1DLFL

High resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody igg2a(s) crystallized at ph 5.25
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
b'DVVMTQTPLSLPVSLGNQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPFTFGSGTKLEIKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S)
molecule tags Immunoglobulin
publication title The pH-dependent structural variation of complementarity-determining region H3 in the crystal structures of the Fv fragment from an anti-dansyl monoclonal antibody.
pubmed doi rcsb
total genus 27
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dlfL00
3RU8L 3GM8A 4PJ9A 1UA6L 3V52H 1JPST 2A9NL 2CKBH 1A6PA 5D5MA 3TV3H 1CR9L 1YMHA 3HC0A 4LKXA 4QOKE 4UT6L 5JW4N 4XP6H 1T5WA 3D5OF 5AYUL 3RWEA 1CLOL 1X5IA 4PRDB 2EIEA 3DX9B 3PQYE 2L7JA 3D85B 1SBSH 5FM8A 3MRRB 1PW3A 2OTWB 3U6RB 1MCQA 2JJWA 1U95A 1FJ1B 3MNVB 3TN0C 4UNVA 3QQ4A 3GRWA 3RI5F 4Z77B 1G7JB 3L5WB 4D9QE 1AD0A 1R5WB 5CEYA 5IMMA 1MCSA 5ISZB 3BZFA 1QLEL 4K94C 4GRWH 3EJYD 3RWGB 2BK8A 2P8PA 4YDLC 3S88L 4HD9A 2O93L 1XGPA 4O02L 1OAYL 4X6BB 1XFPA 3SCMC 4PJHF 1DVFB 2GT9B 3V7MA 4FQQA 2G60H 4YUEH 1MQKH 1HHKB 3HNVH 3QAZB 5LWYH 1UADC 2BSRB 1JRHH 1I7RA 3JZ7A 4PY8J 1I7TB 3QG7L 1MF2H 1YJDC 4M62H 4HSQA 3X11B 4CAGA 3WNLA 3ARBA 3HFMH 1HH6B 2VDPL 3MLSL 2PYFA 4HWBL 3ARFD 4NYLA 3SN6N 5MENE 15C8L 4YIQA 1ZA3B 3T09A 2ADFL 5DA0B 5BS0D 5BV7B 2C5DC 4PJGF 4ZUSB 4P9HC 2R2HA 1QFUL 2NY5C 2IQAB 4LSDA 1TTFA 5DRWA 3VJ6A 3WS6A 4ZFFB 2VYRE 3LRGA 2DIBA 2GSIA 2NY0B 5F7HA 1EX0A 4PREB 1Y6KR 4JHAL 3BAEH 4OFIA 5A2FA 3T0EA 1WEJL 4JHWL 5HHOD 4J3UA 1C8PA 4NO0A 3ES6A 1Q94A 2AJXL 5DJ8A 3ULUH 3ESVF 3OKDB 4XPAH 3KPMB 8FABB 4ZSOB 5EORL 2JLLA 1LNUA 3SDXB 3ZYJA 5HHPB 3GMOA 4ZXBA 1T1WB 3VXSD 3DNKA 3PGDA 3INUH 4DKFH 1F3DJ 2CO7B 5FF6B 4QHMB 8CGTA 3C60A 1G6RA 3W39A 3CCHB 3SKOB 1IM3B 4WU5A 4EUPG 4U1KA 3QEUB 4M5ZH 1NDMA 1H3VA 4XNQB 3VXNB 1B3JA 1U93A 5D7KD 4NC1E 5ACLA 4F7TB 5JHLH 1S5HB 2FBJL 1KIRB 2ZUQB 3ARGD 4KVCL 4PB0H 4HUKB 1NMCC 3HN3A 4LDLB 4XNUH 3TVMB 1F00I 4S1DD 4YDLB 4YDVA 3GBMH 4HFWA 4JQVC 4KV5E 5T5NG 4JHAH 5FV1L 4NJ9L 2LU7A 3NAAL 1ZA3A 2X42A 4XPTL 2BSSB 2VSDA 1P7KA 1A14H 4OIIH 3N0PB 4X7SH 5IVNA 4N5EC 1R3KA 3F7YA 3PP4H 1WT5C 4Y19E 1AXTH 3BJ91 2F5BH 3HI5H 3MMEA 5C0NC 3L7FA 5TFSH 2EDXA 5CIPA 2WANA 4MXWH 3LKQB 1KELH 4R7NA 4RX4D 3LKSA 2B1AL 2R8SH 1P2CA 2MCPH 3BW9B 1MIEH 5AZ2L 4CVWA 4DKEH 4KAQL 2DLIA 1HEZA 4G7VL 4GMTL 1PZUB 2ZP0T 4UIMA 1TVHB 1KJ2H 1KNOA 2CKBA 1DN2A 2BOBA 4L3ED 1FZMB 3LKPB 2BOBB 1CICA 2VABA 5D2NE 1U8QA 3HR6A 3U0PA 5IB4B 1Y18B 4UZGA 2ZUWA 2F5BL 1DVFC 3T1FA 4I8DA 3VFVA 2BHZA 4OGXH 3PQYB 1ITBB 3BH8A 1ADQA 2JCCE 4JPIB 4JDVA 1I4FB 3I6LE 3M1BB 3MX0A 3ILPA 1VPOL 2BXYA 4ONHA 1F3JA 4GMTH 4M6AA 2HLFD 4K9EC 3IJYB 1MCBA 1F90H 4IOSD 5KJRL 4PGEA 2IH1A 4MQTB 5D7JC 2VLLB 5ITFA 3S98A 3MV7D 5F9WB 3DUUB 4M1DL 4TSAH 1OGAB 2D7OA 4ODWA 1BOGB 3PHOA 1D6VH 5TDPA 4JFYB 3L9RB 1AFVH 4Q6IC 5EZLA 4OV6F 3MV11 3M8OH 1RVFH 3TZVC 3DGGA 5FIEA 5F6IB 5IEKB 3QHFL 4C4KT 3LKOB 4CVUA 3D3VE 3FO2A 2NYYD 4QXUH 2VQTA 3LEYL 2VNCA 3O45A 4QYOB 3FQWB 5CJXC 5IG7A 4OCXL 5IB4A 1K3ZA 3DV6A 1T4KA 2DQIL 2ATPA 4NN7B 3DMMC 1IC1A 3GUTA 2VABB 5FDYA 5DMJB 5D2LF 4F7EB 1PG7X 3KPPA 4X83A 4KY1H 1KJ2A 3BT2L 4MA3A 3NFNB 3S8WA 1KCSL 2NX5D 4PY8I 5FK9A 5ESAA 3MBEC 1KT2A 4FG6C 4RMVA 1IKFL 1MPAL 1U36A 4TTDD 2CO6B 3NPSC 2HTLD 5IKCB 3HPLA 3R1GL 1UVQB 5DWUH 4MAYC 4ZAKA 1ZANL 1UZ6F 5GGVY 1JN6B 4FQHB 4HHAB 5J11C 2G5BA 2P46B 3VXTB 2DOCA 3KJ4B 4NDMA 1U8MB 3VMPA 3VFRB 4AZ8A 2VDLL 4NDMB 1MFCL 4M7KH 5C7XL 3WUZA 4JFOB 4LF3A 3RBSA 4WFHD 2VLME 2X2YA 1QSZA 2I07A 2ENSA 4UQ2B 4AENA 3GSVB 1HILB 2I9TA 2XOTA 4ELMA 3BHBA 4OLZL 4KMLB 4A2LA 2BRQA 1NGPL 2AS5M 1AJ7L 4I18C 1RK0B 3MA9L 1P1ZB 25C8L 2W92A 4UV4H 4U1IB 2HRPL 3ZTNH 2H9GB 2DD8L 4CW1A 2AJZA 1MFCH 3H0TA 1GGIH 2EIBA 1TJHH 1EEZA 5KS9F 5AZ2H 1CXKA 1UM6H 4OD1L 1BAFH 2LABA 3N9GH 1DEEB 5E5MA 2R0KH 5DD6A 1NJ9B 2LU4A 1UEYA 2HTLC 3HB3D 5TF1H 3TP4A 4PJEB 2E6JA 1X4XA 3H2WA 3PDOB 2OSLA 2XZZA 2BSTB 5L88H 2VDQL 4PRHD 1NAKH 3CVIH 5DD1L 5CWSB 4ERSH 3DARA 4U6HB 3PDDA 1RZJL 1CFSA 3TWCL 4PJBB 3BMVA 5INCA 4HZAA 5EBLB 4F58L 4H25A 3RVWC 1FGVL 5GGTH 3T2NL 2Z92B 3O6FD 1LVEA 2AK4A 4AIZA 1D9KC 3L95B 2FNBA 5FYKH 3K8LA 3WN5C 4QTHB 2YA2A 4R4BA 4Y2DC 5D7LD 2R69H 2BOCB 3QA3B 2XN9A 4TSBL 1Y18A 3V6FA 4R2GB 4K7FB 1HXYA 3MRFB 4IRJC 1SJXA 2YEZB 2PNDA 2Q86A 5ALCH 2EDJA 2YEZA 4Y19D 4PGCB 3BRFA 4ALAL 3VH8A 4JB9H 3UAJD 3MLVL 4G8EA 4ENEC 1WZ1H 2MKLC 5GGTL 1YEDB 2A1WH 2IPTH 1RZ7L 3MUZ1 1N3NB 3REWB 1NFIB 3GBLA 1UM4L 1P5UA 1T83C 4QRTA 1BVKA 5DEZA 4H1LA 4TTGA 4CU7A 1E4XH 5IJVB 4M1CC 1LQSR 1DQML 4JFYA 1I7ZB 4Y5VC 2Z91B 5C8JA 4NP4L 5IBLD 3V4UH 2EDOA 4N0FB 1HDMA 2Z8SA 1UZ8B 2O5XH 1UKQA 5ICZB 3G6DL 1R0AL 3MYJB 2BVTA 4Z7WB 5EBWB 5C0RH 4X7EC 3THML 1D9KD 5D4QA 3UTSB 1EUTA 2IFFL 1WZ1L 1WCQA 1G7IA 3CFCL 3SGEI 2J8HA 2WUBH 43CAA 2ZOLA 3VXMA 1EEYB 3EYQD 3V4UL 1OAUH 3R8BB 2K7QA 1IGIH 2ZG3A 2HJFA 4XP5H 4JFDD 3SKMA 3X13A 5IVZB 1VFOA 5FDWB 2R2BB 1DUZA 4HWNA 2RR3A 4KQ4L 4EN3B 1MFBL 4GLRI 1U3JA 1FL3B 5D1XB 1BBDH 3SKJL 5LG1A 4WEUD 5EOTB 1XGTA 2VAAA 1ACZA 2HJLA 4XBGA 3V0WH 3KYMA 4D9RE 1OPGL 1A9BA 1S5IL 1TFHA 4JKMA 4ZPTA 4BK4A 1SJEB 4WUUB 4GAJL 1X6NA 1K8IB 2XRAL 5LAXB 1NAML 2FGWL 1KENH 5SWSD 3VFWB 3PV7A 1SMOA 2FB4L 2XQBH 3MV7A 1OSZA 3HZVA 5ACZA 4R8WL 4OFDA 4NO5A 5HGAB 1BD2A 1BD2E 1OSZB 3H3BC 2H6PB 4BQCA 1JPSL 3HNSH 1PG7L 4XP4L 3ARDC 1EA9C 1JVKA 1RZIB 4XI5C 1KXQE 3CVIL 3IXTB 5DEFA 1WFTA 3QIBD 2Z31B 3UTTB 1JPFA 5E8EB 2PYED 3ELAT 1G9MH 3HLAB 1NCAH 2GFBB 1W0YT 3QP3A 2P5EE 3HE7B 1K85A 3KPPB 3C09B 4WUUD 5EOQL 3IKCA 3QO1A 4O51A 3H7BA 3KHQA 5IIEA 1H3TA 3S7GA 3G5YB 3QWOA 3U36A 4CUCA 4P4KB 3HC3L 1YECH 3SKUD 1N0XL 4JFPA 5HHPA 4K3GA 2AJSH 4PS4L 5TQ2L 1I8LA 4RIRB 4CN6A 1Z0MA 5JIHA 1ZE3C 1YY8B 4NHUB 2AJUH 1JHTB 2H9GA 4PJCF 1T20B 3TBWB 1RK1A 1LO2L 2JIXD 3HNVL 5I8KL 5FCUL 2EE3A 4Z7UE 2CUIA 4NUGL 3GSRA 4OT1L 1AIFA 1EJOL 4GXVH 2B4CC 5L0QC 2EE6A 3QDJA 5E2VL 4ZUVB 5TPWL 3WNPA 1UZ8A 4RWYL 1NMCB 5EUOE 4X6CB 4NWTL 5CLWA 4YJZL 4HKJB 4YIQB 5C70A 1A4JA 1INEL 4HXAH 1I8IA 1YPZA 1YMMA 2BSED 3K80A 3RWCA 4KXZH 2PYFB 4FQLH 4NFBA 5JORB 1DL7H 1OTUD 5E2UH 4PJ7A 2OP4L 1LK3H 4PUBH 1WICA 1P9MC 1NBYB 2OS7A 4WCYL 1YEFL 1L0XA 3S4SG 2DJSA 4P2CG 5AZEH 1CLZH 3VH8B 5LGKA 4JDZA 3JBG7 3SDAA 4U4BA 3VXQB 3Q5TA 1XGPB 4YBLB 5GGTA 1X4YA 3HS0B 1UKTA 3S4SA 1EV2E 5E6ZA 1KNOB 2X4TA 1RUPH 1MNUL 3SDAB 1EAJA 1MJ8L 4PG2A 3JV4B 4QHLA 5KG9B 4ZDHB 3V4VL 1YEKH 4X0KA 5FO9B 2P5WD 1A6UL 2DQTL 4S0TD 1G7QB 5I19L 1QLRB 4XNUL 3BUTA 4E0RA 1E28A 3EO9H 4JJ5A 1AGFA 3GJEA 1GC1L 2M26A 3OGCB 2DMBA 4NQUA 4UMGA 1XEDA 4ELME 2V17L 3DVFA 3FQTB 1A6AB 3IFOB 1N5YL 3MLUH 3WIFB 3VFTB 5BS0E 1FFPB 2ZNXA 4YDJA 1PZ5A 1DEDA 2BSTA 3I02B 1GGBH 1U91A 2YOCA 1G7MA 2WNGA 5DRNA 1XF1A 2JK5B 4I18A 4GW1A 1E27A 3FQXB 5FKAB 4KAQH 1B0RB 2AEQL 4R97B 1DLHA 1MHCA 3K1KC 3LB6C 1HH9A 3ZDXF 4J3TA 5JMOC 1RHHB 3QUZB 5IMOB 1J8HE 4UIKL 2ZUTA 3ARTA 3RDTC 4M1GL 5B39A 4MCYA 4FQ2H 1BEYL 1BX2B 5DQJA 3KLDA 2NY0D 2CUHA 8FABA 4HJ0D 3CXDH 2A83A 1YUHB 4JKWA 5HGDB 1NCUA 1CGSL 2BVPB 1SQ2N 3DVNA 3S4SB 4LNRA 1MRFL 4EBQH 2VDKH 5IB2B 4L4VE 2QSCL 1S7WB 4IRZL 1VPOH 5BMFL 1S9XA 4U33A 1I9IH 1S9WB 2AEQH 2PW2B 3GJFH 1Z3GH 3C8KA 3RP1A 4FG6D 3LV3A 2DDQH 4PJBE 3LKRB 2VXSH 4NKMB 4JFFE 5DHXB 5KBNC 3C5ZB 2DQHL 4U1HB 5DT1L 1XR8B 2I60L 4NQDE 4F33B 1UWEH 1E4JA 2HH0H 4FXLA 4ODHH 1U8MA 1FVEA 4CMMA 3IDMA 2LAGB 1NUGA 4HZLB 4EBQL 2W0FA 4XMLH 1R3JA 4GXVL 3U79A 3WXVL 4D9RD 1T5XA 3RAJL 4BSVA 1JYVA 4EI5D 3RTQD 3HG1B 2NY4B 4QTIL 3MRJB 2FATH 4IHOA 4QHKJ 2JJUA 3GMPA 2BNRB 2QSCH 4LCWD 1DP0A 2X4RA 3VRIB 1CLYH 4PTUA 3T0EC 1IEAA 2LVEA 1FNSH 1E4WL 2BERA 1Z3GL 2C1PA 4P5KB 2HYMA 1I3RB 1IT9H 3EOAB 3OSKA 2YKLL 4P23A 4OLUL 1E4KA 4YGVB 4RFNC 5KTEL 1ND0B 2YPLB 2DQIH 4L8SB 1A3RH 1KACB 1VESA 3OXRB 3I6LD 3R1GH 4PRPB 3LN9A 4AEIH 3EZ8A 3W5MA 4XHJC 4JY6B 4LLVA 1QHOA 3L3OB 2JJTA 4ZFGH 4FQIH 3OTTA 4YHNB 1EVTC 3WHXA 4JFFD 3G9VA 2NTFA 4ZFFA 3ULUD 1FFQA 3TNMA 1UXSB 1MRCL 1AXIB 1QOKA 1Q9OB 2Y06L 2MQ0A 2R1WB 4LEXL 3D18A 5TE4H 3P2TA 2WP3T 4XCNA 2XIDA 35C8H 3KWWB 4NO5B 5HGAA 1I3VA 5EZIH 2NY3B 1CL7L 3L5IA 4GG6F 4G42B 1GSMA 5HYSB 1OP3K 3ARVA 3PUCA 4JPWL 4LPWA 5HPMB 4IIQB 1IARB 1PX4A 2A77H 5SWQA 1RUAL 5GSVB 3MJ9A 3T0AA 4MLIA 1P7QD 2CDGB 4MQ7B 5L9DH 4WTXA 1J8HA 3Q1SL 3UJIL 2XY1A 4WGVB 4H88H 5D7IE 2W9DH 1IM9D 3GUTB 2BNRE 5FDWA 4ZOBA 1QSEE 3IFNL 4WJ5B 1V7NH 2HJFB 1F58H 1T3FA 4HJJH 4JZJC 2FH6A 1JGVL 5I1LA 5KJRH 3VFUB 5TQ0L 4MA7H 1PQZA 4IRSD 1CYGA 5KAQG 3TO4C 2ITDA 5INDA 1A21A 1GC1C 1IC5L 3P0VL 4NN5B 3ULVC 5C07E 1LWRA 3BN9D 1NEZG 5ADOL 4HH8A 4G6AC 1YZZA 5DK2B 1O0VA 5IBTH 4LRNH 4YHYB 1IQDB 1QFWL 5F89A 4X9BA 4RA3A 3CSYB 2C3HA 5DMGC 3STLB 1YN7A 2I60H 3QDJB 5IVOA 1KLUA 2BHUA 3CU7A 3O3BB 3MACL 2PTTA 2C3VA 3B9KD 1N4XH 3UTQB 5BRZD 3MLRH 3EYQC 1IBGL 2RCSL 4OGYH 5D1ZB 2Q6WA 3MCKA 1S3KL 2E8YA 1QBLL 4MHHG 1T04B 1IEHA 3KPNB 1PKQB 3U0WH 4PR5B 5CGYD 1T66D 3I3BA 3MROB 4G5ZH 1ZMYA 3C2SA 3MXVL 1RZ8A 1H8NA 4DZ8B 4I3GA 4PJ7E 3WNMA 1W8NA 2OZ4L 4JG0L 3LHPL 1PSKL 2EH8L 4OGYL 4V1DE 1SJHA 3IJHB 5KOVC 3CDGA 2IQ9L 1CDUA 2WBJA 2WBJC 5E94B 1QLFB 4PP2B 2Y5EA 3IDGA 3BP4A 1A5FH 1C12A 3ZSSA 5C09A 5J0BA 1HE7A 4Z7VE 5JW4R 1NEZB 5T3XH 3MYZA 1MFDL 1A4JB 1I8IB 5J89A 2EECA 4QWWC 2YUXA 3ZHKA 2AGJL 4X6DB 1KC5L 5B21A 3GNML 2LAAA 2DQDL 4KZEL 3KXFD 3BP7A 4P9MH 2N56A 4MZ3A 5B3JF 2E27L 1KEMH 1QP1A 1YEGH 4E42B 3NGBC 1R3LA 5GHWH 2E9IA 3TJEL 5DC0A 1UM6L 2OL3L 1EAPB 3VFOA 4F57H 1W0VA 4XPBL 1RULH 3O6FB 4XNXL 1ZGLA 5ISZA 4GKSB 1PKOA 3PWVA 3IAGC 4GRWE 5I1EH 1IC7L 1D5IL 3LH2L 1MFNA 3GSOA 2ITCA 5D6DC 1JGUH 5JOPD 3V9FA 5C6WH 3KLHD 4JFFA 1DE4A 5F7NC 5I9QB 1FG2B 1S9YA 1K4DB 2K1MA 3EFDL 1JWMA 2HN7B 4Y4FD 4YO0A 3C6LC 3HE7D 3S3SA 2WWKT 1W72B 3MYJA 3D69A 2YD5A 1YMHB 4OSUH 2DQDH 2V2TA 2FGWH 2IQAA 3STLA 5L0QB 2GITB 5GGUB 2OL3H 1FBIH 5FO7A 4YX2H 1JPTL 3A6BH 1LHZA 3B8YA 5IWLA 3EJZD 1LDPL 1XF4A 3D25B 4GJTB 4JRXE 2F5AL 3DSFL 2ZSVA 3I50H 4L9LA 1JTOA 1DQJB 4D8PA 1I3GH 3HC4L 5IEHB 1WAAE 4N68A 2GQHA 1CK0L 1OF2A 5FEBA 2D7QA 2CDEB 4XP6L 1BFSA 3QCUL 4HWZA 1GZPB 3TIEB 1FL3A 3EDKA 3HS0A 1J1PL 3P4NB 1DUZB 3ARGC 3AC0A 1CXFA 3GMLB 3BUYB 1R3IL 4Q9RL 3LN4A 3KR3H 1AO7E 3V6ZA 3KNBB 3QQ3B 1FYTA 4G5ZL 4ZD3H 2JB6B 5T3ZE 1QYGH 1RJLA 1FBIL 5FYKD 2DI9A 3KS0J 3ETBF 4PJAA 5DVKA 1KCVL 2FR4A 4LARH 3RDTA 3FB7B 3HNTL 4OJFL 5E4EC 4NKQB 3N85L 1YPZB 4PIRF 1OM3L 4FZ8H 1I3GL 3GK8L 4HC1A 1WITA 4C59B 1JPGB 3WFHA 3S35H 3TBYA 5FYJH 1MLBA 4WUKL 1LO3H 2PYEE 3OKOA 4W81A 1JMXA 3T77A 3ZE1E 4HS6B 3ILQD 3QT2A 4M48H 1F8TL 4BH8B 4NZUL 4Y0GA 2YD3A 1TPXC 4ODUB 1UYWL 4K23H 3WFCH 1FC2D 2OZ4A 1BQSA 5DO2C 4LHJB 1LNUB 1ZK9A 3CH1A 3SDXA 4GO6B 3ESUF 4QHLB 2CGRL 5KG9A 3KPMA 1MIEL 3GMRA 3RL2B 2Y72A 4MXVF 1KJ2L 2B5IB 5DDHB 3TJHC 4TNVK 3LPWA 3SOBL 3ULSB 1B0WA 4Q74A 4WV1A 3T0XA 3L5XL 4P4KD 3H9YA 3KYNB 4WNQA 4C83A 3BZEA 4YHLH 5CUSL 3WFEH 3S35L 4JANB 3LRSB 1IC4L 4YAQB 5EOCH 5I76A 3V6OC 2XWTB 5HHMD 4RAVB 5BVPH 3QPXL 1Q0XH 1ZT7A 5L2KD 1A9EA 5IFAH 4CADA 3P9MA 4MLSA 3IDMB 5BOZG 1CWVA 4GSDH 4NNYA 4GXUM 2NYYC 3N1MC 4K3JH 2R1WA 2HFFA 3Q6GH 4HX1A 3KAAA 2C9AA 3L3HB 3MRCA 3BP6B 5DVLA 5IM7B 5F1NB 1ZLWH 4YHML 3ROLB 4GAGL 4Y2OA 5D6CA 2DKSA 1P7QB 4N90E 4JFDB 2KQMA 4JRXA 2E8ZA 3NCJL 5D1XA 2A6DA 3M8OL 4UB0H 1CFQB 3TBWA 2KL6A 5FF6A 5CMAB 1YEEH 5F70A 4HCRL 5MP6L 3RUGF 3OF6D 4MS8D 4PJBF 1G9EA 2IC2A 1EEZB 4LVNC 1OLLA 3O8XA 1IILE 4ZYKB 2A73B 4LKCB 2AXFA 4LQFH 1I1AC 1MCJA 2BJMH 3TA3C 4OCWH 4PJGB 3PGCB 4CNIA 3VDBA 4JRWA 4G7YL 4YPGA 4YUEL 4G9DB 2R1YA 2XZAL 4P46A 1CS6A 5A2JH 5F7DA 5EN2B 3S34H 3PHOB 1JPGA 4XC1H 4QRSB 3VGDA 2Y36H 4KDTC 3UZVB 3MZTA 3KS0H 2VLRE 1QSFE 3HFML 4RFOL 4N8PA 1CFBA 4JFHE 4MA1B 2FZ3A 3H3KA 5BRZB 15C8H 1A7RL 2AJYH 5C0EA 1CLYL 5C0AD 1A6TB 1BM3H 1XGYL 3P40A 2BJML 3UJTL 3N1FC 4M7KL 1MVUA 3MBXH 4HKBB 1ZANH 4MNQA 5EIVA 2EH7H 4HMCA 4WFGE 5I0ZA 3CC5B 3FCTA 2EC9T 5JXAL 3RNKB 3ARED 5ESAB 1SEQH 3FRUA 4KK9C 4JLRA 5HHNA 4O9HH 2OK0H 1U8QB 1TITA 2PCPA 3IB4A 4O2EA 4N8CH 5C71A 2B20A 3RZCD 1U3HB 4HJ0C 1EFXB 2BMKA 4JLRB 4TVPE 1GYAA 4OLZH 2MTPA 4HGWA 3I6KB 4K55A 5FUCC 4HJGB 2VL4A 4OV5B 3AU1A 1P53A 5GGRB 1A7RH 4NN5C 1OHQA 1SEQL 2OK0L 1ED3B 1JYWA 5KSUB 1BF2A 2IAND 3P0YH 3RTQC 4AMKH 3PF2A 1QG3A 4NQSB 2CJUH 4ACPA 3QIWC 4AL8L 5IROA 5J6GB 4NQSA 4LSQL 2W91A 2PXYA 5T3XE 4WVRA 5K9OB 1AI1H 4M1DH 4TSAL 4LCWA 2AV1B 5B8CB 3AXLA 4L8SC 2XI9A 1DQDL 4NJ9H 3ECBB 1CD8A 4JPWH 3JWDH 3L6FB 4ZAKD 1CGSH 3FQUB 3LQZB 3LQAC 3RGVD 5LXGL 3HG1D 4TQEH 5BXFB 4G8EB 1FZKA 3ZKND 4YGVA 4UOW1 2AJZB 4P4KA 1FIEA 7CGTA 1K3IA 4PGCA 3G04B 4I3RL 1JTPA 2QEJA 3HUJB 1YEIH 1FZOA 5D1QC 3JTTA 4LL9A 4OCXH 2VLKA 4F9PC 5CINH 1KPRB 4UUJA 4HUWB 4XCFH 3QWQB 4E9LA 2M8XA 1GH7A 4KKBD 3SBWA 3VRJB 1EHLL 2IMMA 5CIPB 4JFXB 1BMGA 2CH8A 1RUMH 3ARXA 5J6HA 4UNTA 3RAJH 5AWNH 4LMQI 1KJMA 1A1MA 3WCYA 2W9EL 4U6HA 2V5TA 5J6HB 4Z7NF 2HG5A 4RAVA 3VXRE 3G6JA 2O61A 4M8VA 3KDMB 4CVXB 3PWJA 5DZNA 5IJKA 4U0QB 1MCPL 1KJ2B 2VH5H 3OAZK 3SDDC 1ZS8A 2C3XA 1RUML 1S7WA 2XA3A 3DGCR 2F54D 1GAFL 3RUGE 1B4JL 4OD3H 3RWGA 3VXPB 4Q0XL 4PJHE 5BV7H 3BEVA 1KF9B 2W9EH 5FA4B 5DJCA 5LCVL 4JY5H 1E4KC 4R97C 2YD9A 1CZ8H 3EHBD 4OUUB 1CFVH 4YXLH 2HMID 4RFEA 3GI8L 4ZFGL 5KVMC 3HKFA 5T1LA 5C3TA 2IADB 1K8DA 3D0LA 3H9SB 4U1LB 1WWCA 1EZVY 4KKBC 2KQNA 1CIDA 1U58A 1GOFA 4NQEA 1CT8A 1IKFH 2JJTC 3IYLW 2A2QT 5JOEA 2ICCA 4P9HH 3IETA 2V2WA 1CDGA 5F1NA 2DMCA 3GMMA 2Y5TB 4KPHL 1UH4A 4PJ9B 5ELIA 3A6CL 5C8JB 2I25N 4JQXC 5ANME 1PLGL 1NC2B 2F8VA 5E56A 1JZ2A 5FA3A 5FUOL 4FABL 3VWJA 5SWZD 4WFFE 3U46B 5H2BA 4E41A 2BVOB 4ERSL 3IDYB 2FCBA 1U8IB 3OR6B 4JZNA 3QI9A 3CX2A 3FQRA 1OT1A 4HXBL 4PJDB 3O6KH 4XGZA 1LO5B 2KDGA 4GBXA 3PL6C 3FO9A 4RISL 3VXOB 1CE1H 4K94L 4LRIC 1XGTB 3T2NH 3MNZB 3PGFH 4X4ME 1JPSH 4ZO9A 5KSBB 2Y1VA 1LO4L 3EW3B 1UWXH 7FABH 2AABH 2GTZA 5C0AE 1KBGL 4NM4L 1NC2D 2ADGB 4GMSH 5HGDA 3OHXA 3EYOA 3MA9H 3LH2H 2BDNH 2DLHA 3RNKA 1LILA 3O0RH 4XP9L 2VITB 4PJCA 3WLWD 3ARFB 1KV3A 3VWKC 1N0XH 4IIQC 1BQHA 3JV6B 1Q72L 5EU6B 3T8XB 9CGTA 3O41A 1BQHG 3AM8A 5HI3C 4ORGA 1JF1A 4YXHH 4YHOL 1NDGA 2PO6D 1WZKA 5DK0B 4GUPA 1JF6A 5J1TC 1LO2H 3P73A 1K5NB 3TESA 2NY3D 3RWEB 2PTTB 3EOBB 1MLBB 4X6CA 2DBJA 5HHOB 5D5MB 4C56E 1BLNB 1EJOH 3CX5J 3QDGD 4S1RH 5FM5O 2NTFB 4KDVA 1OGAA 4KDTA 3KXFE 3ZDYE 3OB0K 1DBBL 3ILQC 4MJ4A 1UWGH 1DZBA 1ZHLA 3L3GA 4JDTH 3SE9H 4XPHL 3UPRA 4FFZL 4Z7VB 4PGJA 3UO1L 5F7EH 4GRMA 5BW7C 5E2UL 4XPGH 2V9QA 3QUYB 2VTFA 2ZUSA 1LK2B 1S7VB 1JWSB 1XR9B 4JZOA 2VDRL 1KCRL 3E3QE 3FKUS 4ZO6A 4GKSA 2WBKA 2E9WA 5D7LE 3LN4B 2RBLA 1ZLVH 1INDL 2ESVE 3MRMA 2ESVA 4OZGB 5ALBH 3BVNB 2HWZH 4OZIA 3BZDA 2X4TB 3GSWB 5D71L 1KFAL 1ZWIA 4HPOL 5DS8B 1UCBH 3PWPB 5C0FB 1WIUA 3Q6FA 3V5DA 3LS4H 4JO3L 1D6EA 4ZUTA 1AKJB 4DQOL 2A9MH 2B1HL 1TETL 3HC3H 1RV6X 1L0YA 4Y5XC 1OAXH 2P8MA 5EUOF 1QD0A 4NZRL 5EOQH 5B22A 3WXWL 3V0WL 4U1NB 4UAOC 3RKDD 2JIXB 3MXWL 4P23C 5D8JH 1BQLH 3F7YB 3CMOL 3MQIA 1C7SA 3OKMB 3RDTD 3FMGH 1OTSC 4N0YL 3NFPB 5CWSA 3KPQA 5FOBB 4R9HA 2YA1A 3BGFB 2O5YL 5D72L 3RKPA 4JO3H 5HDBF 3RJQB 3TA3A 1ONQA 4PJ8C 5DLMH 4OFVA 5T1MA 3MLXH 3S5LA 4Q6IA 4LK4A 4XVUD 4F9LC 5IB2A 3G6AB 4LCYA 4LCIH 3OB8A 5HDLA 1FGNL 1SYSA 2WUBL 4YC2B 5T1LB 5C0RL 3VMOA 1EFXD 1T0MA 4ODSL 4WFHE 2G75B 4OIBA 1RZGB 1M7XA 1T0MB 1IAKA 1RURH 4YFLF 1NSNL 2X4QA 4KRPD 3RNQB 2NZIA 1D5XA 5LBSL 5KSAA 1QSFD 4KQ4H 4Z7QE 2HFTA 4MX7B 4MJ6B 1R6VA 1F6AB 2A6IB 3PHSA 3ARBC 4BZYA 5D7JD 3BQUB 1S9VA 3W0WB 3DX9A 2F9BT 3QWRD 2AJUL 4AT6B 3H3PL 3C6LA 1QVOA 4UDTA 1N59A 1AE6H 4LLMB 1QFHA 2FEDC 4KU1A 3BP6A 2AQ2A 2DMKA 3H9HB 4NIKB 4X7DC 1AXTL 3U0TB 4HZLA 5F89B 5C07A 1PEWA 3MRPA 1NGXA 5F7WC 5D7LA 2UWEB 4KJQC 4XNZC 3FAXA 5MERA 1AHWC 4P2OD 5E70A 1P4BH 1YEHH 3AUVA 4ODXB 4G7VH 1OARL 1NSNH 3PQYA 4NHCH 2ZSWB 3WDIA 4P99A 1MLCA 4GRLD 3JV4A 1FAIH 3OHXB 4FQQB 4PJ5D 3U0PB 3GMLA 2P5ED 5T1DL 1S9XB 1P6FA 1CICB 5T33H 3PWPA 3ZHLA 2NXYD 5I74C 1EHNA 4ZTOL 2XYCA 2C7UA 4JO2H 1MH5B 3VXOA 2E7HA 3LEXA 1KN2H 3NZHH 3KXFA 3BGMA 3ARBD 4J2XA 3NACH 3ALXA 5C0BD 1CD1B 4K2UL 2VLJE 3KLAA 3SO3C 3UTSD 1PJ9A 5DJ6B 5FYLD 3RHWF 2XTJE 1GL4B 4QXGL 2XPGB 2CMRL 4LIQH 5C07B 3AS1A 4XX1G 4D0BB 4OQTA 1KJVB 3FN0H 4RMQA 3IAQA 5BZDA 4QXUL 1YN7B 2OTPA 1RU9L 1FC1A 1W0WA 4Y4HC 1V7MH 3V5KB 1LEGB 4YFLI 5JW5B 4G43A 1FVDB 4LVNB 5JXAH 1E6JH 2W0PA 4WO4A 2OQJA 4ODHL 4KHTH 1N5AA 1AY1H 3BIBX 4TPRL 1DFBL 1TZGH 4AY0A 3BD3A 1QKZH 1XAUA 3TN0A 1BZ7B 2UYLB 1KULA 4IMKC 1QLRA 4CBPA 5JHDD 1HYSC 2XWBA 2BP3A 4O9HL 4OV5A 3G5VB 1MCHA 3GIVA 1HHHB 2RIKA 4N8CL 3BT2H 2Q76A 4NQXB 3TPUA 3VGBA 4B53A 4XMLL 2DQCL 4IRJA 2HRLA 4PJCE 2ZG2A 2ICWI 1GPOH 4FFWD 3RX7A 4P3WA 3ULVD 5D7KE 5GS1C 4PB0L 1N8ZA 3QZWA 3DBXA 2HTKC 4XBPA 4N9GB 4WGWB 3ARGB 1VHPA 4KWUA 5E8PA 3LN5A 1AGEA 3D48R 2P5WE 4R7NB 4TOYH 3NFPA 2VN7A 5EBLA 5I1AA 1YQ2A 4R4FL 2HJKA 5EOCJ 3BJLA 5D70H 1BD2B 3WIHA 3C87A 3MRPB 3OKLB 4Z7NE 3NIFF 3NFSH 4YHPA 4U3XA 1QPPA 1DR9A 2GITA 2R8SL 2X41A 2VRAA 1IGJB 5KW9H 1MCFA 4Y19B 4ZTPH 4JCLA 1M4KA 1GOGA 4NZJA 3HUJF 1FP5A 5C0CA 1MREL 3LDBC 2Y06H 3B83A 1VFAB 1NANH 3SEPA 3ULSA 4QRRD 2YUVA 4P3CL 4L3EB 4PRID 2IPKB 4TVPL 3WNOA 1I9RH 3ZE2E 3GIVB 4X9IA 2DIAA 4XHJD 1IFHH 2W59A 5FA4A 3SBWC 1M6OA 2R56L 1S3KH 2YPKA 3O2VL 5CIPH 2Y9RT 3NABH 1H3GA 4MJIB 1DBMH 1VKXA 4U6YB 4HS6A 2VXSL 1HYRC 4P0DA 4PJXB 3UTQA 5DHVH 5TDPB 1RUAH 3AMLA 3MO1A 1SVCP 1ONQB 3V0AC 4MQSB 3QUXD 5BZDB 12E8H 5EBGA 1A02N 3TWCH 1LE5B 5GS3A 3LIZL 3LDBB 4P3CH 4AEHH 4HQQL 1NCWL 3B2VH 3O2DH 3MV8B 3VGAB 4OM1H 3WL9A 3BH9A 2EYSA 2IAMB 5DJDA 4JGJA 5JQ6L 3Q3GA 3RGVC 1ZXQA 1SY6L 1N0LA 5E1HB 2Z9TA 5F6IC 5DR5H 2O26U 2PN5A 3GZKA 2Z93B 4OD2B 4HFUL 4JFQA 4CU8A 2UWEE 4URTB 2OMBA 2QADB 3LEVL 1MH5A 2MKWA 4P59L 1EFXA 2BMKB 4Z7UB 1OD9A 1IT9L 4K3EH 2OX5A 3CXHJ 4YFDB 4IRJB 1CQYA 4NN6C 3G04A 4X9GA 4RMRA 4DZ8A 4ZMAT 3GMRB 5F9WC 1ZLUK 1YUHA 4YXLL 3H8NA 2ESVB 3MRMB 4OZGE 3UJIH 3GDBA 3OF6A 3MV9D 4MGXA 2VZVA 4UU9A 4HDIA 5BCAA 1JGEA 3TPKA 2I26N 4U6XB 2YC1A 1H3WM 2I5YH 4PV9B 1LO0H 4UBDC 3QUMB 2FX8H 3PABA 3DVIA 3BO8A 2CIKB 3TVMC 3VWJB 3U83A 5I0DA 3IU3B 1YMMB 2AV1A 1EHAA 1WAAF 4HIEB 1BFVL 5GGSB 2AEPL 3O3BA 3WFHB 5ICZA 2VLMD 5DQ9B 2XTLA 5HHOA 3CSPA 3LZFL 2X7LB 3DVGA 3BWAA 3QXVA 4F7MA 3VCLA 1FLTX 2DYPD 5CJQH 3DX8A 1X5KA 3GSNA 4HXBH 3RWJB 3TLRA 5L2KA 1RMFL 2AXGB 5I1HH 1NBZA 1YY8A 4YDIL 3GSOB 3CFJB 5JOFA 2Y23A 4OUUA 2VISA 1OPGH 4WI2A 2NZ9D 5DJCB 3UCRA 4QOKD 1IE5A 1ZGLB 4FXKA 2ADGA 4U1MB 5SWSE 5EIIB 2F5AH 3RWHB 3IDXL 3RY6A 4LSRL 3KPTA 4M8QA 1G0YR 4YZFE 3QJHB 2CLZA 3WDJA 2N7AA 3IXTA 3D2UB 4F58H 5DRWB 3VJ6B 4DUVA 4BZ2H 2EEBA 4OF7A 4DGIL 3T4AA 3OKNA 3VI3E 3AAZB 5FOJA 3OKMA 4DEPB 1NCDH 5A1AA 5FCSH 1DBBH 5J11B 5F6HJ 1NCCL 3BISA 3NCEB 4PRBA 32C2A 2VLJA 1RQ5A 3GKWH 5KVDH 1IGTB 4XB8A 4LMQE 3RY4A 3PWPD 5CEZE 1A2YA 4PJ9C 3S36H 4ISVB 4CMHB 3EGSA 1MCKA 2GJ6A 5D5MF 4HWBH 2X05A 2AKRB 2QR0A 2NY7L 4P5TC 5E9DB 4P57A 2XT1B 1KC5H 2P5EB 3ARSA 1ZWIB 4KXZI 1QFUH 2YPLE 5DA4A 5EZJB 4FQCL 5F1KC 3VG0H 4JAMB 1GGUA 3RL2A 3ROOA 4FXKB 3ZE2F 1U0QA 5AYUH 3G5VA 4B7LA 1E4XI 4F57L 1S78C 1ND0A 3ORJA 3CZFA 1DDHA 2HT3D 3V6OA 1Z9MA 5IMKB 3ZYIA 5D2LA 5DJZB 5MEQA 4NZRH 4KH2A 3ISWA 5IR1B 1EMTL 2P43B 4LPCA 1TETH 2D7MA 5T3ZH 3HE7C 3HZYA 2ICWJ 1F4AA 5E8EA 5DRNB 3O6ML 4YR6A 4QF1A 1TVBA 1V8HA 2O5XL 5EU6D 1PZ5B 4ZUSA 4X8JA 1SY6A 4JHZA 4D0BA 1VENA 3VDAA 1OWWA 5CD3B 2D03H 5JR1H 1A1MB 1A5FL 2A0LD 2EYTA 2P44B 4MDIB 5HBBA 3P9LA 5EB9A 5HDOA 3QI9C 3BQUD 3W0WD 1Q0XL 3NN8A 5JPMA 2F53D 3I6GA 3CX5K 3QQ3A 4O2CA 4MVBC 4ODSH 4HG4K 5C0JA 3I50L 4NZDA 5DURD 1FLRL 3TA3D 2C7UB 5C0FA 5IT2L 1U3HA 2YK1L 2FWOB 4HIHA 5EO0A 5F96H 4R7DA 3WJJC 5D1XC 4EXKA 2FWOA 2CDFB 2HT3C 1ZGLP 4QO1A 2O5ZH 5ILTL 2OM5A 1N5YH 1MCOH 2EXYD 3B9EA 3GSQB 2WLYA 4HMEA 1S5IH 2RQ8A 3NZ8A 5DTFB 4P2OB 3OZ9H 2G60L 2X40A 1HZHH 1U8JB 2V7HA 4RDQG 4UT7L 3MUJA 1ZA6A 3EFDH 5CJOH 5D7LB 1J0KA 4GKNA 1BD2D 4OGXL 3RWCB 5C08D 3QUYC 4YE4L 2VZTA 3D18B 3HI6H 3DYMA 3TBYB 5JHDE 2C4FU 3MV9E 4XPHH 4XVJL 3QNZA 4PRHE 4JGMA 2OR9L 5SX5K 1KJ3L 2XZCL 4NRZB 3O4LA 1DN0A 2Z31D 4FXGA 3TT1H 3Q5OA 5E5RB 2X70B 5IFAL 2F74B 2AV7A 1K8DB 3D0LB 2J8UE 5GS0C 1QR1B 3UJTH 4U1GC 1NFDB 4JREC 1HZHL 3PNWB 1DQTA 2YPLA 3O4LD 2QQNL 2ZUVA 2Q3ZA 4WW1B 1I85C 4K23L 4LHUD 4RNRA 3QEQE 5L2JA 2CDFA 3SDCD 3R0MA 5GGQH 3FOLB 4YEFA 4OKDA 2EDYA 2ZOKB 5SX4H 2DYPA 3V6OE 1ADQH 1C5CH 2NY1B 2VXVH 1UGNA 5BJTB 3KGRA 1X7QA 3DPBA 3DROB 3AROA 1A1OA 2DLFL 1NBYA 4CKVX 3FMGL 4N0YH 5HGGS 1R3JB 4L4TD 2O5YH 5D72H 1IMHC 4PJXF 1FFNB 2DM7A 1K6QL 3C5ZC 4D0CA 5BRZA 5DLML 3WUWG 4RGNB 4DGVL 3GBNH 1KGCE 1RJYB 4PJDE 1RU9H 3AAZA 5F1IB 3WUWB 4O58L 4LU5H 3C5JB 3W81A 1MCCA 5TDOA 3P4MA 1MAKA 5DHYA 2DLFH 2PW2A 3LCYA 3RVVD 3UXFA 2R0WH 3MODL 4LSVL 1XH3A 2IBZY 2N7BA 5IQ9B 1ZEAH 4Y16C 5SWZA 4BQ8A 1HCVA 2AQ1A 5J4MA 4JZOB 5C0BE 5DJ2A 1B0GA 3IDUA 5IQ9A 3WJLA 1EO5A 5SV4A 3LOWA 1A1NA 4GKZA 3PXHA 3VGAC 4NOFA 4PG9A 4YHZL 4L5FH 4LVHC 2MOVA 2C4XA 2XA8L 1I1FA 1OD7A 3GHBH 4PJIB 3V7AE 2C3VB 2IBBA 5EU3B 2A6JB 3OAUL 5TE4L 3TYGH 2GJ6B 1KLUB 1AP2B 4PRIB 5I66B 2QV2A 1VGKA 1DANU 2VZSA 3CNKA 5FHBH 1RJYA 4P5MA 1TQBC 2ZCHH 1MI5A 3DRQA 1K5NA 3T0VA 5I73B 2FX9L 3KPSE 1MAML 4UINL 1H15B 4XPTH 1NFDF 3CFKB 4PTTB 3RZCC 2FDBP 4UIKH 1OW0C 1KB9K 3FQNB 3IFNH 4MJID 3QBTB 4MAYB 2JTDA 5BVJA 4HCRA 3IRZA 4RGNE 4HUMB 5F21B 4LGSB 4NKMA 5I1DB 4B0MM 3LEXB 5ADPL 3TT1L 3AREC 2Y25A 5HI5D 4FFWC 3C8KB 1T7ZA 3NFNA 1D5ZB 4Y7MA 4KMTH 3KPLB 4UBDD 3B3IA 4L3CA 1XMWA 1ROWA 4V1DA 5F8QC 1IEBB 1DLFL 4L8BA 4JRXD 4JPKL 3U4AA 5GRUL 3SDYL 5AG8A 4JY5L 4NQDA 4D94A 4F2MA 4F8QA 2EEAA 1DQDH 4DOHB 4PJBA 1KTDA 2D0HA 3KYOA 1HKLL 2WK2A 5F7YC 1HHJB 1T2QL 3D85A 3KWWA 2VR5A 1CXLA 4XP1L 2GSGA 4PGZA 4WFED 1T0NA 3HC0B 5IW3A 1VGKB 1D6VL 1IBGH 1FNGB 1G6VK 1NEUA 4JM2D 4YQXL 1BBJA 2V7NA 1KPVA 5HY9A 3OX8B 2HVKA 1AGCB 1DLFH 4PRIE 3INUL 5DR5L 2AXHA 4MX7A 4TUJA 2VDQH 2DN7A 2A73A 1UXWB 3K2MC 3SDYH 4AEIL 1NFIA 1B90A 3PGDB 2BRRH 4LSTL 2X9XA 1WWBX 4F7CA 3U7WH 3V6ZB 4PJFA 2PO6C 4L8BB 1YYML 4ODVL 5GS1B 4JEGB 2IALB 1ORQB 1BAFL 5H35A 5I16B 2UY6A 2NNAB 3O3AA 4AJ0A 4HBQA 5C08A 1Q9LA 3KG5A 1U8LA 1J0ZA 4R4FH 5J12B 5FM5M 3CUPA 3UDWA 4ELMB 4J1UB 1BHGA 3IFLH 2G5RA 3L95A 3U7YH 4Y1AE 5HPMA 4F37K 3GNMH 2R9HC 3JWDC 1KELL 1KCKA 5DMGD 5INCB 3ZO0A 3W11C 2J1KA 1H3PL 3NBNA 5GJSH 4CMMB 3P9MB 5L9DL 5L8LB 4XNMA 1GJIA 3DX7B 1ULVA 4TNWF 3SDXE 2J6EL 3H9HA 3MUHL 4HV8A 5IW1A 4RZCB 5FKPB 4XBEL 4JFEA 3WBDA 5EA0L 3STBA 4MA1C 2HJLB 5C0CE 4BQBA 1VFMA 5KVGL 2GY7B 5L8JB 3LVEA 1X3DA 4MNQD 5JXEA 3T0BA 3RWHA 2FO1A 1FZOB 2YUWA 2R2BA 5F3HA 2VDOH 1T4KB 4M1CD 3A6CH 3BGAA 3I75A 1DDHB 4TQEL 5I8EB 1K4CB 3D0VA 3B2UD 4BKLB 3PNWA 3DURB 6FABL 5KSBF 3D0VB 3QO0A 4Y5XA 1NMBL 2DWDA 3S37H 1I9JL 2X1QA 5KS9A 5FFLA 1FCCA 1HI6A 5CEXB 1F97A 2FIKB 4QRUA 2JCCB 2DBLH 2FHFA 3BPCA 5AAMA 5B38B 2VLRA 3WHE1 1T89C 2GFBA 4LCWB 1NCBH 5FGCB 5B38G 2UVFA 3I3DA 4LKXB 3MC0A 4X6DE 4GG6A 4NKDA 1NBQA 4UV7L 2ERJB 3MACH 1CGTA 4JFOA 2X89D 2W0FB 4P46C 4NUGH 3MGTA 4XVTL 3GRWH 4LLYB 4BFBD 1YMMD 3WS3B 4D0CB 2MQ3A 1JNNL 3C9NA 4OZ4A 4NWTH 1QSFA 3IDJB 3KPRE 1YJDL 4BH7A 2OJEB 4KRPC 1D3CA 4I77H 4HPYL 3WSQL 3V2AR 4XBPB 5C0DB 4MJ2A 4M3KB 4P2QE 4ZPVA 4PP1D 1CBVH 4OCRL 2FJGA 3D1MC 4GH7B 4Y2DB 3TJHD 1YEJH 4KTDL 2BFVH 2HFGH 4NO0D 1VDGA 5EIIA 2Q76B 2FJGB 2VO5A 4N8VA 1Q9WA 2KBGA 4IOIA 2ZCKH 1HHHA 1G9ML 4HWUA 4M6NH 4PJ8B 1JGDA 3IJSB 1T2JA 1MCLA 1HOCA 4EI5A 1NLDH 4KRMB 2Z92A 4CJ1A 2JE8A 3SE9L 3VI3F 3L7FB 4YC2C 5HI3D 5BS0A 4LCIL 5EU7E 5LGJB 3S6CA 4P3DA 4JFZH 1Q72H 4P2OC 1MFDH 4GW5B 5FO7B 1YEGL 2NX5B 5KZCB 1F8TH 1E27B 1W72L 1RZKH 3FQXA 4XCNB 2EXWC 4Y2DD 4L4JA 3U0TA 1AKJD 3Q2CA 2OR8A 2HT4D 4Z78B 4IDJH 4DW2H 5CGYC 1UQSA 4I2XB 3WFCL 5IBUB 2ZCLH 4V2BA 3I85A 3LMJH 1NMAH 1EEUA 2PYEB 4OT1H 2B0SL 3TCLB 1UC6A 3ZYZA 5HYJE 1G6RB 3W39B 2YPKB 4X7TB 1T80A 3SDXF 3QO0B 4Y5XB 3VD3A 3MOAL 2G75A 1GIGL 4HLZG 1T3FB 5CZKA 4ZQKA 2F8XC 3ZYOA 4WW2A 2IPKA 1J10A 3R8QA 1F3RB 4OB5L 4HULB 3OV6A 2VDOL 4LNVA 2HWZL 2VB5A 1CVRA 5LJYH 1U8NA 4G6ML 4JGUA 4NHCL 4PREA 3E2HC 3K8KA 4JO2L 2Z8WC 4HH9B 2MWCA 1KEGH 4M6OL 4UT6H 1OP3H 3FTGA 4P48A 4ONOA 1DQJA 4FQ1L 1AQDA 5FOBA 4EOWL 4Q6YA 4PRBB 4PJ7B 1AR2A 4X99B 4Y4KC 3OKLA 3FT3A 5FYKL 4YE4H 3Q6GL 1NGXB 4RRPG 5B3JE 1B4RA 4G8GA 1NAMH 4G8GE 3LKNA 4W6XB 3DRQB 3NCCB 1DUYB 4QHUA 3DO3A 1DL7L 3HC4H 5ICYB 5D2NC 1ETZA 2QSTA 1PG7H 2HA1A 1TQCC 4Y5YC 1JRHL 2CMRH 3MLVH 4LIQL 1HYSD 3MJ8B 5BO1L 1U93B 1K4DA 4WV1B 5F7EL 4PJGA 1P4IL 1U8HA 4KKLC 5HYJD 1IM3A 4WU5B 5DD6B 4GRWF 2AXFB 5L2JB 5E5MB 5GJTL 4ZQKB 4WW1A 3OXRA 4ZOCA 1GXEA 1MCDA 2IF7A 5IQ7H 3QQ9D 2YBRA 4MQXC 1OAZL 4K7PH 3K46A 5SWZB 4R2GD 3L3DB 4L29B 5GGQL 1KFAH 1CGUA 5C0IB 4QT5B 3DTXA 3T0WA 5JO5A 2CK0L 4F7PB 2CRYA 1BJ1J 5ESQB 3KPSD 4I0KA 4LLQA 4I0PC 2BZDA 3HE7A 5FKAA 3VRIA 2I9LB 1W0WB 3BKJH 4JO4L 5J6GA 2DLGA 1MRFH 4Z78A 4HX1B 4G6JL 5BO1H 1T0NB 2WUCH 4LU5L 1BM3L 1XGYH 1AE6L 3IDYC 2EDTA 5EDXA 2GTWB 1FH5L 4ZFOB 2IBGA 2CLRB 4WI5A 4HAGA 2R1XB 5MEPA 4K2UH 4KGJA 3WIHH 1HSBB 2Z4QA 1WISA 1I1CA 1PQZB 4KVCH 3BKYL 3K7UA 1AD9B 3JVGA 1KT2B 1N8ZB 4KTEH 3SDCC 1YYLH 1WLHA 3KPLA 4EN3A 1CN4A 3ZDXE 3W9EB 1FAIL 2OBGA 3WN5A 4R2GC 3CVHB 4NQXA 3P30H 3TPUB 3HPJA 3QCVL 5C0DA 5HYIA 3SCMB 1MREH 3QIBA 5K9KA 2X4OA 3LKSB 1FNEB 5E08H 3C5ZD 3S37X 2GIYA 3ARDA 4P2QD 4WHDA 3BKYH 3QXWA 2YR3A 3ZTJG 3DLQR 3LS5L 5DC9B 3FB8B 4M7LH 2ZUUA 5D1ZA 1EZVX 2FZ3B 4MA7L 3S35X 4ZFOA 2IPUG 2CRMA 1MI5B 3K2UH 4HKJA 4I3SL 3SQOH 4K3DL 4U1JB 1UT9A 4PRAB 1HIML 1MF2L 4MXVE 4I0CC 3RVVC 4TRPL 5CCKH 2GYSA 3JWOC 3WKMH 1SVZA 1MWAH 3U9UA 1NAMA 2NY4D 4DUWA 5HVFB 3UTPE 1FNLA 4GRWB 5JXEC 5I2IA 1SBBA 4X9FA 3CXHK 4L4VD 2R23A 1F3JB 2XKNA 2R0LL 1A4KA 2MJWA 3V5HA 5DVNA 3MRNA 2QBWA 5EWIL 2ZPKH 5IW6B 4ZYKA 2ATKB 5FO8B 2FHBA 2CQVA 1N3NA 2QSVA 3REWA 4LLAA 1T1WA 5DTFA 4X4YB 2Q8AH 3ZE1F 4UU9B 3I6KA 4Q2ZB 5GRVK 4HQQH 2E9BA 3T65A 3V8CA 3L3JA 4FQ2L 4IMLB 4D0DB 4JE4B 2VWEC 1J12A 4G3YH 4TSCL 5F3HB 3TVMD 3N1GC 1P4IH 4JAMA 3W9EA 2JELH 1KG0B 1W2KT 4N1EA 5H94B 3P77B 4HIHB 2H3NA 4LLWB 5BV7C 3EDJA 5JIKA 1CGVA 2PW1A 3BE1L 2VDMH 1B2WH 2B2XL 3QDHA 4I9WD 4F3FA 3GIZH 1AC0A 4O00A 4AENB 1FYHB 4JZJA 3VXRD 4QTHA 4OZFB 5ID0A 1JHKL 1OP5K 5JZ7D 3WUWA 1G84A 4PJFF 1UACH 3W2DL 4XNMB 4IRSA 1K9TA 1MCPH 3U46A 1HNGA 3OAZH 5FA3B 4WWKA 2Q3AA 1PEZA 2UZIL 2YN3A 4LAQL 1KCUH 3BDBA 4OTXH 5K9JH 2EZ0D 4Q0XH 3O3UN 4X8JB 1YC7A 4XTRD 2AJ3B 3B5TA 1JGLH 3MGAA 2B7DT 5GGRY 1VA9A 3TO4D 3QQNA 4WV1C 1OY3B 3OJMB 4TUOA 2NY4C 4YHKH 4XZUA 3PGCA 3PQYD 4QTIH 1U58B 3FOLA 1NBVH 1DE4B 1NJ9A 5I6XC 4MJIA 3HUJA 3GSWA 1GRWA 1JHTA 1IJ9A 1I1RA 3BVNA 1FNSL 3PWUA 2DWDB 4LAQH 4YDIH 3DURA 5I18H 3R06A 5EC1A 2HLFC 1MCNA 5I8EA 1EEQA 4UAOB 2IH3A 5EIQA 4I4WB 1I75A 4KGLA 1QQDA 4Y16A 5JQ6H 2P24B 5EFIA 2OTWA 3U6RA 4FRWA 3ULUL 2VZ1A 1TCRA 4Y5YA 1XZ0B 4E42A 5IB5A 4BFGA 4GRLB 2KUTA 4KI1A 2DS4A 1GPOL 1HK6A 4RZCA 5FKPA 2XTJC 1BLNA 1F3DH 3QDJD 1AJ7H 4DGIH 3DX7A 5EZIL 2I5YL 3UBXA 3HR5A 4YXKH 1XF5B 3GI9L 3H42L 5CGTA 1PBYA 5DJYA 3VE0A 1REIA 4IEFB 4X6FB 3NCYS 3K8MA 1NCCH 1KLFA 5E8NB 4GMSL 2VDKL 1WBXA 5EU7C 4XXCA 1NL0H 4WI4A 2FX8L 3GSXB 4UOW0 2VITA 3T1FB 3QNXB 1U9KA 5C07D 1ZLSH 3MLTB 1SJHB 4Q9QH 5GSRB 4OF0A 3C6SA 3CDFA 1MI5E 5EO0B 3L1OL 3O81A 5GSRA 1O7VA 3LEVH 3SE3A 3FONB 4WW2B 2PUQT 3MLTA 4J4PA 1I9EA 4PRNB 4UDUA 1S7UA 2B1AH 1ZVHA 2FO4B 3TBVB 4OBRA 2L0DA 3WLBA 2CLVB 3TZVA 4KVNH 4GT7A 4LLUB 3TYFA 3MRQA 4PGBA 4XRCB 1ZLWK 3WXVH 4FQCH 3OR6A 2J8UB 3K4AA 3D25A 3WIIH 4KHXL 2GW5A 2BNQA 2EYSB 2IAMA 3MJ9L 2X4SB 3AS2A 5H2BB 1R3KB 3VWKB 1ZLSL 4ZNCD 3WS3A 3BKMH 1B0RA 3HR5B 4XAWL 2FL5B 5JW4Q 1NL0L 3D9AH 3B8SA 4Z7OE 1G7MB 1RJZA 4BUGA 4EDXA 1DBML 1Y0LB 2XNAA 4PRIA 2NW2A 3QDJE 4MB3A 4DCQB 1BQUA 4Q9QL 5D96C 1KLGA 3MBEA 4MSWB 1QBLH 1I8KA 1UB6A 4MNGA 1HXMB 1SYVA 1FIGL 3GI8H 4MNQE 3C8DA 2NZ9C 3O6MH 3PL6D 4KRPB 5ITBH 5CP3A 3VGGA 43C9B 2A74A 2NXZD 3IFPA 5IMKA 2MPAH 3VD4A 1D5XB 1I4FA 4P49A 3VWKD 4OM0H 4RIRA 4DVRH 4LVOC 1JV5A 1N7MH 1X5ZA 1J1XH 3VXUA 1JPTH 3VFVB 3WIIL 1A8JH 1JNLL 2PETA 1OVZA 3IXAA 1RUQH 4BSWA 1Q1JL 2Q7YB 1N64H 1MIMH 3EUUA 4G6FD 3BKML 1XH3B 4HKXB 4RAUA 1UYWH 2AK1H 4U2ZA 4L3EE 3EYVA 1L9MA 3HMXA 3AGVA 2ERJC 4JN1H 3OJDB 3CIQA 3IF1A 1Q0YH 1SEBB 5GISL 4QHKI 4A6YL 4APQA 1T7YA 3HCVA 4R4BB 4MZ2A 5IB3B 4OF3A 1HQ4B 3FT2A 2G9HA 3UYRH 2R2HB 4QEGA 4IDJL 4DW2L 2HFFB 3VFPB 1TPXB 1EGJH 2VLJB 4MAUH 1U2CA 1EK3A 2BVYA 4POYA 2JKXA 1GHFL 3O3DA 2Y6SD 2JB5H 4NWUH 5L7XH 4P5MB 4I9WE 5IVXB 2DIJA 3TBSB 5IOPB 5DWUL 4U6VH 3WDHA 5JW3L 1X6LA 3KYNA 4IM8A 4WNQB 1JNHA 3N85H 1RFDL 5F9OL 5EU5B 1UFUA 2DQGL 1IZJA 1NDMB 3BQUA 3W0WA 1F4HA 4F15B 4LKCA 4Y89A 1S7SB 1CFTA 5I1EL 5I1IL 4BSWB 4S10A 3EDDA 1A22B 4WTZG 2H41A 3O8XB 1QEWA 3LSOB 4N0CD 4JCMA 4X4YA 4Z6AT 5BOPA 3T2PA 3VGHA 1D5MB 2VQ1A 5E0QA 4IS6A 5DSCB 1ACYL 5JQHC 1AXSB 4NN6B 5HSFA 1Y6NR 2EDQA 5ALCL 3LD8B 1CDJA 2DQUH 4QRRE 5DUBA 5MP6H 4XP4H 5I6XB 5C0BA 5EZLB 2VE6A 3T77B 3HLAA 4I18B 3JTSA 5ERWB 4X80H 5C92A 3QZWG 5B4MD 1RZ7H 4G9FD 4EDXB 3UEZA 4U1JA 3AMKA 3O8XD 2VQUA 1ZVSA 4YHPB 5ENWB 3U9PL 3HI1A 4EDWH 4WUKH 2CIIB 4WHYG 3RWFA 1FN4A 1V3KA 4L1DA 3RIFF 4HS8H 2DQUL 4Y16D 4JRYA 5HYFA 2ICWB 4HPOH 2M1KA 5E1AB 4WUUA 1AO7D 5D1XD 1KIQA 5JLZB 1KN2L 2XY2A 4PY7B 3VFUA 4ZUWA 4J3OC 3VWJD 5IFHH 5IQ7L 4PRNA 1KB5H 3CVHA 3UC0H 1OAXL 3B3IB 3HAEG 4JFHD 5GJTH 1FSKB 1A0QH 4I5BA 5LWYL 2IFFH 3MODH 1HHGB 4RNRB 3RVXD 4FTVA 3BD4A 4LOUC 4ETQA 4HK3N 3DETC 2DLTA 1T03H 3QDME 1PY4A 3HZKB 4M9PA 5DRZA 3TO4A 1IGIL 4GS7B 4LARL 2J5LC 3GSNL 2D31B 4NRXB 2Q8BL 3GK8H 1LK3L 3HI1B 2BHYA 3NGBB 2P1YA 2E27H 1JF5A 4H20H 2DQEL 4PRDA 1F6FB 4XAKD 5JW5A 2Q87A 4QRRB 2VWEE 4BZ1H 2R15A 3L5HA 1U8OA 5I1JH 1M7DB 3RZWA 2H32A 4LCCA 4NKDB 4ELMF 3DX6B 4L4TB 4QOKA 1CVSC 3BXNA 3DYOA 1RURL 3ZKNC 3MA7B 1TENA 3PHQB 5BQ7B 4TVSa 5D2LB 1AGFB 3GJEB 3M1BA 5ISZE 1M6OB 3QUKA 4PV8B 3SGEH 4CVZB 5DJ2B 2ITDB 5INDB 1D5MA 2C4FT 3VXME 5GRWA 3PWVB 1YEEL 3KXFB 4W68A 5T3XD 1UH3A 2QKIA 2AAVA 1FRGH 1PY9A 1T22A 2I27N 4L3CB 3GBNL 1JHLH 4XCCL 1MWAB 4RGMB 3VMNA 4TUKH 3DECA 4W6WB 5GRVL 2APWA 3VFMA 1RY7B 2IANA 4QRPE 1JL8A 3O3EB 2BNRA 4G8FB 3UTZA 2YK1H 5EU4A 5E08L 5D6CB 3F8UB 4YDKL 4YX2L 1JYXA 1ZEAL 5GSVA 3DETD 1JK8A 3BDYL 4BSVB 3UROR 1RZIA 5DI8B 2O5ZL 5BZWA 3RY6C 1CGXA 4NGHH 3DMMD 4H25B 5C09E 3EBAA 2EDDA 2R4SH 3K2UL 2EKSB 5JORA 5HVHB 4HF5L 5DFTA 2GKIA 1R5VA 4IRSB 1NUNB 3W9DB 3UBXB 4UI2A 5C0AB 3JV5A 3VFPA 5IF0A 1LD9B 4GQPH 5EBMB 3QDGE 1JIBA 1UEMA 1TVDA 5IV2B 1T21B 1BJMA 5K59F 2UWEF 3IJHA 5FK9B 5EOTA 1UB5A 3QXDA 4QRPB 4OI9A 4X5XB 2ZOKA 3ME0A 4RGMC 3JTTB 4ZTOH 4TSCH 3ZKQD 2VZOA 2IALA 4U1GB 4NO3B 1CICC 2IADA 4NC0B 5GS1A 5IB1B 5MHSD 4NHUA 3L3JB 4OZGA 4CN4A 2V5SA 4PJFB 4NQTA 1HHIB 4QHNB 2WMPA 3R4DA 3TCXA 4FP8H 3VXUB 1HHIA 4YGAB 3IS1X 2FHCA 4EUPB 3RUGA 4PLKD 1JWUA 5C9KA 1S7SA 2WWMD 5D2LE 5I74B 3U48A 5JW4M 1AHWB 4KQ3H 1JTTA 1BIIB 1IEAB 1WFUA 4Y1AA 4Z7UF 4QRPD 5I15L 2L7UA 2DQJH 4Z7WA 5DZOA 5K9OA 4ETYA 1T5WB 1J5OL 3ZKXC 3M17A 2KZ1B 1U91B 1G6RL 3KDMA 2ICEB 1M7DA 2GCYB 1TDQA 3QUZD 3SE8L 4LVEA 4I48A 3B5HA 5IFJB 1T1XB 5JDJA 1CXIA 3S36X 1MI5D 5FHAL 4MS8C 3O2WL 1T1ZB 2X5PA 4QRTB 4KQ3L 1TMCB 2FJFA 2HP4A 3DHJA 1J0HA 3U7YL 1MHHB 4HWEH 2J5LB 4G6AD 1XIWA 2CK2A 5KVEL 6CGTA 1WVZA 1J18A 5E94A 3FO0L 2C26A 3KYMB 4Z8FH 5I18L 5TE7H 5HI5C 3EYSL 4X6DF 3HPJB 2XV6B 1DVFA 1Z9OA 2DI7A 2XZQH 2H2PC 4QKXB 3P77A 5DS8A 3TFKC 3GFUA 4OI7A 2HKHL 2YD2A 4PJDF 4RAUB 4DZBB 4NFDA 2OYPA 5CZVL 1TJIL 3QEGL 1Z0NA 1S8DB 4R0LC 2CR6A 3FFCB 2X4NB 5F8RC 3G5ZA 1DQLH 2ARWA 4B7IA 5KN5B 1MEXH 2ADJB 5DGQA 3FQRB 1V5JA 2UZXB 4PJFE 5DMIH 3ZE0F 1FHGA 3CFKA 2BY1A 1KB5B 2VXQL 4F80A 1A6VL 1ZHLB 4ZXBC 4F7MB 1X4ZA 5E9DD 3KYKH 2NY6B 5MEND 1RMFH 5D7IA 5CEZH 4UOJA 4YBQC 2GCYA 4ZTPL 1AI1L 2YWYA 4YXHL 4OI8A 2XNAB 3HG1E 3P0YL 4ZOEA 1FL5B 3OMZA 2CJUL 3GMQB 4RQQA 1RUKL 4LEOB 3G5XA 4LSQH 2FH8A 1HSAA 1U8PB 4KPHH 4QHMA 5I30H 4ORGB 5IBTL 4IMKA 4XAKE 1YY9D 2CSPA 3L1OH 2ITCB 3ZTNL 4LASH 5JA8B 2X4OB 1Z6JT 4APQD 3FRPA 4BKLA 1A6WH 1JGDB 5MENB 3BE1H 3C2AH 3I75B 1WCBA 3WSQH 4IOIB 5FGSA 2P8LB 4LSRH 1CZ8L 1CFTB 3NMEA 1SM3H 4JQIL 1F90L 1WFOA 4BJLA 4D3CH 3N9GL 1S7TA 5I75C 4MD5A 1X5YA 3VFNB 3LPFA 5ADPH 1TIUA 5M7QA 1YYMH 4ODVH 3PV6B 2VN4A 3ARYA 3OR7B 1ZLVK 4ISVA 4YLQT 5KVDL 3QIUD 4XVSL 4DEPC 3O4LE 3MV01 4JFDE 4AEHL 3VE0B 1XF4B 2VKWA 1SHMA 4HFUH 1A6TA 4C55A 4OAWB 4LLYA 1ZLUH 1SY6H 1I8MA 2DF3A 2R69L 1IRAY 4D9LH 2BCKA 2BX5A 4GFTB 1ZHBB 3QDGA 5C6TL 4KY1L 3SGDH 4ZNEA 3C2AL 4F8TA 2DICA 1MRCH 3RHWK 3X14B 1AIFB 3CFEA 4RAHA 3REVB 3CDGB 4PG2C 3MRGB 3EDFA 1ZHNA 4M8QB 2GT9A 3LHPH 1VKXB 1NCBL 2N1KA 3BDXA 4U1KB 4CMHC 3UJJL 5DDHA 4LNRB 4PRPA 3CK0L 4HKXA 5TE6L 4YQXH 1KGCD 2IH3B 5E03A 3RNQA 5BW7A 3SY0B 5I1KH 2BNUA 4QLRA 4Z8FL 4KZDL 5EPMB 4OLXL 5L6YH 4WEMB 5JDSB 3F62A 5T1KB 2P7TA 3B9KC 3OGOE 2NY2D 1ZHKB 1QRNA 5DRXB 3OKKB 4OGAD 1YEJL 1U3HD 4NCC1 3L3GB 5SWZE 3QIUC 4LPVA 2D03L 4B5EA 2YKLH 4Z95H 3QWRA 5D96B 4NRZA 3CK0H 2I9TB 3MUY1 2PXYB 1BIHA 2I07B 5I1HL 1UQSB 4I2XA 5D71H 3M07A 1T5XB 3LZFH 5E2WL 3T4YA 1RJZB 1L4IA 3GHEH 1IAIL 4FFVC 4HUNB 2GSGB 2VR9A 3MJ7B 3UAJC 2QQKL 3KJ6H 4BUHA 4OLYL 4JY4A 3SPVA 2XFXA 2FJHA 4PJEF 4M6NL 1C5DB 1KUMA 4LHUB 3OXSB 2YD7A 3D39D 4RA0C 4LPXA 2WZPD 1E28B 4U6VL 4OIAA 3RL1A 5EA0H 4LHUG 1SJEA 1QNZL 1BQHB 2BSRA 5DJAA 1PFCA 2AERT 3CUPB 5DQDH 4PP1C 5FXCH 3MRBA 1C1EL 5I8OL 4H0IA 3SGKC 1HHGA 4M43L 2Y7QB 2NR6C 4I77L 1X5GA 1D7FA 5DMKB 5DYOB 3PDGA 5I8CA 1T22B 4D0DA 3GSUB 5SWSB 4N0UE 1LEKA 5IK3B 4LASL 2COQA 6FABH 1WBYB 4EI6B 3UTOA 2P45B 1WGOA 5K93A 5CZXC 3QJFA 43CAB 2GK0A 1A7NL 3MRDB 1MJUL 4PJHB 2BVQB 3RWJA 1MHCB 5ACMA 3AXLB 4MNGB 1II4E 4R8WH 1BQLL 1KLGB 3S36L 3T4YB 5IHUL 4PUBL 4LCCB 2ICEA 4PJ7F 3OKEB 2KPNA 2VLJD 4QRRA 4JRYE 1MCRA 1WV7T 2ESVD 5DUPL 1IGML 4BFIB 3GRWL 2Z35B 4JR9H 4NQCE 5IFHL 1QA9A 3NIDE 1YMME 4PJAE 4RMSA 3ILPB 2F19L 3HNTH 1FCGA 4PJAB 5DJ6A 4OLEA 2VAJA 5C0IA 4JPIA 4WFEE 4IS6B 4PJXE 3HMXH 4RFEB 4N5ED 2D2OA 4M7ZB 2GUOA 3IU4H 4WTZA 4HJGA 5I1LB 4LBEB 3VXUD 3LSOA 2NY5L 4H1LH 2HKFL 3EYOB 1U6AL 1LEKB 1I7UB 2YXFA 5C09D 3BIKA 3SKNA 3QG6A 4QGYA 3SDCA 5E6IC 4R0LB 4PTUB 1VCAA 3TEUA 1CU4H 1FO0B 5F9JB 5HD8D 3AREB 3LRHA 5IMLA 3EGSB 3L3HA 3MRCB 1G9MC 1A7QL 2FECI 4G9FE 4MXQD 4DQOH 2HG5B 5CP3H 5TPWH 2E9JA 2A38A 2FJHB 1R5VB 1BGXH 3MV8A 1DBJL 1RJCA 5ENWA 3WHE0 1RIUL 4ZS6D 4OCMC 4I48B 1HWHB 1XIWC 3OAYH 1H0DA 3W0WE 1ERNA 2D0FA 1NLBH 2ZJSL 2R0WL 3A67L 3SDAD 4NQDD 1X5JA 4WO4D 3DBXB 1N26A 2R1YB 4P46B 4XP9H 4MA3B 4NQCD 4X6BA 1ZV5A 4RMWA 4OIIL 1E6OH 2NXYB 2E5EA 3PXJA 3O4OC 4U1MA 3RWIB 2FD6H 4KKCC 4RRPA 4OZIB 1I7UA 4IRZH 2XA8H 2W1NA 5DSCA 2ZPKL 4LBEA 2VERN 1ZT1B 4NNXA 1JV5B 5HTSA 1DQQA 4TPRH 4XT1C 4ORZC 1VSCA 5GPRA 5I1GH 3HI5L 2OR9H 4J12A 2C1PB 4WO4B 2D9QB 3FFDB 3HNSL 1QRKA 1KEGL 1KSRA 3GMPB 3E0GA 3GKZA 2MCPL 3U9PH 1LEGA 3BHBB 2GJJA 3UTTA 4XVJH 4C56D 4X6DA 4DUXA 5DQ9A 3F7VB 2DQCH 4Y4HD 5H37H 2Q7NA 3SO3B 3KPQB 5LQBH 2IMNA 5C0AA 2B39A 2FL5A 4OJFH 1KB9J 4AM0A 4RGNC 1W8OA 1KCRH 5DMYA 3P0GB 4OAWA 3IJYA 2EDWA 5DO2D 1I1AB 3ARWA 3V52L 3V79C 1KCUL 4RMTA 4TN9A 3MOQA 1AY1L 4H8WL 1XR8A 4G6KL 1AGEB 1KXVC 1FVCB 3HCVB 4DAGH 4UT9H 4XBGB 1RZKC 5IK3A 4OCWL 4DZBA 2H2SC 1CG9B 4Y4HB 2NNAA 2E7LA 4R7DB 2FEDD 3C6SB 5LGHL 1QUNA 3SDCB 1NBVL 4CU6A 3JSSA 3QHZH 5C0ND 4LSPH 4Z0XA 3BAEL 2X10A 1WC7A 4XNZB 5J12C 1JUFB 1E0OB 3C6LD 4NFCA 4OQ1A 5KSVB 2MHAA 3IAPA 3ULVF 2ZKHH 1FZJA 4MCYB 4KJWC 1C16A 2Q8AL 3E8UH 3AVEA 3CPLA 3KPNA 4WCYH 4Y8AA 1RIVL 5FECB 3RVTD 1U95B 4B50A 1ZAGA 2JELL 2LE9A 1XF5A 2V7NB 3V4PH 3U82B 2BNRD 1MCWW 1A3LL 3DVGB 4FMKA 4GW1B 3U4BH 4L4TA 1FL5A 4M7LL 3QHZL 1ES0A 4UTBL 4YBLC 2GHWB 2IGFH 3L5JA 4QRQA 3MRIA 4PJEA 2D7TL 2VXTL 1FL6B 2ZKHL 3K81A 1R5IB 3SJVB 3FFCD 3CMGA 1DBJH 4APQC 1KCSH 3CLEL 3CSGA 3RA7L 3SDDA 5FB8B 4OZIF 1WT5A 2WUCL 3C60B 5LBSH 2K3TA 4K8RL 1T20A 4J3VA 4MXWL 5D7SL 5JO5B 1OLZA 1J0YA 5SV3A 1VB9A 3EDEA 3V4PL 3CZFB 4OBSA 3AB0C 1IAKB 4PLKC 3PP4L 3FFCA 3ARFA 1M1SA 1NCWH 1K4CA 3IKKA 2MHAB 5IVXF 3GSQA 3PWUB 2X9YA 3PWNB 4UDUB 1M7IA 3SGKA 5I17A 5C7XH 5CKAA 3EKCA 3RWDB 3P30L 4NZUH 4DKEL 4L4VA 3CLEH 3RA7H 3BWUC 4I0PA 3BZ4A 2E7CA 2OR7A 3BEWB 3F6IA 3BP7B 3ULVL 3QA3A 2Z31A 2K7PA 2DM3A 3TT3H 3RPKA 4U0RC 1T1YA 2AJ3A 4L9LB 4D8PB 4EI5C 3QI9B 1OTUC 1FDLH 5GIRB 4EEEA 4KK9D 1IKNC 5KVFL 3BI9X 2EYTB 1QSEA 4G8GB 4NBYB 5C0EB 3X3GL 1KXTB 3L3IA 4R26H 5E4EB 1QSEB 4P5TD 3FT3B 4JM2C 1YEIL 5TDNA 5GIRA 1HIMH 3D39B 3QFJA 1U8KA 3RZCB 3IDGB 2XTJB 5BVPL 3WHXB 1T89A 3KPSB 4TULH 3E2HB 3I3EA 5DUML 4HEME 1U8LB 2QADD 1S9WA 3HHRB 1CT8B 1V7NL 5FYKU 5F1OB 2IFGA 2VLKE 4N9OB 1F02I 1OGAD 3CCHA 4Q9BA 3SKOA 3MOBL 5KS9E 1FQ9C 2NCMA 3X3FH 2Q7YA 2OXHA 5JIPA 1F4XL 4FMFA 3PWPE 4U3HA 5CEZD 1QFPA 5DZLA 5MENA 5KZCD 4WU7A 4LCUB 4MDJB 5CJQL 2BNUB 1KN4H 2P5WB 1RIHL 3QXTA 2PO6A 3UTSE 2NW3B 3RWIA 3ZE0E 1MHEB 3L6FA 1L6ZA 2XTJD 1F11A 3LAFA 3L9RA 2EDFA 1JPFB 1Q0YL 1B4JH 3F65A 3QNZB 1Y0LA 1BFVH 3NIGE 1MHPL 1U8KB 1IGTA 2ZNWA 2BCKB 5IVXA 1RIVH 5F7MC 2NLJB 1DUYA 4QHUB 1UM4H 4L4TE 2G2RB 3N06B 5E2TL 3B2UC 2J88H 1BZ9A 4OCYL 1EGJA 3HMWL 4AQ1B 4GBXD 3LIZH 1XGRA 4LGPB 4NQVB 2V5MA 4XHQA 2A1WL 2DAVA 4K9EH 4E0RB 4H0GA 3T8XA 3BH8B 2Y36L 4F2MB 2JB6A 4POZD 4X0KB 5FO9A 3BGMB 3KNBA 3I9GL 4FQIL 4NM8H 3LKRA 4F3FB 1NLDL 1SEBA 3WLWC 1I85A 1ODAA 3F7RA 1CDCA 4PBWD 5F3BB 5TE6H 3H9ZA 1UJ3A 4P59H 5F3BA 4OLWL 3FO1B 1S7QB 35C8L 3BX7C 4QXTA 3IVKA 3K74B 3VFSA 1RZKL 5IBUG 3QXAB 2AXJA 5JUEH 3IDXH 3KPOA 4Y1AD 1LO5A 1F42A 1GCFA 3D2UD 1OGTA 4Y4KD 3VG0L 5HPOA 2A77L 3VDCA 2AXGA 5T1LD 1IAIH 4Z95L 1CFSB 3VI4E 4KDWA 2D7PA 2KH2B 4DVRL 1CL7H 4LLDB 4LVOB 4WWKC 3K4DA 1FVDA 4GG8A 5J3HD 4NSKA 1CGWA 2W9DL 3DV4B 4XBEH 3CFDB 4XH2B 1X5XA 2SEBA 3F7VA 1EHLH 3GGWA 3CFDA 4XH2A 3CH8A 3JWOH 4G8IA 3G6JF 4LCWE 1CK0H 2WIIB 4U1SA 3ZDZE 4EVNB 1XF2A 1QZ1A 5IR1A 4GUPB 3FOMA 4JM2F 1HI6B 3RJDA 1DTUA 4AMKL 1DEEA 2FEEL 5KS9B 3BD5A 3ZT5A 1IQWH 2X4QB 3TYFB 1FZJB 3H42H 3VGFA 4OFKA 4AEEA 4FQJL 1QEWB 5ADOH 5D6DA 4OM0L 4FQPA 3MRHA 3MRKA 4P2RA 2MMXA 4NO3A 4FN0A 4LRNL 3ES6B 1J05B 4Z0BL 5DYOA 3N50A 4W4OC 1U2HA 2VDPH 3MLSH 1UWGL 1Q1JH 3WEXA 1IZKA 1F2XK 3D3VB 2QQNH 3UDWC 1TJHL 4IHOB 4KVNL 4ONFL 4UQ2A 4U31A 3IDIA 2W60A 5F9OH 3C5JA 4XPGL 5SWQB 1IGJA 4GOSA 5HYSA 1FE8L 2FLBT 2ICWA 2YD1A 5DD5H 4ONGH 1AH1A 1PG7W 2R1XA 3NOIA 2RCSH 4HPYH 3WL9B 3LKNB 2D0GA 4K7PY 2Z0BA 1D5BB 2X6MA 2WP3O 4Z0BH 3D6GA 4NZTL 4R90L 1F4WH 4KHXH 3K0WA 5J06A 5M94B 4YHIA 4U7SA 1I7TA 3HPLB 1H9VA 5I76B 3C5ZA 2ORBH 4NWUL 4DFHA 2DTML 4HIIB 3QH3B 3WO4C 4YHNA 1QVOB 3J8F7 4O2FB 4N1HB 5GS0L 5DD5L 3H9SA 4JVWA 4FTVE 1ZHKA 2VR4A 5D1QD 3PIQA 3NCYP 5AEAA 2PO6B 3BPNB 1QYGL 4IMLA 4KJYA 4KK8C 5MI0C 4GAYB 1B6DA 1RUQL 2YZ1A 3L5WA 5ILTH 4DK6A 3V0VB 2ORBL 3A6OA 3G5YA 4FZ8L 1CDHA 1YDPA 2ADIA 4Y4KA 3QIWB 5HDQL 3UC0L 1DLHB 5JHDB 2EIZB 1N6UA 5FUCE 4WHTA 4A6YH 4P57B 1X5FA 2R39A 5EBWA 2QQKH 2R2CA 3KJ6L 3U9UB 3GSVA 4CVXA 5IGXL 5D1QB 1G0XA 3G6JB 3V4VH 4EN3C 1JHLL 4XCCH 5GS0H 3S3PA 1VFUA 4XCEA 32C2B 1BJ8A 1Z2KA 5DFVC 4KKLD 4YHMH 3VXSA 3W9DA 1BVLB 4AIOA 3QNYA 4HIXL 4ONHB 1GGCL 4UILH 2BVUA 4ZG1A 2L4OA 3CGTA 1JN6A 4FQHA 3EO0B 5IHZA 2DQTH 2FB4H 1MUJA 4NT6A 4EIGB 5ETUB 1J9CT 3ARFC 4U1HA 1A1OB 1QLFA 2AQ3A 4HGWB 4F9PA 3QZWB 2VAAB 3VFSB 1GGYA 5D5ME 4C56B 4V1DB 4KK8D 3RIFK 2XKSA 1RSFA 2H1PL 3VFMB 3DUHA 5H35B 4XXCC 1TJGH 5C0GA 3MZGB 4JQVA 3QG6B 4FNLH 5DD0L 5I1JL 4C56A 4DWHA 2DQGH 3IXAB 2YSSA 4PD4K 5DJXA 2DWEB 3WO4B 4Z7VF 4X5WB 1DCLA 4G80B 4KROB 3VD5A 1WBZB 1F5WA 4HKBA 4OZHE 4XC1L 1AGDB 3BPNC 5CCKL 4P2YA 5MEPB 1U8IA 4QGTA 4AG4H 3BH9B 3BKCL 4E41B 4K3DH 2R23B 3MCKB 4JHBA 4G8GD 2V6HA 4M1GH 5B8CA 5I2IB 2NY7H 2OLDA 4DN3L 5MEOA 2X7LA 1K6QH 3SJVE 5E2VH 4FNLL 5DD0H 3EOTL 1KCLA 1FNHA 2NW2B 2XRAH 2WSKA 1NGZB 2HAZA 3TVMA 1Q9KA 1IVLA 5T1DH 3RPIB 2QHRH 1JZ4A 3CFBB 4FQLL 4NQCA 3QEQD 2JJVA 4UT9L 3K1DA 5HVHC 5EC2A 1OOAA 3FB6B 1L7TH 1RK1B 4U1LA 3T3PF 4OZFG 5ABDE 1G7QA 5GRYA 1OT2A 4NNXB 4NQDB 4ZSOE 4QHNA 2FX9H 4HDIB 1MCIA 4PJCB 4IOFC 4KI5E 3TO2B 3PE9A 4U2YA 4IDLA 4WI8A 4G6JH 1S7XB 5A16B 4X9HA 3TH4T 3UO1H 1FZMA 1P1ZA 3LB6D 4MNHB 3LY6A 3U7WL 3V6FB 2KKQA 2GSIB 1XCQB 1WIOA 3UPCA 2UV3A 3PWJB 4XWOC 4M7JH 2AK4B 5EBMA 2O61B 3B9AA 4YDKH 4JZNB 1G7HB 2HKHH 4KHTL 4EUPH 5DJDB 2OTUB 1T1ZA 4KK6D 4WWKB 1RZJC 2M2DA 2UWEA 3L3IB 1M71A 1I1YB 2E6PA 4NGHL 2IG2H 2G2RA 3WIHL 5IFJA 1CI5A 2D9CA 1G7HA 3E3QC 1IAOA 1FV1A 1CICD 1KPUB 4QXWA 2DD8H 3OPZL 4GW4A 1X9QA 1J5OH 3L5XH 3MPCA 1Y6MR 4J23A 5L8KB 2V2WB 5BJTA 4MQXD 4OFYA 1JZ6A 2PW1B 3DJ9A 3MXWH 5EOCL 4FZEH 1J87A 4FA8A 4LLWA 3QEUA 2VSCA 4PG9B 5I16A 1FG2A 1S9KC 3MJ6A 2E7BA 1M7IB 3BOVA 4X4XA 5GZND 5I1GL 5KSAB 5FM4A 3EFFB 4DOHE 1UWXK 3LQAH 1MELA 1WFNA 2YBRB 3JUYA 2GUOB 4PGDB 4XXDB 5EZOH 5DURB 1OW0A 4X4XB 4CW1B 1TZHA 3PIQB 4P2QB 2DKMA 2PR4L 1TJGL 3H7BB 4OZHF 1NFKA 2XZQL 1U3YA 1XF3B 1AGCA 3QRGL 4C57C 1FGNH 3TZVD 3JUZA 2F54E 3BESR 4DTGH 4KI5F 5C08E 2JK5A 1B6UA 3GMQA 3OJVC 4RQQB 3FO0H 3MBEB 5DGRA 3MRIB 4HIIA 4DKDC 1KTKE 4JFEB 1XT5A 2YXMA 4JQIH 2UUDK 3QYCA 1ES0B 4HV8B 5TF0A 3TBSA 4NSKB 5D7IB 3TYGL 1FNFA 3BDYH 3G6JE 5T5FH 4JN2B 2CRIA 3HA0A 4N0UB 1NDGB 4UQ3A 5FUZL 5LAXA 4NCDA 2R4SL 4JDVB 4K8RC 4ALAH 1RJLB 2IPUK 4HKZA 3TFKD 3JV6A 1I7RB 5EU6A 5EZOL 3TZVB 1FYTB 4S1QL 4ZDHA 1S8DA 2XZAH 1F4XH 5KSVA 3BZEB 3EIFA 4CDHA 2IPTL 3LV3B 1OAQH 4Z0XB 1Q9LB 1U3HC 1S7QA 3VI4F 1KIPA 1WF5A 3X3FL 1S7TB 3BP5A 3UJJH 3DSNA 3MRKB 1E4XL 5AG9A 3BPOB 1OSPL 4GBXB 5CEYB 5IMMB 1YNKL 3VXRB 3TIDA 3DRTA 3LKQA 4MAYA 4ZAKC 4KRLB 3B6SA 2HT4C 3MMEB 3SGDI 5T33L 5L2KB 1Q38A 3ZLQC 2XKNB 2FBOJ 4LFHD 3QHFH 3RI5K 5CD3A 1CF8H 4ZXBD 1JJUA 4M6ML 1SYVB 4ZS7L 5C2BL 1G7LA 2GTWA 1RZJH 1DN0B 4FXGB 1H3PH 3HMWH 1ZVSB 3MLWH