4BA8A

High resolution nmr structure of the c mu3 domain from igm
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
102
structure length
102
Chain Sequence
MGDILTFTIPPSFADIFLSKSANLTCLVSNLATYETLNISWASQSGEPLETKIKVMESHPNGTFSAKGVASVSVEDWNNRKEFVCTVTHRDLPSPQKKFISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IG MU CHAIN C REGION SECRETED FORM
publication title High Resolution Structures of the Igm Fc Domains Reveal Principles of its Hexamer Formation
pubmed doi rcsb
source organism Mus musculus
total genus 16
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ba8A00
3S97C 1AJ7H 1KIPB 1UKTA 2HVJA 3BZ4B 5C09A 1KPRA 4CVXA 3B9KC 3T8XB 3OG4B 5D71L 5BOPA 3RBGA 3PWLB 3KLDA 3MLWH 4M62L 1HH9B 1ZS8B 3SE8H 2KL6A 3HZKB 5HYJB 4M62H 2VR9A 1LMKA 3GSOA 2WW8A 4JQVA 1NLBL 1S9KC 4YHLL 1G9ML 1TITA 2BX5A 3TA3A 1NLBH 4YHLH 2J7LA 1QA9A 1ZHNB 1G9MH 4JFED 5T3ZE 5IB3A 3WJLC 3P11H 5D7LA 5I76B 1VACA 4YC2C 3ULVL 4DKDC 4XVSL 2DDQL 5F9AC 3VXUA 5JNYA 3ORJA 3O6FD 1UXWB 1WZKA 3TJHD 4XVSH 2DDQH 2FNBA 2A74A 1CGUA 2YPLB 5CP7A 4WTZA 1QLEH 5B38B 1OY3B 4QRRB 1YPZB 3K8LA 4LNVA 2R4RL 4HWBL 1GSMA 3QHTC 4ZTOH 2R4RH 3QO0A 2YUVA 3MNWA 4UUJA 4BKLB 1AHWB 4ODTH 2AV1A 4XP9L 1L0QA 5DS8B 4PGDA 1MCFA 3IDIA 4DJMA 3LKRA 2NX5E 3LMJL 1CI5A 4N9OB 4QRUA 4QYOA 3ZHLA 2I27N 1V7NH 1HHGB 3X3GL 4YXHL 2QTEA 4X7EC 2PR4L 3I84A 5IB1B 3UDWA 4YXHH 1L6XA 1JI1A 3V5DB 2XWJB 1CFSA 4PTTB 2N56A 4K3DH 1WK0A 1ZWIB 2IQ9L 3B8YA 3BPNB 4XPBL 4ZTPL 5KOMC 4CVXB 2HVJB 2CMRH 5C09B 1KPRB 4OZGE 2IQ9H 4XPBH 1L7IH 3LKQA 4ZTPH 4J6RH 4C55A 4OM1H 3PHQA 4ZS6C 3GSOB 3DLQR 2EKJA 3O6LL 4X83A 4Z7OF 3TA3B 3QFJE 4Z8FL 4QXTA 1ZANL 3O6LH 1QA9B 1TETL 5IB3B 1KB9K 4EIZC 4Z8FH 4PRPD 1O0VA 5D7LB 1V8HA 1TETH 4PJ8C 3VFMA 1VACB 1ZLUH 3MRRA 5EDXA 5KN5A 3TV3L 3VXUB 5JNYB 3NBNA 5D1XC 4TQEH 5I9QB 1FH5H 4HLJA 5MEQA 4WVRA 4XTRD 4HIIA 2A74B 1MCBA 5CP7B 1LO0L 4XBGA 3WNPA 4OD3H 3SDDD 1SQ2N 3C6LA 3C6SA 2NMSA 1EZVY 2Q3AA 5FDYA 5GZNC 2DQUH 1G9NL 3ARSA 3NCCB 2V2TA 1G9NH 5JUEL 4OZHF 4GBXD 1QHOA 1J1OH 1WVZA 5J0BA 4Y7MA 3L3DA 3KR3H 3MNWB 4UUJB 5B4MC 4HKJA 2AV1B 5IMOA 3F6IA 4PGDB 5C0GA 3IDIB 3LKRB 1TPXC 4QRUB 3SGDH 1IARB 3R1GL 5EO1A 3T2PA 4QYOB 3OAUL 2H6PA 2JJVA 4NWTL 2FRGP 4DKFL 1YEKL 3OAUH 1BJ1H 4NWTH 5HHOA 3DMMD 3IRPX 1CFSB 3KLHD 1I8LC 3GGWA 5GRJL 1OCWH 4NKDA 4XPFL 3PWPD 1OQXA 3LKQB 1MCRA 4NZJA 5GRJH 5DHXB 5EUOE 2CXKA 3PHQB 1N6QL 5F70A 5K9JH 1JUFA 1IILE 1WBYA 4C56D 4LNRA 5CUSL 2FBJL 1N6QH 3AGVA 1T21A 2YPVL 1LO4L 4QXTB 4HULB 1W0YT 5DD5L 5CUSH 4MZ2A 5T3XH 4P4KA 5EFIA 2YPVH 4O4YL 1LO4H 5E6IC 1MJ7L 5DD5H 5FUCC 1QFWM 1BWMA 2O5XL 3VFMB 3MRRB 2XKNA 1MJ7H 4M8VA 1WGOA 2VKWA 3Q6GL 5KN5B 4OB5L 3OKKA 3Q6GH 1KV3A 5MEQB 2E6PA 2J8OA 1GL4B 1RFDL 1WITA 5FB8A 4OB5H 4HIIB 4J4PD 1VDGA 5FGBA 1GC1H 3D48R 3C6SB 3C6LB 4WFHE 1DP0A 3BFOA 4LF3A 4GAYA 2FGZA 4TPRH 1JTTA 4WWKA 5E9DA 2GJ6D 3SCMC 3TN0C 1GOGA 2V2TB 4X9BA 3L3DB 4RGOL 4FFWD 4DW2H 3M1BA 4HKJB 5IMOB 5CZVH 5C0GB 1QSVA 1IGCL 4BZ1L 4M7ZC 3VXRE 1X5IA 1IZJA 4NGHH 5EO1B 1IGCH 4RAHA 2H6PB 4P5TD 2ICCA 3IDYB 4YBLB 5DC4B 4LKXA 5DFWH 5HHOB 4N68A 4TSAH 4UDUA 1G7JA 5IMLA 2I9TA 1WCBA 2YA0A 4OFDA 3GGWB 3O6ML 4NKDB 1U95A 1RUAL 3QIBD 5I8OL 4MB4A 3ZHKA 4NQTA 1FZOA 3MREA 3O6MH 4Z0BH 2ATKA 3WD5L 2ZUUA 1JUFB 4XMPH 1WBYB 4LNRB 4DZ8A 2IGFL 3WD5H 1T21B 2HKHL 4YE4L 4W6XB 2IGFH 2JB6A 3VRLE 2HKHH 2VH5H 3G5XA 4P4KB 4R4BA 5EFIB 2P5EA 2J2ZA 1B88A 1CR9H 2XN9A 2G60L 4HZAA 4PJFE 4NSKA 2XKNB 1IC4L 2G60H 2GJZA 1G7IA 2YA1A 3QJHA 1IC4H 3O9WC 4KTEL 4FZ8L 2YXFA 3OKKB 4P5KA 1MCOL 4PD4J 4DCQA 2CKNA 5FB8B 1WFUA 4KTEH 4FZ8H 4YGVA 1MCOH 4M7LT 2AEWA 3BD4A 4HWNA 4PRIE 3QUZA 4WHCA 4LF3B 1GOFA 4GAYB 1GGBL 4WI6A 1UKSA 1HIML 2OMNA 3FO0L 4XVTL 4WWKB 1FYTD 2FBOJ 5E9DB 4PJGA 2YXMA 4N8VG 1HIMH 2PCPA 1M71A 5BZDA 3V8OA 4C54A 2VC2L 5GGTH 3M1BB 1K85A 3TH3T 3LN5A 4DKAA 4LLQA 5KS9E 1VCAA 2FX9H 3ZE0F 1YYML 2VC2H 3VXSA 1HE7A 1MH5A 4U0RB 2XNAA 1P4BH 3WFHA 4EXKA 1FAKT 3ARTA 5D6DA 3B9KD 3PP3K 5BMFL 4UILL 4LKXB 2VDRH 3LN9A 3SGKA 1TJIL 1EAPA 2CRYA 4W70A 4KKLC 4UDUB 1QHPA 1ZVSA 1TJIH 4LEXL 4L4JA 1G7JB 3GBML 4ONHA 5IMLB 2I9TB 1WCBB 2ADGA 5D2LF 2CDEB 2R2EA 1U95B 3C2AL 3V6ZA 1IM9D 1AXTL 1TJGL 3PGFH 4OTXL 3T0AA 3OPZL 1FZOB 3MREB 2ATKB 2VDPH 2NY6C 5C0JA 3UYOD 4DZ8B 4OSUL 2HAZA 5T3ZD 2CO6B 1DEDA 5F7HA 1EJ6A 2JB6B 3G5XB 4R4BB 2P5EB 4L9LA 3C5ZC 1H9VA 4UBDD 2VDKL 2XN9B 3MYJA 2W07A 4ZMAT 4DEPB 1FCCA 4NSKB 2Q86A 5JXEC 4X6CA 2GJZB 1NH6A 3UTTA 4LLAA 5KJRH 1G7IB 3QJHB 5ICYA 4P5KB 1FFNA 3ZYOA 3V4UL 4DCQB 1AO7E 3LPGA 4YGVB 3X14A 3G5VA 1EFXA 3QUZB 1AGBA 1EEQA 3CX5J 1PDKA 4PJGB 2UZXB 1U58A 5IQ7H 4PY8I 4GOSA 1M71B 5BZDB 3MLTA 4DUWA 1QG3A 4HT1H 1NEUA 3LN5B 4LLQB 2NX5D 4TUOA 3VXSB 3SO3B 1MH5B 1S7QA 2XNAB 3D85A 5BV7L 3WFHB 3JVGA 5BV7H 5JXAL 4ZPVA 3EYFA 2NZ9D 4K94H 1EAPB 4ZS6D 5JXAH 5CBAA 3ZDZF 2R39A 1ZVSB 1MRDL 2EKSA 2ICEA 4ONHB 2ADGB 3A0OA 1NBQA 5DZNA 3MGOA 2R2EB 1YNLL 3V6ZB 4AEHL 5GGTA 2KBGA 5CBEA 1YNLH 5F89A 3AROA 5ERWA 3NN8A 4KI5F 5C0JB 4R2GC 3SO5A 5D1XD 3QFJD 2X4UA 5CD3A 4IRZH 3OKOA 4L9LB 1CDIA 1Q72L 3RUGA 2WLZA 3MYJB 3OF6D 2Q86B 1MIMH 5GZND 4UNVA 1YPZF 4X6CB 3UTTB 5ICYB 4OI9A 4N0UE 1FFNB 5E56A 4DWHA 4AZ8A 2NTSP 5GSVA 4JKPL 3X14B 1MCIA 3CCHA 3G5VB 1EFXB 4K3GA 3BSZL 4JKPH 2A6KA 4OZIA 4OBSA 1AGBB 1CD9B 3BSZH 2I25N 4R0LA 4RA3A 4G8GE 4JHBA 5INCA 1U58B 1YNTA 5ADOL 4YDIH 1QFUH 2NYYC 3MLTB 4MJIE 1INDH 4P46A 4AIZA 3O3AA 2IEPA 2YD5A 4NUGH 4TUOB 3D18A 4NQCA 5ICXA 3VRIA 1S7QB 3D85B 4D0DA 1RUMH 5IUSA 2UZIH 3RVTC 4OI8A 5HXMA 4ZPVB 3EYFB 4DUXA 4TNVK 2VZTA 1XCQA 5CBAB 5EZOL 1A14L 3E8UH 4J3TA 2ICEB 2ZSWB 1G9EA 3MGOB 3ZL4L 4PJHE 4GQPH 1WJ3A 5F88A 5F7FA 3AB0B 5CBEB 3N1PC 5F89B 5ERWB 1CIUA 3O3DA 3NN8B 1JZ4A 2FB4H 3V4VL 4H8WL 4XI5C 2AXJA 2M2DA 3MRJA 3V4VH 2X4UB 3NFPA 4NWUH 5CD3B 3OKOB 4WV1C 2FEDD 3GNML 4LSUL 1DZBA 4ORZC 5DRXA 3GI8L 4LIQL 3RUGB 1OP5H 3TF7C 5CJ5A 4PJ7F 25C8L 4LSUH 1QSFA 3WUWA 4LIQH 3WXVL 2VDMH 5HGDA 3WXVH 3N85L 2PW2A 3PHOA 5I1CH 2X09A 1WIPA 4OZFG 3L5WA 3N85H 5GSVB 5EU6A 4WFHD 3CCHB 4Y4KD 3QG7L 2APWA 4FFZL 5FM4A 3V4PH 5ABDE 2A6KB 4OZIB 5D2NE 1MFEL 4U1MA 5HDLA 4R0LB 2HLFD 5INCB 2EC9U 4L4VE 2P46B 3V95A 4P46B 4AIZB 3O3AB 4H1LH 1OW0C 4P99A 2NXYC 3D18B 4FQXC 4NQCB 5ICXB 3VRIB 4AH2A 2ZCLH 3MLXH 2COQA 2DQJH 5HHXL 4PJIE 4C58B 3B2UC 2DQGH 4EI6A 4MA7L 2BXYA 4ZO7A 3U9UA 5HHXH 4QRTA 4RFNB 1XCQB 4MA7H 4DZBA 3LKNA 2ZUYA 1BJMA 4EUPG 3I2CH 2ILLA 3PP4L 2QSVA 1U42A 2YUZA 4BUGA 1P9MC 2AXFA 5F88B 5JOEA 1SY6H 2ITCA 3O3DB 4O5LL 5E7FA 5HGGS 4X8JA 1MCDA 3MRJB 4KPHL 5CEZL 2O61A 3NFPB 1KLUA 4KPHH 5CEZH 2ICWI 2AJSL 5DRXB 1J1XH 5D72H 5DMGC 1QSFB 3DGCR 3WUWB 1VGEL 2M26A 3PL6A 1O5DT 2GIYA 5HGDB 3TGXA 2OZ4H 1IQWL 4DGIL 1DBAH 1VGEH 2PW2B 3PHOB 4AY0A 4AT6A 1IQWH 1HYSD 3L5WB 1ADQA 4MCYA 4PRID 5EU6B 1RZKC 5D4QA 3D0VA 4KMQA 3ARGC 4XP5L 4U1MB 4HIHA 1CFBA 4K9EC 2VL4A 4I3RH 5DJCA 5DRNA 4ZFOL 4IRSA 2I24N 1F6FB 1DQLL 4PS4H 5K59E 4NN6B 1V3JA 2XQBH 4GKNA 3GRWL 4AH2B 1H3TA 4A2MA 1UWGL 3IGAA 4TRPL 3QDGA 1HQRA 4ZUSA 3MXVH 1KN4H 3BH8A 4EI6B 4R97B 3U9UB 3SBWA 4QRTB 2ZNWA 3UC0H 4I48A 2NY6D 3OJ2C 4GXUM 1AHWC 4DZBB 3IDGA 4DAGH 3IFLL 3LKNB 1I3VA 1TJHH 2ZUXA 1S7SA 2VN4A 3IFLH 1LQSR 4UAOC 3ARPA 5IIEA 4NC2B 1HILA 2AXFB 2HJKA 3MLSL 2ITCB 2ZKHL 1Z9MA 3O3BA 1JWUA 3MLSH 4LVHB 4OD1H 4X8JB 4LRIA 4HXAL 2O61B 1MFBL 5FK9A 4ALAH 3I3DA 2YD1A 1RIVH 4LHUG 1KLUB 4MNQA 4HXAH 4M8QA 1VGKA 2X7LA 4GRLA 4RISH 3BPNC 3MBEC 5HGHA 5CJXA 3RAJL 2KUTA 3PL6B 2BXZA 2EH7H 1AO7D 5SV3A 4AJ0A 3B5HA 4NBXB 5C8JA 4AT6B 2D0HA 1D5XA 2V7HA 1IKNC 4MCYB 5E8EA 2AKRB 1FC1A 4OM0H 1SY6A 3D0VB 1MFAL 4JY5H 3OJMB 4HIHB 1MFAH 2P5WE 3P0GB 1DBKL 2DN7A 2Y06L 4Y16A 1LP9E 3RU8L 5DJCB 5DRNB 2VR5A 5I9QC 4IRSB 3GSUA 5EPMA 1FVDA 1RVFH 3LDBB 4OCYL 3H0TA 1PSKL 4LKCA 3D87B 4GKNB 4CGTA 5T1KD 3DSFL 2OZ4A 3IGAB 2RFXA 3QDGB 1HQ4A 1ZE3C 1V05A 3DSFH 4M5YL 4WCYH 1HQRB 4P9ML 4ZUSB 4LRNH 4EXPX 3BH8B 3CNKA 4H20L 2L4OA 4NQDA 3UMTA 4I48B 1CIDA 4NO3A 3IDGB 1S7SB 3E2HB 1NFDA 5IIEB 3U0WL 1BP3B 5HHPA 1EEZA 2BFVH 5DK3A 1HILB 2HJKB 2B0SH 3U0WH 3QZWA 2CKBA 1MCSA 1BVKA 5I1HL 3O3BB 1JWUB 1BVLA 3X13A 4K3EL 5FK9B 1BD2E 1IGFL 4K3EH 5H37H 4M8QB 2X7LB 3S3SA 4GRLB 1Q1JL 4ZPTA 1BLNA 1IGFH 5HGHB 4I2XE 4NC1E 2M8XA 5C0RL 5JIKA 4E5XA 1HKLL 1TCMA 3KNBA 1IL1A 3IU4H 5J12B 4HFWA 4PJGF 5C8JB 2V7HB 1D5XB 4OT1L 2VQ1A 4Z7WA 2NYYD 4Y2DA 43C9B 4RMWA 4FQIH 1ZGLM 4S1SH 3MJGX 2WINA 5DJ6B 4QTIH 1C8PA 1UT9A 4G8GD 4ONGH 4PGZA 3JUYA 4Y16B 1B0GA 2QL1A 3RVTD 4MJID 5I1DA 5EPMB 3GSUB 3NH7L 1FVDB 2QLVB 3QWRD 1ZKAA 4Y0GA 3H0TB 4LKCB 3DURA 3L5XL 1UENA 2ARJA 3NIFE 2OBGA 2GFBA 2RFXB 1HQ4B 3L5XH 1U8MA 5CINL 4NQVA 3CVHL 2LVCA 5AZ2H 3IS1X 2P49B 3CVHH 4NQDB 4OFVA 4PB9L 4KJWD 1X44A 2UVEA 4NO3B 2R8SH 2ZCKL 1V3LA 1SJHA 3QEHA 1NFDB 4QO1A 4NNXA 1J0HA 3BH9A 1VFMA 4WUUE 3VFGL 4H26A 1ZK9A 5HHPB 4KGLA 1EEZB 5DFVD 2FGWH 4POYA 3VFNA 3QZWB 2CKBB 1BVKB 2X44D 3B9EA 2YKLL 3WIHL 1HH6A 5HI4C 1BVLB 3X13B 1EEUA 3WIHH 2VLRE 3MLRL 3OJDA 4PJDA 4G43A 4ZPTB 1BLNB 1F90H 1QSZA 3MLRH 4Z7NF 1KJ2A 4JY4B 5ADPH 3MROA 1EHXA 1P7KA 4E5XB 4MAUH 3E0GA 3BPOB 3KNBB 5KTEL 1IL1B 4HFWB 3HNVL 4CUCA 2Z92A 5JW4N 5KSAC 2JCCE 2VQ1B 3WHE1 4Z7WB 1ES0A 5KTEH 4Y2DB 2EH8L 3HNVH 2LU7A 2EDHA 4G8EA 4NHCH 2YPKA 2WINB 4P4KC 3STZA 3IDNA 4WW2A 1MPAH 4FQCH 3BWUC 5A16A 4YHMH 3CPLA 4BZ2L 4FFVC 1B0GB 4HQQH 4L4VD 5C07E 2XYCA 5I1DB 3CZFA 2CRZA 5EOTA 1MSPA 4WI2A 4P2RE 1BREA 1FNFA 5FGBC 3DURB 3C87A 4LVOC 3KJ6L 2Z31C 3Q0HA 2ARJB 4A6YL 2GFBB 4E9LA 1MCPH 1U8MB 1JHLL 4A6YH 1YQVH 4NQVB 4X6DE 5L9DL 3WDJA 4DTGH 3BQUA 4TULL 4YXKL 2GTZA 5DMIL 5IOPA 3UAJD 3T0XA 5L9DH 3MRBA 4YXKH 4NKOA 3BIAX 5DMIH 1FZJA 5IEKA 3ZHDA 2HFGL 4PGJA 5DR5L 1SJHB 3QEHB 4GJTB 4NNXB 1U8QA 3BH9B 4JN1H 4F7CB 1YJDC 4H26B 4QT5A 2P48B 1FZMA 5IGXL 2OJZL 3VFNB 4Q7DA 3RUGF 1XCTA 4QOKE 5IGXH 1REIA 2CJUH 5HGBA 3RWCA 1S5IL 5ISZE 1U3HD 1HH6B 3IJYA 4W68A 1OL0A 2ZJSH 1C5CL 2VITA 4G6ML 4PP1D 2IF7A 3OJDB 3D39E 4G43B 4PJDB 1IFHL 5D7SH 3QUXA 1IFHH 1KJ2B 3ARGD 4OZIF 5DEGA 3NPZB 2R1YA 4TTDC 1X6LA 3MROB 1P7KB 1T80A 5FGCB 1EO8L 1DR9A 3N06B 3NFSH 2DQCH 2IAMA 3MFGB 1EO8H 3GO1H 2Z92B 1ES0B 2DLTA 5GRXG 5HI3C 1NUNB 4I13B 4FXKA 4G8EB 5FOBA 2YPKB 1MRCL 3STZB 2GYSA 4FFYL 4K55A 2X40A 3IDNB 5FECA 4WW2B 2EDTA 3FB6A 1MRCH 3BGFC 5A16B 5IT2L 3CPLB 3D2UD 3KPRA 1KCSL 5DUPL 5F1NA 1BZ9A 3CZFB 1PG7H 3MJ9A 5DUPH 5CFHA 3S98A 4AIOA 5EOTB 2X1PA 1T0MA 5DJ8A 3DTXA 4XP6H 4LHUD 3QUZC 1VHPA 3P0VL 1FLRL 1PZ5A 1S3KL 3RWDA 5I74C 3P0VH 1FLRH 1QBAA 1S3KH 4LLDB 3BQUB 4S1QH 2GTZB 4ZUWA 5IOPB 3WNKA 3MRBB 3VFRA 4NKOB 1FZJB 1M6OB 1MWAA 5IEKB 1DSFH 1RULL 1LNUA 2K3TA 4XH2A 1U8QB 1RULH 4XMLH 4QT5B 3MBED 1FZMB 1NJ9B 1VFUA 5D6DC 3HMXL 2FECL 4WO4A 1XCTB 5KAQF 3VGDA 4HD9A 5HGBB 3RWCB 1OVZA 4J1UA 3HMXH 4GT7A 1X5GA 1DUZA 2HP4A 3IJYB 1CICC 3SGKC 2Q7NA 1T1YA 1FNLA 2VITB 2PTVA 3F6LA 3HCVA 1B3JA 1KOAA 3S3JA 1EGJL 1R3HA 1T03L 3QUXB 3MV01 4UDTA 2Q8AH 5DEGB 2R1YB 1T03H 4JO4H 4PJCF 3T0VA 12E8H 35C8L 4ZSOE 4NNPL 3HE7C 1OD7A 4HPYL 1FL6A 2IAMB 2BMKA 3MO1A 4ACPA 4NNPH 3WFBH 4EDWL 1GH7A 2BC4A 2XTJB 1MCWW 4FXKB 2NY5L 3CC5A 4EKXA 5FOBB 4XMKL 4BA8A 4L9LC 2P5WD 2NY5H 5FECB 3FB6B 4XMKH 2WQ8A 4CNIB 3ZSSA 4JCMA 3KPRB 5F1NB 2JJSC 4WEBL 1BZ9B 2FX8L 1CXEA 2AP2A 4ODHL 4ISVA 4NZUL 5JW3H 4NFCA 1T0MB 4K71C 5DJ8B 4YHOH 5FGSA 1NFIA 2EC9T 3DTXB 4NC0B 2Y5TA 3FZUC 4KI1A 4CDHA 5K9KA 1PZ5B 1ZVHA 3RWDB 4OFIA 4RDQG 2CK2A 1ZLVK 1KXQE 5IHUL 3TIDA 1AKJD 3WFDH 2JJUA 4ZUWB 4LSVL 1JPSH 43CAA 3VFRB 5IVXA 4I4WA 4LSTL 4LSVH 4OF5A 1MWAB 1IVLA 1LNUB 4QHKJ 4XH2B 1XAUA 2D4DA 2EECA 4AIXA 1RJZA 1BJ1J 5IBUG 3G6JA 1DDHB 3S4SA 2AAVA 4WO4B 2A6JA 1CDYA 1YQ2A 3FB8A 4J1UB 4I0PA 5F9DC 2EE2A 1DUZB 3EOBA 4UIKH 1BD2D 4N5EC 5JR1L 1T1YB 5LBSH 2J8HA 1A7QL 2CO7B 5JR1H 2IALA 1A7QH 1DFBH 1R3HB 2NY2C 3ULUH 1VFBA 5EA0H 3KDMA 4UDTB 1DCLA 3V8CA 1CGVA 3VW3H 4MB5A 5FYKU 5AAWA 2VABA 3BJ91 4HMCA 1U8OA 3EO1A 5CZKA 5C2BL 4OFYD 1FL6B 2BMKB 3MO1B 5C2BH 3IDXL 2J88L 2BC4B 2K1MA 3KPTA 5JA8B 3FAWA 3RI5F 3CC5B 4NIKB 4M00A 3IDXH 2J88H 4KY1L 2V5SA 1C7TA 1DVFD 4IRJA 1EO7A 2FEEL 2HT4C 1U8LA 2H32A 5CGMA 2C3WA 3Q1SL 4FQ1L 4E41E 3AUVA 2Z4QA 1OTTC 3Q1SH 4U2YA 4ISVB 3SE3C 1T0NA 2MPAH 4TOYH 5J3HC 3IETA 1BIIA 1NFIB 2Y5TB 1NFKA 4YHZL 2UWEF 3UTSA 5K9KB 2C3XA 1TNNA 1IBGL 1RJCA 4XNMA 3BN9C 1T5XA 4I18A 1IBGH 3TIDB 4XCCL 1BFSA 1KF9B 43CAB 4P46C 5IVXB 2E7CA 4I4WB 5KANG 3Q5YA 1RIUH 4WUUD 1HEZA 2R2BA 2BZDA 3DUHA 3IJSA 3DYPA 4Y1AA 1JGEA 1RJZB 4BQBA 3PE9A 3G6JB 1GGUA 2H2PC 4N1EA 4M6NL 3CH1A 3S4SB 2A6JB 3FB8B 1T7ZA 4M6NH 4I0PB 2DLHA 3EOBB 1AE6L 4RFNC 1C1EL 2VLRD 4XWOC 5KSAD 4HWBA 4MZ3A 5L8KB 1Z9OA 3MLVL 4Y89A 4XNQA 4ZOAA 1IAII 2IALB 2EIEA 4KQ3L 5INDA 3MLVH 5CAYB 5TDPA 1VFBB 3QCUH 3KDMB 2R4SL 5L2KE 4MDJA 2VABB 1U8OB 4WI7A 3GMNA 3EO1B 4FFVD 4XVUC 4O2FA 1PY4A 3VXQA 3H7LA 1KB9J 3RZWA 3UPRA 4ZUUA 5EOQL 2GSGA 4OI7A 5FCUH 1NEZA 4IRJB 1NCWL 4AENA 4UNTA 5C07D 2E7HA 2EO1A 2Z31D 5EOQH 4U6HA 1U8LB 2H32B 1NCWH 3MA9H 1ZGLA 2J6EH 2Z4QB 3LQZA 1WICA 1EFQA 3DRQA 4P2RD 4XCFL 5IEHA 1GIGH 1U3JA 1T0NB 4BSJA 4HJJL 2BY1A 4P2QA 1JZ8A 1CF8L 2ICWA 5DF0A 1JNNH 4XCFH 3IETB 3BPLC 1BIIB 5F1IA 4HJJH 3W11C 1CF8H 2Z35A 1NFDF 5GRUH 3BEWA 3KPSA 4XNMB 2FCBA 1T5XB 1CL7L 3KPOA 4I18B 5BZWA 3U82B 1MCHA 3PQYE 4RX4A 3VGGA 3FB7A 4U6TA 4R7DA 1FSKB 1Z9LA 1JPTH 1ZHBA 3IDUA 4RGNE 4U05A 1HEZB 4KUZL 2R2BB 4XWGL 5DD3L 3IJSB 1EHAA 4XP4L 1JGEB 4KUZH 4MGXA 3U1SH 3N9GL 4XWGH 5DD3H 4QOKD 2AW2A 4OF3A 4XP4H 1ZLSL 1LWRA 3CH1B 5J7CC 5FXCH 3OB8A 3OHXA 2JLLA 5DURD 3JWOL 1GPOL 4TTDD 1J12A 1JI2A 3JTSA 1ZLSH 4AQ1B 5ISZD 4RGNC 3JWOH 1MCLA 4P48A 3D39D 1HZHL 3DHJA 1TCRA 3QEQE 1PAMA 4XNQB 5HI3D 4Z7WF 4P23D 5INDB 2HTKC 4HW6A 4XCYA 5TDPB 3WL9A 5GPRA 3VE0A 3FQNA 4RNRA 4PIRF 4MDJB 5EOCL 1GZQA 3GMNB 3VXMA 3ARRA 5EOCH 4Y4HA 4OLYL 2DS4A 4O2FB 1QFHA 3FO9B 3RTQA 2UY7A 5C0CA 2JELL 3UP1A 3UPRB 2G5BA 4ZUUB 2GSGB 2JELH 4Q9RL 2Z8WC 1NEZB 4AENB 4U6HB 2J4WL 3CVIH 1YEJL 1ZGLB 1QFOA 4KXZI 3MV9A 4RA0C 1YEJH 3LQZB 1LE5A 1E4XL 5ESQA 5IEHB 2XWBA 4P2QB 1E4XH 1NCTA 2ICWB 4Z95L 5F1IB 1KTDA 4JR9L 2F8VA 3U6RA 2Z35B 4AEIL 4DN4H 2B1AH 4JR9H 4M7KH 3BEWB 3MLYL 3KPSB 4RMSA 4AEIH 1U8IA 4YWGL 3KPOB 2C3VA 3KYAA 1EDQA 5BZWB 3T04D 1A7RL 3FB7B 4GS7C 4R7DB 4YWGH 3RVUD 3DGGA 1KENH 4IRSC 5EC2A 5HDBE 5KW9L 1F4AA 1A22B 1A7RH 3HI1A 5KZCB 2EDDA 1A6PA 2Q1EA 2ZUQC 1CICD 4P49A 1ZHBB 3ILQC 2ERJB 4NZRL 5D5MA 2KQNA 3IU3A 5C7XL 2J6EA 3R0MA 4KJYA 1PG7X 4OZHE 3CX2A 5C7XH 2VSCA 3LV3A 3OHXB 2P4AB 3JTSB 4NKIL 3SBWC 4HMDA 2B39A 4MA8L 1B90A 3HE7D 1U0QA 3U4EA 2Y1VA 2YWZA 3E2HC 1R6VA 3PWVA 1Z3GL 4XCYB 4X7TA 4F15B 1SJXA 5AYUH 3WL9B 3VE0B 3JV6A 4L3AA 3FQNB 5D1ZA 4RNRB 4WW2F 4C83A 1GZQB 3VXMB 5DD0L 2LFGA 4Y4HB 1MOEA 4LRIC 1KCKA 5LG1A 2MFNA 3HZVA 5ALCL 3RTQB 5HYFA 5C0BE 3EFFA 2Y07H 4QLRA 4CADA 5C0CB 2ESVE 1DANU 3LEYL 4GRLC 1A5FH 3OQ3B 2G5BB 3QP3A 1P5VA 4BFBD 1OAKH 3LEYH 1L0XA 1DLFL 3FZUD 3LN4A 4NO0D 4PJEF 5D96B 1IAIM 4F7MA 1DLFH 4QRQA 3WHXB 5J12C 3MV9B 4UI2A 4GAJL 5FV2A 1MCQA 4YK4B 1LE5B 2WBJA 5I30H 1EV2E 5ESQB 2XWBB 3NCJL 1OGAA 1SHMA 1KTDB 4WI8A 3HC0A 3NCJH 3U6RB 2X1QA 1JZ7A 4JN2A 4KRPB 4Y16C 1U8IB 1NQBA 2C3VB 3SKOA 3MRFA 2APTA 4EOWH 3DGGB 5EC2B 3HI1B 5DMYA 2EEDA 1UZ6F 1ZT7A 4K7FB 4AM0A 4MB3A 3TJEH 2AGJL 1SJVA 4KK5C 5D5MB 1MJUL 3IU3B 3FQXA 3GK8L 5BJTB 5I19H 4KJYB 2NY2D 3IFNH 5HPOA 2ADJA 2WP3T 5EIVA 2VLKA 3MGAA 3LV3B 4H25A 1JHKL 1JNLL 3F7QA 4ZAKC 5H35A 1T0PB 3U4EB 1JHKH 4ZNEA 3EJYC 1WEJH 2HWZL 4LCIL 3UEZA 5TPWL 1XGUA 5SWZE 2H26A 3PWVB 5TDNA 2X05A 4U3HA 4X7TB 3NCBB 3DJ9A 1W2KT 5IG7A 4NZDA 4U7MA 4IDLA 1UM6H 3JV6B 4JFFA 4QNPF 5D1ZB 5EH1A 4C83B 1P6FA 3B6SA 2Z8SA 1ETZA 4OLVH 2VAAA 2WAHA 1T66C 3HZVB 2DIJA 2PYEA 3EFFB 2DQDH 4CADB 3MRKA 3HN3A 5A2LH 1T1WA 4D9LH 1JYVA 4D2NA 5J3HD 1MHPL 2X1OA 4JDVA 3LN4B 2F53A 4F7MB 1GVIA 4E41D 4N0CD 1B2WH 3BPOC 1WWWX 4JKKA 3BN9D 3LY6A 4M03A 4YX2H 4U6VL 1GGIH 3GJFH 2WBJB 5SWSA 5CEYA 1OGAB 2X4QA 3FMGL 3H2WA 4CVZA 3GSQA 3WXWL 1JZ3A 3C2SA 3HC0B 3FMGH 2YUXA 1PBYA 4JN2B 1H3PL 3OL2A 4ZFGL 1JFQH 2AQ2A 3SKOB 3T3PE 2P1YA 3QR2A 5KSBA 2HKFL 4ZFGH 3OKLA 4D9QE 4LSSH 3SQOH 3BESR 2ZUWA 1R3KA 1UC6A 1W72A 4GG8B 1ZT7B 4XWOD 1X4XA 1E6JH 1KIQA 1CWVA 1T83A 3FQXB 4KDWA 1KCUH 5F7MC 4G42A 1F6AA 4YBQC 2ADJB 2VLKB 4G6JH 3MCG1 1YMHA 4H25B 1QOKA 2D7NA 2GEEA 1AY1H 3QUMA 5EZIL 5H35B 1ND0A 4XVUD 4F3FA 3HC3L 1FO0L 4D94A 3QI9C 4M6ML 3HC3H 1XGUB 1FO0H 2H26B 5TDNB 3U30C 5L2KD 3VFWA 5BRZA 4DK6A 5IG7B 2DM3A 4JFFB 1IGMH 5C08E 3B6SB 2X4SA 2Y5EA 1JZ5A 1IJ9A 5J89A 1ETZB 4M4RA 3ALXA 2VAAB 2DICA 3EGSA 4ZD3L 2VB5A 2B7DT 2PYEB 3RIFF 3MRKB 5GS1A 3DYMA 3GI9L 1T1WB 4ETYA 1K4DA 3GI9H 4HS6A 4JDVB 1EBPA 1CLYH 2F53B 3W11D 1ULVA 3NZ8A 2IH1A 2B5IB 1O7VA 2IMNA 2HFEA 5SWSB 4GO6B 5CEYB 1LVEA 2DMBA 2X4QB 4N5UA 1RSFA 3GSQB 4CVZB 5IVXF 1CDJA 1XIWC 1YY9D 2IBBA 3AXLA 1D6EA 5DT1L 4W4OC 5TF1L 5L88L 4NQEA 1I9RH 3PQYD 5FYKE 1NL0L 5KSBB 5L88H 3QBTB 1RUKL 3OKLB 4F9LC 3EJZD 1HCFX 4P0DA 1FG2A 1BM3L 4KZDH 2Q6WA 4LMQE 1R3KB 1W72B 4RGND 1RUKH 3ZDXF 4JG0L 1GGYA 1RQ5A 3LH2L 1KIQB 4TSBL 5A2KH 3LZFH 4G42B 1F6AB 3GJFA 4KK6D 2HTKD 4TN9A 3UBXI 1TVHA 4JFEA 3RFZC 1QBBA 1YMHB 4RCAA 3JV5A 2NY0D 5TGBA 3IKCA 5DHYA 1IQDA 3INUH 2W65A 2EDEA 1UEMA 3QUMB 4MYWB 1ND0B 1RIHH 1Y6NR 3QEQD 1SBSH 3O2VH 4F3FB 3O6FA 2JK5A 3CXHJ 3VFWB 5BRZB 4HUNB 4DOHE 4UQ2A 4HCRA 2X4SB 3ZDZE 3HLAA 1BF2A 3LAFA 3H7BA 3EGSB 3MOAL 4HWZA 2W9EH 2O5YL 4URTB 5GS1B 3MOAH 2B2XL 1K4DB 2O5YH 4HS6B 2B2XH 4KI5E 4GXUN 3HUJA 3DETC 3N1FC 1URLA 1UM4L 2IH1B 2IAMC 2HFEB 1UM4H 4LARL 4K8RH 2XTJC 3VXOA 3AAZA 4KJQC 4KROC 4QXGL 1MLCA 1MY7A 2ORBL 3CAFA 4QXGH 3AXLB 1D6EB 1FNSL 4YFDB 4NQEB 3TYGH 3RGVD 1FNSH 1UACL 1HN1A 1TVBA 3BGMA 2WBKA 1FG2B 4YHKH 2Q6WB 2EXYD 2GTWA 3LQAC 8CGTA 2NY7H 3SKNA 3GKZA 2A0LD 2HLAA 3GJFB 4W6WB 1F4YL 1TVHB 4JFEB 4K3HA 2CUIA 4X9FA 2R1XA 5GS0L 4PRPA 5TGBB 2J3SA 5HYSA 3IKCB 5DHYB 1IQDB 2W65B 5GS0H 3U7YH 3MPCA 2RQ8A 3O6FB 2JK5B 3TWCH 5L2JA 3KPMA 3BDXA 3GIZH 3QNYA 1IAIH 3SDDA 1VESA 4UQ2B 4P9HH 4U49A 3HLAB 4FTVE 4F9PA 3CMOL 3QDHA 4L5FL 3T1WA 3H7BB 2X9YA 2YZ8A 3RZCC 5C0BD 4HWZB 2ESVD 3BIBX 1KCLA 5EBWB 3ULUF 5DA0B 1CLOH 3NA9L 1CD0A 4HPOL 1FNEA 3NA9H 3P4LA 1KCVL 3UCRA 3OBAA 4F33A 3HUJB 4IOSD 1KCVH 1SEQL 4LEOA 1OF2A 3ZE1F 7FABL 3VWKD 3ZYJA 5MEOA 4B0MM 3HAEG 3QHFL 3VXOB 5IJVA 3AAZB 1MLCB 1GHFH 1MFCH 4OIIL 3QHFH 4PJ7E 3HNSL 5C6PB 3DMMA 5M94B 3MLZL 4KK5D 2R56H 3VFUA 5DJDA 3VU2A 4EI5D 5I1LA 1TVBB 1A8JH 1NCCH 3PWPA 5TE4L 3BGMB 2XKSA 2IANE 4LHQB 2VDLL 5K9OA 1W0VA 4ZAKD 5IBLC 1ZEAH 2VDLH 2GTWB 1FIGL 2HRPH 5E08L 5E2VH 2E6QA 3RHWF 4KU1A 4C56A 4ODVL 3SKNB 1FIGH 5E08H 2HLAB 2QSTA 2EZ0D 4MXVF 1H5BA 1RZFL 2Q8BL 4M1CC 3BPCA 4ODVH 4PD4K 2R1XB 5BOZG 4PRPB 3RVWD 3RWFA 4Y19E 5HYSB 2F9BT 4MQXC 4S1RH 1R0AL 3BT2L 1A1OA 5CCKL 4YDLB 1SM3H 1FGVL 1T66D 5CCKH 4S2SB 5SWZD 4ZFOA 5IR1A 5L2JB 2H1PH 3KPMB 1FGVH 1GJIA 2D2OA 2BY0A 4MA3A 3QNYB 5EULV 5HD8D 4O51A 1DBJH 3SDDB 3GRWA 1G7PA 4I0PC 2B4CC 5HSFA 2QR0A 3CLFH 3I50L 4HHAA 1FFRA 1CD1A 1HINL 2QQKL 4ZFZA 5C3LD 4OJFL 3I50H 3QPXL 4Q0XH 5TQ0H 1OT2A 1Q38A 1FNEB 5GJSH 5CIPH 1UXSA 4JG1L 4F33B 5C0IA 1CS6A 2LVEA 4LEOB 4J8RA 1OF2B 1CBVL 5E4EB 3BX7C 5K9QG 5CP3A 5MEOB 3CSPA 1KJ3H 2YUWA 3MACL 1C12A 5IJVB 4KXZH 2PW1A 3JWDL 3ARYA 3MACH 1FRGH 3DMMB 3VFSA 3JWDH 2ZP0T 4IRJC 3RNKA 4R96A 2OJEB 3VFUB 4POZD 5DJDB 5I1LB 3QO1A 4D9QD 4L8SA 4PY8J 4YBQD 3QIBA 3PWPB 3MOBH 2IBZX 5K9OB 5TQ2L 1W0VB 3FO2A 1RJYA 3CXDH 1LEGA 2I26N 4IEFB 1JPFA 4C56B 5HVHB 1KTKE 1NUGA 2YRZA 3QI9D 1T2JA 1G9MC 1XR9A 1H5BB 3HS0A 3BPCB 3H42H 5DVKA 5EU7E 4ORGA 3RWFB 1CVSC 1A1OB 1X5JA 5ACZA 2MCPH 3PJSA 3ULVC 5CGYD 3CX5K 3VG0L 4ZFOB 5IR1B 3K8MA 5C0EA 2NY4C 5EUKA 4MA3B 3VG0H 5C08D 4IJ3C 4LAQL 3VFTA 3SGEH 4O51B 5E2UH 2BSRA 4GW1A 2H2SC 4RWYL 1G7PB 1DEEA 3K1KC 5FHAL 2BNRE 1FVCB 4RWYH 2QR0B 2BOBA 1FYTA 4JEGB 4HHAB 1EUUA 1CD1B 4JDTL 4OLWL 4ZFZB 3MX0A 4JDTH 2V5RA 4FG6D 3WO4B 1XIWD 2FSEA 1JRHL 1NAMA 5KVMC 3JXAA 1UXSB 4PUBH 3LD8B 5KVFL 1JRHH 3KPNA 5C0IB 4N90E 4TVSa 1DANT 4J8RB 4G6FB 1RPQA 2KZWA 3B9KA 2YD4A 1DBMH 3MA7A 2DD8H 1JGLH 5D1QD 4ZXBC 3EYQD 1C12B 1I1RA 4RMUA 3SQBA 3WSQH 2PW1B 4P4RA 4PLJC 2A38A 4OF8A 3VFSB 3RNKB 3SEPA 5FYKD 4R96B 5FUOH 4HGKC 2E7MA 4L8SB 1FJ1A 5F96L 2DLIA 3NCMA 5L6YL 1IM9A 4WTXA 4PLKC 2DQHH 5F96H 2DF3A 5DYOA 5CIPA 5L6YH 3FO2B 3M45A 4ODBD 1CU4L 1NMAH 3LB6D 1LEKA 4MJ2A 3TCXA 5GHWH 3RNQA 1AD9A 1YEIL 1N0XL 3SN6N 1XR9B 5FUZL 1P5UA 2BHUA 1YEIH 1N0XH 3HS0B 5GSRA 1MQ8A 1G6RL 4ORGB 3ZDYE 3DPBA 5AWNL 5E8DH 5ACZB 3PJSB 1Q94A 3EW3B 2VYRE 5AWNH 1BMGA 3FCTA 2CXGA 2R9HC 2VLLA 4LK4A 4G7YL 2WP3O 4IDJL 3SDXF 5C0EB 4M3KB 5EUKB 5IFJA 4G7YH 4IDJH 3VFTB 2BSRB 4GW1B 4KQ4H 3P2TA 4NZTH 4B50A 1DEEB 3ME0A 5DK0A 5LGHH 2BOBB 1FYTB 4YBHA 1JE6A 2F5BH 3BN3B 5IMMA 3BKJH 3PDDA 4FRWA 4JO2L 2DWEA 2WUBL 3MJ7A 2HMIC 4KROD 2FSEB 1NAMB 3HB3C 2WUBH 2OSLA 5GS3A 2NX5A 3KPNB 4NQSA 4NT6A 1PX3A 2F74B 1IC7L 4CW1A 1RZGA 1J8KA 3OGCA 1KTLA 4Y4HC 4TSCL 3N0PB 3LEXA 4XBEL 3ARQA 3B9KB 3RTQC 4NKMA 3MA7B 3G6DL 4P4RB 1HI6A 4Y2OA 3G6DH 4XPTL 3JZ7A 1X5ZA 4X6BA 4QRSA 4JPVH 1A9EA 2QQLL 5D96C 4OZGA 4HXBL 3L1OH 2QQLH 2X9XA 1FJ1B 4G7VH 1AR2A 4OZ4A 5T3XE 1IM9B 3GHEL 3KYKL 4LPXA 5DYOB 5CIPB 3B9VA 5FHBL 1LEKB 1WWAX 3GHEH 1HSAA 3KYKH 4YC2B 4HJ0D 3O2DH 4LSDA 1LK2A 3RNQB 1AD9B 5D1XA 3GMPA 4KRPC 4PP2A 4MS8C 1JV5A 2X2YA 4ESKA 5GSRB 5DQDH 4XAWL 4LP4A 5I71C 1YN7A 4WUKL 4ZOBA 3KG5A 4XAKE 1MI5E 2WIIA 2BNQE 3OF6A 3O8XD 1Q94B 3MC0A 1PY9A 3FCTB 2G5RA 4PRAA 2VLLB 1BFTA 3CUPA 5IFJB 1EIBA 4PJXB 4FTVD 5GGSY 3F65A 1MQKL 2FX7H 5K33A 5DK0B 2Y36L 1MQKH 2ID5A 4GLRH 3W2DH 5IMMB 3MBXH 1A7NH 2DWEB 4GMSH 1FG9C 3ZTNL 4U7SA 3MJ7B 1A6ZA 4JFZH 2OSLB 3ZTNH 1J1PL 1NGWA 2NX5B 3ZTJH 1IMHC 3GSXB 4NQSB 4NT6B 1D5IL 3HI6L 1J1PH 4CW1B 1RZGB 4APQC 3OGCB 1KTLB 1D5IH 1I8LA 3LEXB 3KPQA 4TVPL 4NKMB 1RUQL 3CFIC 1YEHH 4TVPH 2HTLC 4Z7NE 1XF4A 1HI6B 1ORSB 5IBLD 4JVPA 2UUDH 4PBVC 4X6BB 4QRSB 1A9EB 5I1JH 2P8LA 2QEJA 3O4LE 5B21A 1QUNA 4OZGB 4U0QB 4OZ4B 4M1CD 4G6KL 2IAND 4GFTB 1FFOA 2WBJC 4MQXD 2VOTA 1QNZH 1HSAB 2HFTA 2YD8A 1LK2B 4QKXB 3L5IA 4UQ3B 5D1XB 5MP6L 1LO3L 3GMPB 5ID1A 5IKCA 4PP2B 1IC1A 4O02L 1JV5B 4P2YA 4Y19D 1YN7B 3PWNA 2DQTL 4QGTA 3V5KA 2WIIB 4AMKL 1PYWA 2DQTH 4G5ZL 3P9WB 3DUSA 5SX5H 2CD0A 3H3PL 1GAFL 3L6FA 4G5ZH 4PRAB 1A4JA 1GAFH 4JANA 3CUPB 3OWEA 4E42A 3OAYK 1QVOA 3DYOA 3O2DA 1Z9SA 1VPOL 3CFCL 3HUJF 3QCTH 1TPXB 4XBPA 1VPOH 3RWJA 3CFCH 1CLZH 3QWQB 3BISA 2LQRA 5DO2C 3KXFE 1A6ZB 2CH8A 1N5YL 5EORL 1DL7H 1L9MA 3W39A 1NGWB 3P40A 1F3DH 1N5AA 4K2UL 1N5YH 1QSEE 4K2UH 2ZUVA 3KPQB 1J0JA 5DGQA 5C0AE 3C6LD 5LCVH 1VERA 1NCBL 1XF4B 2XZAL 3O11A 4K7PL 4IIQA 2EEAA 1NCBH 1LILA 2P8LB 1UADC 2QSQA 1EMTL 2B5IC 2XKUA 1EMTH 4CMHB 4ZQKA 1FFOB 1G0XA 3I6GA 3OKDA 3R06A 5GISL 1UCBH 3HZMA 5ESVA 4BK5A 4ZDHA 4N8VA 4U33A 1X5FA 4X9GA 5JQ6L 3GBNL 3O9WA 1MAML 2X89D 3H6JA 4AEFA 5ID1B 5IKCB 1QD0A 1TTUA 4LVEA 2NY4D 1MAMH 3BKCL 3TH4T 3PWNB 5E8OA 1A3QA 4KVCH 3V5KB 5E94A 1PYWB 4JPWL 4KK9D 3DUSB 3OXRA 4L1DA 3MCLL 1J18A 4JPWH 2F5AL 3L6FB 1A4JB 1JVKA 1JJUA 3RY5A 4JANB 4D0CA 1CGSH 5DLMH 2OL3H 2WZPD 4E42B 1U91A 3ARWA 4MXWH 4PRIA 5JMOC 3D25A 4AG4L 1QVOB 1CE1L 4IMKC 2BNRD 1BZQK 4M7ZB 1CE1H 3ZLQC 4XBPB 3RWJB 1AR1C 1JYWA 3MRDA 5KS9A 2VIRA 5IW1A 3EDEA 5EOCJ 1OM3L 4N90D 3UBXA 3W39B 1N5AB 1MFDL 2OK0H 2E9JA 1RMFL 1OM3H 8FABA 1NLDL 1QO3A 2RAMA 2P24A 2NR6C 5HDQH 4PLKD 3EKCA 3FN3A 4O2CA 5GS1C 4PBXA 3S35H 1V7ML 2ZPKH 1Q9OA 4Y88A 5FM5O 3O11B 3ZMRA 4IIQB 1CGTA 2DWDA 1QP1A 1V7MH 4PJCE 2HT3D 4XHJC 3CLEH 2PTUA 3BGAA 1YMME 3G5ZA 1MLBA 1S9VA 5JZ7C 2QKIA 4JZJA 4ZQKB 3I6GB 1OAZL 1P4IL 3OKDB 1G0YR 2D7QA 3R06B 3KYNA 1YA5A 2C4XA 3HZMB 2W0FA 5ESVB 3SDYH 3WFEL 1OAZH 5F9WB 5KAQG 4N8VB 4ONOA 3L5JA 1NBZA 3O9WB 3WFEH 3S36H 3BD3A 3AS1A 4OF6A 3UYRH 5GGVL 1KIRA 2BERA 4ELMF 1QRNE 5MENE 2FO4A 5E8OB 4O00A 2OI9C 5E94B 4NOFA 4JFPA 4RBPK 4LSPL 4X0KA 4PJAE 2RB8A 3OXRB 3OAZK 3TT3H 1AO7A 1OAUL 1W0WA 4D0CB 2DM7A 2ENSA 1HKFA 3E3QE 1I3GL 1U91B 3ESUF 2VLJA 2VXQL 2HMID 3D25B 1A64A 3T0EE 3HB3D 3OAYH 1JNHA 3FQUA 3U48A 2VXQH 2H9GA 2BSED 1RZ7H 1AGFA 1K3ZA 4XC1H 3UJIH 3MFFA 3QT2A 3O6FC 3T2QA 3MRDB 5KS9B 2BJMH 2VIRB 5IW1B 1RHHA 3UBXB 2AS5M 3I9GL 2PF6A 3O6KH 5T1KA 8FABB 1GGCH 1KB5L 3VFPA 2EEBA 1QO3B 1ITBB 1WZ1L 2P24B 2OL3A 4O2CB 2EXWC 2GCYA 3CSYA 2DKMA 1Q9OB 1WZ1H 3X17A 3C5SA 5F7LB 2AABL 2DWDB 2NY6B 2HRLA 3WFCH 2AABH 3G5ZB 2EDKA 3R4DA 1MLBB 1XGPA 5T3XD 1NKRA 1FNGA 1S9VB 2QKIB 3C5ZB 4JZJB 1NDGA 7CGTA 2IG2H 3KYNB 5EO9A 2R0KH 2W0FB 4LIQE 4W81A 4W4NA 4CN4A 1EUTA 1NBZB 4H8WC 4JFHE 1QKZL 3QDGE 2HJFA 1AC0A 5FYKL 5I73B 1KIRB 4XZUA 2HH0L 4XAKD 2MTPA 1I75A 1MI5D 3ISWA 2FO4B 1P69B 2BNQD 3O0RH 4JFPB 3MRLA 2DLFL 3BMVA 1CFVL 1P1ZA 2UWEE 4N0UA 5H94A 1AO7B 5KG9A 1W0WB 3OB0K 4EVNA 5I18H 2VLJB 4FQHA 4MXQC 4FQ2L 1JNHB 3FQUB 2XZQH 1XZ0B 5D7KE 2H9GB 4F7TA 2MJWA 2NNAA 4FQ2H 4G8GA 5IROA 3EYVA 1AGFB 4APQD 4ZO6A 4YDLC 1QYGL 3D5OF 4WU5A 4GW5A 3MFFB 2J12B 4MJIA 3C5JA 4KZEL 1IGJA 1RHHB 2JJTA 3SDDC 1Q0XH 5DK2A 5T1KB 4X7DC 4F9PC 4XPHH 1CN4A 3G5YA 3VGAB 3VFPB 3C60D 1R3JA 4TUKL 2OL3B 5E99H 1KTRL 2V2WA 3MZTA 1RZKH 5I1KL 2GCYB 3CSYB 4GBXC 5I1KH 3C5SB 1E4WL 4H1LG 2FATL 4OCLC 3F62A 3O4LD 4KWUA 2N7AA 2EIDA 1FQ9C 4K9EH 1BHGA 5KANI 1XGPB 4PJHA 1FNGB 1HHIA 5F97E 5CEZE 4QXWA 3TO4C 5E4EC 4OCNC 3BYYA 1NDGB 2KH2B 4L4TB 4HKZA 3ULSA 5EO9B 2PNDA 3GB7A 2D7TL 1H3VA 5DHVA 3MOQA 2PXYD 1IM3A 5E2WL 5JIIA 3LHPH 1QR1A 3SE4C 1ZHLA 5E2WH 2HJFB 1QLFA 1LD9A 1LDPL 4LASL 4XZUB 3KLHC 1LDPH 2EYTA 3QXWA 4PJXF 2IC2A 2FJGA 2BHYA 3MRLB 1I7ZA 2WUCL 4N0UB 1P1ZB 1YECL 3LIZL 5H94B 1VFOA 2WUCH 4ZUVA 1DQMH 5KG9B 2I07A 2VDQL 3LIZH 5DO2D 5LJYH 4EVNB 4RMVA 4R4ND 3GJEA 2CGRL 4FQHB 1RJLA 3EO0A 5I66A 5D2NA 3PUCA 2OR9L 2CGRH 2LU3A 4OLZL 4EUPA 4QGYA 2NNAB 5F7KC 1ZAGA 1BAFL 1ITCA 4G8GB 2JIXD 3EYVB 1U6AL 2OR9H 4PG9A 4BYHA 1NBVL 3FQWA 4YGAB 1BAFH 4L4VA 1S9XA 4WU5B 4GW5B 1NBVH 3KXFD 4QXUL 3I3EA 4UV4L 3RL1A 3C5JB 3QJFA 4DFIA 3L3HA 1IGJB 1A21A 4J4PC 1ZSDA 3BDYL 1OQOA 1QSED 4K7PY 4ODSH 5DK2B 4QEGA 2DQFA 4PJIA 3G5YB 2WWKO 5C0AD 2ZOKA 1KBGL 1R3JB 2Y9RT 1XFPA 2V2WB 2DYPD 4FFWC 5L8JB 3T77A 3CDFA 2D7MA 1NCAL 1NDMA 4YQXH 1TXKA 2X10A 5F7UA 3ZKXC 3LD8C 4NO5A 4X7CC 1MRFH 4PJHB 1HHIB 1SVZA 3LVEA 4XNXH 4DGVH 3B5TA 4U3CA 1UM5H 4P5TC 4HKZB 4U6XA 3ULSB 3OMZA 3EYUL 3GB7B 5DHVB 1NSNL 3QCVL 1IM3B 3C8DA 1QR1B 1U3HA 5DQ9A 1ZHLB 4YDKL 1NSNH 1QLFB 1LD9B 3D3VE 5GJTH 3HG1E 5BVJA 5C9JA 1L6ZA 4NRYA 2EYTB 3NA4A 4XXDA 1H15A 4BSWA 3QIBC 1OP9A 2FJGB 3ARGA 1ZLUK 3PV7A 4YR6A 1I7ZB 3F58L 3NAAL 1YEEL 5E6ZA 1F4XL 4V2CB 1OAYL 1RHFA 2A9ML 3F58H 3NAAH 1F4XH 4N8CL 2I07B 4OF0A 4ZUVB 5TDOA 3GJEB 4N8CH 3OB0H 4Q9BA 4HK3N 1RJLB 1TZIA 4XNZB 5C0ND 5I66B 5D2NB 5FYLH 4MQSB 4U1GB 3U4BH 3ELAT 5A2FA 4EUPB 5EZLA 5FCSH 4FQPA 4PG9B 3ETBF 3FQWB 4L8DA 1INEL 2MQ0A 3D2UA 4L4VB 1S9XB 4WFEE 1PX4A 2NR6D 3RL1B 3QJFB 4N1HB 4WDIA 3QRGH 3D9AH 2C4FU 3L3HB 1DN0A 2LV4A 1BFVL 1ZSDB 1D9KC 5L8LB 2A9NL 3CDCA 4XHJD 1MCNA 3MRCA 4LHUA 3AS3A 2O93L 1CG9A 2DQFB 3F7VA 4PJIB 2ZOKB 5JZ7D 1J0ZA 3E6FA 2NCMA 4FQLH 1I9IL 3SJVE 4OFKA 4LLWA 1YMMD 1FC2D 3NACH 3T77B 1GOHA 5DD1L 1I9IH 1NDMB 4F2MA 4NO5B 1AJ7L 4JB9H 2KKQA 2Q76A 1T7YA 2RIKA 4L3EE 5GGVY 3MBEA 3MLWL 4U6XB 2X6MA 3SE8L 2VXTL 2JF1A 1XF1A 1KJMA 2VXTH 1U3HB 4PJEE 1TQCB 3DO7A 3FFCE 3P9LA 1QRND 5MEND 1MUJB 1IKNA 1T7VA 5BVJB 5C9JB 5LVEA 5CEXA 4NRYB 4UMGA 3P11L 1A1NA 4XXDB 1H15B 3S35X 4BSWB 3VI4F 3ARGB 1CXFA 1PKOA 2GI7A 5E2TL 4B41A 3TNMA 4YR6B 1HNFA 3ZKSD 5E2TH 1OWWA 5TDOB 4R26H 5SX4I 2C1PA 5H37G 3T0ED 3WCYA 2YZ1A 3MMEA 1QLEL 2P5WA 1O7SA 4UBDC 5EZLB 4PYGA 2JB5H 1UZ6E 4OKDA 1LP9A 4L8DB 3S36X 3D2UB 3H9YA 4UTBH 1A7OL 5DRWA 4ZTOL 2GK0A 4WDIB 2EXWD 1A7OH 1PW3A 1CDBA 4ODTL 1DN0B 3ROOA 4RAUA 3M07A 5CKAA 4CAGA 5GQBA 4PV9A 3MRCB 4LHUB 1CG9B 5C70A 5IVZA 1TVDA 1V7NL 3F7VB 4UAOB 2Q87A 3QUYD 3E6FB 1AKJA 4Y5VC 1JN6A 3TPUA 5EBMA 4QNPE 4LLWB 1XF2A 1U8PA 3HZYA 4R7NA 4K3DL 3D1MC 3B43A 4F2MB 1AGEA 4FZEL 3VRLF 2Q76B 2CMRL 1KEGH 4FZEH 2MOVA 3MBEB 1L7IL 4JGUA 3BZDA 5ENWA 4J6RL 4R90H 4X5LA 3MRGA 4XGZA 4OM1L 4WFGE 1CQKA 4F37F 4JFHD 4ZFFA 4IMLA 1KJMB 2NZ9C 3QDGD 3WE6A 1BD2A 3DO7B 4XCEA 3S34L 1FPTH 3P9LB 3SHSA 2BVTA 2C7UA 4UV7H 3V6OE 3S34H 5CEXB 4MXQD 3QFDA 1A1NB 1EEYA 4I2XA 2VXVL 1NCNA 1B4RA 4RWHA 5D93B 3TNMB 2NXZC 2ADFH 1WT5A 2VXVH 1IRAY 4TQEL 4OFYA 1FH5L 1YJDH 2C1PB 3VXNA 4H88H 3MMEB 5D7KD 2Y6SD 4OD3L 5TFSH 4NO2A 2P5WB 3GHBL 1DVFA 4BFEA 2DQIL 4P2CG 2DQUL 5DJ2A 3GHBH 4WENB 4J3SA 4OCRL 4I5BA 4O9HL 2DQIH 3WFZA 4LFHG 4OQTA 1WWBX 3V6BR 5DRWB 4OCRH 1J1OL 4O9HH 4J3VA 2GK0B 1CQYA 3KR3L 3NVQA 4ETQA 4X9HA 2D9CA 3QO0B 3ROOB 4RAUB 5HVFB 4ZODA 3BO8A 4PV9B 3JTTA 5J6HA 5IVZB 3BP7A 5EWIH 3TO4D 5M7QA 5GIRA 1AH1A 3BRFA 2DIAA 4H0HB 4CU6A 4NJ9H 1AKJB 1MCEA 1BZ7A 3FAXA 3TPUB 2AJVL 5EBMB 1XF2B 3EIFA 1U8PB 4R7NB 2BSSA 2AJVH 5CEZD 2XXCB 1AGEB 3AREC 4S1DC 2FDBP 3WO3B 4LP5A 2XQYG 2WWMD 1OCWL 1RU9H 3OKNA 3O4OC 5ENWB 3VMOA 4X6EA 3MRGB 4XGZB 5DUMH 4ZFFB 3HHRB 5K9JL 4IMLB 3WE6B 4K3JH 3FONA 1BD2B 2VLRA 5TH2A 5HHME 3G9VA 1GRWA 4XCEB 5KSAA 1NGPL 2AJ3A 5T3XL 5HHQA 2C7UB 4NBZB 2PETA 3VD3A 1NGPH 3QFDB 1EEYB 1NMCC 4I2XB 3DHMA 4NDMA 4PJBF 4CMHC 2OTPA 5IVXE 3O2WL 2GQHA 4FS0A 2R0WL 2WBWB 3QNZA 1TZHA 4YDVA 3O2WH 1MNUH 1A7PH 2JCCA 2R0WH 3J8F7 3RQ3A 4LAJH 5TE6H 3VXNB 2BY3A 1F45A 1GC1L 2FEDC 4JRXE 3S5LG 2B1HH 4NO2B 4XBGB 1HOCA 5E00A 5I8KL 1DVFB 1KLGA 1P4LA 2NLJA 4TPRL 3ZDXE 5ID0A 2AXHA 1H8SA 5C07A 5DJ2B 2DJSA 2Z31A 5I8KH 4I5BB 4MJ6A 3MNVA 5DMJB 1KJVA 4ETQB 4JFXA 4KK8C 4DW2L 2WV3A 4YPJA 2CDFA 3VGFA 5CZVL 2X70A 3BO8B 4Y4KC 2V5MA 4HK3J 3JTTB 5HGAA 5J6HB 4NGHL 4X6DA 3BP7B 2HLFC 5SV4A 5GIRB 1BZ7B 2MKLC 3KPLA 1F2XK 4TSAL 5HY9A 3WHE0 1A6VL 3AY4C 3NCYP 5F6IC 2KZ1B 4GKSA 2BSSB 1A6VH 1JF1A 1UWEH 3LRHA 3HFMH 3IYLW 2OTUA 1P2CA 3OKNB 2CRMA 2CUMA 1QFPA 4QOKA 5FIEA 4Z0BL 3CH8A 4X6EB 1ZV5A 4PRHE 5ISZA 4GUPA 3T09A 4XMPL 2PYFA 5C6TH 4IIQC 3FONB 3D3VD 2VLRB 5TH2B 3HG1D 4KKCD 5KSAB 3D39A 4WY7L 2AJ3B 2VH5L 5HHQB 4P23A 2F8XC 4Z77A 5GGSA 1I7RA 3NCFB 4WY7H 1CR9L 1N4XH 3MTRA 4NDMB 5T1DH 3W5MA 3V2AR 1PFCA 3UO1H 3QH3A 3QNZB 4YDVB 5F9WC 2JCCB 4LMQI 1BQUA 1H3GA 4NN5C 2J5LC 3GMMA 2NY5C 1UJ3A 2MMXA 2KDGA 1D9KD 1HOCB 5E00B 1KLGB 1P4LB 5ID0B 2NLJB 4LVOB 5F3HA 5CJQH 5C07B 2Z31B 4L29A 4MJ6B 4WFED 4B7IA 2X9WA 3MNVB 1KJVB 5GGTL 4JFXB 4N0YL 3S7GA 5JPMA 1HYSC 3P0YL 2CDFB 5IK3A 3L3KA 2FX9L 2H41A 4N0YH 3P0YH 2X70B 1YEDA 4KMTL 2NW2A 4NP4H 1KC5L 1OAQH 4PJ5A 5HGAB 1P4BL 3EAKA 2AK1L 4X6DB 2DKUA 4KMTH 3OZ9H 1KC5H 1HSBA 2AK1H 5JPNA 2VDRL 3IXAA 5E03A 3SJVD 2J8UF 5FYJL 1PG7W 1JYNA 1ZMYA 2UZYB 3KPLB 3TBYA 3T65A 3FRUA 5HY9B 5FYJH 1A3RH 5E1HB 4GKSB 1CICA 5EBGA 1JWSA 1ZTXH 1JF1B 2IQAA 4L3ED 3C08H 2OTUB 1P2CB 3PGFL 3ULUE 4QOKB 2VXUL 3GMRA 4HH8A 1N3NA 2VDPL 4NKQB 1ACYH 1WC7A 4P2QE 5ISZB 4GUPB 1G0DA 2VXUH 4KV5F 5BW7C 4CJ1A 3H9SE 3IRZA 2PYFB 2NQCA 5I1EL 3HE7A 3FFCD 2R0ZH 1Q9LA 5I1EH 3D39B 3ZE1E 2YD2A 1NCDL 4WHYH 4P23B 4Z77B 5GGSB 1I7RB 3RI5K 4DUVA 1NCDH 1OP5K 5E70A 4JZJC 3TPKA 4ZSOA 2FHBA 4UIMA 3QH3B 3BGFB 5KJRL 15C8H 2PO6C 3CSGA 2JJSA 1WTGT 4OBRA 5I73C 3GMMB 4DN3H 3DXAE 1Q9WA 1UJ3B 4ONFH 4H5SA 2DM4A 4F8TA 2ZCHH 3RWGA 5F3HB 4NM4L 5DSCA 4NO0A 3ZYIA 4L29B 1L0YA 4JCLA 4NM4H 5IQ7L 4PJIF 4GRWH 5I74B 3M8OH 2DLGA 2K7QA 3OJVC 3B4NA 4MXVE 5T5FH 2PCPB 5JPMB 4HT1L 2VISA 5IK3B 1T04A 3L3KB 2CSPA 4ZNCD 4XNYL 4NCDA 2NW2B 4PJ5B 4XNYH 5DC9B 2QADD 3IAQA 3DBXA 1HSBB 2QHLA 5JPNB 3IXAB 1E0OB 1IZKA 2LABA 3QDME 4K94L 1CXLA 3TBYB 5A40E 3FRUB 4LLVA 4GW4A 1CICB 1JWSB 4Z7UE 4JM2C 2IQAB 3QNXA 4HJGA 4KTYA 4YHYB 3VGAC 4JRYE 4M6OH 2D03L 3GMRB 4WFGD 3LS4H 4BQ8A 4M5ZH 1N3NB 4PRBA 1WC7B 2D03H 2NXZD 4LFHD 3U0PA 4GQ9H 3HE7B 1NUFA 4NOBA 1Q9LB 5HDOA 2ZG2A 3GMLA 4LLUA 4LHJB 4IRZL 3LCYA 1OB1A 5TF0A 4ZSOB 1MIML 4UIMB 3HI5L 5A2JH 2P47B 1T20A 3VWJC 5ETUA 4ZO9A 3HI5H 1PVHA 3I75A 1QTYT 5K59F 3SE3A 1Q9WB 4RRPG 1B0RA 4I8DA 4H5SB 3RWGB 4UTAH 4K71B 5DSCB 1XF3A 4NO0B 3BKML 5IBUB 4CL7A 4E41A 3BKMH 1SBBA 2BDNL 4OGXH 3LQMA 4YDIL 1QFUL 3CDYA 2BSTA 1INDL 2BDNH 3QQ9C 2VISB 5BXFA 4NUGL 4OCWH 5K9QI 4UU9A 3WS6C 2C4FT 3U36A 1QQDA 3ARED 5IROC 1RUML 4RZCA 4S1DD 3T08A 1H8OA 2UZIL 4OLUL 4DVRH 2RHEA 3DBXB 3B5GA 3EZ8A 4OLUH 4RGMC 1G6RA 5C0DA 2APVA 5E2JA 1F3DJ 5I0ZA 1XGYH 3WEXA 1E4JA 3E8UL 4GW4B 2JJTC 4OCXL 2DBLL 3QNXB 4OCXH 2EKSB 2DBLH 1ADQL 1QFWL 4HJGB 4JFOA 4GXVH 4P2OD 2NY2B 5A43C 3ZKMC 3S96A 1ADQH 1QFWH 4JHAH 2UVFA 4PRBB 5L0QB 4KVNL 2FB4L 3JWOC 3CXHK 3U0PB 5AG9A 2DI9A 1VKXA 4KVNH 5HHMD 4C4KO 1OP3H 4KJWC 5D7JC 3RKDC 4NWUL 3GMLB 4LLUB 4M43L 1IGYA 5HVWA 2F15A 3MUJA 4M43H 1SMAA 1OB1B 3MLUH 2NPLX 5L2KA 5DFVC 2VDML 3FFDA 2GAZA 1YEFH 1T20B 3DV4A 5I1CL 5ETUB 3KVQA 3MV7E 3I75B 1J9CT 4KK8D 3K8KA 4JRXD 3V4PL 5IHBA 1B0RB 1EPFA 3IDMA 5SX4H 2HT2D 1BQHG 3J7HA 1UA6L 1J05A 1XF3B 2BP3A 3LS5L 1UA6H 4E41B 4ZNEE 3LS5H 1YNTB 2BSTB 1A3LH 2W59A 3TT1L 5BXFB 4UB0H 3LRGA 1VEPA 3Q2CA 5CSBA 4UU9B 4JFFE 2YN3A 3TT1H 4XNZC 5D2NC 2ZCLL 3MLXL 3ZKND 4POUB 4U1GC 3VXRD 2IWGA 3U36B 2DQJL 3PV6A 4RZCB 4D0DB 3PQYA 1FBIH 2PYEE 3SDXE 2DQGL 1G6RB 4X4ZA 3V0AC 5C0DB 4X4ME 4WW1A 1JGVH 3WEXB 2PTTA 4X4YA 3I2CL 2N7BA 2VMFA 1BWWA 4PYHA 4GRWB 4JAMA 4JFOB 5I15H 1KYOJ 3FKUS 5JIHA 4PRHD 3R8BB 1SY6L 1I1AD 3S96B 1CXKA 4YAQA 3UAJC 1VKXB 4RIRA 4EQ3A 4G8FA 3QEQA 1IGYB 5C1MB 1DBBL 1I1FA 5L2KB 3MV11 1J1XL 5D72L 5HI5D 4MNGE 4ZO8A 1DBBH 3FFDB 2GAZB 2OZ4L 2IFGA 4OUUA 1DBAL 1UYWL 3DV4B 4S0TD 1U3HC 1IGIH 1Y6KR 1UYWH 1TQCC 2CR6A 3PNWA 3IXTA 1EA9C 4PP1C 3E1F1 1CTNA 4OIAA 5IB5A 4WU7A 3BPLB 3IDMB 1J05B 1X6NA 5M95B 3MV8E 4F58H 4I3RL 2FD6H 3QDAA 1J88A 4PS4L 1N6VA 2CKBL 4P57A 4M93C 3UROR 2XQBL 4N1CA 1IAMA 2CKBH 1HHJA 3M17A 3PV6B 3T0DA 3EOTH 2E5EA 3NCYS 3MXVL 3PQYB 1KN4L 4FP8H 3RGVA 2MWCA 3SGDI 2OXHA 5DWUL 3UC0L 4WW1B 5EO0A 1LDSA 1N8ZA 4QHKI 4RGNB 1EAJA 4DAGL 5DWUH 1FFQA 1TJHL 2PTTB 3RVXC 4X4YB 4I77H 5EU4A 3TYFA 3UPAA 3SDCD 1JK8A 3ULUD 4OZHA 4JAMB 3UTZA 4P2QD 3H9SD 4EN3D 1K4CA 2PN5A 4WTWA 3TH2T 2NY0B 4YAQB 1U92A 3EDFA 4HEME 4OD1L 4RIRB 1TQBC 3G08A 4ALAL 2JCCF 2PO6D 4G8FB 3QEQB 1RIVL 2EDYA 3HMWH 2LAAA 2I5YL 4RISL 5FKAA 2IH3A 1KELH 1I1FB 4J3WA 2I5YH 1KG0A 2ZNXA 1DQDL 2GITA 2MSPA 5DEFA 3QYCA 4OUUB 2EH7L 4M61A 1UFUA 4U1SA 3SKJH 1CK0L 1YEGH 1DQDH 3FHAA 4UT9H 2VLME 1JF5A 3ARXA 5C0BA 1CK0H 2ESVA 5H2BA 3DXAD 3IKKA 5GZOC 3IXTB 4HFUH 4OM0L 1FORH 4JY5L 1NGZA 4MLSA 5IB5B 2XI9A 4WU7B 4JRWA 4X7SH 2YS4A 5D93C 3QUKA 1MIEH 5EN2A 1F4WH 1H3UA 3VWKA 1RVFL 4GS7B 4P57B 4PY7A 2DMCA 3AM8A 1HHJB 2ZUQB 2D9QB 5DXWA 2R29H 3EHBC 4HC1A 4JM2D 1K6QH 3TZVD 4WCYL 1UB5A 2XQYK 1T2XA 4Y5XA 4DGYH 4LRNL 4EI5A 3QDMD 3SDAC 3T2OA 1WBZA 3RGVB 5J6GA 3LOWA 1SEBA 2FHFA 2JKXA 1KJ2L 5EO0B 1N8ZB 4ZAKA 1KJ2H 2KQMA 1VENA 3TYFB 5EU4B 4QRPE 1JK8B 2N4IA 3K46A 4JRYD 4OZHB 3UTZB 2BFVL 2RCSH 3HC4H 3QG6A 2B0SL 4Y4FD 1BX2A 4NPYA 1K4CB 1X5AA 2BVPA 1U92B 4YHPA 5FV1L 3VWJD 3G08B 1N7ML 5GRWA 1N7MH 5SWZA 5FKAB 5EBLA 2IH3B 4MNQB 3RIFK 1VGKB 1KG0B 5CSGA 4EBQH 3MNZA 3GSNA 2GITB 4MD0A 5DEFB 1RURH 3CFEA 4OGAC 4U1SB 1NGYA 4M61B 5B3JF 3IU4L 1RI8A 4UT7L 4IS6A 5C0BB 4UT7H 2ESVB 4JVUA 5H2BB 4FQIL 3QQ9D 4S1SL 5E8EB 3U7AA 1NGZB 2CPCA 5CD5D 1WFNA 1Z5LA 4HMEA 3I02A 4QTIL 4NC1C 4ONGL 4Y8DC 5EU3A 1RK1A 3A6OA 4JZNA 4AL8L 1MEXH 1WT5C 3HRPA 4JREC 2ARWA 5EN2B 3VWKB 4AL8H 1NAKH 2NY1D 5I6XC 4BM7A 5D1ZD 3B9DA 4PY7B 2XG5A 2R2CA 1NC4D 4HS8L 1DVFC 5IM7A 1KCRL 1UB5B 4HS8H 4HZLA 4EI5B 1R5IA 2K7PA 5AZ2L 2WK2A 1KCRH 1WBZB 5J6GB 3AFLA 3ZKMD 3BI9X 4D9RE 1SEBB 3DI3B 4BFGA 3P30L 4Q6YA 2R8SL 4ZAKB 1JTOA 4LGPB 5D7JD 3P30H 5SWQA 3RKDD 2DRUA 2YA2A 4NUJA 4QHLA 3O3EA 1OLZA 3QI9A 3QG6B 2E3VA 2FGWL 4JPKH 3GSVA 4Z7QE 3S9DB 1BX2B 4NPYB 2BVPB 1OGTA 2X42A 4YHPB 1MF2H 4X6CF 4GG6A 2NY3D 5BQ7A 1I3RA 5AAMA 4NRZA 2H45A 5SWZB 3ZE2E 5EBLB 4JM4L 1I8MA 1F90L 3F7YA 3NGBB 3MJ9H 5C08A 3MNZB 3GSNB 4JM4H 5ADPL 1W8NA 4MD0B 4WFFE 3MV7D 3CFEB 4MAUL 3WMSA 1NGYB 1KB5A 3LQAH 2X4NA 4IS6B 4HWEL 2DQEL 3N50A 2EYRA 4NHCL 3VMNA 3DECA 4HWEH 2DQEH 1Z5LB 3I02B 1XIWA 1MPAL 3BXNA 3DIFA 3L3IA 1MWAL 2IBGA 4FQCL 5EU3B 1RK1B 4YHML 5FGRA 4JZNB 4LCWE 4HQQL 1MWAH 3QAZB 1B6UA 4W4OA 3RDTD 1A2YA 5FKPA 2GK2A 4ELME 5GGQH 1T2QH 3ARBC 4F9LA 4M1DH 5D1QA 2AI0H 2JE8A 3GSWA 2ZG1A 3WIFA 2V7NA 5IM7B 1MCPL 2PYED 4HK0A 1S5HA 4CKVX 1YQVL 4HZLB 3V0VA 1R5IB 1CYGA 4DTGL 1DN2A 4KKAC 2XV6B 3L95A 1CE6A 3MQIA 1S78D 5I8CA 1OT1A 5SWQB 1LO2H 4JN1L 4NUJB 3K3QA 4QHLB 4ZYKA 2W0KA 3O3EB 3QI9B 2AJUL 4V1DE 1NANI 3GSVB 3U30B 5HYIA 3PWUA 2AJUH 2CJUL 4NN7C 5DVOA 3L7FA 1OGTB 4K23H 5ACMA 4PLOB 5F71A 1X4ZA 2ZJSL 2XA8H 4GG6B 3ARDD 5D7SL 5BQ7B 1I3RB 4NRZB 4RFOL 1I8MB 3F7YB 5CZXC 5C08B 4RFOH 3E6HA 4AK1A 5IW6A 2VQUA 3VDCA 2RR3A 4DQOH 4U1LA 3RA7H 3NFSL 2DQCL 1KB5B 4YUEH 3GO1L 5IHLB 2X4NB 3K4ZA 1C5BL 3V0WL 4FMKA 5IESH 1C5BH 2EYRB 2Q3ZA 4MWFA 4P59L 3V0WH 2ED8A 2A1WH 4GKOA 4P23C 3FRPG 4I3SH 4KH2A 4P59H 1XIWB 3L3IB 3BXNB 3DIFB 3MV8D 5HHVH 4U1JA 2F8OA 5HJ3A 1JMZA 1A2YB 5FKPB 5IV2A 3UXFA 1PG7L 3RJDA 5KOVC 1A6UL 4JDZA 5D1QB 3FTGA 1A6UH 4XP6L 1UJ3C 3GSWB 4GMTL 3RVXD 2OR7A 3WIFB 2V7NB 3VXTA 2B4CH 1V3MA 3HA0A 4HLZH 4OQ1A 4GMTH 4GRWF 4HK0B 1S5HB 3RHWK 2P43B 1YZZA 1BGXH 4S1QL 1CT8A 3L95B 1CE6B 1IC5H 5E24E 5I8CB 1DSFL 3V7MA 1A6WL 4ENED 4XB8A 1JPGA 1LHZA 2IPKA 3MODL 3TBSA 4XMLL 2CK0H 1A6WH 2Z8VC 1FL5A 4ZYKB 1HK6A 3FOLA 3NPSB 3MODH 1UH2A 5CILL 5JHLH 5DC0A 4G3YL 3PWUB 1F5WA 2XG4A 5CILH 3L7FB 4G3YH 4JJ5A 3KPPA 3RVUC 4OGYH 5GRYA 3RWHA 1WTLA 4JHWL 3O8XA 1MCCA 3RZCA 4M48H 4JHWH 3HAEA 2H32H 3HE6C 5GZOD 1VFAA 1T1XA 3CJJA 1GCFA 2Q8AL 5D71H 4DOHB 4YHYC 2YHGA 4JO4L 3E6HB 4FTVA 12E8L 4M6AA 5IW6B 5FFLA 3KHQA 4U1LB 3RVVD 2VLMD 3WFBL 1PKQE 5DVNA 4J3UA 4Z7VE 4ZOCA 4MWFB 4LDEB 1AD0A 2Y23A 1JIBA 3QIWC 4IOFD 4KROB 4NM8L 4U1JB 3EHBD 4G9DA 3ULVH 3AC0A 4NM8H 5HJ3B 4UZGA 1EHLL 3SDAD 5IV2B 3CU1A 4AQOA 1DQTA 5A3IC 1EHLH 5JW3L 4JDZB 3FTGB 4PJ7A 3V9FA 4PJXE 4YHOL 4WI5A 3JWDC 3U83A 3VXTB 4PREA 2FLRT 1U3ZA 1UQSA 4HWBH 3WFDL 1CT8B 1JPSL 2IANA 2SEBA 1IKFL 4OD2A 1HYRC 2DAVA 4XP9H 4KUCD 4QRPD 1IKFH 1JPGB 2IPKB 3TBSB 3LMJH 4JFDE 2AK4A 1EO5A 1FL5B 4B7LA 3FOLB 4FHBD 3X3GH 2PR4H 4Y19A 4JZOA 5I75B 1J8HE 3TVMC 3BEVA 4JJ5B 3GSRA 3KPPB 5F6HJ 4OGAD 4UIKL 3RWHB 3O8XB 5LBSL 3TBWA 1UB6A 3RZCB 3KYMA 1K2DA 3HAEB 3IDJA 2ZOLA 3TIEA 1DFBL 3HCVB 3ULUL 4KDTA 1VFAB 1T1XB 5EA0L 2EDWA 4RMRA 3UZEA 3VW3L 1UVQA 4FTVB 4KGJA 3RWIA 5L0QC 3BIKA 1CFQA 5JO5A 3QSKB 3ZO0A 3KGRA 5DQJA 1T5WA 1AD0B 1ZANH 2CUHA 3LRSA 3QDJE 2HFFA 3QIUD 3P4OA 3VDAA 2YOCA 3FT3A 4G9DB 5ICZA 1UWXH 3TV3H 3W81A 3BZFA 3QHZL 2OS7A 3GIVA 1BVZA 5EC1A 1I1CA 5HDBF 2MPAL 3QHZH 4TOYL 4PJ7B 4V2BA 1LO0H 3SE9L 5E5UB 2EC8A 2XT1B 1UEYA 3SGJA 1WAAE 2BRQA 3SE9H 4PREB 4JKWA 1UQSB 2VZOA 1U93A 1L9NA 4YHNA 4D9RD 3PXJA 4N0CC 1RZJC 2MQCA 5JUEH 2IANB 3ILPA 2SEBB 4GH7B 4PJ9D 4WGWB 4OD2B 1RIUL 3PWJA 5D9SA 1T7XA 1I85C 3OKMA 2AK4B 4LCCC 2OM5A 2X89A 4MVBD 3R1GH 4G6AC 2VQTA 2VRAA 4MAYD 4Y19B 4JZOB 4DKFH 1YEKH 3MUY1 1HCVA 1F58L 3RIAF 3BEVB 3GSRB 3JSSA 1F58H 3TBWB 1UB6B 3VFOA 3KYMB 1K2DB 4NNYA 3IDJB 2APBA 2ZOLB 3EOYG 3TIEB 5IBTL 3IB4A 4XPFH 3QCUL 5FUCE 4WFFD 5IBTH 1UVQB 1EZVX 1S7VA 3RWIB 3BIKB 4YH6A 1CFQB 2BNRA 5JO5B 2HJLA 5F9OL 4OF7A 4LPVA 1EXUA 2YMXL 4K8RD 2VXSL 2FBJH 5F9OH 5DQJB 5DJZA 5E0QA 5T1MA 1T5WB 1N59A 2YMXH 3ARBD 2VXSH 3K2MC 4ZXBA 4O4YH 5FCUL 3LRSB 5ECJE 2HFFB 3P4OB 2O5XH 4LCWD 3FT3B 4OLXL 2WLYA 5FM8A 1AXSA 5ICZB 3PGCA 1LGVA 3MA9L 4OLXH 3BZFB 2J6EL 2W9DL 1I9JL 4GKZA 1OSZA 4KKAD 3GIVB 1RFDH 5EC1B 3DVGA 1GIGL 2W9DH 1I9JH 2GW5A 2F54A 1JNNL 3VI4E 3TFKD 2DKSA 2EDRA 4W6YB 5HPMA 2ZG3A 5GRUL 4Z18A 5BVPL 1RV6X 3UTSB 1KXVC 1U93B 1A9BA 4YHNB 5BVPH 3FO1A 3ILPB 5GS0D 4RGOH 1W8OA 1JPTL 3IAPA 3PWJB 5D9SB 4G6FD 4OKVA 1YY9C 5KVEL 4BZ1H 4V1DD 3OKMB 4ELKA 4HKXA 4UOW0 3U1SL 5KVEH 1I4FA 5LWYL 2NY4B 4Y1AB 2FWOA 5CZXD 4IJ3B 5LWYH 3ZSTA 1NBYA 3EJZC 3ES6A 2WSKA 1D5ZA 3VFOB 3CGTA 2CDEA 4NNYB 2G9HA 3BP4A 5HVGB 1RUAH 5I8OH 4KK6C 3NIDF 1S7VB 5E5RB 5J1SC 2BNRB 2NY0C 1CFTA 2HJLB 1AQKL 3RPIA 1EXUB 2Y25A 1AQKH 4CDGC 4YE4H 5DJZB 3VXQB 5T1MB 1N59B 1AQDA 4ZXBB 3S8WA 4TVPE 4MNHA 3WLWD 3FJTA 3OSKA 1OTUD 2YN5A 3ARFC 1E6OL 3CVIL 1AXSB 3PGCB 1ZT1A 1E6OH 4UT6L 3FQRA 3T3PF 1UH4A 4GKZB 3RY6C 1OSZB 3VGHA 3F12A 3GJFK 1NUDA 2WANA 3DVGB 4Z7OE 4UT6H 1QLRA 1F2QA 3DRQB 3R0NA 2F54B 4DN4L 2B1AL 3ZTJG 1GGBH 5HPMB 4M7KL 2VSDA 4XVTH 3FO0H 5D6CA 1A9BB 4X98A 4TNWF 4E0RA 2KPNA 1VEOA 3FO1B 1KENL 1I3UA 5JHDE 3VH8A 1YYMH 4OKVB 4Q9QL 4GG6F 2EDXA 4HDIA 4ELKB 4HKXB 3HE6D 4Q9QH 1I4FB 1TFHA 1FP5A 4PJDF 2FWOB 5BMFH 2EE9A 5F7DA 4UILH 1MI5A 3RGVC 2BNQA 1NBYB 3ES6B 3WNOA 4KRMB 1D5ZB 4OV5A 2EXYC 3G9AB 1V3KA 2W91A 4LEXH 3GBMH 2G9HB 1TCRB 3BP4B 3RX8A 2A0LC 5AYUL 3QIWD 3C2AH 1AXTH 1TJGH 2OTWA 3O41A 4OTXH 3OPZH 3S88L 1KPVA 1CFTB 3S88H 3UBXG 4G80A 3RPIB 1XMWA 4NCC1 4OSUH 4APQA 2Y07L 5A3ID 1A5FL 5JORA 1AQDB 1G7MA 1OAKL 2FL5A 4MNHB 1HXYA 1W72L 2VDKH 3K81A 1W72H 3BZEA 1ZT1B 4WWID 3FQRB 3MUHL 3F12B 3V4UH 1QBLL 3C60A 3U4AA 5I30L 1T7WA 1QLRB 2VLJE 1QBLH 1FZKA 4PJBE 3FT4A 3QUML 3BAEL 1X5YA 4P5MA 3ALWA 3BUTA 3O4LA 3QUMH 3BAEH 5D6CB 4X98B 3UJJL 3A67L 4E0RB 4LDOB 4EOWL 3VWKC 5I71B 3UJJH 3A67H 3TVMD 3VH8B 1J11A 1UH3A 5K93A 1T89C 2PXYA 3AM8C 4JFDD 3TJEL 4HDIB 1HNGA 5J06A 3W0WE 5I19L 1IT9L 3IFNL 1J8HD 4Y5XC 4H0GA 4EI5C 5F7DB 1IT9H 1MI5B 3RY4A 3FN0L 2BNQB 3WN5C 1QACA 1NANH 4R9HA 3FN0H 4OV5B 1MRDH 2ZSWA 1WEJL 1OAXL 2I9LA 3DI2B 1OAXH 4PJ8D 3O41B 2OTWB 1UM6L 2EZ0C 4L4TE 3L3GA 4U4BA 1CVRA 3WNNA 4AEHH 3P4MA 4L8BA 3MLPA 1OHQA 3H8NA 1FHGA 1KPVB 3RVWC 1XR8A 4G80B 2JIXA 4JE4B 1G1CA 4OLVL 2DL9A 4APQB 2BRRL 4LOUC 1NC2D 2DQDL 3KXFA 1KGCE 3RX5A 2ITDA 4D9LL 3QDJD 2BRRH 5JORB 1G7MB 5DFTA