4BA8A

High resolution nmr structure of the c mu3 domain from igm
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
102
structure length
102
Chain Sequence
MGDILTFTIPPSFADIFLSKSANLTCLVSNLATYETLNISWASQSGEPLETKIKVMESHPNGTFSAKGVASVSVEDWNNRKEFVCTVTHRDLPSPQKKFISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IG MU CHAIN C REGION SECRETED FORM
publication title High Resolution Structures of the Igm Fc Domains Reveal Principles of its Hexamer Formation
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 16
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ba8A00
4HUUB 5MEPA 2A6DB 3CJJA 1UVQB 5BJTA 2VZVA 5MHSD 4C56D 4PRNA 1MF2H 3EO1A 3L3HA 4U1HA 4J6RH 1HXYB 4L9LC 1MJJA 4ZOCA 4D9RE 2EXYD 2AEIT 3MLRH 3LCYA 1RVFH 1BIIB 5JPNB 5HHOE 3D85B 2BHZA 2BSSB 3W5MA 3VGAC 5L9DH 2A6IA 3QDJA 1I9EA 1IC7L 3T0VA 4X6CA 3GSOA 4JRXA 3K46A 2W0FA 5IIEB 5CP7A 3PWVA 1SEBA 3ZKNC 5FGSA 4ZUWB 2O5YH 4O2FB 1FFPA 1CGSH 5K9QI 5ALCL 1ZHBA 3EGSA 3Q6FA 4ZTOL 4H1LG 3KGRA 3SDXE 5BRZA 4FFZH 2CPCA 3EYQC 3V5KA 5HYQB 1CBVL 1INQB 3F7RA 5GGRB 4XBGB 1BQLH 3OV6A 3T2QA 2G9HA 4FFVD 4U3CA 4P23A 3WXVL 4NQXB 1A6TB 3WDIA 1MWAA 4X4XB 4O51B 2CDEB 1PZ5B 3OTTA 5HDOA 4LDOB 4OFIA 3V0AC 4N0CD 4F7PA 1LO2L 3M8OL 5EWIL 5LWYH 4OIBA 5KSBB 1A7PL 1CFTA 4FQ1H 4QRTA 1EO7A 4QO1A 2DJUA 1PX4A 1UVQA 4I0PC 1ZEAH 2J1KA 2JCCE 4R4NC 3HE6D 1BOYA 5DJYB 1FDLL 3K1KC 3QQ3A 5FO9B 4RWYH 4A2MA 1S78D 4CAGA 3G5YA 3ILPB 4TNWF 2J88H 4IMLB 5HD8D 3D85A 2BSSA 3GBMH 1S7TA 1T7VA 3CVIH 1SVZA 2DJSA 4LCWA 2NY4D 3QJHB 1Z2KA 5IIEA 4M9OA 1L9NA 4UI2A 4Y2DA 1OCWH 4PRPE 3ALWA 5DRXB 1PG7X 4YFLI 4LHJB 4O2FA 3RGVB 3HC3L 5CBEA 3LKOB 1KJ2A 2D03H 5T3ZE 3N1FC 4ZXBB 1X5XA 2ZSWB 5KSVB 1H3UA 4FZ8H 4MD4A 3U7YL 2VXTL 1QBMH 1G0YR 5HGDB 2FWOB 1A6TA 2QADD 2EEAA 3IDXL 4O51A 1I9JL 1PZ5A 1H3XA 3SKNB 1HSBB 4UDUB 2Z31C 5DJ6B 2RB8A 5C7XL 2F53E 5LXGL 3U1SH 2MKLC 4P9ML 5HYFA 1HQ4B 1T83A 1UH4A 3RWIB 2CIIB 3UC0H 3MRMA 5DJYA 2ITDA 2AK4A 5FO9A 1EERB 3KYOA 2VZUA 3WFZA 1J12A 1ZT4B 1WFOA 4YC2C 1A3LL 1UKSA 5E1AB 1TDQA 4YFEA 4R4BB 5FYKU 3WSQH 3O3EB 1RZKL 1K8DB 3H2WA 5IK3B 2OQJB 4YXHH 2ICEB 3LEYH 4NRYB 5EU7E 3QJHA 1U95B 4KTYA 4MCZB 1OTUC 3OBAA 5DMKB 4N68A 4TSBH 3RJDA 2EE3A 3QG7H 4U6XB 2VAAB 3GI8L 3KXFA 5DRXA 4C58B 5J8OA 1QRKA 4UAOB 5DO2D 3RGVA 2DWDB 1FORL 4Z77B 1VENA 1AY1L 1OD9A 3NCJH 4ZXBA 3TESA 5IGXH 1L9MA 1AFVL 3F62A 3VRIA 5IJVB 2ZSWA 5KSVA 1X44A 3BSZL 3MBXL 4GXUN 5GRJH 3UYOD 4PP2A 4M43H 1XF2B 5HGDA 3GKZA 2UV3A 1OAUH 5D71L 4KTEL 3JSSA 3CH1A 2HT3C 4YBLB 4JPWH 3BESR 1HSBA 1F4YL 3UBXI 4MJ2A 1MWAL 1NEZB 1HN1A 4W68A 1BFVL 1CTOA 5EU5B 4WI8A 3O6KL 1UM4H 2GCYA 3S97C 3UTTB 2Q7NA 5D1XC 1HQ4A 3RWIA 1IEBB 1M05B 5F1NB 2CIIA 2HRPL 2PXYA 5D70H 3X11A 5E08L 4RMTA 5CCKH 5I75B 1YEKH 5EZIH 2DM4A 2VQ1A 1NBZB 1ZT4A 4WFEE 4MHHI 5E1AA 4R4BA 1FGVH 2XG5A 5E8OB 1X5JA 5IK3A 4PBWD 1KYOK 4OKVB 2NXZD 5FHBL 5DD0H 3NA4A 2YUZA 2DQCL 1U95A 2FB4L 1NGYB 2QQLL 3QP3A 5IBTH 4WO4B 5D5ME 1Q8MA 4UUJA 3BT2L 2DWDA 3NPSB 5C09E 5EOTB 5GRZA 2FCBA 2H2PD 5HHVH 4Q0XH 5TE6H 5E56A 5HBBA 1AJ7L 3IDIB 1IGFH 3O6ML 4XCFL 5DRNB 1T0NB 2QTEA 5J12B 1KJ2L 3EW3B 1P7KA 1V8HA 3RVXD 3OKDB 1XF2A 1QKZH 3KPSB 3S9DB 4Z7UB 5C0AD 4XB8A 1G6RB 5LGJA 4YWGL 2WMPA 1LP9E 3FQRB 2ZCLL 1AKJD 1EAJA 1BGXH 5EU5A 1FFRA 1DFBL 4NC1C 2D7PA 5DFVD 3UTTA 4RGNB 3C09C 5I2IA 5F1NA 3TNNA 1BJMA 3S5LA 5EB9A 4Y5VC 4XNUL 2IAMB 2P5EE 3GJFH 1JNLH 1NBZA 1S7VB 4XP9L 3HC4H 5JTWA 4YDIL 3VFNB 3T0EC 3E2HC 4ZUUA 1F4WH 4LLWB 3IAPA 4UV7L 4OKVA 1LGVA 3U0PB 4EBQL 3VFUA 2AJSL 5FECB 1ADQA 3SBWC 4WO4A 3WE6A 3DXAD 2DBJA 1CFSB 2FBOJ 4LLUA 4M7LL 3RIAK 2EXYC 4JFDE 5DRNA 5F3HB 5F7LB 4WW2B 5HHQB 2NY0D 32C2A 3OKDA 3ZYIA 1RMFL 2XPGB 3KPSA 1U2CA 3R4DA 3BP5B 1IGYB 3O4OB 4U1IB 5GS0H 1G6RA 3LRSB 5DLML 5K33A 4OFYA 1UADC 4P0DA 1QUNA 1A7QL 4I9WD 1UWGL 3FQRA 3VRJB 4V1DA 4AQ1B 3L5XL 2NY6D 3KVQA 3P0VL 3NA9H 3QIUD 3GNML 3RZCD 5CP3H 3L5WA 2Q3AA 4M6MH 3F7PC 4TTDD 5ENWB 4XX1E 5FF6B 5F7EL 4G9DB 3ARDD 2HLAB 1PZUB 4FFVC 1MJ7L 3ZDYE 2PO6C 4CMHB 2ADFL 3P4LA 4OGXL 4ELME 1T6VN 4GXVH 5KANI 2FX8L 4LLWA 2GTWB 4N0CC 4AIXA 5I8CB 3P2TA 1IGCH 2PW1B 3BUTA 4KZDL 5TGBB 5KZCB 3BKYL 2VKWA 3KPMB 1M1SA 1RU9H 4Z0XB 3DPBA 3CAFA 4X7CC 3PHOB 4HUVB 3HE6C 1DANT 4WUUD 1F45A 3S36X 1DVFD 3CFCH 3EOAB 1S78C 1AHWB 2F74B 3IVKA 4ODTL 4FQJL 3RNKB 3LH2L 3K80A 4PJAA 5F3HA 4QWWD 4WW2A 5MERB 5HD8C 1MLCB 3PXJA 5EU6E 3BUYB 3BP5A 4XC1H 3SDDA 1IGYA 1OLZA 3BP6B 1MCSA 4U1IA 5HHMD 4YXLL 2NY4C 2YPVH 4FQHB 2CMRL 1AXTH 4M03A 3V52L 4KJYA 4JAMB 3HUJB 2E9IA 5FO7B 4UZGA 4X7FC 4KQ4H 1UJ3A 5EBLB 5HHNA 3SHSA 1I85A 3ABZA 5E2UL 4FHBD 1KELL 2XACC 3OKKA 1S9YB 2H9GB 2FSEB 1XCQB 5ENWA 1G9NH 1DP0A 4I3GA 4G9DA 4MWFB 3WV0A 3BE1L 4KQ3H 3IU4H 5ANME 1F4AA 2XTJB 3U4BL 1MFAH 3C60D 3SO3C 3WKNA 4Y0GA 1QG3A 3INUH 4H20H 4HJGB 2XZCL 4UNUA 2FGWH 2PW1A 4H88H 2Y7QA 1PKQB 3EO0B 4K8RL 4JKKA 1YJDL 1LDPL 1QSED 4R9HA 4Z0XA 1AP2A 5BCAA 3NFSH 3PHOA 4HUVA 1XF3B 4QTIL 1ADQL 4OZFH 1S7SB 1WZ1H 2BNQD 2APVA 2F74A 2YPKA 3RNKA 1S7QA 4LSTL 4M61B 1AE6H 4ZS6D 4UT9H 3GSVB 3LKRB 5MERA 3GEWB 3BUYA 1SJEB 2R69H 4X6DB 2CK0L 4MJIA 5IMLA 2KQMA 4X5XA 3BP6A 3FCTA 2XZQL 1SJHB 5ISZB 3MSPA 2OR7A 3WXWL 2XI9A 4YLQT 4LSUL 1ZT1A 1R3HB 3ELAT 1W8NA 1G6RL 5GRWA 5DO2C 4JAMA 3SCMB 1EHAA 2DQHL 4YUEH 3DVNA 3LPWA 1S9YA 5I1IL 3VJ6B 2FSEA 1CL7I 1XCQA 4G6KL 4X6EA 3D2UD 3MV11 4MWFA 2VH5H 2XKNB 5C8JB 1J1PH 1PYWA 4F7MB 4I0KA 1LO0H 4JG0L 4X9HA 3M45A 5CHNB 1HHHA 5KOVC 5J6GB 5BZDA 2X9XA 5GJTL 3WJLA 4L4VD 2F5BL 2GW5A 4NHCL 4PGCA 1IAII 1ORSB 1Q9WA 4Y19A 1GC1L 5TF1H 5IBUB 2VITB 1FN4B 3UAJD 2FEDD 2CKBA 3CCHB 4JRWA 4U1LA 4BFIB 4CNIB 5M95B 5FGBA 3A6CL 4KKAD 4MNGE 2QQQA 5ID1B 1LVEA 1XF3A 2F8XC 3VDCA 1D6VH 4XNYH 5IB5B 2Q7YB 1RIUH 5BS0B 4M61A 3W39A 3VE0B 4A6YH 3VG9C 2YKLH 5T33L 1ZHNB 5I9QC 1IFHL 2C3GA 5MENB 1U3JA 3P73B 5B38G 4L1HA 4JFOA 5DEGB 3SKOB 2NXZC 4X7SH 2HKHL 1SJHA 5C0BD 5D7SL 1JNHA 3T2NL 1U91A 4J8RA 1CN4A 3I3DA 4XMKH 4GG8A 3TBTB 1LP9F 3EDKA 2H2PC 3SGEH 2DI9A 2O26U 3AM8A 3IF1A 1KGCD 4OT1H 5DGQA 5IQ7L 4ALAH 4R0LA 4M48H 2JJWA 2F8OA 3JTTB 3WIFB 3RVXC 3TIEB 4P4RB 2OYPA 3EFFB 1TTUA 1CWVA 5L7XH 1FL6B 2EDFA 3P0YH 4G8GB 1AQKL 5JQ6H 3C2SA 5IMMB 1A14L 3O3AB 3CVHH 2D2OA 1J5OH 4LDEB 2E6QA 3RVTD 1FN4A 3DGGB 2QSCH 2EDOA 4M6NH 4G6JL 3CFJB 3CCHA 4K7PL 5DFVC 4EI5D 5KOMC 1KTDB 1U2HA 2EC8A 3HPLA 1XGTB 3C9NA 4NO2B 4NQDB 2IBZX 3LHPH 4OIIL 1YN7B 4TUKH 1FYTD 1CZ8H 1EBPA 1LDSA 5IB5A 2ITCA 4Z7OE 2A2QT 3DMMB 4K3JH 4PGBB 4DAGH 5BS0A 4HX1B 1WC7B 1EHLL 1R5VB 1ZHNA 3FT4B 4RX4D 4XNZB 1W2KT 5MENA 3MLXL 3P73A 4WIQA 5GGVL 4KJWC 5DEGA 3TBYA 1CYGA 4IDJH 1NUDA 4PRAA 1NDGB 2APFA 2VN4A 5HGBB 1DZBA 5C0GA 2FX9L 1G7LA 2DQIL 5GXBB 3TBTA 3I2CH 3MLUL 4MGXA 3VMPA 5E6IA 2APWA 3H9SD 2DQGH 2AXFA 1FE8L 4DKEL 4OBSA 5C0CA 5TDOB 3OF6D 3T8XA 3CDFA 4DN3H 2NY0C 4PGZA 3MREB 1N5AA 1K6QL 3K4AA 3EFFA 2XN9B 5CZKA 5FKAB 1S7WB 1MRCL 1SY6A 5SX4H 5B39G 2DQEH 4QOKE 4OFVA 3SDAA 5IMMA 5K9JH 3O3AA 1Q72L 5CILH 3C6LD 3ZDYF 2NX5E 5BMFH 1J8HD 1PW3A 3FTGA 3MA9H 4NQEA 4WGVB 1C12B 5GISL 4ELMF 4XP6L 2NY6C 4I2XA 1CICD 4RFOH 3DGGA 3CFJA 5FM5M 3I02A 3QIUC 1JGEB 3MNVA 2IADA 4PLJD 3RZCC 3ZKSD 1KTDA 4JLRA 1MCQA 5EZJB 5K59F 1XGTA 4HIXL 1E0OB 4TTDC 3VGHA 3DV4B 5DUML 5BV7B 3D39B 5F7FA 2CKBL 4QRPE 4Y2OA 3NTCL 3PWLA 2JTDA 1AD9B 1A0QL 3ARDC 4AMKH 2V2XB 1MJ8L 1ZHKA 4LPVA 4L29B 3RTQD 3K3QA 5A2KH 5EA0H 5D7IA 4FZEL 1MCWW 1MREH 1A5FL 3SGDI 3NCMA 2DQDH 2H8PA 2NY7H 5EBWA 4CUCA 2ZUTA 2KPNA 4GS7B 2BSRB 5EC1B 4OCYH 1NDGA 4JFEE 5I1KL 5HGBA 1P4BL 2OJZH 3RDTB 5HJ3B 1TVBA 2QQKL 4QHKJ 5EIQA 4NWTH 1DVFC 1YQ2A 4OZFG 5D2LF 4ZOAA 5TDOA 3MLTB 5F70A 4QWWC 1VADB 1ZSDB 2X1WL 3MREA 4L3EB 1FVDB 2XN9A 2GUOA 1S7WA 3DNKA 4YK4B 3H6JA 1N8ZA 4NNPL 1TQCC 3MNZA 1ROWA 1ZE3C 1WJ3A 5B3JF 2G5BB 1INEL 3EYSL 4ZO7A 2V2TB 1NCDH 1JCKA 2Z93A 3CNKA 2V9RA 1IAKB 1JGEA 1A7NH 3NFPA 3NIDE 1I7RB 5EZJA 1JZ6A 2ZKHL 4X9GA 5ACLA 4Y5YC 2VLJD 3D69B 1AD9A 5IB4A 3VGBA 4DVRL 4Z7WE 4RNRB 4L29A 1KC5H 1NAKL 4HH8A 5E8DL 3C60C 3UBXB 2R1WB 1QRNA 3BGAA 5D93B 2CO6B 3MRFB 5FYKH 5FXCH 3V4PL 4RFNB 2BSRA 1OARL 5EC1A 1VKXB 1OHQA 3VWKB 5FV2A 1X6LA 2CJUL 1PSKH 4GBXB 5F7MC 1NLDH 4MDJB 2HAZA 2V2WB 5HJ3A 3RWHB 3MJ6A 4FP8L 5IVOA 2HT4D 2ENYA 3QUMH 5F3BB 4ZS6C 5I1LB 3SJVE 1HILA 3MLTA 1ZSDA 4IOFD 2OXHA 3IS1X 5MP6L 4IMKC 3VW3L 2XZZA 5IB3B 3GSXB 3VU2A 3TV3L 3LN5B 4ZSOE 3PWUB 1SY6L 1W72A 4RDQF 4YX2L 2D9CA 2V2TA 1QD0A 4LCCB 5GS2H 4HLZH 3LMJH 5E2VH 5MEOB 5A2LH 1IAKA 1I7RA 4LSSH 2GI7A 2YMXH 4PJ8B 5DUPH 4KRNA 3DO7A 2FR4B 3AGVA 3B9KD 2QR0B 5DURD 3I9GL 5BQ7B 1UM6H 5ICZB 1G84A 3MOBL 2SEBA 5FO8B 2DJ4A 3P4OA 4RNRA 4YNYA 3QXVA 3ZKXC 3GK8H 3MX0A 1RHHA 4QCIB 1WAAE 1IGIL 4ORZC 2R1WA 4FQCH 3MCKB 5E2TH 4ZDHB 4QF1A 4ZPVB 1T20A 3UAJC 2FEDC 4KHXH 3HAEG 1JPSH 4KKAC 3QIWD 2C3VA 5DHXB 4CVXB 4OD1L 4MDJA 2DIJA 2V2WA 4UIKL 5FUOL 2ZOLA 2X09A 4Z7NE 3VXOB 1QFHA 5HYJD 4CVZB 5I1LA 1CLYL 1RI8A 5D7JB 4MQ7B 2YRLA 4K3HA 4X4ME 1U8HA 5IB3A 3GSXA 4N5ED 4HIHB 4U6HA 2YRZA 1XIWB 3LN5A 2XKUA 5KVEH 4QHMB 3TBSB 3RJQB 3V6FB 4PJFF 5EZLB 1SHMA 2M8XA 2V5RA 4OM1L 4NRZA 1C5BL 4LCCA 3MLSL 3GI9L 3E3QE 4FQPA 2A77L 1M6OB 3KYNB 1JMZA 2QEJA 2IALB 3T1FA 1YUHB 4Y16B 1L6ZA 4HXAL 4FQXD 3FHAA 2VLKA 3TCXA 1YYLH 5BV7L 1KCLA 5FO8A 5I66B 2ZOKA 3M17B 3BWAB 1PG7L 1MEXL 2FEEL 3O3DB 4TSCL 4OF3A 4ZPVA 3RVTC 2X4NB 3HZYB 4I18C 3ULSB 4EI5C 3FO9B 5L0QC 3VDAA 3MOAH 3X3FH 1H8OA 1UZ8B 4CVXA 1B0GA 4RMVA 2H32H 1CFNB 1UENA 5I71B 3RU8L 3B3IB 4GG6B 4OZGE 3I84A 1OT2A 3UJIL 4LOUD 3VXOA 4DKFH 3VGDA 1IT9L 4HUXB 5GGTA 3CDGB 4R7NB 3IAQA 5DJ2A 1RFDH 1FSKB 4H5SB 4M62L 4L8BB 5JMOC 1QP1A 4YDKL 4JPIB 3ZTJH 3R1GH 4TUJA 4UIMA 4J12A 4QHMA 3TBSA 3BI9X 5TFSH 5E00B 4CVWA 1DLHA 3MV9B 3WD5H 2UUDH 1W72L 1N6UA 4OQTH 3TN0B 3PABB 1CGUA 4LQFL 4X6CE 4JRXE 3FRUA 1R3LB 1MFBL 4JCMA 4Y4HD 3WEXB 4KZEL 1KPVB 1N64H 5I66A 4LFHG 2EEDA 3M17A 5L8JB 3CUPB 1BJ1J 1RURL 2EZ0D 4NZRL 3TBVB 4ELKB 1K4DB 2R0LL 3O3DA 2XZAH 4PRIB 1DLFL 4WI5A 1CICC 1D5IL 2X4NA 3N9GH 3UTZA 1MCWM 5FOBB 3ULSA 5E70A 1NBVL 3PWNB 3WJJC 4PLJC 5CJ5A 1D5MA 1UZ8A 5LBSH 4MMZC 3MXVH 4NM4H 1OAQH 1F8TH 4XX1G 4ZD3L 5IJKC 4L5FL 3B3IA 4GG6A 5ILTL 1J0HA 4G9FE 3JWDL 1AGEA 4HUXA 3CDGA 1CIDA 4IHOB 4R7NA 1K5NB 2PCPB 4QRSB 6FABL 4L8BA 4F2MB 4HPYL 1CLZL 3CZJA 1JGVH 3PXHA 3UO1H 3QEUB 4S1DD 4FTVD 1RUKL 2WUBH 1HWHB 1NC4D 2MFNA 5E00A 3S34H 3OL2A 1QHPA 3MV9A 2V9QA 3B9AA 5KS9B 3DHJA 3TN0A 1IVLA 2WBJC 3PABA 3WFEH 3TO4D 5DHYB 3VXUD 4NJ9L 2CRYA 3VXPB 3B9VA 3NIDF 4G8FA 5LG1A 2Q6WA 3WEXA 3N1GC 4GRLA 3WFDH 3VXRB 1EAPB 3CUPA 3MV8B 1K85A 3IFLL 4LSDA 4Z7WF 3WKML 1A1NB 4K23L 4E41B 4K3DH 3HI5L 3L95A 4X80H 4ELKA 4Z5RA 4X5WB 1K4DA 3OWEA 3MO1B 2XICA 4PTTB 1YNLH 4HLZG 4Y89A 4LIQH 2DICA 1PQZA 1Q94B 1KCVH 2OMBA 1GYAA 2FH6A 5JHDB 3SE3A 3VFPA 1HYRC 4XVJL 5KSBE 1T04B 3DVFA 4IBLT 1K5NA 1D6EB 4QRSA 3L9RB 1C16B 1MOEA 3STLB 4F2MA 5DMYA 4I3SH 2ADGB 5GGTL 1UA6L 5C3TA 1IBGL 4WFHE 5H94B 2ED7A 3ZKMD 2B0SH 4JFQA 5EG6C 4Z76A 2W59A 5HXMA 4M7KL 1G7MA 3LD8B 1LO5B 3D25B 4NP4L 1ZS8B 1CXEA 1NCBL 2AAVA 2B1HL 3TT3H 1BM3H 4D9RD 1JWSB 5DHYA 1QYGL 1UZ6E 1WZKA 3KNBB 5DVNA 5HHOD 4NJAL 2JELH 3VXPA 5HY9B 3VFMA 5JW4Q 1XGPB 3V0VA 3MRJA 4YDLB 4NO0B 4IOFC 5EC2A 2DQFB 2WQ8A 1J0KA 3O2DH 1RIHH 3MV8A 3S3SA 3IT8D 4X6FA 1E4KA 3L1OH 1A1NA 1CDJA 3U0TB 4HPOH 1CLOH 2AQ1A 2X1OA 3MO1A 3S35X 3UCRA 1WAAF 5ITBL 4L8SB 4PTTA 2YK1L 1TFHA 4QTHB 5DD6B 3GSWB 3H3BC 1Q94A 3B9KC 5F8QC 5IOPB 4S1QL 3P3YA 1IQWH 3T4YA 3QWRA 1FV1B 1S8DA 1S9VB 4WU7B 5JHDA 2NW2A 4Q6IC 2PTUA 1TPXB 4PG2A 4RDQG 1OW0C 2QL1A 2DDQH 4M6AA 1HI6B 4KVNH 4OGYH 4Z7NF 3BQUB 3A6BH 2NY3B 1D6EA 1SBSL 3L9RA 3U9UA 1C16A 3RX5A 4BZ2L 2ADGA 2IG2H 2F15A 4G8EB 5H94A 4BQ6A 3CLFL 2IANA 2VERN 4UOW1 1ZOXA 5CJBA 2EH8H 2WBKA 1HH6B 1II4E 4JQIH 3QIWC 4EDXA 1YEEL 3NMEA 3WYRA 3EKCA 3MJ8B 3KNBA 1EBAA 2VXUL 3FRPA 3QEQB 4TVPL 1YEJL 1OAKL 5ERWB 4ODBD 3X12B 3S37X 2O61B 3FAXA 4DGYL 3S4SG 4LK4A 4N5EC 1F11A 5IHUH 3WHE1 2EE2A 3Q6GL 4PRPD 4WI7A 1KB9J 1U8KB 4K94C 5DK0B 3S36L 1IC7H 5ELIA 5LCVL 5F6IB 2VZ3A 3QR2A 3IFOB 5T3ZD 3Q5OA 1NDMB 4UBDD 2VTFA 4NBZB 1KJMB 2O5XL 4QTHA 4JPVL 2H2SD 3GSWA 2RR3A 3S98A 3SDYL 5IOPA 5ALCH 2Q20A 3QUYB 4QEGA 1PDKA 4HS6B 1P1ZA 2GEEA 4OZGF 5DVKA 3TNMB 1ED3B 3VWJB 4YPGB 3BQUA 2RAMA 3UTTE 3QQ9D 4MB3A 4OLXL 5B3NA 2VXVL 3UDWA 3WXVH 4OZHA 2QV2A 4WY7H 3MODL 2F53D 3ORJA 4Y7MA 2J12B 1CD1B 5GRUL 1HH6A 1Z9SA 3O41B 1LO2H 3M8OH 5EWIH 1VGKA 4D3CL 1A7PH 4NBXB 4MAYB 2CLRB 3PIQA 5I1AB 2KQNA 4LOUC 2HJLB 3MJ8A 1W0VB 2NTFB 2VRAA 4U31A 1GZQB 1FDLH 3EDFA 4JDVB 2BSTB 4I48B 4NN6B 4X6CF 5ERWA 4HWEH 2UVFA 4P4KD 1D5XB 5DK3A 2O61A 3NCFB 1J7VR 2YZ1A 4QHNB 3H7LA 5CEYB 3BP7B 1U8KA 5ESAA 1T3FB 5DK0A 2YUWA 4NC2B 3GKWL 3ARXA 3IFOA 5HPMA 3KPSE 1NDMA 1TMCB 5C07A 4Z7UE 1KJMA 1ORQA 3FFDA 2ZUQC 3GUTB 4QY8A 5IROC 4C83A 4M7ZC 3QXTA 3ZYJA 4Y4HC 3QUYA 4HZLB 4QXGL 3V95A 3CU1A 2A6JB 3OJDB 3RKDD 4N8VB 1OQOA 3ZDZF 1FFNB 3U7YH 1W8OA 2VXTH 2EZ0C 1BEYL 1P5VA 4RGNE 3MYZA 4WFFE 3IJHB 2PYEB 1NGXB 4X8XA 1JPST 4KK8D 3IDXH 1I9JH 1NMBL 2P8LB 4NO5B 1CD1A 3SN6N 3UTPE 5I1EH 5C7XH 4P5TC 4BSWA 3C6SA 5D72L 4MAYA 2CLRA 5LXGH 3PL6D 5I1AA 4P9MH 2HJLA 3P77A 4WFED 1W0VA 1GZQA 5BZWB 4OI9A 4XGZB 3UZVB 4JQVC 3QZWB 4JDVA 3HPJB 2BSTA 3RWJB 1D5XA 4MXWL 1T0MB 1A3LH 2B5IB 2EH7L 3FO1B 1RZKH 4S1DC 3BP7A 5IW3A 3DETD 4BQBA 5C09D 1KLGB 3LY6A 3GI8H 3TO4C 1I3RB 4E0RA 5D8JL 1AY1H 3AMKA 4BFBD 4XTRD 4XHJD 5JZ7D 3P11L 1DTUA 1AFVH 5EO1B 3LS4L 3VFRB 4ENED 1FFNA 3BSZH 4JREC 1DE4B 3MBXH 1N0XL 4PJ9D 4NKMB 1NMCC 5B8CB 3IJHA 2PYEA 5D71H 4KTEH 3TO2B 1NGXA 4AIOA 1R3JA 1NCTA 4NO5A 2CK2A 3I50L 1F4YH 5CUSL 1MWAH 3DOSA 3V2AR 2OMNA 2EDBA 4JFZL 4OZ4B 1BFVH 3MRQA 2EDJA 5EBMB 2P5ED 3AB0B 3O6KH 4S2SB 1X5AA 4ZUVA 2J4WL 3WLWD 1FZKB 3NCEB 4CN1A 2HRPH 4FQIL 4XGZA 5BZWA 5E08H 3HPJA 1UZ6F 5JORB 5JIIA 5F8RC 3SGEI 4FABL 4P2RB 1N4XL 2JK5B 5EN2B 3ZKMC 1T0MA 4OCRL 3AMLA 3FO1A 1MI5A 1GOGA 4NZTL 1GGUA 1QBAA 5BO1L 5C0DA 2VDML 5FHBH 4W6YB 4HIIB 2QSQA 2DQCH 1MCEA 1CS6A 1KLGA 2FB4H 3BZFB 3M1BB 2QQLH 1EXUB 1GCFA 4JFDD 1FIGL 4P2OD 4MVBD 2D4FA 3LKSA 3ECBA 4LFHD 1AJ7H 4QXUL 3O9WD 4TOYL 4XCFH 3HC0A 3HUJE 1A1OB 1KJ2H 5HVGB 3G08B 2XFXA 4DW2L 4NKMA 4Y4KD 3RAJL 3KPRB 3O2VH 2ATPA 4YWGH 1HDMB 5I74C 2ZCLH 3QH3B 4MZ3A 2XTJE 3IDGB 4BUHA 3UTOA 4UINL 4KKLD 5EBMA 1DFBH 3TZVD 3HZMB 3BP4B 5DZLA 3RVWD 4S2SA 3QFDB 4PPTA 1LWRA 4CDGC 4D9LL 2NYYD 1R5WB 4LCUB 4YH6A 5FYJE 1KIQB 1PKQE 5JDJA 4EQ3A 5JORA 4XNUH 7FABL 4P2RA 2JK5A 5T3XL 3ARBA 4G7YL 4ZG1A 4YDIH 1L7TL 4XPHL 4IEFB 4KY1L 1EX0A 3GJEA 3I3EA 4LHUA 1FAIL 4UV7H 1N26A 3OB0H 5SX4I 4EBQH 1BIHA 4IOSD 1T1YA 4NQCB 3HI1B 3BZFA 3M1BA 1EXUA 4X6DE 2UZIL 1A1MB 3CDCA 5ISZE 5EU6D 4YEEA 3ZE2E 2W9LA 4XWGL 4M7LH 1BBJB 4OCXL 1REIA 3T4AB 1S9XB 1A1OA 4N5UA 3G08A 3MUHL 4RIRB 1RMFH 4F15C 3UJJL 5IQ9B 1YEDA 5DLMH 2GIYA 3LEVL 2VN7A 1HDMA 3QQ4B 3HMWL 1A7QH 1I8KB 1UWGH 2Y06L 4K9EL 3QH3A 2H2SC 4PY8J 3IDGA 3T0AA 3L5XH 4F9PC 3P0VH 1W0WB 8CGTA 1EEYB 1HNGA 3L5IA 4LCUA 4M1DL 2K1MA 3IKCA 5J11B 5KSAB 5F7EH 4OFKA 2DM3A 3TYFB 2Y25A 3QQ9C 4O00A 4NYLB 5GZND 2X1XR 3B6SA 1MJ7H 2ADFH 5DWUL 3QHTC 3U46A 2E7LC 3BDYL 2VDOL 4OGXH 2FX8H 5BS0E 2Q3ZA 4DN4L 4RQQA 4X4ZA 4J7RA 3RQ3A 25C8L 2BY3A 4KZDH 4NQCA 4U6VL 3HI1A 2DQTL 3BKYH 5F9JA 5MENE 4DUVA 2V7HB 2B1AL 3DROB 5I1DB 4XMLL 1JYXA 2VDKL 1M7DA 4RRPA 4P4KC 4ODTH 1G7HB 4FQJH 4RMWA 3LH2H 2QBWA 4NQSB 3GRWH 2GJJA 3MUZ1 4CN4A 1FBIL 3HG1A 4RIRA 3IRPX 3SDCB 1A3RL 4X98A 1VGEL 4P46B 5IQ9A 4K7FA 2MCPL 4IRSB 4YXLH 2UUDK 2P7TB 1HHGB 2CMRH 1J0YA 3RI5F 2WK2A 3V52H 1GRWA 4G8GE 2R0ZH 1S5HB 5L88L 2BK8A 1EEYA 2JJVA 2XRAL 1H3TA 5EOQL 1LO3L 4UV4L 5E2UH 1JBJA 1KELH 3QCTL 4L3AA 3RKDC 5E9DA 5F7DA 2HVJB 3LDBB 4MSWB 5KSAA 3EYOB 3BE1H 3TYFA 3ZZ1A 4S10A 4NQDE 4NYLA 3SKMB 4OQ1A 1JE6A 3QCVL 2AJUL 1RZJC 2YUXA 3GIZL 4MAUL 3QQNA 5TDNA 1IGJA 1R5IB 1TQBC 2X89D 2XZCH 1RVFL 4L3CB 3ROLB 2DWEB 2D0GA 3BW9A 1DBBH 2LTQC 3SPVA 4K8RH 1YJDH 1LDPH 2IFFL 4PJAF 4WW2F 5CD3B 2AV7A 3DROA 3QUZB 4CGTA 5E5RB 4ACPA 1NGQL 5I1DA 4LLDA 4QTIH 1D9KB 1ADQH 1VEPA 4LLYA 4PRBB 3HR5B 5DK2B 1Z9OA 3QULB 1KJ3L 4LSTH 3U30C 5SWZB 2KDGA 4JY5L 1OAXL 4HLJA 4P46A 2CK0H 5J9PB 5E4EB 5I6XC 4HBCL 5E6YA 2JLLA 3DETC 3IAGC 1HEZA 1P84J 2YBRB 4BH7A 2XZQH 3WXWH 1XF5B 3IJYA 1FNSL 2XN9E 5HGHB 3N1PC 4LSUH 5DR5L 5H37H 5IM7B 1JZ5A 1G6RH 1T1ZB 3MUJA 4DEPC 3C5ZB 1S5HA 2Z31A 2DQHH 1H5BC 2DF3A 1WQVT 4XTRC 3FT2B 5I1IH 4XHJC 1NGZB 5JZ7C 5INCB 4ENEC 2HVJA 4MSWA 3WO4B 3EYOA 2DLFL 3GJFB 4HXBL 4PJ9C 2Z91B 4JG0H 3D39E 2EDDA 3KJ6L 1U92A 3ILQD 1UXSB 3OG6B 4CW1B 2RHEA 5DMJB 2X4SB 2F5BH 5KVDL 1I1AB 1WBXA 4NHCH 2Z9TA 3MA7B 3X14A 4L3CA 1GC1H 3GBML 4HIJA 5SWSA 3DO3A 3ARYA 4N0FA 1S7UB 1JV5A 1BLNB 5CD3A 3QUZA 2OXGA 3A6CH 4K07A 3WLWC 4ZUTB 2XWBA 5GGUB 4P2CG 5ESQB 1U8NA 4KPHL 2ZWLT 5DC9B 3TIDA 2DN7A 5EDXA 3HZVA 5SWZA 1KBGL 1FLRL 5T33H 1GIGL 1IFHH 3EAKA 2P5WB 2HKHH 2R2HB 4FQ2L 4L3EE 2XQBL 5D7SH 4WV1C 3BVNB 2CUMA 5HGHA 3RBSA 3TFKD 3W0WB 4KUCD 3DYMA 3T2NH 1T1ZA 5CBAB 4P2OC 1LHZA 3GSRB 4PJIA 1O7SA 3DRTA 3GMNB 5GZOD 4YHNB 4XCEB 4OTXL 1GOFA 2V5YA 3V5DB 5IQ7H 4OSUL 4IRZL 2DL9A 1FJ1B 2IFGA 3VI4E 1NGZA 3MBEB 2W91A 3WS6C 3O9WC 4QOKD 4OZIB 1URLA 3T0BA 4P99A 4LRIC 2NX5D 2ZP0T 2V5MA 4YHKL 4Y4KC 3JWOC 3CK0L 1UXSA 3QPQD 4CW1A 1P7HL 1S7XA 1AQKH 1QTYT 2X4SA 1A14H 1U58B 4YHYB 5CJQL 5DC0A 3F6IA 4JDTL 1F02I 2Z8SA 4PR5B 4QRPD 1CFBA 1RZFL 5HI3D 1GL4B 4HS8L 2J7LA 3GHBL 4KKLC 3TZVC 5FDWB 4G6JH 3O3BB 4K7PH 3RVWC 1ZA6A 1BLNA 3LEYL 5HYEA 2NYYC 5DJ8B 1U3HB 4U1JA 4OIIH 4YBHA 4X99B 2K7PA 5FGRA 1SVCP 1DBKL 5GGUA 5ESQA 2GYSA 5FA3B 1BFOB 3ZE2F 1EHLH 1ZVHA 4JFED 4HK3N 2P5WA 5IGXL 3BO8B 3MLXH 4PGJA 3B5GA 3BH9A 2EEBA 3L3KB 3P4MB 4M43L 3IRZA 4JN2B 2IPKA 1CGWA 1HZHL 5CBAA 2FX9H 2DQIH 3GSRA 4L8CA 4JPWL 2ZZUT 4ZTPH 3MLUH 4YHNA 3SOBL 4HUNB 1FJ1A 1PLGL 4DKEH 1V7NL 3WN5B 3MBEA 5D1ZD 4OZIA 4DZBB 3C5SA 3WHXB 1K6QH 3MCLL 4QRRA 2BOBB 2Q8BL 1MRCH 2FECI 4U2ZA 5HGGS 1RHFA 2J3SA 4QT5A 2RGSA 2PO6B 1Q72H 3OAZK 4MA3B 2FYYB 4KV5E 5GISH 4XP6H 2DBLL 2X1PA 1FZMB 1MCOL 1MAML 1T1XB 3JV6A 1NEZG 4HIXH 5DUMH 2AK1L 5DJ8A 2HG5B 3WDHA 2CKBH 5CIPA 3NTCH 3F12B 3QI9B 4X99A 1NFDB 2E9WA 1J9CT 3RUGB 5D96B 3SBWA 4C56A 1A0QH 1JPFA 3MFFB 1MJ8H 5GZNC 4JGJA 2X70B 3NBNA 1OAZL 2DYPD 1VFBB 4XCYA 3G6DL 4FZEH 4Y8AA 4LGRB 2XG4A 3LQAC 4F3FA 3CFBA 1A5FH 3BO8A 2VDRL 3OX8A 3L3KA 4WHDA 5I76B 1QKZL 4KHTL 4MJ6B 1JUFA 3O11A 2KUTA 4BK4A 1UB6B 2Y4SA 5I1KH 3SJVD 4MXVE 5DMGD 4YHPB 2FDBP 1HHJB 3D0LA 1P4BH 2WIIA 2QQKH 2MKWA 4B7IA 4H8WL 4JRYB 2EECA 5BW7A 4U05A 4HKZB 3BGFB 4RZCB 2OX5A 1V3LA 3C5JA 3IJSB 4HGKC 2BOBA 4L9DA 4TSAL 2AS5M 4WHYH 2HJFB 4NNPH 2Y72A 1XGYH 2VQUA 4J4PD 2PO6A 1OP3H 4LU5L 4DVBB 1PY4A 5JOFB 2FYYA 1INEH 3EYSH 4R96B 4D0DA 1I3VA 1WZLA 1FZMA 4NNXB 4WEUD 5E99L 1JPTL 1J05B 1T1XA 2ZKHH 5D7IF 2HG5A 1JGLL 3RUGA 1NFDA 4ZFZB 4MQTB 1F6LL 2MHAB 3MFFA 1KPRB 4DVRH 2VYRE 3HE6A 2EDNA 5D2NB 3C87A 3NCYP 1NAKH 1P5UA 1VFBA 2CSPA 4A6YB 5E8DH 2OSLA 1MCDA 5DVLA 4GG6E 2BVYA 1NMAL 3T1WA 1XF4A 4LNRB 1FZJA 4G6FB 3ARTA 3EFDH 3V4PH 5I76A 2VLLA 2J6EA 4MJ6A 1OARH 5T5FL 3FO2B 1UB6A 1LEGB 2CJUH 4HAFA 4YHPA 2XWJA 4TNVK 3OXRA 1TJHL 2VLRB 3O6FB 4FP8H 1UM5L 2V5SA 1TZHB 3LQZB 4OI8A 3BMWA 4LKXA 3MV9E 4PG9A 3ARFB 3H8NA 1ACYL 4YFLF 3IJSA 5MP6H 3BGMA 3IDYC 5HHPB 2N4IA 3VW3H 4ERSL 2VKXA 3TV3H 2JIXD 4NPYB 1SY6H 5CGYD 1KNOB 4YX2H 5JOFA 5D6CB 2FATL 1OPGL 3S37L 2X4PA 4LEXL 4Q7DA 5DEZA 3IDUA 4PRIE 4KKBD 4U6TA 2OTUB 4LCYB 4QHLA 3I9GH 1YMMB 3MOBH 4JANA 4TTGA 2CO7B 2FIRT 5D2NA 2OI9B 1N6VA 3TPUA 5KBNC 5DQ9B 1NGWB 1IGIH 1Q9LB 4LNRA 3VG9B 1WIUA 2APBA 3FFCB 3B83A 2CDGB 3BKJL 3MRNA 3VXQA 1MSPA 1Z0MA 2KKQA 4KROB 1NC2B 4NNYB 2LE9A 1CT8B 3ULVL 4YDJB 3SE4A 4OD1H 3U6RB 5IWLA 4UIKH 3UXFA 5FUOH 2VLRA 1MCJA 2BY0A 4HGMA 2X4TA 3BH8A 1TZHA 3R06A 5BVPL 3TCLB 4AT6B 3SGJC 1CLYH 2YD2A 1RZIA 2FHCA 3EOTL 4OV5A 1P4LA 5KS9E 2I9LA 1DDHA 5GGRY 1JHTB 4TRPL 3CU7A 5TDPB 1BQUA 4ZODA 5CEZE 1S7RB 2BVQB 3TFKC 4JRXD 3ZTNL 1HIML 1FPTL 3VXRE 3MV8E 4JFFB 4YHLL 2NY2B 4EVNB 2Y1VA 4OM1H 1C5BH 1MRDH 3MLSH 3LSOB 3GI9H 4E41E 5CZXD 5GZOC 3L7FB 3ZYZA 5JLZB 1T7WA 2A77H 4YE4L 4PJXB 4LCYA 4OGAD 4HXAH 2FRGP 2DKMA 4HWZA 1A7OL 1A6VL 4DTGH 5C08B 4ZNCD 1MNUL 3NIGE 1B0WA 3QPQC 3VD7A 5DQ9A 1NGWA 1PG7H 3L3OB 2B4CC 5DS8B 4GAYB 1DQTA 5JHDE 3LS5H 4TSCH 2XYCA 3FFCA 3V4UL 4X9IA 2CDGA 5HI3C 4HQQL 4ONGL 5B4MD 4LL9A 3NGBB 4ZAKD 3CMGA 1ERNA 3RWDA 4G9FD 4NNYA 4PP1D 1ZLWH 1CT8A 5J1AA 1K3ZA 2J6EL 3U6RA 1AGCB 4HFWB 2WUCL 3RU8H 2M2DA 1CDCA 3UJIH 3TCLA 4AT6A 3O6LL 4XBPB 1IT9H 3WL9A 1I1YB 3TA3C 2XY2A 4LSPL 4M62H 4KDTC 2FO4B 1JNJA 1HXMB 3J8F7 3D85D 4H26B 4YDKH 1TCRB 3IDMB 5AAWA 4TPRL 1OGAB 4ONOA 1QNZL 4Q6YA 1H3GA 1J1PL 3TVMB 1LO0L 1T5WA 3PP3H 4JFFA 4EVNA 1OL0A 3QO1B 5JDSA 3IDNA 3OJVC 1W72H 3LSOA 4JGUA 4NUGH 2CR6A 5JLZA 2FD6L 4LQFH 1OY3B 3VFVB 4PJXA 5D1ZC 3FZUD 3RA7L 1KCRH 7CGTA 2GJZA 3R8QA 1MFBH 2AXHA 1G0XA 4UTBL 4KZEH 1K3IA 4CBPA 4HUWA 5C08A 2R0WL 4F80A 4O2CB 4WHYG 2IBGA 1L4IA 1RURH 2JB5L 4Z0BL 2R0LH 3QNXB 3KWWB 1C5DB 1S9KC 4X7TB 1DLFH 1QOKA 3RWEA 1D5IH 1TNMA 3MR9A 5EO0B 1F3RB 1NBVH 2MOVA 5C6TL 1CGYA 3MTRA 5IBUG 4XI5D 1CVRA 5ID0B 4ZD3H 4HFWA 4L5FH 5F6HI 1YEHL 5MI0C 5C9JA 5ILTH 3DXAA 3QWQB 4WFHD 4XBPA 3JWDH 3QUMB 4M1CD 1BF2A 1AGBB 4PYGA 4FRWA 4PJ7B 6FABH 1JGDB 4HPYH 1CLZH 1HXMA 4H26A 3Q1SL 3QEQE 4XT1C 3IXTA 5ETUB 4OF5A 1TQCB 1RUKH 3MRLB 1MIEL 4R4FL 3L3DA 3P0YL 5DMGC 3MLWL 5D2LB 5IFHH 3KJ4B 3RGVD 1QFPA 5AG8A 4XBEH 4NJ9H 3QIUA 1T7ZA 1MHHB 4CJ1A 2N7BA 5C07E 1JWMB 4LVNB 4ZXBD 3HR6A 4EIGB 3LB6D 4GUPB 3ARDA 3IFLH 1JGUL 3WKMH 4KK9D 5D1QB 4K23H 4J4PC 3HI5H 2FJGB 4G5ZL 5ECJE 5F9OL 3SKUD 1I3GL 3PDOB 4GAJL 1MCCA 2EDLA 4B53A 4BFEA 3KWWA 1C5DA 5EUOB 2DLTA 4MZ2A 1GGTA 4TULL 2B7DT 3S8WA 2R39A 1U6AL 1NCNA 43C9B 5IMOB 4QHKI 2NCMA 5DJXA 4P3WA 2BNUA 2PYFB 4RMQA 1FVEB 1FIEA 4U1NA 2GQHA 3QDAA 3VD3A 5ID0A 4ZPTB 5K9QG 5EPMA 2E27L 2Q87A 5DJ0A 5C0FA 2E8ZA 2R1YA 1J11A 4D2NA 3VXSB 5C0JA 3BN9D 4BH8B 1KOAA 1F4XL 5IVZA 4XVJH 1MUJA 3MJ9A 3GMRA 2DQJL 4HG4J 1KB5A 2MSPA 2GTZA 2W38A 4XXDB 1R3IL 4PJ7A 5SX5K 2W92A 1T1WB 1NFKA 2X9WA 1CFQB 1T22B 1I75A 5GGTH 1UA6H 3U7WL 1IBGH 4ZFGH 1QLRB 5T3XE 4NGHL 1PBYA 5BOPA 3BMVA 4M7KH 3V5HA 1U93A 3OSKA 5ESVB 4JZJB 3MGOB 1A9EA 3MRLA 1KUMA 2M26A 4UU9B 2B8OT 3EJZD 4NP4H 2DOCA 1NCBH 3T04D 1FZOB 1AO7B 2B1HH 1S9WB 4XPFL 5DJDB 4NJAH 1YC8A 2NR6D 1MHHA 1I1FB 1UQSB 2FJFA 1TENA 4Y5YA 4R97C 5KAQG 1MCNA 5HYSB 3W5NA 5CGYC 3PDOA 3C60A 1A8JH 5EUOA 4LDLB 4M8QB 5ITBH 4XMPL 4XNXL 43C9A 3L3IA 5GRVK 1G6VK 3LEXB 2PYEE 4JY6B 3UEZA 4PTUB 4KKBC 2NPLX 1LO4L 1F3DJ 3UTTD 2H32B 4ZPTA 4S1QH 2X41A 1OOAA 1ZXQA 2C3XA 3VXSA 1WFNA 3KPOB 4EJ1C 1RD6A 2BNQA 1NBYA 2YHGA 1SBSH 4BZ2H 4OUUB 1QSVA 5JO5B 3CLFH 1XZ0B 3OR7A 2FLBT 4U1GC 4WWKB 1Q9OB 2BXYA 5TPWL 2DLEA 3MGOA 2EDWA 4OCMC 1YEEH 1FZOA 1AO7A 4WO4D 3QDGB 1ACZA 4I77L 3B4NA 5DJDA 4P2QB 2VXUH 3BD4A 3ALPA 4TVPH 1YEJH 4NM8L 5AUMB 1OAKH 1I1FA 1YQVL 1RZKC 2DKUA 2D31A 2HH0L 2DMKA 4PY7B 3ARWA 4DGYH 1MCKA 1R3KA 4PJFB 3KPSD 2NW3A 3Q6GH 5HYSA 1DUZA 3NIGF 3S36H 1KC5L 4DK6A 3MGTB 5LCVH 5BVJB 4NKOB 1NFIA 3T2PA 5CZXC 2EDXA 3DI3B 3LKQB 2O5XH 1T4KB 3SGKA 4JPVH 5DD5L 1BBDL 3MYJA 2J5LC 3VCLA 3X17A 3SDYH 4EI6B 3O45B 4N0UB 4RGND 1EHNA 4WFFD 2X42A 2Y6SD 1J0ZA 4NKDB 1I4FB 3CZFB 2IAMD 3UZEA 1X6NA 4OLXH 3TP4A 2VXVH 3UTPD 5IV2A 2PETA 5DTFB 2IQAA 3MJ9L 3MLYL 3MODH 1KB5L 3T2OA 5EBGA 1XZ0A 4PJCB 5B4MC 4ZAKC 4MX7A 5ACMA 3SE9L 4I1NB 4P2RE 5GRUH 3UBXG 4PP1C 2HN7B 2QHLA 5C0BA 2BRQA 4HH9B 1WICA 2XXMB 4D3CH 4KRLB 3OJ2C 3K8LA 3OR6A 2WINB 4J23A 1HKLL 4P3DB 1X7QA 4P2QA 4OD2A 3G6JA 3DX7A 5JHLL 2ADJB 3FHQA 2BY2A 1A6UL 4NZJA 3BKMH 4PY7A 4MHHG 2O5ZL 1CGTA 3EYFB 3MGTA 5BVJA 1LILA 4NKOA 5I17B 4FQCL 4C54A 3LKQA 3V9FA 3RWCB 1T4KA 3PNWB 4I18A 1OTSD 3KPRE 4EI5A 1ZV5A 1BVKA 2GAZB 3FO0L 3FZUC 4OZHF 1FC2D 4GOSA 3O45A 2BERA 3CXHK 4N0UA 4APQB 5HDQL 3S88L 4PYHA 1FYTA 1RQ5A 1OB1B 5SV4A 3WNNA 1P6FA 1F58L 2CR3A 2HYMA 1QVOB 2GSGB 3QNYB 4PV9B 3OHXB 1WVZA 1BEYH 1FNAA 3MJ7B 3UJTL 4WFGE 4DK3A 5JA8B 5J13B 3QSKB 4XNQA 1YNTA 4PJCA 1ZTXL 3Q3GB 1NMBH 5L6YL 4M93B 3WCYA 2QSTA 4J3SA 4B50A 1LNUB 2HN7A 5ITFB 4D0BA 2AEWA 1A2YB 4FOMA 2AABL 4HH9A 5KZCD 5C1MB 4XI5C 5EO9B 5D72H 4JY4B 3DV6B 2WINA 5JIHA 2BC4B 4P3DA 2Q76B 3H9SA 4AENB 4M1CC 2WBJB 4NQCE 2E6JA 2L4OA 4LAJH 5FA4B 2ADJA 1JF1B 3V6ZB 4F37F 2D7NA 3PHQB 2BNRB 5ADPL 4MXWH 2EH7H 4LVHB 3UMTA 3FMGL 3DTXA 3EYFA 4Q9RL 3ET9F 3GB7B 4GJTB 5I17A 1SYVB 1UEMA 5L2JA 1J8HA 5DD1L 3CFEB 2AJYL 4ISVA 3PWJB 1CICA 3RGVC 3CH8A 5D8JH 4U1MA 2GAZA 3WJJA 1A6WL 3JUYA 3KPQA 4ZXBC 4Z7WB 5IJKA 3O0RL 4JQXC 1QR4A 3P11H 3LB6C 4P57B 4Q2ZA 2H45A 4W6XB 3ZMRA 3LS4H 3DSNA 5FUCE 4L8DA 4KK9C 4PV9A 4XPBL 3QNYA 4LASL 1OP3K 1N0XH 2IF7A 1SJVA 2XTJD 4GAGL 3MJ7A 5CFHA 1ZVSA 4OLUL 1ZA3B 3Q3GA 3I50H 5ITFA 5CUSH 5FYJD 1A2YA 4PUBL 2V17L 4YHZL 4PD4J 1MVFA 4JFZH 4LPTA 5INDB 5EO9A 1KLFA 4JHWL 4JY4A 4YJZL 4KFZC 1X5KA 3G5XA 1X5IA 3BN9C 2J4WH 3WD5L 4AENA 2FX7L 4FQIH 2WBJA 4PJGA 1N3NB 3BXNA 4FABH 1N4XH 4O9HL 3TJEH 3V6ZA 4PJ5B 4F7TA 3PHQA 4EXKA 5E6ZA 3FN3A 4OCRH 5KANG 4NZTH 5ISZD 1ZT7B 3EJZC 3GB7A 2VDMH 5DQDL 5L2KB 1SYVA 1PGRB 4IDLA 1WF5A 2VL4A 3CFEA 1LEIB 1XH3A 4UAOC 2P24B 3PWJA 2UZXB 1QLFA 1FIGH 1GZPB 3SCMD 3JBG7 5CMAB 3QAZB 3U36B 5FCUL 2NR6C 4Q74A 4HGWA 2WV3A 5DJZB 2N1KA 2GFBB 2VLJA 4QXUH 4TOYH 3I6GB 2ICES 4DW2H 2YN3A 1FG2B 3HZKA 3RAJH 1KFAL 4YO0B 4YBLC 5SWQA 1ZA3A 2VB5A 3HE7B 4OUOA 4KUZL 5CEXA 2XWTA 4KDVA 2C4XA 2B20A 1XF1A 3TT1L 3Q48A 5IFJB 1WZMA 1M71B 4UINH 5INDA 2XKSA 4JEGB 4MJ5B 5E8EA 2HFEB 2KZ1B 4U49A 1YN6A 2BCKB 4D9LH 2FHBA 5C92A 2PW2B 5T1MB 5I75C 1U0QA 5BS0D 1WWCA 1N3NA 3WFEL 7FABH 5DZNA 1BQHB 4Q97A 3A67L 1T2JA 4PJ5A 4G7YH 4MMXC 3TH2T 1JFQL 4EIZC 4BYHA 4CL7A 5MEND 1YJDC 1L7TH 3QNZA 4XPHH 4KY1H 5K9OB 5SWZE 1ZT7A 1FAIH 2ZG1A 2GK0B 1HCFX 4WO4C 1LEIA 2P24A 1GGCL 3V4VL 4XP4L 2UZIH 3IFPB 3NPSC 1YNLL 5CMAA 3U36A 2R9HD 3ZO0A 3PWPB 4XWGH 4NSKB 2CLVA 3T77A 4OCXH 3QG6A 5J12C 3VFWB 2DIAA 4U4BA 4Q6IA 4HDIA 3RP1A 3KPLA 3UJJH 2C7UB 1FG2A 4U1KB 4G8GD 4DGIL 1XGRB 3RWGB 3H9HA 3HE7A 3LEVH 1CXLA 2LABA 4X6BB 3HMWH 2Y06H 4K9EH 2LU7A 4Z7QE 2I07B 4QRUA 3GSNA 1FLTX 1JP5A 4EN3B 2OCFD 3CSBA 5IFJA 4U1SB 1FL3A 4NQDD 3G5ZB 3NZ8A 4RGNC 2HFEA 4M1GL 4XCCL 3GMOA 2BCKA 2Y6SC 5I8OL 1G1YA 4JN1L 4M1DH 3MLVL 2IAMC 5MEPB 2XTLA 3DMMD 5HYJA 5H2BB 1BQHA 2HLFD 3EO1B 4U1HB 4OLEA 1DSFL 5DWUH 3BDYH 2VDOH 1CFVL 2IH3B 1ZLWK 1RIHL 4DN4H 4N90E 1T7XA 25C8H 4PREA 5IR1B 4U6VH 2DQTH 3GMMB 3ZDXE 3K2UL 3QDJB 2P5WE 2ZUUA 4FQQA 4F9LA 2B1AH 3GSOB 3IFPA 4Z6AT 5EORL 5CP7B 2VDKH 4MDIB 2BHUA 2Y5TA 4HD9A 4GW4B 3PWPA 3VXNB 4NSKA 4HV8A 4PB0L 3W0WE 4WW2C 5IMKB 2WWKT 4R3SB 3VFWA 3FRPG 1WWBX 2XN9D 4U3XA 1FBIH 1ZHBB 1MHCA 5IG7B 5F21B 1A3RH 1T2QL 1VGEH 3O4OC 1G7QB 5BRZB 2DDQL 2MCPH 4OZIE 3RWGA 4KI5E 4NFDA 4X6BA 4B41A 2G9HB 1WCBA 4P23B 4YR6A 1ZGLA 1OTSC 1MWAB 1CXFA 3QXUA 4M6OL 1UKTA 2XRAH 3G5ZA 4BSVA 5CINL 5EOQH 1LO3H 3N06B 4UV4H 3D39D 4P5TB 1WISA 3UYRL 3QCTH 4J3XA 1CXHA 3BYTA 5KVFL 2QSVA 5FV1L 4KRMB 5H2BA 4CMHC 2H26B 1KYOJ 1T6WA 3QCVH 2AJUH 3QQ3B 2VOTA 3GIZH 1U8QB 4MAUH 4X9FA 4LMQI 1MLBB 2EYTA 3G5YB 2IH3A 4ZO9A 4Q9QL 4RFEA 5IHUL 4RAUA 1S7TB 5IR1A 3D0VA 4TUOA 3B9DA 3GMMA 4BA8A 2IFFH 1JK8B 3ARSA 3WNOA 4LCWB 3AXLB 4FXLA 3RDTD 4XVTL 1KXVC 1NGQH 2UYLA 3VRLF 1CTNA 1I7TA 1XCTB 3D5OF 4POUB 5JIPA 4MDIA 3ULVE 4J3OC 4GW4A 1AHWC 3VXNA 4Y2DB 5IROA 2A1WL 1KJ3H 5CBEB 2FL5B 5IMKA 4L3ED 4R3SA 2XOTA 4Y4HA 4JY5H 1OAXH 1KJ2B 1DBJL 5IHLB 2MMXA 5IG7A 1A6PA 5I1CL 1G7QA 1YMHA 4HBCH 1DN0A 4MD4B 2VR9A 2XQYG 1FNSH 5I16B 5DR5H 3Q5TA 4WY7L 3TPKA 3SKJL 5KN5B 2IC2A 1TJIL 1AH1A 1GPOL 3JWNC 3OKEB 3GSNL 3K1DA 4P5TA 1X5FA 5IUSA 2UWEA 3VFTB 1NUNB 1BZ7B 2DLFH 2L7UA 2YXMA 4HXBH 4JQVA 2H26A 4JKMA 5IB2A 3GIVB 3MRMB 3KJ6H 5B38A 1CDIA 3WJLC 3RUGE 1NFDE 2AK4B 2ITDB 1A21A 4HWEL 4P9HC 1U8QA 3KYOB 4AZ8A 1MLBA 2H6PB 2R1XA 1C8PA 1DJSA 5KVDH 5I1JL 2ARJA 3WO3B 4FTVA 4P3CL 1NC4A 2I9TA 3VWKD 2EYRB 4GKOA 5FGBC 3I85A 4GBXD 3LVEA 1JK8A 3AXLA 1Q38A 2C3HA 4K94L 3V6OA 3VH8B 1XCTA 1BPVA 3RHWF 1L0YA 3TO4A 3VXUA 2EIZB 4NWUL 3KXFB 3EZJB 1D7FA 4KPHH 4LSQL 2IGFL 2FL5A 4KK6D 5IKCA 3NAAL 2ARWA 4LKCB 1KBGH 1FLRH 1GIGH 3GSUB 4JRYE 3VRIB 1RIVL 3KPPA 4Y5XB 2EDKA 4FQ2H 1RUML 4FNLH 4PJBA 4PP2B 4WVRA 2XQBH 5DT1L 3VXMB 2A74A 4BSJA 5I16A 1B4JL 4ODSH 2FEEI 3SCMC 1BZ9A 3CH1B 5KN5A 2EO1A 1AIFB 3IB4A 2R2EA 1G9EA 4OTXH 4OLVL 3OKEA 4IRZH 4OSUH 4PJ8D 2DQUL 5I1EL 4HAGA 5J57B 1W0YT 2GCYB 3VFTA 3WS3B 1CD8A 1BZ7A 3KPTA 4YHKH 1T03L 4ZO6A 3X11B 2PXYB 1IC5L 5F7HA 3GIVA 3KYMA 3BAEL 4N8VG 1GVIA 3CK0H 4LPWA 2FJHA 1K8IA 2H6PA 1MVUA 2YRPA 1MCBA 2VQ1B 1FG9C 4JDTH 2EDYA 3FB6B 5CJQH 5D2NE 2EXWD 4KGLA 4LHQB 1RZFH 2BVUA 4HS8H 1A3QA 3RVUD 3GHBH 1S5IL 3CPLB 5F9AC 2EYRA 1FCCA 4OLZL 3BRGC 3VH8A 2D0FA 3QT2A 1BAFL 5GS1B 4S0SD 1DBKH 2EIZA 5HHOA 3ZHKA 5CKAA 4UUJB 1VFAA 1UCBL 5D7JD 1TETL 2VLRE 2X10A 4LKCA 3QZWG 3GSUA 4PJIF 4DUXA 2C26A 4U33A 3H3KA 4Y5XA 1P7KB 1VDGA 2CUHA 1QLEL 3KYAA 1XIWD 1YEFL 3BIAX 3VXMA 2NTSP 4JPKL 1HZHH 1DQQA 4YFDB 1V05A 5LGJB 2R9HC 1AIFA 4MA1B 4Z7QF 1P84K 3PHSA 3SDXA 3SOBH 4LBEB 2C3WA 1PLGH 4MD0A 4Y16D 1V7NH 2NMSA 2VISB 3MCLH 3WS3A 1T7YA 2E6PA 1B6DA 2Q8BH 2BVPA 5I2IB 1YEIL 2GJ6B 3TNNB 2UY7A 1F90L 3S5LB 1F3DH 1YMME 4FA8A 1B9ZA 1JMXA 3KS0J 4CADA 3FB6A 3NVQA 4ZFFA 4P2YA 1MCHA 2DBLH 4K55A 2JCCA 3CPLA 4ZUUB 2VWEE 1MCOH 1MAMH 3FFCE 4UDTB 2PNDA 2AK1H 3ZDXF 5GS1A 4LLMB 3CFIC 3VFUB 1L0XA 3UTSB 3DMMC 3RVVD 1DQLL 5EIVA 3WE6B 4P5MA 1OAZH 3GRWA 4PBXA 5T5NG 4XNZC 3G6DH 4J1UA 3HS0A 4LLUB 4YAQB 2NY1B 1J1OL 5F93C 1EUUA 4GO6B 2VDRH 1IQDA 3Q2CA 32C2B 4PY8I 4KKCD 1B2WL 4ODWA 4FN0A 1BX2A 4KHTH 1T80A 2V9TA 4OZIF 3KDMB 2DKSA 4OCWL 3MV9D 3O2VL 4KRPB 3NN8A 4KI5F 2YA0A 3JTSA 4L4TB 3TN0D 1VB9A 3C8KA 3BPNB 4LLQA 3V0WL 4AEFA 4LBEA 5C9KA 4F9PA 2VMFA 4V1DB 4H8WH 2YD7A 4JFFE 3LPFA 2E7HA 3LOWA 3OKMA 2VISA 5A2JH 4XHQA 3L5WB 4H0HB 4TSAH 2Z35A 1HSAB 2GJ6A 4PJXE 2K7QA 4EUPB 5I30L 5HTSA 5DI8B 1H0DB 1UCTA 4LU5H 1KTRL 4PRID 2YPLB 5GJSL 4M8VA 5C08E 2GY5A 3FB7A 5E99H 2EIDA 5DYOB 2LVEA 5BV7C 1JPTH 3U4EA 4GLRH 5GRYA 4UDTA 5I1GL 3MRHA 3OG4B 4DCQB 4LLMA 5JR1L 1JGLH 3UTSA 2XXCB 3ULVF 4K3EL 1VEOA 3KYKL 4CDHA 3DBXB 3GFUA 4P4KA 2IWGA 3MLPA 3IVKB 4KJPD 4YAQA 1NMAH 4IS6B 5IFAL 4PJAB 5J56B 4GS7C 5CJOL 4L4JA 3ROOB 5T5FH 3AS3A 4LEOA 3MRDA 3SDDB 3KDMA 5J06A 3RDTC 4JM4L 1JZ4A 4FXGB 1OGAE 4L4TA 1TJHH 3KHQA 5E8NB 1UM5H 3ZSTA 4XP1L 4L1DA 4KJYB 5A2IH 5HHNB 1UJ3B 2X4RA 4RRPG 5CEZD 1ACYH 1JRHL 4YK4C 3KHOA 1QFUL 3OKKB 2B2XL 3OAYK 3VXRD 4F57L 3MV8D 3O8XB 1HSAA 1CR9L 1FO0B 1ND0B 2J2ZA 2WQRA 4I0CC 4E41D 4ERSH 4EUPA 5DI8A 4C4KO 2ED9A 2A73A 1H0DA 2P8MB 5DZOA 2YPLA 3QYCA 3RUGF 3HAEA 4QGTA 1NFDF 2JJUA 2FATH 1OPGH 3S37H 2CIKB 2F54B 4LEXH 5DYOA 2RCSL 5FYKE 5DFTA 5K59E 2Y7QB 4DCQA 2HVKA 3QWRD 5JHDD 1UACL 2IMNA 2VE6A 3CX5J 1AP2B 3EYUL 5CIPH 4LRNL 2C1OA 3WMSA 3DBXA 4GQPH 5D93C 2YPKB 1S7QB 4IS6A 2AQ3A 3GRWL 3IFNH 4RFNC 1JI1A 3BKJH 1KEGL 5D5MA 4PJ7E 3VWKC 3ROOA 5DEFB 4GBXC 3BX7C 5C09A 4MJIB 5EULV 5IMLB 4X5XB 3ULVH 4WNQB 3FCTB 3QFJB 3I3BA 1O0VA 4R90L 4FXGA 2DLHA 1H15B 3MRKA 2EYSA 1ZT1B 5E8NA 5T3ZL 1UC6A 5BVPH 5D2LE 2R0ZL 3H7BB 1H5BA 4KK6C 3EOTH 1OP5K 2AEQL 4NO0D 3DVNB 3MROB 5DF0A 4EZMA 4XPTL 3O8XA 3MMEA 4X6EB 2XQYK 1FO0A 1ND0A 2F58L 4TRPH 4PJ9A 4G6AD 1ZLUH 1PYWB 4QLRA 2IJ0C 1NSNL 2P8MA 3ZTNH 1HIMH 4J3VA 3LKNA 4LCCC 1FPTH 1HHHB 2QADC 4YHLH 5B3JE 5BZDB 2WWKO 2CIKA 2F54A 3HRZA 3QDMB 1OLLA 4PGCB 4PJ8C 1Q9WB 4Y19B 4YE4H 2P5EA 5EUOE 3MZGB 1DBBL 1ZLSL 2CKBB 2IBBA 4U1LB 5JUEL 1KCSL 5F72S 5K93A 1A7OH 1UEYA 1WTLA 1A6VH 1SMAA 1A47A 1MNUH 4KVCL 3BQUD 4Q9CA 3K2MC 2NY3D 1ZWIB 3C8DA 4JFXB 1CU4L 1IEAA 5F9DC 3VXSE 3WLBB 4IRJB 3W39B 5JNYB 3NZHL 2EXWC 4A2LA 2HKFL 3V4UH 4Z8FL 4HQQH 4ONGH 3ULUL 3ARVA 3RVUC 5CLWA 1J0JA 2AJZA 2G75A 5DEFA 3HB3D 4JFOB 4PGEB 4XPGL 4WNQA 3QFJA 3LN4A 1MQ8A 2G5RA 2J6EH 2VL5A 1H15A 4IIQB 2EKJA 2ZNWA 1JNHB 2WUCH 4OKDA 4U6YA 4P2OA 1U91B 4J8RB 3O6LH 4NDMA 5JQHC 3QEQD 4GG8B 2F5AL 3WFHB 3H7BA 5D7JC 1AO7E 3IF1B 4LSPH 1RUQL 3O9WA 3MROA 3WS6A 4F8TA 3QRGL 4R0LB 3RWFA 3TF7C 2BSED 4P59L 5TJWK 1XIWC 4TPRH 1QNZH 3SY0A 1UWEL 4BM7A 1EO8L 1VERA 1RZJL 3BPLB 2GSIB 3QDMA 1RUPL 2FD6H 4GW1A 2BP3A 4Y16C 2ATKA 1V7ML 3QUYD 3F7YB 5E94A 3RA7H 5I18L 4G6ML 2BFVL 2ILLA 1BVLB 3RPKA 3WFBL 3HPLB 3C9NB 2H3NA 4UTBH 5DSCB 4ODVL 2R0WH 2WIMA 3B8SA 3VWJD 1ZWIA 4JFXA 2ITCB 2YD3A 5HHXL 3OKYA 2JB5H 3AREB 1OSZA 3WLBA 4Z0BH 4IRJA 5JNYA 3LAFA 1DEDA 1GHFL 2EIBA 2CD0A 5FYLL 1INDL 3TBYB 1TLKA 4PGEA 5C6TH 1CG9B 5BXFB 4MCYB 4MAYD 5I71C 1KIRB 4IIQA 4JKLA 4PRAB 5LGHL 1YEHH 3ES6A 1ZKAA 5H8DA 3O2WL 1DQML 3RVVC 1G7LB 5C0GB 5HGAB 3QEHA 4WJ5A 5FHAL 5T3XD 3WFHA 1JF5A 1FSKC 5E6IB 5A1AA 3MRBA 2AXFB 3QDGE 4CN6A 5C0CB 2KZWA 3T8XB 2VNCA 4P2QE 3Q1SH 4NHUB 1N5AB 4P48A 1YECH 4GRWF 4KKCC 4PJXF 5CSZA 1FO0L 1MIEH 4R4FH 4PJFE 2XA3A 3MLWH 3SDAB 3TN0C 2HRLA 1B90A 1MY7A 3FTGB 2GSIA 4NQEB 4FMFA 1PY9A 4I2XB 2P47B 5ANMA 3BPOB 3F7YA 3I02B 3IGAA 3DX8B 3MNVB 2IADB 4DFHA 4JLRB 1E27B 1BVLA 3FOMB 3IETA 5DSCA 1DR9A 1OSPL 3PWLB 1N5YL 1JGUH 2OL3B 2VZSA 3ETBF 4N0UE 4YDVA 3AREA 4K2UL 1ZHKB 2PYED 4G5ZH 3W2DL 3QEGL 5F9OH 1I3GH 4GAJH 1Q9KA 5FKPA 1QPPA 4TULH 5D7IB 1U6AH 2H8PB 4W81A 5EBWB 5F9WB 1CG9A 5BXFA 4MCYA 4PJCE 4YHOL 2E3VA 1KIRA 3TH3T 3SE3C 2E27H 1NPUA 2V7NB 1F4XH 5HGAA 1WT5C 1TVBB 4ZTPL 2OR9L 2AVGA 2DQJH 3MUGA 1R3IH 3MXWL 3D3VB 4KJPC 3HNVL 5EH1A 1J8KA 3U7WH 2MCG1 5F6HJ 4XP5L 4NHUA 3CX2A 4NGHH 1BD2B 1ZANL 2GUOB 1MFNA 2FBJL 4XB7A 4AY0A 4OFPA 1N8ZB 1YY9D 1BMGA 3MNZB 3JWOL 4OF8A 5MEQB 4XZUB 1I7ZB 5DD3L 3LRGA 4XPFH 2WLZA 3H0TB 4XRCA 5GSVB 2Z93B 2JJTC 4M02A 1KEML 1QQDA 2EKSA 3DX8A 1LMKA 5CJXC 3NFPB 1E27A 1U3YA 4GRWH 3FOMA 4LIQE 1XT5A 3QIBB 5ICXA 4RMRA 3T3PF 3AS0A 2P49B 2OL3A 1NLBL 5IB4B 4Z7VB 5AYUL 4UQ2A 2AV1B 1NANI 3LZFL 1D5ZB 4JDZA 4I4WB 3QHFL 4HIEA 4XMPH 4XNXH 2EDQA 2NLJA 2X89A 4MNGA 2RIKA 1QRNB 4M3JA 4LSVL 1R24B 3U2SA 1YEGL 3RIAF 1KJVA 4PJ7F 2AXGB 3UP1A 1LO4H 4XXCA 5CLTA 3QUXB 1MHPH 2N7AA 4XNMB 2V7NA 4MB4A 1A02N 4PJDB 1EPFA 5I0DA 3S4SA 4P2RD 6CGTA 3D3VA 4PJEB 3RY4A 4POZD 1HILB 1EJ6A 4NQVA 1AR1D 1RZ8A 3LD8C 1BD2A 1YNKL 5JOEA 1JWUA 5TPWH 1CE1L 4X83A 4ZS7L 1MHEA 2BNRE 43CAA 1XGYL 5MEQA 3UPCA 1JTTA 1W72B 4XZUA 1I7ZA 2APTA 4I77H 2CUIA 3H0TA 4JFHE 5GSVA 1NBQA 2Y5EA 1OWWA 4NM8H 4YDLC 4JO3L 1YQVH 4HSQA 5EUOF 2HH0H 3QIBA 3DO7B 2D7OA 2LFGA 4G6AC 4Z7VA 2W07A 2SEBB 4F7CA 4OAWA 4CU6A 3EYVA 3CGTA 3P4OB 4YNYB 2AV1A 3KPRD 3RBGA 4L8SC 1MJUL 1D5ZA 1RHHB 4I4WA 3ZE0F 3E8UL 1R24A 3LQAL 4QF1B 5DD5H 1BBDH 4IJ3B 4N8CL 1T20B 3EFDL 3Q0HA 2AXGA 3QUXA 5IP4A 1NEUA 5FUZL 1TPXC 4XNMA 4WFGD 2ERJB 2C3VB 4PGDB 2DS4A 2P45B 3BQUC 4PJDA 2NY3C 2GT9B 3DYOA 2ZOLB 2ZJSH 5ADOL 3SGJA 4PJEA 1CDUA 2V6HA 3TA3B 3MJ9H 3MLYH 3DUSB 4UT7L 1KB5H 2V5TA 2R8SL 3UPRA 4HG4K 3CFDB 3SE9H 5HVHB 1J1XL 3HB3C 5D7LB 1U8HB 4PJ5E 4MA8L 4NQCD 4HJ0D 4U6HB 2W0LA 2AJVL 5TE7L 1IAOA 1UH2A 3ZKND 1HKLH 4NRZB 4TNWK 3IXAA 5L2KE 2HFTA 2VZOA 5JHLH 2NY5C 4QOKA 3T1FB 3OPZL 3H3PL 1A6UH 2NX5A 2ZPKL 2VLKB 2O5ZH 4WI9A 3RHWK 2ZOKB 5AYQA 1Y6KR 5F6IC 2OL3L 5JW4N 2X7LA 5F71A 1EIBA 5IT2H 1PEWA 1WSST 2AKRB 4RGOL 4LSRL 3FO0H 4MNQB 2I60L 2WZPD 1CLCA 5HDQH 3S88H 1B0GB 4PGDA 5KSAD 1E4JA 3VWJC 3V8OA 4K3GA 1F58H 2GT9A 2ENSA 2DIBA 1T21B 3TA3A 3UJTH 2JJSA 1F2QA 3DUSA 4WWID 5DJ2B 2EO9A 4JFEA 5ICYB 1U8JA 1ZTXH 3MJGX 5EU4A 5L6YH 3CFDA 1HKFA 2E7CA 5D7LA 2VSDA 3G6JF 3K7UA 2AABH 1BZQK 4MAYC 1X5HA 3F6LA 4TUJB 5D9SA 4UIMB 3UTQA 3DVGA 1IKNA 3VD9A 1DLHB 3D48R 4Z95L 1MRDL 5A2FA 1G9MC 4NN6C 1FAKT 5D1ZA 3UYPA 3FRUB 3NFNB 5ADPH 3PWPE 1XFPA 4K7PX 3SDCD 3FMGH 4P46D 4DTGL 4Q9RH 2GK2A 3CSYB 2NZIA 4PLNC 5DJAA 4IRSD 1FRGL 4JZOB 3NPZB 1MPAH 2QJDA 5DD1H 3JV5A 2AKRA 2AJYH 3LS5L 1NL0L 3UTZB 3GHEL 1X5GA 4MNQA 1A6WH 1JHLL 3QDHA 3FQXA 2HFGL 3PGCA 3ALXA 3KS0H 1MIML 1D5MB 4P5KB 4PJCF 2LQRA 5DHVA 3O0RH 3FQUB 3QXDB 5CWSB 4XPBH 3GJFK 5LAXA 3LV3B 4LASH 3DX9B 1T21A 1AGEB 4GAGH 3U82B 2C4FT 2ZUWA 4OLUH 4EXPX 1QEWB 5ICYA 4MQXD 3W82A 4Y4FB 1JN6A 2MNUA 1ITBB 4PUBH 2V17H 4YHZH 3RX7A 2RBLA 3K0WA 4OFDA 3QCUL 4JHWH 3SJVA 3QUZD 1OT1A 1HH9B 3U9PL 1D9KD 2FX7H 3R8BB 1VACA 4JO2L 4EEEA 4N9GA 3QDJE 3PE9A 4G3YL 4NUGL 2R2BB 3EDEA 5SWZD 5DRZB 4O9HH 4UOW0 2B5IC 3NFNA 4G8FB 1KCRL 2E7BA 4HT1L 2Q6WB 4GRLB 1U42A 2EC9U 3CSYA 3F58L 3MRIB 1EZVY 1YY9C 4J4PA 5DQDH 4JZOA 3BOVA 1SBBA 3L7EB 3S3PA 2CLZA 4F33B 3KR3L 3C6LC 3L95B 4Z5RB 2B4CL 5BRZE 2DTSA 2WP3O 3C5ZD 1WGOA 1GGIH 5FCUH 1RJYA 3BIBX 3RNQA 2ZSVB 2EIEA 2IH1A 2D4DA 4X0KB 4DGVL 2VIRA 1PQZB 4P5KA 3AUVA 4ZNEA 2AEPL 1M7XA 3FQUA 3QXDA 5CWSA 4JO4L 3K8MA 4UQ3B 3ZDZE 4XH2A 5B8CC 5JA9A 3LV3A 3DX9A 3VFPB 4CRPA 4HJJL 1UXWA 4G7VL 1KFAH 3RTQC 1QEWA 4KUZH 1I1AD 5D6DA 3P9LB 1ODAA 1XGQA 4PJGF 4Y4FA 1UKQA 4JFQB 3TT1H 4Z76B 3AB0C 2X4UA 3B5HA 1G7MB 1FL5B 5FOJA 1RK0A 1U3ZA 5I15L 2R0KL 4HF5L 1HH9A 1Z6JT 4NFBA 5IFHL 2C9AA 2DLGA 1WEJL 4X4MA 4WHCA 3LIZL 1KIPA 2R2BA 3ZE1E 2LVCA 4XBEL 4LCWE 5T1DL 4N90D 5DRZA 3A67H 4POZC 3V6OE 1IGML 1JFQH 4KXZH 3VFMB 1AR1C 3V0VB 3MRJB 2P5WD 5AZ2H 5EC2B 3ZL4L 1MFDL 3MRIA 5TF0A 4X6FB 5GS0D 2JIXA 3RPIB 5KG9B 4F33A 3L7EA 3QJFA 3W0WD 3E6HB 4LARL 3HCVA 2Y23A 3V4VH 1GGCH 4XP4H 1NCUA 4LVEA 3EJJX 4D94A 3EOYG 3EHBD 2JKXA 1MAJA 4JM2B 2ZSVA 3FAWA 5HDBF 1MCLA 4X0KA 3MBED 1AD0B 2X40A 2O93L 4KI5D 3T4YB 4UQ3A 1S8DB 4RISL 3OZ9L 2NW2B 4MJ4A 2B39A 2NXYB 3E6FB 4XAKE 4DGIH 3U9UB 2EDTA 3ISWA 3P9LA 4ZFGL 4PS4L 3RIFF 2P48B 1XGUB 2AK4E 2IANB 3OJMB 1FL5A 2OS7A 3DVIA 1I1CA 2Q8AH 4UT6L 4M1GH 4XCCH 1U3HD 2ARJQ 4EDXB 4JJ5A 5I8OH 4JN1H 1RJLA 3NIFF 3MLVH 4PD4K 2BOCA 3NABL 2HT4C 2A9ML 1DSFH 4ZYKB 3KXFE 3NCCB 1VSCA 1WBZA 1CFVH 3ULVD 2BXZA 4HJ0C 3RPIA 1F11B 5KG9A 1HHIB 3RL1A 3E6HA 3K2UH 2VC2L 3L3GB 1PD6A 5IW1A 2A83B 5EORH 4ONFL 4JM2A 3VXME 1B6UA 3Q5YA 4PB0H 5JXEA 1P7QB 1XR9B 2P46B 1AD0A 3JV4A 4GLRI 5K9KA 1NGPL 4NCDA 2ICCA 2GITA 4NOBA 1XAUA 1A64A 3VGEA 1JZ8A 1P1ZB 3T3MF 1KENL 1T2QH 3E6FA 1Q0XL 1XEDA 5DDHB 2PO6D 3ZHLA 5IVNA 1JPGB 5HYSG 1TTGA 4OZHB 4HWBA 5J0BA 4ZAKA 3ARQA 1TCMA 4M6OH 1XGUA 5FUCC 4G9FA 1FFOB 3HRPA 5ALBL 5FM4A 1FNLA 3PGFL 4HUUA 5CINH 2A6DA 3UYRH 1VGKB 3QI9D 1F13A 5J11C 5KSAC 2WANA 3PIQB 5KVFH 2BRRL 2D7QA 2ZUXA 1HXYA 4C55A 2J8OA 4ZYKA 1BIIA 5JPNA 1F2XK 1J86A 4GMTL 4Q9QH 1VFOA 2ICWB 3WUZA 4OBRA 1HHIA 5JW5B 1HCVA 5AEAA 5ESAB 1QBLH 3ZTJG 5I73B 3L3GA 2A83A 4I3RL 4XVTH 4ZUWA 3OB8A 4PLOB 5HPMB 1RULL 5C07B 3BEWB 2ZG2A 4JRYD 1ORQB 3FFDB 1P7QA 1XR9A 4QY8B 4C83B 2A1WH 4FQXC 1GXEA 1QSZA 2IMMA 4O4YL 4RGMB 3SDCC 1DBJH 4P46C 5HYQA 1IILE 1INQA 5GGRA 5I1CH 4IRSC 4XBGA 1OTTD 5DDHA 5A3ID 3DGCR 4NQXA 2WW8A 4NN7C 4X4XA 4JB9L 1JPGA 1QBBA 2OR8A 2CDEA 1EFXB 4NCC2 2GJ6E 3SKJH 1TJIH 1FFOA 2FZ3B 3UZQA 1GPOH 3N85L 5KSBA 3GSNH 5FCSH 3VG0L 3HLAB 4U7MA 2G2RB 3LDBC 4BSWB 3C6SB 3QXWA 4DQOL 3P77B 3ILPA 4IMLA 3UTSE 5ABDE 5JIKA 5C0RL 4G6FD 4MQXC 3GMQB 5I1JH 4HKXB 3BKML 2BDNL 2ICWA 3EZ8A 4N1CA 3T65B 5JW5A 4P3CH 3ULUE 4JGMA 3EO9L 3QUZC 2K9UA 3B9EA 3TYGL 1NH6A 4K94H 1D9KC 2VLRD 3O6FD 2ZCKH 1ZLVH 3BEWA 4NWUH 1BF8A 4E0RB 4PJHB 1CIUA 3LKOA 1H9VA 4LQ1A 15C8L 3HHRB 4LSQH 2IGFH 4X5LA 3ARFD 3S7GA 2P4AB 1DCLA 3NAAH 4L4TE 1A6AB 2ORBL 4EDWL 3VDBA 4JQXA 4WW1B 5E4EC 4V1DE 1DQDL 5DC4B 2W9EL 1AI1H 1RIVH 2PTTB 2FWOA 3MUY1 1RUMH 5E2JA 5DT1H 4HHAB 1FQ9C 2UWEF 1PFCA 1B4JH 1EFXA 1YPZB 4H8WC 3SKNA 3C5ZC 1R3JB 4UDUA 1SYSB 3DARA 5DJ6A 4URTB 5C6PB 2DI8A 2FZ3A 4HWBL 4OLVH 2YPLE 3HLAA 2DQUH 3MRQB 4YPJA 2G2RA 3CLEL 3WO4C 1YMMD 2D7TL 4ZUVB 1V3MA 35C8L 1MCPL 3RY5A 1T03H 1VHPA 1IC5H 3BAEH 3ZE1F 1E4WL 2P8PB 1MCFA 4M3KB 3FFCD 1I1AC 3O3EA 3GMQA 3EDDA 4HKXA 1K8DA 2OQJA 1YYML 1B88A 2ICEA 3T65A 4NRYA 4KROD 1NC2D 5FYLE 4R2GB 1MI5B 1S5IH 1YC7A 4AG4L 5JW4R 4MCZA 5DMKA 3R0MA 4QXTB 4OLZH 4PJAE 5C0DB 4M5ZL 4U6XA 2VAAA 5FAAA 1GSMA 4MS8D 1BAFH 1BJ8A 3OQ3B 2OBGA 4Z77A 1QSFB 3QISA 4XWOD 5FM8A 5E24E 1VCAA 4PJHA 4PJBF 5AD0B 1UCBH 4YHIB 1TETH 3LKSB 5JOPE 1A6AA 3ECBB 3QA3B 4NN5B 2XIDA 5IJVA 4WW1A 5C86A 1KLUB 3TWCL 3HC0B 5J1SC 5GS0C 1KN4L 2PTTA 5J4MA 1QLEH 3ARGB 2XFXB 1YEFH 4HHAA 4JPKH 2E9JA 1RSFA 4JFFD 3GBNL 2NY2D 1YPZA 4LLVB 1MFCL 4HWNA 2ATPB 1SYSA 3PDGA 2L0DA 1NEZA 3EHBC 2VUYA 3KLHD 5GRXG 5HSFA 2DL2A 3PJSB 5C2BL 3MBEC 1T66D 1IEBA 1M05A 4KI5C 2F54E 4G42B 1FNGB 2E7MA 3QB7C 5C08D 2X44D 3SQBA 3U0WH 1YEIH 5L8LB 1F90H 4JHAL 2P8PA 4YHYC 2WSKA 3TJEL 5E8OA 3ARBB 3NCYS 4KJWD 1E6OL 3CSGA 5J7CC 1NKOA 3GJEB 4LHUB 1NGYA 3QBTB 4QXTA 1U3HC 1T1YB 2BMKB 3QXAB 4WI6A 4U0RB 2VAJA 5I19L 2FIKB 1IAIM 1QSFA 3ESVF 4MJIE 5EOTA 1L7IL 1DQLH 5AD0A 4JZNB 3QFJE 5DUBB 4YBQD 3IDIA 4WEMB 4YHIA 3N50A 1T0NA 3QA3A 1J1OH 1KLUA 1IC4L 3SDXF 4AYFA 3ULVC 4QYOB 1OGAD 5AWNL 1EJOL 4Z7UA 3ARGA 2H1PL 3TVMD 1B2WH 3CSPA 1RV6X 4LLVA 4OCWH 4OLWL 1EEUA 1YEDB 2K3TA 3RZWA 3DRQB 3V0WH 1WIPA 3PJSA 3WN5C 5BW7C 1RJZB 1G9NC 1I8IB 3QDME 4G42A 1FNGA 4Y19E 2VDQL 5JXAL 2IAMA 2JCCF 3U79A 2YUVA 3IKCB 3RGHA 1S7VA 5I30H 3AFLA 4LPYA 3JVGA 3PQYB 3VFNA 2MPAL 3B6SB 5FYKD 5GJSH 3GSQB 3TGXA 4RSVA 4L9LB 3PP4L 3U46B 4LLAA 3G04B 5D4QA 3MPCA 3U0PA 2KL6A 3GZKA 4RQQB 3VGAB 1IARB 1QO3B 5FECA 5J1TC 5I1GH 4UILL 2BMKA 3QI9C 3QXAA 1TZGL 5DA4A 5D96C 2D3VA 5JR1H 5F9JB 1GH7A 2FIKA 3MV7B 3B2VL 5T1LB 1CFSA 2BJML 4K3EH 4JZNA 5DUBA 1JIBA 3KYKH 1M7DB 1Y6NR 3J7HA 5HHQA 3NH7L 4F7EB 3T0XA 3KLAB 4JVWA 1HK6A 1BQHG 3F7VB 5IFAH 2A9NL 2XPGA 4QYOA 3HG1B 4M7JL 3VFGL 5CJOH 4X98B 3LRSA 4WTXA 3JUZA 2DB8A 4K7FB 3L6FB 1T89C 4CU8A 4M4RA 4JM4H 4U7SA 5GS2D 3VRJA 5LQBL 4Y1AB 3DRQA 4UBDC 5F44A 4XP1H 1PX3A 1RJZA 2Y07L 1JNNL 3BGFC 3GBLA 1I8IA 1JRHH 2APXA 1QFUH 5FF6A 2B2XH 3L5JA 4BELD 4F57H 4OF0A 2HLAA 3WIHA 1RJCA 5E9DB 1Y18B 1CR9H 4OGZA