 3MROA 3PWJA 3X3FL 1JPTH 4Q6IA 1C5BH 1FNGA 1MFEL 2FLRT 3RTQA 4Z7WF 2VR9A 2BX5A 4LCIL 3HUJF 1RUPH 2R29H 2BFVL 4XMPH 5EORL 5IMLA 4Q9RL 3QXUA 1A6ZA 5F70A 3QFJA 3PGDA 1MLCB 4N0CC 4L3AA 1RZFH 1MIEL 5HTSA 2ZCLH 5F7DB 3QXDB 3NA9L 4U1NA 4UIKL 5T3XH 3DX7B 3LSOA 4HWNA 2FGWL 1TVBB 2R1WB 4YDIH 2V2TA 3QRGL 1E0OB 5I16A 4W4NA 3X3FH 3S88L 1H15B 1CT8B 4PJ7B 4PREB 5ITFB 1F3DJ 1U95B 1MFEH 1MLBA 4LCIH 3ECBB 2J8UE 3D2UA 3DX6B 4HIHB 4N5ED 4KAQL 4NUJB 4QXUL 5D8JL 4KUZL 5EU5A 1T03H 2BFVH 3MUZ1 1BBJB 3SJVD 3ULVE 3UTPD 1EHAA 5ESQA 3DURB 2SEBB 4KPHL 3GI8L 2DI9A 2NY5H 2JJTA 1I8KB 3CFEB 5ACMA 1MIEH 4MD4B 1EIBA 5DK2A 1KB9K 1KTLB 1S9WB 5JW4N 3NA9H 4DZBB 2EDOA 1S5IL 1DE4B 1LEIB 3V8CA 5DDHB 5JLZB 3UZQA 4R26H 5F44A 4D8PB 3QRGH 4EBQL 4CU8A 3S88H 3BH8A 3MLZH 4QOKB 4FP8L 1K6QL 2Q76B 3F7YB 4P4KB 3P2TA 4WJ5B 5HY9B 3FN0H 4P2OC 2P5WE 5GSRB 3U6RB 1NBYA 4DUVA 3DGGA 4KAQH 3FQUB 5D8JH 3ARQA 4KUZH 1MCCA 4G7YL 2X4QA 1FCCA 1IT9L 4HUUB 4O00A 5CGMA 3CFCL 4ODWB 4KPHH 3LQAC 4PB0L 3GI8H 3AREC 2DIBA 1A7BA 1VFOA 3ZTJG 3RWJB 1T89A 4XWGL 1A7QL 2AABL 3E6FA 1V7MH 5F88B 2YXMA 4XVSH 4K2UH 5C8JB 1JGDA 2VSCA 4OUUA 1LQSR 4EBQH 5J12C 4PRHA 1Z9LA 1QSFE 3MR9A 4HS3A 2BJMH 3RGHA 4U1SB 4DVBB 2VLJD 4R96B 3O4OB 5F1NB 4Y16B 1U6AL 4IRJD 1NBZB 5IMOB 3DYOA 4WFHE 3FOMA 2O61A 3CUPA 4G7YH 5GRXG 3WUZA 4LBEA 1IT9H 4PB0H 1UZ6F 2AJSL 3QNYB 2E6JA 1YQVL 3WN5A 4XWGH 2NNAA 3NN8B 4X98B 2AABH 3VCLA 3GSXB 3HC0B 2UWEE 4L4TA 1ZA6A 4P57B 2JCCA 4QRTA 1S7XA 1IGFH 4UBDC 1I1FB 4YC2C 5DVMA 4F15B 1MCPH 2PTVA 5C2UB 1JNNL 5HHXH 3VD4A 2BSRB 2FATL 4WHCA 1U6AH 3RNQB 3ARDC 2DKUA 4NHUA 4J12A 4ONOA 2X4RA 1SBBA 3MOBL 4D3CL 2BOCA 1QP1A 3LPWA 2NY1D 5FEBA 5TDOA 4H25B 1INQA 4RISL 1OTTD 5JZ7C 2CR3A 5JR1H 2H3NA 2Z8SA 2Y25A 3STZA 5K9KA 2X42A 1P6AB 3DVNB 4C57C 3OJDA 4OGXH 4ZS6C 3V4VH 2EDFA 4Z7UF 5IT2L 4DTGH 1I8MA 1E27A 1MFNA 2AJ3A 1XIWA 2XXCB 5IV2A 3IDNB 4LLDB 2A0LC 5C0DB 1PG7W 3DUSB 4RGND 5KVFL 3KYNB 1OB1A 4F7EB 1K4DB 4NDMB 2CSPA 2HLFD 2FATH 4LVNB 1HH6B 4YBLB 1MELA 1S8DA 2VDKH 2QQKL 4HGKC 4JPVL 3VXSE 1I4FA 1SEBA 4NOFA 3D85D 3VFUA 1U8LB 4PLJC 3MOBH 3BPLC 4HZLB 1M7IB 3D39D 3BP7A 4RISH 1G9ML 5D6DC 4N8VA 2R15A 3PWJB 5KSBE 1JI1A 4HK3J 1WBZB 5IT2H 2FHCA 3EYSL 4Q6IB 4XHJD 1FNGB 3RTQB 4KJWD 1Q1JH 3NIGF 5KZCD 2XN9D 2QHRL 2L4OA 4P2RA 4JM2C 1HZHL 4JY6A 5IMLB 2N1KA 3TPUB 3RHWK 3FFCE 3PGDB 1ZHKA 4PBVC 4FQXD 3DYPA 5ICXA 3LSOB 1CK0L 5HD8C 1MHCA 1YNLH 1G9MH 3RJDA 2V2TB 3I2CH 3CFKA 1DFBH 3PV7A 4MA7H 4N90D 3BGFC 2FECL 5BW7C 3RVVC 1YYLL 5CJXC 5GSVA 3GUTA 3D87B 1MLBB 4PJ5E 2Q3ZA 1FL5A 1T7XA 2I24N 2HT4C 5D1QA 5EU5B 1PVHA 5E5MA 2J5LC 1HZHH 3W5NA 5ESQB 1G0YR 4QXWA 1P53A 2D7TL 5HGBB 1QLEL 4AYFA 3RVUC 4S1DC 5DK2B 3UPRA 3QHTC 4K7PY 3VXNA 4F58L 3QEQD 3RGVC 3AXLA 3QQ4A 5FO9A 1NCAH 3CU1A 2C7UA 3DGCR 5I1KL 4KZEH 2YMXL 4RMWA 3IU3A 3BH8B 1FYTB 2QV2A 1U3HD 3ZL4L 1HHGB 1YYLH 3ZMRA 1QRNE 1NBYB 3DGGB 5IG7A 2FBOJ 2X4QB 4QY8B 4HJ0C 5M94B 4JR9H 3HPLA 1IAKA 3KWWA 2D7TH 1QLEH 3N06B 4N9GA 1LO3L 2VERN 4MSWA 1ZLVH 4FFYL 4V1DE 4L8BA 3E6FB 5I1AA 4JANA 3U7AA 3V6OE 4WHYH 1JGDB 1ZVSA 3BEVA 5KVDL 4D9RD 5L2KA 2YMXH 4OUUB 3MR9B 1M1SA 5T3ZD 1KBGH 5HSFA 4U1IA 5CWSA 2ZOKA 3ZT5A 3S35X 3CUPB 4OKDA 2O61B 1AKJA 1FCGA 4LBEB 5ISZE 4FQPA 3C60C 1PZ5A 5E4IA 4WW2A 4FFYH 2NNAB 3VCLB 2FB4H 4EQ3A 1NAKL 3NZ8A 3SE9L 1WV7T 1RZIA 2ZWLT 4MJIA 1CGWA 5KVDH 2Z92A 1L9MA 4L4TB 1ZA6B 2XWTA 3EKCA 2JCCB 4X6CA 1S7XB 1NANH 3P30L 4FQJL 1G7PA 2JELH 3S35L 2GCYA 1X5JA 4NHUB 5D93C 5J1AA 1QVOA 2X4RB 4L4VD 1G7JA 4PJCA 2A6KA 3BD3A 5TDOB 1LE9A 3GSRB 2H3NB 2YPLA 3EHBC 5AZ2L 3U7YH 4OZIA 3STZB 1NAKH 1RIUL 3ARSA 3OJDB 2BDNL 4Y4KD 3IDXL 1I8MB 1E27B 2AJ3B 1QLFA 1XIWB 4UNUA 5IV2B 4LGSB 4H0GA 4PS4L 4FQJH 4PLNC 1YEHL 4NJAL 5J9PA 1OB1B 1TJHL 4QGYA 4GRWH 4YDLC 4HH8A 4GS7C 1B0WA 3EGSA 3QCUL 1S8DB 4ESKA 2C4XA 1I4FB 1SEBB 3N1MC 4RX4D 2ICWA 3VFUB 2EZ0C 1PZUB 1MIML 2EE3A 1AR1D 3BP7B 4N0UA 2ADIA 5DJ6B 2P5ED 4KMQA 5AZ2H 1GAFL 3L1OL 4G6AC 4N8VB 2ZSVA 4KKNA 1RIUH 1Y6KR 3AY4A 2BDNH 3IDXH 4JRXA 4Y4HC 4P3WA 1JRHH 2X6MA 4PJBE 3U83A 4PS4H 1HIMH 3O4LB 4JQIL 4M48L 5F72S 5C7XL 4NJAH 4P2RB 4N0CD 3PUCA 4KXZI 3JXAA 4JY6B 1TJHH 5B3JF 5KVMC 5TGBA 3VRJA 1QZ1A 1OT1A 4LF3A 2JK5A 3D1MC 1ZHKB 3GSNH 5ID0A 3IDGA 5I9QC 4WTZG 1MHCB 3F7PC 1ACYL 2PCPB 3VRIA 1GAFH 3L1OH 2YSSA 3CFKB 1OGAA 1IGML 2UUDH 4BQ8A 3QUMH 2WW8A 5DVKA 5JO5B 2MWCA 5GSVB 3GUTB 4BM7A 4JQIH 5D1QB 4JZJC 1JYXA 5E5MB 3EW3B 3K1KC 1NCDL 3FMGL 4X4ME 1BD2E 2WV3A 1EEYA 5GS0C 3VXNB 1KC5L 5I76A 2VLME 5DFWH 3QQ4B 5FO9B 4Y5VA 3I75A 1TZHA 1GH7A 3IU3B 1QA9A 3EJYC 2XIDA 4G9FE 4NNXA 4J1UA 4DWHA 1RK1A 4NKMA 4Y2DC 1RK0A 2BC4A 2YUVA 3WS6C 3ARED 5IG7B 3CH1A 1KXQE 1NCDH 5D2NA 3V5HA 1WCBB 1IAKB 3HPLB 3KWWB 2UV3A 1RZKC 4N9GB 4W81A 1RZJL 3QUYC 4WGWB 2ZPKL 1E4XL 4MSWB 5H37G 4UNVA 3UTTE 1FSKC 3TO4A 1G1YA 5I1AB 1NAML 4JANB 1KC5H 3BPOC 1UWEL 4JB9L 1ZVSB 3BEVB 1AHWC 1IARB 2R0LH 3UBXA 4AIZB 4PRIA 1CL7L 4KDVA 1BQHG 3L5WA 5T1KA 1NCTA 3LDBC 1KB5L 4U1IB 1OAKL 1XF1A 5CWSB 1QFUL 2ZOKB 1AKJB 1SYSA 4OCRH 3H9SE 1PBYA 3I02A 3DARA 4PJFA 2H2PC 4WW1A 2WUBH 4DQOL 1PZ5B 1J9CT 1RJZA 1E4XH 4WW2B 4NQCA 1F11A 5GGVY 3NZ8B 4M3KB 4R4FH 1RZIB 4HC1A 1IAIM 4JB9H 4MJIB 4UBDD 4OSUH 1UACH 5JA9A 1MQ8A 1A2YB 2NXZC 2VE6A 4X6CB 3ZTNL 2DTML 3QIUC 4Z0XA 2EDNA 4J3TA 3ARDD 3WLBA 1OAYL 1G7PB 1AQKL 3MRHA 4XX1G 4IIQA 2AJXL 2GCYB 3F8UB 4LSRL 5J1AB 2BNRE 5FCUL 1QVOB 3ALXA 4Z7NE 1G7JB 5F8RC 4PJCB 2A6KB 1BM3H 3P9LB 4OIIL 4ZS6D 4OLUL 2ESVA 4DQOH 1LE9B 2GJ6B 2YPLB 2X5PA 4OZIB 4G6MH 3HPJA 2NY3B 2R39A 5CIPH 4UDTA 5JOFA 1QLFB 1FZKA 4KH2A 2BNQE 4XCYA 4PGCA 3LN9A 3BWAA 2DTMH 2RIKA 2H26A 1OAYH 1K4CA 1AQKH 3C2AL 3JTSA 2CR6A 2AJXH 4GAYA 5IQ9A 3KDMA 4LSRH 1X5AA 1IGIL 3EGSB 2DOCA 1JPGA 2D7QA 3MLXL 1OAZL 4FS0A 2XZAH 4JHWH 4C83A 3D6GA 5D9SA 3RVWD 5IHUH 2OYPA 3F7QA 2ADIB 4N0UB 4OLUH 4M00A 4J3UA 2LVEA 1J1OH 4OF8A 1MJUL 4GLRI 1CDUA 1ZWIA 1KELH 2HT2C 2ZSVB 1BWMA 2JJUA 4QHNA 4WV1A 4JRXB 4P46D 1PX3A 3IFNL 4P5MA 1BFSA 3BQUC 5E4EB 4YXKL 1ORSA 4G8GD 4Z7WE 5TGBB 1IGIH 1JFQH 3QFDA 3MLXH 5ADPH 1OAZH 3VRJB 2ZUXA 3HUJE 5HD8D 4LF3B 1OSPH 4LPCA 2AI0L 3IDGB 3P9WB 5GS2H 3HC3L 4KGLA 1GZQA 2AGJH 3VRIB 4YGAB 3RVVD 2YSSB 1UCTA 1OGAB 2IADA 1CD8A 3FQRB 4K7FA 3BGMB 1G9NC 1Q94A 1NMBL 5IVNA 5IW1A 4XPFL 4K94L 1U2HA 5HHPB 1DQMH 4D9LL 4OGYL 3OAYK 3T0EE 4YXKH 5K59F 3TH2T 3MLTA 4CDGC 4G80A 4S1DD 4TVPE 1JVKA 3RGVD 1EEYB 3U36A 4ONFL 3HC3H 5I76B 4MCYA 4Y5VB 2XZZA 3I75B 2ZCKH 1R3IL 5IB3A 4ZNCD 4NNXB 1XGRA 4J1UB 1RK1B 4OZFG 4RMRA 4NKMB 2ED7A 3C5ZC 4K94H 1X6LA 2D7MA 2AEWA 5FGCB 1WBXA 1OHQA 4LASL 2BC4B 4HJ0D 2VAJA 4D9LH 3WNNA 2DWDA 3CH1B 1QSVA 3V9FA 2HFFA 2FSEA 1NH6A 1RY7B 4N8CL 5LGJB 3BEWA 4GKOA 3LHPL 4JFDA 1T6VN 1GZPA 4Y4FC 3CX5J 4IS6A 1OP5H 3TO4B 3KPPA 5CD5D 3K3QA 2CK2A 3WNKA 3X3GL 3UBXB 1CICA 4PRIB 1KTDA 2QQNL 1EBPA 3L5WB 5T1KB 4ALAH 4JGMA 4LASH 2F53A 5JUEH 3C60D 3NGBC 1NEUA 3HC4L 4S1SL 4M8QB 4N8CH 4BUGA 3HI5L 1SYSB 3SJVE 3I02B 2CRMA 3UTPE 2PO6C 4PJFB 1RUQL 4WW1B 4Q9QH 4UB0H 1FLTX 1RJZB 4MJ5B 4U1LA 4NQCB 2PTTA 4I3SL 3CFDA 5IOPB 1GIGL 3P40A 4UTBL 1UZ6E 4YEEA 4Z8FL 1K85A 2MQ3A 5KSUA 3RVXC 2IH3B 2VE6B 3TFKC 3QQ9D 4Z0XB 5D72L 1XF5A 2Q86A 4QRQA 3RUGB 3WLBB 4Z7VA 3MRHB 3BIBX 3LEYL 3TYFA 3L3DA 3WNLA 3BZFA 2Q6WB 1IKFL 5IQ7L 2R23A 3HI5H 3RY5A 4BH7A 3D9AL 3I3DA 1HYSD 1RUQH 2Y4SA 2FJFB 2ESVB 5J1SC 2DQHL 1E4WH 1QR1A 2KKQA 1TJIL 2Z35A 4I3SH 1RJCA 4RSVA 4NZRH 1CFVL 3HPJB 4R7NA 3O8XA 1I7TA 2WBJD 4UTBH 2V5RA 4UDTB 3TESA 4Z8FH 4QT5A 2EEAA 2GAZA 3BUTA 5JOFB 1FZKB 4XCYB 3HNTL 4WCYL 2D3VA 3ESUF 4X5LA 4PGCB 3TZVA 2A6JB 1ZLUK 2H26B 1EA9C 1K4CB 3QCVL 4U6VH 3UX9B 4Z7UE 5FYKH 3JTSB 4GAYB 2VLJE 3LEYH 1JYVA 5IQ9B 2L7UA 3KDMB 4EDWL 3MBEC 2EZ0D 1HE7A 2P4AB 1IKFH 1RMFL 4C83B 5IQ7H 4GBXA 4G6AD 4QRRD 3W0WB 1CIUA 2DQHH 3OQ3B 2VQ1A 5DURB 1B6DA 5SWQB 3E2HC 4OF0A 5FHBL 3HNTH 3VMPA 5LGHL 1KTKE 3O11A 4P5MB 3FZUC 3HG1B 2VIRA 3QCVH 2VZVA 4PGBA 1I1RA 4QTHA 3H3PH 4XP5L 1ORSB 3JBG7 2J3SA 4EDWH 2B20A 3NIGE 3QFDB 3G6DL 5IF0A 5AG9A 1D9KB 1FN4B 4PUBH 4S0SD 1RMFH 1KULA 3MSPA 4KDTA 4JO1L 4HWUA 1FZJB 1FFPA 4HEME 4OCYH 1WGOA 1GZQB 2DM7A 3BUYA 3KS0H 2ZNWA 3V7AE 2IADB 3MA9H 4OGAC 5FHBH 1I9JH 4ZD3H 4K7FB 4HUVA 3L3OA 1Q94B 1UYWH 3LS5L 4PJIF 3B9EA 5IW1B 4Y1AD 4M7JL 3MLYL 2DRUA 5D1XA 1UJ3A 1DVFA 4RGNE 3UXFA 1LK2A 1TNNA 3MLTB 1R3KA 4G80B 5GS0D 4HIJA 4S2SB 5FKAA 3G6DH 5F96H 3OKEA 5EZIL 2BRRL 4JO1H 3U36B 1BOYA 5J11C 4O58L 2EC9U 4PRPA 4GOSA 3EJYD 2BY0A 3C8HA 3D39E 2D0FA 1CN4A 4MCYB 3GK8L 5IB3B 3UTOA 2EE9A 1XGRB 4HUXA 2GQHA 3LS5H 1X5IA 3WMSA 2WQ8A 4KTEH 1AGBA 5DQJA 1P7QA 2NTFA 1OWWA 2XN9E 3BHBB 2HFFB 2FSEB 2X1PA 1OQOA 2OTPA 4RAUA 5CILH 3D0LA 2ICWI 3BEWB 4GAJH 1IAMA 1UB5A 4I0PA 1GZPB 3NCCB 5EZIH 4QXTA 2QADC 1WTLA 4IS6B 5K9OA 1KCSH 2FIRT 4JQVC 3ALPA 3GK8H 3O6ML 4NHCL 5I1GL 2LTQC 1CICB 4JFFA 1PDKA 3MZTA 3BPCB 1U2CA 4N90E 2UUDK 4PD4K 1A14L 2J88L 5D2LA 5TE6L 3E0GA 2F53B 1J8HA 3DX8A 5C0NC 5C1MB 3WSQH 1I75A 4UT6H 3PV6A 1V3MA 1RUKL 3SGEI 1CGYA 1MSPA 5E2TH 1KT2A 4U1LB 4YR6B 2HKFH 4BFEA 4LKCA 3U82B 2NXZD 3CFDB 4PJHF 1KLFA 4NZUL 4Y5XC 3O45A 4XB7A 1RUAL 3BP5A 3U0PA 3QEQE 1HWGB 5KSUB 3TT3L 1L7TL 3QCTH 1D5MA 3O6MH 4NHCH 4I4WB 3B9KA 3RX5A 2AS5M 1HH9A 4QRQB 2Q86B 4I13B 5IROA 4Z7VB 1A14H 2H2SC 5TE6H 3TYFB 3L3DB 4TTDC 3BZFB 4CU6A 4OF6A 3FO2B 3Q6FA 3V0VA 1RUKH 1QR1B 1QD0A 2VLRA 2Z35B 4R7NB 3O8XB 1I7TB 5HI4C 2HN7A 5MI0B 3VA6A 1F42A 1MHEB 5E9DD 3GSNA 2GAZB 3TT3H 2EDHA 3NCYS 1L7TH 4D9RE 3ULUC 1NUNB 2R0WL 3TZVB 2JE8A 3MYJA 3NCEB 5T3ZE 5HYIA 1EFXD 2H45A 4AEIH 2IG2L 5KVEH 1F4AA 1FIGL 4P5TA 3MRDA 3D0VA 3NACL 1VGKA 1CBVL 4EI5C 3PQYD 4CKVX 5CUSL 1FO0L 1BLNA 4GBXB 2VKXA 2GIYA 2ERJC 2QSQA 2HT2D 5DYOA 3V79C 2VQ1B 2NR6C 4X6EB 4XP6L 1JNJA 5FK9A 2XWBA 3UBXI 3C09C 2YD8A 2FJGA 3NBNA 2IPUK 3H7BA 2NY4D 2OMNA 2VIRB 2C26A 5LCVL 3MV7E 3QDGD 2BHZA 4PGBB 5KANG 1VFMA 2IG2H 3NCFB 4QTHB 2R1YA 3NIDF 2MPAH 2Q8AL 1JF6A 3NACH 2EDBA 5IF0B 2HFTA 3G6JA 4L4VE 1FFPB 4PJDF 2LU3A 1C7TA 3CC5A 5B3JE 1BJ8A 3BKMH 5CEZL 1WEJH 1T66D 4OLVL 4XP6H 1T3FA 5IFHH 1NEZA 4NM8H 3L3OB 2RCSH 1CD0A 2K3TA 3HZMB 3HZKA 2VRAA 5CSBA 5D1XB 4HK3N 1UJ3B 1DVFB 3TN0D 4ZG1A 1SQ2N 1S9KC 1F45A 1LK2B 3QWRA 3DHMA 5LCVH 4PJGA 5HHNA 2XACC 3ZSSA 1R3KB 2CO7B 4HIJB 5FKAB 2Z31A 1BZQK 3OKEB 3IAQA 4UTAL 4AMKL 1J05A 3S37X 4PRPB 5MENA 4I0KA 5D96C 4LLQA 4FTVA 2P5EE 2DTSA 3X11A 4CU7A 3C5ZD 5IFAL 2MFNA 5DZLA 1W0WB 5BO1H 3DSFL 2YUWA 4HUXB 5EPMA 5C9JA 3L9RA 3QJHA 2NY7L 1AGBB 1P7QB 4GO6B 4F15C 1UA6L 1DBML 1A6UL 2IQAA 3IRZA 4HKJB 4O4YL 4Y4FD 3VI3F 1KCLA 4RAUB 3D0LB 3SE3A 1UB5B 4I0PB 5BV7H 1YZZA 3WFZA 4PRDA 4UTAH 5GJSL 4JREB 5JTWA 5FYJL 5K9OB 4JO2L 5E8DH 1MAKA 1WT5C 1G9EA 4OZGF 1MHHA 4LQ1A 3B2VL 5E2WH 2EIBA 1YDPA 5IFAH 5C0GB 3DSFH 2XICA 4JFFB 5DK0B 4X7CC 1LP9A 5D2LB 1AGEA 1UA6H 4LHUD 4F33A 2RAMA 1J8HB 3DX8B 5CIPA 1A6UH 2PO6D 3PL6C 2JIXA 3ULVH 3RP1A 5IB5A 3P9MA 4GG6A 1AXTL 3PV6B 5D7LA 2R0KH 4R9HA 4F3FA 1KT2B 5GJSH 4GRWB 3OV6A 4LKCB 4JO2H 4N5UA 5FYJH 3D25A 3TFKD 3U0PB 3O45B 3BP5B 2FDBP 3PHOA 4G5ZH 2HVJA 4XPHL 2WWMC 4L8SC 3RBSA 1KLUA 1RZGA 1A7NH 4H1LH 4U1GB 1RIVH 4XBGA 2VR4A 4RGOL 3B9KB 3O9WC 1HH9B 5I71B 5GS1B 4J3WA 3NCMA 3HE7C 3MFFA