4BA8A

High resolution nmr structure of the c mu3 domain from igm
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
102
structure length
102
Chain Sequence
MGDILTFTIPPSFADIFLSKSANLTCLVSNLATYETLNISWASQSGEPLETKIKVMESHPNGTFSAKGVASVSVEDWNNRKEFVCTVTHRDLPSPQKKFISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structures of the Igm Fc Domains Reveal Principles of its Hexamer Formation
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords IG MU CHAIN C REGION SECRETED FORM
total genus 16
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ba8A00
4M6AA 1AC0A 1C5DB 1KJMA 3RNQA 2GJ6B 2ICEB 5GRUH 3TYGL 5GGQH 1R5WB 4R4ND 4F80A 3UYOD 1MEXL 1LE5B 4YAQB 4HG4J 4Z7VB 4NYLB 4RAVB 1XGRA 2KZWA 1MNUL 1TNNA 3HHRB 3NCFB 2RFXB 1CR9H 4ENED 4KZDL 1IKFL 4UT6L 3T65B 3OJDB 1KLUB 4LKXA 4XNQB 3NPSB 4V2BA 3U6RA 3MXWH 5E94A 4M61B 1YC7A 3PWPE 2P48B 4NNXB 2EIZA 3HN3A 1PKQA 2B5IC 2YRPA 3O6MH 1U8PA 4P46A 5CSGA 2HFEB 5FKPB 1T6VN 2H6PA 3GJEB 5INDB 1DEDA 4MMZC 4G8GD 2F58H 2G2RA 3REWB 5GZOC 1SY6H 3NA9H 3S3PA 4JKWA 4TOYH 3W9EA 5K9QI 3NCMA 1T5WA 1U8IA 1NUFA 3DV6B 2V6HA 5CEZD 4RGMC 1WBZB 4Z7NE 5KSBF 4KK6C 3U7YH 5D1QA 1KBGH 5INDA 3RVUD 1NBZB 4UNTA 1MI5A 3KNBA 3GFUA 4GXUN 4HGWB 4Y19D 3HE7B 3RWFA 2GTZB 2ARWA 1VFAA 3BN9C 1G7JA 3D18A 1FL3A 2VZUA 3LQMA 3QI9D 1ZS8B 2VL4A 3H0TA 3CH1B 3MBEB 4JFFB 4LBEA 4D0CB 3FT2A 1E4WH 2YEZA 3QZWA 2XN9A 1KIUA 2DIJA 3CMOL 4Y7MA 1RSFA 4PRPD 4U1NA 2NNAB 3T4YB 3AXLB 4OV5A 1BIIA 2AAVA 2EDOA 1LK3H 1ZSDB 1IGFL 3MMEB 1IM3B 4GRWB 1IE5A 3ESUF 3KYKL 3PNWA 3FOLA 3VJ6A 1NMCC 4NBZB 3R8QA 4GG6F 1KBGL 4N8CL 3RDTD 4XP4L 1JE6A 2J2ZA 3VH8B 1XF3A 4YH6A 3TO4C 3U4EA 5J4MA 2ADFH 3ABZA 5GRJH 3LZFH 3JWOL 1CWVA 4WW2C 1XGPA 2L7JA 3I9GH 2MKWA 3R1GL 4HK0A 2YMXH 2F58L 2OMBA 3QUMH 4PJ5B 3EFDL 3RU8L 2IJ0C 3C6LC 2EXYD 5BV7H 2Z4QB 3QXVA 2AQ1A 1ZLUH 3D85A 4M1GH 3V52L 4NYLA 1PG7X 3AY4A 1Q9KB 3AAZA 5D2NA 2XN9E 4E9LA 5CIPA 4MVBD 3CFCL 4MQSB 3INUH 4R8WL 2XYCA 5CUSL 5I0DA 1RIVL 2BVPA 3VCLB 1MJ8H 1EEZA 5DD1H 5IVXB 1J05A 3RX5A 2WBJA 2AJSH 1AY1L 4WEBH 2XTJD 5HDLA 2MTPA 4M93B 3W2DH 1V5JA 3TF7C 1S7RB 4QY8A 5ICXA 1NAMH 2I26N 1MFEH 4TPRH 1DQTA 1A1OB 2ZCKL 4CUCA 4UQ3A 1SJEB 5C6TL 4LVOB 5TQ2L 4KDTA 5L2KD 5CJOL 1VEOA 1XIWA 2AEQH 3DNKA 2G60H 4Z76B 3GHBL 3OAUL 3BPLC 5CS7A 4AIZB 2XKNB 2X5PA 2BNRB 5GGTA 1QTYT 5FGBC 3BZFA 3LEVH 1LILA 4I0PB 1IQWL 4OD3H 4DKEH 1CLYH 5EOCL 3LSOB 4F8QA 1S78C 1SY6A 5IVXE 1DN0A 1MFDL 2DLHA 4RIRB 1XCTB 2ICEA 1VGEL 3QFDB 5E99H 4PY8I 1U8JA 3LB6C 3BGMA 5DRNB 4JG1L 5TDNA 3NAAH 4ETQB 4OLUL 5KSAC 1M7DA 3KPRE 4XWOD 5CJXA 3V5HB 3PWLA 4ZUVA 5T3ZL 2FIKB 3VXMD 1MHPH 3ORJA 2CDGB 2RJMA 4JO2L 3B2UC 4IOIB 5FOBB 1DUYA 1IM9D 1IC7L 5TQ0L 1ZHBB 3V5DA 3T0EE 1MCEA 4JZOA 4JG0H 5C08E 3NCJH 4NQDD 1DSFL 3WLBB 2FX7H 1F13A 3K3QA 3ZO0A 2IWGA 1H0DA 5E1HB 2VR9A 2OLDA 3CPLB 4ZG1A 3CC5A 3FFDA 4P2RB 3WNOA 2G75B 3SJVA 4WI9A 4AK1A 3D85D 3G6JA 1NGQH 3AM8A 4YHYB 1U58B 5IROA 3UC0H 1KPRA 1JJUA 1NCTA 1BD2B 4OI7A 1FFOA 1AXSB 1X5ZA 3QWOA 3AGVA 3L3KA 2N7BA 3UTSE 4H5SA 1EBPA 3PHOB 1ZAGA 3T2QA 3WE6B 3OWEA 4Y4HA 3BDYL 2BSRA 2UZIL 5DJDA 5JOPE 5CEXA 4ELMA 5C0CB 1KACB 4HWBH 1CS6A 1DLFL 3MX0A 1CBVH 4FFVD 4DUVA 4AIOA 2DJUA 4M1DL 1EVUA 4EUPA 2K9UA 5GGRY 4BM7A 3IDXH 1P5VA 3RNKB 5IHBA 3UTOA 2X2YA 2A6JB 2VL5B 4BQBA 4G3YH 5HY9B 5CBEA 4EI6B 5JXAL 5HHPA 5EC1A 3EDEA 1XGYH 3MGOB 1C1EH 2AQ2A 2DYPA 2PYFB 1WAAA 1K5NA 1XH3A 2X10A 2YXFA 4NC1E 1JHLH 3P4OA 4MD0A 3ZZ1A 3QT2A 4NFBA 4EI5A 4E0RB 3A6BL 1CN4A 4Z7QE 4YFLI 3UJJH 3LPGA 2QV2A 5C0AD 2VZVA 2FO1A 1H3PH 1DQMH 1QNZH 2DJ4A 1L4IA 2AABH 5D6DA 3QXAA 4FQ1L 3O6FA 3UTSD 2JF1A 5F9OL 4LAQH 4X7EC 2DQIH 1OAKL 4MHHI 4NRYB 3W0WA 3WIIH 5D2LF 2IADB 3HKFA 1OTTC 4J4PD 4O51B 3WXVL 5MHSD 1TZHA 5FDYA 3H3PL 4M6OH 4E41A 1LE9B 3LKSA 4PRHD 4NGHH 3HE7C 2ZUTA 4FZ8H 4W68A 1W72H 3TM6A 3ARDC 4KDVA 4XVJH 1X3DA 5TDOB 4U6VH 1RUPL 2VABA 5EOQH 5E08L 4GUPB 1S7RA 3D39D 4CVWA 4XXCA 4WU7A 2XY1A 3T0XA 1QLEH 2ZCHL 4GG6E 2VDPH 3S36X 3O9WA 4JR9H 4JY5H 1MRFH 5EIIB 3ARPA 3BXNA 3ARYA 2NY2D 3C60C 3VFSB 4FTVB 4UT7H 4X6EB 2OP4L 4GBXC 2OZ4A 1DUZB 5C7XH 3QRFM 5DI8A 4TVPH 3O4LA 4LLQB 4AIXA 1PBYA 5H8DA 4CW1B 3EGSB 5FYLE 1T20A 3MO1A 5TDNB 4P3CH 4Y5XB 1HEZB 4G5ZH 3VDAA 1NBYA 1MHHA 5I1IL 3CJJA 4JN2B 4NOFA 4P23D 5T5FL 1JZ8A 2OBGA 5DK0A 4YR6B 4LPVA 3LKRB 1IC5L 4OUUB 2ZOKB 5ESVA 1M7DB 2CGRL 2V9RA 3OBAA 4MWFA 1UM5L 4JRXB 4IRJB 1YEGH 3FQXB 2R1XB 2AQ3A 4H20L 1YPZA 4WU7B 2PTVA 3GKWH 3VGAB 4DN4L 2QQLL 4ODTL 3RIFK 3RZCC 2ATKB 4EI5D 2F53D 3TBWA 5F3BB 4DUWA 5KVDH 4K3JL 4HUVB 4HJ0D 3QA3A 1ZMYA 4JFYA 5DRXB 1RZIB 4R8WH 4RGNC 3DX7B 1GGIH 5K9KB 4ZS7L 5IG7B 4JN1H 1CLOL 4HLJA 3MV01 1JGUH 3RIAF 3GHBH 3OAUH 1U2CA 1BFVH 5AWNH 3P77A 4M1GL 4LSRL 4FQJL 1GAFL 4JFXB 1ZVSB 2CSPA 2APTA 1G7QA 3KG5A 4TSBL 4OFKA 3NFPB 2BXZA 4R0LB 3U9PH 1XGUA 4N9GA 4XMKH 4F2MA 1ZE3C 3R1GH 1WCBB 2PUQT 2OL3A 2FJHB 5C09D 3O3EB 4ORGB 3T65A 1F90H 3PL6B 4DK3A 3EYOB 3ZKMC 1OM3L 3RWGB 3U7WH 2NX5B 4LEOB 4DZBB 4GXVH 1MPAH 4MDJA 5KSBA 3SE4C 1IC4L 3UO1H 2FBJL 2IG2H 2DLIA 1EFXB 4L9DA 4OGYL 4WUUE 4R97B 3MLTB 3CFCH 3ULVC 2WQ8A 3D85B 4HS8H 3G6AA 1EJOH 2OL3B 1DVFB 1F58L 1U8OB 2F15A 5TE7H 3CGTA 3ET9F 4GAJL 5M7QA 5DJYB 3Q5YA 1RIHH 3WEXB 2Y7QB 1K5NB 5MERA 2FJFA 1K4CA 2ZG3A 3HAEH 5FF6A 1EJ6A 1G7HA 4YHIA 5IESH 1Q1JL 1LK2B 2CMRL 4GW1A 2C1PB 5C0AE 3DUUA 5F88A 1I9JL 3QEGL 5FFLA 5EU6D 1QYGH 1YNLL 3DX9B 1Q38A 5KS9F 4FFYH 4ONGL 4MNGE 1ZSDA 2FRGP 4JFED 5I71B 4GG6A 4HS6A 3CH1A 4JFFA 4D0CA 4A6YA 1Q72L 2YC1B 5HGDB 2R1YB 3LS4L 5CD5D 1Q9OA 3IXTA 5HD8C 2XT1B 4MVBC 5D96B 3SDYL 4AH2B 3P73B 5GS2H 3NA9L 4PJEE 2HT4D 3TJHC 1E27A 2VZOA 3VXRE 3DURB 3QNYA 3S37L 5LG1A 5BRZE 4LNVA 5BO1L 4EIGB 3LKNA 1UACH 3TBSA 1G7IA 4U1MB 1JVKA 3MC0A 1NUDA 3D0LB 4HKJB 2PNDA 1FYTE 4Z7WB 5C2BH 5E1AB 4KJPC 1Z3GL 1XF2B 5JW4M 4HUVA 1ZT7B 1KENL 4KJQC 5JOPD 3RWDB 3T0BA 2J8UB 2E9WA 2E8ZA 3LRGA 4E42B 5IIEA 4JZOB 1X5HA 3KLDA 3SCMB 1TIUA 4GUPA 3TPUA 1F4WH 3L9RA 2O5ZH 2W60B 2AP2A 3QSKB 1I1AB 4WTZA 3MV7A 4TOYL 4JCLA 4G42A 3UDWC 4IOSD 3VXRB 1U8QB 1NFDF 1Z3GH 2P8MB 3P30L 4LSSH 5B38B 3RPKA 1T22B 1AO7E 1A7RL 1KTDB 5FOBA 3ROOA 3VFPB 3MO1B 1VERA 4HF5L 4JM2D 1RK0B 1FYTB 1OARL 2ZKHH 3QDJD 2FWOA 4HMEA 4QRTB 5SV4A 4LIQL 3HG1A 4XVTH 4MDJB 5KSBB 1YYML 1HEZA 5H94B 4NUGH 3I50L 3D3VD 1NAKH 3VD4A 4K8RD 2OSLB 3M45A 4XVTL 1J0JA 1T2JA 4WHYH 2B20A 2I60H 3BD3A 3KWWA 4KMLB 4KVCL 3DGGB 1ZANH 4S1RL 5D72L 1S7TA 1UM6L 3H9ZA 1T89A 1K6QL 1UWXK 3E1F1 1KJ3L 1Q94B 2CIIA 4QRPA 4WTZG 5I1DA 5D5MA 3VMPA 3EO1B 4WU5B 3GSXB 1HIMH 3FTGA 1T0MB 1EFQA 3QDMA 3MBED 5HD8D 3RTQB 3HPJB 4ENEC 1WVZA 4RCAA 3SGDI 1JK8A 2A73B 2W07A 4RMWA 3FQUA 3IFNH 4PB9H 2XV6B 1DDHA 2OZ4L 5CIPH 5C92A 1S5IH 4MXVF 1A3LL 4KUCD 1OAQH 4OZIB 4WO4B 1OD9A 4XCNA 2IFFH 2X4NA 1EPFA 2DQUH 4LCWE 4GG6B 4PJDB 2GTZA 4D0BB 4KKAD 1RJLB 5C9KA 4HS8L 4D94A 1NUGA 2FX8L 3MLZH 1NBZA 1F6LL 1UWXH 1QSZA 2AJUL 3FKUS 3LKQB 4HQQL 4NO0D 1Y18B 3N1PC 3O3EA 1D5BB 2XZQL 3EKCA 1AC6A 4UU9B 3EDJA 2RAMA 1F3JB 3BD5A 1DEEB 3KLSA 4OCLC 5D96C 5EZIH 5FO7B 4GMTH 3T0EA 1OM3H 2FZ3A 4XPFH 5C08A 1SVCP 2DDQH 2AJZA 4X99B 1HHHA 3RFZC 2ORBL 5C0GB 4FOMA 1YN6A 4F9LC 3MJ9L 3QNXA 2J5LC 3FTGB 3WUZA 4HV8B 4XMKL 4KQ3L 5DFVC 5ISZE 4O2EA 5GRXG 1CF8L 1YYLH 4JRYB 1GZQB 1OPGH 1U8PB 1GC1H 2XPGB 4FQJH 5EZLA 1NGYA 3AXLA 4E42A 2AXJA 2R0WH 2OTWA 5TFSH 4KTDH 2JK5B 4HZLA 1HHIB 4LASH 3HUJB 3M1BB 4XRCA 1ZGLP 25C8L 4OLWL 4KTEH 4FHBD 4RFOH 1HXYB 4JO4H 2R23A 1JPTH 2BOBB 2OS7A 1ZVHA 3F6LA 3GKWL 4G43A 4URTB 4LRIC 2KUTA 5FECB 1BFSA 3WFHB 1FYHB 3IVKB 5KAQF 3OAYK 3FHAA 2UYLA 4TUJA 2DQCH 1X44A 4PJ5A 4OM1L 4JQIL 4XVSL 3FCTA 1DANU 4FFZL 2NY3B 3HPLB 5GSVA 1P4IH 2BRQA 1IGCL 4LLDA 4KAQH 1QSFA 2KH2B 3F7RA 4X8JA 1CFVL 1WZ1L 2B0SL 3QDMD 2P24A 4XNYH 3QAZB 3S9DB 3OKNA 4CBPA 1F90L 2QSVA 5SWZE 4ZOBA 3K0WA 5F1OB 5JW5B 3VFVA 4O9HH 3DV4B 5DR5L 3E6HA 4WWKA 1UVQB 1A6UH 1IKNC 2YA2A 1IGYA 4K71C 2VDRL 2QQKL 5HSFA 5DDHA 3F8UB 4L8BA 2P49B 2C7UB 2VZTA 3X12B 2CO6B 2P24B 5DQ9B 3AUVA 1S9VA 5F96L 2JELL 5C0IB 2CIKB 4JAMB 4GW5A 2OXHA 5KW9L 1SJEA 1EO8H 2IG2L 1DQQA 3LEXA 3O4LD 1TJIH 2IH3A 1A7QL 3PWUA 5I73B 4OF5A 3D2UD 4PJFF 2W0PA 3NPSC 4X4XB 5CILH 5CEZE 3IFPB 1FNAA 4MXQD 3KLHD 3PJSA 1AXTH 5GGSY 1HE7A 4DOHB 1CFTB 5E9DD 1I9IH 2HKHH 1HXMB 1UKTA 3ULVL 5JA9A 4NKMA 2APXA 1RD6A 1ZLVK 1B4JL 5BZDB 1SYSA 3U83A 5H94A 5DUML 1GZPB 2J3SA 4M6OL 1UM5H 2QLVB 3QFDA 3V7AG 5C9JA 1AGEB 3KHQA 5DYOB 3ULUC 1BD2D 4K8RC 3I2CL 2K7QA 4S1DD 5TPWH 5DS8A 1I1AD 5K9OA 3KAAA 4N1EA 2IQ9H 4LPYA 1OSZB 1LDSA 1MWAL 3BZDA 2NX5D 5H37G 5BW7C 5D7LB 2FO4B 1QSEE 2FEDD 4QYOA 2VXUL 4G9FD 2X40A 4EUPG 1QKZL 5C0BE 4I18A 4OZHF 2VXUH 3FB5B 3FB6A 4LFHG 5D1XC 1OVZA 3Q5TA 5F72S 1QSVA 1BP3B 5E0QA 3OKOA 2EKSA 1U3HB 1YDPA 1L7IH 1EBAA 4NKDA 5FGCE 3SKMA 2BCKB 4XVJL 3VRJA 4L4JA 3LKRA 4LRNH 4ZXBD 3ROOB 3QCVH 3IB4A 5IBTH 1A5FL 3WSQL 5MEPA 5HHMB 2F53B 1A9EB 4MSWA 1BFTA 35C8H 1QLFB 3JTTB 2PR4H 3GIZH 4JFFE 4WEUD 4LSTH 1Y18A 4OM1H 5C07A 3TBVA 3MJ6A 5CGTA 3V4PH 2A83B 2HT2C 3ULVE 4HHAA 2COQA 3L3JB 5GXBB 1GXEA 3OAZH 1OY3B 3DX7A 4KUZH 4M7ZB 3UAJC 3LEYL 4F3FB 4RFOL 4ZQKA 4J3TA 4NC2B 1NGYB 5I66B 4IOFC 1T5WB 2W9DL 5FXCH 1CIDA 1WITA 4JRYA 4X6FB 1XZ0B 5GS0L 2Z91A 3L7EA 1E4KA 3X17A 2XWBA 1T83A 1T0MA 1A47A 3WUWB 4LMQE 3SO3B 3B9AA 1I8MA 4KK8D 5IHZB 5ENWB 5J8OA 5IBTL 3WSQH 4PS4L 1CF8H 5D1QC 1A9EA 3WXVH 3QIWB 3Q2CA 4GS7C 2DLGA 5GS3A 4LLMB 4MJ2A 3BVNA 2NY5L 4ODXB 1RJYB 4N0UE 3BKCL 4MNQE 4M93C 4RGNE 5FGBA 1C8PA 4LNRB 4EN3B 1LP9F 5KG9A 5KJRH 4OT1H 2ICWJ 3RWCA 4O51A 3DTXA 1N5YH 4KZEH 1U2HA 3CLFL 2M26A 4M7JH 4JQVA 1TZGH 1CXKA 5J06A 2Y36H 1D5BA 3P9WB 4N0CD 4QHUB 1RK0A 2E9JA 4JQIH 5JW3H 1OSPH 3G08A 1I75A 4JKPL 4UBDC 5D1ZA 2AV1B 4QTHB 2CDFA 4TUKL 2Y6SC 1IAKB 2MHAB 5J13B 4TVPE 3MRBB 4QNPF 4I5BA 3LN4A 3QUZC 2F54B 3GJEA 1S7VB 3KLAB 5IEKA 2FO4A 3ARGC 3DMMD 2GK0A 5ACZB 3NFSL 4MNQB 3O4OC 3QDJE 4OCYL 4MX7A 4Q74A 3MLWH 1CFSB 4WWKD 3TO4A 2YUZA 3AC0A 3EZ8A 1FVEB 1HH9B 4ODSL 2J5LB 1QFHA 2UWEF 1FZJB 3HC0A 3G5YB 1IAKA 2MHAA 2IMMA 4IRJD 4Q9BA 5DRNA 4R26L 1H15A 1MCIA 3NIDF 3DI2B 5D7IF 1HKFA 1XF5B 3DUSB 5K59F 2AJSL 3P0YL 1J1PH 1BOGB 3LOWA 1C5BL 5IROC 1AE6L 3MA7B 4MCYB 1MELA 1RZKC 2X4UA 3HC3H 5CILL 3T2PA 1R5WA 4CDHA 1IARB 2GY7B 1NFIB 5AD0A 2J12B 4I9WE 3BIAX 4X7SL 4GAGL 3RTQD 2NX5A 5MENB 4TSCH 3RGVD 1NH6A 2UYLB 3QQ3B 5F96H 5HDBE 4JFZH 1XCQB 4HC1L 5K9JL 3I84A 3PHQA 4FQLH 2ZKHL 2B4CH 3M8OH 1B6UA 2EDBA 4YLQT 3SDCB 3CX5K 5GIRA 3NAAL 4M6NH 3MODL 3BPCA 2WP3O 4NN6B 5F7MC 1A6PA 3ZE0F 3FRPG 3ZKXC 2PTTA 3MR9B 4TNWK 4D8PA 5KSBE 1RMFH 5D7JA 4WVRA 1NCUA 4HPYL 1A4KB 1FNHA 2IAMB 2PW2B 4UOJA 4JG0L 4MXVE 4W6XB 1NEZG 4NN7C 1ND0A 3QA3B 4FQXD 5I76B 3KPPB 2D2OA 1VPOL 4EXKA 2BFVL 3HE6A 5T1DH 1KF9B 5E4EC 4JHAL 3TO2B 1FZOB 2VLJD 3C2SA 1WWWX 4L8DB 1UKQA 1M7IA 3W0WD 1F45A 2QEJA 4Y5YC 2E9BA 5D6CB 2O5YH 3EW3B 2QHRL 1CDJA 4BH7A 3GMPB 4E41E 3T2NH 4FS0A 2CLVB 4U6HB 3OXSB 1IGTA 1B9ZA 4M02A 3HNTL 4PJEA 5D1ZD 5SWZD 3RVTC 3VFWB 4AZ8A 4GBXD 3JTTA 4LIQE 3RVTD 5T1KD 3U0PA 1NL0L 5DD1L 2VKXA 4JM2C 5DD6B 3PWJA 1YECH 2EYSB 4Y5XA 5IQ7L 2P5WE 3ROLB 3QHZH 9CGTA 3AS3A 1INEH 5D9SB 3JV6A 3G9AB 3HTLX 2P5ED 4WW1B 5EFIA 2G60L 3TWCH 3EHBD 3O6FB 3FO9B 5E6ID 4ZYKB 3WO4B 2GQHA 5IFAH 1HHJA 2FEDC 1S7QA 3EJJX 5IB1A 3WBDA 3IXAA 3WUWG 5FM5O 4XPAH 3TCLA 1YNLH 1BAFL 3L3OB 5D1XA 4LEXH 3I6LE 2EDQA 2VUOA 1FAKT 4G8FB 2WANA 2R2HA 5E9DE 3MLVL 4MA3B 5EBMA 3SOBH 1KNOA 4NO3A 4GMTL 5J9PB 3HE7D 1AGCB 4D2NA 3K1KC 5F1IA 2OK0L 1A4JA 3EDDA 4O2FA 3MRJA 1L9NA 3RPIB 1KT2A 3QI9A 5C09E 1D9KB 5FHBL 4WV1B 4KKNA 5DQJA 5I1EL 4HV8A 4KPHL 5HGHA 1OTTD 4J4PC 1JIBA 3VFMA 1GSMA 5IT2H 4XPAL 3JWDC 1VB9A 5JXEC 1MCLA 1G6RH 1ZKAA 1ORQB 1BLNA 1QSEB 4EDXB 3EYFA 1IGFH 5HI4D 3VD9A 1HI6A 4WUUA 5IJKC 3KPRB 3GBNH 1FLTX 4R7DB 2GT9A 1NKOA 1WCBA 2FWOB 3QHTC 3IDGB 4L29A 5DQJB 4GXVL 2V5TA 1NCDH 4PJ8C 2Z4QA 1JZ5A 1OAXL 4YO0B 1OD7A 3QJFA 2VXVH 3FOMB 5GJSH 3T2NL 1Y6MR 2YPKB 1U3HC 5ID0A 1RJZA 2PXYD 3HCVA 1D5IL 4NQVA 4XVUD 1VKXA 1I1FB 3PABA 3HE6D 3TNNB 2NY1D 4IM8A 1DP0A 3QG7L 2WQRA 2QADD 4WFFE 1WK0A 1EA9C 3GMNB 2GJ6E 4OGXL 4GKZB 3HUJE 4XHJD 2NTFB 1R3IL 1CTNA 4DW2L 4C54A 3ZTNH 2B1HH 4NJ9H 1B2WH 1YPZB 3MFGB 1T03H 2WNGA 4FFVC 4LVHB 1M05B 2AK4E 2ARJA 5F3BA 1GZPA 1K8IB 4JY4A 5JHLH 4HX1A 4JDTH 2V17H 3RWHB 2A74B 3QQ9C 1T7WA 5DK0B 3RI5K 4ODUA 1YJDL 3TESA 5DHXB 1NBQA 4Y4HB 3V4VH 1LEKA 3TVMA 4NC0B 4YUEL 1J9CT 1CE6A 5I19H 3DVNB 2AJ3B 2VQTA 3VI4E 2ICES 1YQVH 5EIVA 2R1YA 4PJFA 4OGAD 3N85H 1DQQB 1LEGB 2ESVE 3IJYB 1PVHA 4N5ED 1YY9D 4XP9H 5I9QB 5IHLB 3HE7A 2KKQA 3BESR 4LPWA 2C3VA 1KENH 5GS1A 2ATPB 1Z9LA 1NGWA 3BUTA 3MJGX 1OW0A 5J1AA 3OPZL 1RUML 2X1OA 2XZAH 5EULV 2DI8A 4TULH 4OJFH 4EJ1C 2CD0A 3OG4B 4DUXA 2BNRD 2VDNL 5E8NB 4ELME 2VLKE 3F12B 4OGAC 4NFDA 4HC1H 2R2CA 3N1FC 1NCBH 1NC4D 3S88L 3STZB 3O9WC 2XNAB 3EJYC 1LGVA 2DQEL 4XHJC 5F21B 4LVOC 4YXHL 1JL8A 2LABA 4DVBA 3DXAE 1C08A 1JUFB 1IKFH 4UT6H 4H1LA 5J13C 5I1AB 2YSSA 4PB0H 3CVHH 4P5MB 1RJCA 4CW1A 3UBXA 3VXMB 4PD4J 4PV8A 4Z7UB 2CLVA 4U6HA 5F1SA 1EFXA 3PIQA 4HCRA 1M71A 4P23C 5IWLC 1D5MA 4I3GA 1J8HB 1ZK9A 5BOPA 4R4FH 4ZS6C 2NZ9D 2PO6B 1GPOH 2GSIB 2YPLB 1DQDH 3TYGH 2JJTA 2NY4B 2HKFH 2W0FB 1K85A 4RSVA 4ELMB 1PZ5A 2XQYK 1XGTA 2BHYA 5KJRL 1NLDL 1OAKH 3VE0B 2VQ1B 3IKKA 4F7TA 4LAQL 4CKVX 2IANE 1A14H 5DSCB 2XZCL 3UTPD 5EO1A 4AENA 2A6IB 3GK8H 3IDNA 1F00I 1FZMB 3WXWL 2EECA 3MUY1 4UUJA 1AD0B 1G9MC 2CQVA 2QSCH 2LE9A 1EV2E 4I2XE 1P7HL 1FDLH 2XTJC 4TVPL 3EO9L 4W6YB 5H35A 1MVUA 4PRNA 3F7YB 4NZUH 4QRSB 3SQBA 4IIQC 2Z8RA 3T2OA 1HZHL 2DL2A 4MAYA 4Z7UF 1YPZF 3F7VA 3MLXH 1AFVH 2HAZA 4MYWB 4XBPB 2HFFB 4WTWA 3RBGA 4LPUA 2DS4A 3QUXB 3PF2A 3MYJB 4NHUA 2NY5H 1P4BH 4XHQA 4KUZL 3CDGA 1N0XL 1QR4A 2VDKH 4NQDA 4OLXH 2DWEA 3DX8A 5AUMA 3U9PL 4J8RB 5ECJE 1G6VK 4U1HA 4L4VE 4NKMB 4OM0L 3AREB 1LDPL 3MRFA 1CGXA 5ANME 5E6IC 2XWTB 2D9QB 2FH6A 4G9DB 1HSBB 1P7KA 3BP5A 3MCLH 4LP4A 4P5TC 1I8MB 4APQB 3CSYA 4Y16A 5JNYB 4PPTA 1OAUL 3HZYB 1QFUH 4WFHE 2Q6WA 3QULA 3VXSD 1P7QA 2AGJL 3DPBA 4HK0B 3QI9C 1GCFA 1Z9MA 3U4BL 1IEBA 1JNHA 1B0RA 1OTSC 4OQTH 4WHTB 1VENA 3DMMA 4PP1C 5E6ZA 2XI9A 2P47B 1QLRB 3QFJD 1BREA 3DECA 3DI3B 3VD7A 3KPRD 2ZCLL 3TCXA 5CLTA 2R4RL 5HVHB 3DX6A 1EAJA 4W4OC 5J3HC 4JFPA 2FX9L 4J3SA 4ORZC 2R8SH 2VABB 2G2RB 2EIEA 3VA2C 1JHLL 4OKVB 4G5ZL 4TVSa 1ES0B 2DLTA 4RX4A 4PRIE 4E41D 5IEHB 4AMKH 3QUMB 5L7XH 3CFKA 2O5XL 4HSQA 3D69B 5E5MA 5CD3A 4IEFB 3PWLB 1QFWI 4NKDB 1MWAA 3UTTD 4XNMA 3U46A 3K1DA 1GC1C 4QHUA 2EDFA 3W82A 1M6OA 2VZ3A 5J1TC 5DUBB 3LDBB 4YPGB 1U58A 3NIGF 4WV1C 3FT3B 2HKFL 1JGVH 4XCNB 2Q1EA 4P2RD 1YEIH 4HXAL 3SE3A 2VLJB 2HJLA 1CK0H 5HJ3B 4GJTB 3O0RH 4LL9A 4RFEB 2FGWL 4A6YH 2CRZA 1FC2D 4GRWF 1RUPH 5EOQL 1IAIL 1G7LA 2PCPA 1JMZA 3LKPA 4KKLD 5DGRA 2GTWB 3S4SG 3VGEA 5JQHC 4BFGA 3LQAL 4ZQKB 1A21A 4UQ3B 2NY2B 3BPNB 4OI8A 1FVEA 4F9LA 4OV5B 4NZRH 2VITA 4MA7L 3HZKA 3KPTA 2XFXA 4YNYB 4XP9L 4I48A 2HP4A 2VXSL 4Z7OE 4NNYB 5D2NE 2UUDK 1BBDH 1KJVA 3ARGD 2OM5A 5J11B 4LSUL 4U3HA 2CLZB 4S2SA 3GHEL 2HVJA 3MJ8B 3ULVH 4PJ5E 3Q1SL 1BIHA 5AD0B 1AY1H 1VFBB 4WEBL 3SDCC 1XMWA 2BK8A 4WJ5A 5I8KL 5ADOL 2JJWA 4QT5B 3SDCD 1FG2B 5IVNA 2FX7L 4JRXD 3VG0H 5DEFB 5FYJD 2D31A 1C5DA 2YN3A 5HBBA 3AREC 3GBLA 4G6AD 3QEUA 1P84K 3I6KA 1U9KA 1GGTA 3WJJC 4ALAH 1NFDA 3MRIB 1YMMB 1Q9KA 4P59H 2B1HL 4NJ9L 4JZJB 4M3KB 5E00B 3CSGA 4J1UA 4WY7H 4M4RA 2HTLC 4L4VA 4HGKC 4RBPH 3HRPA 3FB8B 1R3KB 2F5AL 1KB5B 3UTTE 1P84J 2P1YA 2H1PH 4X83A 4XCEB 4Z8FL 3MBEC 4KTEL 2XXMB 3T4AB 1CLYL 1AIFB 5TE4H 5ITBL 5GRJL 1U8OA 3MMEA 1K2DB 1HILB 4IRSD 1PKQB 3DX6B 5C0ND 3RL1B 7FABH 4K07A 3LN5A 5B21A 4NNPH 2HYMA 2NNAA 1EVTC 2JJTC 4XNXH 3QIUD 1WWCA 4WENB 2EH7H 4P99A 2DQCL 4D9RE 1RVFH 3PL6D 4RGND 3OSKA 1F3DJ 3MGTA 2BNUA 1TXKA 2ZCKH 4NC1C 5T1LB 3L7FB 3BEWB 3G5ZA 1FNEA 4MB4A 4N0FA 3GBNL 1H3XA 4OTXL 5IMMB 1TVDA 4NKIH 3V6FB 5DRZA 4CVZB 8CGTA 2VN4A 3FN0L 2V2WB 4BZYA 5C0CA 1CD8A 4R0LA 1QA9A 5L88L 4KY1L 5JQ6L 1OB1B 4LASL 4YWGH 5GGTL 4G8GE 2EXYC 2HLAA 4ONFH 4DGVH 4IIQA 1KXVC 1ZGLM 5LGHH 5DI8B 3RVXC 3V6FA 4JLRA 3BIKB 5GGUA 3BO8B 2O93L 4R97C 4I4WA 4OLYL 4S0SD 4CL7A 3WFBL 4HMCA 4NCDA 3TBTA 4I3RH 3Q48A 5BZWA 4X6CB 3L5IA 2GJZA 4KI5F 5TQ0H 3WLBA 2NY2C 3BPNC 3C60D 1PEZA 3AB0C 3OHXA 4TRPH 4OAWA 3OZ9L 2KQNA 3S36L 1R0AH 4YNYA 2JIXA 4GLRI 2FR4A 2X4PB 3F7YA 4IS6B 3OKEB 1UC6A 4S1SL 2AK1H 4QGYA 5D71H 3QUYD 3O41A 5K9OB 4XP4H 2VSDA 1NSNH 5C3LD 1O7VA 1GIGL 2ZUWA 3B4NA 2QJDA 5FKPA 1MHHB 3QHFH 4IDJH 4PJ7A 5EBWB 1MWAB 2HMID 1HWGB 1OT2A 1TLKA 5JORB 2BY1A 4NQDB 5DYOA 4NPYB 5I75B 3OR7B 1G9ML 1BOGA 4WFEE 1T7YA 2BRRH 2Y4SA 3ZYZA 1L7TL 1FORL 1A1NB 1KCLA 4KKCC 1JNNL 1ZWIA 2VUYA 1U95A 3MOBL 4CMMB 4LVHC 4FMFA 3PJSB 2JKXA 3HLAB 1TJGH 5DEZA 1CT8B 4HXBH 1HCVA 5DD5H 1A6WH 3SKNB 4ZO9A 3MLRL 4PGBA 3ZT5A 2DQHL 4XX1E 3D0VA 5J6HA 1OT1A 3I85A 4QRPB 4Y5VA 1FL5A 3CX5J 3BKJH 7CGTA 2CRIA 2ADGB 3O6FD 3G6DL 2VZ1A 3STLB 5FDWA 4HF5H 1ZA3B 1N64H 2VR5A 3VWKD 3P30H 2XQBH 4PRAA 1II4E 1C5BH 3E2HB 4LQFH 2XTJE 3FQNA 5E2WH 1RURL 3ZKSD 3O2VL 4MD4A 5E2VH 3O0RL 4A6YL 2ERJB 3GMRB 4YR6A 1I85A 3BJLA 5EUOA 4QHMA 5HHVL 3IJSA 5CKGA 2X4SB 1BBDL 5FA4B 1KV3A 3T0ED 4FFWC 2H32A 3LS4H 1LHZA 3P3YA 1EUTA 1HYSC 2E8YA 2O61A 4YC2B 3L5JA 1J1PL 3IGAA 1PFCA 3QIUC 4F7PB 1JNLL 2QSTA 1IEAB 4PJHB 1JYVA 3CFEB 3LQAH 3GJFH 3QIWC 3GGWA 1RZIA 3BAEL 12E8L 4P46C 1I9JH 3QEGH 1XF3B 1UACL 5JW4R 4ODSH 2YRLA 1D5ZA 1HHJB 3RUGF 1MRDL 4S10A 1INDL 5EZLB 1UZ6E 5F6HJ 3CLEH 2VQ1A 4MGXA 1EHNA 2FB4L 3HZVA 4PJIE 4WTXA 1ZT4B 4X98A 4ZTOL 3HZMA 3OF6D 4ZFFB 5LBSH 3HNVH 5CAYB 4N90D 5DJ0B 1S9WA 3EYVA 1G7JB 3D18B 2LAAA 3MRLB 1FNEB 5C0FB 2PW1A 3CZJA 4XVUC 3W81A 2H26B 5I75C 2GAZA 1AI1L 1S7SB 4JQXC 1ZS8A 1WBXB 2C3GA 4X7DC 4L29B 4KVNH 1Q1JH 5JIPA 1NDMB 2IADA 1BFOB 3S96A 3O4OB 5DRWB 4QXGH 1KTKE 3DUSA 1R3JB 4PREB 2CKBB 1CYGA 4YFDB 4Z78B 5FYKE 3NMEA 1RIHL 3MV9E 3CDFA 3MJ7B 2XN9D 3P0VH 3MRHB 5HI4C 5B38G 4NRZA 2LU4A 5F89A 3WS3B 2X09A 4NQVB 1VKXB 5FF6B 5FK9A 1JHTA 4ODBD 5LGKA 3KDMB 3DVGB 3PQYD 3RVWC 4BQCA 5BQ7B 3O45B 2KQMA 1WIPA 3V8CA 5I8CA 4PJ8D 5JTWA 4G8FA 4U2ZA 4XTRC 3JTSB 1TQCC 1U8KA 3MGOA 4P5TB 4MZ2A 3FQRA 5E8OB 4YDLB 3KYOA 1JCKA 1BBJA 3NABH 5EZOL 3U48A 4HUWB 4M00A 4PJGF 4NN6C 4ODHH 3WXWH 3H7BA 3OR7A 4X6DE 1D5MB 1ORQA 1QRKA 3IFLH 5EZJA 1GAFH 4MJ5B 2HVJB 3P73A 4YHKL 1RZFH 1WISA 3WFEL 1MCDA 3N9GH 2DIBA 5BV7C 1MHCA 3RZWA 2YD8A 4O5LL 5E8OA 4GH7B 4DN3L 3QCVL 4NQXA 5D2NC 1V3MA 4LRNL 2OR9L 3RDTC 3VXUA 3WMSA 5L2KA 3C5ZD 3WDHA 2D7PA 3SO5A 3EYUL 1RZJL 6FABH 4UT7L 3CPLA 2B5IB 4JFPB 3PGFH 1CT8A 4OD1H 4GXUM 3K4AA 5DJ6B 3SEPA 3EFFB 2PO6D 2YPLD 3QUYC 2A9NL 1BZ7B 4YDVA 3NZHH 4G9FA 1RV6X 3TPUB 2R1XA 4JR9L 4JFYB 1N4XH 1TMCB 4KDTC 5HDQL 1J12A 4KGLA 3CFBB 4TN9A 1M1SA 1U42A 1BQUA 2APWA 4OZ4B 5I30H 1NKRA 2KPNA 5L6YH 1Q9LA 4K3HA 2NY7L 1ITBB 4LKCA 4O2CB 3TV3H 4DKFH 3V5DB 5E00A 2PO6C 3QIBC 5E8EB 5C0FA 1CL7H 2WBJD 2OXGA 4NGHL 3HS0A 1LD9A 2CRYA 2NW3B 1RZ8B 1XCQA 4PJCB 4PB0L 4R3SB 1UENA 3K2UH 4MB5A 1KN2L 4FXKA 5T1LA 2YC1A 5HDQH 1UJTA 4C83B 5HVFB 5KW9H 3OKMB 1KC5H 1TCMA 4ZTPL 4ORGA 3RJQB 1UZ8B 3NZHL 3MA9L 4J3WA 2I9TA 1IGJB 4P2OA 5F1NA 1P6FA 1YJDH 3V5KA 3ZKND 4K7PY 1I8IB 3B9KD 3D25B 1PJ9A 2XZAL 2GITB 4WHTA 2V17L 1TTGA 4NNYA 4Z7WA 4U1KA 2Z0BA 3VI3E 4OFYA 1XR9B 4HKZA 4M7LL 4IMKC 1EHLH 1BF8A 2E7BA 1OSZA 1UT9A 2E27H 3HCVB 5FCUL 2X89A 4U3CA 3O11B 4J1UB 1OQOA 2P7TA 2H6PB 3WIHL 1YQVL 4ZSOE 1A6UL 3WEXA 2WBWB 2FZ3B 5C08B 4OLEA 3FQTB 1FGVH 2Q8AL 1RZ8A 4PJCA 4QXTA 4WW2B 5AYUL 3GSNB 3K7UA 3OXSA 3JWDL 5IMKA 3FONB 1NMBH 2OQJA 3CIQA 3TNMB 4TVPD 3G5XB 1VCAA 5EZOH 5EBLB 4YZFF 1HWHB 3ARBC 4PRAB 4JVPA 5JHLL 1SEQH 4RA3A 3CLEL 1N6VA 3CDCA 3OL2A 1BM3L 2HH0L 5I17B 4JRYD 2LAGB 12E8H 2BJML 5I71C 1I7UA 1YMME 2CUIA 3O4LB 3OMZA 1AIFA 4OQ1A 2R69L 1OP5H 4LMQI 4OBSA 4BSWA 1RULL 3T8XB 4PLKC 3B5GA 5GJTH 5HHPB 1DBML 4QHLA 1RUQL 2IC2A 2A2QT 5DJ8A 5K9QG 1FZMA 3KDMA 5E9DB 3LN4B 1JZ6A 2FEEL 4KUCF 3UTZA 4O2FB 2Y06L 3E6FA 1P6AB 4GSDL 4JRXE 2ICWI 1WFTA 3MLUL 1OAXH 1QLRA 3ILPA 2DKMA 5FUOL 3MNZB 2EIBA 1CDIA 3KPSB 2XZQH 5MI0C 4KI1A 4J4PA 4NQEB 4UILH 1T4KA 4OZIF 5EOCJ 1FE8L 2W1NA 4QRPE 4EI5C 1JGDB 3MLZL 1QA9B 3H7BB 4K23L 2YKLH 3V0WH 2BSSA 5LGJB 4HW6A 5FM5M 3X11A 3U30C 4G8EB 4P46D 1U91A 2P44B 4XNMB 4MJIA 3U46B 4CMHC 1A7NH 3ZYIA 2AXGA 3BKJL 3LDBC 4K2UL 5ESVB 4K55A 5CD3B 5E70A 3RWIA 4WHCA 3BWAA 5IW1B 1UCTA 4G8GA 5EZJB 3VWKC 1MAMH 5TF1H 1UM4H 3T1WA 1I8KB 3S4SA 3D39A 1U3HA 1YDPB 5A1AA 1KPUA 2H8PA 4HEPG 3FN0H 3MYZA 5LWYL 4LPXA 3QP3A 3WHXA 2R29H 3KPLB 4AYFA 1UVQA 1IQWH 4P2RE 3IU3A 3QCTH 5C0AA 5AYQA 3UAJD 3C9NB 5DJ6A 1AHWB 1CQKA 1MSPA 3JUZA 1JNNH 1KFAH 4JPKH 3IFNL 5IFAL 2AV1A 1SYVA 3FMGH 2JB5H 3MZGB 4JE4B 1SBSH 4N90E 5IGXH 2H2PC 4NWTL 2N1KA 5DXWA 1BZ7A 5IFHH 4GMSH 4ZNCD 3PDGA 4RAUA 4DVRL 4L3EE 4MS8D 4NUGL 4XXCC 3F5WA 3UMTA 2Z8VC 1YYMH 1RZKL 4Y2DB 5DFTA 4OCNC 1VACA 2G9HA 4DAGH 4QRRB 3ZHKA 5CINH 5E5RB 4O00A 4AY0A 1C7TA 1IRAY 1IGIL 4B7LA 2D0GA 4M9OA 4Z95L 5FA3A 1MCKA 5SWZA 3DVNA 1I9RH 1WWAX 1RIVH 2APVA 1S3KL 4H5SB 1T04A 4IMLA 4GMSL 4UDTB 3CSPA 1BJ1J 3EBAA 2ENYA 1R0AL 4N1CA 3GM8A 3MRKA 1F4XL 3NIFE 5SWQA 3WN5A 3FHQA 4I3SL 2VC2L 4LSPH 2KBGA 4Y4KC 5KSUB 3KGRA 4ZSOB 3TZVB 1NCWH 5T1LD 3GSWA 3CFDA 3UZQA 3W2DL 1UFUA 3IDYC 1K4CB 2W92A 4G7VH 3JSSA 2Z31C 2P8PA 2CRMA 4I2XB 3BHBB 1HHGB 1JF6A 2GY5A 3RA7H 1VA9A 1Q9WA 3GMNA 2Q6WB 4U1KB 3GMLB 3N1QC 2XQYG 3MRRB 4M5YH 3GSWB 5GJTL 4NKOB 2HT3C 3BZEB 4HWNA 5B4MC 5CBEB 5I1KH 4OKDA 2ZUYA 4OTXH 1P4LB 4WI4A 4FQHA 1GVIA 2F9BT 3MOAL 2J8UE 2NXZD 3R0MA 2DM3A 3B6SA 1S7UB 1RVFL 4N8VB 3QHFL 4IDJL 4CVXB 3B9KB 5HYFA 1U3ZA 3TNMA 5HVGB 5JW3L 3QXTA 5ESAB 1CK0L 4WJ5B 1I8LA 1KEMH 4R7DA 4MQXD 1LO2H 5EA0L 3DHJA 1XAUA 4H0IA 1MFCL 3M07A 2P43B 2APBA 1A7OL 1JWMB 4N8CH 4PY7B 4YPJA 1KB9K 2DQJL 2KDGA 3SQOL 5IGXL 1N6QL 1V7ML 1QD0A 5BCAA 4ZFFA 4OZFH 2Q76A 4PJBB 1CD1A 4WO4C 5ILTH 1VHPA 5E95B 1INQB 2NY0D 4U7SA 3DRTB 2VLKB 4FN0A 1QYGL 1XIWD 1AQKH 3GNMH 5LWYH 4OF3A 3MNWB 5DS8B 1B3JA 2O26U 2HH0H 3VFVB 3Q5OA 1C12A 3L7EB 2NZ9C 2ZJSL 4N8VG 1CG9B 1SM3H 3OKNB 4JFEA 4U2YA 3ARBA 3N0PB 5SWSA 1F5WA 1K2DA 2FBJH 3MV9B 3SY0B 3DRTA 2NW2A 3L5XL 1IBGH 4RRPA 3LKNB 2VXTH 5FHAL 1F58H 2C3XA 3O6ML 4X0KA 1TETL 3BFOA 2D7TL 4Z7UA 2HTKC 3ETBF 1ZGLA 3MSPA 2BVOB 2Q8BL 4WNQB 1MPAL 4N68A 2WWMD 1N2RA 4IJ3C 3RWHA 3GMRA 2V2WA 1I3GL 2BNRE 5C0EB 2XOTA 5LCVH 1FGNH 1F6AA 2UV3A 4HWUA 5BVPL 2R1WA 2A77H 5D7LD 2P46B 4J12A 1FIGL 1H3WM 3ARDA 5GISL 1K4DA 5J11C 4KJYA 1T0PB 1EDQA 1Z5LA 2I25N 3LB6D 3KPSD 2ESVD 4K3JH 3QXDA 2YD2A 4M48L 3GBML 1FHGA 4HS3B 4DN4H 1U3HD 2GK0B 4S1QH 3BH9A 5ACZA 5IFJB 4YBQC 5DJ8B 3PABB 1A1OA 1UEMA 4GKSA 1GGBL 3D48R 2Y6SD 1GGIL 3T0EB 4PGBB 5IB5B 1BM3H 4JO1H 4R7NA 5IK3A 1E6OH 1X5FA 4Y4HD 2HWZH 4ZUVB 2BOCA 5C0CD 5IKCA 3QCUH 2P5EB 5L9DL 1UH4A 2VISB 4MJ5A 2B1AL 3MA7A 4MCYA 3Q6GL 4K3EL 1L7IL 1F3RB 2R0ZL 2VO5A 4X9GA 1U92B 2P8LA 4M4PA 5CBAB 4MQXC 4HX1B 3LRHA 4R2GB 5I15H 1AGFB 2GFBB 4PRPB 1N4XL 1WBXA 3HG1B 1NLBH 2DD8L 2EDTA 1F4YH 2R2BB 3RUGE 3THML 4HFWB 2JE8A 1FAIL 3ARFA 4GAYA 4LLVB 5HGHB 3KPSE 5C1MB 2YK1L 1AO7B 1J8HA 1MCFA 5DUMH 1XGUB 4EI5B 3H9SE 3O8XB 5J1SC 3OKKA 5FM8A 4QO1A 5DQDL 1H3UA 2FYYA 5E08H 4J7RA 5DO2C 1AXSA 3IS0X 2YHGA 4MXWL 3C6LD 4F15C 2X9YA 5C0AB 1YEJH 5IF0A 1ONQB 2EICA 5C0BA 1MJJB 1N8ZA 4PJAA 2HVKA 2FSEA 4YXHH 1SYVB 4XCFL 4AM0B 3ZMRA 4YHKH 4AEFA 4F3FA 2A1WL 1GOHA 2I9LB 4U1NB 4ZOAA 3DBXB 4U6VL 1KYOJ 3FAWA 4NO0A 5I1GH 5FV1L 3H3BC 3BH8B 5KVGL 5FYKH 1W72L 2Y5TA 1KJ2B 5C0GA 1T2QH 4Y4KA 1KELH 2VAAA 4PJEB 4QXGL 3KYNB 4KMTL 2VJXA 4HDIB 5B39B 4BH8B 3ARQA 3QEUB 5DVOA 3VFOA 2LVEA 2R39A 4UQ2B 1R3LB 4PGCA 1CFVH 4HIXL 2B0SH 1N2RB 2HRPL 2H2PD 4PV8B 5DJ0A 1N3NA 4ZOEA 4KAQL 2IF7A 2P7TB 5F9JA 1MH5A 4PJ9C 1WAAF 1NFIA 4G9DA 3WIIL 1ADQH 3WJJA 2PYED 5DJZA 1TETH 4TNWF 5LGJA 1XCTA 1JI2A 5HYJA 3CU1A 1DLHA 1VGKA 2C9AA 4UIKH 3L7FA 4KJQD 5JMRA 1GOGA 1F2XK 1V8HA 5D2LB 2FLRT 3V0VB 4P4KA 3MNWA 3B3IB 3NH7L 5SX5H 1G7LB 2PCPB 3LKPB 4YE4L 2FB4H 4LGPB 2ZPKH 5DT1H 2E6PA 2R2EB 2DJSA 4KK6D 2OR9H 5HYEA 4ZUUB 4KVNL 3G5VA 4FXGA 3KLAA 1R3IH 2HLAB 5HYSG 1QRND 4U0RC 4L1DA 4KMTH 1MVUB 4PRNB 4PGEB 3IDYB 5ILTL 3FAXA 4K94H 1CE6B 4Y5VC 5F9JB 2GCYA 2NYYD 2B8OT 1OHQA 1ZHKB 4KQ3H 1D5IH 4OLXL 4LP5A 3D6GA 3CZFB 1JPTL 1N26A 3MYJA 2DLFL 4LRIA 3SKJL 2BY3A 3EOAA 5EORL 1BJ8A 3K2MC 4J8RA 5JLZA 1AFVL 1MRDH 2QQQA 3K74B 4LQFL 4I0PA 5BXFB 1UJ3B 4LSVL 3TYFA 4QF1A 2X44D 3GEWB 4GQPH 5HHOA 1GJIA 4KK9D 2H9GA 3RIFF 4AG4L 3U7AA 3BUYB 1L0QA 3EO9H 5CWSA 4M43H 5HYQB 2A0LC 3PGDB 5GQBA 4QHNB 5AG9A 4F9PA 2CH8A 3D9AL 3NOIA 1C16A 1MFAL 1MJUH 1J8HE 2QKIB 4IS6A 1KN4L 4MJIE 3U36A 3TBSB 4NRZB 1XGQA 1F11A 4FNLH 4U3XA 1UA6H 1NLDH 3O2DA 5I15L 2BSTA 4JO2H 3IDJA 5EZIL 3EO1A 1RURH 3ZYJA 1KSRA 4XCFH 4DGYH 2CIIB 4A2MA 4OLUH 5DURD 3GKZA 1S9YB 2WP3T 1P7QD 4ZFOB 2IEPA 3GI8H 4UI2A 2NCMA 5KOVC 5HYJD 5IMKB 1OP3H 3E8UH 4HWEL 4WI6A 1CFNB 5E8EA 4NZJA 1EGJH 2DQUL 1KIRA 3SKOA 4PJIB 1KTRL 1L7TH 1SYSB 4OD3L 4EDXA 1H15B 1N3NB 1R6VA 1INEL 4WHDA 4FRWA 3FN9A 4LBEB 1B4RA 4L4TD 2P5WA 3SDXE 2Z9TA 3QQ9D 4PB9L 1U8QA 4G43B 1I1RA 3LQAC 5HPOA 1JWSA 1MOEA 3AMKA 4GW1B 3TFKD 5IHZA 1T7VA 1NCBL 5E99L 5F3HA 3RKPA 2CK0L 2VH5L 4M62H 4GT7A 4N8VA 1NC2D 3SDAD 2MQ3A 1BVKB 3UJTH 3D1MC 1BQHA 3VFTB 2OJZH 5DLMH 4PJXA 3I75A 1E28B 4Z0XB 3UROR 3JXAA 2A38A 3MRCA 4K3DH 3LEVL 2EE2A 4LSSL 1BWMA 1A6TB 2ATKA 4TUOB 4PG9A 4DVRH 2VXVL 2Q20A 3F12A 3O3UN 5J57B 3NTCH 1KEGH 2VXQH 4HS3A 3TC9A 5HHME 4DKDC 1FL5B 4MA1B 4PREA 3HI5L 4PGZA 5JUEH 5CJOH 4NFCA 1MJ8L 4WO4D 1F4WL 3E6HB 3EFFA 3O6FC 2AJYL 4I9WD 4JO1L 4U31A 3TN0D 2AERT 4DQOH 4X80H 1WAAE 1T66C 3OR6A 2R29L 4APQD 3H3KA 3NIDE 4GKNA 3PDOB 3D39E 5C09B 4KRPD 1G9NL 4L3EB 3GUTB 5KS9E 5EO1B 4AENB 4G6MH 4PYGA 3OXRA 2I07B 4JJHA 3T0VA 5TF1L 4F2MB 3STBA 1J0KA 2Q7YA 4CVZA 4NSKA 3HR5B 2GYSA 4L9LA 2M8XA 4X6EA 5D7KD 5D70L 1FRGH 1V3JA 1J1XH 1H8SA 4LEOA 5T3XH 4JRWA 3LZFL 3QH3A 1QBLH 4G6KH 4YIQA 5GS0D 4KI5E 5B4MD 1LQSR 2DWDB 4QRQB 5GHWH 4PJXE 1I3GH 2Y23A 4JY6B 2BC4B 4DTGH 1UXWA 3QBTB 1QFWL 1KIPB 2BNRA 3O45A 2Y9RT 4LLAA 1CGWA 3QUML 1MIEL 5C6WH 2F19L 5ICYA 4Q0XH 5JHDE 5IEKB 4HAGA 3L3GB 3I9GL 2DQJH 4M5ZL 1I1FA 1HDMA 1CFSA 1KCKA 4JFDE 3TO4B 3L5XH 1R3KA 1HHHB 4R96B 4UOW1 4X6BB 2EDLA 3NA4A 4KKCD 3PDDA 2E3VA 5EU6B 4YJZL 4JM2B 3TNNA 1NCDL 1DBMH 4OCXH 4KROD 3SDYH 1GYAA 3GJFA 1ZOXA 4ISVA 4RWHA 3CK0H 5SWSE 2R69H 3QG6A 3L3GA 5C07D 2ZSWB 1MCPL 5EOTA 3NZ8B 3QO1A 4Q9QH 1TJHL 3KR3H 5F6HI 5KTEL 3TH4T 1CFNA 4WFFD 3H42H 3WIFA 3PWPA 4AEIH 1VPOH 1E4WL 4I8DA 2ARJB 2EO9A 4JGJA 4C4KT 1EMTL 1V7MH 4X7CC 1CDGA 4LOUD 2Y36L 1IC4H 2PO6A 2YPLA 3EYFB 5CJQH 2XKSA 5HGBA 1KPVA 2CR6A 2X1WL 3MQIA 1TCRB 4KZEL 1CVRA 2RGSA 3TGXA 4UOW0 1QBAA 2F8XC 4PRIB 5LQBH 2GW5A 4AL8L 1I4FA 2X41A 5DZLA 5F89B 4U1JB 4M6NL 1O7SA 4U1IA 5T1MB 4MHHG 5D1ZC 1C7SA 5JZ7D 2BY0A 2VXSH 4G6KL 1RUKL 3U0WH 4PS4H 1F4XH 4CMMA 5CMAB 2PETA 2WIIA 2YPVH 4I2XA 2DKSA 2Y07H 4ALAL 1FVDA 5I9QC 3TBTB 5SV3A 3GRWH 4OCXL 3LRSA 4ZPVA 1BIIB 5J6GA 3SGDH 5L88H 3FO9A 4ZYKA 3AS1A 5IOPB 1TVHA 1FPTH 4NHCH 2DKUA 1FQ9C 4Z6AT 5FYLL 3QDJB 3H6JA 4R26H 4JFQA 5K33A 3MXWL 1AKJB 3KYAA 3R4DA 4H20H 3BGAA 1BWWA 4X4YA 4NSKB 5EU5A 5C2UB 1FNGB 1DEEA 3PWUB 3OKLA 3TH2T 2VXQL 1U3JA 3EOAB 3FZUC 3HI6L 1S7XB 2P5EE 4Y4KB 2UY7A 4J6RH 2FECL 1UB6B 4PJGA 4UT9L 3RDTA 3F65A 1U8MB 4AMKL 4CJ1A 5HGAA 4YDIL 4YDVB 4YBLC 4U7KA 1EEYA 3QR2A 1N0LA 3ALPA 3ARGB 1IC1A 1NFKA 1MRCH 1LWRA 2W9LA 4JKLA 5DWUH 2V9QA 4MNGA 5AAMA 1Q9WB 1SMOA 5D2LE 4NZDA 4HHAB 1QKZH 3QZWB 3HPLA 3QJFB 3O3BB 3NGBC 5T5FH 1SEBA 4X7SH 3WDJA 4LCCB 3LH2L 1ZT1B 5AZEH 3HE6C 3MRGA 4PJFE 1JZ2A 2GK2A 5EDXA 1I8IA 1OTUD 1AE6H 3EOBA 2NR6C 3DARA 3JV4A 4GAYB 4O5LH 1I3UA 2D31B 3STLA 3MCLL 2Q3AA 3DX8B 4O4YH 3GI9H 4H25B 2ITCB 2GAZB 3HMWH 3QRGH 4CAGA 4UDUA 2W65A 3PUCA 2CLRB 2W9DH 1M71B 3MV9D 1ZLWH 4G8IA 5ISZD 1OCWH 2OJEB 3RWCB 3WFDL 1QOKA 3UTZB 4ZD3H 2D03H 4O02L 1MF2H 4U6YA 4R4BA 2VAJA 3P4OB 4POZD 2DTSA 3O3DA 4OAWB 3VWKA 1PX4A 3QQ4A 3IETA 4YC2C 1I7TB 4O2EB 4PGEA 3L5WA 3L3OA 1PAMA 3VXQA 2DOCA 2M1KA 2V5YA 4XXDA 4FZ8L 4R96A 3P4NA 3X12A 3U0TA 1KNOB 4NO3B 1JHTB 4I5BB 3RZCD 5JMOC 2DLFH 1XR8A 4L9LC 4M8VA 4RRPG 1OAYL 5H37H 1WIOA 3UP1A 2HMIC 4ZO7A 1MCWW 4FNLL 2EXWD 5HTSA 5E1AA 5I66A 4KROC 1C1EL 4JRXA 5GGUB 3EZJB 4O9HL 3UZEA 4DZ8A 1QQDA 1FSKC 2F74A 1F4HA 4U6XA 3VFNA 1ADQA 4P2QD 4MB3A 4S0TD 3WL9A 3KVQA 1H3VA 1H3TA 3VWJB 2X1PA 5IJKA 1T89C 4PR5B 2P8MA 2QQNL 4PJCF 5E5MB 4YHOL 4YHMH 3OKEA 1YNKL 5ICZB 5T33L 1KCRH 1YEHH 2GSGA 4NP4L 2R4RH 4RIRA 1Y0LB 3P9MB 2J8HA 4P9HC 5JIKA 3SKJH 1E6JL 3JVGA 4PJ8A 1CDHA 4U33A 1EK3A 3QUZA 2WBJC 1NANI 1DQLL 1YEFH 4PP1D 2R0KL 4ZUUA 3ARGA 3CUPB 4MNQD 3V5KB 1MCBA 4Y5VB 5IP4A 1RY7B 4WWKB 3VRLE 3MFFB 5K9KA 1FVDB 4LDOB 1KCUL 4I18B 3MV11 4HIXH 1IAIM 2O61B 4C57C 4PP2A 4S1DC 2PR4L 3GIZL 1AO7D 5IFJA 1AH1A 5FK9B 5ALCL 1DLFH 4O4YL 3BOVA 4E5XA 4JZNB 3OPZH 1LDPH 4M7LH 1IQDA 3SDXF 3NPZB 1T1YB 1PD6A 4X7TB 1VFUA 4H88H 1DR9A 2EDRA 2AXGB 3SGJA 2R9HC 1KJ2A 2H3NB 5IM7A 1D7FA 4JFDD 1A7QH 1CFQB 4Y5YB 2H32B 4OV6F 5I19L 4KHTH 1LO3L 5DEFA 1I7ZB 1YEJL 4OZIA 3T04D 4Q6IA 3BZFB 1VEMA 4YHYC 2JJSA 2FJGA 2AXFA 2YD9A 4QYOB 3HFML 5CP7B 1MLCB 4PTTB 4XTRD 2HJFA 2WK2A 1TDQA 2V5MA 1FDLL 5F7KC 3QZWG 5D7JC 5BRZD 1NMCB 4N0YH 2F8OA 4X4ZA 3WO4C 3TJHD 4P5MA 4BZ1L 3MRRA 3D3VA 4YFLF 5IBLD 4WFED 3O8XA 4XXDB 3V4UH 3VFGH 5KVGH 1OAQL 5IF0B 3VD3A 5TGBA 1A6VH 4L4VB 4LF3B 2A1WH 4APQA 2GJZB 5C0DB 3AM8C 4MNGB 1WUNT 3IFLL 2VDLL 3K8LA 5DEGB 3T0DA 4PIRF 1QLFA 4YBQD 4K3EH 5F7NC 3RKDC 4LCYA 4F7TB 5EU6E 2NY6D 4WIQA 4FQCL 5D1ZB 4XH2B 4UAOC 3QCUL 1PYWA 1VGEH 2F74B 4MXWH 2NX5E 4X5LA 5HHMD 5KVMC 1A02N 4R6UA 2EKSB 3OKOB 4N9OB 2XN9B 3KNBB 5EBWA 4EUPH 3JV4B 1O0VA 4ODWB 3WHE1 5FA4A 2B2XL 4LK4A 3IU4L 3VFMB 3INUL 3ZE0E 4Z7UE 3WN5C 5AEAA 2EDWA 5DRZB 3TVMB 3GMPA 3UJIH 4JO3L 4PLNC 1RFDH 3LKOA 5IV2B 3HC4H 2XWBB 4RBPK 4H1LH 3QWRA 3OGCA 1MCOH 1EUUA 2R0ZH 4PJBE 4TULL 5F93C 1HHGA 5DR5H 4UUJB 3ULSA 4XPTL 5TJWK 5T3XE 3RWDA 3BSZH 4HH9A 4JFOB 3D2UB 5T3ZD 2XKUA 3IAQA 3GMOB 1BVLB 4XPBL 2DICA 1LP9A 3S35X 1PSKH 4HIEA 3RJDA 1P4IL 2DWDA 3MRNB 4QRQA 5D7IB 3FOLB 1PEWA 2IANB 3KPOB 5CKAA 2N56A 3OGCB 5H2BB 5DC4B 5F7FA 2YA1A 5I8EA 2EDEA 2VXTL 4AH2A 5JOEA 4V1DA 4IOIA 1G6RL 4PTUB 4Q58C 3C5JB 1UWEH 2AEIT 3O6LL 1TQBC 4LU5L 2MWCA 3LPFA 2ID5A 1MREH 5ADPL 2EDHA 2Y5TB 4X4XA 1LO4L 4XPGL 3T3MF 1SM3L 2ZJSH 4ODUB 3U1SH 4YHNB 5B39A 3NGBB 3ARBB 3IXTB 3MLVH 4UDTA 4BK5A 3P4MA 3DETC 3HAEB 3ZDXF 3HE6B 5BS0A 5BW7A 1BAFH 1L0YA 3MLPA 1XEDA 1FV1A 2QHRH 1JV5B 1NUNB 2ICWA 2L7UA 4FQIH 1YY8B 1BVLA 1K6QH 3SCMA 4KGJA 5KS9A 4QKXB 5AZEL 1WZKA 4Q0XL 5D1XD 2EH7L 5IK3B 5D7IA 1AP2B 5DMYA 4FFYL 3BDBA 4ONGH 4XZUB 3U7YL 4PFEA 5GRVK 1UB6A 4PJGB 4QTIL 3DVFA 5FYJE 1MFCH 3U36B 1IAMA 4JVUA 1A6ZA 4XPFL 4X5XB 5IB3A 1F6AB 1Z2KA 1JTPA 2ZP0T 3ZE1E 4G6FB 4Y4KD 4JZJA 1TTUA 4W6WB 4YX2H 4PBVC 2NXYD 1TVBB 4XC1H 2O5YL 3KHOA 3LQZA 1YEEH 2VDOL 4PBWD 3QJHA 4GQ9L 3GNML 5IB1B 1KB5L 1HSAA 2D3VA 1RJLA 5FO9A 2EYTA 3VXSA 1QSFD 4F7CB 1G1CA 5TE7L 3ULUD 3T0AA 1BJ1H 3I6KB 1NJ9B 2FL5B 2YR3A 4ODWA 2SEBB 3CDGB 3BRFA 3SQOH 1RZ7H 3GSUB 5CEXB 4CMHB 1U8NA 5HHQA 1M4KA 2VOTA 4BYHA 3MNVB 3B5TA 4HT1H 4QRTA 4GS7B 3LD8B 1ZHNB 2FJHA 4G7VL 2V2XA 2BXYA 3NTCL 3ILQC 1W72B 3NN8A 1FSKB 3OX8B 4KRPB 4MNHA 3ILQD 3ULUL 1T83C 3KPMA 4JJ5A 4LEXL 4PJ9A 1A6ZB 4ZO8A 1ZEAL 2WUCL 4K7PH 1KG0A 4R90H 5CJBA 1BMGA 1PY9A 2A6IA 4QXWA 4JO3H 3C08L 4U1SB 2I60L 3SJVD 1UQSA 3NFSH 4NBYB 4PJEF 5D5MB 4HIEB 3GRWL 4QTHA 4JGMA 3MJ9A 4MS8C 2AXHA 2BERA 1YEKL 1IMHC 4QXUH 3RVXD 3QDGE 2WBJB 4JLRB 1F3DH 1ZEAH 3VFRA 5HHNB 1DBKH 3GM0A 3MRMB 3WV0A 1MEXH 1WV7T 2NY5C 4XB7A 1CD0A 1E4XL 5D71L 1VACB 3R06B 4KJPD 5F9DC 5HHOD 4L8CB 1IGTB 3TT1H 3VFWA 3MLWL 3KJ4C 1I1AA 1DBAL 2CGRH 2YSSB 3BWUC 5ESQB 3IDMA 3DROB 2GEEA 4U6XB 4TQEL 3O11A 5ALBH 4C56D 5J9PA 3DIFA 2JJVA 1MUJB 3QCTL 3V4UL 3VFGL 1WTGT 2X9WA 4IRSA 1AD9A 3QNZB 3WO3B 1G9MH 2X4RA 1AJ7L 4RNRB 2VKWA 3DV4A 2JIXB 5EWIL 2FIRT 1ZA6B 5D7LE 4AG4H 4XI5D 2FEEI 3RBSA 3BP4A 5IB2A 1B0RB 5E2UH 2WIIB 3B2UD 1YEDA 4F7PA 1TZGL 1RZKH 1CICA 4J23A 1FFPA 1XF4B 4YEEA 5F6IC 5TGBB 3X3FH 1JYNA 1ZHBA 2VDPL 4HIHA 5EN2B 1OB1A 3I3DA 2X4QA 2C3WA 1Q94A 3H9SA 3ZT7A 1F2QA 2IH1B 2BMKB 2JB5L 2VN7A 1DE4B 3BJ91 3HC3L 1MIEH 5KAQG 3QQNA 1S78D 2GSGB 4PJAF 4FQQB 1FBIL 4OF8A 5KANI 3LN9A 2MJWA 4PJCE 2BOBA 1BGXL 4QF1B 4X6CE 2HTLD 4PRDA 3NZ8A 4ERSL 5ALCH 1M7IB 1RI8A 4FQHB 4D0DB 3MV7B 1GHFL 1LE5A 4EOWL 1J1XL 4JANB 2WAHA 1FRGL 3DUUB 4ZUTB 2Z92A 2X1XR 3RY6C 4DGVL 1MCSA 1K3IA 4KWUA 4P9ML 2AI0L 1DZBA 1LO5A 3W9DA 1JZ3A 4FP8H 3RI5F 2IAND 3DMMC 2NY6C 2DRUA 2HFGH 1KLGA 2R0KH 4K2UH 4OD2A 4AEHH 3RY4A 1G9NH 1R3HB 1X7QB 1J10A 1FO0L 4N0UA 3BPOC 4RISH 4E5XB 4NKIL 3ULVF 3MLXL 1J0YA 1E6JH 3GSRB 3Q3GA 1YNKH 5T33H 2V2TB 1PSKL 2N4IA 3QXWA 1ADQL 5D1QD 3DGGA 4OGYH 3CFJA 3RNKA 1EZVY 5D7SL 2CDFB 3VCLA 2DBLL 3CLFH 4P3CL 4P57B 3X14B 4MLIA 1EZVX 5HY9A 2IPKA 5IBLC 4CJ0A 1JMXA 2EH8H 1CDUA 5TE4L 1I7ZA 5I18H 4JB9H 4MQ7A 1AGDB 4G3YL 1WWBX 1RULH 3FRUB 4CDGC 5B8CC 5DMJB 3GRWA 5JORA 3MRKB 3UJIL 1QO3B 5I1GL 3VXTA 5ICZA 4IRJA 3N06B 4TSBH 1CGSL 1KULA 3SE3C 3ZLQC 4QT5A 3X14A 2R15A 1AKJA 1JK8B 5HI3C 2WZPD 4OBRA 4Z76A 3P4LA 4HWBL 1DVFC 1JGUL 2A6KA 1IQDB 2OR7A 4I0PC 1WF5A 3IYLW 3U79A 5GS0H 4NO5B 1EGJL 1FCGA 3VI3F 3UPRA 2VDMH 5KVFL 4EEEA 4JZJC 2D7NA 3L3KB 1IAIH 5C08D 1YUHB 2V7HA 5DJYA 1IGMH 1EEYB 2HN7A 2WLZA 4P2OB 5ERWB 4DEPC 1ORSB 3MACH 4F9PC 4OZHB 2E6JA 3ARTA 5L8JB 4QGTA 4PG2C 2ZG1A 5IR1A 3PP4H 5HJ3A 1YEGL 3WCYA 5KVEH 1U8HB 5D9SA 4MA8H 1SHMA 1FAIH 1H8OA 2FSEB 2VQUA 2WIMA 3T4AA 4LSTL 2XXCB 5EFIB 1P1ZB 1NCAH 5I1LA 3IAGC 1YJDC 1NDGA 5JW4Q 4F37F 4Q7DA 3I02B 5D2NB 3BQUD 3HR6A 5FGCB 2EC9T 1T5XB 3RWGA 2MPAH 4UB0L 3O3AB 1VFOA 4JDVB 5TDPA 4PJIA 2H26A 4Y0GA 4XAWH 1OTSD 2LV4A 3BI9X 1I1CA 5DO2D 5DUPL 3LMJH 1FFNA 1JGDA 4WI7A 3VD5A 1UH3A 2HLFC 2JB6B 3G5ZB 2Q7NA 5I1LB 4GRLA 3VRJB 4JANA 3WLWC 1W8OA 4X4YB 1MCRA 4LKCB 4NM4H 4O2CA 1S8DB 1MRFL 1WCQA 3KPRA 3IRZA 3IFOA 1XGYL 4OZHA 1BLNB 5JXAH 1RZJH 4CADB 4PY8J 1FVCB 3GO1L 3DO7B 3OJVC 3EO0B 5MEQB 4FQ2H 5DTFB 4M03A 4OLWH 1BZ9B 4Z0BL 2F54A 3DYOA 3C8DA 3BPOB 4NWUH 3VMNA 4QY8B 5ICXB 4F7MB 5L6YL 3CXDL 3HLAA 5DK2A 1FFPB 3IETB 3N9GL 2V9TA 1QBBA 4RGNB 2A77L 1RHFA 3AB0B 5FKAA 4OM0H 4M61A 3NVQA 2XWTA 4EDWH 5KN5A 2LU7A 3IXAB 2ZZUT 1KXQE 4XMLL 3T08A 2YWYA 3L6FA 2GHWB 3HNSL 2HKHL 1LNUB 3GIVB 4R0LC 2D0HA 5HGBB 5DJAB 4IRSC 4PRDB 4HJGB 4LLMA 3OF6A 2FDBP 5F9WC 4WW2A 1TVBA 3JBG7 4MLSA 3B9EA 2NY3D 4NPYA 1CL7I 3QUKB 3ZHDA 3BP6B 2YPVL 4HZAA 4JPVL 4YDJB 2GI7A 3V0AC 1LMKA 4PJAE 5E7FA 3PWPD 2WWMC 3BEVA 3EJZC 3IT8D 4CN1A 2OR8A 1NEZB 3C5SA 1YUHA 4GRWH 4BSVA 1HQ4A 4HGMA 1CU4L 5FKAB 4WWKC 2F5BL 3BKYH 3CFIC 3ME0A 5I1DB 4N5UA 1TQBB 2WUBH 1MAKA 1WZ1H 5CJ8A 3TT1L 3VRIA 4KHXH 1EGJA 4R2GD 1PGRB 3FQXA 3SN6N 1CXIA 2FGZA 3L3HB 5GS1B 1D5ZB 4MWFB 4PJ7E 2C4FU 2ZWLT 1P53A 3PV6B 3ARDB 4UBDD 3FT3A 1IGJA 2VMFA 1MFDH 3FT4B 2VLJE 5LBSL 1A1MB 4Y19E 4KVCH 1WFNA 4X9FA 3OKLB 3TWCL 5T3XD 2JCCB 1MF2L 1RHHB 2D03L 4O02H 3TZVD 2DL9A 1B6DA 5ISZA 2BNQE 2BY2A 5HI5D 4YXLL 4F33B 5I1CH 5I1AA 1JPGB 1G0XA 5DFVD 2BNQA 4QHKI 1BOYA 5DJDB 1ZVSA 4MCZA 4IOFD 3V7AE 1F3JA 5BVJB 1OARH 3IDIB 5ESAA 4PJHE 1DTUA 1Y6KR 5J12C 4M7LT 2UWEA 5EO9B 3QJHB 3VA6A 1DUZA 1UJ3C 4MAYC 5JZ7C 1MJJA 5FV2A 2CUMA 5JHDA 4JHAH 1KLGB 1T1WB 4RQQB 1N59B 4ZPTA 2FECI 5DMGC 3DXAD 1P5UA 4G9FB 3QIBD 2H8PB 3IJYA 1FNLA 1Z0MA 4ZUWA 3HB3C 3DSFH 5J89A 5HYJB 1L6ZA 4LOUC 4LLVA 3MRBA 1UB5A 3TVMD 1G0YR 2P8PB 4BUHA 1PKOA 4HBCL 4MZ3A 2NY0C 3W5NA 4JFQB 3C8KA 4XC1L 1DVFA 2H2SC 5DJXB 4AT6A 3BAEH 5L0QB 4K7PL 5LXGH 2W65B 1EAPA 5F7WC 4ZXBB 3JUYA 2ZG2A 1JNLH 1EXUA 3JWOH 3HI6H 4X80L 4ZFOA 5BVPH 3B6SB 4NQDE 4P2OD 2J4WH 5GSRB 2IPUK 3V6ZB 2OZ4H 1FCCA 1T7XA 1IEHA 4NRYA 2YPLE 1CR9L 4KZDH 2HFFA 1F6FB 2G5BA 3MRPB 3QIUA 1R5IA 2AEQL 4LSDA 1X4ZA 3FMGL 4TTGA 2D7TH 1FL6B 4GRLD 4LCCA 3QIWA 4Y2DC 5FYLH 1TJGL 1CQYA 3QUYB 2LTQB 2VDOH 5DLML 3WKML 2BNUB 3K8MA 5GJSL 1CICD 5FEBA 3QNXB 5DK2B 5C6PB 2E7LC 1TENA 1KB9J 2YD1A 2R9HD 4X6DA 4RGMB 3W9DB 3UYRL 1ULVA 3H9YA 1X5LA 5ICYB 3I50H 3KJ4B 4DGIL 2AK4A 1B2WL 1RUKH 1Q72H 1KGCD 4M7KL 2GJ6D 3ALWA 4GAJH 2PTTB 3MR9A 4D8PB 2J7LA 3U82B 1ZT7A 4YHZL 4HWEH 4JKPH 3FFCD 5CSZA 5C71A 2P42B 3MLRH 3LQZB 3T4YA 1N5AB 3IKCB 4LLDB 2MSPA 5LQBL 5FHBH 1HXMA 4YXKH 4P9HH 3BP7A 4QWWD 5IMOB 2Z31B 1BZQK 2D7MA 3LIZH 5FUOH 5EU5B 3F58L 3LS5H 4JZNA 3IVKA 1KEML 4Y8DC 5ENWA 4HK3N 5F7EL 3RRQA 5BV7B 3QPQC 5I6XC 1GGCH 1KCVH 5DDHB 3RQ3A 3D9AH 1JYXA 4PRHA 2XRAL 4NM8L 4OLVH 4PP2B 1LK3L 4W4NA 1DCLA 3ECBB 4PJ7F 4RQQA 4OZGE 2OL3L 4LSVH 5F1NB 2MCPL 4U1SA 1X5AA 3BMVA 1YECL 4NQCE 1FFRA 3QULB 1JHKL 4Y2OA 1BVKA 1HKLL 1QVOB 1NAMB 3TA3D 1G7IB 3S36H 4HCRH 4TRPL 3QYCA 2AJ3A 4UV7L 4B41A 3BKYL 1SMAA 1T66D 4XPTH 3PGCB 2FHCA 2A6KB 2A83A 3FT2B 1LO0H 3FQNB 3UPCA 3WS6C 3VMOA 1J88A 5C9JB 2X7LA 3SKMB 1FO0A 2J8UF 1MI5B 1DFBL 1JGEA 3KYMA 1V05A 2QTEA 4LKXB 4XNQA 2F53A 2K3TA 1FL3B 4OZ4A 4HDIA 5F8RC 3KPPA 1ES0A 3L9RB 2UZYB 5IVOA 4GBXA 1DQJB 2IGFL 4BUGA 2FBOJ 4JFDA 3UPAA 5D4QA 5DC9B 2C1PA 3ARXA 4K8RL 3KPLA 4R2GC 1FFQA 1EX0A 3OJMB 2QKIA 2WINB 5B3JF 4KFZC 3QQ4B 4FQLL 4GLRH 1QRNA 3ZYOA 3P77B 3SDXB 4K71B 1QLEL 5A2JH 4BSWB 3HI5H 3PHQB 5ID0B 4ZAKA 4X6FA 3BQUA 1MWAH 3UBXG 2R2EA 5MI0B 5EUOF 4DOHE 5DRXA 3E0GA 2BVEA 2J4WL 3RIAK 2DMCA 4YZFE 2PYEB 3EJZD 1DL7H 3LV3A 4DKFL 2GUOB 2I24N 5KSAB 3VE0A 4LSUH 3GO1H 2BHUA 3SPVA 1G6RA 1J0IA 3ARZA 3MGTB 4C4KO 4LNRA 4EN3A 1WICA 5KG9B 2KL6A 1ZHKA 2OQJB 4LSRH 5AWNL 2GSIA 1B4JH 3N50A 4CU8A 4RMQA 4UQ2A 5E2TL 3BGFC 3VXUD 4BQ9A 4JFZL 3BT2H 3GMLA 3MLYL 3C60B 3B9DA 2Q86B 1QRNB 2XICA 4XP1H 1HXYA 2WBKA 1FE8H 4LLWB 5GS2D 3AFLA 4XCYA 4HJ0C 3UJJL 3WS3A 3BQUB 3GJFK 2EE6A 1KCRL 1R3HA 1YEHL 4NP4H 2H9GB 3GB7B 2FCBA 1F8TH 1P1ZA 3UX9B 3FJTA 1JGVL 4P4KB 4HBQA 3MLUH 1N59A 4ZPTB 2ADJA 1OAZL 2P4AB 1N5YL 3U0TB 1VDGA 2Y06H 2CUHA 3NIGE 3OJDA 4WW1A 4MDIB 4HIJB 3VXQB 1U8LB 5EO0B 3TIEA 1KB5A 4MAUL 4I4WB 1LP9E 1FN4A 3WNMA 5IHUH 4GRLB 5TE6H 1JPSH 4LCCC 3RX7A 5B38A 3A6BH 5C0EA 2X4TB 1KTDA 2DQTH 4YDKL 1RU9H 4ODXA 4OFIA 1GGBH 3GZKA 4G8EA 4LARL 3ZKQD 3SDDD 2JCCA 2UZIH 3WNKA 4KHXL 4N0FB 5TE6L 4FABL 4M7JL 3LEYH 1AXIB 5CMAA 3SE9L 3LAFA 2IAMD 1WEJL 1HYRC 1MY7A 25C8H 2F8VA 3HG1E 3WKNA 2I5YL 5SX4I 3UYPA 5ERWA 3WIHH 3I75B 1DLHB 4U1MA 4EOWH 2CXKA 5IB5A 3PXJA 3OKDA 3EOTH 2V2TA 3C6SA 1U6AL 4KU1A 35C8L 3D39B 3QEQB 4NQED 2NZIA 1OWRM 3FOMA 4LCWD 3QAZC 2VWEC 2MQCA 4PJ9B 5EB9A 5EC2A 5FIEA 5J56B 2BVYA 4P3DA 3WIHA 1UXSB 1M6OB 2VB5A 4LCIL 4KK5D 3SO3C 3G04A 3ELAT 5HGAB 2I5YH 4P46B 3WNPA 2W0KA 5J1AB 5HI3D 4OIIH 5IJVA 3O3AA 4AEHL 4D9RD 3BGMB 3MNVA 3QUMA 1QP1A 3ZDYF 3RWJA 3I3BA 4D0BA 4MXQC 4GRMB 1P4LA 5DZNA 1CE1L 3F62A 4PLOB 1OCWL 2ZUSA 2RQ8A 3LKQA 5ETUA 2H3NA 1S7UA 5IM7B 1KYOK 1NC4A 3W11C 43C9A 1KELL 5D7KE 3ARVA 4ZNEE 4R7NB 1UQSB 5GS1C 2DF3A 5FO8B 3GK8L 1A3LH 1CLZH 1KJVB 4K7FB 4ZS6D 1KIQA 1UB5B 4HC1A 5DHYA 1WTLA 2ITDA 2VLLA 4EIZC 2HJFB 1J0ZA 1X7QA 3WS6A 4XBEH 4FABH 2R2HB 3QO0B 4RWYH 5TQ2H 43C9B 5EC1B 5DMKA 4ZFZA 1MI5D 3MLTA 2J6EA 3T3PF 3CUPA 5HHOE 3K4ZA 4X9HA 4PRPA 1QSED 4OD1L 2FHFA 3TH3T 3O9WD 5E2VL 5GSRA 4FXKB 1NEUA 1UM6H 3W0WB 4DWHA 3W39A 3CFEA 1MRCL 5EG6C 2DBJA 3T1FB 4YQXL 3BW9A 3SGEH 4PJ5D 3U0PB 5CP3H 3X13A 1JP5A 5EOCH 3UTSB 3AU1B 3RGVA 4YDIH 5EPMA 3PV7A 4HUXB 4MA1C 1OGTB 3AY4C 3MV8E 4ZOCA 5GGSB 5FUCE 4PYHA 1IKNA 2YUVA 4HUKB 1ACZA 3WFHA 1A14L 3PDOA 1LD9B 4IDLA 1F4YL 4NIKB 2Q7YB 4IRZH 3ZSTA 4YDLC 1NGQL 4UIMA 2W60A 2I07A 3VGAC 1MFEL 1LO0L 4TTDD 1QZ1A 2EDYA 3EFDH 3U4EB 4ODHL 3TLRA 4NQEA 3MRMA 1GPOL 2Z8WC 2EZ0D 5C0IA 3TPKA 5DD0L 1HH6B 3MRQA 1A64A 3VFUB 2EZ0C 4XNYL 5DTFA 1I9IL 4ZUWB 3BZ4B 4QOKB 2HWZL 4XP1L 1IGCH 4N5EC 4CNIA 5A2IH 4LHUB 2VDQH 2VLMD 2R56H 3T0EC 3D2UA 2BC4A 3GB7A 5EUOE 1WC7B 3BT2L 2HG5B 1XGTB 1WZMA 1CXLA 1KJ2H 4XI5C 5IMLA 3ULSB 2PXYC 5IBUB 4PJBA 4JFEE 3BRDA 3TJEL 5T3ZH 3S88H 1MH5B 3ULUE 2A6DB 3GBMH 2AV7A 1QFOA 3NACH 1LEGA 4NUJA 4JN2A 1T1XA 4PRID 4RMRA 5T1KA 2H32H 4MJIB 2NXZC 4X6DF 4YX2L 5I1JH 1J05B 5IOPA 3MRDA 1MQKH 2LVCA 4X9IA 4Y1AB 5I18L 3V2AR 5IMMA 2EH8L 5CEYB 3ZDZE 5GRWA 5CZVL 1OP3K 5C09A 3GUTA 1G6RB 1CGVA 3GSVA 4XNZC 4OCRH 4ZDHB 1XF4A 5BZDA 1A7PL 4P5TA 3MUJA 5BS0D 2KZ1B 1ODAA 3N85L 3C8HA 1AGBB 4MD5A 4AJ0A 1J5OL 3A67H 4X6CF 4P4RB 3VFPA 1LEIA 3VXSE 4TPRL 1C16B 4OZFB 3MNZA 1KIQB 1TJHH 3KR3L 2VIRB 1U8MA 4UV7H 1MCPH 4OB5L 5DQ9A 4LPCA 2WSKA 3FO0H 4RFNB 4U1GC 4M8QB 3C6SB 4FP8L 4S11A 4WFGD 1IM9A 2NYYC 3UYRH 1E0OB 1MAML 5F44A 3WFCH 1CICC 5JA8B 3OHXB 1U93A 3FO1A 4XZUA 5D93B 3MJ7A 3RAJH 3ZL4L 3S5LG 2OSLA 2BVPB 3GSVB 1EJOL 4GBXB 4NM8H 3BX7C 1TZIB 4KXZI 3MROA 4NDMB 1K8IA 3QEHA 4F7CA 4DTGL 1JWSB 4J3UA 4P2OC 4QEGA 4DEPB 4OCRL 2AEWA 5DMIH 5DVKA 3SOBL 3RWIB 4KJWD 5FB8B 2VE6A 4K3DL 4GRLC 1UZ6F 2R23B 1DDHB 4CRPA 4RAUB 1G9EA 3KYKH 4PJ9D 2C4FT 3NACL 1XF5A 1T3FB 4LU5H 4V1DD 1FZKB 5DHYB 1BD2A 1B88A 2PKDA 1BPVA 2F5AH 2WWKO 2EEDA 1WFOA 1HCFX 2QBWA 4B7IA 4NQCB 4M7KH 1CXFA 4ZFZB 5DMKB 2I9TB 1WC7A 4U0QB 5E4IA 2FHBA 1XGQB 2VDQL 5ALBL 1R5VB 4LVEA 2GITA 4F57L 5DA0B 5JUEL 5MERB 3TBWB 4U1LB 3C09B 5DHVB 4X8XA 4OF0A 3SGKC 5GGQL 1JGEB 4X5WB 5C0JB 4KRLB 3MXVL 4AT6B 4DGYL 1PG7L 4LGRB 4NCC1 1FH5H 5E56A 2Q8AH 5ANMA 1KIRB 2ZOLA 4L5FH 4HEME 5DMGD 1RFDL 4OFPA 4QOKE 1RIUL 5IMOA 3AREA 1CI5A 5I1IH 4U1LA 4XC3H 3D3VE 4A6YB 2E27L 1IL1B 2GIYA 2VLKD 4GRMA 5FCUH 3KYNA 4XNZB 5HYIA 1A4JB 1SVZA 3QDJA 3AS2A 1S3KH 3RGHA 5EBLA 1I9RL 3HUJA 4L8DA 3GIVA 3QPXL 4G6AC 1T5XA 4M43L 3BDXA 3KS0J 5HYSB 2EE9A 3HNTH 2XA3A 1C5CH 1E28A 4GAFB 3TN0A 3F7VB 1KCSL 1U8HA