4BA8A

High resolution nmr structure of the c mu3 domain from igm
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
102
structure length
102
Chain Sequence
b'MGDILTFTIPPSFADIFLSKSANLTCLVSNLATYETLNISWASQSGEPLETKIKVMESHPNGTFSAKGVASVSVEDWNNRKEFVCTVTHRDLPSPQKKFISK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IG MU CHAIN C REGION SECRETED FORM
publication title High Resolution Structures of the Igm Fc Domains Reveal Principles of its Hexamer Formation
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 16
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ba8A00
4M1CC 1I7TB 5I8EA 3MCKA 5F89B 5HHPB 3L5IA 2H32B 1P7QB 4OQTH 4XPHH 1I1RA 1NL0H 2BOCB 1CR9L 4LKCB 2BHZA 3GRWA 1KPUB 3IDXL 3AM8C 3ZTNL 2NW2B 4ORZC 4X9BA 5HGHA 2WP3O 3WS3A 4JFDA 3P77A 4RGNE 1CL7H 2IH3B 2D4DA 5D7JD 5D93C 4P46A 3FMGL 2XI9A 2L7UA 1D5IH 2HJLB 5JMOC 5DEGA 4G6FD 2ZUWA 3LEYL 3BP6B 1FVEA 3JV4A 2J8HA 4L4VE 1M1SA 1WC7B 2H1PL 4JDVB 5HI4D 3SGKC 2VISA 3HMXL 4DW2H 1CDYA 5IWLC 5KSBF 5I16B 3CH1B 4LAJH 3T0EA 1GGCH 4EEEA 2J7LA 4KVCH 5T33L 3L3KB 5J12B 2DQJL 3MRFA 1GZPA 3DV6A 3ARPA 3RA7H 3X12B 1UXSB 3CD4A 5HDBE 4FS0A 5K93A 3O4OB 4B41A 2EDXA 3WDIA 1AI1L 5HGAB 1RHHB 3WO4C 3BT2L 5I1GL 2EH7H 4BSVB 4PJ9D 2KZWA 1OTTD 3OKKA 1MQKH 2ICWA 1B9ZA 2E3VA 3OSKA 1GVIA 4R8WH 4G8IB 1CD9B 4YUEH 3P73B 1VDGA 5E4IA 5K59F 1TDQA 5F3HA 1T22A 4NKDA 5D70L 3B9KD 4N8VG 4XAKE 3FAXA 2P5WB 5B21A 3UZQA 1N2RB 4MA7L 1YDPA 3DV4A 2YC1A 4NQCB 1QRNA 2BSRA 2NY5H 4QXUH 3T09A 3OAZH 3RJQB 5FB8A 3IT8D 1P69B 5GGSA 1DUYB 4W81A 2DYPB 2AW2A 4JZNA 4TVSa 4K8RH 5C0RL 4XNXL 3IFOB 3AB0B 2X4OB 1R24B 3NA9L 4KGJA 1KEGL 4NUGL 3P9LB 5HXMA 3GJFA 4NN7B 1RJLA 2A74A 4HWBA 4OF8A 1MH5A 2ADFL 4MNHA 2NLJA 4I9WD 1T03H 4WTZA 1DJSA 5D7JA 1N3NA 5FHAL 1UKTA 3SE4C 4KZEH 3EGSA 5C0GB 2QL1A 5JORB 1CF8L 4WV1C 2XYCA 3PWPE 1V8HA 4KY1L 5SX4I 1MQ8A 1VERA 4RX4D 2AAVA 3VXQA 3KPNB 3MRIA 3AAZA 3QFJE 3HA0A 4KK5C 3JV0A 2R1YB 2FGWH 1EO5A 2AEIT 2YEZA 2F58L 3KJ6L 3M1BA 3C9NB 1U8IA 1YQVL 5EUOF 1DUZB 5IQ9A 4FXGA 1UWGL 3MODL 1IC7L 4M1CD 3TPKA 3KYNB 4P2QB 2ED8A 5DMKA 1U8OB 5FDYA 4X5XB 4KAQL 4PJ9A 2GK0A 3R1GH 4QF1B 1A9BB 4L29B 4CVXB 2A2QT 5BOPA 4XHQA 1L7IH 4G6MH 4I48B 5F88B 1XIWC 5CJOH 4HWZA 5DZNA 4RGNC 3V5KA 1AHWB 1P5VA 1P1ZB 4HQQH 2VZSA 1GYAA 3NIDF 1YA5A 1EBAA 3HAEG 3F6LA 1QLEL 1S7WB 4IBLT 4NWTH 1AFVH 1WF5A 2CQVA 2WINB 3OJVC 3DMMB 1VADA 4R90H 3ZE0E 3BP4A 1YN6A 4FQLH 3MGTA 4UTBH 2VDRH 4LSRL 3IVKA 2VQ1A 2R56H 2FX8H 2VH5L 3SKNB 5KOVC 1G1CA 3O8XC 3QNZA 5HHQB 4PJDE 4Z95H 5DJ0B 4NQED 3G9AB 1KJVB 4MD0B 2AQ1A 1K6QH 3DSFH 4F58H 4NOFA 4YQXH 1OGAD 2ITCB 2DJSA 2ESVE 4PBXA 4U3HA 5CP7A 3HR5B 2HTKC 4EN3B 1N59A 3RWFA 4QHNA 2BSED 2VDMH 3PQYA 4R97C 4D9RE 2GI7A 4PP2B 4JFXB 1AXIB 3LZFL 4YIQA 4RX4A 3ZE1F 5J1SC 5IFJA 2VXVH 1UJ3B 3LEXA 1OQXA 1WZKA 4HH9A 5CJBA 1YJDL 3QNXA 3ARGB 5EWIH 4TUOB 1U8PB 4BK4A 1T7XA 3RFZC 4ZFZB 1UM5L 1KIPA 4PG2A 4PR5A 4MLIA 3V4VH 1CBVL 1MFAL 2P24A 1UZ6E 4QTIH 5I74C 1OAYH 2VLLA 2PTUA 4EBQH 3VFSA 4OZIF 1IGCL 3A6BL 2AEPH 2YPLE 4WW1B 4C54A 1TNMA 3G5XA 3BGMB 4RGOL 3HI6H 4DCQA 3BRDA 1F6LL 1HDMB 1FH5H 1I7UB 2QADC 4HS8H 5HHNB 2C3VA 2D03L 5DFVC 3WKMH 3FOMB 5HYQA 1BQHG 1RK0A 3BJLA 3OG6B 1AXSA 5SWSA 3HRPA 4AENA 5J57B 4YDIL 1JGVH 1PJ9A 3DJ9A 4XPFL 5CZVH 3ARTA 1YYLL 5MENE 3TO4C 2R4RH 1A7NH 4Z76B 3GI9L 2R0ZH 3ZKXB 3VMOA 4AYFA 4UV7L 1N7ML 3EYOB 5KANI 5BRZD 4UAOC 1Z6JT 4K2UH 3UBXB 4KK5D 1PKOA 4LSQH 3K1DA 4NN6C 4WWKC 1ZOXA 3DVNA 2Y7QB 4FRWA 1V3LA 3M17B 2W9DL 3NIFE 4XPTL 1IM9B 2PCPB 5HHME 4AH2B 3HC0A 3RX7A 5ELIA 1GHFL 2KPNA 5CBAB 4I2XA 5DZOA 1IAKA 3H9HB 1BM3H 4P5MB 4L4JA 3V5HA 2GCYB 1RIVL 2HH0L 3R4DA 4DKDC 4S1SL 5LBSL 4OV5B 4OAWA 4RGND 3N9GH 3DUUB 5E9DA 1U8HB 1C5BL 4M5ZL 5C07E 4DTGL 5CEXA 5D7LB 2F19L 2B20A 1P9MC 4WHYH 1LE9A 3MRMB 1GGIL 2X4QA 5FUOL 3X14A 4L4VD 2X4TA 1HHKB 2PYEB 1JGEB 3ULUD 1R6VA 4I4WA 2IH1A 1N0XH 2AV1A 4LDOB 4AY0A 4XPGL 1FBIH 3BPOC 4KQ4L 1KJ2B 1IEBB 4OUUB 4YDKH 3EYQD 5EZLA 4U31A 1AO7D 4A6YB 3ALXA 3QDME 3QXDA 4OKVA 4ZO9A 43CAA 1RZJL 5FYLE 3T65B 3PP3H 2WBJB 4F33B 1VFOA 1KF9B 1H9VA 5CUSL 4Y5VC 1F6AB 3CVIL 3GO1H 1FG2B 1LO5A 2KL6A 3FQXA 5F7MC 4U1KB 1F90H 5EU5A 2VC2L 3HKFA 1K8DB 4NC0B 3DYOA 4WJ5B 4DOHE 3GSOB 1X7QA 3EFFB 1FZOA 4IOSD 3FCTB 1UWEH 3IGAB 1NCDL 4KDVA 3GSNH 5D8JH 1R0AH 4XAKD 3RUGF 4LRIA 3D25A 4U6YB 3WJLC 4XAWH 4BZ2L 3HLAB 5C8JB 5B38A 5CEZL 4KTYA 5JHLL 1INEL 1ZHLA 4XT1C 5F9JB 5ID1B 1IAII 2CKBB 3P11L 4ODSH 5HPMA 4FNLL 3UP1A 3CXHK 5L9DL 3O3BA 2OTUB 1AGFB 5C6PB 1KB5L 1OL0A 3Q1SH 2HRPL 4MD5B 4M4PA 1WCBB 3D39A 3RAJH 3EW3B 2BNRE 3P3YA 1OM3H 4NSKB 3HI1B 3TA3D 5DFVD 1YPZF 1EIBA 4AEIH 4LVHB 4XBEL 4NIKB 5B3JE 2DM3A 4KUZH 1G7QB 3PWPD 5IHUH 1ZWIA 2XKNA 4NFDA 1OAQL 1XGRA 2M2DA 1LP9B 3TO4D 4U1LA 4JRYA 1YEHL 3QDJB 3QFJD 1NBVL 3UPAA 1TVBA 2M1KA 3MA9H 5IHZB 3BQUA 1DVFA 1C1EH 2CK0H 4FQXB 1P4BL 3WL9A 4MS8C 4M7JH 3V0VB 1AO7A 1C5DA 3QUYD 5IESH 5E00A 4V1DE 4MQXC 2OYPA 1ZHNA 5KBNC 2FB4H 4YXHH 1G9ML 1AD9B 2FIKA 4MJIE 5FUCE 3LDBB 5FKAA 4NKQB 1VFAB 1KFAL 3OKOB 1OARH 1YMHA 4XNUH 4AM0A 5BZDB 3SCMC 1GOFA 3TCLA 3H42L 2IF7A 2VDLH 3U4EA 5E24E 4UQ3A 3OKEB 1IGJB 4I77L 2JCCB 4U6XA 1JHTA 5D1XC 4X6EA 4F2MB 3QCTH 4TUJA 5FO9A 1ZMYA 3WFEH 2DM2A 4XZUB 1EAPB 1IZJA 4NO2B 2R8SL 4Z7VE 5DRZB 4UBDC 2LVEA 4YHPA 1DQLL 2W60B 1W72B 5CIPA 1UZ6F 5IG7A 3OKMB 1DLFL 5F7LB 1U36A 4EUPB 1CLZL 1NBZB 1MRDH 2RR3A 2G75B 2ZUYA 1H5BA 2ESVD 2XOTA 2WM0A 2ZCLL 3CFBB 4ALAL 4KKAC 1D7FA 3TA3A 5CCKH 2V5TA 4NKIL 2MHAA 4LSPL 4PJBE 4X5WA 3NFPB 1NGPL 5BS0E 3QWOB 4JQIH 4FQIH 2FRGP 4XP1H 4BH8A 3HI5H 3MYJA 4PB0H 5ALBH 5FO7A 5GS0H 4D9RD 4KC3B 1T6WA 4GAGL 5I8CA 4HD9A 4ZSOA 1XGYL 4R96A 3BJ91 4X0KA 3BN9D 3H7BA 1HXYB 5JLZA 3G5YB 2EE3A 5DRXA 1S7XA 2B1AH 3LKOA 5IBUG 1LQSR 3V0WH 4R4ND 2HA1A 2VR4A 1LDSA 2WLYA 1NUNB 3QUYA 5GJSL 2DIJA 3O9WD 3GJEB 4FZ8H 3MRQA 3LB6C 4PB9H 3IU3A 3KYKH 3MUGB 4RFEA 2Q76A 1TQCB 3BDBA 4TNVF 4CN1A 4OFKA 1LDPL 4X80H 1NQBA 2KH2B 2YPLD 4L8DB 4NT6B 4E42B 1R5IA 2ICES 2P5EE 4N0CC 4GW1B 4KTEL 4NZDA 1MAML 5I18L 3MGAA 3SEPA 3UYRH 3MXVL 2DAVA 1B88A 1XZ0A 1T2QL 3RNQA 3OPZL 3BKCH 3LIZH 2AV7A 1TENA 4JPIB 3RY6C 2DDQH 3G6JE 4M7LH 4P57A 3QIUD 4P5KB 2I5YH 1EEZB 3R8QA 3EYUH 3QIWD 3L5XH 1K8IA 2AI0L 3EO0A 1JV5B 4OLYH 4PJEE 3FQNA 5DD3L 3MACL 3GHEL 3TWCH 1U3ZA 4OZFA 5DTFA 1PZUB 3BPLC 4Z0BL 4MS8D 1ZEAL 2A83A 3QXWA 4F7MB 3WUWA 4O02H 1OAKH 4U1GB 3U2SA 2EDFA 4JHAH 2EXYC 3GIZH 2EE2A 4MQXD 3RVVC 1YUHB 1Z9OA 2LABA 3DGCR 4Y88A 3MNZA 2VKXA 3P9MA 1D6EB 1IFHL 3FFCE 4FQHB 5AYQA 2O5XL 4XBPB 4KJWC 5JHDE 1QLFA 2HT3D 3S36X 1RIUL 1MCBA 3FQRA 1LMKA 3MLTB 5J1AA 3KXFE 1V7MH 3O6MH 1U8MA 1AGDB 3C60C 4OIBA 4U7MA 3BPCB 1L6ZA 5D1XD 1A22B 1IC5H 3RVUC 4XBGB 1Q9WA 1Q1JH 4GXVL 3U82B 4UUJB 4UBDD 2VRAA 3WD5L 2A6JB 5INDB 3RGVA 5TDNA 1RZ7L 2NY7L 2Z4QA 5A2JH 1F4AA 3EYVB 5HYSG 1ZGLP 1I7ZB 3DRQB 3FONB 2YPLA 3MLSH 1SEQL 3LCYA 4LLVA 2EDTA 2DI7A 5EBMA 4NQDE 2GJZB 5AD0A 2AXGA 2YS4A 3MV8B 4QRSB 1KN2H 3OKDB 1KB5A 3QDMD 4KKAD 3K7UA 3T2OA 1J86A 5FYLD 2UY6A 4L3CA 2SEBA 4X6CE 2EDOA 2ICEA 3LSOA 3TIEA 5CJQH 4JY6A 4BA8A 4LSTL 5J1TC 3QIWA 1INQA 2VXTL 4J8RA 1EJOL 3WIIL 3QHZL 1JPST 4P23C 3HFML 1PEZA 4IRSB 4GG6F 4XMLH 3ZO0A 6CGTA 3ARBC 1UQSA 3OR7A 1L0XA 5JZ7D 1IGFL 2BVTA 2IQ9L 4JY4A 4XP9H 1MCSA 5D1ZB 2DJ4A 4HF5H 4LPWA 3VFMB 1LEKB 3LS4H 1IM3A 2BHUA 4OZGA 2Z93B 1OAZH 5FM4A 3S35H 4ZDHB 1OP9A 3D1MC 4P9HC 5KZCD 5HYFA 4KQ3L 3PHQB 5E99H 5JA8B 4NFBA 3GSQB 3L95A 2R69L 3OJ2C 3BGFB 2APWA 4N0CD 4KMTL 5DK2A 1MJ8H 4OLVH 2BNRD 5FA4A 2UYLA 3BO8B 2C1PA 4G42A 1ZVHA 4M6NL 4M6ML 4F3FA 4WO4B 4YHNA 4ODUA 3AU1B 4ZPTA 3NABL 4HIHA 7FABH 4XVTH 1JRHH 5CINH 2I07A 4D9LL 4ELMA 2PR4L 4PRIB 1I1AA 4PJAB 4OGYH 4UB0H 5FKPA 3C5JA 1U93B 4PRAA 4JFEA 3N1PC 2ORBH 4U1SB 5I19L 5IEKB 1YEKL 3TPUA 3BISA 3Q5TA 4KU1A 2NY2D 1E4WH 3EOYG 3DVGB 3WN5A 2B2XL 4EXKA 1QP1A 4V1DD 5C0ND 3RVVD 3I75A 1XR9B 2NY3D 1ORQA 3CNKA 1UADC 3TNNB 2E7BA 3T3PF 4QXWA 4DZ8A 5MEQA 1MF2L 1SM3H 5CGTA 3N85H 4KJWD 3UTZB 2B0SL 3BYYA 4JANA 5D2LA 4QOKE 1IT9L 3SJVA 3VRJB 3C60D 4NRYA 2FHFA 3R0MA 5LQBL 3MOAL 4PJGB 4HWEH 3BZEA 1ZS8A 4EOWL 3OWEA 4HK3N 5EUOB 1PKQE 1TJHL 5I76A 4M4RA 2F54E 5TE6H 3LHPH 1HSBA 2DJUA 3TYGH 5TF0A 3FN9A 4Z7UF 5I0DA 2CKNA 4I13B 4N9GB 3V5DA 3PV6A 4CKVX 3I9GH 5CD3B 4XPAH 1MJUH 5ALCH 3RZCB 5C0DA 4UV4H 3IJSB 1UC6A 1S5HB 2Q86A 1FAKT 4JM4H 3KYMB 4M02A 1KLFA 2XRAL 4TN9A 3QEQE 1N6UA 1DN0A 4PREB 3CFEA 5FYJE 3QQ3A 1RUKH 1NUGA 2A77L 5BMFH 3O3UN 3RTQA 5BS0D 3T2NH 4EDWL 5I1DB 2DI8A 3K1KC 5C71A 4NM4H 3BIKB 2VO5A 5I1EL 4XXDB 3G6JF 1J5OH 4KI5E 5EZOH 3FQTB 5F6IC 3OTTA 4ERSH 5IW3A 1BVZA 1R3LB 3I2CL 5D2NA 5BVJA 4YR6A 4PJEF 1E4XH 3ARBD 1U0QA 4P49A 4Q0XH 3V4PL 4HGKC 4WI3A 1HQRB 4BFIB 5FYKU 2IBGA 5JIHA 4N0UA 4ZXBD 3C8DA 4L8SB 4IMKC 2YRLA 3UPRA 3MREA 4IRZH 4OLEA 2HVKB 4L5FH 5DO2C 4ZS7H 4PJFA 2NY0D 4HZLA 5J11B 3VJ6B 9CGTA 4Q9RH 2VXSL 5FYKL 1WWCA 3FOLA 3P0YL 1VA9A 1F42A 4MA8L 5H35A 4W68A 4L9LB 1RZGA 3RIAF 1D5XA 5IIEB 3R06B 4CADA 3QXTA 1DL7H 1V3JA 2R0KL 1BMGA 2IMNA 3EJYD 4C83A 2ADJB 1U8NA 5H2BB 3ULVF 4X9GA 4CDGC 1CICB 2JE8A 4S2SB 1T5XB 3VRLE 5C2BL 5IMKA 4JDZA 1B6DA 4JFFE 3PIQB 2BY2A 4DN3L 1QBML 2BNQB 3HE6C 3LKNA 3MLXH 2GJ6B 1RFDL 2Q20A 4HC1L 2X09A 1Q0YH 4LFHG 4NDMA 1ADQA 1LNUB 2AXFA 2E7MA 5C1MB 4YNYB 5I2IA 2NY1C 3O11A 4D0CB 4Y4HA 4U1NB 4KKBC 5JOFA 4PRHE 5IK3A 2BDNH 4XWGL 4JFZH 3FFCD 2Q3AA 1EZVY 1MNUH 4HHAA 5JHDD 3IF1B 4GAJH 3U4BL 2AEWA 1BIIB 3HPJA 4M8VA 3HNVH 3PWLA 3KXFD 2FX9H 1A6ZA 3LVEA 5E2WH 1X5FA 1NUDA 2RJMA 3RPKA 4N8CL 2UWEF 3JWOH 4PGDB 3WCYA 4HIIB 3G9VA 1IKNA 2DBLH 4LCCB 1JFQL 3ZDZE 1EVUA 2EXWD 3MBXL 3D6GA 3B9DA 3B3IA 4MDJA 5CJ8A 2VLKE 3E6HB 3P0GB 2IBZY 2BFVH 5D7SL 5DJXA 3MROB 1PDKA 2ZPKH 1OQOA 1JWUA 4OLXL 5JPNA 1HH9B 2BVYA 3MLZH 1LEGB 4NQDD 2BRRH 4YZFF 1LK2B 3HUJA 4M93B 1AKJB 3I84A 1DZBA 1SJEB 3V6OA 5KSAB 3MZGB 1VEOA 3PNWA 5HPOA 4OB5H 1F2XK 4O4YL 3IDMA 4LLDA 1S8DB 3MR9A 4Y16B 4LVEA 2PO6B 4DEPC 1JCKA 1G9NH 5IB2B 2AK4A 3MLUL 1RZ8A 1GSMA 4LASL 1N5AB 1T1YB 2WZPD 3VXNB 3QO0A 3RDTA 2J88H 2D2OA 4NWUH 5I8KL 2IAMD 4NQSA 3RVTC 1FN4B 3CFKA 1FFOA 3VWKB 1EO8H 1ZLUK 5J6HB 2V2WB 5B39G 4HBCH 3EBAA 3TVMB 3TZVA 5DO2D 1QNZL 1QHPA 2I9LA 3D3VB 2Q1EA 5JUEL 2DQHL 2EIZB 1WBYA 4NCC2 2R2HA 4MQ7B 4QYOB 5K9OB 1J87A 1R3IH 2Z9TA 2M26A 2CDEA 5DJ6B 1NGWA 3QIBC 1N64H 4PRPA 3D18B 1KXVC 2AK1H 2AKRA 4U3CA 5DHVB 2E7LA 3PWUB 1AD0B 2OZ4L 3H6JA 3W9DB 3WLWD 5F9AC 1L7TH 1PQZB 3RUGB 4G9DB 2VZVA 2V2XB 4GKZB 4HK3J 1RJYA 4ZODA 3F7VA 3QNYB 1PSKH 5IJVB 1T7VA 4KVNH 1AE6L 1M05A 5ICYB 5FO8A 4AIZA 1J1XH 4DUWA 3OGCB 1XCQA 2JJUA 2MFNA 2OSLB 4ZOCA 5E2UL 4X4XB 3D85D 1S7QB 2YWZA 3SGDI 4R7NA 5CFHA 3EDDA 3MYZA 1A0QL 5BVPH 3EHBC 1R5WB 1YEDB 3WJJA 1IEAB 2DQCL 1U42A 1IC1A 2XXMB 1MIEH 1JI2A 4PG2C 5HVFB 4R0LA 1XCTB 2NY1D 3FT2B 1Q9OA 2BCKA 3MCLH 1L4IA 4AMKL 2WMPA 4KJQC 5IR1B 3O3AA 1FFPA 5EOTA 2E8YA 3OKLA 5CKGA 3WIHL 1ORSA 1MCWW 3A67L 5HBBA 3MRKB 1LD9B 2PW1A 5IKCA 4HK0B 4U1HA 2RAMA 25C8L 1T1XA 4E0RB 4JRWA 2NQCA 1MHCA 2Y23A 2VNCA 4HX1B 5GISL 5H37H 3GSNB 6FABH 2JK5B 3HZKB 1A1MB 1I4FA 1U41A 4CDHA 5JNYA 2IAMA 3PL6B 4LLUA 2YR3A 1H8SA 5DDHB 5FGBC 3N1MC 1S7TB 4BSWB 1TZGL 1L0QA 5IOPB 1QACA 4KROC 2F8XC 2VDKL 3LN4B 4WCYH 2ZCHH 4R7DA 3LKSA 3O4LB 3C6LD 3MZTA 4M48L 5EBLB 3MJ8B 3MQIA 3GUTA 3T1WA 2IGFL 3HNTL 4OM0H 1M4KA 3ZHLA 2R2BB 4RMQA 4P9ML 1JTPA 1BEYH 4AJ0A 2Q6WA 3QEQD 3QPQC 4B7IA 1SBBA 1MJ7H 2NPLX 5DD6A 5FYJD 4ZTOL 3V79C 4RWYH 3FT4B 3FRUB 3KPRA 1BZ7B 3L3IA 4ONFL 1EHNA 3UZVB 3NZHL 5DJAB 2DKUA 1EXUB 4ZFOB 1DE4B 3VRLF 5CILH 5EU6B 1EGJL 1IAOA 4KI5D 1BX2A 4JN2B 4PS4L 3S37H 1M7IB 1Q9LA 4LCUA 4QY8B 1KLUB 3FFDB 1KIQA 4UDTB 2YWYA 1BBDH 4WI2A 5AWNL 4C4KT 3DX9B 2XG5A 3RVTD 5KVDL 4X4ME 1Z3GL 4LKCA 4WFEE 4U1IA 3C8KB 4IIQA 2NW2A 3C5ZA 2VZUA 2MKLC 4D8PA 4GRLC 4JPKH 5DUPH 3MGOA 2WIIA 2A9NH 3IB4A 2EDEA 3IKCA 2PKDA 3KAAA 4UNUA 2EO9A 2HJLA 2V7HA 5ILTH 1WTLA 3PP4L 3EYSH 2FL5A 3BH8B 3DRTB 4NZUH 1MI5E 3Q3GA 4EI5D 5J0BA 2GTZB 4PD4J 5INCA 1CDJA 1UKQA 2X4PB 3MNVA 4BQBA 1DEEB 4HXBH 3RBSA 4P2RA 4J3XA 4F15B 4U0QB 1XGTA 4GMSH 3CSYA 2JTDA 1H3GA 3CLFH 1FO0H 1CE1H 2ZOLA 2CGRH 2NW3A 3IU4L 4XI5C 4XVSH 1A9EA 4GSDH 4XTRD 2ERJC 3X12A 1BOYA 1JPFA 3NCFB 1FNHA 3VG0H 3C6LA 3UDWA 3NFNA 3HZMA 5HHXH 1KENH 4UT9L 3EHBD 3HS0B 4OGXH 3SDCC 2ZUQC 1FZMB 2ZKHL 2AJUL 2P49B 5EO0A 5KAQG 3HMWL 4XCFH 4YFLF 1YY8B 4H8WL 1NGQH 4Y5YA 2BC4B 5GGSY 4ENED 4OD2A 5EOCH 2OR8A 3T77B 4KJQD 3ILPA 5AYUL 3W11C 5DFWH 1ZA6B 3SDAD 3DBXB 3MLWL 2DMKA 5JO5B 4YHMH 2W0FA 4DGVL 1WGOA 4I18C 3LD8B 3C2AL 2ZOKB 4UNTA 3MSPA 1S7SB 3WXVL 4Y2DB 5LGKA 4YGAB 5CWSB 1KJ2L 3VXMB 4WNQB 4K7PH 5HGGS 3PWNB 1YEFL 3KJ4C 4RMTA 2X4OA 1KJ3H 2W0LA 3UJJH 5GSRB 2J5LC 4X7SL 4BH7B 5K9JL 4H5SB 1D5MB 5CSBA 2OCFD 1IBGL 4D0BA 2VLKD 4OF6A 1BVKA 1Q94B 4QRUB 3W2DH 1YEJL 3S5LB 2QHRL 3MV9B 4U1MB 3WFBL 5FF6B 1AQDB 1RZIB 2QSCH 4WHTA 3ZLQC 2MWCA 2XFXB 1UCBL 4P2OB 3PHOA 1KC5H 4EI5A 3QWRA 1Q0XH 4U3XA 3B2VL 1CXHA 1OLZA 5DJ2B 3QPQD 2QQNL 4OT1H 1FYTA 2CR6A 3B5HA 1T7YA 3EOTL 1BOGA 4J4PA 4QRPE 2DLHA 3TFKC 3TESA 3V7AG 1OAXH 2XY2A 4J12A 2OZ4A 4Y5XC 1HE7A 3ORJA 3QQ9C 1KJMB 4HCRA 2CKBL 3DSNA 5TPWH 1ZVSA 3Q5YA 5EBWB 2A0LD 3ULUH 1MHPL 1VPOH 4E9LA 5GS1C 3I6GA 3VGBA 3RU8H 3H3PL 2IQAB 1E27A 3QUXD 5E6IC 4ZTPL 1U8OA 4QF1A 3VCLA 1YJDC 4N5ED 5ICZA 4DWHA 4WW2C 2H3NB 4L29A 4IS6B 4S1RH 5SWZE 4I48A 2R2EA 1EVTC 2DD8L 4GRLD 5LWYL 3L3OB 5IBLD 1CGWA 1AHWA 2IG2H 4NO0A 3BVNB 1P1ZA 3IJYB 3UTPE 5CEZE 1LO0H 3O45B 1X5KA 4LDLB 4NJAL 3GMPA 3SDAA 4TOYH 4YX2H 3T0AA 1HH6B 1AGCB 4FFZH 3ZMRA 3MBED 3HR6A 5KS9A 5CP3H 1Z9MA 3KPOB 4KJPC 5L2JA 3QUZC 4PRNB 4RA0C 3ZZ1A 1MEXL 3UYPA 3UTQA 4ZOAA 3FB6A 5D72L 5C6TH 4GG6B 1R3HA 3HG1E 3KWWB 5HHQA 3S88H 5DJ0A 1I8MA 4Y1AE 4JN1L 2OJZL 1FE8L 5T1LB 1PG7L 4XI5D 2HFGH 5BO1L 3O0RL 4CBPA 2VLKA 1FNFA 4EN3A 2GFBA 1UZ8B 4LNVA 2CLVA 5CIPH 3SDCD 2GTWA 1Q9KA 2CIKB 1BIHA 1K3IA 1NLBH 3EDJA 2XNAB 5B4MC 4KRPC 1UH2A 1HILB 2XA8L 4C58B 3J7HA 1QFUH 3PGCB 5IB1A 1I9RH 2Y5TB 5F70A 3DGGA 4X6DB 5D5MB 4O9HH 3MRBA 5MEPB 4MAYB 4TSAL 3V2AR 5I17B 3IXAA 3W11D 2VDOL 1DQDH 1XH3A 4R4BB 2I26N 1U8PA 2FJHB 4MWFB 2A6KB 5I1CL 1W72L 3D0VA 4OD1L 3DX6A 4QXGL 1DBJL 1J11A 3S96A 4HKBA 2AERT 4W6WB 4CNIB 1MRFL 1J8HB 5D7IE 1HSAB 2J6EH 4JG0L 5MI0B 4XMKH 5J6GB 2YZ1A 2NXZB 5FUZL 4QRRB 2YK1L 4NHUB 1NGYB 3CVHH 2X5PA 4TRPL 4WY7L 4WW2F 3GMMA 1CLCA 1HDMA 2VZ1A 2HKHL 1I7UA 3GKZA 5HHNA 3CH8A 1F00I 4G7VH 1BHGA 2I60L 4FTVE 2Z92A 1WJ3A 5D1QB 1HHGA 5C0EA 5I0ZA 5DHYA 4JRXD 1R3JA 2LTQB 2YXMA 2O26U 3RNKA 5J4MA 5JTWA 1EJ6A 5KVGL 2ZG3A 1NEZB 5FDWB 5JPMA 1WAAE 1BGXL 4JO2H 1GOHA 3EDEA 3EYOA 3UBXA 4X8JB 4PJ5B 3OXSB 1UEMA 1N6VA 4MHHI 3IDGA 2R4SH 4QHUB 3QJHA 1RZJC 3TFKD 2EDWA 3HE7A 3GB7B 4K7FA 5IUSA 4RCAA 5DZLA 3W9EB 2G9HA 3QQ9D 4UOW0 4X98B 3LKQB 4Z7UB 3V4UH 2Z35B 4D3CL 4M00A 1I1FA 1HN1A 4F7PB 3ROOA 2L0DA 5TDOB 1F11B 5EC2A 3T4AB 3AS1A 4MNGE 5CBAA 3QDGB 4WFED 3H9HA 3ESVF 4RQQB 2GCYA 2YXFA 3LQZB 5HYIA 3O3DB 1RURH 5L2KE 1UVQB 2W0KA 4FQ2H 4Q2ZB 3DUUA 4WUUE 4OGZA 3NH7H 4ORGB 1CFSB 2X7LB 4FXKB 3T0XA 4YE4L 2ADGA 1FJ1A 3BSZL 5IFHL 4XCCH 4U1JB 3QHFH 4HH8A 3T0VA 3KPSD 4KJPD 4PYHA 1HHKA 3QUZD 5EORH 5T1KD 4I0PC 2XZCL 1G6RL 2LAAA 4ZUVA 5F7FA 5I1KL 4YFDB 2VSDA 5E5MB 2Z31D 3V0AC 3W0WB 5LKNA 3EZJB 3GGWA 1MVUA 2HFTA 4F37K 4KUCF 4NCDA 4MB3A 1JWMA 1MCOL 3X3GL 3MFFB 4K7PY 4MX7A 5ANME 2XKSA 4AIOA 1A5FH 5HHOE 3KDMB 3L7EA 4JO3H 1QPXA 4PGEB 2WBJA 3RJDA 3BKYH 4JRXA 4LEOB 5IROA 1F6AA 1IL1B 3IFNH 1D9KC 2XWTB 5HVHC 1EEYB 2J8UE 2EYTA 3S36H 4U49A 4WHCA 3OB0H 2E5EA 3GSOA 2BVPA 3EFFA 4S1QH 3ZKMC 3FCTA 4NZTL 1XF3A 4HT1H 3F62A 1WBZA 5FOBA 2IANB 3NIGE 3Q6FB 1KCRH 5DWUH 3RY5A 4JR9L 3EJZC 3TH2T 1EFXD 1BF8A 4Y0GA 5F9JA 5AUMA 1W0VB 1XGPB 3ZKSD 2EKSB 3QQNA 4NP4H 5ID1A 3ARDA 1RZKH 4IJ3C 3SGEI 1MCEA 5HHVL 3UTSA 5BXFA 4GO6B 4LRNL 3C09B 4H88L 5EBGA 3TCXA 4KUCD 4OSUH 2BERA 2CRZA 1DBKH 4RFNB 1FGVL 3P4NB 3MCG1 1ZT1B 4OIAA 3SGJA 1BBJA 1NCBL 1JNLH 2N7BA 5I8EB 3MCKB 5FXCH 4L4TB 3T4YB 4DAGH 2D7MA 1QFWH 2CLZA 4AEFA 1YNLH 3KPSA 3BPNC 5T1KA 4EQ2A 2ARWA 1FNSL 3WS3B 3DX7B 3LH2H 1QVOA 4P46B 2NY4B 5DRNA 5BQ7A 4QRPD 1BZQK 1FSKC 1IARB 1BAFL 3AREC 5C92A 5DEGB 5AZEH 4HUVA 4G9FD 4F7CB 4YDLC 3JV4B 1J9CT 5HVWA 3QFDA 4OQTL 2WUCH 2P1YA 1H3TA 1NL0L 2VISB 5I8OL 4C56B 1VEMA 1QBBA 4XPBH 4ODBD 4ZYKA 2DWDB 3AGVA 3T0EB 2JJTC 2E6PA 4PJ7A 2VLRE 3WNLA 1CL7L 1VFAA 3MRFB 5F6HI 5SWZD 4U4BA 4L8BA 5JDSA 2EEBA 3OKEA 1IGJA 1FCGA 3V7AE 2JCCA 5FYLH 3UTPD 5CEZD 5C08E 1NFDE 2OP4H 1F4HA 1S9VB 4BQ9A 4DW2L 3OKKB 2J12B 3QWQB 2ICWB 4H1LA 1GGCL 4KVCL 1GC1L 1W72A 2AJYL 5F3HB 3ARSA 4NKDB 3HG1D 3RA7L 2G5RA 2GEEA 1Y6NR 4Y1AD 1YDPB 3DV4B 2YC1B 1KLGA 1MFBL 1QRNB 4ELMF 2BSRB 1ND0A 5FB8B 4JJ5B 3ALPA 4EVNA 3IETB 5GGSB 4BKLA 3WXWL 4JZNB 5IGXH 2V5YA 5CGYD 1E6JH 3BI9X 4Z5RB 4R8WL 4K55A 2C3XA 1K5NA 4YUEL 1D9KD 4G5ZL 5I73B 2IFGA 2VDNH 2FD6H 3GJFB 1RJLB 2A74B 3ZYZA 5DA0B 4MNHB 2O61A 2NLJB 3OL2A 1WAAF 1YMME 2FSEB 4UOW1 5D7JB 1N3NB 3DLQR 2NY5L 5JQ6H 3EGSB 1NC2D 5FM5O 4G9FA 1QLRA 4IOFC 4LCWE 2EYSA 3O6FA 1MCIA 5E2VH 4K8RL 3GJEA 3EJZD 2NZ9C 3DHJA 1ZE3C 4N9OB 1RU9L 3AAZB 3ZSTA 3MJ9H 3G04B 5DVOA 2YEZB 1XR8A 2GY5A 3STZA 2I27N 1U8IB 1TTFA 2HYMA 1A7RH 5HVGB 4FXGB 5HY9A 4KZEL 5C09D 4ZS6C 2EC9T 3SE3A 1RAMA 1AY1H 5DMKB 5I15L 4PJHA 3KS0J 3REVA 5C2UB 1IAIM 3JBG7 4PJ9B 1FDLL 2GK0B 1G9EA 3VFNA 5LJYH 5BZWA 1CLOL 5EIQA 4P5KA 2ENSA 2FGWL 5DUML 4KK9D 1BD2E 1G0DA 4HUNB 5SV4A 4Y4HC 3V5KB 5ERWA 3B9KB 5IB4A 2K1MA 3PDOA 1G6RA 4NCC1 2W91A 4QT5A 3U30C 4XWOC 5BW7A 1F4YL 5EIVA 1H8NA 1NMCC 1VADB 3GNMH 3R1GL 3B5GA 3MGTB 3IVKB 2C1OA 3TGXA 1HK6A 4FOMA 1A6WL 3QNZB 2XIDA 4X7TA 1L7IL 3AY4A 4G6ML 4FQHA 3BKJL 2J8UF 4D2NA 4HQQL 5CSGA 3D9AL 3BIBX 5DS8A 1GGUA 5CP7B 3VXTB 5L2KD 4BELD 4PJFF 1EHLL 4XGZA 4WUUD 1N59B 4MNQE 4Y4KD 3QSKB 4LOUC 4NWTL 1AFVL 5C7XH 3RWFB 4XBGA 3V52L 1HWHB 1YYMH 3PQYB 3NIGF 5FYKE 1RQ5A 5KVFH 4UTBL 2VDRL 3G6DH 1FGNH 2F53E 2GSGA 1QQDA 4LLMA 4YIQB 1J10A 1PVHA 4ZUWA 2B5IC 4HH9B 4ZFFA 3JVGA 3DSFL 4F58L 4YQXL 2IADA 4FZEL 4MXVF 4ZUTB 3FONA 4MYWB 1J1PH 3TP4A 4KHTH 2EDDA 4JFQB 5D6DA 4QNPF 1JMZA 4PR5B 2NX5E 5C09A 1CI5A 4OKDA 1NCWH 3BUTA 2YSSA 3TO2A 1T2XA 1IEHA 4R26H 3D2UD 3W81A 3VH8A 2P24B 4WDIA 5F7HA 4P9HH 1YNTA 5GGTA 3SKJH 4UT7H 4JHBA 3HRZA 2VXVL 2X4NA 1RUQH 4OFDA 2OI9B 3UJIL 3ARRA 4YHYC 1DQMH 1MFNA 2GKIA 3G5XB 5EWIL 1DQJA 4OZHB 3GMNA 5DLMH 2P8MA 3MPCA 2C3VB 3MRGA 1GJIA 3PE9A 1RK0B 5HYQB 4HUKB 4HIXH 1AXSB 5DEFA 5SWSB 1A3LH 4AENB 1I9IH 2YA0A 4G80A 3H9SE 2ZUVA 4QTIL 2Y6SC 2FH6A 2NZ9D 1PY9A 2PXYC 2AEPL 3CUPA 4M1GH 4ZDHA 1JF6A 4OQTA 5JIKA 5ISZD 2HLFD 5GRVL 4NQEB 3PGFH 3DVNB 4MJ6B 1FH5L 1I85C 3W5NA 4HS8L 3WKML 3LQAH 3G08A 4TSCH 4NZRH 5IVXA 5F97E 1KCLA 2WAHA 4GS7B 2F9BT 1WEJH 1DFBH 4ZD3H 3KPLA 3HZVB 3KLHD 4Y4KA 3TBVA 1JGLL 4LMQE 5CZVL 1N4XL 3HC0B 4ZOBA 2OTWA 2X4UB 2R4RL 1IAIH 1A7NL 3H7LA 4RIRA 3WJJC 2R0ZL 4DGYL 2V5SA 1IAKB 2B4CC 2PN5A 4WEBH 4HPOH 3V5HB 2F5BH 4NRXB 1BQUA 4PRIA 5DVMA 4OAWB 3V6ZA 1S7VA 1PG7W 2WUBH 5E9DB 3WNPA 4PGBA 5I71B 1P53A 1CXFA 3STLA 2P5WE 4KKLC 2VQUA 4XWOD 1LE9B 4P5TD 2YN5A 2X4QB 1IJ9A 4NQCE 3X14B 4OGAD 1CGSH 2X4TB 5I6XC 4PJIA 2ADIA 4I4WB 2VDPH 3UMTA 5KJRH 1NDGB 2IH1B 2AV1B 1HNFA 1XR9A 1FAIH 1RUMH 1DBMH 3QISA 5CZXC 5F9WC 4APQC 3VXUE 2VLRD 3S98A 4PY7A 3NACH 5EZLB 4CN4A 2UUDH 3QXDB 4OKVB 4YBQD 3A0OA 3OF6D 43CAB 3VRJA 2CMRL 1OP5K 2X1WL 5C08D 1KTRL 3MJGX 3PGDA 1ZHBB 2FO4B 3FQXB 2LU3A 5J3HC 5EU5B 1KULA 1RY7B 5E8DL 4FFYH 4RISL 5TFSH 1PY4A 4YDKL 5GJTH 4IM8A 5ISZA 3MJ6A 3RWCA 1NGXA 3RZCA 2DIAA 3D25B 3IJSA 3CK0H 5E8NA 2V5RA 4U33A 4EZMA 2XTJE 3IDNA 4Y4FD 5B38B 3S3JA 3FJTA 3TBYA 3GO1L 1ZHLB 1HIMH 1K4CA 3KNBA 2RCSH 4S0SD 4PJCE 4BK5A 4XNZB 1F90L 4P2QE 3BKML 1JRHI 4WI7A 3ULSA 4WFFE 3O3BB 1H3WM 4JKLA 4MCZB 3BIKA 5CJXC 1MJJA 4FXLA 3VD4A 3JWDH 1UWEL 5D8JL 4EUPG 3GSNL 2BZDA 1YMMD 1IQWL 1NCCH 4QGTA 1T6VN 3WFDL 3WHXA 1YECH 5EO1A 4KGLA 2DMBA 4P5TA 2A9MH 1FRGH 1H15A 4PTTA 3FO9A 1QFHA 5L8JB 4PUBH 3DXAA 4YBLB 4ODSL 2Y6SD 3PABB 1ZWIB 1U3HD 2XKNB 3WFCH 1XGRB 1X6NA 2QKIA 4U1LB 4GKOA 2Y25A 4JRYB 5IJKA 5BV7B 3Q1SL 1TVBB 3EDKA 2VDQH 3PUCA 2RBLA 3QEHB 3VXSA 1TXKA 5GPRA 3RAJL 4JZJA 1DSFH 4L9LA 1OM3L 3WL9B 5J12C 1AO7B 3O2DH 2AVGA 4R4FH 5GRYA 5HYJA 3RL2A 1C12A 2OXHA 3ZTJG 1ZHNB 4B0MM 4KRNA 4HXAH 3O4OC 4KUZL 1LHZA 1H3UA 3MO1A 4TNWK 1CICA 5KW9H 2YPKB 1BF2A 5FKAB 4ZMAT 2VXUH 1UT9A 2QHLA 1YMHB 3S8WA 3VFGH 1JNNL 1P4IH 3GDBA 2CK0L 3TCLB 5HDQL 4UQ3B 1DP0A 1BD2D 3FTGA 1MFCH 1CGTA 4M7JL 4U6XB 2YD7A 1JHTB 5CHNA 3ZYIA 3BAEH 4TUJB 2FB4L 35C8H 4LCYA 3MLPA 4Y4FA 3IYLW 1UG9A 4YHPB 4MAUH 4D0CA 1JE6A 1NCTA 2UV3A 1OARL 2WSKA 4U1NA 4XNUL 1A6AA 5CIPB 5IG7B 5CZXD 1FIGH 3AB0C 2VDLL 1JPTH 4YEEA 3B8SA 3H3KA 5MERA 2DKSA 4NN7C 2FR4A 1B6UA 2DMCA 1H5BB 5GSVA 3QCTL 1NMAL 3WFEL 3TA3B 5FYJH 4MNQD 2MHAB 4I5BB 2BVEA 2AQ3A 1VFMA 4BM7A 4YHLH 4BFEA 1AP2A 4TPRH 4BH8B 3MYJB 4PGDA 5JR1H 2F53D 1U3HA 5I8CB 1SVCP 3C6SA 4N0FA 4IEFB 3AFLA 4LU5H 4FMFA 4ZSOB 3BYTA 5LGJB 3QFJB 3EO9L 5IW1B 1MRDL 5JLZB 3E6HA 3MROA 5DRXB 1S7XB 1TVDA 5J13B 3EOAB 3FHQA 3CVHB 3DVIA 3BGAA 4DUVA 3UTTD 1X9QA 3QUYB 1LEGA 4H26A 3FB5A 3DTXA 1OTSC 3MRQB 3ZHKA 4JHWH 3K74B 4FQIL 1QRKA 4XP1L 5EDXA 1AKJA 3HI5L 5ALBL 3IU3B 4U7SA 1D5ZA 4RFEB 3UO1H 3VGHA 5KSAA 2Q76B 5EUKA 2DQDH 1P7QD 1DANT 2DBJA 1S8DA 1OOAA 4TULH 5DRWA 2JB5H 5I1IL 4M7ZB 1R5IB 4AT6A 1QSEE 4HW6A 4U7KA 4P0DA 2OL3A 2B1AL 3V0WL 1N5AA 1T1YA 5LGHL 4TVPL 1AHWC 1F6FB 5D7LE 2C26A 1FN4A 2AV7B 4EDXB 4JM2A 3H9SD 2V2WA 3JSSA 1UKSA 1YNKL 4P57B 3O41A 3OHXA 4X80L 2PYEE 1GOGA 4HCRH 3DMMC 3BDXA 4JO1H 1ED3B 5IB5A 4JLRA 1K8IB 2IBBA 3EO0B 2DQIH 3VI3E 4PJDB 1HXMB 4LCIH 5TQ0H 4I3SH 4MXWL 3MA7A 1I75A 3VWJD 4OZFB 3UYRL 1QHOA 4GBXD 2A83B 3WUWB 3BMVA 3U2SB 2ESVB 2GAZA 3QUKA 3VXRD 2XG4A 1S5IH 5DJ6A 3LIZL 2QSQA 3C2SA 4G7YH 4EN3C 2DDQL 4M7LL 3MNZB 1AD0A 2I5YL 5EG6C 5AAMA 3WSQH 2HT4D 3L5XL 5IF0A 1LE5A 5JW3L 1QPPA 1QLFB 3QNYA 3QT2A 2AJVH 4OLYL 4TYUA 5IJVA 2FH8A 4M61A 3FQRB 4NQUA 3TWCL 3D0LB 1UJ3C 5F7EH 3IDXH 4Y19E 4RRPG 1S7QA 3ZTNH 4O02L 1OAKL 3ARGC 3N06B 4JHAL 2EO1A 5A16B 2P5WD 2VAAA 2EZ0C 1OF2A 1Q9WB 3UTTA 1MWAH 2BOBA 4XP6L 4W4NA 1YY9C 3O9WB 5DJDA 4NQCD 1HI6B 3ARFD 4Y8AA 3U0TA 5TDNB 2WLZA 2DYPD 5DJ8A 2W92A 2Z4QB 2H1PH 1IGMH 4TTGA 2J1KA 2G5BA 4KH2A 3HMXH 2YPLB 3VXUD 4LLVB 5I1HH 1V7ML 4JGJA 5EBMB 2YUZA 5AD0B 4PPTA 1IC5L 2Q8AH 5SV3A 1Q1JL 3GSNA 2DQJH 1OY3B 3BP7A 4L3CB 2SEBB 1U8LB 2ICEB 4HKJA 5DMIH 3LSOB 4LVOB 3TIEB 2FBJL 1AI1H 3HN3A 3QIUB 4JY6B 3ABZA 3QIWB 4FQ1L 1LP9E 3OGOE 5I1GH 3MLSL 3SO3B 3QDJE 3ZKXC 3O4LA 5DC0A 3RHWF 1RIHL 4IRJD 2DQEL 1NFKA 1KN2L 1UQSB 3VWJA 3X3FH 3OR7B 3EKCA 4LHUA 3SDXA 1UH4A 2V9RA 1NCUA 1TNNA 5D70H 3VXRA 2XTJD 1IM3B 4OZGB 4MA7H 5IMMB 3S97C 5CJQL 3VRIA 3P2TA 5IEHA 3OMZA 4P2QD 3FRUA 5KVMC 4WFFD 5DJAA 2FO1A 1UM4H 5GQBA 3L95B 4U0RB 2VL4A 4XMLL 5CBEA 5EU6A 5DK2B 1KEGH 2EDBA 4H8WC 4NUGH 5FA4B 4BQ6A 2UYLB 4XP9L 2C1PB 4G42B 2ADFH 4HF5L 5K33A 4UINL 3DX9A 1JWSB 4YHNB 5JW4R 3LS4L 4ODUB 1B90A 4ZPTB 1WK0A 2I07B 2ZSWA 5FHAH 2YUVA 2MQ3A 3T2PA 3ARFA 4J6RL 2WQRA 3M45A 1I1AB 5D71H 1F3DJ 3B9VA 3WMSA 3DROA 3HNSH 5FKPB 3C5JB 1PD6A 4KTDL 3VXUA 3WS6C 1BJ1J 4AEHH 4TQEL 1MJ8L 3TPUB 4OLVL 3DRTA 1CDCA 1LO3L 4DVBB 3WN5B 3TBTA 2F58H 1S7RA 1RJCA 1P6FA 4XVTL 1JRHL 3I75B 1DEEA 4GT7A 1ORQB 3LS5H 2WBJC 1CD1A 1A3RH 1CS6A 3P4OA 2R15A 2Z8SA 4DZ8B 5AG9A 5MEQB 4N8PA 4BYHA 4OGYL 2GITA 4UB0L 1TVHA 4HDIA 4JANB 5D2LB 1HWGB 4KAQH 2VMFA 3HHRB 1XF1A 4PLJC 1KPVA 3EJJX 4NRYB 1JGUH 1VENA 4IRJA 1OP3K 3ARGD 3QG7H 3BZEB 3HS0A 4O00A 3O2VH 1E28B 1YY9D 2VUYA 3MRCA 3CDFA 1NJ9B 1HSBB 5FV1L 4KV5E 1SM3L 3N85L 3V5DB 3PV6B 1DANU 1ZA6A 3DBXA 4UMGA 2I25N 5DMYA 3VXPB 1W0YT 2GQHA 4POZC 1ONQB 2Q86B 3KPMA 4HWEL 1I9JH 3DWTA 1U58A 1DN0B 3CFEB 4R6UA 4WNQA 4N1EA 4LVHC 1DEDA 1V5JA 3PWNA 5J89A 5TE6L 3RTQB 1MCRA 2AEQL 3SQBA 3TYGL 1P84J 1LK3L 2MOVA 3ZT7A 2JB6A 3I9GL 1D5MA 1MJUL 1QFPA 3SDDD 1NEUA 4NNYB 4UV4L 1Q94A 5D2NB 3DHMA 4QHMB 2YRZA 4GRWH 3WLBA 1HKLH 5FF6A 1AQDA 2R0WL 4FQXC 2NY2B 4N0UB 3JV6A 1MVFA 1RUKL 2FNBA 4P2OA 5BMFL 1FNEA 3UPRB 3MREB 1CFVH 3HZYA 3NN8B 4B5EA 5K9KA 3ULVL 4ZNEA 4PJFB 4HZLB 2NY3B 1UM5H 2Y72A 2APXA 3O6KH 2ATPA 4FA8A 4Z0XA 1CBVH 4LHQB 5H35B 3LEVH 4MDIB 4XP5H 3LDBC 2YUWA 4ERSL 1D5XB 1QSED 3GM0A 1KJMA 1E4XL 4YXLL 2B1HH 2JJVA 4ESKA 1UA6L 3W39A 5F8RC 2MPAH 4D0DA 1KXTB 4EQ3A 4IRZL 1PYWA 1U8NB 5D7LD 1FL5B 4L5FL 1C7SA 4R2GD 5HYEA 1AR2A 2D03H 4H0GA 4Q9RL 3MRJA 5E56A 3O6LL 5IMKB 2YD3A 1FG9C 2W0PA 1JNJA 3QRFM 4F8TA 2YN3A 3LKNB 1HEZA 5DK3A 1YYLH 1DL7L 1OTUD 4HKXA 3MRPA 1S78D 4NDMB 5GGUA 2VN4A 4LLYB 3MLVL 4JHZA 2X44D 3MV8E 5IB3A 3KPOA 2AXFB 4FG6C 4PRNA 1U6AH 4E41A 5EOQH 4JY5H 2QSVA 1QSFA 2W9DH 4Z77A 4P3CH 5I1AA 1ZK9A 4XCYA 5I66B 2Y9RT 4XPTH 5DSCA 3CMOH 5JOFB 5IK3B 2V7NA 3VXOA 2HKFL 1CDGA 3ECBA 4HHAB 1WV7T 3MLXL 2Y36L 2QTEA 2DQTL 3SDDA 4CMHB 1OB1A 1LP9F 4PLNC 1Q0YL 4H1LH 3PWLB 4ONHA 5DMGC 4J3WA 3I3EA 1A6ZB 4Y19D 4M6OL 1UZ8A 2HH0H 5ACZA 4ZXBB 2IBZX 4NO5A 2XNAA 1HILA 3UPCA 5TE7H 2Y5TA 4LQFH 1A14L 5HI3C 3MV7D 4DVRH 3ZHDA 2NY0B 3S35X 5E5UB 2YHGA 2BDNL 4JFZL 1MNUL 3B3IB 4MDJB 5I17A 1TQCC 5DJXB 4CUCA 2CDGA 1A2YA 1JWUB 3E8UH 4R4BA 2YD4A 1AIFB 1NMBH 4POZD 2FX9L 1P5UA 1I3GL 4KQ4H 2A6DA 5E2WL 3HUJB 1GXEA 3JWOL 5DD5L 5K59E 4Z7NF 2BX5A 2DBLL 2JCCF 2XN9D 3PNWB 2X1PA 3WE6A 3IDMB 1RZJH 4LLDB 3RP1A 4QRRA 3MR9B 4NHUA 5E94A 2BFVL 4JKPL 1A4KA 1RZ8B 2ZPKL 3CVIH 5E08L 1T1ZA 3QDJD 3RRQA 1VCAA 3QO0B 4PJAE 3RDTB 1I7RA 3MLZL 2CXGA 3QZWG 1FP5A 4NQSB 5D1QA 2JJSC 4HIJA 4HWBL 3CFKB 4QHKJ 2C7UB 1FFOB 1D3CA 3ME0A 4U1GC 1MHEA 1NEZA 1CFTA 4Z7QE 3TZVB 2I9LB 4BZ2H 1G9NL 5CEZH 2A38A 3AY4C 3V8OA 4KZDL 1WBYB 3W9EA 2R2HB 2J88L 4ZAKD 4FNLH 3Q2CA 5SWQA 2CDEB 3KXFB 1NGWB 5EB9A 5C0BD 5JIIA 1EO8L 4PRPB 4PY8I 2AKRB 4JQVC 5L0QB 2HRPH 1U8KA 4HBCL 4LVNB 4HG4J 4PJGE 3B2UC 3DO7A 3F58H 4LARL 4XNMA 4OCLC 1ZV5A 1RJYB 5EUOE 4XBEH 1ZVYA 2XWBA 3MV7A 1M05B 4HLZG 3LQZA 5FA3A 1XCQB 4HIEA 3G6AA 4KV5F 2PNDA 5I30H 3HC4H 4K3GA 1OAQH 4R7NB 1E0OB 4WI9A 4KKCC 1R3IL 4FXKA 2ZCKH 3IRZA 4GG8A 1NBVH 3G5VA 1QD0A 2QEJA 2AK1L 4L3EA 4GRMA 5IQ7L 4FQJH 4FG6D 1L7TL 1LILA 4R0LB 1P4BH 1Q9OB 2BCKB 4F80A 3CIQA 2C3GA 2XN9A 3O3AB 1PSKL 5HGDA 1UJTA 1MREL 3OKLB 4X6CB 1J1XL 3QXAA 2QBWA 1ORSB 3DYMA 1K4DA 2ZJSH 4KDTC 3MFFA 4MQSB 5IKCB 4P4KA 4U1HB 1T1XB 5DMGD 1MHCB 1KFAH 3WEXA 5JNYB 2ATKA 2IAMB 4IRSC 1F3JB 3REWB 4XXCC 2KQMA 3ZE2F 1MPAH 2F74A 1S9WA 4XP4H 2XWTA 1EEYA 5D1ZC 2B7DT 4W4OC 4M1DL 5HI3D 3D69A 3U7WH 4R7DB 3LKSB 3BFOA 3VGAB 1F4XH 5A2IH 1LWRA 3CXHJ 4LGSB 1DQLH 5GGTH 4BZ1H 6FABL 2WWMD 4ZAKA 4Z7WA 3BGFC 1CLZH 2Q6WB 5C0BA 3CFIC 4HWUA 3TM6A 5A43C 5DD6B 4Q6IC 1CVRA 2Q7NA 3KPRB 3L3IB 4GQ9L 4HBQA 2ZCLH 4WO4C 3KYOA 4ALAH 2FHBA 4WCYL 2ZCHL 4M9PA 4NKIH 3WHE0 3PDDA 1NGPH 2VLJE 1CFNB 5EA0L 1IAOB 1BX2B 1AXTL 4HUXA 1BFTA 4OM0L 1Q9LB 4LCUB 5EH1A 2BNQE 1KIQB 4GAGH 5DUBA 4L4TA 2GJ6E 3QG6A 3T4YA 4OZIE 1SJVA 4K94H 1GC1C 1MJ7L 3GBML 2YPVH 3VFTB 1DBAH 4U1IB 4WGWB 4RWYL 4IIQB 4PG9A 3C5ZB 2Q3ZA 4O58H 1I8IA 4J7RA 3RIAK 3QQ4A 1EEQA 4D8PB 3FRPG 1P7KA 3DX7A 4F7TA 3BH9B 3MGOB 2WIIB 4EIGB 1TJGL 2HT2D 2VSCA 3IKCB 5FCSH 5CILL 4ONGH 1QO3A 1QOKA 3S37L 1AGBA 2V7HB 4JQXC 4XH2A 2K7QA 4F7CA 3S5LG 2FL5B 2MJWA 1LDPH 4YDVB 3Q3GB 3OXRA 5INCB 2DLFL 3MNVB 1J12A 1A6UL 5DYOA 3MOBH 1RJZA 4C56A 2XZQL 4P2RB 4XX1G 5DD1L 1X5ZA 1DTUA 1XGTB 2DWDA 3CSYB 1NAKL 3TYFA 5DUPL 5I1LB 5ICXA 1Q72L 2HWZH 2NY5C 2ZOLB 1JZ6A 2A9NL 3QI9A 1T2QH 4X99A 2NW3B 1A21A 1A9EB 32C2A 4XVUC 5DC4B 1JPFB 5ILTL 3C6LB 3NFNB 4RMWA 5F1NA 3EYSL 2A73A 4PRDA 3HZMB 1YEGL 4JVPA 4YEFA 2DN7A 3WO3B 3ARXA 3PWVA 1S9VA 5EO0B 1CFQB 4Z6AT 3QRGH 4HXBL 3FQWB 4JGMA 2IPKA 4OLZL 3D48R 4JEGB 5DD3H 4Y5YB 2CSPA 1KCVL 3QEQB 3TN0D 4HUUA 4OD2B 4HUWA 5GGVH 3BW9A 3CLFL 1Y18A 4MA1B 3EZ8A 2R1XA 1KGCE 3ILPB 1FL6A 1B3JA 4W70A 4DFHA 4HPYH 5ESQA 5B8CA 4CVUA 3VG0L 5T1MA 2W0FB 2DM4A 4WFHD 3VFRA 1KENL 3O81A 5GZOC 3MLYH 5IM7A 4JJ5A 2O5XH 3L9RA 3L6FA 1Z0NA 3IETA 4V2CB 3F12B 4XCFL 4PJAF 1RIUH 4NUJB 1QFWI 4PJ8D 4IRSD 4N1CA 1NGQL 4Z5RA 1J18A 4GAYA 2YD1A 4ELKA 2HJFA 5EOCL 4MQTB 4JAMA 4L8SC 1FZKB 3UCRA 1A4JA 4O2FA 2V5MA 2GUOB 4Z7QF 4D0BB 4YHML 5IJKC 2FSEA 5J11C 2APBA 1BVKB 3D3VE 1TJIL 1O7SA 4YWGL 1ZT7B 4WHTB 2X4SA 1J0IA 2NY7H 1P84K 4YXKH 3PHOB 4EI5B 4K7PL 1SEQH 2IC2A 2BVQA 1FYTB 3UJJL 1BOGB 4IHOA 5C0CE 3QH3A 2HMIC 3O3EA 2W1NA 4WO4D 4PJGF 3RUGE 3G04A 5EC1A 3H0TB 2D7NA 5CD5C 4CU7A 5FM5M 2DQUH 1TPXB 4YHOL 3W2DL 4DUXA 1HHIB 1ZVSB 5GS2D 2QSCL 3I6GB 1KC5L 3JTTA 4LSTH 1HOCB 1Q0XL 5DGRA 1E27B 1ZLUH 2VXTH 3WIIH 3QHZH 4OZ4A 3VCLB 5F1OB 4MCYB 4MZ2A 5ICZB 3HFMH 5D6CA 4S0TD 2GT9A 3JUYA 1JTTA 3TN0A 1GPOH 5ESVB 1OAXL 2N56A 2R2EB 4TNWF 3GJFK 1FPTH 1YPZE 2X70A 4KK8C 4NO0B 3B9KA 3SDAB 2Z8WC 3GMPB 4YDJA 5TPWL 3DECA 3RVWC 3ULUL 3IXTA 1VPOL 3B6SB 4MB4A 1KELH 1G7IA 5KS9B 3RU8L 4KQ3H 2DS4A 5BV7L 3Q5OA 5L2JB 5KSBA 3UTQB 2VIRA 3B83A 4PJ8A 3FB6B 3QBTB 4JREB 1R3HB 4KMTH 2JIXD 5GRZA 3GMLA 1MWAB 1O5DT 3FO2A 4OJFH 4FABH 1WT5C 3BP5A 1I8MB 1ZGLA 2XV6B 3MTRA 5LCVH 2IG2L 4L1HA 1NCAL 1MCCA 4LCCC 1LO0L 2R29H 3NABH 4XVUD 2IPTH 5E2TH 3VXTA 2VLKB 4XC1H 2GFBB 1M6OA 5E1AB 2CLVB 4M7KH 5TH2A 1BQLH 2GTWB 1Q9KB 2XQBL 2MNUA 1QYGH 1DDHA 1UACL 3U9PL 2CR3A 3CCHA 2B39A 2UVFA 5C6TL 5IB1B 3EFDH 3DGGB 3WHE1 2GW5A 5IW6B 4BQCA 1CZ8L 3MRBB 4M93C 1DLHA 5DVKA 3B5TA 5GRJH 1ZANL 3IXAB 4P2CG 4ZUTA 2FECI 2HFGL 4JFPA 4ODHH 1XH3B 5FK9B 3SBWA 2J3SA 4CGTA 4Y16C 5GRUH 4JFQA 2PO6C 3IJHA 3S37X 3D0VB 5GZOD 3DX6B 5DI8B 3GSXA 5GGRA 3S96B 4HKBB 2XZZA 5LVEA 3QUXB 1QFUL 1IT9H 2FIRT 3LN5A 4K3HA 2DL2A 2EIBA 4O9HL 5IVZA 3VWKC 3AM8A 5TGBA 2Q8BH 4MMZC 4OZHA 3GMMB 3TVMC 3SQOH 1TJHH 3LRGA 4P59L 4YFEA 2Z92B 5C0EB 1HHGB 5DHYB 1R3JB 3MBEB 3RNKB 3LN9A 2B4CH 2X40A 4G8GE 3SGKA 5JPMB 2OL3H 4OFYD 5IWLA 4J3TA 3CVHL 2Z0BA 4ACPA 2JIXA 2HMID 2BXZA 3IDGB 3QJHB 4NQEA 5FAAA 2HJKB 4J3VA 4MJ6A 3HE7B 4K7FB 5CD5D 2BK8A 1OGAA 3VDAA 4G7VL 2G9HB 2VLJD 4EDWH 4LPTA 1J0HA 3KVQA 5MP6L 3F7YA 1I1FB 1X5AA 3HZVA 5CEYA 3ROOB 2FCBA 2GJ6D 3S7GA 3V7MA 3VGGA 2X4UA 5EC2B 3BZ4A 5ETUA 4JO2L 3SGEH 5L88H 3I2CH 4PJXA 2P47B 4NRXA 2R4SL 3IAPA 1XIWD 1L9MA 1WLHA 3IFLH 3D5OF 1J0JA 1T0MA 4KK8D 5DC9B 5JW5A 5A3IC 1I3RB 4DFIA 4AZ8A 1DR9A 1FO0A 2ADGB 4HG4K 5E1HB 3V4UL 1FJ1B 2EYRB 4WU7A 5GGVY 3UAJC 1MCKA 4MA8H 1T7WA 3SE9H 1NDGA 1QTYT 4ZUVB 4K7PX 3VXME 1MLCA 4NJ9H 1CIDA 3O8XD 3PL6C 1INDH 3ZKNC 1RURL 4TVPE 3GGWB 4K9EL 3BEWA 1MVUB 4JM2F 3GBNL 4K71B 1JWMB 4RSVA 5E8OB 3GEWB 1X5GA 4MX7B 3WBDA 1UB5A 3L7EB 5C2BH 2HTKD 3QHFL 1BFVH 2H32H 1L9NA 4NOBA 3TJHC 2DICA 1SEBB 3P0VH 4JRXB 3MV9E 4DN3H 1QBMH 1ZHBA 2FO4A 2OMNA 5T5FL 2BVOA 1RFDH 3KYAA 4HC1H 2EYTB 4RGMB 3BHBB 3SE8H 4XX1E 5JDJA 4ZPVA 2AABL 5BRZA 2BVPB 4NNPL 1KGCD 1XF3B 5DGQA 1ZXQA 1WBZB 5H94A 1T89C 5FOBB 1A1NA 1A5FL 1DQTA 4V2BA 2PO6D 3CFDA 5F7NC 3TBSA 1ZAGA 3AROA 3CX5K 5AUMB 3IFNL 4GRWB 3DETC 3ARDB 2GYSA 3S4SA 3S36L 1ES0A 3OJDA 3UTSB 5BXFB 2H45A 4Y7MA 2DTML 1N8ZB 3IRPX 2Z8VC 5CZKA 4GLRH 4S1QL 5DJZB 4MCZA 4HT1L 4N68A 1XIWA 4WWID 4LSUL 4N8CH 1BBJB 2QADD 1HNGA 5DWUL 1JFQH 2HLAA 1IKFH 3D3VD 3MBXH 5JXEC 1NAMH 4KPHH 2CLZB 3C5SB 4L4VA 3PABA 3KPSB 1JZ4A 1RZKL 4RAUA 5T1KB 2AJZA 1CXKA 3OZ9H 3GI8H 4XRCA 2XACC 2M8XA 1QVOB 4OSUL 3O8XA 4GG6E 5C0CD 1DBKL 5DRNB 2Z31B 4F15C 5BQ7B 1OWRM 4WWKD 3NVQA 4WTZG 3QEHA 4CU8A 1UCTA 4HUVB 5T5NG 3QFDB 3SDYH 5C70A 4AL8H 4KHXH 4XB7A 2FHCA 4CU6A 1YNLL 2X41A 2YRPA 4LLWA 5E03A 4ZYKB 2E8ZA 4PJ7B 2YPKA 4HFWA 5CP3A 1V3KA 3LH2L 2AJSL 1CQKA 4L8BB 4X6DE 5D5ME 3QO1B 5AZEL 5JDSB 4HS6A 1QSVA 5A3ID 2WUCL 1X5IA 4OI9A 3T3ME 1BJMA 1QNZH 1B0GB 1WICA 3UAJD 5DEZA 3LD8C 4XPBL 5DFTA 2DQHH 4H1LB 5JUEH 1EA9C 2MKWA 4Y2DC 2P46B 3CDYA 2FEDC 2X2YA 5F7DA 1J8HE 1FNAA 3I3BA 5HGBA 3SKUD 3K80A 3ZKND 4GUPA 2ED7A 5A2FA 5FYLL 1CU4L 1KLGB 3KR3H 1GGBH 3UJTL 5KSUB 4U6HA 1ND0B 2R39A 3U48A 1H3PH 4EVNB 4BKLB 5DJCA 1AE6H 3T3PE 4I5BA 1YEIL 3TJHD 5E2UH 1K5NB 3P30L 1D6VL 4DGIH 3T04D 1X5XA 3PWPA 3T0WA 4F9LC 3TEUA 4BJLA 3TO4A 2O61B 4PBVC 3RWGA 2DQCH 3B9EA 5LGJA 3QFJA 2J6EA 3PHSA 5F1IA 5IW1A 1VKXB 3MUJA 4LEXH 4WWKA 4PJ5E 4RMSA 3VA2C 4XMPL 5FOJA 43C9A 3EOAA 3CVHA 4G9FB 1MCPH 1QLRB 1XMWA 2EYSB 3O6FB 2PTVA 1E6JL 3WIHH 4Z7UE 5IMLB 5TQ2L 4LSDA 4HKZB 5BCAA 1NANI 2FD6L 5H37G 5EPMA 4Q9QH 4JB9H 1XR8B 3STZB 3QDGE 3SKMA 1T5WB 4X7FC 1KUMA 5JQ6L 4ODWA 5HY9B 4ISVA 5F1SA 2D7PA 1J05B 1TZGH 4I3GA 2UZIH 2VDKH 5JXED 3BRFA 3P40A 5CLTA 4PJHB 3REVB 1SYSB 2HRLA 4EDXA 3VFNB 3NCJH 5T3XE 5BZWB 8FABB 3TIDA 2DL9A 5MEND 1T66C 4G8GD 3HNTH 4NRZA 5E7FA 2D7QA 1ED3A 4ODVL 1J0ZA 2FECL 1JF5A 4P9MH 1A7RL 1F45A 5ERWB 5IB4B 3PDOB 4PJDA 3KPPA 1MSPA 1G6RB 1HXMA 4O2EA 4QT5B 3W0WE 5C0AE 1RUAH 1AY1L 1XGUA 2ESVA 1J7VR 4GAFB 3MRHB 1ROWA 2C1OB 5HHMD 4LNRA 3N1GC 4Y5VA 4X7TB 2EICA 4F9PC 2WQ8A 1JBJA 3SCMD 4B53A 5DS8B 3QJFA 3D0LA 1U3YA 2AXJA 4XGZB 4MAYC 3N1FC 3ULVE 5C07D 4OI8A 5A16A 2P43B 2IANE 2C4FT 3CXDL 4HFUH 3WJLA 1WITA 3O9WA 2GSGB 1JYXA 1QEWA 1QQDB 4LLMB 1HI6A 2OX5A 5F7KC 3CFJA 3SO5A 5M94B 4Y2DD 2VZOA 3PP4H 2VERN 4HZAA 4ZUWB 2GY7B 5D7IB 3VXMD 4ZFFB 4IJ3B 4UTAH 3TC9A 2IADB 5IFAH 5MI0C 3SPVA 1ADQL 1VEPA 2NXZC 4TVPD 4OFVA 5MHSE 4LAQH 4NGHH 5C7XL 1T1WB 1FFNB 5C09B 2YSSB 3TO2B 4POUB 1BPVA 3RWDA 5KVFL 1ZKAA 3VH8B 3QEUA 1FGNL 4WDIB 2VQTA 1TMCB 1YNTB 2HG5A 1T21A 1U8LA 5D1QC 2DM7A 2H9GA 3HRZB 2X4NB 3Q48A 5IT2H 2LTQC 3QIUA 1KN4L 1S9YA 5MENA 1DQJB 3GMNB 2VR5A 2P8MB 4LKXA 2MSPA 1J1PL 4JFDE 1IGTA 3BOVA 3VGFA 3MRGB 4U05A 4HMDA 5DEFB 3C8HA 4OFIA 4QLRA 2VWEE 3L5HA 1NCWL 2UWEE 1V7NH 2Q7YA 5AZ2H 4G80B 4R26L 5AYUH 3NFSH 1MCDA 4DGVH 5GHWL 3LB6D 1WSST 1RUQL 4CJ1A 5IMMA 3CUPB 5C0IA 3C2AH 1T83A 3BEVA 3HCVA 3L5JA 2RFXA 5DLML 3T0EE 2V2TA 1KJ2H 3KLDA 4ODTL 3E2HC 3MUHL 3G08B 1YEFH 4YZFE 2V17L 4OCXH 5IVXB 4X6DF 4A6YH 2XPGA 5D5MF 2BSTA 2FYYA 3OBAA 3KPLB 4Y4KB 3OB0K 3TBVB 5D1XA 5C07A 5B38G 5K9JH 4ZO6A 2OTWB 1JWSA 1IBGH 2K3TA 4RIRB 3T3MF 3U7YH 1FC1A 4M1GL 2Y07H 2H26A 1OWWA 3V9FA 4P4RA 1MRCL 3PGFL 1UXWB 4NPYB 4FP8L 3CFCL 3V6ZB 1S7VB 4QXTA 4PGBB 3LQAL 4H20L 3T8XA 3B2VH 4NZRL 3STLB 4OCYH 3JTSA 4YFLI 3F6IA 1A8JH 2H8PA 2VJXA 1JZ8A 1QRNE 2E27H 1LEIA 4DVBA 2EXYD 3I3DA 3QDMA 4PJIB 2ADIB 1IAIL 3D2UB 1RVFH 5SX5K 1OPGL 1WCQA 2LVCA 4WEBL 2CKBH 4HPOL 3PV7A 3AVEA 4MJID 2VZ3A 4PY7B 2WUBL 3H3PH 4ZTPH 4K3EH 1XF2B 3LMJH 4XNQA 3GKWH 4WI4A 2LU7A 3TF7C 2GJJA 4MAYD 5FIEA 2D0FA 3ULVC 1CGSL 3RVUD 2VDPL 1E28A 2WIMA 3PGDB 1BLNA 5C86A 1FAIL 1DBML 3LKRB 1NJ9A 3LRHA 3I50H 5EN2B 4YK4B 1B2WL 5ISZB 1BQSA 4WUKH 1MEXH 3TT1H 2AQ2A 1NGXB 3BE1H 3RWCB 3VXPA 2NXZD 5C3LD 4NQVA 1XF5A 3C09C 4TSBH 1ONQA 5D72H 5DURD 4P3WA 4RFNC 5E8NB 3ARVA 3IDNB 4N8VA 1MHHA 2BNRA 1OT2A 2WWKT 3TBYB 1FE8H 1K4CB 4NBYB 2FWOA 1PG7H 3KNBB 4X7CC 1K2DA 5BO1H 2V9QA 4FFYL 3ULSB 3RY6A 5TFSL 2I9TB 2UZXB 5GJTL 1W8NA 5GZNC 1MJJB 1EERB 2YOCA 4U6TA 4HV8A 4C57C 5KN5A 2CIIA 2W07A 4NNYA 4JZOB 5D96B 3MJ9A 4PIRF 4P23D 3SY0A 1JYVA 4P46C 2NY4C 4PJ5D 5F8QC 3WHXB 3NPSB 5EO1B 4QHMA 1XFPA 2VWEC 3L1OH 3ALWA 4P5TB 4X9IA 1H15B 4PTTB 3FO9B 4TSAH 1WBXA 1G7JA 1HIML 4I3RL 3STBA 1KV3A 2RCSL 2OR9H 3DXAB 4V1DA 1NMCB 3NN8A 3AMLA 2QKIB 3GMQA 1B0RA 3CMGA 1F8TH 2HFEA 1F58H 3JWDL 3UC0H 4OD1H 4MJIA 1HHJA 2P4AB 2YKLH 4QXGH 4OM1H 3VXSB 1QBAA 1CT8A 2F15A 3C08L 2VLRB 3T0EC 4JZJB 3QDGD 1MRFH 4MDIA 4JG1H 1X44A 1NCCL 4L9DA 2P5ED 1YECL 4I9WE 5HYJB 3RL2B 1CCZA 1C12B 1FRGL 2A9ML 1RUPL 2WWKO 2NY6B 3C60A 7CGTA 4PUBL 4W6XB 5C08B 1C08A 1KPRA 4S1DC 2H2SC 2P8LA 4OD3L 3MO1B 3WFCL 1FL5A 5I1JH 3PQYE 2P42B 5E8PA 5T3XD 4Z7VA 2VDQL 1MIMH 1CLYH 1DSFL 4A2MA 3FTGB 5TE4L 4K23H 1NSNL 1JNHB 5CHNB 4R4FL 3U9UA 4G6KH 3W0WD 1BGXH 5C0AD 5F96L 5MEOA 4LCYB 5BJTB 4LLYA 4BQ8A 4NZJA 2W38A 1ZGLM 3ZTJH 2C5DC 4Y4FB 1CG9A 1FHGA 1NC4D 1UFUA 4I1NB 4F57H 1GGYA 5KW9L 1JIBA 3HAEA 4PJBA 1A6AB 4Z78B 5I66A 5BS0A 1P4IL 4IDJH 4D3CH 2APTA 1MFCL 5I73C 5MERB 1A6VH 2FR4B 2D7TL 1PZ5B 4OZFG 3BAEL 5GSVB 5KVEL 1YMMB 3F7RA 3FT3A 5LAXB 3WUWG 5D7JC 3K4DA 1J0KA 3ARBA 1HCFX 3CDGA 5SWSE 3ULVD 2GIYA 5ABDE 1T20A 1CD0A 1AP2B 2IAND 4ZXBA 4JKKA 1Y0LA 3L5WA 2FATH 2NTFB 1G9NC 1RMFL 1U3HB 1JK8A 2MMXA 1JPSL 4YE4H 3C6SB 1IE5A 4N0FB 3BSZH 1JPTL 5FYJU 2CDFA 3O2WH 1DCLA 4GOSA 4L8CA 3PJSA 5EULV 1AIFA 4JGUA 5I1KH 5MHSD 4WTWA 5FYJL 2P5EA 4H26B 4DJMA 3FB5B 3DTXB 5JQHC 1J88A 4YHLL 1FLRH 1D5ZB 5JR1L 1OGTA 1OAUL 5EUKB 4YHIA 1IVLA 1PX3A 1CK0H 2C4XA 3T1FA 4LU5L 4I2XE 2JLLA 4PJ9C 5ID0A 1OTTC 2E9JA 5DRWB 1DQQA 3G6JA 3RWEB 5GZND 4AT6B 1Q8MA 2OL3B 4GMTH 3MJ7A 4QRTB 4JFDD 2D9QB 5E9DE 4PJEA 2NY4D 3B9KC 2E9WA 3CAFA 4WEUD 3QB7C 4JHWL 2C7UA 4JM2B 3UO1L 1JN6B 1NC4A 2DQDL 1BQHA 1L6XA 3O41B 3OHXB 3HPLA 3CJJA 4F7EA 1MLBA 2NXYC 5IB5B 4JLRB 1VESA 2JB5L 4UIKL 2CJUL 4LIQL 5DK0A 3MA7B 3FFCA 5T3ZL 3T0ED 1WIOA 1CTNA 4BZYA 5JHDA 2JELL 1I8KB 3GMOA 8CGTA 1WWAX 2AGJL 5HHVH 5JOPE 1SMOA 2GAZB 1UWXH 3ARZA 3QUKB 3IFPA 2Y06H 3NCBB 1A7QH 3KXFA 4J1UA 1TTUA 3HC3H 1TETH 4S1DD 1QBLH 5T5NF 1NCBH 4HCRL 4JO1L 5IF0B 1LE5B 2F53B 1WZ1L 4HJJH 4R9HA 1RV6X 2F5AL 1KCSH 1I1CA 3DARA 4NBXB 4M61B 1F4WH 2X05A 5EIIA 2OBGA 1E4JA 2PETA 2MCPL 1QSZA 3HE6D 4Y8DC 1G7MA 2OQJA 4ZUSB 4FQCL 5CMAA 1FNSH 2VAAB 4OBRA 1G7HA 1OF2B 3UTTB 2BOBB 4NQDA 3U0WL 2L4OA 4G7YL 4HJ0C 5DJDB 3WSQL 3U0TB 5DJ8B 4Y2OA 3NPZB 2AJVL 4M62L 2CLRA 4X6CA 2G5BB 4KKBD 3CU7A 5I8OH 5F7EL 1WISA 3PWJA 2OI9C 4N0YL 4QOKD 3D39E 1OP5H 1MWAL 2APVA 5C0FA 3BP7B 1WFNA 1F3JA 4MD4A 1AQKL 3REWA 5DD0L 5DQJA 2UWEA 4HKJB 2FBOJ 3H3BC 3H9SB 4IMKA 1EMTH 3DUSA 5I9QB 5CJ5A 1IGML 5F7YC 3ULUE 4JE4B 2F54D 3VD5A 4JRYE 3IS1X 5GS2H 5I1HL 4A2LA 4YO0B 2FJGA 3VWJB 2Q8AL 4GBXB 1GC1H 2R0LH 4OCSH 4LHUB 2AJYH 3SDXB 1MFDH 5KSVA 1AO7E 3Q6GL 3VXRB 3EOBA 1WTGT 4GS7C 5DMIL 1EO7A 1SJHA 2UUDK 4NC2B 1MFBH 5IMOA 3VRIB 4KI1A 5IEHB 1NAMB 2DWEB 5TF1L 5DQ9A 4NHCH 4POYA 1W0WA 3WXWH 4K3JH 1A6PA 1CFNA 4OCRH 1WFUA 5CBEB 3X3FL 3ZKQD 4G5ZH 3HE6A 3D85A 3IKKA 5E70A 1GH7A 1ZSDA 3E6FA 4LF3A 4CN6A 4JFYA 5I71C 1JL8A 5EFIA 2EECA 2D31A 3O2DA 3VFTA 2ZSWB 2GK2A 3ARFB 1KEML 5F7UA 2NXYD 1UM4L 3BH9A 3OV6A 3DROB 1VGEL 1VGKA 4UNVA 5T1DH 3VXUB 1PLGL 3IDIA 1RU9H 1JHLH 4YDVA 4QOKA 4UU9B 2EIDA 4OZHF 1X5YA 3TBTB 1S7RB 3QIBD 3B9AA 3OR6A 3INUL 2XZAL 1G1YA 1CD1B 1T0PB 3P4OB 1IC4H 1FORL 1FLTX 3PQYD 5D71L 2A1WH 1PKQA 5I1LA 5IV2A 4X7DC 3HNSL 2GITB 1TVHB 4RAVB 4HDIB 4HS3A 3OX8A 2F54A 5I15H 1KBGL 1FDLH 1RULH 1KPVB 4JFFD 4ZSOE 3CSGA 4AEHL 2EIEA 4X6FA 3I6KA 1CLOH 4IRJB 5DR5H 3FQUA 1NKRA 5DUMH 4C4KO 2NR6C 3LV3A 2ZSVA 4LRIC 1JGDB 1CFQA 3FQWA 4HJ0D 2QV2A 3LS5L 1TIUA 3RPIA 2XTJB 1A3RL 3MRCB 2Q87A 3QEQA 3A6CH 1S3KH 4KKNA 1OT1A 2D0GA 1IGIL 2J8OA 4PJCB 4WU5B 1F4YH 1WWBX 1YEEH 3GK8H 4XNZC 2OK0L 2CRYA 4MXQC 5KANG 3NAAH 4PRHD 1QA9A 4QCIA 1JGUL 3QEGH 1A6WH 3KPMB 3MUZ1 4PJXF 1GGTA 2KDGA 3QG7L 4KMQA 4GJTB 5EU7E 1U58B 4RA3A 3O2VL 1KSRA 2ITDA 3BKJH 3F12A 3MXWH 4NUJA 4ZOEA 15C8L 3D9AH 3NCYP 1YZZA 3SOBH 5SWSD 1JJUA 4X4YA 1AGEB 3FO0L 1EHLH 4UIMA 1FZKA 2JB6B 4YBLC 4KROD 2VL5A 3ULUC 3V52H 4Q9BA 2GUOA 4ZFGH 2CXKA 5BV7C 2O5YH 12E8H 3LPFA 3BQUC 1DVFC 1I9JL 1ZT7A 3WLBB 3VD7A 1KTDA 3EYQC 3JV6B 5KOMC 4OF5A 1E6OL 4P2YA 1FNEB 4P48A 4FZEH 3HZYB 5K9KB 4P3DA 3QIBA 3JZ7A 3MLRH 3BWAB 3S34H 1PX4A 2ATPB 4G8EA 4Z0XB 3H0TA 1ZLVH 2W9LA 1HQ4A 4H25A 4JFFA 3EYFA 1HHIA 1WZLA 1HKLL 3UJIH 3W39B 1KCKA 5IHBA 3VW3H 4D0DB 5E9DD 5KTEH 3X17A 1HOCA 1PYWB 1CFBA 1CFVL 1FFQA 5JW4Q 3GIVB 4RDQG 4MCYA 4QHLA 3VMPA 3MRJB 4XB8A 4LP4A 3O6KL 2BJML 5ESVA 1D5BA 3QDHA 3JXAA 3LEVL 1N6QH 4XP5L 1HEZB 3U4AA 3KS0H 3AXLB 2ZZUT 4PRHA 4HKXB 1U92B 3HB3C 3MRPB 2HAZA 2B1HL 3OG4B 3DX8B 5GGUB 3B6SA 2MPAL 5JOPD 5IB3B 1DBBH 4JFOA 1H5BC 3GMRA 4E41B 3TA3C 1KIRA 1QSFB 4Z77B 2AJXH 4LSSL 5I1AB 4GKNA 4XCYB 1MWAA 3LRSA 5FGBA 1XAUA 3GM8A 5DSCB 1N5YH 2X4RA 2MCG1 2V7NB 3VXOB 1JGLH 5C9KA 1N4XH 3ECBB 4CJ0A 3CPLA 2DLTA 4GH7B 3OKNA 3SDDB 3ULUF 1OB1B 1Z9SA 4DGYH 3ILQC 4ONHB 2VZTA 3I6LE 5ESAA 5ADPH 4PYGA 3VFPA 3HMXA 3QHTC 5E1AA 5ACZB 2NR6D 1U6AL 5M95B 5J13C 4NO5B 5EOQL 4JY5L 3QUYC 3L3JB 4P3CL 1XEDA 3NGBB 3RWJA 2H6PA 3QUMH 4OQ1A 5GGRY 3GBLA 1Y6MR 3QYCA 3CMOL 5IW6A 4X6BA 4OZGE 5HDBF 1FL3B 4NM8H 2IPUK 2CDGB 1A2YB 2G2RB 5FK9A 4K3DH 3K4ZA 4MXQD 3MRRA 1QSEB 4S11A 3VFUB 5FECA 3B43A 4M7ZC 2A6DB 5DI8A 3D39D 3BZFA 3I02A 5EU7C 5HYSA 3T0DA 4O5LH 3TBWA 4DKAA 1TCMA 3QUXA 5TE7L 5DHVH 1X3DA 4LQFL 3WE6B 4DVRL 4R2GB 5IBTL 3RHWK 1U8QA 5FHBL 2CMRH 2WBKA 5E94B 4XC3L 4ELME 1NDMA 3FB8B 3BDYH 1A4KB 1T3FA 4PRBB 5TDPA 3E8UL 4GRLA 1SQ2N 1OCWH 4JRYD 2VKWA 1T1ZB 5EZIH 1NMBL 1I7RB 2EH8H 5E8DH 4JFEE 4RISH 3BQUD 1DVFD 4HIJB 1QFWM 3QCUH 4IMLA 1JZ2A 3MBEA 3WIFA 1MHEB 1CFTB 4K9EC 1X4XA 2B8OT 1ZLSL 3FN0H 1CE6B 4HGMA 4PGJA 2HJKA 5F9OL 3QAZB 3BKMH 3DVFA 5D2LE 4XCNA 1CXLA 4GW5B 5HI5C 3SJVE 5SWQB 3TJEH 3X11A 4Y19B 3BN9C 1U8KB 5E6ID 1SBSH 3SDCA 1GZQA 5F9DC 3DO7B 4R4NC 4W6YB 4XNMB 3GHBH 3KLAA 2R1WA 1IQWH 1UB6B 1G7LA 3RWIB 3WFDH 4OTXH 3O9WC 3CDCA 4HGWA 4Q6YA 2XWBB 3MV7B 3AC0A 3U1SH 5FA3B 4HIEB 3G6AB 4G6JH 4X8XA 5GIRA 3U7AA 1KT2A 3RGVC 4AG4H 2HFFB 3QPXH 4MJ5A 2PYFA 1I3RA 1UM6L 3HB3D 1CTOA 2EYRA 3WNMA 5LXGL 1RK1A 4I18A 4GG8B 2J4WH 3G5VB 2X6MA 4L3EB 1MI5D 4GRMB 4K07A 3F58L 4DKEH 5L7XH 1K3ZA 4YPGA 1BJ8A 2XN9B 5L6YH 5HGDB 3AS2A 3QXAB 4LK4A 1K4DB 4OF0A 4LVOC 3F5WA 2VB5A 4HLZH 5I30L 3HC4L 3QIUC 4MA3B 3SKOA 5E8OA 4EKXA 2VXQL 3QIWC 1FZJB 1OP3H 4P4KB 4ZQKA 2ZCKL 3ILQD 3ZE0F 3SO3C 1R3KB 5K9QG 1RZKC 3WEXB 1DN2A 2ATKB 1JNNH 5D2NE 3U79A 3CU1A 3V6FA 5HDQH 4FQJL 4PJDF 1SEBA 5I75B 3THMH 5B4MD 2F74B 1S9WB 2DQGL 4KRPD 4N0UE 1Z0MA 2Y4SA 3BHBA 5FCUH 3D69B 4OF3A 4PJFE 3CSPA 4HLJA 4YC2B 1T83C 4MJ4A 5LG1A 2ZJSL 2OM5A 3U46A 1G9MC 4Y5XA 4ZAKB 2HT3C 4UILH 4U0RC 4OIIL 4Z7WB 2KZ1B 3QCVH 1XF4A