1DLFL

High resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody igg2a(s) crystallized at ph 5.25
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
DVVMTQTPLSLPVSLGNQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPFTFGSGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S)
publication title The pH-dependent structural variation of complementarity-determining region H3 in the crystal structures of the Fv fragment from an anti-dansyl monoclonal antibody.
pubmed doi rcsb
total genus 27
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dlfL00
2W0FB 5FYKU 4PJBE 3GSQB 1PDKA 4I3RH 2PO6B 1FJ1B 4DZ8A 3BEVA 2ZKHH 4PRNB 1ZGLB 4JKKA 3ZE0E 4G8FA 1INDH 2CIKB 4KAQH 1Q72H 4U2YA 1JPFA 4GMTL 4PJHE 3BWUC 5HPMA 2FJFA 4N8VG 3D87B 1C1EH 1K8DB 3QAZC 4K3JH 3LKQB 1CI5A 3T3PF 4D2NA 3WLWD 3WFEH 2EIEA 3BD3A 1CE6B 1U8PA 3LN4B 2DQCL 4NRXA 3N0PB 4OGAD 2I60L 1SVZA 1N7ML 5GJSH 4DW2L 2VAAB 4XB7A 5C0BD 5IM7A 3T08A 2YPKB 3RIAK 3P11L 1RHFA 3LH2L 4HMCA 4PUBL 3U4BH 1L6XA 5BW7A 1QUNA 2XWTA 4LCYB 1YYML 2DBLH 2BNQA 1AC6A 5CLWA 3HCVB 2O61B 4MAYA 4JDVB 4OKDA 5EULV 1CICC 1T66D 3P0GB 3IRPX 4PV9A 4OCRL 2XZAH 4EUPA 1AI1H 3T0EB 4KQ3H 5FO9A 1C08B 5I8EA 3WYRA 4PRPE 2VDOL 2DAVA 4H0GA 2GTWA 4XXDA 1FO0B 4WI7A 4X80L 4E0RA 2V9QA 3L9RB 3TN0D 3QXDB 5DJ2A 2DKUA 3OXSA 4MQXC 4QTHA 3SGEI 4ZQKA 5ITBH 3PDGA 4XP4L 1JN6B 3KXFD 3SY0B 1LNUA 2YN3A 3SCMD 1P2CB 5D5MF 5D72H 3REWA 4NO5A 2AK1H 1MFCH 3EZ8A 4QRSB 1JNLL 4TTDC 3QIBB 5K9QI 5I76B 4HIEB 2ZNXA 4DN3H 3R0MA 4LVEA 5CJXA 1S9KC 2VTFA 2CKBB 1JFQL 4EVNA 3VD5A 1D5XB 1S7RB 3O2DH 4MVBC 5GJTL 1A0QH 5KSAA 4GRWH 4U1HA 5T3ZH 5FXCH 3P77A 3WUWA 4Y2DC 1I9JL 4PJAB 1FC1A 3ARGB 2RCSL 4PRPD 3VRLE 4K71C 4X5WB 3E6HB 1TPXC 2V5SA 1WC7A 2Y07L 4X0KA 1TETH 1J0KA 4BJLA 2AP2A 4YFDB 3RKPA 1BFTA 4P4KC 5HI4D 2DL9A 2UZXB 4EBQL 3HAEH 1IZKA 2VOTA 4XBPA 3DVNA 1DBJH 3G08A 3HE7C 3TPUB 4OLXL 3IETB 3QUZD 2V7NB 4U6XA 2W9EH 4KKLC 3BGFB 3WNMA 2VLME 1F3RB 1IAIL 1YY8B 1R6VA 3QIWA 5DJ6B 5IEKA 1GGIL 3QHFL 1SJHA 1ZANL 2YA2A 3GNML 4JO3L 4K23L 3LHPH 1MCIA 4JREC 2AV1A 3GO1H 3U82B 3DETD 2ICWI 4PJ8A 3AS3A 5DHVH 2FATH 1GGYA 5J7CC 5DJDB 1MCFA 4CKVX 3EJJX 1S7UA 3LEVH 4ZSOB 2FRGP 3QA3B 4F7PB 3O41A 4OAWB 3CH1A 2N7AA 3LEYL 4LVNB 2VISB 4HXBH 3LS4H 2MOVA 1QBBA 5I74B 4JFFA 1DQTA 1FDLH 1QLRB 4FFZL 2F74A 4QRPE 5EB9A 1EFXA 5EUKA 2E9JA 4XC1L 2VXUL 4KI5F 3RI5K 5EZOH 5KSUA 1CDUA 1A6TB 1MVFA 4XNMA 1R3LA 2J8HA 2KQMA 3GK8H 3R1GL 4Y4KB 3ZZ1A 2VLJA 4L8BA 3EO0B 4GG6F 3BGMA 2FGWH 4HKBB 2IAMD 4MWFA 3S9DB 3HC0A 3P0YL 3DYMA 4M5YH 1N59B 3M8OH 4XX1E 3RBSA 1QNZL 3SE9L 2LU7A 2FYYA 3D85A 4KDTA 3MUGA 3DVFA 3FTGB 4ZS6C 2EIZA 3CVHL 1T4KB 1NC2A 1YEDB 3B2UC 3VFRA 4DVBB 1K5NA 5KSBF 3WIHA 1N5AA 4G6FD 2WM0A 5KG9A 5INCB 5C9JA 5T5NF 4M6AA 4PJXE 1NBYB 5CILH 1FVDB 5FFLA 2F5AL 5GSVA 1CS6A 4YBLB 4PBXA 1AQKH 1EJOH 3WHXA 4QRPD 4HGKC 3CZJA 1B0RA 1NFIA 4OZFB 5D2LA 5ACZB 4ZOBA 2PYED 2EE2A 3ZYOA 3MV8B 4KQ4H 1UXWB 2B8OT 1WCBA 1XGQA 4TUOA 2CRMA 1W72A 2Y7QA 4N0UE 8FABA 3EHBC 1UCTA 2CMRL 4GXUM 3QG7H 2EICA 4M8QB 2OR7A 5BV7B 3DV6A 3O6FA 5HBBA 1NJ9B 3QCVL 3AGVA 5IB1B 4JVWA 4Y19D 5HHPB 2IADA 4GKZB 5E2WL 2F8VA 5J8OA 2VDPH 4QWWC 5KANG 4P99A 1W0YT 5MEOA 3QJHB 1MHEA 3AXLA 1YEGH 3I6KB 5I1AB 2R8SL 1DDHB 5FB8A 2VWEC 4AH2A 1BBDL 2XQYG 4DFHA 3TBVA 1IGML 4Z7VF 1TCRB 3K7UA 3KPRB 1TENA 3F12B 3MLSL 5I8KL 1AXSA 3UBXA 1CGSH 4PRIB 4HKZA 1RHHB 12E8H 3C60C 3S34H 1JHKL 1NANH 4HW6A 3MXVL 1BBJB 3QUMB 4P5TB 1MLCB 3STLB 1F90L 1A4JB 1N4XH 4PJ9C 4LDEB 2Q7YB 4Z95H 4YAQA 2VZTA 5HDBF 4BM7A 5DR5H 4U49A 1MCKA 1K85A 1DEEB 3MV9E 3O2WL 1MIML 4KRPB 3O11A 3H0TA 4PYGA 5DK0B 1CG9B 3GUTA 3DURB 2JJSC 1CDGA 3VXTB 4Q2ZA 2H3NB 3Q1SL 2X9YA 1G84A 4WI4A 4JM4L 5ID0A 3BPOB 2X4UB 1RUKH 1CWVA 3BMVA 5FF6B 3S4SB 5I17A 2J8UA 4MDJA 1D6EB 3BH9B 4CRPA 1S7SB 3MFFB 1FZOA 4BQ9A 5CP7B 3JWDL 4Q58C 1UCBL 3D2UA 3MRRB 1JWUA 4NC0B 2NY5H 3WNOA 5SX5K 2EH7H 2AV7B 4OGXL 3C6SA 3MRQB 3PGDB 4HIIA 2JIXA 4JHAH 5GRXG 3VI3F 1TJGH 4WTWA 4NYLA 2YD7A 2HKHH 4PJFA 5AZEH 4LKXB 3RY4A 1HINH 3PL6B 4CMMB 2M8XA 3EAKA 1BWWA 1NMBL 5D71L 1Z9SA 4ZMAT 1EX0A 5FECA 3RVWD 1RIVL 5L88L 4IRZH 4OI7A 4JFQA 4TPRH 5C0RL 3DTXA 3HPLA 5EU6D 4JO2L 2BXYA 4G9FE 4C56E 1P4LA 2VLRA 4UU9B 1CFVH 2ICES 4NZRL 4JZNB 4YBQD 1HHGB 2AJSH 1FNAA 3UTTE 2AGJL 1QR1A 5GS0D 1MFAL 4LPXA 4MJIA 2AEPL 1RJCA 3X11B 5I73C 2C1PB 5EA0L 4N1HB 1F6AB 1LO5B 1MCBA 5B3NA 1U3HD 3B9KA 5AZ2L 3MGTB 4PTUB 5JXED 3QUYC 4X98A 2W60B 1IC7H 1J0HA 1AD9A 1CU4H 4YUEL 4OLWL 5IEHA 2PW2B 2OTWA 2E5EA 4YXHL 4ORGA 4OZIA 3MV11 4ZUTA 2XYCA 1MFEL 4PRHE 5I1KL 1K2DA 2AJXH 3GM8A 1I1YB 1OAYL 4W4NA 4N8VB 2NY4C 1AGCB 3DHMA 1KB5A 4G9FD 3IDYC 4C56D 3FMGH 1GAFH 4D9QD 1F6LL 1CD0A 2ID5A 1PAMA 5HDQH 3LN4A 3MLWL 3HHRB 4WUKH 5IFJB 4GLRI 3WL9A 3VWKD 2VAAA 1A14H 5IFHH 3PDOA 3S5LG 5JW4Q 3C2AL 2IBZX 5C1MB 2NY5C 1WGOA 3NFSL 1TCMA 4UNTA 4WHTB 4LCYA 1R5IB 2AW2A 4I18C 4BH7B 3JBG7 1NDMA 4JDVA 5E08H 4K3EH 1QQDB 3S96A 4X9HA 3ARBB 4X6FB 1A21A 3C09B 3TNMB 3T0EA 1C08A 1SEBA 4J4PA 1MEXL 3KS0H 1EAPB 4Y1AE 4PRHD 1YN6B 1WTLA 2C4FU 3B43A 4I3GA 5BS0B 5CGMA 3QXDA 4P57B 4HGWA 5GGVL 3L1OL 2ERJB 2YD3A 1FORH 4GBXC 3TWCH 3RFZC 4HS3B 3I85A 5FGSA 4R2GD 1N5YL 2DWEB 4Z9KB 3ZDZE 3IB4A 1P2CA 4NC1C 4EI5D 4MQ7B 1W8OA 4QRSA 1UT9A 2VO5A 4ZD3H 3E3QC 4J3XA 5I16A 1NCUA 1JBJA 4WO4C 5HHVH 4POZD 3DVGA 3BI9X 4MXVE 4JN1L 3MOBL 2CKBA 3GHEH 3FO1B 3PHQB 2YKLH 4OZHB 3CFKB 1BVKB 3AREB 1SJVA 3LB6D 1OSZB 2DQIL 4GW5B 5JW5B 4APQC 1FNSL 2J6EA 3BXNA 1SEQH 5FYKH 3DNKA 1QFWL 2Z9TA 3ARGA 3E6HA 4Y1AD 4TUJB 1U8OB 1DN0A 4NQVA 3UYRH 2H32B 1I1AD 4R4BB 1NGPH 2ADJA 4MHHG 4AY0A 3RWJA 4R8WL 3O4LA 2FEDC 3HG1B 4HUUB 1B2WL 3TZVA 1MSPA 1U6AH 4MA7H 3ULSB 1J12A 3BKCH 3IETA 5TH2A 1HWHB 4D9RE 1KCKA 1ZVHA 4RFNB 4XHJD 1VGKA 3QEUB 1WT5A 1S9YB 1JYWA 3UTPE 4XVJH 2EH8L 5H8DA 1UA6L 5DJ6A 1W0VA 4I77L 4MDIB 1D9KA 1XR8B 2VKWA 3KJ4C 3LDBC 1LO0H 3EO9L 5LAXA 3MJ9H 3NZ8B 2ORBH 3R06A 1KLUB 5TF1L 1NCWH 1F3JB 4K9EL 1QSFA 2X1WL 3OAYH 1T0NB 3PV6B 4N8CH 4FQXB 1FIEA 4F7PA 2OK0L 4L9LB 5C0AE 5EU5A 1RAMA 2I26N 2HRPH 4L4JA 5JMOC 1A9EA 1JTTA 4ONGL 4YHYB 1AGDB 3ZL4L 1GOFA 4JB9H 3SE8H 5CWSA 2VABA 1PKOA 1KCUL 1MCLA 3PP4H 4AMKH 1A3QA 3NOIA 4WHYG 1RK0B 4D9RD 1BGXH 4NCDA 1T1ZB 1DJSA 4HKBA 1KXQE 2JKXA 4YHLH 5T33L 1PLGL 1MFNA 2R29L 3V5KB 4MAUH 3RWCB 1PEZA 3HZMA 4PYHA 4DEPB 2ARJQ 1A2YB 4Y5XB 3I6LE 3P3YA 4XMPH 3FTGA 4A6YB 4LIQE 1G9NH 3KAAA 3A6CL 1YEDA 4DVBA 4J3UA 3E2HC 5ISZE 4GXUN 4GG6A 3VG0H 2R4RH 5IV2B 2BNQD 3KPQA 3D3VB 4JY4B 4LSRH 2R1WA 1UZ8A 4D0CB 4WFHE 1U8IB 4PJCE 5JW4N 2MJWA 1FGVH 4I9WE 1DBBH 4G3YL 1U58B 5E8EB 5E1AB 1FVDA 5DVLA 1CLYH 3KPPB 4LP4A 4O58L 4WEMB 3MBEA 5ACZA 1KBGH 5A2LH 5IFAL 1HEZB 3NFPA 4MD5A 1UXWA 2J12B 4DKFH 1JWSB 1OPGH 5GIRA 4ZDHB 3GSNL 4NQDE 2FX7L 5J3HD 2X1QA 4MJ4A 5FKAA 3BEWB 5EU3B 1N2RB 2YK1L 1FGNL 1S9WB 4I0PD 1BM3L 4YXKL 5SX4I 4ERSL 4WUUB 1NJ9A 1RZJH 2X1XR 1YPZE 2FBJL 1PBYA 5HYSB 2X41A 3I6LD 1RURL 3CXDH 4BZYA 4NHCH 4RX4D 5DUML 5C0NC 1RJZB 5KTEH 2DJSA 3HA0A 2NX5A 5ISZD 1OF2A 2IPTL 5TF0A 2E9IA 1IKNA 5C2BH 3B8SA 3QJHA 1UJ3B 2RB8A 3ARPA 3EYUH 5I1AA 4LLMB 2ZNWA 2CSPA 3BX7C 2VE6B 4JFDE 2COQA 5EUOF 1TCRA 2X4PB 3KPRA 3F12A 2VDRH 3FQTB 5MP6L 1QP1A 2UUDK 5AWNL 4JZOA 1HHIA 5DMGC 3ZHKA 1EHNA 3CK0H 2F54E 4HK3N 4NT6B 4PS4H 1MJ7H 4NQDD 3OKYA 4XAWH 1AHWB 5IW1A 3RZCA 1MI5E 2UVFA 3B4NA 4GW4B 3RWIA 2HYMA 5HHOE 4LCCC 1DEEA 3LRSA 4PJ7B 5DFVD 3OAZH 1NGZB 3QFDB 1E4WH 5IG7B 1ETZA 2PTVA 1CLOL 5D96C 1N0LA 5DK0A 1CG9A 1KEGL 3TT3H 4YDKL 2RBLA 1Z9LA 3DURA 2XPGB 3VXTA 3MODH 3O8XC 1G9NC 5HYJB 4TNVK 2Z8SA 3QIWD 3JTTA 4MZ2A 3A6BH 4S2SA 2X70B 4OM1L 2X4UA 1AD0A 2M1KA 1S7SA 4QRUA 1HILB 4L29B 4JFDD 4J6RL 4NGHL 1RU9H 5CZVL 5CP7A 3T4YA 1LP9E 4KVNL 2DM3A 5DK3A 5JLZB 1G7QB 4XP9H 1I9RH 3MRRA 2F54D 2ZG3A 5JOPD 2DQTL 4GH7B 4E41B 1C16B 5CAYB 4L8DB 2BY2A 3Q48A 5AUMB 2VDMH 4KDWA 1MI5D 4Z76A 4JFFD 4LSVH 1YNLH 1R3JA 2Z8WC 5HJ3A 4H20L 3X3FL 5HHOD 3SDDA 4YHKH 3MROB 4LKXA 4Y8DC 3RU8H 4PTTB 1CIUA 4XPTL 4OIIL 3PL6A 5JHDE 1OAKL 4CMMA 3ZYIA 5CBEB 2DRUA 3WLWC 2ZSVB 4Z6AT 3DRQB 5LJYH 3UXFA 1S78D 3BE1L 1M6OB 1RZJC 4TQEL 5FUOL 2WAHA 5HGBA 5CSGA 4MCYA 2BNUB 1QBML 1K6QH 5F71A 3TM6A 3WIFB 3QSKB 3FKUS 3LQMA 1AKJD 3K2UL 4O4YL 5GRJH 4YC2B 4M43L 5CIPB 5ENWB 5T1MB 1X4YA 2JF1A 2C9AA 4MYWB 1VENA 3OKNB 5HYEA 5AYQA 1KCVH 1ZA6B 2NR6D 4MB4A 4LFHG 1HHGA 3IRZA 4X5XA 2D0HA 3UTSE 1T66C 4QTIH 4F9LC 1BFOA 4K3JL 4F37K 3VFOB 3QFJB 4O2CB 3WO4B 1ORSA 1SYSB 3HRZB 3IKKA 2IH3B 2R2HB 3X11A 5FV1L 1FSKC 3IXTA 3TN0C 2X42A 1LO5A 5J11B 3GMQA 4TUKL 1U93B 2EYTA 4NKOA 4XWOD 1EUUA 5JHDD 2EZ0D 3SCMC 3U79A 2F5BH 4E42B 1QFPA 5IVNA 2IQAB 1DFBH 3LV3B 3X13B 3PHOA 1GZQB 4JG0H 3EOTL 1TJHL 1OGTB 5J6GB 3KLSA 2PR4H 3VA6A 3L3JB 4M00A 1I1YA 1KIUA 3W0WB 3G6JF 1I7ZA 4N8VA 1J1OL 1I7UB 1RIHL 4QHUA 2XY2A 2ED7A 4NWUL 2H8PB 3AS0A 1S8DB 2Z31C 5ANMB 1YEKH 3UTSD 4OBSA 1J0YA 5EOQL 4EDWL 2O26U 1WAAE 5TDNA 1HSBB 5ICXA 2OTPA 4Y2OA 5IFJA 3X17A 4JQVA 4NOBA 5GGRB 1VKXB 1T7ZA 4IMKA 1SHMA 2E6JA 3D25A 4O51A 4AEIH 1S9VB 2LU3A 5CJBA 1QRNE 3VFTA 3QDME 3MOAH 1LEKB 1X5XA 2QLVB 2R9HD 5HI4C 4BH7A 5TE6L 1Q9KB 4JFEB 2XNAB 5I2IA 4WGWB 4X6FA 5GGTL 4Y4FD 4S1SH 1U8HA 3MYJA 1G7IA 2CXGA 3LQAH 1CLCA 5KZCB 1UVQB 3QUZC 3MMEA 3ZTNL 3NCJL 1AR2A 3KNBA 3F6IA 5MHSE 1L7TL 2CJUL 4J2XA 3I84A 1HH6B 5JDJA 4P2RB 3C8DA 2DWEA 3C5ZD 4KWUA 3KWWA 4FN0A 1CTNA 4MQ7A 5FYJL 3LPFA 5BRZA 3DETC 4JPVH 3PWPA 1HOCA 4XP6H 5FM5M 3BDXA 3CFBA 1ZHLA 1ZHKA 5IJVB 4F7TB 3D2UD 4OT1L 3NIDE 3PHQA 1I3GH 2DS4A 4NIKB 5C0FB 3LHPL 4LSQL 2V2TB 1BVKA 5CMAA 3EJZD 4GW5A 3O0RH 4AK1A 1GPOH 2IFFH 4YIQA 1NFDB 2G2RB 5F93C 4D94A 3V6OA 1JPTL 4XAKE 2FGZA 5L7XH 3CVHA 2H32A 4P49A 2IAMC 3HFML 4LASH 5MHSD 1JGLL 1A7PH 4R4BA 3QPXL 1QFUL 2VSDA 3N85L 3QWOA 4D0DB 5IB2B 3EDFA 5FUCC 2APWA 2DTML 3VW3L 3WKMH 1ZSDB 3LS4L 1TQBB 4NJ9L 4X9BA 5DS8B 4HUUA 3HZVA 4PJGF 3QJFB 2WBWB 4DKDC 4L3EB 2QADB 4S1RH 1L9MA 4AENA 4MNGA 1IGFL 2WINB 4OUOA 5E8NB 1S9YA 1DVFD 3GSNB 3V4UH 2AJUL 1YNKL 3A6OA 4NP4H 1XR8A 4HFWB 4WU5A 2HN7B 3WN5A 3O3UN 4YDLB 3NZ8A 4NN5B 3GIZL 1XH3B 4CADA 1MNUL 5E99L 1KLUA 2HLFD 1F3JA 3B9KD 4XAKD 3T3PE 5LG1A 2ED8A 5MERB 1VDGA 3U9PH 5DTFB 1T2QH 1V3LA 4I48B 1MCHA 3M1BB 2NLJB 1UXSB 1H3TA 1WBXB 3VXRE 5DI8B 1V8HA 1M71A 4P9HH 5FA3B 4XCCH 2IPKB 3B83A 3T65B 1JF1B 4XP1L 1SJEA 4M6NL 3I2CL 3QAZB 4KXZI 1P5VA 2ZCLH 2AKRA 5C0GB 2KZ1B 3TYGL 3RWCA 1OP5K 1Y18B 4PY7B 3QG7L 4MCZB 4ODWA 2LVCA 4Y5XA 3RNQA 2XXMB 4LU5H 5E6ID 3VDBA 4OM0H 1IM9B 4H26B 3U83A 3TO2B 3FFCB 2HVKA 1FLRL 1CICB 3D3VA 2VDPL 3QPQD 4D0CA 3RTQD 2C3WA 4FXGA 1DQMH 1EZVX 1U58A 5D5ME 1U0QA 1PSKH 3KPPA 3QH3B 3VXRD 1B90A 4ZXBA 2BSSB 2H26B 5F8RC 2N56A 3VFNA 4F7CB 5SX5H 1A6ZA 1HEZA 2Q8BH 2KL6A 1F4WL 4KKCC 4ZDHA 4U0RC 4UQ3B 2XICA 3IDNA 3BEWA 1LE9B 5D7LE 1N2RA 3FQRB 4F2MB 2Y4SA 2QQNL 5MENB 4PJDE 3AMKA 4WUUA 2Y36H 2R2EA 5ESQB 5HYSA 1N64H 2BFVL 4YEEA 2WIMA 3ZKNC 3FB8B 3KDMA 4LMQI 4ZS7H 1NL0H 3UTOA 3KJ6H 1Z3GH 1KJ2B 1A1MA 4OLUH 1JF5A 2EC8A 1F00I 5I18L 3O45A 2VE6A 1ZXQA 5HSFA 4Y2DB 1RUKL 3HC3H 4QOKE 3DSFH 3F7YB 2D3VA 1QFOA 4ODUA 4K71B 3FQTA 1TPXB 3VXOA 3BPCB 4I4WB 2C1OA 2HJFB 5DQJB 5IBUB 1T7VA 5K59F 4P9HC 3GMPB 4P4KB 1P69B 4V1DE 3RVWC 1BJ1H 32C2A 1NAKL 1OTTD 3CC5A 3NZHL 2X1OA 4GXVL 5I1IL 1AHWA 3U0WL 3ES6B 3HE7B 4LCWB 2VC2L 3OGCA 2YRPA 3O4LD 1ZTXL 2IBBA 4PJ7A 5EUOA 5I8OL 4ZG1A 1G6RL 3QI9D 3NGBC 4YBQC 3WFHB 4IIQA 3AY4C 3NACL 5IG7A 1LDPL 3DX9A 4IMLB 4J3VA 3EFFB 3T0XA 1D5MA 4QRRA 1T5XB 5IVZB 4BFEA 2E7LC 2CLZB 3H9SB 2XPGA 2NTFA 1ONQB 1A6UL 3VWJD 5HYJA 3T77B 1X5FA 3ARFA 5GGUA 5JA8B 3BYTA 3IU4H 2B1AL 4JREB 3SQOL 5GGQH 3BUYB 4RGMC 3NPSC 4KKAD 4QCIB 1MWAL 1HILA 1U3HC 4KKBC 2ATPB 2YRZA 1CDIA 3MRBB 1BQLL 1T2JA 4QOKD 3QHZH 1BIIB 4PJEE 3WS3B 1EIBA 1YJDH 2BRRH 2A0LD 3BKJL 4JQIL 5IJKA 1CFVL 1G7QA 2YD5A 3U48A 2D9QB 3SDXE 4JANB 1BEYL 4PLKD 3CU7A 4E41A 4V1DD 1OGAB 1A6VL 1A1NB 3JV0A 3K4AA 5AUMA 2BSTB 4X6EA 2Q6WB 2GK0A 1D5BB 5EZLB 5KSBE 3MROA 1QSZA 4OIBA 3V9FA 5J12C 1DQDH 1NMAL 2V5YA 2DQJH 5E70A 3ILPA 1WLHA 2R39A 1FP5A 1U42A 3RBGA 2NY2D 3MLXL 1IGCH 1XF3A 5HVHC 3RUGB 1EEQA 3VGHA 3OKLB 5IW6A 4K07A 2VSCA 5T1MA 4KI5D 1L0XA 4LGPB 4GRWB 2P5EB 4NQEA 4NSKB 4P23B 4FZ8H 3JVGA 3F7VB 4Q6IA 1G7MB 4EIZC 3CMOH 5IOPB 3QFJA 3HRZA 5EG6C 4U31A 2R2HA 1IC5H 7FABL 3BH8A 3DX6A 5FHBL 3HNSH 4WUKL 3VD4A 1WIUA 4M7KL 1T5WB 4GAYB 2NPLX 3HAEB 1J86A 5A16A 2X4NA 2OZ4H 4Q9RH 3TH4T 1U93A 1BX2A 1PY9A 5J1AA 5IESL 1BMGA 5KSVB 2XKNB 1CFTB 4E42A 2IQAA 3QO0B 2XN9B 1DANU 2OTUA 1J87A 3ULVH 3BPNC 4EI5C 3ECBB 2R56L 3X13A 3DO7B 5GISH 5J57B 2LE9A 4Z7VE 1GGTA 3UEZA 2CUMA 4POZC 4UV7H 4ACPA 4XT1C 5DQDL 3PQYE 1TZHB 4W4OC 5GSRA 2FB4H 1RK1A 3EFDH 4MS8C 3INUH 4ZUUA 5DHVB 5IBTL 4KVCH 1NCTA 3W82A 3VXSB 5IHZB 1YJDC 3LB6C 2ENYA 5IHUH 5E9DE 3S5LA 5GGRA 5DZNA 1UEYA 2X89A 2OJEB 4OJFH 1CIDA 3C60B 2NZ9D 2ARWA 5IR1B 3T0BA 2VLKB 4QNPE 4DUXA 3RWDB 4L8SC 1GOHA 2DQGH 1Q9KA 4NN6C 4PJ9B 3VI4F 3LS5H 2Q1EA 3BVNA 3VGFA 1KCSL 4X6CE 5JR1L 3ZE1F 1WZLA 3RWGB 4QXUL 5K93A 1UVQA 1OAQL 4Q9QH 4XHJC 4KV5E 2YC1A 4A2LA 4DGVL 1KYOJ 4XH2A 5EC2A 3U1SH 3PQYD 5KVDH 3WS6C 1GJIA 4WW2C 3RGVC 5IB4B 1H3VA 4P2RA 2F8XC 4LRIC 1DUZA 4UT9L 1FPTH 2X2YA 3L3GA 5KW9L 3JV4A 5GGSA 3VI3E 4RBPK 4ZPVB 3CLFL 5TQ2H 4JRXB 3TO4A 1ZT4A 1MPAL 4NZUL 1MQ8A 2WUCL 4JDZB 1E4XH 2VZ1A 5HD8C 2NY3D 3MYZA 4H25B 2K7QA 4DZBB 3ULUH 5IJVA 3IDMB 3MV7B 1V05A 1CDBA 5EBMA 4F7TA 3OKEB 1KXTB 3QEQB 2BJMH 5LGHL 4HLJA 5CZKA 1KLGB 1OY3B 3LMJH 5F89A 4JKLA 4XPFL 2M26A 3SOBH 2DM4A 3MA9H 5IW3A 2DQFB 2HH0L 3SDDD 2NW2A 4I3SH 4FXKA 4Y0GA 4O2FA 3V4PL 2PYFB 5DDHA 3O3EB 5H37H 4G7VH 5C09E 3IJSB 5DURD 5IB2A 1E6JL 1ZEAL 1HXYB 2NXZC 3CGTA 2HRPL 3RL1B 5DS8A 3GB7B 4F15C 2EDOA 3BZ4A 5KOMC 1MCEA 3NVQA 3QBTB 4RGNE 4UUJB 1ZHNB 1RFDL 5KS9E 1QLEL 1CF8H 2E7MA 2WINA 2VDKH 4MXQD 4QO1A 3PP4L 1J1XL 5E8NA 4MAYC 1K8IB 5B39B 5D1QD 3RHWF 3GSNA 5JIPA 1C12B 2WBJD 1MHCB 4CN4A 2HT4D 5C7XL 3LIZH 5I73B 1UKTA 1WVZA 1WZKA 5F7EH 4GSDH 3HNVH 1HQRB 1RUPL 3BN3B 4PJGA 4HH9A 5F7LB 2BNRB 4M1CD 3QUYB 1DEDA 1A7RH 1XH3A 5C6PB 4XMLL 1J1PH 2VQTA 4FQLH 1Z5LB 5IROC 4QHNB 3MLUL 5J3HC 5C86A 4Z78A 5CP3A 3HC4H 1T80A 4X7EC 4F9PA 5DF0A 4P3WA 5DD5H 5J1TC 5C09D 1UXSA 4ZTPH 5T3XL 5DI8A 1MRDL 1XCTB 2G5BB 2MSPA 2UUDH 3DX8A 5CD3B 1H3PL 2JB5H 2IPKA 2MPAH 2NY4B 5KN5A 3T65A 1FBIL 3IDYB 5J6HB 1X4ZA 3DHJA 3RVUD 5K9OB 2A77H 3HZKB 4WI9A 5CJ5A 2BOCB 5E4EC 5DZOA 3MGAA 5C0GA 3WIHH 5KSAC 4LPUA 4ELMF 4NM4L 4MCZA 1B0GB 5E8OB 3ULUC 3RX8A 3WMSA 2HLAA 4HS6B 2I9TB 3PABB 2AK4E 4H26A 4I18B 1JHTB 1A3RH 1ORQA 2RFXB 1A7QL 3SKUD 3Q0HA 1UC6A 1CICA 3D69A 2BVUA 3GKWH 1PG7H 1OT2A 5GGRY 1YEEH 1ZMYA 3OPZL 4FHBD 4JJ5B 2YUVA 3WIIL 5HGHB 1U8QA 1W72H 2XXCB 4QHMA 5BZDB 1FAIL 4TRPH 3GMRA 5CKAA 2BSSA 2DQEH 2YUZA 1TFHA 2CH8A 2D7PA 3TVMA 3VMNA 2YD8A 5ECJE 4GBXB 1EVTC 1G7LB 1NLBL 3QIWC 1ZT1A 4P3DA 3V79C 5DRNB 1NBVL 5DD0H 3FN0L 3SKNB 4F2MA 5T1KA 1DSFL 2LTQC 5TFSH 2DTSA 4OF5A 3HI6H 5BRZD 2NNAA 4PJ8C 4XPBH 4KK9C 2ZUTA 4UBDD 2PW1A 3FB8A 2AK4D 4LAQL 3VE0A 3QNYA 4NZJA 3BD4A 4X6DE 5LGKA 1IEBA 1S5IH 5E94B 4NN7C 3TT3L 1KJ2A 3LCYA 4KK6D 3W9DA 3EIFA 3AS2A 4OV5A 2ILLA 3K1DA 1BQSA 3HE6D 4APQB 4Y2DA 5LCVL 1F42A 1A7NH 5IBLD 2GY7B 1B88A 2CK0L 2QSCH 1IRAY 3BPCA 4I4WA 2GITB 1H15B 1MCRA 2HT2D 4F7MB 5C07D 3KPSA 4QXTA 2BCKB 3ARZA 4P5KB 2P43B 4DVRL 1IC4H 3F8UB 1R5WB 2CRZA 3OKOB 3HE7A 1A7OL 1K9TA 1M7DB 2GT9B 4KDTC 4HBQA 4R97B 1J18A 2NR6C 1KFAH 4HLZG 3WFHA 3P30H 4P4RA 2XWJA 3ZYJA 4PB9H 5AD0B 3MO1B 1T5XA 1KACB 3H9SA 4BSWB 3GMOB 5C0IA 3WXVL 4P59H 1I9EA 3X3GH 4JDTL 4YGVA 5LGJB 1CL7L 1WV7T 2GUOB 3GSVA 3KJ4B 4PRAB 3LDBB 5LQBH 4NJAL 4QCIA 4YO0A 3E1F1 3MRFB 1R3KB 2VN7A 4R9HA 5I0ZA 1A5FH 1RJYA 1BIIA 1MIEL 2P4AB 1QVOA 2R1XB 2QQKL 1XGRB 4G9DB 3EGSB 1OGAA 4XX1G 5FK9A 2D03L 1Z0NA 1QLFA 3M17B 3O6FC 2Q6WA 4WTZG 2YXMA 1D5IL 1D5BA 4K2UH 3S36X 4M02A 2FL5B 2O5ZH 3AROA 5GHWH 4YXLL 4CW1B 4HD9A 3QZWB 4KC3B 4TVPH 4W6XB 3A0OA 1S7WB 1OCWL 1GIGH 2CIIB 4R7NB 1P4BH 2P24A 2X09A 4RNRB 4LEXH 5EPMA 5GGTA 4HUXB 2EDJA 4JG0L 3U9UB 1BF2A 5F9JB 1CGTA 4ZTOL 4KTDH 1ZKAA 1IGIH 3H42L 4PG9B 1Q9OB 3E2HB 4GKSA 4IJ3C 1JGDB 2P5EA 2R9HC 4BYHA 4P23A 5ESVA 4XZUA 4PRBA 3MLVL 5DJAB 1IT9L 5DA0B 3B6SB 1G7MA 4Y4FC 4MD0B 5HTSA 2A74B 3WEXB 4FQIH 3ZTJG 1UZ6E 3ARSA 5EOTA 1MJJA 1MHPL 4HUWA 1F11A 4ZPTB 3DROB 3PWUB 1MREH 1T5WA 4JFYB 2L7JA 1IEAB 1AFVL 3MUHL 5SWZA 4JFXB 4M4PA 1CLZH 2Z8VC 3C5ZC 5EIQA 4R0LC 1CFTA 3ARXA 4QHKJ 2XN9A 1PEWA 4J1UA 1KB5H 2EDTA 1Q38A 4FABH 3DO7A 1SVCP 1II4E 3HUJF 3I3EA 3P4OB 3ARUA 3FJTA 4C55A 2F53B 1TZHA 4DGIH 4JKPH 1A6PA 5I1HL 2UYLB 1FNGB 3B9DA 1WFTA 1SBSH 5I1EH 5F7NC 3EJZC 3QEHA 1CXIA 1MCSA 4GQ9L 3JV6B 3MQIA 4S0TD 1KELH 2ESVB 2OJEA 4YE4H 3I02B 1MCNA 1AXIB 5FM5O 5IR1A 2VLKA 2QKIA 4LPYA 5K9JH 4ETYA 3QXTA 2VDNL 2VQ1B 4Q97A 5EBLB 2JB6B 2APVA 3RAJL 1WISA 5A40E 2P42B 5BOZG 4LCCB 4UINH 4ZYKB 3EYVA 2G60L 1D3CA 4HULB 4ENEC 1MJUL 3FB5B 5L2KE 3MRNA 4UIKH 5A3ID 1DVFC 3ZT5A 4JY6B 1PGRB 3OQ3B 3O8XB 5TE7L 5KVFH 2NZIA 4M5ZH 5IB4A 1FFRA 3G5VA 4X9GA 1L7IH 5D7JA 4HJGA 3BZDA 4FFYL 2VZUA 3ARFD 3G6DL 4G43A 1KPVB 4KRMB 2P8PB 2V17H 4OCSH 2VKXA 2PTTB 3FT3B 2HLFC 4HIJA 1J8HB 3B9KC 4JM2F 3PJSB 2ZCKH 4CVZB 1P4IL 5L9DL 1AQDB 4S1RL 4H25A 1OP5H 4NUJB 4ODTH 3MV7A 2J6EH 4U3HA 4X7DC 2YRLA 4M8VA 1FL3B 2E6QA 3SJVA 2V5MA 1YMHA 4HJJL 1FQ9C 2R4SH 2Q8AH 2W07A 4L4TE 2FJGB 1MH5B 1NUGA 3H9ZA 5CINL 1P5UA 1HHJB 5ALBL 3NCFB 4XVUD 1QZ1A 2MQ0A 3OG6B 1GXEA 2AJVL 3BHBB 4ODSL 4PJ5E 4D9LL 1I8IB 4RSVA 2PYFA 2VRAA 3BP4A 4OCYH 1EHAA 4HWBL 3Q3GA 1XZ0B 1U91B 3O3EA 4PJBF 5C0BB 5CEZH 3MZGB 3IJSA 1VACB 4RWHA 1U92A 2B7DT 3MRPB 1NBZB 4L4VA 1TQCC 3IFNH 5E6IC 3RL1A 3GB7A 4PJHF 4LGSB 4LHUD 1RVFH 4Y4HA 3TF7C 4XC3L 4DKEH 3I3DA 1GSMA 1LDSA 4NQED 3QPQC 43CAA 1P6AB 4FQPA 4CN1A 1CDJA 1Q94A 3MXWL 5IHBA 4HS8H 4UILL 3K74B 5DUPH 1LQSR 1RJLA 5KBNC 3FOMA 4ZFOB 4OV6F 1FSKB 1TVHA 2VLJE 3TN0B 3CMGA 4NUGL 3MRCB 4J4PC 5CCKL 1KGCE 2ZUVA 5GS0L 5D6CA 4K7PX 3QUYA 2QTEA 2YMXH 1WZ1L 3TPKA 4JPWH 1UKQA 3KXFB 4R90H 3FQWB 1KCRL 3D9AH 3SCMB 1M7IA 3SGDI 3BP6A 2YPLB 3OSKA 4OD1H 2A9MH 4WV1A 3SHSA 4PGEB 2APXA 3MR9A 1IVLA 3MRIB 5L6YL 2E7BA 2L4OA 4RQQB 4OF0A 2FJHB 4L5FH 4K7PH 1MQKL 3QDGE 4U1SB 4FTVE 1EHLH 5F8QC 3QCUH 5BMFL 4H1LG 1WITA 2A1WH 4KY1H 3OAUH 5CGYD 1JRHL 3E0GA 1EH9A 3PWNB 5GS1A 4ZO8A 4ISVB 2ZUQC 5K9OA 1PZUB 2Z31B 3TIDA 3L95A 3UAJD 3X14A 5TQ0H 3LKPB 2AQ2A 2BOCA 1Q0YH 2AXGB 1RQ5A 2X40A 4P3CL 1EEUA 3CX5K 5DVOA 4PRPB 4TYUA 5E8OA 1MCOH 2R0LH 1TLKA 3CFJB 1KGCD 3SE4A 2Z93B 4OCXH 1TXKA 1ZT7B 5FDWB 3PIQA 5IWLA 1G6RA 4I18A 4R6UA 2ATKB 1OTTC 1QR4A 1TTUA 3WFCH 3IDJB 4OCWL 1KIRB 4M4RA 5CJQL 4OF8A 1G1CA 3QUZB 1ITCA 4BH8A 1O7SA 4UDTB 5DYOB 3TZVC 3QDGD 4ALAL 4FTVD 1MWAA 2A2QT 4NNXB 4LQ1A 3L3HB 4XBEL 1LILA 5F21B 2GFBB 2XZQL 2YN5A 1T1XA 2EDNA 4PLJC 3OB8A 1L0YA 4IOSD 1G7LA 3SBWA 3VWJC 4N9OB 2FWOB 1HXMA 4KKAC 4MX7A 1JTPA 2ADFH 2YA1A 4WIQA 1G9ML 1KLFA 1D9KC 1WZMA 3MSPA 3QYCA 4XNQA 1INQA 3SKNA 1A4KB 1T3FA 4I2XE 3GKZA 2Z91A 3WDJA 4H5SB 1K4CB 1DUYA 3FT2A 1GYAA 3TO4D 4OQ1A 4HIHA 4MNQA 2C3HA 4FXLA 1XCQB 2X7LB 3QDJB 4XWGH 4PLKC 5TDPB 3IXAB 3OHXB 2NY7L 5C0JB 1NLDH 2QHRH 1EV2E 5HI3C 1P7KB 4LVNC 1I7RB 4QRTB 5CEYB 4JG1L 3IDXH 1J05B 2HG5A 4HKJB 1G9EA 3VFWB 4APQA 1QSEE 3HLAA 4N1CA 4AG4L 1LO3L 4ETQA 2IAMB 1I1RA 3WXWH 4P2QB 4HUMB 4LF3B 5KVGH 1NGQH 2D9CA 3BO8B 3MRJB 5JXAH 4LSUL 2DM7A 2YOCA 4ODHL 1KNOB 5DUBB 1QBLH 2VDLH 2HWZL 3DI3B 3OKOA 5J13C 2WNGA 5DT1H 1DBAL 4KI5C 1FL6A 3A67H 3S35L 4YHPB 1Q9LB 1LO4H 2GJ6E 1BHGA 3RA7L 2IGFH 4YUEH 5AD0A 4YQXL 4PJFE 4BSWA 3P9MB 1UH3A 1RY7B 2WMPA 3AAZA 4Z7WF 4K7FB 1BFSA 4GMTH 4PRAA 1L4IA 4YBLC 5IHLB 2PYEB 2BHYA 3QQ4A 1PX4A 3MRFA 1OTSC 1R3KA 2EXWD 4IOIB 3MBEC 4JRYE 3VFVA 2YS4A 3W2DL 3WSQL 4HKXB 4KTYA 2GSGA 5GZOD 2DQCH 1RZ8B 2XA8L 2I60H 1N7MH 4DW2H 3IU3A 1XGRA 3MLRL 4PJXF 4G9DA 5ADPL 5DRWA 3P11H 3LH2H 4PUBH 1N6QL 5I71C 4LLQB 4Y19B 4X4MA 1EMTL 4U33A 1YYMH 2VAJA 3U4EA 3VU2A 1DBKL 3NTCL 4YJZL 2CDEB 2ZOLB 3QUKB 5IGXL 1WWWX 2IG2L 1TZIB 2FL5A 2XTJD 1J11A 1JE6A 1HDMB 3L5XL 2GJ6D 4Q9RL 5K9KB 1WSST 4CW1A 4OCRH 1FYHB 2P46B 2VDOH 3EO1A 4R7NA 4RNRA 4X80H 1FRGL 4EXPX 3FQUA 3E6FB 3MLTA 2H2PC 2QV2A 1FL5B 4HUXA 3C87A 3QCTL 3U9UA 4QXGL 4EN3A 4U1LA 1H0DB 4UZGA 4PG9A 2ZUWA 4JO4L 1JGDA 4XP4H 4HPOL 3LVEA 4JRYD 4NM8L 3MNZB 5GRWA 1EO5A 5FGCB 1YEHL 4G80A 4Y5VA 4MD0A 1I4FA 1JNLH 5DGQA 3RZCC 1PKQA 3TCLB 3LKSB 3DROA 5SV4A 4G5ZL 4JFYA 4OZGB 2G75B 2ZCHL 1CDCA 4KK5D 3BUTA 1IAKB 5F7DB 1JFQH 2VZSA 5B38B 5I1JL 3FRUA 4DK6A 4U0RB 5GJTH 4W68A 4HQQL 3WFZA 5CSZB 2UWEA 5IT2L 5JDSA 2UZIH 3GIVB 1I9JH 3JUZA 2RCSH 3VFGL 4IRJD 4KHTL 3P4OA 1HQ4B 2P5WE 1G7JB 2Y07H 3DVIA 2AJZB 4E5XB 3HPJB 3B5TA 1FZKB 2AXJA 3ROLB 2HFGL 1GCFA 2UYLA 3ZT7A 4AYFA 1CD1A 4EBQH 5I30L 3W5NA 1X7QA 3MJ9A 3IDGB 3DI2B 1FNGA 4WU7B 5DMIL 5F44A 4OLXH 3DX7A 4LIQL 3VH8G 2X4OA 4QF1B 1VADB 3MJGX 3S97C 1JGEA 3UJIL 3QULA 1HCVA 1ROWA 3SDDC 1DQQA 3FAXA 4NO3B 4JEGB 3PL6C 1BZQK 2OL3L 4DQOL 1GGIH 3QHFH 3GNMH 4JO3H 4K23H 4U1KB 1I3RB 4NHUB 4QKXB 1QA9B 3V5HA 2QQLL 4YDVB 1L6ZA 4PPTA 3KPSD 5EU6B 1F4YL 3IJYB 4GG8B 4Z7UB 1WIOA 3NGBB 5TGBB 2FHCA 1WCQA 2P5WD 3C6LA 3FB5A 4K94L 3U7WL 1BD2B 2FCBA 2AABL 2A6IA 3LEYH 4Z0XB 5ID1A 3O8XA 2HT4C 1WEJL 3H7BA 3ALXA 4PJAE 4FFZH 3MBXL 3BKML 4YX2L 4XC1H 3D39D 2H9GA 2VXUH 4RGMB 3NPSB 3WE6B 4RFOL 1ZV5A 1U3HB 3J7HA 4M1CC 1KPVA 3R1GH 2P8PA 3CFEB 5IMMA 3VFUB 3KPNA 3FT3A 1NANI 2WBKA 1J8HA 4R96A 4X99A 1VFBB 3CLEL 4UT6L 3P0YH 1KN2L 5HYIA 2W9LA 4NUJA 1QNZH 3SE9H 3QIBD 3RWEB 3CFDA 3OX8B 3AU1A 2YBRB 2DI9A 1N26A 2FO4A 3ILQD 3CVHH 2DQDL 3BD5A 4K55A 1HHJA 2X4QB 3L3OB 4JM2A 3RVUC 4J3WA 5J12B 4U1JB 3CXHJ 3GEWB 1IE5A 1I8IA 1OAZL 4XBGA 4YH6A 1I8KA 2G9HB 4BELD 2F5AH 5C0BA 5HVHB 3ZHDA 5D2NC 3QR2A 1VACA 1F97A 4X7SL 2EDQA 1FZMA 1K4DA 3U46B 4ZSOE 4WI3A 4EDXA 1QACA 2YHGA 4BA8A 4NKDB 4JHZA 1ZVSA 5IMKB 1FVCB 1PX3A 2MPAL 4C4KO 1KT2B 1GZPB 1YEIL 2CMRH 3SN6N 4GRLA 1TTFA 4KHXL 1GGCL 4PJBA 1X5ZA 2AQ3A 1TVBA 3QCVH 3L6FB 1I8MA 4NKMB 4PRHB 2HTKD 3KYNA 5E2WH 4PJHA 5F97E 4NDMB 4LSPL 4AM0A 3KXFA 5FYJD 3SCMA 2R8SH 4FQ2L 1HI6B 4EI5B 4POYA 1BBDH 1VFOA 4FQHA 1IGMH 2HMIC 3MLSH 5I8KH 3TYFA 4RQQA 2ZP0T 3ABZA 1JV5B 1YC8A 4U1SA 3IJHB 1JHKH 4H1LB 2Z35B 2O5YL 3LRGA 3CZFB 1N8ZA 2A9NL 1X5KA 3MXVH 5JHLL 4CVXA 2V7HA 1F90H 4XCEB 4KK6C 2EDDA 3LKPA 2EEDA 3VI4E 2UY6A 1ADQL 1FG2B 3ZDZF 4GRWF 3MV8E 3HE6C 3O2WH 3P0VL 1FV1A 1TNMA 1MIMH 3LEXB 4PRPA 3ZE1E 3FB7B 4YPGB 2G5RA 2PXYD 4ELKB 4Z77B 1U8LA 2HT2C 3I50H 3M45A 2Z93A 4GMSL 1I1AB 1LEGA 1ZT7A 5CZXD 2PUQT 4GJTB 4C83B 3Q1SH 3BJLA 2ICEA 3OR6A 2WLYA 4X4YB 4N68A 4L8SB 2ATKA 3GGWA 4NN6B 4JM4H 1NGYA 2BVYA 1X6NA 2Y5TB 3IDJA 3L7FB 1KIRA 3TBWA 4N8PA 2BY3A 3G9AB 3JWDH 3V0VB 4UDTA 1WICA 1YUHB 25C8H 2CLVA 1UCBH 3DIFA 5ITFA 2FECI 2BY1A 4FNLL 5AEAA 1XIWA 4L1DA 4JPKL 4ZUSB 4OGXH 3RGVB 3GSOA 3VXQA 2LQRA 3FL7A 3EYFA 4PRIE 1Q0XL 3LSOB 3ARVA 3WN5C 3MV8D 3PGCA 2BVQB 4KGJA 4PBWD 1K4CA 1XF2A 1NMBH 1MRFL 5D71H 3F5WA 1XCQA 1HIML 2P8MA 2FD6L 5I0DA 1ND0B 5CHNA 3AMLA 1RIVH 3OHXA 5C0JA 5L88H 4LVHC 5FGBC 3T0WA 4QRTA 5C0RH 5CEYA 4J3SA 4JO2H 4G8FB 4PD4J 2AJ3A 4DCQA 3VFWA 4F58L 4QHLB 2ZG2A 4AIOA 1JMZA 4NZRH 5HPMB 2P1YA 2QSTA 5F88A 5FYJU 2UV3A 2AGJH 3HMWL 2BVEA 3FHAA 1HH9A 1KV3A 1MFAH 2W38A 2AEPH 4Y16D 1UFUA 2JELL 3BO8A 5EA0H 5IB3B 1FFOA 2NXZB 1KNOA 1GHFL 4M6ML 4PRID 5AZ2H 2FIKA 4F15B 3KS0J 4L4VD 1IBGH 4YHPA 2OP4L 2DOCA 4OLWH 1H9VA 2BNQB 5JPNA 4P5TD 1CZ8L 4Y4HD 4YXHH 4MAYB 1D5ZB 2CUHA 4XVSH 3P9MA 1MFEH 4MNHA 1AY1L 5I1KH 1OAYH 3NFNB 4QRPA 5I8EB 2WP3O 5LXGL 2PYEA 3UYOD 2GTWB 4XXDB 4ZXBC 3RVXD 2VERN 4M9OA 5DJ2B 5DQ9A 3S36L 5FYLE 4FP8L 4HWEL 4ZQKB 4LGRB 2LV4A 3JWDC 3MLWH 4OCLC 4C58B 1QHOA 2FLRT 5J4MA 4PJCF 3C2AH 2NY6C 3C5JB 3REWB 4NO5B 2LABA 3O3DA 4LLQA 3NFSH 1FYTD 3GMLA 2JCCB 4WTZA 4MA1C 3C2SA 5EU7E 1J0ZA 2CDEA 2ZOLA 5I1CL 5ISZB 1TZIA 1HDMA 5H2BB 1J5OL 3STBA 5TDOA 1IL1B 3MRDB 1XFPA 4KJQD 4PJXA 5KSAB 3B8YA 1T21A 3FQNA 1IILE 3P77B 1MEXH 3TBSB 2CGRL 2MMXA 4Y5YC 4JLRA 3GJFB 3E6FA 1YPZF 1FL5A 2KBGA 5GGVH 1I85A 3L1OH 1H0DA 5F3BA 1WC7B 2Z4QA 4JFPB 4POUB 4OIAA 1TMCB 4X0KB 3LRHA 2FNBA 5FYLD 4NQDB 1N5YH 5EOCL 1FH5L 3MNZA 4N0UA 3ZSSA 3W9EA 1LGVA 3P4NA 3BDBA 4XBPB 2RJMA 1KPUA 2MQCA 5HY9B 4JAMA 2VXVL 4U6XB 4IIQC 5A3IC 4RMTA 4JN1H 4DWHA 2BC4B 3MOBH 4LOUD 3QIWB 5IEKB 1F6FB 1VFUA 2FHFA 4GUPA 3ARFC 5EOCJ 2DQIH 4JFDB 4OSUL 5D7IF 2LTQB 1QFWH 4O02L 1HQ4A 1ACYL 4V2CB 3LZFL 4PJ8B 4ONOA 3DUUB 2AJZA 4Q0XL 4JFHE 1AE6L 3ROLA 1MUJB 5IJKC 4M7JL 3B9AA 4MNQD 3O41B 4R8WH 4NN7B 4Q7DA 3CH1B 3UO1L 5BS0E 1XAUA 4JFFB 5ACMA 3VH8B 1B2WH 4HWBA 1EFXB 5EUKB 3KGRA 4QF1A 1VADA 2VH5L 4K3HA 5KSUB 4M3KB 1KYOK 1R3LB 1TDQA 1LP9F 2V17L 1FN4A 2EH8H 1UA6H 5DJXB 3BGMB 4I77H 4MWFB 1IFHL 4NHUA 1CFBA 3HC0B 4TULL 5I8CA 4TSBL 4YDVA 5I1GL 1A6AA 1XMWA 2FYYB 2J88L 3EO9H 3D85B 3IJYA 1E27A 2VXTL 3MUGB 4DUVA 2W92A 3EDEA 3L3IB 1CK0L 5TF1H 2EIZB 1NC2B 3VFRB 4K9EH 1CXKA 1K5NB 2QBWA 5TGBA 1CR9L 1N5AB 3ARBD 3QUXD 2OK0H 4OZHE 3ZHLA 1CGYA 4PLNC 5M7QA 4JFHD 4U7MA 3FRPG 3JVGC 2V5TA 4Q6IC 3DRTA 4ONGH 3MREB 4XVTL 3O3AA 3ZL4H 5IVXB 1U8KB 2OI9C 1KCUH 2R0WL 3WHXB 1U3HA 4UQ2A 3ORJA 1UWEL 1B0RB 1NFIB 5D2LB 5JXEA 3CFEA 3VRJB 1T83C 2YPVL 5JHDB 2H2SD 4F57L 1WCBB 1HE7A 1XGQB 2HKFL 4TUOB 1VFBA 1DR9A 2Y7QB 2V2WA 5T33H 4ZOAA 1PLGH 2R29H 2V2XB 3HG1E 3RPIB 8FABB 3AVEA 2MWCA 1EERB 1MCPL 3TA3D 4NO0D 3RWEA 3O6FB 3A6CH 4N0FA 3EJYD 4G9FA 4C56A 1LK2B 4PIRF 2X4QA 1VHPA 1VB9A 3UAJC 4U1JA 1MJ8L 4JPWL 4G3YH 1MHEB 3AXLB 3VWKA 4LCUB 3HN3A 5FB8B 2IWGA 3BP5A 4O58H 3F62A 5C2UB 5IFAH 2XWBA 3CUPA 5EZJB 5I1DA 1AXSB 4U6VL 3UBXB 4IJ3B 3GSNH 3KLAA 1BZ7A 2FX7H 1B3JA 4EN3D 1T20B 1KT2A 4AIZA 3D48R 5BZWA 2A6KA 2PETA 2YK1H 4PRDA 5FUZL 1FGNH 2H1PL 4Y4FB 3HG1D 1BM3H 4YXKH 4ERSH 2X4RA 4YAQB 5IB5B 3F65A 2W1NA 2FBJH 3O6LL 2K1MA 4NKMA 4PRHA 1RURH 3HUJE 5CP3H 4NFDA 4U6HB 3GBML 4XMKL 2W9DL 3AS1A 4CAGA 2IPTH 1BFVL 1PVHA 3H0TB 4KRLB 1DLFL 2JK5B 3TBTA 3GUTB 3C5ZB 4D3CL 4R0LB 5AG8A 4MQTB 4K9EC 4Z7NF 4EI5A 5ID0B 5I17B 4FFWD 2EKJA 2J8UB 4RDQG 4WHYH 5BXFA 4NBYB 3FZUD 5MP6H 2VL5B 1N6UA 3VCLB 3TO4C 5AWNH 4H1LA 2Z35A 5MEPB 3CZFA 1B9ZA 4IDLA 5CSBA 3N1QC 4HG4J 2D0FA 1TIUA 4YHZL 4PP1C 3D2UB 4RIRA 1JWUB 4HIIB 1FG2A 3TLRA 4D0BA 4NYLB 3GZKA 2PN5A 1CXHA 5SWQA 4Y1AA 1CLOH 5IVOA 4G8EB 4ELKA 4Z77A 3EYOA 1KEGH 2PKDA 43C9A 4YDKH 4M03A 3TCXA 1I1AA 1OARL 4X4YA 1HZHL 4KU1A 1H5BA 3F58L 4L8SA 4WUUE 4KZDL 3CSBA 4OM1H 2L7UA 5E0QA 2Y5TA 3NIDF 3L7FA 2DM2A 4J6RH 4NGHH 4XNYL 5FIEA 4J23A 5CZVH 3HPLB 4PJIB 1P1ZB 3HNTL 4KVNH 3FT4A 1P4LB 4LLVA 1JPSL 1DZBA 5TE4L 4K8RD 4S1QL 4NNYB 3RVVD 1DVFB 3IAQA 4MSWA 1JUFA 3WS6A 2DQTH 3C6LD 3HS0A 4KPHL 4M62L 1QR1B 5B4MD 4X9IA 3SKJL 4MJIB 4UIMA 1DTUA 4YWGL 3X3FH 1R24B 4H20H 1KN4L 3O9WD 3LSOA 1G1YA 1I7TB 1KB9K 3PF2A 1ZS8B 4OIIH 4XPTH 5F1IA 1OAKH 3TIEA 1S7QA 3B9KB 4ZUVA 5K9QG 4X98B 5F6HJ 3BE1H 4R7DB 5D1XA 3WD5L 5T3XD 4TQEH 3OAZK 1AD9B 5FO7B 5FUOH 1T0PB 1HSAB 3S6CA 5L2JA 2VZ3A 2ZUXA 2OX5A 3TC9A 4OFVA 2BSRA 1QBMH 2OTWB 1ND0A 5E5RB 1U8MA 4F9PC 5GZNC 1U2CA 1KJVB 2OZ4A 3K2UH 4ORGB 4O4YH 4OZIB 4ZUTB 4M43H 2NCMA 4KMQA 1K2DB 3S8WA 4QHLA 2EYSA 1AP2A 4Y7MA 3H3BC 2XTJC 1KB5B 4MB5A 5EBWA 5CUSL 4JM2D 1ZGLM 3V7AE 3VD3A 2PF6A 1NGXB 1PQZA 5JNYB 4PY8I 5IB3A 3WL9B 5FA4A 1S5HB 3PDOB 1TQCB 1R0AL 5E6IB 3L5HA 4TUKH 1MFDL 3RTQB 1NDMB 4OD3L 3U30C 1D5ZA 3S96B 2ZWLT 3EOTH 4B41A 4GRLD 1TJHH 4X4XA 4Y8AA 3IS1X 3NFNA 1H3XA 1GOGA 1J1OH 1SEBB 2FSEA 1RIHH 3B5HA 4HGWB 3TVMC 4NWUH 3SDCD 5IROA 2DIAA 4DTGL 1OSPL 3TNNA 3DXAE 1N0XL 5EOQH 4EDWH 3QIUD 3VFPB 2Q3ZA 1UWXK 4I0PA 4V2BA 1XR9B 3ZMRA 3C5JA 1KTLA 5DJ8B 1AGEA 4RX4A 2JCCA 3O6KL 5I16B 1XGUB 5F7UA 5IMOB 3QFJE 1UQSB 3TJHD 1LD9A 3DVGB 5ISZA 4S1DD 1TITA 5TE6H 3DUSA 2ZUQB 5DMYA 2GTZA 3D1MC 5H2BA 1WFNA 2R15A 5GGTH 2EO1A 1IL1A 3F7RA 3NABL 4PJCA 3MRDA 4TOYL 3WDIA 3ARDA 3LKOA 3EDJA 5D5MB 4BKLB 3ZTNH 3TBSA 3NCJH 4PJDF 2UZIL 2CR6A 3GJFA 3BXNB 1BWMA 1L7TH 2CJUH 1YYLL 3NIGE 5DVNA 1V7ML 4UTAL 1DN0B 1NSNH 4JFPA 4NQVB 4RISL 5KVEL 3UZVB 4B0MM 4NQDA 1U8JB 2DQUL 3QG6A 2DKSA 3DXAD 2ADJB 1I9IL 3W0WE 3RWJB 5GQBA 5E56A 5FYJH 2WQRA 3O4LB 2Z92A 1NEZG 1YPZA 3RZWA 3TZVB 4NNPL 5ANME 5HY9A 2F58L 1BZ9A 5TH2B 5EDXA 4UI2A 2AEWA 3D0LB 2BC4A 1VGKB 1ULVA 3QRGL 4NC2B 1CN4A 1N3NA 3CCHA 4OT1H 3DUHA 3VWJB 2OJZL 1E4KA 2BX5A 1XIWD 4ZFGL 1JNHB 1AJ7L 1W0VB 4LSQH 1D9KB 2R2CA 1RMFL 3QT2A 4JFDA 4R4FL 4OTXL 5LAXB 1JPTH 5T1DL 1NUDA 1OLLA 5HHQA 3TH2T 1DE4B 4FA8A 1BLNA 4JFEE 3R06B 3DWTA 3HFMH 5C0CE 3DUUA 5KVMC 6CGTA 1JGLH 1BVLB 1QSFB 4W6YB 5JOEA 2F54A 1MUJA 4OD2A 3QPXH 1QFUH 3N85H 2DTMH 5EU5B 3VW3H 3BJ91 4DOHB 2KDGA 4NJ9H 1MI5A 3W0WD 5C0EA 3TBYB 1A9EB 3VH8A 5HHXL 4FS0A 5HHOA 1T6VN 4B5EA 3QQNA 5E5UB 5CWSB 2VABB 5IF0B 2B4CL 1OM3L 1HNGA 1IGFH 4BZ2L 4WTXA 3DBXB 4PJEF 2ICWJ 1TJIH 5DJXA 5EC1A 4QT5B 2AJUH 3BKYL 1AXTL 3GRWL 1CGUA 1S7XA 1YNKH 2DJUA 2VLMD 5CJ8A 3SDXF 3SDYL 3WHE1 5HVFB 1CFSA 4U1NA 3HI5H 5JW3L 1AKJA 3HZMB 1ZA3A 3JWOL 4Z7WE 5J13B 4Q74A 4UDUB 1KOAA 3GIZH 3L3IA 1QOKA 1MNUH 5E99H 1YEJL 2XACC 4JFED 2W65A 4P23C 4GG6B 5C0CD 4UT7L 3KPQB 2R1WB 1UZ8B 2UVEA 2YA0A 3PG2A 4PGCA 3MREA 1NFDE 2HTKC 1G0DA 1A47A 1KC5L 4HC1L 5IVXA 1ZK9A 1U8KA 3G5YB 1Y0LB 1HHKA 4XP1H 4M6NH 3I2CH 3MBEB 3VRJA 4MD5B 1T7WA 3NFPB 5JHDA 1C5BL 3B9EA 5GIRB 3ZKSD 3FQXA 2V2XA 3RPIA 2E8ZA 1JJUA 5FKAB 3MA7A 3ZYZA 4L3EE 5I71B 2AVGA 2EDXA 3N1PC 5JW4M 1NCDL 1ADQA 2MHAA 4TSCL 2PNDA 1F13A 1LK2A 1FLRH 2XQBL 1TZGL 2NX5B 3ZE2E 1XGTB 1OF2B 3UTSA 2NQCA 3R0NA 1FLTX 4ONFL 3TV3L 2W91A 3NCYP 3IFPB 4LCUA 3EW3B 5H35A 4P46A 3P9LA 5EZJA 1QEWB 4DAGL 3PE9A 3BRGC 1F4WH 1O0VA 4ODBD 1JI2A 1B4JL 4M93C 3NCCB 4JZOB 1HHIB 1T20A 2NY1D 4HFUL 4CVWA 2HTLC 2QQNH 4Y4FA 1TNNA 5IW1B 3RZCB 2GJJA 2YSSA 4L3ED 2QADD 5D70L 4RDQF 3RWIB 4AJ0A 5IB5A 3LRSB 3GSRB 2BFVH 4U6HA 3U7YL 1D6VL 2BDNL 1ETZB 4M6OL 2JK5A 3FO0L 2QEJA 3I50L 2XFXA 3C5ZA 4LSSL 4QNPF 4R0LA 3MLPA 4U6YA 4DUWA 3QNZA 5I18H 1MOEA 4H0IA 2C3VA 4S2SB 1HK6A 3JTTB 1WAAA 3RI5F 2WIIB 1RZGA 5D7JC 3UC0L 3W5MA 1AD0B 4LBEB 4QRUB 4X6CF 3FFCE 2VL5A 4XNUL 3VCLA 2AXFB 4M3JA 1QKZL 5MEPA 4KV5F 4PBVC 3T4YB 4RMWA 2FR4A 5AG9A 1X44A 4N1EA 25C8L 5JIIA 3QDMA 2PCPA 1NAKH 3RIFF 3NZHH 4GXVH 5I1IH 4HV8A 3U0WH 2VC2H 1ZTXH 3L7EA 5I8OH 3CDGB 1G6RH 4Z76B 3C5SB 1R3JB 5HJ3B 3NACH 1DQJA 1LDPH 3SDDB 4LPVA 1OAUL 1LHZA 4M7LL 1VFAA 1KCLA 3MV9D 4G8EA 1MF2L 4U6TA 3KHQA 5MENE 3VD9A 2B1HL 3WCYA 4Y16C 1A6UH 5T5FL 5DURB 1CBVL 5HGBB 2B1AH 4MCYB 1XGYH 3SQOH 1E28B 4AT6A 5EN2A 1MWAH 3QISA 4HT1L 3OG4B 3RDTA 1IM9D 3Q6GL 3QWQB 1BQLH 3D18A 1GRWA 1X5HA 4PJIA 4LHUG 1P1ZA 4MLIA 1LE5A 3FFCD 3BKJH 3MRLA 4JQIH 2BSED 4Y4HC 3ME0A 4NNYA 4FQQB 5ELIA 1DVFA 4X5XB 1BEYH 1BFOB 4C4KT 1A6VH 3NMEA 1ORSB 2ITCB 4OFYD 3MX0A 3PWLA 4B53A 1R24A 2IANE 3IXTB 3RVXC 2VL4A 1EEYA 1I7TA 3IS0X 4WVRA 1ZS8A 1IAMA 1NMAH 3GMQB 4IEFB 5E03A 4R7DA 2EYTB 1IBGL 5KS9F 4KMTL 4NKOB 4LCWE 5I75C 4OFIA 5FO7A 1I3VA 3QXWA 1HSAA 3MLXH 3OL2A 5C09B 1Q9WA 3V95A 4HEPG 3OXRA 4F33A 1KJVA 3PHOB 4WV1C 5BVPL 3RWFA 4XVSL 4NBZB 1OT1A 1NDGA 2YZ1A 4P5MA 4M7ZC 3BZFB 1I7ZB 3BT2L 4MVBD 4QHUB 4Z7OE 5GS1C 4LLYB 5ACLA 3LAFA 2J4WL 4U1IB 4Z7UF 4KJQC 3ARQA 1NGXA 3UTTD 5JNYA 2VDQL 5D2NB 7FABH 5FHBH 5TDNB 5ICXB 1QRKA 1S5HA 4M7KH 4W81A 2R1YB 4LL9A 1E4XI 5E6IA 3I9GL 2IAND 3D25B 4O51B 5IESH 1EAJA 4YLQT 3CVIL 4P4KD 5HYFA 3VFTB 3SE4C 5IWLC 2B20A 1P9MA 3RY6C 3RTQA 1LVEA 2MTPA 5GS2H 2R56H 5I2IB 1CDYA 2DLHA 1U8HB 1KG0A 3VXRA 3MYJB 1M7XA 1CGVA 1G7IB 4WI6A 1B4RA 4KKLD 5DQDH 3HB3D 2X4SB 3MMEB 4HJ0C 3KNBB 4G6KL 4X8XA 3RUGE 5BQ7B 5CJOL 5IBTH 5DHXB 3B3IA 4UOW1 5SWSE 3SBWC 2CD0A 3VFPA 3KWWB 1XR9A 3SPVB 4GRWE 2P5EE 4WY7L 5T3ZE 2RIKA 2AEQH 3BAEL 5BRZB 5DJ8A 1NFKA 1CD8A 3PWPB 1HOCB 1XGUA 5IMOA 4LNVA 1UQSA 2CLRA 3SKMA 1UB5B 1X5LA 3CFBB 1ZHKB 1ZHLB 1TVDA 1CYGA 4NWTL 3EOYG 1KCSH 3HE6B 5JR1H 5E2UL 4QXUH 5D5MA 4BKLA 4UOJA 5CMAB 1OAQH 4DGVH 3LKNB 1YQ2A 1VEPA 4OLVL 4YGAB 4YIQB 15C8L 1A3LL 2GK2A 2OMNA 2DI8A 2D4DA 4HUNB 5C07B 6FABL 3CVHB 4XB8A 4MB3A 1U8JA 4UT9H 3WBDA 4X6DF 2WW8A 5KW9H 5C71A 4LEOA 1RUML 3LD8C 3QWOB 5SWSD 5D7LA 3CLFH 2O5XL 1MPAH 4NZUH 3QI9A 2WUCH 4PJDA 2MQ3A 5T3ZD 4OKVB 3HZVB 4JY5L 2EC9T 4R97C 4WGVB 4Q9CA 5F70A 4AENB 3QUXC 2YUXA 4BFIB 4MNGB 3D0LA 3VXSE 1EUTA 4YDIL 3VWJA 4ZAKA 1JL8A 1JNHA 5LGHH 4WU5B 3MRMB 2B0SL 1HHHB 1YEFL 4XPFH 3WN5B 2VLKE 4QOKA 1HNFA 4XGZA 4XNZC 2HH0H 4CU6A 4UV4H 1DE4A 2WP3T 2SEBA 4CADB 3V4PH 4Z5RA 3SE3A 1UYWL 5DC4B 1BVLA 2OM5A 2Y6SC 4A2MA 5D1XD 2GSIB 4V1DA 4WFEE 1E6JH 4N0YL 1ZEAH 4LVHB 4BZ1L 3ZT6A 4JGUA 3G5XA 3DV4B 4NRZB 4R3SA 3TBYA 3EJYC 1M71B 1T0MB 4KTEL 4ZNEE 1UGNA 5IF0A 2Y25A 1RFDH 1QLEH 4XPAL 1JZ8A 3DBXA 1IKFL 1SJEB 1J1XH 2VIRB 2AERT 5EZIL 4YHML 3VXSD 4QT5A 5C7XH 4JRXE 3CDCA 1UM4L 2AKRB 1DN2A 3H3PL 1S7TB 2XT1B 4LRNL 3UTPD 4HUVA 1RUPH 4XNXL 1QSVA 3GJFK 3WUZA 2HJKB 4ODWB 4UDUA 5LVEA 1DL7L 3RNQB 4WW2F 4YHIA 4XMLH 2BOBB 4EN3C 3MLUH 5DD1L 4WWKA 2W0KA 2BVPB 2R23A 3QEQE 4WW1A 1CVRA 5TJWK 2HVKB 3UBXI 3SDXA 3JTSA 4I0CC 3FRPA 4CU8A 4HWNA 1OVZA 3L5WB 4Y5VC 5T3XH 4RGOH 3GFUA 1MRDH 4FXGB 4WFED 5C0AD 1H3PH 1MFBL 3DGCR 3H3KA 2GY5A 1FBIH 3G5YA 1Y0LA 4MJ6A 4ZXBB 3BYYA 3UDWC 2E8YA 4OF3A 5KSBA 5J1SC 3VFNB 3QNXA 4PGJA 1F45A 1A6ZB 3CXHK 4YDJA 4NQCE 5HHNB 3GI9L 3THML 2RR3A 3IDNB 4FFWC 1JGUH 1P7QD 3QWRD 4JRXD 4NM4H 2NY6B 5BOPA 1NGWA 3ULVF 5FHAL 1UZ6F 3FZUC 2D7NA 1MELA 5CD5D 2VITA 1KEML 1SMOA 2R2EB 4MA1B 2DI7A 2W0LA 1A7QH 3FHQA 5DEFB 3T2QA 3KDMB 3O4OC 1GC1L 1XGTA 3V8OA 3QEQD 4M61A 5JQ6L 3OPZH 1A1MB 2BNRE 1JZ7A 2FIRT 3IFPA 3WIIH 4WFHD 3O45B 1FAIH 1KIQA 3HI1A 1EO8L 4Y5YB 4I9WD 3ARDD 4HXAL 3T2PA 1UM6L 4D8PA 1QEWA 4ODUB 1IGJA 4H88H 3VXOB 2JJVA 2C1OB 1NLBH 4JFZL 4HZAA 3PWJB 1NBVH 4NQCD 3FN0H 1OTUD 3JUYA 32C2B 3CC5B 3NBNA 1DSFH 2R0KL 3V52L 2EXYD 1ZHBB 5D7IE 3OGCB 5ILTL 4Z7VA 5EUOB 2BRQA 2J1KA 3GSRA 1X6LA 2ADIB 4IIQB 3RVVC 3PQYA 4LAQH 1F5WA 1PJ9A 3DX9B 3C6LC 4MJ5B 4X7TB 3GBNL 5B4MC 1D5MB 4QRRB 3BP7A 1UACL 2NTFB 3N1GC 4H0HB 3ARFB 4FFVD 4MZ3A 3O9WC 2Q76A 5GGUB 2RHEA 2WIIA 5I1LA 4IRSD 5LCVH 5E9DA 3L3DA 4LBEA 2CK0H 3I3BA 2AXFA 4N5EC 2X6MA 2EDLA 4N5UA 4AEHL 3OJMB 4RA3A 3VXNA 5H94A 3ULUF 4DVRH 4CDHA 5JMRA 1UM5L 2DD8L 1JGVL 1A7OH 1A6WL 2NY4D 5F72S 3CDGA 4X6EB 5JORA 1FFPB 3RKDD 1MRCL 2GK0B 1YNTB 3C5SA 5E2VL 2DLEA 4JZJB 2HJLA 1H3GA 3I6GA 3KPTA 1JZ2A 4G8GE 4JM2C 1ES0B 2FH8A 3K80A 3WXVH 3AB0C 3ILPB 4JDTH 4OGAC 1CL7H 1C7TA 3E3QE 5HHMB 1XF3B 1E28A 4NJAH 3ZKQD 1Z9MA 3BW9A 3RP1A 3T1FA 1T03L 2ED9A 5IW6B 2YUWA 1MIEH 2A6DA 4K7PY 3MCKA 4NQEB 2DWDA 3UMTA 1CXEA 3UTZA 2DLFL 3SKOB 1UWXH 4FQQA 2QQKH 5D1QA 4GRLC 2WBJA 4Q6IB 3MGOA 1F3DJ 2RQ8A 2OXHA 2D03H 5A1AA 2ITCA 1U3ZA 1LO2L 2B2XL 4PGZA 4FMKA 2OI9B 3BH8B 1RZKH 3DX6B 1D5IH 5EO9B 5FEBA 5HYQB 4C59B 4RFEA 5EWIL 1JZ3A 3SDCC 4F3FA 3VDCA 5A16B 2X4NB 3CFCH 5LBSL 3HKFA 4YXLH 1BX2B 5J1AB 4G8GD 3WKNA 1FO0L 3QIUC 3U0PA 3NA9L 2LAGB 4YHOH 4RCAA 1OCWH 4WCYL 1LK3L 2OMBA 2OTUB 5C09A 4JHWL 3T8XA 3QQ9D 3RWHA 4GAGL 1BF8A 4WO4D 3GHBL 1VGEL 3G9VA 2XA3A 4ZTOH 1JHLL 3H42H 3BZFA 2CR3A 4LLAA 4RMUA 3TJHC 3U0TA 5GSRB 3MLVH 1IT9H 5KS9A 1RK1B 4LLYA 4U1IA 4ZUUB 1MHPH 4HLZH 5D2NA 3VXUE 3ET9F 3OV6A 3S5LB 4ZNCD 2R1YA 3BWAA 1YDPA 3G6JB 3OR7B 4DKAA 4P46D 5DRZB 1AFVH 5DLML 2EDYA 4TNVF 5GRVL 3RQ3A 2D7OA 1FCCA 2FEDD 4F7EA 1GGUA 2BXZA 1X4XA 3QXAA 4Z7NE 1JZ6A 3D0VA 3O3BA 3ETBF 3BVNB 1W8NA 3VFMB 5E6ZA 1EK3A 3QDGB 4FTVB 2HVJA 2X4SA 1VFMA 4X6BA 3V6ZB 5D9SB 2YC1B 1KTKE 2NXYD 4XH2B 4EKXA 5EC2B 5I1HH 2ICWA 4JPIB 5JTWA 5BQ7A 1KPRB 5JA9A 1XIWC 3MOQA 5DWUL 1Y6KR 1NSNL 3MUY1 4OZFG 2EYRB 1DUZB 1Y6MR 4KJYA 4GQ9H 3L3GB 2XZZA 3JV4B 5GGSB 3STZA 3SPVA 5IQ7L 1VPOL 1U8NB 3VXUD 2BVOB 4X8JB 2J5LC 3TO4B 1ZT4B 3E8UL 1FFQA 5EFIA 5FYKE 1JCKA 2AK4A 3MC0A 1UB5A 2PTUA 1RZKC 2Q86A 1JYXA 1QRND 2VDNH 1CFNB 1VSCA 3RAJH 3QDMD 1JPST 4WI8A 2CRYA 5EBMB 5DXWA 4IDJL 2G60H 3HE6A 3GRWA 1R3IL 5F1NB 3U2SA 1MJUH 5ABDE 5F89B 3LKNA 3K3QA 4B7IA 3ZTJH 4F37F 2NW2B 2BMKA 5C07A 2ZPKL 1F2QA 5TE7H 2FZ3B 5C92A 4FXKB 4O2FB 2B39A 5DDHB 4FFYH 1YN7A 2F53E 3G6DH 1W0WA 4I2XB 1NEZA 4OKVA 2FLBT 4Z0BL 3RDTD 3N1MC 4HC1A 1P4IH 3BZ4B 5L9DH 1B6UA 3QXVA 5FYKD 2EKSA 1Z9OA 5LKNA 1NMCC 5BVJA 1GGBL 4BFIA 1PFCA 2J8UF 4XTRD 3KPMB 3RNKB 4K3DL 1JZ5A 3JV5A 1TJIL 4LHJB 3BSZL 2ESVE 4AEEA 4HJJH 5I9QC 3HI5L 3MRMA 5CINH 3REVA 1HHHA 5ALBH 2QSQA 4PJGB 1YA5A 4HH9B 4B7LA 1MAKA 4XRCA 2AJVH 4ODSH 4LLWB 4D9LH 4ZO9A 4XHQA 4M1DL 4IM8A 1WUNT 4FQCL 3S4SG 4Z78B 4HWBH 2LAAA 5E8DL 2GSIA 1C7SA 4GAFB 4PJFF 5FGBA 1ZLSL 1WBZB 1FIGL 4M1GL 4U05A 1VESA 3DV4A 1VEOA 4NRZA 1SYVB 3DX8B 5C0ND 5BV7L 1T0MA 1F4XL 5KN5B 3KYMA 1ZVYA 4LLUB 4XC3H 2XTJB 4MGXA 4KRNA 2K9UA 2QJDA 2VIRA 3MXWH 4UILH 4MXWL 2CKNA 4TN9A 1IQDA 1S7TA 3PP3K 2Q87A 3P73B 4P9ML 2YZ8A 3DMMA 4NUGH 4CUCA 3V7MA 2EC9U 1OAXL 5CCKH 5GS0H 2HJKA 4YR6B 4GKOA 2HLAB 1WZ1H 3OKKA 1I85C 2BOBA 2FEEI 2GAZB 1KCRH 4MA8H 3M07A 4WNQB 2NY1C 2P45B 4LQFL 1ORQB 2BVPA 4FQ1L 3U30B 3D69B 3IFLL 5L6YH 1EO7A 3L5WA 2D7TL 2GQHA 1Q8MA 1MQKH 3QUML 9CGTA 3WLBA 5D1ZD 5DJYA 1U8QB 4QHMB 5BMFH 2A6JA 3GMRB 2QL1A 1JRHH 3TVMB 5ADOL 4AQOA 1UEMA 3OBAA 3P4LA 4HF5L 2E9WA 5DMJB 3ROOA 2VR5A 5HHNA 3VRIB 1IZJA 1F58L 1ZT1B 4P3DB 4P3CH 1MVUA 2J3SA 3OMZA 5GRUH 2Y06L 4JO1L 4RWYL 4UB0L 4OFPA 5T1KB 4HHAA 4N0CD 4OLYL 1IM3A 5FCSH 2NNAB 3KR3L 1S9XA 5KJRL 2PW1B 4NKIL 5DEFA 3VE0B 3QNYB 1A9BA 4OCWH 1IEBB 5CJQH 3PV7A 3W9DB 4HK3J 4OV5B 3KXFE 4Y5YA 4ALAH 1EA9C 4I5BB 5L0QC 4YPJA 4PFEA 1S7VA 3CSPA 2YPLE 1T89A 4XBEH 2XZQH 5C0DB 1PY4A 3PWJA 3KPSB 1XT5A 4QXTB 1FFNA 3N9GL 4Z7QE 1G9MH 3FOLA 5E1HB 1ZHBA 5D7LD 5FYLL 2P5WB 2EDHA 4HG4K 3RVTD 3GI8L 1X9QA 2ADIA 3LPGA 4DK3A 3V4VL 3I75B 4HWUA 4P4RB 1QO3A 2XWJB 4MJ5A 1PD6A 4X7TA 2NY7H 5GS0C 4OB5L 3D39B 3RX5A 5C0IB 3BZEA 4S0SD 1HKLL 3FN3A 4JG1H 5D6DA 3VXPA 4H1LH 4YGVB 4ZAKD 1V7NL 3GSVB 2E7CA 3H6JA 1XGYL 2XZCL 3MLYL 3T4AA 3FFDB 4YO0B 5DEGB 4AG4H 1LO3H 3S35X 5JXEC 2P44B 2P8LB 2DBJA 1RJYB 2GJZA 2YPLD 5F7MC 2DYPA 4XCNB 2MCPL 4G7YH 2GCYA 4OGZA 5CBAA 4N9GA 1QVOB 4LSUH 4ODHH 4KGLA 1VERA 4KJPD 4PJAF 2HWZH 1CE1L 2N1KA 5FK9B 1DBAH 3K46A 2OBGA 3S35H 1QLFB 1FFPA 3AM8C 3KYAA 1YNTA 4JZJA 5C6TL 3RA7H 2Z31D 5L2KA 1K3ZA 5ICYA 2I07B 4YQXH 3Q5OA 1ES0A 1M4KA 2RGSA 2D0GA 3V0WL 3V0AC 5EO1B 1NCAL 3VWKC 1RZ7L 4QGYA 1DBML 2P24B 5EPMB 4HK0A 3QDJE 4LHUA 1SM3L 1JWMA 3W2DH 3WSQH 3T2NL 4OCNC 4GKSB 2XA8H 3SKOA 2MKWA 5ESVB 4XZUB 5GRYA 4PRBB 5FV2A 3MLRH 4WWKD 5CKGA 5ADPH 5C08E 3EDKA 4AL8H 1N6QH 2WUBL 3UYPA 5DJ0B 4G6AD 3N1FC 1EMTH 5EOTB 1MJJB 1UADC 3HB3C 4HUWB 1F11B 1DBKH 2APBA 2LFGA 3NTCH 5EO9A 3BQUA 3EYSL 5IGXH 4L4TA 4P2QE 3VGEA 5GPRA 1IAII 4LLDA 2IG2H 5HYQA 1G9MC 1T83A 3L5XH 1WBYB 5FUCE 5JO5A 2JJTC 2R2BB 4KUZL 5SWZB 4R2GC 5D93C 4PJ5A 4EOWL 2JTDA 2KKQA 3OWEA 3CU1A 5A2FA 3ESUF 4J1UB 3EOBA 1FRGH 2JJWA 3QCTH 4P2CG 4QXGH 5B8CA 4JO4H 4HPOH 1IGTA 3QDJD 5HGAA 3Q5YA 4NM8H 1P84J 3G04A 1YEHH 2V5RA 5D7SL 4UTBL 2PYEE 1YMME 2XKUA 5C08D 3PDDA 4ESKA 3QEHB 4G5ZH 2PXYB 2ZCHH 2AEQL 1KIPA 3G6JA 3OR7A 4M93B 4P2QD 5DRZA 5I1JH 3VXME 3RIFK 2DL2A 4HQQH 1I1AC 1ED3A 2QKIB 5IT2H 4Y19E 3W39A 1H5BC 1EBAA 5CFHA 5EU4B 4XPHL 1ODAA 3VFGH 2ZOKA 2MKLC 4KHTH 4HMDA 3EYVB 3VFMA 3QDGA 4FTVA 1C5CL 2CDFA 3V6ZA 2HFGH 5D9SA 1WFUA 3MRNB 1XF4B 2F15A 5I30H 4JPIA 1QYGL 2DN7A 5DMIH 1KPRA 1INEL 4M7LT 4KROD 4Q9BA 4LIQH 3T3ME 4ZFFA 2EYRA 3G5VB 4NO2A 4PR5B 5D7JB 1YMMD 4HJGB 3SDAD 3UJIH 3HR5A 5INDB 1U8NA 3OKMB 3GSUA 3K8MA 3UP1A 4G43B 4LAJH 2BVOA 4RAHA 4X8JA 5E9DD 5FGCE 2OL3H 4HIJB 1M05A 4DQOH 3IDUA 5D1XC 4YBHA 2QQLH 3VXMD 4EXKA 1CFNA 2L0DA 3GJFH 5C3TA 2NY0D 1F4YH 5HYSG 3HZYA 4OZGE 3SJVB 2XG4A 2FX8L 5I66A 1YMHB 4CJ1A 5F1NA 4K94H 3U7WH 2AABH 1S3KL 4XCYA 4GT7A 2CO7B 4NZTL 4UV4L 4Y16B 5ALCL 1WEJH 2FZ3A 2VR4A 3S88L 2EIBA 1AO7E 2YEZA 3MBXH 3BKMH 3BP4B 4YX2H 2QR0A 3Q3GB 5DSCA 1CXLA 5BO1L 4RFOH 4DGYH 4TSAL 1Q1JL 1U92B 4IBLT 5E2TL 1QD0A 4L4VB 3UJJL 4I2XA 2OYPA 2VYRE 3CLEH 4JR9L 4DN4L 4UT6H 4Y4HB 5HGDA 1MHHB 1KN2H 4A6YL 3MPCA 1FNFA 43CAB 2AJYL 1NC4D 3KPMA 1X5JA 1Q94B 3RNKA 4XCFL 1RJLB 2DIBA 2DQDH 3FOMB 3MZTA 4K8RL 2VXQL 1I1FA 1TVHB 1P6FA 2VUYA 5EORL 3TFKD 3PGFL 4YK4C 4O9HL 4KKCD 1QSEA 3CH8A 5D6CB 4PGDA 4LLWA 5GGVY 2OR9L 3UPAA 1OAZH 5I75B 5EU6E 3V7AG 1M7IB 4JN2A 3BP6B 4X7CC 4Z7UE 1T1YB 3IKCA 4X7SH 1AO7D 1NCNA 4WV1B 3LN5A 4I0PC 5HI5D 3MR9B 1FYTB 1WBZA 2C7UA 5CD5C 1BD2E 5F7YC 4RGOL 2AI0L 4TVSa 3R8BB 1MAML 4M7ZB 3SQBA 1SYVA 2DB8A 3ZKND 2R0ZL 4LLUA 2HRLA 1YEIH 5E7BA 1OW0C 5GRZA 2GJ6A 1FZJA 4BSVB 5GS1B 4KHXH 1GGCH 1MY5A 4RGND 5TPWL 2Q20A 4BFGA 3TIDB 3L95B 3X14B 4FQJL 2D2OA 3C08L 1BQUA 2HFFA 2XG5A 5KANI 4OZ4A 2C5DC 1CT8A 2HFEB 2P48B 3ARDC 3P73A 4KZEL 3IYLW 5IMLB 1JGUL 2ZUYA 4HUKB 4P2OD 3RGHA 3WJJA 2OCFD 4LSPH 4YR6A 1NCBL 4JRYA 2GAZA 3UJTL 4WNQA 4MLSA 3PIQB 4PB0L 5HXMA 1G6RB 3QEGL 4FZEL 1OTUC 4FQ2H 1AGBB 4K94C 1YECL 2EXYC 3OB0H 1MCQA 4D9QE 4ELMB 5DFVC 1H8NA 2O5YH 2A9NH 1BD2D 4BH8B 1QFHA 2HT3D 1UB6B 1XF5A 1NCCL 5JHLH 1MWAB 1T04A 4H88L 4WI2A 1T1XB 4GOSA 3VRIA 2Q3AA 1SY6L 1ADQH 4OFKA 3WNLA 4FFVC 1E4KC 2IQ9L 3P0VH 4IRSC 4KKBD 1HXMB 4MX7B 4IRJA 4XNQB 1INQB 1R5VB 2ARJB 1T3FB 3GBLA 3TT1L 5IUSA 2Z91B 1IAOA 2QQQA 5AYUL 4GMSH 2W0FA 1DUYB 4QRQB 1VA9A 3FT2B 3GSQA 5T1LD 1WK0A 2DDQL 2LVEA 2PO6A 1FJ1A 3OZ9L 4HIHB 4YFLI 4MNQB 4KKNA 4PRNA 1ZGLA 3IFOB 4LARL 5JZ7D 4J12A 5GGSY 2CIKA 3MCLL 4H8WL 4ORZC 1REIA 2H6PB 3RKDC 3K8LA 2MFNA 2HG5B 1K8DA 3JSSA 3LKQA 3WFBL 3VGAC 1IC1A 4I5BA 4WEBL 3KYKL 2YD6A 1CE6A 3HLAB 1E6OL 4FNLH 2YXFA 4ETQB 4JPKH 1S78C 5C0DA 3HMXL 2YPKA 5I19L 3DARA 1U9KA 3LD8B 1KJMB 5GS3A 4OQTL 1Q0XH 4MQSB 2BK8A 4GS7C 2BVTA 3HCVA 2O61A 4J8RB 1FL6B 2P5WA 1MRFH 3OF6D 3QUXB 4U4BA 1HIMH