2EVIA

Structure of a ndt80-dna complex (mse mutant ma8t)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
303
structure length
290
Chain Sequence
VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle/dna
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*AP*CP*AP*AP*TP*AP*AP*C)-3'
total genus 86
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2eviA00
2EUXA 2EVGA 1M7UA 2EVIA 2EVFA 1M6UA 2EUZA 2EUVA 2ETWA 2EVHA 1MN4A 1MNNA 2EUWA 2EVJA
chains in the Genus database with same CATH superfamily
4P46D 4APXB 3L2MA 1PLGH 1F11A 5D7SL 5CEYB 3I50L 5C0CE 1RD6A 4BRVA 2ZOTA 2ZUXA 1BLIA 5EEXA 1HKLL 1UD8A 3PPSA 3ATDA 3D69A 2Q3AA 2XACC 3ZHNA 3DIFA 1IARB 3QJRB 2CRZA 3D3VE 1BWWA 1P6AB 1QTSA 4P59L 2ID5A 2GSGB 1SYSB 3VMNA 5AFAA 4P06A 4AWJC 3FOMA 5DMGC 3UZQA 5LG6A 4F9LA 4XBMA 2E7CA 4FNLL 1OCZB 5ICYA 4JO3L 3K4DA 5E8OA 3GSUB 2EIJB 1Y7VA 3T0VA 5BQDA 2GSGA 1BJ8A 2F15A 2GBUA 3P2BA 2APSA 4B41A 4P07A 5FGRA 1MHPH 1JPGA 1P2CB 3NAAL 5MENE 1DVZA 1T22B 4HS8H 4P0DA 3EW3B 4BWUA 4J12A 4YHKH 1LO3H 3H7BB 4Q6IC 4M48L 1QX1A 4AIOA 3L3OA 4I2XB 4BKTC 4DP8X 4GP4B 3CH8A 3WKPA 3S96B 1UWEL 5E9DA 4APQB 2ZKHL 1YSOA 4I13B 4WHTA 2FIKB 4JFHD 2MCG1 5BPPA 1WG3A 1QP1A 4ZMNA 1YEKH 3QS2A 1CGSL 3GSOA 4NQVB 4XB8A 5F7DA 5I26A 3IDNA 1JHTB 5JNYA 1QRKA 1ZVHA 4PJIF 5C09B 2YPLB 1NCTA 1NFDB 1H3XA 3WE1A 1F6AA 3EO1A 4I3RH 2G5UA 1CBJA 2W60A 2VQ4A 2H45A 2VDMB 1IAII 4XHQA 4HOMA 2BS71 1TLKA 1MXGA 3HLAA 2UXVA 3SBPA 2ZCKH 3FO9A 4IRZL 3MLPA 3BUIA 2ZOKA 5E08H 5KSVB 4HIIB 2LTQC 4LCCC 3Q2NA 3LD8B 4ZFZA 5HXMA 4G8IA 1JZ8A 1GGCL 3L9EA 3T4AC 4JPIB 4FQXA 5HI3D 3VXMD 4K3HA 4PJDF 3K2UH 4P57A 1RCYA 4TSAL 3SE3A 3SN6N 2HRPL 4HLEA 3I6SA 2DN7A 3VRLE 4GRWB 1YEWA 4ELMB 3PDOA 4H5SA 4GAYA 2FWLB 1DEEB 4JM4H 3DI2B 4JFDB 2DTMH 1HJBC 3NBNA 1TQCB 3CV5A 3P9MA 4M43L 2TSAA 1B0RA 5AOIA 3QDJB 2IWEA 5E6UB 2EDFA 3GMNB 4X7DC 1YMHA 3IDUA 1YNLH 3N1GC 4YK4C 3ARGD 1HS6A 3CZKA 4JBSA 1E40A 2IH8A 4X4XB 3GB7B 5DRZA 3HRPA 3T9WA 3TJPA 1JK8A 5KVMC 1VJSA 2WZ0A 1UWGH 1FGVH 4HUWA 4XPHL 4PJ9B 4YZFE 3ELQA 4F8QA 3GZQA 3EXLA 3BH8A 4DP5X 5EWIL 1S2EA 4PS4H 2R0LL 1J8HA 3D3VB 3BCFA 1NANH 2O6PA 1XEUA 3CLWA 3MROB 4MAYD 1Y6NR 4UUJB 3KWTA 4KKAC 5CR1A 2R2BB 2P46B 4MXVE 2YD4A 3F58L 2UUDH 1DQDL 1QHQA 2DEYX 1UJ3C 1QRND 3C87A 4PGBA 3FN0H 3C60D 4FKHA 3I6GA 1AC6A 1A9BA 3UTTE 1J9SA 1Z9OA 3PP4H 5B21A 2HTLD 2KLSA 2WN3A 3ZHDA 5KTEL 3L13A 4PG9A 3HR5A 3HNTH 2YBGA 4ZG1A 1TTAA 2GIMA 2FATL 3MGTA 1XXDC 3C8DA 1NIAA 2Q86A 1MEXH 1TF4A 1FIGH 1U41A 4QF1B 3F5WB 3WE6A 4I2XE 3AB0B 4NUGL 1M7IA 4ORGA 3V6FA 1AGFA 1TQTA 1BX2A 3IAGC 2R69A 4DP2X 1AXSB 3SBQA 6PCYA 4NQEB 4PJ8C 1QFPA 4OZ4B 1TMQA 4L8BB 4WK4B 1OAXH 5TGBB 4GFXA 3FZUD 2ENSA 1KOAA 3OG6B 4YHOH 3EDKA 5TGBA 3UX9B 3VACA 4EOWL 2ZYIA 2ICES 4OZ4A 5FOBA 1FAKT 4AGQA 4QXGL 3S35L 3DSFL 4B27A 2FEEI 2DYRB 2FCBA 3PDOB 4H5SB 2A6IA 3KPMB 2WMPA 3SKMA 3QG6A 3P9LB 2AEIT 3RUGF 3L3JA 4E9YA 3WFBH 4GRLB 1XCXA 4X6CB 4ZMTA 1ZLEA 3KLAA 3Q0HA 3ECBA 3UP6A 3KPSA 1PYWB 2CNYA 4WK0B 4FABL 1PLAA 3UYPB 4W9IC 43C9A 3FOLA 2BOCA 5DUPH 1BFOA 1A7NH 2VUOA 3S7GA 4NKOB 1VFBB 2L4OA 1NDMB 1OSZB 3L1EA 3BAXA 1C1EL 4MA1B 5J12B 2P8MB 1ETZB 5D1QC 3UIYA 3NZ8B 1XDTT 4J28A 2PR4L 1HILB 1EUUA 5DJCA 5IVOA 4B5EA 4MQXC 1DUZB 5B3SB 2GJZA 1H8OA 1YNKL 3WY2A 2XHNA 3BN9D 3OXRB 1EHLL 1MI5A 4J5VA 2HZHA 1V3KA 2Y7LA 3FHEA 5HYJB 2HSIA 2CIKA 1M7UA 3EYUH 2A99A 1PY4A 5CUSL 2R59A 3N42F 3PABA 1UT9A 2DD8L 1FCCA 1ESOA 5FO9B 1BF5A 5KSAA 2QVMA 5DJ8A 3QCTL 4AIEA 1S9VB 4OFYD 4CMMB 3B3IB 2ADGB 1E9PA 3RWEB 3ILPB 3ARGC 4RGNC 5A7EA 3BEVB 3NK4A 3TBWB 4FTDA 3IDJA 3HBGA 1X5FA 2GTZB 4M61B 4R7NA 4RGNE 3EH5B 3R4DA 3ULVH 1LL1A 2L7QA 4TQPA 2QGDA 5FK9B 1QI4A 5DT1L 1IGYB 3KG5A 2AK1H 3BP7B 2DQJL 4JG0L 2QT6A 2QKIC 3SPHA 2V2TA 2WOYA 3OXSA 4XN4A 2XIBA 1MW0A 4BKLA 1P7KB 3DX8A 3JVGA 1RSYA 1N3NA 4HMEA 4XN2A 5J6HB 4ABUA 1HL9A 2PR4H 4PJ5D 3RHWF 1YN6A 3BRFA 1JXDA 4PWGA 2ZYHA 1XQ4A 4XWOC 4LCYB 2IFFH 4FQXB 1G6VK 4YSPA 1ACYH 4X6DE 4BK4A 2FGWH 4HDIA 1UCBH 4JO1H 5E8OB 3RY4A 2YKLL 3NCBB 3SSGA 4OI8A 4ZFZB 1EEZB 3ARBA 4TUJA 3DECA 3QEHA 2DYPA 1ZA6A 3QJUB 4XVTL 5C2BH 1P7HL 1ADQH 2A77H 2B0SH 4NCC1 1VB9A 1J8SA 2W0LA 3H2PA 3LKPA 2R0ZH 2V7NB 4ELKB 4RBPK 1X5XA 3RYMA 1C8QA 3DPBB 2JI2A 3VCLA 3PE9A 4ZQKA 1I8MA 1OPGH 2W1NA 3LQAL 5FKPA 3VFWA 4KTYA 5AYQA 4Y1SA 3GXFA 1BZ9A 5AB1A 4ZO6A 1C12A 1B2WL 1EFXA 4MD5A 3RURA 4KK9C 3BN3B 4PJCA 2YPLA 3ZE1F 5I75B 3NJLA 2IDSA 4APXA 3QYMA 4QHMA 5F7DB 2VMDA 2VLRA 2X05A 3ARZA 3IE4A 5DJXA 1L5GA 3SE3C 3AFLA 1HL5A 3G5VA 2IV8A 1OAKL 1E43A 2IDUA 3LPOA 4GSRA 4L0YA 4FA7B 3H9SA 2NY5C 3PIQB 2PXYB 3BUDA 1EZSA 3C08H 4X6CE 4OJFL 4XXDA 3EG9A 1RU9L 5HHNB 1D2OA 2FBJL 4YXLH 3KYKL 4AGLA 2X1XR 5BW7C 1OP9A 1T22A 3GTVA 3WY4A 2BIPA 1P2CA 3OC5A 3QRGL 3DTXB 2BSTA 2QZ5A 3VWKA 5C7XL 3FJTA 2XX1A 5DQDH 2WXOA 4ODUA 2Q7AA 1TVBA 3WMSA 2UY7A 1RV6X 1II4E 4TLTA 3A24A 3KYOA 3A4DA 3OQ3B 5CIPA 2NY0D 2WAHA 3I6LD 4GI6A 2IJ0C 3MUGA 1TTUA 3NFPB 1NM9A 1ETA1 3RHWK 5T1LB 1UWGL 1RZJL 4U1JB 1NJ9B 5D2NC 3IJ7A 1OL0A 4YBLB 2UXGA 3FF7A 1OHZA 4HHGA 2F53A 3DOSB 3IDGB 1TVHB 3HI6L 1T7ZA 1WA2X 3MRBB 3OHXB 4XP5L 2E8ZA 3DVNB 4CA4A 3VFTA 2CBMA 4FFZL 3X11A 2A74C 3FSAA 4FLRA 4GKNB 3WHXA 1JGEA 1F11B 4KROC 4UTAA 3QQ4A 1WPCA 5HI4C 2A6KA 1X5KA 5EOCL 2OTUA 1R34A 3L4XA 4GSDL 5JA8B 3AROA 4ODWA 2FNWA 3SGJC 2X53A 5F0MB 5F7AA 3V55A 2WUBH 5BNXD 4KPHL 4NEHB 2GHWB 4O58H 4V1DD 3VA6A 5KJ7E 2C3WA 5D2LE 3T0EC 4F1ZA 4YHZH 4MTMA 4MA3B 3FCGA 4PBVC 3EGXA 4MVBD 3F7RA 1KDJA 3E6HB 4S1QL 1N26A 3AADB 2CJUH 3H8NA 1U3HC 3W2DL 3T65A 4J6IA 3RTLA 3KWUA 1JWSA 3WAJA 1W15A 3B56A 4R0LB 2VXQH 1NBYB 5J11C 3KL5A 3HTLX 3WIHL 1BAFL 2Q0ZX 2R4SH 3T0EB 3ABKB 2VTFA 1BQHG 4GQ9L 2RCSH 4LLWA 4CDGC 3CBJB 2H0FA 4KHXL 3CCHA 2WYHA 4OD2B 5I5RA 3V0FA 5KANG 2F53E 1YNLL 3KR3L 3DWTA 4JKPH 4OR1A 4JZJA 5GGVH 5CJXC 4LSRH 5D7JA 4WI0B 5DZJA 3UXFA 2V17L 1RKRA 3P77A 2JNZA 5F8RC 3TH4T 2ODIA 2VQ1B 4F37K 3BX7C 4FI8A 4HYTB 3DROB 4LLMA 2DKUA 1AQ8A 3LKNB 1I9IL 4EVNA 5K9JL 3SGEH 1XCTB 1VGKB 3VXRB 1MPAH 1NLBL 3PHQA 4BHUI 1G9EA 1XIWA 3N55A 4QIRA 3BDYL 2NTSP 3OQRA 3QK0A 5A16B 1KPVA 1RIVH 4GXVH 4I9WD 1XH1A 3RFZB 2B4CC 2CXGA 2ICEA 3MRHA 3CG8A 2WXGA 4HKBB 1E4JA 4C55A 2R29L 5FYJE 3QUYA 1PIFA 5A16A 1TU2A 1U4FA 4W9HC 4EKJA 1OAJA 4Q6YA 2VDOL 3CTTA 4R3SA 4YFEA 4OQTH 3X13A 2BNQD 2JCWA 2Y5EA 1XCTA 1MWAL 1A7PH 4X5WA 4PV9A 3PDGA 3UJJL 1XH3A 2VUKA 3TWCL 1ZK9A 1G84A 2VQ1A 3ZE0B 2VABB 3LHPL 1TETL 1EAOA 1NCAL 5IROA 3IJEB 1SY6H 1T04B 4Y16A 2BCMA 5F7MC 3VQ1C 5KS9F 2EKSA 2IGTA 4HOWA 5DHXB 3CQQA 3IJHB 1WWWX 4CJ1A 4P5RA 3VI4E 3H55A 2CBPA 3PJLA 1KXQA 3CN1A 1UVQB 4L8DA 4YBQC 5C0EB 2FYYB 2H4EA 3WIFA 3SCMA 3PHSA 4G43B 2IQAB 3B43A 4DEPB 3LN4B 5CM1A 1R3IH 2E59A 2ZNXA 5BRZD 3MYZA 2XTJD 3DHJA 3SPCA 2NNAA 2Y6TE 3LYRA 1SDDB 1X4YA 3PNRB 4ZS6D 4DGVL 5DJ6B 1OPOA 3MRDA 5BMFL 5FWQA 2QADD 3RGBA 4Z7WE 5ANMB 3BC9A 4BXSV 1G7MA 1H5BB 1P5VA 4GRWH 5DYOA 1YC7A 4ZMVA 3S6CA 3OMAB 1KB5B 3TX4A 3KLQA 4DPCX 5FUOH 2I9TB 4WU7B 1M53A 1V3JA 2IIJA 1MELA 3WJLC 1BQUA 1D2PA 1GA2A 2WC7A 1E4XI 3LKOA 3R8BB 3LXCA 3K3QA 2Y4SA 3NPSC 2F6AA 1B4RA 5D5MF 4GUPB 4LCIL 4EQ2A 1G5GA 2MQ0A 1LWRA 1LE9A 3RTQA 3VFTB 3DVNA 4LRIA 1OXYA 3L9YA 1Y1UA 1VFAB 3MRFB 1XMEB 3WN6A 1KGCE 3DETD 1VSCA 1X9RA 4YXLL 2FE0A 2YAFA 4G5ZL 3PP3H 1WC7A 2AANA 4F2FA 4G42B 4WEUD 4JG1L 3HUJB 4HC1A 5C0RL 5B7EA 2M1KA 4D2NA 4XT1C 1UZ6F 1I7RA 3EDFA 1Y6MR 3RA7H 4UT6H 2F5AL 5CJQL 5DQDL 1HSAB 4ZUVB 5I19L 1EGJH 4PJHE 2VT0A 4OUUB 4GG6A 1MVYA 3DTXA 3LNEA 1CXKA 3D5OF 5F1KC 5HYFA 1S9XB 4AMWA 1CYXA 3E8VA 1KPUA 1EBAA 1ZHBB 2E75C 5JHLH 1RZQA 2B15A 3VXRD 5BVPH 2X9YA 2YN3A 4HWBA 4GQPH 1MCIA 1FAIL 2RH0A 4FGMA 3S3JA 3SO3B 2OL3H 1BXUA 1EZUA 3B2PA 1NCWH 2X70B 2PWHA 3J8F7 2VW4A 1YEJH 5HDOA 2BSBA 3Q1EA 4HPOH 4P05A 3BEWB 4PJHF 4XC3H 3BH9A 3SEPA 4FQ1L 1ZHKB 4MDJA 1AI1L 1AO7B 1UA7A 1W0WA 2P4AB 4HUUA 4PJDA 1WWCA 2OP4L 2XYBA 2EDBA 1QEWA 2OMZA 2DQUL 3GLDA 3BQUA 3VNZA 2V2XB 3WLWC 2H47C 3FTGB 2HVJB 4P99A 1DVFD 1KT2A 5GHWH 1XZ0A 1S6NA 5E9NA 5C0AB 2P8LB 5FM5M 5ACLA 2VRAA 3CHXA 4HEPG 3O4OB 4G7QB 3V4UL 3HG1A 3LS5L 3VFWB 2IG2H 2ZXWB 4FNUA 1U3HA 2CJ3A 4FXGA 3HE7D 4B9GA 4QHLA 3MOBL 5IVXE 1L3WA 3HNSH 1V7NH 1DUYB 2AABH 1R24A 3IWVA 3MVSA 4L3EA 4MX7B 4PJGA 5FCUH 5TDOB 1T83C 4CC4A 1FHGA 4XX1E 2FO4A 4QYOB 1E6OH 3M7FB 1SOKA 3MACH 2GSMB 5EO1B 3ZL4H 4NNYB 3W39B 1FYTB 2CKBA 4S1DC 4ZS6C 3DLQR 1B3IA 5GGRY 3NCWA 1W72H 1OM3L 4Z77B 4YHLL 5AVQB 3BAYA 5F6HJ 4XXWA 4BKLB 5MI0B 1X9LA 3VM7A 1J8HE 1NWOA 4PP2A 2V0AA 3UYOD 3TO4D 3Q9QA 2IF7A 5CEXA 5GGVL 4KKBD 5D1XD 4UB0H 5JHAA 5BS0A 5GJTH 2AK4A 3GSNH 4NP4H 1XIWC 5HDQH 3DA0A 1JRHI 1IM9D 3V9FA 1CU4L 1QYGH 4NXKA 3TN0B 4CSTA 1ECZA 1U93A 3GIVB 2CK0H 3K6NA 5JDJA 3LS4L 2F2HA 2X38A 2DY2A 3B3IA 3O9WC 5DVOA 3IJYA 5HHMB 1L4IA 2AAAA 2O5ZL 4LBEA 5BZZA 1GZPB 4H8WH 4X5XA 2J1WA 3VI4F 1KNOA 1ROCA 1RLBA 4XMKH 1J10A 1DANT 2GVYA 2OM5A 4YHKL 2GABA 3W0WB 3OAWA 1LNUB 5MEPB 1RZGA 1FIGL 3FB7B 4HUVA 1EAPB 3C5ZA 4P2OA 4XCYA 3RL2A 3NUKA 2X4PB 3VW3L 3APNA 1EEQA 1A5FH 1BLNB 5FEBA 3GI9H 1Z1WA 2LV4A 3LZFH 1EO5A 3MZTA 4YHPA 3GXNA 2YC1B 4JW3A 1D5IH 5E8PB 4KPHH 4RGMC 3TNNA 3EBIA 1VFBA 1HZKA 3GJEA 4P4RB 1I1CA 4LCUB 3TA3D 1KYUA 4O9HL 3SE8L 2P5WE 4TOYH 3ZRFC 2HH0H 5FXCH 3QJTB 2P9RA 5HYSB 1B9KA 3EJYC 3AU0A 3L3JB 4EI6A 2DRUA 1CF8L 1WYJA 1RZIA 2MCPH 4K5NA 3TH3T 1G7LA 1GR7A 1MY7A 1YAIA 2F8OA 2R1YA 4Y7MA 5E00A 4HK3J 2CHWA 3PFUA 4HW6A 4RDQG 1WZKA 1O7DE 3F6IA 1MFUA 4OU3A 1M56B 1IBDA 3RVUC 4OCXH 2ZAIA 4YC2B 2UYLA 4J7RA 3FSZA 4Q89A 2R1YB 4UZUA 2VDLL 4W9CC 3ECQA 3RIAK 3QIBB 4JCMA 1QWNA 4B3EA 1CN4A 2VITB 3V0JA 1NAKL 4POZD 2Y7SA 1I85C 4KKAD 3SYPA 3SKOA 1UURA 4AQ8A 3RKDD 1CD1A 1X9UA 4WTWA 4L4JA 3SBWA 1SGKA 4GKLA 4P5TC 2XETA 3BVNB 3O0RL 4FFYL 1NGQH 3IGLA 4A2EA 2CDFB 2LU7A 3DJRA 5K9KB 5MENA 2BWDA 3U7YH 3V6BR 5D9SB 5DMGD 5DLML 3D7PA 3LH2L 1JTTA 5DDHB 4RETB 5FM5O 1BLNA 3NJXA 1J9QA 3A22A 1OF2A 1TJHH 2E3VA 4NJ9L 4UQDA 1I1AD 1H19A 3MRCB 4YHMH 2DLEA 1WAEA 4CN1A 1LO5B 4AG4H 3WDHA 1S5IH 1GC1C 3H53A 1T0NB 5EOCJ 4NNPH 5D7IF 4NM8L 3UEQA 3H1ZA 1T1WA 4EDXA 5BUAA 4EI5A 3VXMB 4KKLC 3AQXA 1LTXA 1NCDL 4R90L 1Q1PA 4ZX4A 5FR3A 3IJYB 2IGFL 3LNIA 3QCUL 5DRZB 1O7DC 4XNMB 4X4XA 3AY4A 1OCWL 1OKEA 2VDPB 3TXAA 1ZANL 3GBNH 1HHHA 4LO9A 1J0ZA 1YMHB 3F7YA 4FZ8H 3GMNA 4N0UA 3SZKC 4NXSA 1IJNA 2YR3A 4E9LA 3DKHA 4MMXC 2EDWA 4JM4L 5CEXB 3B2UC 3ZQ9A 3LN9A 4PP2B 2JIXA 3D2UB 2CGRL 4MHHG 3P73B 1TQBB 1JTPA 3V4VA 5IW6B 3EIFA 5BV7L 2X4NA 2K7PA 3F12A 4WV1B 1VIWA 2D31B 1Q9WA 3WNIA 3BWSA 1IU1A 2MHAB 5F3BA 1WJ3A 2GQHA 5EO1A 4NGHH 2JKIS 2D9CA 3T0XA 4MQTB 1UXSB 4NPYB 4FA6A 3MODH 4X99A 3SE4C 3L4TA 2WGNB 3HZVB 5A2CA 1QUPA 3LEXB 5KS9A 1NCHA 4RFNB 5KSVA 2CPUA 1OTSD 2OP4H 2R1XB 2WUCL 3HC2A 4JPWL 4KGLA 4FQCH 2X41A 4QXVA 4U1LB 1HXMA 3QA3A 1TQBC 2GBTA 4FXGB 4X9GA 3WEXA 3HLAB 3W37A 2ZIDA 3GEFA 3FQRA 1UD4A 1KTRL 1OCWH 2QVKA 2JKNA 3Q8AA 3V95A 5E24E 1T80A 1T2XA 5IMMA 4MCYB 1S7UA 2PR9A 3KM1A 4UOZA 1JZ4A 4HWBL 4LCIH 4NKDA 4LVNB 5DF0A 3JV4B 1ZLUH 3JTBA 2VQUA 2BP5M 3CH1B 4PRNA 3ETTA 3IEAA 4JFHE 1MHHA 4S0TD 5LDSA 4P23D 2VZOA 3FFCD 1BYPA 4L3CA 4P2CG 4A2DA 1BQLH 1JZ2A 4G9DA 4QDGA 2WXRA 4KJPD 1A6UL 5EV7A 2G2NA 2J8HA 1IZKA 3V0DA 3FDWA 5E2WH 1TEGA 2PCXA 3X1NA 4NT6A 4XZ4A 3DHUA 5KJRH 3NTCH 5I75C 1UEYA 1NEUA 3TIDB 1HNFA 1Z0MA 2OULB 4M4RB 5F1NA 3VUAA 4KAQH 4B5ZA 4G7VL 4XOAA 12E8H 3LY6A 4QO1B 4WJ5A 1XGYH 5JIQA 2OTPA 2J1YA 5JUEL 3PV7A 4PS4L 1AR1D 2DPKA 2ZUTA 4WCYH 1B90A 4W9ZA 1BBJA 5EEYA 2EIKB 2HLEB 2ADJA 3O45B 4TNVF 3SGJA 1G4MA 1K4CB 1JHLL 5CCJA 4I1PA 4BQ6A 1RZJC 3VXME 4YR6B 1JV2A 4HU8A 1TTFA 4ZMQA 3OGCA 1W9XA 1L9OA 1IGTA 4UDUB 3D69B 4JHUA 3MRPB 3V5HB 1U58A 1G7IB 4MKMA 4OCYL 2EXYD 5FW6A 1IL1B 4M7LL 2VRKA 4G82A 4Y4FA 1UUNA 2YZ1A 3SDYH 3GYRA 2R4RL 4EN3A 4PRDB 2ED8A 4WSKA 4TQEH 4BE6A 3CXDL 2DQIH 3D48R 1ZKAA 2EDMA 1WV7T 4G9FB 4JAMB 1AQKH 5JIIA 4X5LA 3AC0A 1OGSA 5CP7B 2VXUH 4A6YL 4PJEB 3RAJL 5IROD 4IBSA 3L5XH 3DURB 4G6FB 3CC5B 4MNGB 5ANMA 1TNMA 4PD4J 1GYVA 4N2HA 3CFUA 5CF3A 5IHUH 4HPYH 4JFQB 2BIIA 1PQZA 4OM1H 4X80L 1N64H 2CR6A 3EGSB 4NIYE 3FQWB 3MN8A 3K6FA 4M1CC 4RMSA 5E4AA 5EU5A 4KQ3H 4BZ2L 2YWYA 2HH0L 4ATWA 2AP2A 2X6BA 4G43A 1HXYB 1IGIH 1U0QA 2WZPA 4LHUA 4AQEA 3WJLA 1KIRB 4OD3H 2ZSWA 4MJIE 1KTKE 1V3LA 1JDDA 3B5TA 1GW0A 3IMSA 5F88B 5IESH 4ZPVA 4P2QD 1LQSR 3NT0A 1FZOB 1MWAA 4PWHA 1KBWA 1A6VL 1XB6A 1SOQA 1C5CH 3TJHD 3UTPE 3GJFA 1IBFA 5FHBL 1RZPA 3E6FA 4J3WA 5FV1L 5I8EB 3ULUF 4BK5C 4YE4H 1KBKA 1O7VA 4G8GA 1VPOL 2RACA 3I6KB 4AJWA 1XR8B 1NANI 2XXMB 2JB6B 5FM4A 2BZDA 2ZKHH 4NI6A 4EQ3A 4GW4B 4K9EC 1JGVH 3C09B 4XGZB 4X5WB 3FUFA 2VDOB 1Z9MA 3X3GH 2LU5A 3HFFA 4Z5RB 1MNUH 3LMJH 4P2AA 1QLRA 3UTQA 5AZEL 3EFFB 1U8IA 1KJMA 1V5JA 5AW9B 4N5UA 1MRCH 2X6MA 2YUXA 4F2MA 1MCWW 1L7IH 5H4YA 4JCLA 3I9GL 4JPVL 4U1MB 4N90E 2ETWA 3RX5A 1DJGA 4I18A 5IBTL 1NEZB 4P3DA 2ZT9C 1H0DB 1JK9B 2ZXDA 2OMXA 3BSGA 3QI9C 2J8UF 3ARBC 4FQQB 5DWUL 3VXSB 4PRAA 1OAZH 4U3SA 4Y5XC 5JIHA 5F9WB 4M5ZL 1TQSA 4FOMA 1B6DA 3Q3GA 4UM9D 4OF3A 3MXVL 4UANA 4ZTOH 3ARED 5IM7A 3OKDA 2OTWB 1EZVX 3DROA 1S5HA 4E41E 3ZKSD 1F18A 2WZPD 4AQ1B 2YSSB 4WO4D 1G0YR 3D4CA 5L88H 4U1NA 5EOQL 4HA1A 2HLFC 4F5CA 4UT6L 4HS3A 2BP8A 2NDGA 4OIBA 2ORBL 1JUFB 5HGGS 4PV1C 2BZ7A 1ZIBA 1U8CB 2W07B 4NN6B 3EYSL 4LLUB 3QZWB 15C8L 4M5TA 4W9DC 4N8VG 3UTZB 4G6KH 3B9EA 3EZ8A 4HCIA 4GBXA 5IVXB 2B1HL 5EULV 2BX5A 1ASQA 2BSEA 4E41B 4LSQL 2YD9A 5IMOA 3ARTA 4PB9L 1OO2A 4Y16D 5EUKA 2HFEA 1A9EA 3QJZA 3FUJA 5L2JB 1T7XA 1DFXA 1XL6A 4NO0A 5JXEA 3HLKA 3V0VA 4F3FB 2BP0B 1NSNL 4BWWA 3DO4A 2YEVB 1OSYA 4Y5VC 5D2LB 5DD6B 4LSTH 5D5ME 5DCCA 3FC8A 4KNTA 2X28A 4DKFH 1NC2A 4QAMB 5IIEB 5M95B 5CJBA 4PU2A 5LN8A 2OMVB 4N2NA 1NOFA 5GSVB 4KY1L 2JKSA 1AD9B 3I2CH 4HJGB 4L3ED 4OZGE 2VRQA 4H26A 4IDLA 1SF3A 4KTEL 5DEFB 5DJAB 3RBGA 4MJIB 2GC7C 5BRZA 2K3HA 3LX9A 5EU4A 1EXUA 2VLLB 4CADA 3L16A 1M6UA 2X1OA 3FCSB 3HRZB 1R3KB 2GK2A 4HQQL 3TVMB 3DOSA 2BY3A 3THML 1BJMA 3SY6A 1CXEA 2JKRM 2ATPB 3VGHA 4Y8AA 2OS7A 3JWDL 2LOEA 3SJVE 3BAJA 1PKOA 1V8HA 3C08L 4FG4A 1A1OB 3VI3B 1TJIL 3U4AA 4UIMA 2OMYB 2Y0SA 4I48A 3WELA 5EZOL 3K71A 1RULH 4WZ9A 3QIWC 2WTOA 1LP9E 2HKFL 5E2UH 4DPBX 4E68A 4HGKC 4HGWA 2XWJB 4HFUL 3SDCA 3TVMC 2BSTB 4GKSB 2XRAL 4JM0A 5EIQA 1I9EA 1XF3A 5JPMA 1CLZH 1E9OA 4WTZG 5ICUA 3OZ9L 4OZIF 2F7OA 2OSYA 1JHLH 3CBRA 4M8UA 5ADPH 4O2FA 4UT7H 5ID1B 3MFGB 3T2OA 1UYWL 3QRLA 3M1BB 3TL5A 3R0MA 3REVA 3GNML 5CHNA 1RIVL 2SEBA 5AVZB 2W9EL 1H15A 1X5ZA 2BNQB 4OB5L 4LPCA 2NY5H 1TZAA 4O00A 2AEOA 1C12B 2R83A 3S34L 2EYRA 3GSQB 1KLUB 4WI9A 3APDA 5LXGH 1MRDH 3VSTA 2QQKL 5ID0B 2QSVA 3AXHA 4IBWA 1P0SE 1NFDF 1TQWA 4ZX6A 5DZPA 4GQQA 4LDOB 5KBNC 4Q6IB 3LRLA 1JERA 2IAMA 3O2DA 5AAMA 2IBBA 4UYQA 4Y2DC 3HAEB 4C56E 4XOBA 4BZ1A 1WD8A 3K8LA 5JQIB 2RCSL 1MCLA 3MUZ1 2C9AA 5E6ID 2DLHA 4ZZKA 4J3BA 1KCRH 2YBRA 5FHAL 1T7YA 3PNWB 4W6XB 5IR1A 4H20L 4ZFGL 3ECUA 4NHUA 2A9ML 3W2DH 3HW7A 4NPKA 1ZGLA 3O4OC 4IJTA 1N3NB 4LIQE 3RY5A 4OLWL 2XTJB 3OXSB 1HH6B 5FO8A 4H13C 2O6DA 2JTYA 1N19A 4DOHE 1VZHA 3SJVD 1OB1B 5F96H 2QADB 4AKPA 1TJXA 3UZVB 1NAKH 4LSRL 1UKTA 4IBTA 4KV5F 4XHJC 1UYWH 1FLRH 3BIKB 2QZQA 1B4JH 1AAJA 1Q9LB 3QNZB 1HAUA 4URKA 4PIBA 5ECJE 3DIVA 2ZE0A 2VDKL 2RFXA 3TT3H 5IMKA 3BHBB 2JVUA 2KZKA 2XJLA 2B3RA 1MG2C 1FFQA 3Q2CA 1UCTA 1S7WB 1DVXA 5JOFA 2R9HC 4DFHA 4X50A 2R8SL 5LHDA 3LD8C 3MV01 2CCVA 1F41A 3PABB 4JNXA 3B37A 3SJVB 3ARUA 3BVXA 3DIDA 1G43A 4Y1TA 1DQJA 2GJ6A 4DGYL 2O5YH 3Q7JA 5LDUA 5E23A 1S7TA 1N4XH 5B39G 2QBWA 2GJZB 3RLSA 1ZK5A 2N7SA 1NCUA 2XQYG 3WUWB 1IT9L 4NENB 3M46A 5ABAA 5I6XB 4ZI8A 4XWGL 4WWOA 5SWSE 5AOLA 2XNAB 4YHYB 5IB2B 5A6LA 3IKCB 4WKZB 4ZMZA 1ACCA 1D5XB 1F58H 1PYWA 1W91A 5EH1A 3VXNB 4R84A 1RZKL 1IAOA 3U6XS 4Z7VA 1EBPA 1WBYB 4YDJA 2J6EL 4ONFL 3F64A 3KGSA 5H35A 3IS1X 4P5SA 3CU1A 3C8HA 3N85L 1FV1A 3TT1L 2ERJB 4OZIE 3NA4A 4NM4L 2XFGB 2RMNA 4I0PC 4N8VA 4U1KA 1F4XL 2XCMC 3M8OH 4PRBB 5IHZB 5DYFA 2OMUB 3UG4A 1VRSA 3DX2A 3S3DB 1JCVA 4NQEA 4XMWA 4Y1AD 1EDQA 5IB4A 2DV6A 5FW7A 4AT6B 1AJ7H 3D0AA 2X44D 1VADA 1WUZA 4LRNH 4XI5D 4YHLH 2YD7A 4YSDA 4AI7A 2V3FA 1OCCB 3H4FA 4WU5A 4Z7UA 4H25A 4WTXA 4L5FE 4KITB 2VWEC 3GHBL 1HKFA 4QKXB 4C56B 5DFWH 3RVWC 1MKFA 3DVGB 3ZHLA 2DQDH 1IC4H 2VXSH 1HVXA 4XNYL 2EYSB 3MV8E 3V52H 4CBZA 4XXCC 2H32H 1O6VA 3DHPA 1R5WA 1RK7A 3CHPA 3QWRA 4Z7OB 4PJ8B 3V10A 4MZ2A 1QBLL 3O3BA 1BECA 5I1LA 4UMSA 5DUBB 2H2PC 3VG0H 5GS1A 4XVSL 1QWUA 3QQDA 4C47A 1TCMA 1RURL 3DBXA 4IHBA 3VXTB 5I6OA 3EJCA 1J8HB 1BOYA 2NY7L 3UAJD 1TO4A 2WBJB 1JN6A 2CLRA 3FRPG 3KNBA 5FV2A 3EF4A 3SE9L 1ETB1 2FIRT 3IU4L 5LBSL 2DJUA 3V4PA 2PNDA 4NZRH 1BVKA 3PQYA 4WY7H 1R0AL 5AKVA 1NBCA 2DQFB 4YWGH 5IW3A 4K0OA 2DD8H 1NIEA 1ZEAL 4P3CH 5CKGA 3RA7L 1QSVA 4TNWK 4EI0A 5CCGE 2LGNA 2E0PA 5AALA 3KVDD 4KV5E 2UZIL 4FQCL 4OFIA 3QDGD 3TIEB 4MD0A 3DSNB 4WUKH 3WIHH 5JZ7C 4NYLB 5IROC 1ADQL 4PJEE 2BVTA 1NBZA 1N6VA 1LO2H 2LLNA 4IRZA 4FCHA 5ERWA 4DGUA 4WTZA 1KGCD 4NO0D 5AW6B 5CIPH 4HCRH 1GGBH 1KEML 4F7CB 2LW3A 3D39E 3MJ7B 1HI6B 3HE7C 1CS6A 2N0KA 2A7BA 3CZLA 4HUNB 1FFPA 1BZEA 1MFEL 4N5ED 2XBZA 3QPKA 5HI4D 1GGIL 5HHQB 3FO9B 1P6WA 4PJXF 4WEBH 1G6RL 1S7SA 2X5PA 3FU6A 1KTLB 4PWFA 1GSMA 4E9RA 1IKFL 4KKLD 1HEZB 5E51A 2EKJA 3IVKB 4OLYH 2IPUK 5EUOA 2J6EA 1HE8A 1RUKL 5DO2D 1L9QA 3OJDB 4G1EA 5DZLA 1Q94B 1NINA 5CINL 1WBZA 3C6LD 4XN7A 1PZ2A 4CC0A 1TEFA 1NIFA 1ORSB 4FQPA 4YZWA 2HXAA 2PTUA 2YPKB 1IC7H 1RJZA 4M7LH 1WSST 5D7SH 4BFBD 4JFDE 4KBPA 3DMMD 5D6DC 2ZKXA 4HSAC 4ORZC 4DEUA 1I9JL 4D9RD 4TL5A 3DRTA 3VTTA 2XDHA 1ES0B 3MOBH 1J5IA 4JFFD 4S0HA 5E9DB 4KRLB 5F3HB 4OZFH 5HBBA 1BIIB 2ZCZA 4LRIC 1R3JA 3C6LB 4H4NA 4NNXA 3U79A 5ICXB 4Y1AB 3ARFB 2KQNA 4ZAKB 3KPTA 3MQIA 3R06A 5C3IA 3LQZB 1AKJB 4UU9B 3N9GL 2BRRH 2XC8A 4HFUH 2HVKA 5FYLH 1KTJA 4L8SA 4P2RD 2QGCA 3APFA 5MHSE 4ZDHA 3MUJA 1E5BA 4OUOA 1PGRB 4Y5XB 3G5YA 5CGYC 4M7JH 5C71A 2ARJQ 1MH5B 3U7AA 5JPNC 35C8L 4NBXB 1JWUA 4NSKA 4RMVA 3STBA 4DP4X 3NIDE 4F58L 1MHEB 2I60H 2OJZH 3CHQA 4UNIA 2N7AA 2WXJA 5CWSB 3IFNH 5INDB 2BP3A 3OMIB 3KPRD 4HAFA 5HGDA 4L3FA 4PHXA 4KVNH 2V7HA 1ILUA 3H0TB 4U7MA 3SPVA 3FU0A 4JHBA 4QRBA 3RVWD 2WHVA 3U30C 3WDJA 4K23L 4OLXH 2JFCA 5C6WH 1AIFB 3BDXA 3KWWA 3LIZA 4OLUL 3MRNA 3HNTL 2NY2D 4GT0A 4W4OC 4M9PA 2LLGA 3I85A 4H0LC 4OF7A 3CDYA 4ZTPL 3L5WB 5EZLB 5GRJL 4PCSA 3G6JE 2VDMH 4TVSa 2NR6C 3BWAA 3D2UD 1K2DA 5CCKH 4GQ9H 4ODBD 3CZGA 3H85A 3QYCA 4ZW7A 1INDH 1JD7A 4KXAA 3D18B 3QUMH 3MRMA 4UWQB 1NZRA 1S9WB 3K2UL 4G7YH 4LMQE 4B9CA 4E9WA 1Z3GH 2A74B 1CD8A 3FTYA 2DQJH 3G6JF 2C7UB 4WW1B 5F9JB 4ZZFA 2JCCA 4EI5C 1YEHL 2CZNA 3FQXB 3PXHA 5CZXD 2MSPA 4TRPL 1YMMD 1WFOA 1TTGA 1IX2A 1S7XA 2VH5H 4J23A 4HJ1A 1U92B 4IGBB 5DQJA 3RNQA 3WD5H 1M1XB 1UXWB 5KVGE 5EN2B 3WKQA 4U1HB 2R4SL 1P4LB 3C5JA 2G9HA 2XIDA 4PCTA 5HTSA 5E6ZA 1CFTB 2GIXA 4IHOA 3ZTDC 1KLFA 2YAHA 1XR9A 4IBLT 5T1MB 1NMCC 2QHRH 1CGSH 1UZ8A 4JPQA 1YHPA 1RJYB 3GXMA 1CDYA 4H1LG 4M9OA 2QKIB 4X6DF 3E2HB 3ZDZE 3OB0H 5T3ZE 4XNYH 4UOW1 4ZFFB 1YMMA 2UZXA 3FH5A 1VEPA 1UB5B 1ZANH 3OKMB 4KI5D 3SE4A 4PJBA 2DQEH 5FGBC 2ZSVA 4JQIA 5LBSH 2F7PA 1K8DA 1AKJD 4WDIA 1NMCB 2JJVA 2K1MA 3NJNA 4AEEA 1A1MB 5EORL 3BSHA 1EAJA 1Z9PA 3O6KH 4HXBH 1VCAA 1Z2KA 1N59A 3ZDZF 2AKRA 3GI8L 4Q9CA 5IOPA 2DWTA 2XG5B 5DJZB 4D3CL 3KYKH 1NMAH 2DWYA 4YK4B 4XP1H 2VL5B 1P69B 3ZE0F 1U8NB 2X3BA 3HZKB 4UM9A 3UDWA 2QR0A 5CD5D 3TFKC 1YNTF 3ARPA 3AMKA 4LLAA 5E1AB 3QVAA 1MLBB 2EVHA 2PETA 3EOBA 1X5AA 1M2OA 1R5IA 1MFCL 4XMTA 1LEKA 4IRJC 1P4BH 3E1F1 5HHOA 1YJDL 3SDDB 3ZKMC 4UV7L 5B3JE 3CZJA 5ICZA 4KK8C 4PLKC 4NLHA 3CVCA 4AEIL 4H2CA 3V4LA 4Z6AT 3ML9A 4OAWB 2JXMA 4XCFH 1A6VH 4LZKA 2GJPA 3OJMB 2NY3B 3NIFF 5DXWA 2X2UA 4XE0A 4NAQA 2VDKH 3FB5B 1HTYA 3AWFA 5HDRA 4UT6A 1MCOH 5ITFB 2WXNA 4PG2C 1MDTA 4K7FA 2FQDA 4L29B 2OAAA 2GAZB 3IE9A 4U6YB 1QMUA 5EPMB 4KZEH 4P3WA 3RVUD 2XG4A 4Z1PA 2IALA 4ZW3A 3MLZL 4JCWA 5IGXL 4HWEL 5JXED 3O3DB 4QOKA 4U3XA 2X2IA 5E5LA 1I9JH 4MAYB 5H37G 4OGQC 2OMTB 2F5BH 1KZYA 4YVNA 3M88A 1WAAE 2YN5A 3QAZB 5KJRL 4JANA 4WJG3 3CX2A 1T5WB 3X14A 1QBMH 2XZQH 1ZDSA 5T1KA 4LSUH 1NDTA 4MXQC 2W0FA 3KWVA 4PJAB 2GG1A 1QRNA 1NMAL 4PV8A 2MMXA 3IPFA 4F27A 5CSGA 3BZFB 4FZEL 2PP7A 2MJWA 5AZ2H 1BA9A 3P3YA 5BZXA 4UTBH 2EIZA 4R4FL 3HNVL 3JYCA 4WGKA 2JV6A 1KG0A 4FHJA 3HZMA 4MCNA 4PIRF 5D4IA 5TE6H 4OV6F 4EIGB 2B9BA 1AG6A 1QZ1A 4HJ0D 1H3TA 3P02A 2N7BA 1CFNA 1K8IA 5DD5L 3MFFB 3DX9B 2WIIB 3S3CB 4KUZH 1OP3K 2ESVE 4Z7WF 4Q9BA 1UD3A 5SWSB 4L5FH 5KSBE 3MREB 3WFHA 3WHE1 3BMVA 1ETJA 3COOA 2OQJB 4H20H 3L81A 4G9FE 4QT5B 3BPCB 4U0RC 4JKWA 4AMKL 5HGHB 2FWSA 5IVZA 3T2QA 2DMGA 1A6ZB 4PY7B 3IFNL 1CGXA 1UJ3A 2ITDA 4YVUA 3DUSA 3VXQA 1OLZA 3HZYA 4XC1H 2ED6A 1GPOL 4PLJC 4X0KA 3HG1D 1KIPB 5DJDA 1MY5A 1JXJA 1OZTG 5INCB 3QIWB 2IG2L 1OGPA 3LH2H 2K70A 4X6FB 4R8WH 1CFSB 3TEYA 1BV8A 1FAIH 3VJ6B 3FUEA 2WINB 5DLMH 4J3OH 2AJYH 1KLGA 1C1EH 1M57B 2IBZY 2Y2WA 2BO0A 5JOEA 3IN2A 2OBGA 2QJDA 5J6SA 1E4XH 3V0EA 3SO5A 5IFHH 3II2A 5E94A 5I16B 5TTRA 2L7EA 4Q74A 5FGCE 2CMRL 4V1DA 5JPMC 4NNPL 5CUSH 4A6YA 2XI9A 2XVKA 1O75A 4PJBF 3GT6A 1OAKH 4AJ0A 2JK5B 4FRWA 3ULVL 1AH1A 2AW2A 2HLAB 4YHML 4LLYB 1B0GA 3GSXA 4K5OA 5C0ND 3DPDA 3ZUCA 3QIUB 3C60B 1J0IA 4CSPA 5KYYA 4YO0A 5GGVY 1JZGA 4WFFE 1T89A 3C12A 3O6FC 3T08A 1Y1DA 3RWHA 1MDAA 1OGAB 2PW1B 3FQUB 2CO7B 1IBHA 1SOXA 4YSAA 5E2JA 3W9EA 1YN7A 4R2GD 3ZN6A 3AS2A 4OF8A 5HJDA 1Y6KR 1Y0LB 3LZLA 2AXHA 3Q8BA 3CZSA 1SMAA 4N2BA 1NPJA 1B0IA 5EF3A 4H7VA 5JYLA 1X5YA 1J9RA 4TNEA 5FYKU 3PWUA 3WEOA 1K5WA 1MCQA 2APVA 2VIRA 1G7PB 1T03H 4OY9A 1FYHB 1OARH 2J1KA 5C0IA 5J5EA 2Y25A 4WW2B 1FNEA 3HR6A 1K85A 1OQXA 2NZ1A 1GGBL 1KEMH 1NUGA 2GUYA 5DMIL 1A5FL 3W57A 5IT2L 3GBEA 4QRTB 2YWZA 1QLFA 3S2CA 3Q01A 3RWFA 3NCJL 5AUMA 4XAWH 1KN2H 1X7TA 4KKQA 4NS0A 5GZND 5GRUL 4P2QE 1UB6B 2VZ1A 1P7BA 4NKMB 4ZOBA 5FS5A 3CSPA 5HI5D 3TEXA 4QRPE 2VLRD 5CJOL 2J5LC 2MOVA 4LU5L 5FIEA 3VI4B 3MOAH 2BVQB 4OTXH 1LE5B 1N5AB 2JJWA 4PY8I 4PFEA 4JKLA 1NCIA 4AW7A 4BH8A 3NCXA 3RB7A 1G5AA 3U0WH 3W5NA 1BFTA 2BFVH 4FADA 5K9OB 1EHXA 1J1OL 1C9SA 4JN2B 4XPTH 2BOBA 2BINA 2YXMA 1N12A 3FO2B 3T71A 3B7TA 5FYLE 1NC2D 5I23A 5GZOA 1GAFH 1PF3A 1U8KA 3HOGA 3WN5B 2J88L 3JT2A 4JKKA 1JYXA 4L37A 1L9NA 3QXDB 5L0QB 5I6LA 2Z4QB 4M3KB 2BVPB 4WI4A 4U31A 2ARJA 4HKZB 1I53A 4NWUH 1KTBA 4LOUC 4Q6KA 5DJ0B 2MQGA 3LEYL 4ZOCA 3D08A 3M7OA 1I8IA 4KU1A 4WFGE 5CO1A 4ISVA 2FJUB 3PWNA 4E42B 2RHEA 5E6YA 2EYTB 5C0JA 4LSTL 2APFA 2CU9A 3GLAA 4XP1L 5PAZA 4U6VL 2MCPL 2WQ8A 2R2CA 1CDJA 3IDXH 1LD9A 3TBVB 4R97B 3MBWB 3OPZH 4JO2L 1CXFA 3L4ZA 4O4YL 2EEFA 1ID2A 1UZ6E 1SN0A 4LL9A 1N67A 1XGPA 3VRIA 1J8RA 1RUAH 5B7MA 3HZ3A 2VR4A 4NB7A 2FSEB 4RBPH 4O2EB 1E4KA 1CFQB 1U2HA 1AHKA 4YXHH 5ISZE 1E7UA 3QDAA 3V6ZA 4HV8A 2V5YA 3MNVB 3HE6B 3BWUF 2E8YA 3FB6A 1PNCA 3IMTA 2JKJA 3FFDB 4JDZB 1J88A 2WSDA 2Z31A 2FWOA 1TZIB 4DIXA 5DR5L 2VR9A 2WANA 2DKSA 3QWQB 5B1BB 4PVNA 2QKSA 2YK1L 1HYSC 4OIIL 1AANA 3NIDB 3TCXA 2XN9D 1RY7B 4N2KA 4I85A 2VN5A 4N2FA 4XBGA 4QUOA 4JM2F 4B97A 1QO3A 4PVMA 4LSDA 3LKSA 4C4BA 3AY2A 2YEZB 1A64A 1C5DA 5B38B 3FRUA 5GJTL 4YHZL 1M05A 4RCAA 4OJEH 4JFSA 4Q52A 1TKWA 4JN1L 4DUWA 4C83B 4QCIB 1G1CA 1MIMH 2ZCLL 5DD3H 5J56B 1MCKA 1OOWA 4LLVA 4G3YL 3E80A 1H6TA 2WYIA 3N91A 4FFYA 5IESL 1GZQA 3CFEB 3SGDH 4F80A 4QXTA 1J48A 4D9QE 2YFOA 5DHVA 5FB8A 4ETQA 5IFJA 2W8CA 4D9LH 2FH6A 5H37H 4W4OA 4KVCH 1E3XA 3M6DA 5HGAB 5HI5C 4QRSB 4JRXA 2CBQA 2P5PA 4OT1L 4Y2DB 1ZT1B 2APTA 1FNSL 4WFHE 5KYWA 5DJ2A 3E8UL 3NN8B 5LAXB 4LMQI 2E7LC 3N04A 3K6SB 4GRWF 2EDQA 4KKRA 4ELMF 3PHOB 5FO7A 2AMGA 3RGVA 1DDTA 1NLDL 4FTVA 3ABGA 4P5TA 1Z9SB 2EEBA 4J6RH 2SODB 5D93C 2WD0A 3K8MA 2GYSA 2QDWA 2VC2L 4MMYA 2A6JB 2CXKA 1KJ2B 4M7JL 1JGLL 2JQZA 4KFMA 2NXZC 3GMMA 4OF0A 2N01B 3ZVVA 3L5JA 1YC8A 4ELME 2WXKA 4H0HB 4EE2A 5A6IA 1HKLH 2DZEA 4N22A 1X7QB 3DBSA 3PXJA 3WL9B 5FOJA 4KVNL 4YNYB 4FQLH 5KEZA 3LXAA 1A6WL 5I8OL 1IC1A 2H7WA 5IEHA 4G6AD 5JZ7D 1HEJC 1R3LA 2B39A 2J71A 3IF1A 2QADC 3MGOA 1AMXA 3N43F 4G9FD 5TK4A 4AGMA 2YRBA 3DTUB 3U0TA 2NXYD 1QABA 1QA9B 2BY1A 3PF2A 5LGJA 4M8RA 5G4MA 3PAUA 3T0BA 3O8XB 2F9BT 3L3IB 3UYRL 4ODTL 4KRMB 1CQYA 1SY6L 5I19H 3CFTA 1OEZW 1NDGA 4PRIB 3MV8B 3ASWA 1MVUB 2AJXL 1P7QA 3P2TA 3IXTB 1N7ML 3T6QC 2YRLA 1W8OA 1FL5A 4LVHB 4TULH 2EINB 3TA3A 4X98A 2GW5A 4NKIH 1OK8A 4YZFF 1PG7H 2Q5BA 2EACA 3BPOC 1ZS2A 3FYEB 3MR9A 4FQHA 4LSQH 4RDQF 1I4FB 3QSKB 3FT4B 4U33A 3S36L 3STZB 3FRPB 2YPVL 3GGWA 1CF1A 5C6PB 1HDMB 4ZMXA 1MXDA 1ZTMA 4RA0C 4HBQA 1LO3L 4M7KH 2ADYA 3ME0A 4JPKH 3WFEL 1WAAF 2LTQB 2VSCA 3D33A 4TVPD 5DMKA 4OCWL 3SHSA 1FE8H 6PAZA 1QLEL 3EYOB 5TD4A 2OCFD 1KB3A 1FZJB 1I1YB 4HCRA 3P0VL 2X4OA 1HOCA 1ZSDB 2WVSA 1ET5A 3RUGB 5IFHL 1TUPA 4JY4B 3VVVA 1LEIA 1PNDA 2BMKA 3NH7H 4KJPC 2CDGA 2IPTH 5MERB 3ZW3A 2YHGA 4MCMA 2FH8A 4KJWC 1IVLA 2G75A 1E5YA 2ERJC 5C07A 1X4XA 3S88L 5BOJA 2BHYA 3MV7A 3IBEA 5H94B 3S5LA 5I1JL 3UG5A 2NW2A 3WLBA 4YWGL 1GW6A 1YEGH 2MIZA 4LNRA 4ADIA 1UH3A 5GXBB 5IVNA 2J43A 2AZUA 3QP3A 5MEQA 3VDBA 3JWDH 4QPEA 3LZOA 1P7QD 1KCSH 2GBAA 5E4EB 3GTNA 1A7OH 1ZTXH 1YDPA 1HSBB 4F7MA 5I1IL 2VLJE 1FH2A 3N42B 3VXPA 3X12B 3FT2A 1TCRB 4AEHH 3HC0A 3VWJA 2FJHB 2X0UA 5JHDA 5I66A 4V33A 1RIHL 3KLDA 4P2OC 2A0LD 1RHFA 2ALWA 2ZX5A 4JKNA 1YRKA 1WZ1H 3QAZC 1ILSA 1KZQA 3FS9A 2I7SA 5BVJA 3FO0L 3N1PC 2Q76A 2UY6B 3EH1A 2IQ9H 3CFDB 5EU6D 1KBBA 2HFTA 3IXAA 3TZVA 2P5EA 1I9RL 1NBQA 3D0LB 2RBLA 1PAMA 1Q0XH 1EK3A 3NGBC 3D0VB 3T3ME 5B3NA 3DMMB 5IOKA 4UV7H 5DUMH 5CP3H 4XC1L 1A8JH 1RXLA 4XCNA 1WS8A 1QBLH 4APQD 2UVEA 4HC1L 4KFZC 2E4FA 2IPKA 3VG0L 5JYMA 4K9EL 4QWWD 2WXFA 4RQQB 4XPGH 4NKQB 2FBOJ 3RWJB 3MCYA 5EU6A 4MSWA 4PRIE 3QCUH 4UINL 1MCOL 4N86A 4B60A 4A7UA 3F2LA 5D1ZI 5JW3H 5EBLA 2IH1A 5D4HA 1RZFL 1UM4L 2IWKA 2FECL 4MJ6A 5JTWA 4DK6A 4YHNB 2KBGA 1A6TA 2E56A 3KPLA 4W1TA 2WY3B 1JGUL 4X8JB 1CE6A 4NC1C 4Q9RH 1M3IA 3BCDA 1XGQA 3T1FB 3UTSB 3L95B 4CDHA 4ZSOA 4MD4A 2VAAB 5D1XC 5BXFA 2YRPA 3JWNG 4N26A 3TYFB 3HI1A 3I02A 5GGSA 4HPHA 2ZWZA 3A3YB 4KOBA 1IM9A 2WBWB 4N8PA 2P42B 2X9WA 4NQSB 1GRWA 3B6SA 4JDVA 2EIMB 4LHUG 5JO5A 2WLIB 3BLKA 4NC0B 2QLVB 4DCQA 4X4KA 1KBGL 2Q7YB 5IGXH 2ICWB 4PBWD 1FA4A 5KUKA 5IW6A 4ACTA 3TZVC 1TZGH 2FUTA 2Y36L 3VFUA 3K0YA 1DDHB 3V7AE 3GBML 4KVPA 4AQ1C 2C9UA 1Q72H 5DZOA 1A0QH 1F02I 4PJXA 4TSBL 4N0CD 1W72B 1C5BH 2WNWA 2GSIA 5GSRA 4AQAB 4PGCB 4B6ZA 3BISA 1Z9LA 1NIDA 2BIOA 4GSDH 4JHVA 5IQ9A 5ACMA 1NKGA 2HTKC 1T0MB 4J1UA 5MP6L 2VSKB 4MQ7B 2NUTA 1PLCA 3VFMB 4RAUB 3NZHH 3OZKA 1JGDA 3MA7A 2AQ1A 2O5YL 2YD8A 4H44C 4XCEA 5I9QB 7TAAA 4NQXA 5IJVA 1SJHB 4N25A 3N0PB 4AYDC 2BSCA 3WFDL 1DYZA 5HHOD 4RIRB 3OVUB 2OPCA 3PHAA 5CEZH 3NSYA 2XQYA 4PUBH 3PWPA 4Z7QF 5EA0H 3LNFA 4Q4EA 2TRYA 3FMGH 4UTBA 4G59C 4HAGA 4AVIA 1ZWIB 4X80H 5ETUA 4R7LA 4F8PA 3QULB 3NDZE 3FU9A 4N0YL 3WUWG 4BGLA 5IKCA 5DSCB 5FGBA 3HBQA 4JO8A 4U2ZA 3I9AA 5GRWA 1Y07A 3OKLA 4XBEH 1CVSC 3SDXF 3GMPA 5GS2D 3MXVH 4H0IA 4TSAH 2OJEA 5FA4A 4YDVA 3DX7A 5TF0A 5I17B 4Y9CA 2ITEA 5I5IA 3PYCA 3GS7A 1V05A 3CZFB 4PP1C 3RNKB 5F6HI 1PZ5B 4QLRA 3GWJA 3S97C 4YHIA 4PTTB 4YDIL 3MRLA 5IJDC 4K8RH 2KERA 3QR0A 4AV0A 2C3XA 4YOKA 3HRZC 2M2DA 1A4JB 2IOIA 4LF3B 5C0BD 3W56A 4F33B 2NY4C 2VL4A 3BZEB 4FG6C 3UTTD 1G6RA 2J5WA 4L2YA 5A2KH 4OZIB 1EMTH 3ECVA 5L0QC 4XBPA 5DK2A 4B9JA 3BD5A 4FFVD 1RUAL 1D5MB 3DX3A 1YUHA 3QZMA 4YUEL 2J72A 3NACL 4QD2E 3GQFA 3CFJA 1PMYA 4K23H 1SUHA 4R90H 2W65B 3F84A 3NFSL 4Z78A 5IB5A 3LNHA 1J9TA 1P1ZA 1BP3B 3RIFK 4UQBA 4HK0A 2PW2B 3CFQA 4MCZA 2QPSA 1BGXH 4FQ1H 3BXNB 3WEMA 4AM0B 1ZDQA 3P69A 3QIWD 5IB1B 1X6NA 1JG9A 3ALWA 3SDAD 4AG4L 1XL4A 4DHLA 1F2QA 4FJYA 4W6WB 5J7CC 4FNRA 2QV4A 3ARSA 2XWTA 1G7HA 4YBLC 2G2PA 2GJ6D 5HYQB 4UQ3A 3TF4A 3BQUC 4XMPH 4P8QA 2WSKA 3TBSA 3REWA 3F6LA 1AOZA 3QNYB 5GGQH 5LBSA 1CG9A 1BEXA 1WHPA 3F85A 4L18A 3CVHL 4Q14A 3Q2LA 2JKLA 3AREA 2H32A 4HXAL 3AAZB 3ARBD 2EXWD 2R7EA 3T2LA 4WI8A 1P4IH 2XFXB 4AJYV 4FXGC 4LE8A 5D71L 4N8CL 4ZK8A 4CNIB 5J6GA 2P7TA 5AVXB 3G7TA 1RERA 4R2GB 4QRRA 5BZDA 4WEBL 3JT0A 3BUBA 4HX1A 1YAZA 1NEZG 3PG2A 4QJ4B 1KEGL 1ID5I 2C3HA 1SMDA 1SNRA 1ZXKA 5BZWA 1NMBH 2V5RA 2GITA 3QDJD 3RDJA 1A2YB 2WKOF 3O6FA 1G9NL 1SQMA 2HX7A 4NI3A 1CICC 3CQPA 1KXHA 1Q9KA 4EUPA 3S37L 1T1ZB 5A3ID 3D50A 3OJVC 4N1HB 2X87A 3D4YA 4P23A 4PJ9D 2FJFA 2ESVB 1DR9A 4O5LL 2NX5A 4LPWA 4CL7A 2XZQL 3B1TA 4EEEA 3QUYD 3AXLA 1JJUA 3LZFL 4Z3EA 5MEOB 1H3PL 3UTOA 4QTFA 2RALA 4GKZB 2XWRA 3ECWA 1GHFH 1AGCB 2YOCA 4BFOA 5EORH 2Y7QA 1KYAA 4OLVH 3CNKA 4CW1A 5EC1A 1MG3C 4JFEA 5D5MB 2CO6A 1BQLL 5D7LB 2IANA 2Y3AA 2DWEB 3AU1A 3RPKA 4A7GA 3C5ZC 1O9ZA 3VD4A 2BSSB 4JG9A 3ARDC 4NHCH 4WWKB 3M1OA 2G9KA 1N8ZB 5ABDE 2CO1A 3F65A 3UBXG 4K7PY 4C59B 3FUMA 4K3JL 1I8LC 4GS7C 3VE0A 3HUJF 4NQTA 5T1KD 1MAJA 2OYPA 3RI5K 4JN1H 3RVXD 2AJXH 3UOAB 2Q8AL 4HWZB 2OYLA 3V52L 3N41F 4LASH 2F7QA 4TNGA 5C0GA 3TESA 2A3TA 1NLBH 4IMKC 2N56A 4URTB 2R0WL 4YHYC 1J0YA 4U6XB 5IK3B 3D8MA 4QXGH 3S35H 2NY0B 3BJ91 5IQLA 5SX4I 4D9RE 1AZBA 1BSIA 2AXWA 4GT7A 5F9AC 1ML0A 4B3VA 5KSBF 3C6SA 4H1LA 1W8NA 1EANA 4J4PC 4XN1A 3OLGA 1HCYA 2WN2A 3TURA 4JPVH 4QHKJ 4GRLD 2IDQA 2BWIA 3ALPA 2PCFB 1WK0A 1YEEH 1A47A 1JD9A 2RIKA 3UZEA 4PJHB 1F3DH 3ULVC 2DTSA 4FLQA 1IC4L 2VXSL 5FGSA 4J8RB 3TWCH 3Q2WA 3GS4A 4X7CC 4Z7OF 4BE5A 5KBKA 2UVFA 4D9LL 4WHYH 4JFED 4LLDA 4X7TA 4PJFA 1ZV2A 3UJTL 3PAZA 3SDAC 1LILA 4N2AA 1RURH 5DI8B 4HMDA 4OM1L 4FFWD 4LASL 3HNVH 4NUJB 4TUKH 4WFGD 2EQDA 2DH3A 4HHAB 4X8XA 1IM3B 1SEQH 4UT9H 1MCBA 1J1OH 3BFOA 2P28B 4MZRA 1C5CL 3MRJB 2FBRA 1UOLA 4HJSA 4JY6A 1U3YA 4WWKA 2X4QA 5CSZB 1KPRA 4HMCA 4DNLA 3NRQA 4ICXA 1JPFB 3L3KB 1BQSA 4DVBA 5D7LA 5SWZE 4ERSL 1U3JA 4JFEB 2Z92B 3O3EA 2OI9B 4YPGA 2ZKYA 3SBRA 4ZMLA 3MCKB 3I74A 2BW4A 3HS9A 2VXQA 2AQQA 3I84A 3TEWA 4ONFH 2C9PA 4WENB 5F7YC 4WUKL 1ZHLB 3WD5L 4Y4HB 4MNQA 4NUQA 1WEJL 4D0BB 4F8LA 1CT8A 1PY9A 2NY6B 4W9KC 2DEXX 2N4IA 1TEYA 2EDDA 3ISRA 2VLJB 4IK6A 3LV3A 1A1NA 3RTQD 3PUUA 3TC9A 4WI7A 4PJ5B 3EJQA 1ZVSB 2P49B 4KJWD 4RFEB 1PZUB 4J2QA 4BSVA 1Q9KB 5DQ9A 1S7QA 4G8FA 4C4UA 3UIZA 3TFKD 3IETB 4MJ5B 4U1SA 2L7UA 1NFKA 1FIEA 1HZHL 4DGYH 3LZQA 3O6FB 5D8JL 2EEXA 1XVSA 5I2IA 3WFDH 2NY6C 5C2UB 5JIMA 1BVLA 5I6KA 1F00I 2FQGA 1QFWL 4OCSH 4BV1A 2AI0H 1AXTH 4YAQA 5K93A 4NRZB 4A7GF 2RD0A 1E28A 1A7BA 5AL8A 2WUBL 5F3FA 3WNMA 4OJFH 1FORL 4Z3JA 1E6JL 4DN4L 2E9WA 4ZQTA 2F54A 1T66C 4MWFB 5B39A 4GW1A 3C2AL 4QRQA 2Z6FA 1XTLA 1YECL 4OZHA 4BSWB 4DKTA 4L23A 4HXAH 3AWEA 5C7XH 3Q5TA 4OVVA 5ISZB 1SXNA 2Y5TB 3Q6FB 5CBEB 1VACB 2YMTA 2A73B 3AGWA 3REWB 3W3BA 4NP9A 1MREH 3MX0A 1CLOH 1R3IL 2Y1AA 4PRPA 4UQ3B 4XC3L 3A4AA 1HL8A 2O61A 1HQ4A 1LVEA 2Y07L 2WVVB 3H3PH 4CSZA 3WS6C 3ABZA 1MJ7H 4AZ8B 4XP6H 3HMWL 1I3RB 1RZ8B 3MO1B 1OSPH 3QDMB 5BVPL 5CJOH 5CZKA 5B8CC 5DHEA 4U7SA 4ATTA 4Z7QE 2UWEA 3DV4A 3ILQC 3BESR 5KUMA 43CAB 2X42A 1SBSL 4MCZB 4OW6A 2BIHA 2HT3D 1QFWI 3KPPA 1Q8MA 4FQJL 1WZLA 4XAWL 5IB5B 4Z78B 3UC0L 3LKRA 5GISL 2BERA 2BNRE 1DQLL 4M1DL 2ZUQC 4ABVA 1BOGB 3WY3A 2GT9B 1J18A 3Q44A 1U8PB 3QEQA 4GUOA 2YMOA 1CJYA 3FUDA 4ZUTA 4XBPB 4AC4A 3RWIB 3RJOA 3S4SB 4K5MA 2UWEF 5T3XH 1CLVA 2H3NB 4LHQB 3EOYG 5AG9A 4WQOA 2GY5A 3OKOA 4U7KA 2FX7L 5IMLA 2E9BA 4LKXB 3IDIA 4JQXA 2FX8H 4I9XA 5IG7A 1X5LA 4HK3N 2ZUQB 3MJGX 4FG2A 1RK1A 3QPXL 2K7QA 1I7TB 4L0PB 3RL1A 3THMH 1MQKH 1M9WA 3OX8B 4LEEA 3VRLF 5LWYL 4JKMA 5LBGA 5EDXA 1B9ZA 1S3KL 1E6OL 2FK9A 1IQDB 1LDSA 5F7NC 2WO2B 5B1AB 5DD5H 3FUIA 4ZMYA 1RMFH 1U9KA 2QSTA 3MLUL 1AGEA 4M03A 4Z7OE 2HKFH 5BRQA 1TQVA 3CHSA 4OGXL 4IS6A 4BCYA 5I0VA 1A6AB 2X4UB 5AW5B 1IKNC 1JTOA 1KXTB 5I28A 1KELL 1QVOB 3BP5B 1JNHB 4AL8C 2H26A 4PJ7A 3B9AA 3JZ7A 1G0XA 4YGVA 3S8FB 3GM8A 1ZLSL 1BAFH 3DO7A 2DWDB 2E47A 4G7RB 4RFOL 3U2SA 3KBFA 5I1CH 4TULL 1YZZA 4FQIL 2VLKA 4M1DH 3EO0A 4DK5A 2DQUH 5FFOA 4Z3GA 1ORQA 1C7SA 1MIEH 3CZEA 2AJVH 1TFHA 3L9RA 3QUKB 4BFGA 4PYGA 5L9DL 4LCCA 3AB0C 4AQ8C 2PYFB 2LU4A 3N2JA 4RRPG 1U8QA 3QFDA 5DD0L 2B59A 1S3KH 2QHLA 1QACA 3T3PF 4A38A 2W0PA 5KSAC 1NGWB 3IFPB 3H56A 4I0PA 3AZUA 3T3MF 3U0PB 3QPXH 3SY0A 3CDZA 4OD1H 2NUPA 1XGUA 3ZRSA 5ILTL 4R4BA 1A7QH 2BNRD 4JUTA 4X6DB 3BVVA 5H2BA 5A40E 3BUYB 5IBUG 4YEEA 3HBPA 25C8H 3MLWH 4UQ2A 2ATKA 5D4QA 4QY8A 5J3HC 4ZOAA 1NL0H 3HKZA 5FYKE 3VD1A 3VYNA 1OW0C 1PD1A 2Q7YA 4MJID 1I31A 4XNXL 3VQ2C 1X44A 3B6SB 4JDVB 4EIBA 4O2CB 1FSKC 3WYRA 3F83A 1D6EB 3QDGA 3A4EA 4X9YA 3QYNA 1DN0B 2UUDK 3GMRB 3IU3B 2ICCA 1U8MA 1X9QA 4TSBH 3FTSA 3WSQL 3FQ1A 2J56A 1ND0A 5D7EA 2BNRB 3EJRA 1D7FA 3QB7C 4BFEA 3KYMA 1RK0A 2WM0A 5HJ3A 1I1RA 4PJCF 4D3CH 3QZLA 3FTWA 4LCWA 2DQTH 5D2NA 1F3JA 1NCGA 4OT1H 5GRVK 1A6TB 1KGUA 1N8OE 4WRLA 3U6XA 4OBRA 1YNTB 3D85D 3MLZH 2WO4A 2XV6B 1DHKA 3SY0B 3T0ED 4OD1L 1XF2B 2WQRA 4DPRA 2C7FA 3ESUF 3FMGL 2IAAC 2X89D 1UT1A 4GXUM 1IT9H 1G87A 1VCBC 1FDLH 4JL2A 1SOSA 1W0YT 2PYFA 5E8NB 2AI0L 5BQ7A 3CDGB 2I9LB 4XCNB 3D30A 5IF0B 3C75A 2O26U 1CBVL 2IH3A 4UIKL 2QLYA 4Y9BA 3O9WD 5KG9B 4UI2A 3G6AB 1CLYH 3ESPA 1ORQB 1KN2L 2J73A 3EO0B 1YQ2A 4MFHA 3L17A 1U4EA 3U2SB 3IS0X 1Z9NA 3SODB 1NIBA 4XWGH 3G3LA 3L4UA 4LCVA 3B7UX 5E1GA 2WTRA 2G3MA 3MLXL 3QJHB 3MAWA 2WOBA 3BSZA 1FFOB 4DQOL 1NM4A 3N5AA 4O58L 2ZCKL 1QTPA 1MCPL 5EEWA 3MLTA 5DFTA 1BZ7A 4D8PB 2GCYB 3AS0A 4X4MA 2DTML 3U30B 2A77L 1VHPA 2B0SL 4JFXA 3ZMEA 4JE4B 1DQKA 2Y7MA 2YUVA 1IQDA 1ADWA 4Z7NE 2VGLM 2A6DB 2ZPKH 4KDWA 4M8QB 3UAJC 3FO1A 3BVWA 4HCGA 3FONA 2K6YA 1QAWA 4F93B 3DJSA 5FLVA 4UQ9A 1JV5A 4C8XA 2C1PB 2PXYC 2JLPA 4HIHB 1JZIA 4JO2H 2ZX8A 4K5PA 3QC5X 3EH3B 3M17B 1P9MC 2HJLA 1QBBA 4RNRB 4X7SH 2FEDC 3LZRA 3MV9D 1K6QL 4MNGE 1L0QA 5CGMA 4NN6C 5I1KH 1L7IL 3BUPA 2YKKA 2VISA 4J8QA 1YEIL 3K72B 3S4SA 3LQAC 3NCYP 4ZUTB 2CMRH 3TONA 2RJMA 4NQQA 5KVDE 3UBXI 4IJ3C 4XZUB 1IGJB 1U8PA 1KGWA 3QEQB 1KYDA 3MRQB 3QEUB 3ARDA 5E99H 3WNOA 2HN7A 3QR2A 2AJUH 3G5XB 3DX1A 1WICA 1ZLVK 1MCPH 3EYOA 1HIML 4Y5VB 3T0EE 4N28A 1EGJL 4K3EH 4R8WL 3BYTA 3C8KB 1AO7D 3PWLB 2RQEA 3V4VL 3EBGA 2XU9A 4NRXA 4D0CB 1UJTA 1WIOA 1GS7A 4B9YA 3L6FA 1RHHA 2Y06H 5GGUB 4KXDA 3FT3A 4W9GC 2QQKH 1IBGL 2WXQA 2B2XH 3GTTA 3S37H 3BGMB 3SOBH 4R7DB 4JFFA 4U3CA 3SE6A 3STZA 2OL3L 3PWJB 4RRPA 1I7ZB 3DXAA 4ANVA 5F0LB 5I1IH 2DQHL 3DUUB 3C9NB 1JVLA 3B2DC 4QTHB 5FFGA 1QSFA 2OV0A 5HPMA 4DKEH 3RU8L 5DA0B 3CDCA 3FO0H 3HE7B 2QL1A 4Z18A 4AKQA 1A3LH 2VR6A 4NPJA 5B8CA 4IW4C 3GMLB 5GZOC 4HG4J 2EC9T 1FGNL 1L9MA 3L3IA 5CJXA 1WFTA 3EO9H 4MQSB 1GYUA 1NPNA 4KI5C 3B8SA 1IAKB 4AIXA 3KVPA 4I4WA 4ES9A 4LKCA 1DBML 1FVDB 2PTTA 4TKWA 3BSZH 4MJ4A 4FFVC 2QQNL 5DTFB 5I18L 4KC3B 1QUNA 3JUZA 1FYTD 5L4MA 1MJJB 4TN9A 4EOWH 1AQDB 2O30A 3F00A 2OSLA 4FP8H 1NC4B 1CE1H 2B3IA 4PW9A 1KJVB 1D5ZA 3PGDA 4UDTB 4YIQA 1U95A 4I0CC 5HSFA 5FA3B 5JXAL 3NG5A 1FVCB 4YSTA 3QO0A 3PGCB 5SWZB 2J21A 5DHMC 5KN5A 5KVGH 3ARGB 4X7EC 1JNLL 3LPWA 2F8VA 2ZXGA 2WLLA 2WXMA 3MRKB 2W88A 2HP4A 4MHHI 3L3HA 4WUUB 3WNJA 2Q6WB 2XPGB 4XRCB 1MLCB 1USZA 4XNXH 4FL4B 3A6CL 3W82A 1CGVA 3ZTNH 4KJQD 2DJSA 1EO7A 4MNQB 5G55A 4BFFA 4E9TA 2E5EA 4FI7A 5CR8A 4PVLA 4DKEL 1ZT1A 1FL6A 2COQA 2QVTA 3MCKA 4RMTA 5E2WL 5KYXB 2NNRA 3FUNA 2HFGL 5DRNB 4WNSA 2Z92A 4AENA 2KZBA 4PMEA 4U6HB 1EO8H 2XZCH 3PWVB 3G04A 2O5XL 1HHGA 3L7FB 1MF2L 5E9DD 3BQVA 3OF6A 5E5MA 3BP4B 3GSWA 4P4KD 3U82B 3ARXA 4GBXD 3HG5A 4G3YH 3SYCA 1GPOH 3EOAA 4S11A 5I1AB 1A3QA 3QWNA 4ENEC 2DKMA 4IU2B 1HOEA 1KXVA 3P0YH 1JRHH 4YX2L 3QCVL 3BDYH 4NO3B 4OSUL 2G2RB 1CE1L 1WZMA 2A9NH 4KOCA 2DLFL 4LBAA 3KBHE 4KI5E 2F1EA 1C16B 3PUCA 5ADOH 3QEQD 5JDSA 4LLDB 4X7TB 5IQNA 1I8UA 4XPAH 3FQNB 1E5AA 1JZJA 2FEDD 3D2TA 4F8OA 1OP3H 4CVXB 4NRYB 1DE4B 1PDKB 4P9MH 4TQIA 2DQCH 2YXVA 5EO0B 3RPBA 4B0MB 4JDZA 3E7JA 4FXLA 3OR7A 4A2FA 1Z5HA 5C2BL 4PLOB 4TUKL 2HJKB 3MRRB 4GS7B 2WQVA 1FL3B 1LP9B 4QAWA 3LIUA 1F5WA 2BVOB 3CFCH 4CVXA 2H6PA 1PLBA 2F18A 3QDME 4OZHE 1THCA 2WJ5A 1F2XK 2P24A 1ED3A 1ZE3H 5JQ6L 4JJ5A 1S7RB 2NY7H 2JJTC 5A2AA 3PV6A 1DLHA 3CMOH 3N0AA 2XN0A 3NCEB 1YEDB 4ILDA 5EFIA 3BVTA 4P4KA 5AQ0A 5DZ9A 3VQMA 2ENPA 1LD9B 2O4EA 4LEXL 3NIDF 2P3YA 1KFGA 3F7QA 5C0JB 3VXOB 4GRMA 3RJQB 1OP5K 4JM2B 1GGTA 1XGTA 4ISVB 4JRYB 1N8ZA 2AXFA 3QARA 1UM5L 4N3TA 1AHWB 3FCTA 5DGQA 2H9GB 4IIQB 5EFIB 5J57B 4TVPE 4XE5B 1QBAA 5B1CA 5BCAA 1X6LA 2DWSA 4HT1L 3HHMA 3P3SA 4UOJA 1SXAA 4WUUE 4AXWA 3ROOA 1OSPL 5HDLA 4WEMB 4QJ3B 4KO9A 1AGDB 3TO4A 3BAWA 4JM2D 1U8LA 4N0FA 5DMIH 1IEHA 3T8XB 4MNQE 3EAKA 2BFVL 2AJUL 3JTTB 4IGBD 4Z23A 5EBMB 5HY9A 1N5AA 3P0GB 5EO0A 4FJZA 5DJYA 4J3UA 2I27N 1T1YB 5DEJA 2WLLB 1YPZA 4PCYA 4A7VA 2B1OA 1DL7H 1WF5A 3BPLB 5D7LE 1OT2A 5SWZA 3ZTJG 4EIZC 3FU8A 4O4YH 2ITCA 5FECA 2FWUA 5EF2A 2A4CA 1BF2A 1TMCB 2HWZH 4FFTA 5EIIG 3OAUL 4MMZA 3MNZB 3ZUNC 4QOKD 1L6PA 4QRTA 1D6VL 1E4WL 1SF5A 4R96A 4NFCA 4BQ9A 1IBYA 4ZFOA 1S7VB 4POZC 5D1QA 1LXMA 3O3AB 4MS6A 5HHVH 1OANA 5DFAA 1JF5A 5EC2B 2FHFA 1E8WA 2VR7A 3PPEA 5HGBB 4XPFL 3RWCA 4Q9RL 3K1KC 3GI8H 3AREB 1XWVA 5E2TH 4HXBL 3UPRB 4GEJA 9PCYA 4LP5A 2WXLA 3WJJA 3CVHH 7FABL 3QNYA 2PWEA 1SUJA 4NQDA 2BVUA 3FFCB 3KYNB 1ZLVH 4BA8A 5EEVA 4ZYKA 2BRRL 2VAJA 3DUUA 4NZFA 3F7KA 3K6DA 2GI0A 5EU3B 3O4LE 3RFZC 2H2PD 4LP8A 4BIKA 1G7HB 1OVZA 3ALXA 1N70A 4XP9L 1DVFA 5D71H 2C9QA 1B0GB 1TZGL 4GJTB 1YY8B 2Z35B 4U4IA 2RA1A 1TENA 3L6FB 4IRSB 5T5FH 1AMYA 2XLLA 1OQOA 2P5WB 5F8QC 3HC3H 2AJVL 5I1GH 1GL4B 2ZP8A 3KCPA 2N1TE 3BRDA 1SYVA 1INQA 2EXTA 3B9KA 3IDMA 1AP2A 4G8AC 4S2SA 3V2AR 3SPGA 2W65A 3MDJA 4FCAA 4NX0A 5I5MA 3S36X 1EA9C 2DMKA 4I89A 3MMEB 5AVSB 2KI6A 4H2AA 4Y19D 1ZOXA 2GI7A 3KDMA 5HDBE 4KXZI 2MWCA 3LB6C 4JRYE 4N9OB 5T5NF 1FVEA 4JB9L 3LXBA 5DD1H 4FXTA 1XGZA 5CZRA 5GGTL 1H9VA 1QW8A 4BSJA 2UX7A 2IANE 1V7NL 2AABL 5D1XE 2YAQA 1L7TH 1S78D 3LQMA 3NRFA 1K3IA 3QISA 4Y4KC 4AIZA 3M17A 3A47A 1WFMA 5ALCH 1RZFH 1UM4H 2HRPH 3HI5H 3OSKA 5E8EB 3ZLQC 2EO1A 4TPRH 5ESVA 4OLXL 5CS7A 1J7VR 5CNHA 4PTUA 3H9HA 2L04A 4X9BA 1NGYB 1U36A 4J3OG 5BO1L 5DURB 1SVZA 4G6FD 5DHYA 3P0YL 5GRJH 3QFJD 4Z3IA 2G3ZA 4JFFB 1YYML 3KBEA 4FXKA 3QS3A 4GYBA 4ESKA 4LEBA 4ONHA 2BCKA 3BO8A 5C8JA 2UZYA 1F1DA 5C0FB 1H8LA 1E4HA 3ZL2A 2R29A 4FNTA 4HSQA 4N2IA 2A4EA 4JB9H 4JFPB 2X89A 3VFPA 3P2DA 5AEAA 1FN4A 1IIKA 3NPSB 3X14B 1T5XB 4YSEA 3WXVH 1MFNA 3QUGA 2NW3B 3CZNA 2VH5L 3O6FD 3POHA 4TUOA 2G30A 1HESA 5GGRA 1HK6A 4QRRE 5LGKA 3KPQB 4XN9A 1KIQA 2B14A 3NESA 1M6OB 3FPYA 1UTDA 2WKOA 2NPLX 3T09A 2OMNA 1BQ5A 3AM8C 3RVTD 4XP6L 5AYUL 5HYSG 4BZ1L 4RZCB 1RUQL 2I07B 3HPJA 1BVZA 1JZFA 5LXGL 3RGHA 2DMCA 1MRFL 4XP4H 4PJXB 3LKQA 2VLKD 2X2JA 4QJ5B 3N44B 2OZ4L 5AVRB 2C9RA 1MJ8L 2BC4B 4FQLL 1DQLH 4FA8A 1HHJA 3ROLB 1PEWA 3U1PA 1T1YA 2O6FA 1JE6A 1NFIB 1A8ZA 3ZK0A 4NQUA 4CVZB 1Q9OA 1SMOA 3MRIB 2ICWA 1C08A 3QG7H 3LHPH 4AYID 1WIUA 5HHOB 3MLRL 4HFWA 2NMSA 1NOAA 3MJ9A 4X6EA 4N0FB 3A5VA 3TJEH 5I8CB 2HUHA 32C2A 4Y4HC 1OGTA 4XMLL 1YVLA 4BFJA 2VO8A 3DSFH 5SX5K 4QHUA 3TM6A 1HL4A 4ANXA 1OE1A 5ENWA 4AXWB 1E5UI 1HH9B 5ENWB 1G1YA 3IFOA 1D9KA 1G7QB 32C2B 2BVYA 4JHWL 4R7XA 4X6EB 3T1FA 1KB9J 4ZXBC 3DX6B 1N2RB 2XRAH 2YD6A 5F97E 4YSSA 2XN9A 3WIIL 4BUGA 3ZT7A 1PZ3A 4UIKH 3TYGH 5F7EH 4UTAL 1HXKA 1CFMA 1FGVL 2X4RB 5I18H 1EEYA 3BAKA 4FFZA 3OKKA 4ZTOL 2I32A 1CDHA 1RJLA 4NLAA 3O2DH 4X5PA 2WQWA 2VM9A 4LSSH 1YMMB 2FVNA 1U8QB 4GP8B 3NA9H 3HPJB 4PUBL 1E27B 2I07A 1FFTB 2QKIA 3P0VH 2G3NA 4U1IA 3T04D 3V5KB 4NAMA 2G4GA 4LCCB 4G1MA 4O51B 5JHLA 5EBWA 4CC1A 4L9LB 3F7LA 1JYVA 4AEIH 1R3HA 3DMMA 4WAFA 3UJIL 3RPIA 3WN5C 2NLJA 3IU4H 3KXFD 1MAKA 1L9PA 3T4AB 5J1AB 4OQ1A 2P5EB 4OIIH 2X3CA 3FULA 5DC2A 1ULVA 2R1WA 4GAJH 3U6RA 2B1HH 1IBGH 2Z0UA 4I3GA 4YBQD 3SKUD 3U4EB 3QUXD 4HH9B 1N2RA 1HNGA 4JGUA 4ZUUA 2EUVA 4AYFB 4NRYA 1JNHA 3RNQB 1DBBH 3C5SB 3PL6B 2R56L 1MW1A 1AQHA 1D9KB 4MVBC 4O02A 3VXUA 4Z7QB 1R0AH 5GS1C 1F4YL 1OGTB 4KTGA 1WWBX 5FKAB 3B2UD 2WZ5A 4FNPA 1URIA 3NJJA 2A2QT 4AEHL 5F0PB 1Q90A 1T5KA 2FEEL 4M62H 5F7HA 4HEMA 3QUXB 4F91B 1DJZA 2P52A 3QEGH 1Q9OB 2Z1PA 3GMOA 3HN3A 1EMTL 3OG4B 5FYKL 4H88L 3GKZA 4LRNL 2V2WA 1JFQH 3UBXA 1SLUA 3WU1A 4OFQA 2VN3A 2WZAA 1M71B 3PWVA 3NABH 2AGJL 3UERA 5AVUB 2B59B 3G6JB 3A6OA 4ZRGA 5I73C 1MCCA 2EDLA 5L9DH 1QWHA 5I74C 4PWEA 3FNKA 3WKML 2BMKB 5AD0B 2IPTL 4KY2A 2YD5A 1AQKL 1M6OA 3L9RB 1KIQB 4ZAKC 3SKJH 1EJOL 1JGVL 3RVTC 4AGNA 4OZFA 4XB7A 3L3HB 3KCPB 2W9EH 3EF7A 3HVNA 3T6ZA 4ZSOE 1OAYL 3LIZL 1XF5B 1JWUB 4NSKB 1I3RA 3SDXA 2L0DA 4WF7A 3IYLW 4ETYA 1CICA 2HYMA 1DVFB 4H88H 4HZ1A 2XWBA 1AGEB 1Q0YL 3PFQA 1PVHA 1U95B 4BYHA 4D8OA 1D5ZB 3PGDB 4UDTA 3K1DA 3Q8EA 4DVRH 4NUMA 2ESVD 2UZPA 3F3HA 5CEZD 3VD2A 1QHPA 2IMNA 4M62L 4B9FA 3W38A 4OLVL 3PCYA 1SHSA 4NQDB 4ZOEA 1MVUA 3GZPA 2AQPA 4W68A 4B95C 4HUKB 3WS3B 2A9CA 4HVBA 3MJ8B 5FHBH 5E8EA 2VYRE 1HYRC 3FQ4A 4FE9A 3N9GH 1I8AA 2VUYA 3AS1A 1C5BL 3IDIB 3ZDZB 3LHAA 4CILA 2VCOA 5CILL 4DW2H 4UNVA 2YGNA 3EJUA 1TT6A 4RSVA 1FH5L 3H3KA 3MGOB 4FTVD 3HE7A 5FLUA 1EHAA 4KH2A 4S1RH 3V0WH 4D7BA 3FTVA 5TDNB 1BQHB 1N0XL 4JVWA 3C9NA 2EC8A 4X9HA 2NQCA 2ITFA 5JW4Q 5C92A 1BXVA 1U2CA 4AVKA 5CBAB 4YDLB 4BZ2A 1T0OA 1ZXQA 3VGEA 1NCBH 5IT2H 1WH0A 1Y18B 3AQZA 4RWYH 3DOIA 2P5ED 3VFOB 2CBTA 2V8LA 2EIDA 3TT3L 4GQRA 3V0GA 3UTSE 2Y7NA 1QR4A 3X17A 3FB8A 1B2WH 4PGDA 4OV5B 4G8EA 5AAMC 3GSNA 4YLQT 4A6YH 1HEZA 4MMXB 5HHMD 4RGND 4KHTL 5KZCB 2Z35A 4TLUA 4LFHD 4KO7A 5IBLC 3T8XA 2VLJA 3NIFB 5CU9A 3LDBC 5F21B 1XAUA 3KPOB 1G9NH 25C8L 3MLWL 2B4CH 2O93L 3QG7L 5AD0A 3OWRA 4WV1C 1GJIA 1LEGB 2CKBH 1JRHL 4YX2H 4XPTL 1CFBA 1FFNB 1REIA 4LVHC 4M1CD 4QRSA 4O5LH 4M02A 5BRPA 5KYUB 3O3EB 4YPGB 1T1XB 1F4WL 4H1LH 3P4OA 1KDIA 3VDAA 3UO8B 4FQXC 4RNRA 5DHVB 4X4YB 2XV2A 1VFOA 2CHXA </