2EVIA

Structure of a ndt80-dna complex (mse mutant ma8t)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
303
structure length
290
Chain Sequence
b'VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*AP*CP*AP*AP*TP*AP*AP*C)-3'
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle/dna
total genus 86
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2eviA00
1M6UA 2EVFA 2EVHA 2ETWA 2EUVA 2EUZA 1MNNA 2EUXA 1MN4A 2EUWA 2EVJA 1M7UA 2EVIA 2EVGA
chains in the Genus database with same CATH superfamily
1M42A 3ASWA 3NZSA 3WAJA 2O93L 2B8OT 1I7RB 4UQ9A 1IGYA 4B41A 4Z7OF 3QE5A 3CZEA 3SY0B 3C8HA 3Q5OA 3P4OB 1KLFA 4JG1H 5G4OA 5C0GA 4WI3A 2ALAA 2XWRA 4NN5B 2HB0A 4WUUA 3QZWG 4HJ1A 5SWZE 3ESMA 4NRXB 2OXHA 4J3XA 4U49A 3FU0A 3N85L 3GM0A 1YG9A 4RETB 4X83A 5CILH 2BP0B 2CXKA 1IZJA 4FFVC 3TNMA 2IALB 2VO8A 1TVBB 2ZD0A 4M1DL 1I75A 4HGWA 2PTVA 3VD7A 3UTQB 3NIGB 2ZOTA 5BS0D 3LH2H 4KO6A 5CWSB 1JPTH 3CVDA 2VXQL 2GT9B 2QZ5A 5CGTA 3RKDD 2OCFD 3UCQA 1IO4C 4LAQH 4ZMPA 3DO7B 1XL4A 4J3OF 5FYKH 2QELA 1I3GH 4RDBA 4H4NA 4ELKB 5DZNA 1OB1A 4ODHH 7CGTA 1QLRA 2AJ3A 4KMQA 4R0LB 3PP4L 3W11C 2E74C 3RPBA 2UZXB 2Y2YA 3ZTJG 2OAAA 3DRTB 1TJGL 1J0ZA 1SJHB 4NP4H 1IBZA 1DQQA 3LNGA 1LXMA 2K6WA 3NN8A 3Q6GL 1G6RL 1VRSA 3KYKH 5A43C 5C0DB 5D6DA 1BVOA 4OLEA 2DQEL 3PPEA 4Y9FA 2F54B 5F6IB 4MNQB 3LRKA 3AB0B 4H0LC 2DMBA 3WO3B 5BVPH 2NLJA 4MJ5A 1QW8A 5LVEA 2DDQL 2WN3A 5E9NA 5SWSE 4DAGL 4E5XG 1Q90A 4ZW5A 3IKCA 3HPJB 4WWKB 3D08A 4M1GH 3ARPA 3N5AA 3SDDA 1YC7A 1IGJB 3CX5J 2ZKYA 5B3SB 4JHUA 4XWGH 4Q4IA 3DTDA 1AGCB 1JG9A 1QI3A 5DQDH 2SEBA 4X5LA 3U46B 3AREB 2ZNXA 4Z5RB 3U9UA 3MUGB 1Z0MA 1WD8A 1RJZB 3SE3C 1RLWA 4TF4A 5AQ0A 1SYSA 3TIEB 2X4TA 1TR7A 3CSYB 1UD2A 5DR5L 5EU4A 4HU8A 2VQUA 3UJTL 2EACA 3QFJD 4E41A 4K0OA 1T7VA 4EDXB 1K5NB 4M5SA 1ZHNA 4U1GC 3IMTA 3PWUB 3CC1A 3QXTA 4MAZA 1J9QA 3N85H 5C09A 3WFBL 1Y7VA 1IM9A 4OQTL 4LPCA 3O4LD 4OVVA 5HDWA 4FX5A 2ED9A 3WJMB 1PNDA 4M1DH 1Q9OA 1TDQA 2D7OA 4FNRA 1PEWA 2XXGA 4NAMA 1U8QA 2B9AA 2E4FA 2RCSL 3DGGB 4QXUL 2MTAA 4A66A 3SYOA 1UZGA 4YDJA 5AEAA 2YRZA 2VXQH 1QSVA 1IC7L 1YY8A 2J5LC 1RIVL 4M62L 5E08H 4MNHA 1ACYL 3G6AB 2GEQA 5CEXA 2BNUA 4OZIB 1SF5A 4JBSA 3PP4H 1KIUA 1O6SB 2BFGA 3IMRA 3RGVB 1E3ZA 2ZUTA 1L0YA 1QRNA 1TJGH 1XF2B 3IMVA 1UD6A 1AANA 3HOGA 4MHHI 3Q6GH 3N44B 1V8HA 1G6RH 3VMNA 4MMXA 2BNQA 2UXVA 4CN1A 3MBWB 4F92B 2QVFB 5EZLA 4JFOA 2DQEH 2WIIB 1NCGA 2Z0BA 4WTXA 3HG2A 5C0FA 1C5DA 4LOUD 4JFQB 3A4AA 1S9WB 4XXDB 5I0WA 2DDQH 5FDWA 2PR4L 4DAGH 3ZQWA 4FNSA 2TRHA 4P5SA 5F7AA 3QUXC 5LLIC 3SYAA 1OQXA 1AGFA 4MA3A 3EG9A 4WU7A 3WL9B 2CQVA 3I6LD 3VVVA 4I0PD 3B2MA 4WFHD 5C7XH 5I1DA 1F6LL 3NJMA 4P2QE 1AH1A 3NFNA 3D25A 3FB6B 3QZOA 5CR1A 2DWTA 1MFVA 5MI0C 4DERA 1CFTA 4XPTL 5HGHB 2Z65C 4PWKA 5DR5H 3BIAX 5C71A 3UJTH 2ZCLH 3C6LC 4HHAA 3CSFA 2NY0D 3OG4B 1CTOA 4BBWA 3ARBB 4LHUG 4KU1A 5I6PA 5HXMA 3FT3B 3DXAB 3SDCC 3L4XA 1WDAA 4N24A 5SWZB 3SDAD 5JMRA 3WFBH 4CNIA 2G0LA 1JK8B 1NOAA 4OQTH 3UP6A 4IBTA 2EDBA 3FT1A 4RH4A 3R06A 4MJID 3ZSSA 5F1KC 4FABL 2WYZA 3K6SA 2RCSH 4QXUH 3IVKB 3P1VA 3WNOA 2QBWA 3N1GC 2B5IC 5CSZB 2FO8A 4AQ8C 3RJOA 4KQ3L 1RIVH 4Y4FA 5BZZA 3F12B 4M62H 4IGBB 3QQ3B 4Q6IB 5IREA 3WMPA 4DVBB 2HLEB 4IMKA 3I75B 1ACYH 3E6HA 3B7YA 3V8CA 4HVBA 5K59E 3Q05A 4XN7A 5DU7A 3H9YA 3U6XS 4F5CE 2QMKA 5E6ZA 3BPNB 3LVEA 4BFNA 3L13A 2NR6D 3QPXL 1S78C 2XN9A 1CGVA 2Z8VC 2R0ZL 3QC6X 4WUKL 3H7LA 4WNJA 2XRAL 1I3VA 2ENQA 3C5JB 4WHYG 3SQRA 1NCDL 5I5JA 1ORSB 1V3JA 3VRIB 3VWJC 3UIYA 3ULUF 4Y4KA 2ICES 3UBXB 1Z9MA 1HILB 3KE0A 2WUBL 3TWCL 4M5TA 2PR4H 3VFVA 1SJEB 2OMXA 4FYSA 5SWSB 1Q9LB 1K4DB 5DA4A 1P4BL 4GT0A 2WSKA 4PYGA 5KVFL 3FU8A 3WI9A 3LRLA 5IJBC 5JW4M 3O45B 2DTSA 4FLQA 3TBVB 2A74B 1JUFB 4N90E 4ZO6A 1BQKA 2GBVA 1UADC 5FOBB 3QUKB 4C83A 1BQSA 1VFOA 3CFNA 2VITA 3P4MA 5E8EB 3MTXA 1JGEB 3D85B 3MYJA 2JB5L 1KJMB 2OTPA 4J3OC 4RNRB 2CIKA 3NP3A 5DD5L 2OSLA 3DPBA 4U6YA 3AADB 2PWHA 4X6CA 5GRZA 2CPUA 3ILQD 4YSOA 1SDYA 3BH9B 2RMNA 5JW3L 1JFHA 3FO2A 3NYKA 5IKCB 4Y0GA 5HI3D 2BVTA 2LHAA 4HK0A 5D7JA 3RG1C 4AH2B 2DIEA 2IPKB 4OU3A 2AAAA 3HRZA 3GD1C 1HHIB 4FABH 1U8MA 3MV8D 3NZ8A 4IRSC 2MCMA 2CJ3A 1J5HA 4F1ZA 3VFSB 4ALAC 4E42A 1TF4A 3AQYA 4KQ3H 3CX2A 3QPQD 2H3NB 1CDJA 2WN2A 2NMSA 3GSVA 3T0EA 2WPGA 3NCJL 3W5NA 2OP4L 3MLWL 3C12A 4PGBB 4LEBA 1LD9A 2B9BA 3PJLA 2KS0A 3CLWA 3QWQB 3ZDXE 3ZMEA 1UWEL 1LWRA 3KPMA 3MRIA 4PJ8A 5HHOB 1MKFA 2Z31A 3Q1SL 4K71C 4JO4L 4W9ZA 1EO8L 3C87A 3TJHD 3WXVL 3ZN6A 3BEWA 2R0ZH 4RRPA 2FGWL 5ECJE 2JIXB 4WUKH 3OX8A 1A8ZA 2XRAH 2K3TA 3H3KA 3QIWB 1KTDA 4GKOA 4JM4L 5IW1B 1OK8A 1NCDH 5K9QG 4Z76B 2ZKXA 4ZOCA 5F21B 5B8CC 4MRBA 1R3HB 5T1MB 2EXSA 1P4IL 3RL1B 4FQHB 4TLKA 4B7LA 2DQFA 2J7LA 3N06B 1ZLWH 1IC4L 2WUBH 3TWCH 2HTKD 4HS6A 4EZJA 4FQPA 1FFTB 3HR5B 1NCAL 1TQCB 3D52A 3IXTA 4M29A 5E56A 2V9TA 3PNWB 3P54A 1P4BH 2CO4A 1Y0LB 5F88B 5KVFH 4NS0A 3DETD 4BQ8A 2P5WD 4GIOA 2E7DA 4APQD 2W0PA 1XH2A 4QXVA 4D0CA 5AG8A 3IT8D 3GEWB 5FYJE 4HKJA 1VFMA 3TVMB 5D4HA 2DJMA 3NMEA 4K7PY 3V4VA 1AOZA 2Z7WA 3MA9L 5ID1A 3M17B 4N9GA 2ARWA 2JB5H 4QDGA 3V9CA 5E8PA 1NGQL 5F7FA 1BVLA 4NI6A 5DD5H 2XBZA 3VFOB 1CC3A 4G8EB 3X12A 4E68A 4R96B 4XC1L 2VDLL 1DBBH 1XH3A 3RVVD 3O6FB 1NH6A 2X0UA 4J2QA 4YFLF 4QO1B 1P5UB 1XF5A 3FUNA 2K70A 4FERA 1SMOA 2VDPL 3FQRB 5JW3H 1ML0A 1QSFA 1IAII 1ZT7A 3MJ8A 1FC1A 3MRGB 3PGCB 3SO3C 1WISA 4HAGA 2DBLL 4NOBA 4KJYB 4AX3A 1OF2B 2VMCA 1BVNP 3WAKA 3C5ZA 3HVDA 1N3NB 4QXGL 4XN9A 1MLBB 5F0MB 4W9IC 4JY5L 1M1SA 5E8OB 4FRWA 5AW9B 4WJ5B 2WNWA 3QEUA 3QXDB 4JANA 4ZO7A 5HI5D 2BW4A 2GIXA 3NA9L 4PJ5B 3LN9A 4HF5L 3VWKD 3SBPA 3NCJH 1UACL 2OP4H 4AM0A 3MLWH 1ICTA 1GGBL 3FF7A 1JPGB 1UWEH 3CZSA 4JZOB 4PRAA 1DJSA 1W0VB 5T5NF 5IB2B 3OAUL 3NTCH 4JM2A 3CU7A 3Q1SH 1UFUA 1EO8H 3TWYA 4HLZH 4FI7A 3RURA 3WXVH 2AJZA 5B4MC 4R97B 4HJTA 3CBJB 2FGWH 4LVNB 4RX4A 4OZFG 4JM4H 1AXSB 3RWGB 4XNBA 1G6VK 3D06A 1REIA 1P4IH 3D6GA 3GHBL 4G8IA 3WY3A 4FD0A 3RRQA 2H26B 3VXSE 1IC4H 5IVZB 4EN3D 3C60D 2FL5B 1NCAH 2BVOA 2YUWA 3RPIA 3MKGA 4QKTA 5K9KB 4HIIA 3N91A 4JKPL 1L9OA 4P2QA 2E7BA 3U2IA 3WSQL 3IE9A 3JSSA 3MA9H 1YQVH 1OCWL 1OSPL 3C09C 2DWXA 2BINA 2WXIA 3ZL1A 4N8UA 4OD1L 1NGQH 2XV0A 3N1MC 5I8CA 3M86A 3HZYA 3DOSA 4MXQD 2VDLH 3D09A 4XC1H 3VH8G 3G5ZA 3G7TA 4ODXA 2X2IA 4OGAC 4X2UA 1A2YA 3KPSE 2IMMA 5J11C 4I77H 2DLGA 3K80A 3QORD 2YEVB 3KLAB 1V05A 1FV1B 2VDPH 4KROC 1CR9L 1JE6A 1JF6A 1BW8A 1ND0A 4IRZA 2DBLH 1UG9A 2BP8B 4UDUA 5BPPA 5IVXA 3G5YA 5CNHA 2V7NB 5A40E 3CHOA 3ULUC 1J86A 1QTPA 4LKXA 3GHEL 1BF2A 4QXGH 1J8HA 4JY5H 2UWEE 3Q3GA 1WITA 1WJ3A 2J1ZA 4ZQTA 4FTDA 2V2WA 4X6DE 4Y2NA 3WTVA 3NA9H 5EBWA 3QEHA 4HF5H 1G7PB 2P5EE 1EJ6A 5JXED 1UACH 2BHUA 1AACA 1GGBH 4JFYA 3V79C 4JPIA 4F5CA 3ZDXB 2K1MA 3OAUH 3FUEA 1YPZE 2XZAL 2Q8BL 2BOBB 1K2DB 2GITB 4UDTA 4N6RB 4BCZA 3G5VB 4J1UB 1F90L 1OTTD 2GSIB 3N41F 4JL2A 4EI5C 3ZE1E 2W91A 3SZ6A 3AG4B 1ZJBA 3BKYL 3FB5A 3RPKA 4R7NB 1R46A 3GHBH 4JKNA 5IF0B 5TE7L 1QI5A 3D69B 4F9LA 3D0LA 1INQB 1UQSB 1WA2X 3ESUF 1RV6X 2NXYC 4TNWF 5KSBB 2WMPA 1T0PB 1SEBB 3BP5A 3HZMA 4LLVB 5F7KC 2G2PA 1FG2B 3GO1L 3GSNB 3MOAL 1I7ZA 3QDAA 4PJCB 4JKPH 3TYFA 4Z23A 1EDYA 2IGFL 4HKBA 4L1SA 1UKQA 5CSBA 1QWNA 5E8DL 4NYLA 4Q8BA 5DRNA 4G1EA 4GW4B 1OCWH 1OSPH 1ZE3C 4LARL 2QPEB 2WWMD 1UT2A 1W8OA 2XWXA 4HCRL 1CXFA 2XLLA 4OD1H 4HXBL 3BVVA 3FO0H 4EUPB 3S3JA 4ZUSA 5CLWA 2GAZB 5B21A 3ZQXA 5LG1A 2GK0B 4YHML 2G60L 4WFFD 1H6EA 2FEJA 2HMIC 1U33A 2G4GA 4MTMA 4WIQA 3CLFL 1CR9H 2ICEB 1TCMA 3G5XA 3GI8L 3U36B 2JNZA 2BIIA 4OCSL 3WS6A 5IESL 3VD5A 1D5ZA 2XWCA 3E6FB 4YSAA 3ECUA 5FGRA 2CKBA 2ZP9A 5EUOE 3RJQB 3I6LE 3MR9A 3GHEH 4WFHE 3Q2WA 2ETWA 2G0KA 1KGCD 3GRWL 4OCWL 1QI4A 1YEDB 5GSRA 3OTTA 1CXKA 3RVTD 2IAND 3J7HA 2F68X 1KBPA 3S5YA 5EC1A 2ZICA 3FN9A 4R26L 2WBWB 1RZQA 3ARGA 3UZVB 2WOYA 1DLHA 4JQXC 3ZY7A 1CGWA 4HIJB 4TSCL 2J6EL 1OP3K 3OL2A 1TEGA 4GOSA 3QBTB 2E9IA 3VJ6A 4GINA 2XZAH 2Q8BH 1BA9A 4FTVB 4HWUA 4OZGB 1YNTB 2Q2EB 2QLYA 3GBNL 2VJ0A 1F90H 3L9BA 1JMXA 4QAWA 1KBKA 3BKYH 4YK4C 2FLBT 4F2FA 2EDHA 5TE7H 3TESA 3EH5B 4HPOL 2RR3A 4M7LT 4L37A 3CFEB 3VXSB 3UAJA 1GGTA 4H1LA 4I1PA 2KDYA 4L8CB 2VC2B 3VRLE 2PPDA 3GMOA 3JQOB 2X4OB 2EO7A 3D2UB 3MOAH 5HHQB 5FF6B 3WFCL 4LNRB 1TQUA 1SQ2N 1U42A 3QUZC 1T1YA 2FHBA 5E2TL 5C0ND 3B2DC 2Y72A 5T1JA 2G9HA 5DD3L 1KBWA 2XFXA 5E8DH 3KG5A 1YN7B 4JRWA 1YUKB 4LARH 2NY2C 4TNGA 5KJ4A 2AKRA 1R5WA 5ES4B 5JW5B 3EXJA 4HCRH 2A2QT 2E8ZA 5KVMC 5DK0A 4HXBH 1A6WL 1OARL 2HLFD 1I1AC 4EIBA 5MEPA 4G42B 5EFIA 2EUWA 1LQBC 3FT2B 3IAQA 4CMMB 1KZYA 4HT1L 3C08L 1DUYB 4YHMH 2H32H 5L8KB 4LB8A 1OSZB 1P1ZB 2G60H 3FT4B 2JF1A 3ARDB 5IROA 1UCBL 3OKKB 4C56D 3HMXA 1ZHKB 3KPSB 4LGRB 4DK5A 4L1HA 5BW7C 2BSRB 2VZUA 3GXPA 5FEBA 1HZKA 1OWWA 3CLFH 3PQYB 3GI8H 1EAPA 2F7PA 4OCSH 4XCYB 2IIJA 1MFMA 5IESH 3OLGA 4GRWH 5DVMA 1G7LA 1HL8A 2FHCA 3NIFF 3QI9C 3BGFB 3APFA 3HS0A 2YRLA 4OCWH 1FNFA 3CXHJ 3GRWH 3HG1D 4ZFFB 4BHUA 3VQ2C 1WFNA 4PVBA 4YXKL 2UWEB 3VCLB 3HUJF 4AUUA 5B7EA 2R4RL 3FSAA 3HC0A 2CO7A 1G87A 3C2SA 4GFXA 4R26H 4X6DB 4CUCA 2EIKB 3KPOA 5KSUB 1OP3H 2P5EB 4URTB 3GSRB 3UDWA 1W72L 3BSZL 3BUBA 4L18A 1JGDA 1G7HA 1CFNA 2BJML 2EE6A 3PREA 5AUMB 4X7CC 1FVEA 3TIDA 3ERXA 3L1EA 3GBNH 3H8NA 4LSSH 2VQ1A 3HZ3A 3NRQA 1MVUB 3B9AA 3VFRB 4ZO8A 4UAOB 2NX5D 4H44C 1RZGA 2AV1A 3FQXB 4HPOH 4KJPD 3W37A 5BS0A 2C8NA 4C58B 1S8DB 1EV2E 2Y7SA 4AEIL 5DGRA 1ZIAA 1U21A 2P43B 3UAEA 1JN6B 1TU2B 5CS7A 2Z92A 1CVRA 3WFCH 5ITFA 5E2TH 1W8NA 1WT5C 1CGSL 2BCMA 4UOW1 4OJDH 3D50A 1LP9F 4K3EL 5E9DD 4N1HB 5M94B 1M7DA 4L8DB 2CDEB 4WHCA 3TM6A 3EYVA 4RSYA 4M8UA 3QG6A 3GSWB 1A6WH 1OARH 2XTSA 3SCMC 4RZCB 4BM7A 1ZE3H 1BQHG 4J8RB 4HT1H 3C08H 1I8LA 4H25A 2YPLD 1H3GA 1T21B 1X4ZA 4JRYE 4PRBA 3QWOA 1NUFA 4ZX4A 1UCBH 2J2ZA 1Z0NA 3LD8B 3ROOB 2G2RB 3SPGA 4L9LC 4WKZB 5CU5A 3RQ3A 4JJ5B 1WBXB 2WINA 3MV9B 4F9PC 1OM9A 3S36X 4H8PA 4Y9GA 4AMWA 4NC0B 3NACL 5LDSA 1AQHA 5A2BA 2P5WE 3FULA 5EUOB 5CKAA 1JNNL 3ARVA 4XCNB 1QFWM 2HT4D 1JDCA 4KTEL 3BVXA 5HYJD 2OZ4L 4XBGB 2X4RA 4YXKH 4XPAL 5DO8A 1XO8A 4HMDA 4HV8B 1CFSB 2R4RH 4UM9B 2JE8A 2PYED 4LLWA 5FGBA 4KQ4L 1J87A 1N8ZA 4WGKA 1NBQA 3DTXA 4HWBA 3QFJA 3WO4C 1A9BA 2OMYB 4LPXA 5CLXA 1YPZA 1W72H 2BJMH 1L6PA 3W3BA 1EEZB 5JHDD 1KGJA 4YHYC 3PWLB 3MBXL 1J05A 1JZJA 3O4LA 2ESVE 1EZVX 1TETL 1YMHB 2Y6SD 3V95A 4AQOA 2FR4B 1KPRA 2AQ1A 4AC4A 3IFPA 4XPHL 5KAQG 1FO0A 1DVSA 1FZOA 4HIXL 1ZPLA 4G43B 1RPKA 3IAGC 2YAPA 3WLBA 4EBQL 1PNCA 1JRHL 4AEIH 4RMUA 2P8LA 5CUSL 1T5WA 5C9KA 1I1YA 2LFEA 2BDNL 3MFGB 4YSCA 3PDGA 5IB4B 1UASA 1WP6A 5DJ2A 4HZAA 1FZJA 1FFPA 4GLRH 2CLVB 3D33A 1Z5HA 5F44A 4B97A 4BA0A 4K3EH 4BFRA 3E9UA 1MZZA 1JDAA 3CFDA 3PUCA 1TZHB 4J39A 3OMZA 1WFOA 1Q38A 4OI7A 1U36A 5L0QC 2GC4C 3GYRA 2IWEA 1BWWA 5F7DB 4TNEA 2CXGA 1R3LB 1MCJA 4S1DC 4GRLC 3TZVB 5JOFA 3QZPA 2AQQA 2NY3D 1XWVA 3FRPA 1VCAA 4LQFL 5E1IA 4ORGB 1MCIA 4FQLL 4POUB 3WXWL 4GUOA 5TDNA 4JPKL 3TBSB 5I1AA 2I9TB 1JI1A 1K3ZA 4NQDE 1NGYA 3ZDYF 1ZT1B 4K8RD 4KI5D 2FWOB 4QF1A 4R8WL 1J18A 3ELQA 3LKRB 5TQ0L 2YGOA 4PY8J 2WLJA 4UZSA 4I0PA 2HJFA 2X3AA 5HGDA 3IGKA 3PL6D 3GMMA 1JNNH 3BXNA 3V0DA 2GSGA 5E9AA 5FA3A 4YSEA 4KTEH 2F74A 2XTJD 1MLCB 3ALXA 3LV3B 4XPAH 3GC3A 2HVJB 4GB9A 4JUTA 2Z7YA 1URZA 1X7QB 3AXHA 4KQ4H 4B0MM 1KULA 3M88A 4HKZA 1VAHA 3P73B 1OD9A 3QS2A 3T3MB 5C0IB 1H0DA 1EFXD 1H5BB 4ZAKC 5D4IA 3IU3B 1UJ3B 2HT2D 1JHTB 1IQDA 2K6ZA 3COOA 3UTPD 4JNXA 4I89A 2ITCB 1FFQA 2XVGA 2E59A 2ENSA 2VL5A 5T1LB 3SDAA 5CKGA 3UG5A 3MBXH 4YDLC 2NT0A 4ZG1A 1KB5L 1TETH 2N7BA 4Y2DB 2WGXA 5CBAB 3WEXA 4P5TD 4RAVA 5D7HA 4ZS6D 2E6PA 3GK8H 4MJIA 2ARJB 4NSKA 2EDTA 4NRZA 3LSOB 5EOQL 4XPHH 2VR6A 4LLMB 4EN2A 1DVUA 4HIXH 3EGXB 3NIDE 1PY9A 3KL0A 3IDYC 4EBQH 1AIFB 3THML 3ESNA 4HSQA 1JRHH 3DOHA 5AZ2H 5CUSH 4BFKA 4F7EB 2BDNH 4KY2A 3QEGH 4DKFL 5A7EA 2NY4D 4PG9B 3F00A 3B9KC 4X8GA 1DEDA 4PLKD 5LBSH 3VTMA 5LGKA 1N18A 2G3NA 3RVUD 2O61B 2DQ6A 4JAMB 2NR6A 3P9LB 3ARFB 2Q6WB 2KQMA 3O0LA 1HJCA 2LAGB 3OQ3B 1RVFL 3JV4A 3QNYB 4ISVA 3SGDI 2YJLA 1E90A 3EJZC 4WI7A 1OP5H 5BRZD 3KH4A 4PJBF 3CUPA 1VGKA 5D7IF 1P4UA 2N1TE 2X42A 5DJYB 4DHLA 4NFBA 4LQFH 4HJEA 1MN4A 4JRYB 1UVQA 4FQLH 3WXWH 1DBAL 1OW0A 1FNHA 2OYKA 1A6AA 2HJLB 3NAAL 4JPKH 4ZD3H 3CFKB 4ELMF 1SZNA 3FDWA 4L05A 5KSAA 3S96A 3VYNA 1IC5L 5FYKD 1FIEA 1D5MA 4R8WH 1L9QA 1AO7D 2YBRA 1CXIA 4KUCF 5TQ0H 1U9KA 1MVYA 1PAZA 1S46A 1L9TA 3SQBB 5TFSL 4AYDC 1JZEA 3PV6B 2IDCA 2KPNA 2VXVL 3BO8A 1HEZA 2IV9A 2AS5M 5FHBL 2DS4A 4G6KL 2Q7AA 4JFHD 3VVWA 1OGTA 4Y9EA 2AXFA 3BD3A 4P3DA 5L4FA 3WIIL 4JO1L 4JFWA 3VE0A 4G7YL 2LVCA 3DX7B 3ZRCC 1WFIA 3QZWA 2CRZA 4G6AD 4NQTA 4WFFE 3V5HA 4HH9A 4XN5A 3LH9A 2IDSA 1OK0A 1PCXA 5I17A 3MRKB 3HC4L 1TIUA 3INUL 5IW3A 1KB5H 1Q0XL 1R33A 2ESVB 3LQAC 3VFUB 4HSAC 3V9FA 5EOQH 2NYYD 5HP5A 3RNQB 2Q1EA 3MV8A 1OAUL 2CK2A 3AACA 4PREA 3V8OA 4Y1AD 4N3TA 3UMTA 3THMH 3BFOA 5HYSB 2WHVA 3IJHB 2JI2A 3CHSA 3L7FA 4AZ8A 3L3GA 1JAEA 4I9WD 2H1LM 3BQUD 4QRRD 1UD5A 3OKOA 2QTVA 2YXVA 4DKFH 4YMPA 4NN7C 1NBZA 2AQRA 4AQEB 5DHXB 1ZA6B 5EHFA 4BUGA 3DIDA 4RMWA 5EF3A 1HL5A 4G9DB 1FYTE 4AI7A 2NY5L 4TULL 4NKOA 4CU7A 2WQVA 4NAJA 1RVFH 1T4KA 2YGNA 2C1OB 3TO4C 3DI2B 4B3VA 1I1FA 1L0PA 2CR6A 1ZRUA 3HAEB 4U1SA 3IMBA 3AAZB 3FH7A 1FVDA 1MFCL 4L29A 2F58H 4F15B 1IGCL 1UXMA 2BSDA 5DRWA 1DBAH 3NAAH 1MUJA 2F1AA 4YIQA 4E5XA 5C0BD 4G6FB 5J1TC 3QRFM 2N7AA 5G5DB 4KRNA 4NQEE 1IC5H 4NQDB 1P53A 3IETA 1JXGA 3VI4A 2C1PA 5GGTL 2P5WA 4Y5XA 4UV4L 4H8WC 1XGUA 4APQA 4AXWB 5TFSH 5ENWB 5DHDA 1T0NB 4MXVF 4O51B 5KWYC 2VXVH 4OQ1A 4BFEA 4ICXA 4HLZG 4G8FA 5FHBH 4G6KH 4HJGB 7FABL 4XCEB 4FZ8L 4PWGA 2CUHA 2WYIA 3MODL 4AQAB 5IOPB 3VXNA 3MO1A 4K94C 4JO1H 3WIIH 4DEWA 4G7YH 4HJIA 4PJEF 3ULSA 5AOMA 3UTTD 4CW1A 3G5WA 3PWJA 2RFXB 1DN0A 3FUKA 1R5VB 5E6SB 2X10A 2XVBA 3B7RL 3HEIB 3WJJA 3WDHA 2Y0SA 3CZFB 2HCZX 4CSZA 1MH5B 3HC4H 3INUH 3NGBB 3KDPB 3OC5A 1KLGA 1IGTB 1V3LA 1BFVL 2CHWA 3TN0B 2WWOA 3P3SA 1O7DE 1Q0XH 4XE5B 1LMKA 3U0TB 2NW2B 2Q76B 4P4KB 2XWBB 3HLAB 1E30A 2Y1VA 1HDMA 3TA3B 1OAUH 4LASL 5F1SA 4WENB 3VXUD 4LRIC 4Z3IA 4PH8A 1DE4A 1DSYA 1MFDH 1TJXA 1TZ8A 1H3WM 3C8DA 3IDJA 2Y24A 4AIZA 1E8ZA 2ZWYA 4ZOEA 1TQBC 2C3VB 2IQ9L 3VWKA 1YMMD 4OT1L 4P23B 1OAJA 4O00A 4CL7A 3KWTA 1KLUA 2UY6B 4HJSA 5ISZD 4Q9RL 1C7SA 4X6BB 2APVA 3MZTA 4J3OG 2NY5H 4TULH 3KW8A 3OHXB 3ZX1A 4FQQB 3CN4A 3IU4H 3BQVA 4A7VA 2FO4B 1GIGL 1BFTA 4UQ3B 5A6LA 5GZOC 5EG6C 2DJSA 1EHXA 2WVVA 2W38A 4AT6B 4Q7DA 4PJ6A 4ZMZA 4HHGA 1YN6B 1MFCH 4FFVD 4X5XB 4BZ2A 3ATBA 1IGCH 3SE8L 4EXKA 2WVUA 1M2OA 3IYLW 4OJAA 5DUML 3MNVA 5ESVA 4NEHB 5BZWB 2H47C 4GKNB 4EN3A 2VDQB 3O11A 3C60A 1G9NL 5CJOL 3HFML 2DM3A 1GA2A 5CHNB 5GGTH 1MG2C 3JTTB 4UV4H 5E4EB 3QDHA 5C0RL 3O8XB 1BEYL 4GY4A 1BXVA 5JLZA 1DO6A 2OJEB 2XWEA 4GSXA 5CIPH 1ZXQA 1VJSA 4H8WL 3W11D 5IBUG 4JFEE 7FABH 4PCKA 2PW2B 1CWVA 4FZ8H 3MODH 3HTLX 3WOVA 3GF8A 3OAYK 4JY4B 4M00A 2FT7A 4CC1A 4QRSB 1PVHA 3NEEA 3MQIA 5J4MA 3L3JB 4FFYL 2B77A 2ZF8A 4BH7A 1MWOA 3JV0A 2HFFA 43C9B 5E99L 1MW1A 2VOTA 4HK3J 3QORA 5DLLA 4YGAB 3DX2A 4LZKA 2W5PA 1QACA 2Z4QB 3EFFB 1BFVH 3CZKA 3T2QA 3O6KL 2FUTA 4KBPA 4A6YB 1IEAA 2H1PL 3BN9C 5B39B 3Q8FA 1L3WA 2DWEA 1MW2A 1I1CA 1U8PB 3Q0HA 3VM7A 1D5XB 4LASH 3LQAH 5D93C 2FT8A 4WVRA 4PJFF 5MEQB 3V0IA 1WAAA 4YDKL 2HX8A 1P6FA 2QR0B 2WNGA 2AK4B 3ROLB 2X4UA 2IQ9H 4IMLB 4D0BB 5JXEA 2PYEE 4OT1H 5EZJA 4HOMA 1R3JA 4WK0B 5I2IB 4XP9L 2EYTB 3BGAA 4Q9RH 2Y7NA 4TVUA 6TAAA 3DECA 1FYTB 4ANVA 5D2NE 5K9OA 5KYXA 1GIGH 3M1BB 4P9HC 5HHNA 1GXEA 1KJ3L 2OBGA 1OSEA 2LQRA 2X0WA 4M5ZL 2E6JA 4I4WA 5E1GA 4LIQL 3JVGA 4G7SB 5D5MF 2ZG2A 2ZXCA 3MRRA 3X11B 5J06A 1OF0A 2Q8AL 2E3VA 1E4WL 3BVTA 4B9ZA 2YEZA 5DUMH 5KJ7E 2EO9A 5DZAA 2Y23A 1HH9A 3U7WL 4Q9QL 3T0DA 2ZUQB 3OXSA 5CJOH 3HFMH 4NQEB 3QQ4B 3HW7A 2EP6A 4A7QA 5ABDE 5J56B 4GQ9L 3L5IA 4A7TA 1JJUA 5E5MA 5C0RH 1NLDL 3EZJB 3H7BA 4B5EA 4E9YA 1AOHA 1HKLL 4JW3A 3RFRA 1RD6A 1KFGA 1U8JB 4H8WH 4PJXE 4RA0C 5DS8B 3NA4A 2YKLL 4PR5B 3QNXB 4Z3TA 5H4ZA 4XO5A 1WGVA 3N44F 4EKJA 4BSVA 4U1IA 4PRHB 5KANI 3BAKA 3GWJA 3HNTL 2BZ7A 2VZ1A 4FFYH 2BHZA 2X9YA 1W15A 4K94H 5GS0C 1KT2A 1GGIL 5E99H 3L4VA 3MRHA 3CVHA 3MGTB 1A4JA 2X38A 1IC0A 4JFOB 4GO6B 3FUJA 3O6KH 1IRAY 2H1PH 1MAML 2CGZA 1O7SA 1ASQA 5K5YA 3QUXD 2L4OA 3WYRA 4J23A 4Y19E 3CDFA 2VM3A 2VJ8A 4WI0A 4AYFB 1XZ0B 1ODUA 4QRQA 2AJYH 4RAUA 3L5HA 4JUSA 2IANA 1PG7X 4R7XA 1I8MA 2PW1A 1N67A 3N3EA 4CVWA 1QW9A 4YDKH 4IHOA 5IMMA 1SOKA 3H53A 2BRQA 4XP9H 3LKOB 2VUOA 1QR1B 4UQDA 3C6LD 3X13A 3OF6D 2GY7B 1E65A 1HTYA 5AWNL 4L3FA 3DC0A 2CGYA 3DOIA 1IAIL 2QHLA 5GRXG 3UTPE 4L4TD 3K72B 3AXLA 5DHVA 1KJ3H 2W60B 3KM2A 3SIKA 3E2HC 3VXTA 4I18B 4AYGA 1K3IA 2BIHA 4M5ZH 4MJ2A 4LIQH 1KTBA 3GMQB 3WNJA 2P42B 4HUUA 1B0IA 4G8AC 5AZUA 2AXGA 2IH3B 2Q8AH 1B6DA 5DVNA 1E4WH 2B08A 2DLIA 4NOFA 2BOCB 1OOWA 2X1WL 3H4FA 4TVPL 5BQ7B 2XIBA 4Q9QH 1WRFA 1NBYA 3VD0A 1KJ2B 4DFIA 2C9XA 5E1QA 1GVIA 4ZFOB 3KPTA 4F7TB 2Q7YB 4MQTB 4XMKL 3QO1B 2OMTB 4NFCA 1NLDH 2OJZL 4Z3GA 4GXUN 5DHMC 3K2UL 1HKLH 1NZRA 3OGOE 5DK2A 4B9KC 4QTFA 5J6HA 1S4IA 2YPKA 3GMRA 4JFEB 4JQIL 3BUPA 1S78D 1HHHB 1V54B 3O81A 2VDRL 5F0PB 3AMKA 4MB5A 4CKQA 1JTPA 1AAJA 3H9HA 1RLBA 1YZZA 4LCWD 7PCYA 5LB1A 3VWJD 1RZFL 1GGIH 4C56A 4H88L 4P59L 2BCKA 1ILUA 2RIKA 3ZDZB 4NN5C 3G08B 3HZKB 2RJMA 4WFGE 2V6HA 4N2FA 3LOWA 2Q3ZA 3ASNB 2JKIS 5TJWK 1R4XA 4M61A 2NCEA 3QUML 3N04A 4QHMB 1JDDA 2DM4A 2BS71 2ZNWA 4MMZA 3HG1A 2PCFB 1QWUA 1AGDB 4UT9H 4Z7AA 1WA0X 4A7UA 4YAQB 1F6AB 3D07A 4QRPD 1MCFA 2Y4SA 3QQNA 2WLHA 4JG0L 3B8YA 1UHVA 2XTLA 2A6DB 1QBML 4OFPA 2AEPL 4J3OD 1SLUA 3BIKB 3UCRA 1WBZB 2P1YA 4PJ9B 4IIQB 2QSTA 5AWNH 2H8PB 4N86A 1IAIH 2FECI 3U48A 2EKSA 2WVTA 5AD0B 4R0LC 4OZFA 5DYOB 1BYPA 4YHNB 1N6UA 4PCSA 4WEEA 3P4LA 5GS2D 1X44A 5IK3B 2PUQT 3ISRA 2D7MA 1Q1JL 2D0HA 4GBXB 2EYSA 5KVEE 5GIRB 2NX5A 3DGCR 2XG5B 4OZHE 4TVPH 4GXVL 1KG0A 2EINB 5F6IC 4IRSD 3H54A 4ZPVA 1IAKB 1GYWA 3LVTA 4PRID 3WE6A 3AB0C 2X4PA 4ADIA 3CZNA 5D7JB 2C9RA 4I9WE 4XMKH 2KH2B 1YEWA 3QDGE 4IOFC 2OJZH 4WWKC 4PRDA 2DMCA 2GTWB 3K2UH 3QUGA 5E9DA 5JW4Q 2D7TL 3QCUL 4K7PL 2JKRM 2I32A 2R69L 4LOEA 1T5XB 2EEFA 1OP9A 2BVPB 1ZT4A 4MXWH 1C12A 4PJXB 5IQOA 1IAOB 2VDNL 1KV3A 3AREC 2B3IA 2BSCA 2VDRH 3VH8A 2YPLA 3Q8AA 4JHAL 5D6CA 5TE6L 3ALWA 1AKJB 2I25N 3FO9A 3IDGA 2Q87A 5I16A 2JJTA 2MWCA 1RZFH 3TCLB 2X6VA 4Z18A 2OX5A 2BVYA 3L81A 4H88H 4OJCA 4P59H 1GKOA 1OCOB 4PWEA 4LE8A 1DANU 3ATDA 3BI9X 5E8NB 4YR6A 1L5GA 2H6UA 5EU3B 1ZK5A 5I6XC 2CU9A 4P5KB 4JZNA 1CDBA 3X3GL 1EHLL 3FCSB 3HS8A 3QUMH 4ZMAT 1L0QA 3LZQA 4HCFA 4LSVL 4Y19B 4NO0B 5T5FA 5HYJA 5DC4B 2UZIL 4R7LA 2WYTA 2ZE0A 4ZUWA 1CDGA 4JG0H 1F3JA 3RWCA 2PYEA 3WNMA 1W2KT 3APCA 4PSRA 2AEPH 4GIPD 4RMTA 1ADQA 1YEJL 4EJ1C 5HJGA 1IARB 1NCHA 4QUOA 2NQ3A 5D2NA 3UTTE 4FQ1L 4JFFD 2YBGA 5JHDA 1P7KB 2HRLA 5T5NG 5DQJB 3RGVC 2XXFA 4I0CC 2C9AA 4AVKA 4WWOA 4IU3B 3LKSB 1SUJA 2Q86B 1Q1JH 1I85A 4KFMA 4I13B 2J55A 3NABL 2A4EA 2ZXEB 1KXQE 2EAEA 4W9JC 4NXKA 1YHPA 3MFFA 4Q14A 1UZ6F 3OJDB 4HWZB 3WS3B 3FQ4A 2EE2A 4JFDD 2FSEB 3JWDC 3GFUA 1EDHA 1YNLL 5DJ8A 3HE6B 1JV5B 4Z0BL 4BSWB 5I30L 3FTSA 5IMKB 1BIIB 1HC1A 4GW1B 2A6JA 3GB7A 3FH8A 5DSCB 3LS4L 4L48A 1P0SE 1QBBA 3FZUC 3WY1A 2ZWSA 1IBGL 2D7TH 4JZJA 2R69H 3FTYA 1LO0L 1OWRM 1KPUA 5IT2L 2VDNH 3AG3B 2OTWA 1UKSA 3LIZA 5LAPA 5PAZA 3VI3E 5B4MD 4PRAB 3T77A 3OMAB 1XR9B 2V3DA 1IM3D 2Y7OA 4JHAH 4JQVA 1I8IB 2E7LC 2N1KA 4FNLH 5TE6H 2JWYA 5I6NA 4ZMOA 5HJ3B 4OSUL 3EYUL 4MWFA 2BIPA 3OSVA 4MDIB 4UAHA 4O02B 3O3BB 4U0RB 3IDNB 2A9BA 4YNYA 2X89D 4FFWC 3TL5A 4KZDL 1IILE 4PBWD 1LILA 1KGXA 1U8OB 1HXYB 3UO8B 3D87B 1CD0A 3CZLA 3X3GH 4AGLA 4S0HA 1T3FB 2DIAA 3WJLA 1EHLH 2PPEA 3K8KA 3PL6A 3RU8H 1FAIL 4LSVH 1UWFA 3B3IB 2X4NA 5CP7B 1T83A 2JLPA 2AEWA 3RZCB 5DURD 4B95C 2UZIH 3L3IB 1CGXA 2L7QA 2WCGA 1TYRA 4M4PA 2XKNA 1D5IL 1MFUA 4QRBA 1OGAE 5K39A 3SJVE 4CADA 5ADPL 3SYQA 3X14B 3MJ7A 1S9XA 2WWKT 3TV8A 4XBPA 3AG2B 1TLMA 3REWB 2WXKA 1BZ9B 1XCTA 3L1GA 3D8MA 4IGBC 1EFXA 1YEJH 4HKXB 4Q6IC 4BEIA 2XOTA 1AZBA 4FQ1H 4GRMB 4OGAD 2CG9X 2ZYSA 4LO9A 3H3PL 2ICWA 2Q9OA 1ZOXA 2R56L 4RQQB 5J13B 1EHNA 2XZQH 3BPNC 3IFOB 4HHWA 4KROD 5TPWL 3VA6A 2HFEA 4PRNB 4P5TA 1FHGA 2JB6A 3NABH 4F37K 1W0WA 2VLMD 2UX7A 1PKOA 5E0QA 1UZ8A 3AMLA 5H4YA 3OPZL 3EUDA 3ULUD 3BMWA 1T1XA 3VXPA 4OZHB 1QA9B 4KY1L 2UVEA 2B15A 5A3IC 1O9VA 2VIRA 4UUJB 1YNLH 4Z0BH 3SSGA 1IBHA 5IVXB 3IDUA 5I30H 1KIPA 1NIAA 1U58A 3PHOB 4Z7VF 5D7KD 3FHEA 3N2JA 2IF7A 4FNPA 3LS4H 2Y1AA 3H56A 3FUDA 4IJ3B 1IBGH 4MD5B 4M93B 2YAOA 5IB3A 1I7UB 1LO0H 2ZSWA 1WWAX 4OJEH 4U7KA 3J8F7 1NFDE 3ULAB 3HBQA 3D18B 2A74C 1E5CA 4QJ5B 5AKVA 5BRZA 2OQJA 4IBVA 5F9OL 3ZRSA 4IU2B 3KWWB 2YFOA 3V4UL 4EI5D 3O6LL 1A9VA 3P3UA 4HCIA 4P4RA 5E2VL 5ADOL 4OSUH 2CBQA 5GISL 4K7FB 4A63A 3EYUH 4F2EA 3E0GA 4D2NA 2XPGA 2AW2A 4P3CL 4JRXD 1N12A 3ISYA 3NSDA 2F7OA 4OLYL 1KZQA 2NXYD 3L5JA 5FWRA 3N40F 1RZ7H 2DI7A 4Y8DC 2BY2A 3MREA 4XPGL 1AO7A 1VFBA 4YHKL 4PWHA 4ZX3A 4MJ4A 5GZNC 5KSBF 4HXAL 5DMKB 4FA6A 2I9LA 4N0FB 1USZA 1FAIH 3N43B 3LNDA 5IB5B 1M05B 4BYHA 4PJCF 3FU9A 4GAFB 3GIVA 4X5RA 5TF1L 3LNHA 4KFZC 4AUJA 3IDMB 1FL6B 1EEYB 3CDGB 4K15A 4KH2A 4HOZA 1NTDA 1CE6B 1D5IH 3MUY1 3K71A 1FZKB 3MCLL 5ADPH 2YAEA 1T0OA 1LWJA 1JI2A 1KCLA 4PJHA 2WZPD 1X5FA 5DRNB 3AT0A 4HZLB 1YEFL 1NUDA 3TFKC 3ZDWA 1CDCA 1FZMB 4WW2B 4N0UA 1S7TB 2DQMA 5FGSA 5J3HC 3ME0A 3RTQB 4GSDL 4YSSA 1IE5A 4ZUSB 2QKIB 3H3PH 2R56H 4F91B 2HMID 3OHMB 2IPTL 1M6OB 5TPWH 1JERA 1ZCRA 5DI8B 1ZPUA 1JWSB 1UUSA 4YLQT 4RISL 4KKRA 1SYVB 5FUOL 3C6EA 2MCPL 3QIWC 3J2PA 2NTFB 1DLFL 3U0WL 3OPZH 4I1NB 4Y1AA 3C8KB 1JXJA 1NKGA 4KY1H 1HQRA 4D9RD 1P7QD 3KMDA 3APMA 4OB5L 4QHLA 1BZDA 2APXA 2F7IA 2R29L 3OZKA 2CKBB 2UUDK 3QP3A 2CM6A 1M9SA 1U8CB 2D3JA 2YJQA 3BQUA 4AM0Q 5I8KL 4QRRA 1WIPA 4K5MA 3QDGA 5DZ9A 1UEYA 1TQCC 3JWDH 2XWTB 1FBIH 2XI9A 4HDIA 4AQ1A 1ONQB 3W9EA 4H8QA 1PIFA 3S3SA 4JHZA 4DNLA 1Y6NR 5KBPA 4OY9A 3VSVA 2Z91A 4GG8A 3DUSB 3PDOB 4Q74A 2XWZA 5JPMB 2YGVA 3TVMC 2B59B 1BQHA 4ONGL 4UU9A 1KN4L 5F9OH 3ZKQD 4OZGF 5BMFL 2V7HB 3V4UH 3VI3B 2RQEA 1XF3B 3O6LH 1AYRA 3VFGL 4JY6B 1S9YB 5GJSL 4Z95L 4NC2B 5ADOH 2VXTL 3I84A 2BMKB 3QH3A 5E2VH 5GISH 3V4VL 4GUCA 2E76C 2VXQA 3BSGA 2YGQA 5C0BA 4XNDA 5D1XE 2OK0L 3O6FC 4P3CH 1QLFA 2BVQA 3MLVL 4UQBA 4OLYH 3FUFA 4WGVB 4RFEB 4DCQB 4OZ4A 1LVEA 1P5UC 1YEGL 5HJDA 4WI8A 4YHKH 4HUCA 4XPGH 1UXWA 2VISA 3HA0A 2IH9A 3QJFA 2OI9B 1CQKA 2IQAA 3B3BA 3OBAA 1BM7A 4HXAH 1UJTA 4NIKB 4QOKD 4L37B 3V2AR 4U6XB 2W0KA 3QUZD 5CZKA 3NCBB 5IJCC 4AKPA 3L3DA 4HUKB 3KXFE 5TF1H 1E5AA 4TQHA 4U1JA 3WN5A 5IQ9B 3D3VB 1WWBX 4ZUVA 3I6GB 4RAHA 2NY2D 2QPUA 3ZT7A 1NMCB 3MCLH 3SJVB 2R2EA 3GBML 3UJIL 2JTDA 4X9FA 1I1AD 5CAYB 2YIHA 3II2A 2P8MB 5D4QA 4Z7OE 5K9QI 4U1MA 1IKNA 1YEFH 4XVTL 4A67A 5IV2B 1NWPA 3UTTA 4V1DD 1MRDL 4GSDH 5MEPB 1M7IA 5EFIB 2OMNA 2JCCA 4IRJB 2IPTH 2VZTA 3QIUB 4CMHB 2RH0A 4A2MA 2X2YA 3KWVA 1SF3A 1IBYA 1FL5A 1V27A 4E9QA 4H5SB 2WNXA 4PP1C 3OKMB 1NUGA 4R97C 4RISH 4LVNC 1KXQA 3PJSB 5FUOH 4HUNB 1SVZA 2MCPH 3QA3A 3T0WA 3BAJA 1DLFH 1XAUA 2Z35B 4MX7A 3QI9D 2WKGA 3U0WH 4PJ7A 3I02B 3BJ91 3VXUA 5B7FA 5J1SC 3TPKA 5BJTA 1AVAA 3RP1A 1EJ8A 1A4KA 2F8IA 2UUDH 1I8KA 2R29H 3SKOB 3NJGA 5I66A 3V5DB 5BQDA 4PGCA 1HAWA 3BKML 1D9KB 5I8KH 5HHMD 2X12A 5LWYL 1DVFB 1PKQA 3LEXB 4OF8A 1YMMA 3EJYC 3QXUA 1FE8L 1JNHB 2XWJB 4J7RA 4MNGA 4X6DF 3TH2T 4DP8X 1KFAL 5I74B 1BAWA 4X7TB 4XMUA 5ISZA 4Z7NF 3IJYA 4B9CA 4F7PA 3LNEA 3S3BB 3DK0A 2WXHA 4D9LL 3ZHNA 3DJSA 4E9VA 4ONGH 1KN4H 5DMYA 3KCWA 5BMFH 2IFGA 2MPAL 1NCTA 3GSQA 1ET8A 3VFGH 2YEQA 1QABA 1ZVHA 5GJSH 4Z95H 1GZHC 4Y16B 2WLIA 2I85A 2VXTH 3WBDA 2V4LA 4NO2A 2W88A 3K0YA 3BP6A 1FC2D 2ZOKB 4Q9CA 1KIRA 4BKSC 2OK0H 3MLVH 2EDEA 5C3LD 5DRXA 2P7TB 4TRPL 4XRCA 1LL1A 1YEGH 4PRIE 4ZW8A 4B60A 1B2YA 2IAMB 1RMFL 2J20A 2IDFA 3SPVA 1TNNA 2QV2A 5BZDA 1SXZA 4LLYA 3F7VA 3CQFA 4N0YL 5ETUB 1M2VB 1U93B 3PUUA 4M6OL 3MX0A 1EK3A 4U3CA 3DX8A 1OGAA 1ZHBA 4OW6A 4MJ6A 1AMXA 1TJIL 5JUEL 3WNNA 4RFOL 1WD9A 4IRZL 3GBMH 3UJIH 2ERJB 5ACZA 1WTLA 3SCMD 4XVTH 4UANA 5K69A 2A4ZA 3IWVA 3KYOB 4GW5B 4I2XE 1MRDH 2ZUSA 2VE6B 1WVZA 1T20B 4ES8A 2Y7QA 3L4UA 3DHUA 5JA9A 3OGCB 4PSPA 2F61A 3D0VB 2DMHA 3QWOB 4NKDB 4PV9B 3ARRA 1S5HB 1QTSA 1T2XA 2YA2A 2YUZA 3IPFA 4NB7A 4ZZKA 3HHSA 4KO7A 1ACZA 1FSKB 3KPPB 1EZLA 4C55A 1CFBA 4LCUB 2VLLA 1T89C 2W65B 3SDXA 4YBHA 3BKMH 1VZIA 3KJ4B 5LWYH 3SE3A 3GXMA 2XPYA 3TLRA 3T8VA 1FE8H 3I3BA 2R0KL 4MLSA 3RAJL 4Z6AT 4KKPA 5GGRA 1KFAH 2XG4A 4KXAA 1HI6A 4RWYL 4TMPA 3ZYOA 1NFDA 3ZZLA 4LLWB 4D9LH 2LOEA 1UCTA 4WJG3 2D73A 1E50A 2MPAH 2X87A 3O6ML 4FNUA 4HUWB 1GL4B 3UZQA 5IMLB 2BC4A 4X6FB 3TPUB 4H2CA 3K8MA 4YGVB 1I4FB 5IIEB 4FXKB 1DEEB 2R2BA 5AKTA 2VKWA 1AG0A 5EB9A 2BVUA 3DVFA 4QKXB 5D1XB 1XCQA 3UBHA 1MREL 4TRPH 3RFZB 3DX9B 3V6BR 3MJGX 3OMNB 4FFZL 1IEHA 1RMFH 2BWIA 5H8DA 4RSVA 4MQ7A 2ICEC 3QRGL 4FQJL 4HGKC 3QB7C 5ICYB 1XIWB 1RZIA 4ZOAA 5FC9A 2AF2A 3IDXL 2HP4A 3BPLB 1GZPB 4N0YH 1T5WB 4M6OH 4UYPA 2NNRA 5TDPB 1GZQA 1F42A 2UZYA 3KXFB 1ZS8A 2FX7L 5JUEH 1TJIH 4RFOH 4IRZH 2MIZA 3FFCD 2EDRA 2KDGA 2ZP8A 5A1AA 2Y7MA 5IB1A 1U3HC 3BWAA 4GRLD 4S1DD 4Z7OB 3FRUA 4XOCA 4XVUC 2OA9A 2PCXA 3MLTB 1U6AL 2FX8L 4XNYL 3PPSA 4LL4A 3CQPA 4FNTA 4EDWL 4ODUB 3TC9A 2W0FA 2VLKE 3SO5A 4W9LC 5AW2B 5EC2A 1ED3A 2LV4A 1KGUA 3QUXA 1JYVA 3QDMD 4FKHA 3BC9A 3HLKA 2HVBA 3DO3A 3Q6FA 3UMNA 4XBEL 4EMZA 1WYJA 4ZNEE 1ERNA 1U8KA 4X4YB 5IMOA 4MJHA 2X4QA 2WWKO 3KLDA 2PKDA 4PTUA 3GMMB 2R0KH 3T1FA 3RAJH 4WO4B 1F4HA 2HA1A 3C6LA 3OF6A 2V33A 15C8L 3NDYE 4ZAKD 2FJUB 1V7NL 3T3MF 3T2OA 4BWTA 3T0VA 5C3IA 3ATFA 1W0YT 1OB0A 2DQDL 3SGKC 4YZFF 4HA1A 2A1WL 5F9DC 1ZGLA 1LNUA 1ZLEA 1KNOB 4FZEL 1XF4B 4F7MB 3I9AA 3O6MH 4L3CA 1H8SA 4PV8A 1BD2B 5BZXA 3QHZL 1OE1A 4PJGE 3ILPA 2NSMA 2O72A 4AE1A 4XAKD 5L2KD 2JKNA 4AK2A 3B34A 1SDDA 1B4TA 4KTGA 1MREH 2VRAA 3ARDC 3CCHA 4AQ8A 1JCVA 3EW3B 4FFZH 4PFEA 4ORZC 4XOEA 3QRGH 4FQJH 4FXTA 2V8MA 2YSSB 3IDXH 3QISA 1IKFL 1CGYA 3QHTC 1K9TA 4U1KA 2R39A 3RX7A 2BHYA 3H1ZA 3O3AA 3VD2A 2V2TB 3BGFC 2Q3AA 4L3ED 2HG5A 3CFUA 1OAYL 2FX7H 3FTGB 3WKYA 1KB9K 5C9JA 5EOTB 3NDZE 5EULV 5IHBA 2PO6B 4QRUB 3S3CB 1B0GB 2YFNA 3T8XB 4F93B 4N2KA 1E5UI 3EJZD 3QFDA 3UJJL 4P46B 2ZSVA 4EIUA 1SJMA 1J0IA 4LCWA 1HHJA 2J21A 3QEQD 4BELD 4AITA 1U6AH 2BIOA 2FX8H 3VWJA 1S7WA 3INOA 4XNYH 4K2UL 4RMBA 1F4AA 4I2XB 3V0HA 4A37A 2I60L 3V7AG 1EJOL 4MZRA 4EDWH 4F7KA 2G2NA 3S88L 5JHLL 4QNPE 2EECA 1XSIA 2CKNA 2EIZA 3V5KA 1ESOA 4JPVL 4RGMB 3LZPA 1A6AB 4O4YL 1MSPA 3GT6A 1PYWA 4XBEH 4UAOC 4BE5A 3OKNA 4YDMA 2NQCA 2ZWZA 4U3SA 3AFLA 4QRPA 3V0VA 5DXWA 2XV2A 1JP5A 3QCVL 4UTAL 4KVCL 5BUGA 2GG1A 1D7FA 5DEFA 4OF0A 2IADA 1J5OL 15C8H 3DSNA 3FONA 4KK8C 1V7NH 4ZFGL 2I26N 3K5RA 4LDOB 1NMAL 1YYLL 2DQDH 4H1LH 2AXFB 2A1WH 2KQNA 4YN3A 4XMZA 3CSBA 5I73B 2BNRB 4FZEH 2D31A 1T1WA 1XVSA 1Z5LB 4P2OB 3QZWB 3JV6B 2ED7A 3F04A 5FYJH 3QHZH 1F4XL 3HZVB 4H0HB 5I17B 4FYQA 2KHAA 4IRSA 2UV3A 2ENYA 4PRIA 3KNBA 2VQTA 1VADB 3NCXA 3G04A 3HI5L 3LD8C 4LOUC 4A2LA 1WFMA 2EXWC 3B7SA 3GHPA 3P3TA 4OLWL 4FOMA 5AB2A 2OMVB 3U30B 1RAMA 4WSJA 5EA0L 5J1AB 1IKFH 1G1OA 4APXA 4UM8A 1Q0YL 2E0PA 2NQDA 3FW6A 3LZLA 1MJJA 1OAYH 4AV4A 5KSVB 5MERB 1KB9J 3UC2A 3P4NB 3DX6A 4BV1A 1SXBA 4P07A 3TO4D 3UJJH 4BSJA 3DV4A 3K6OA 1KCRL 3ZMNA 3NSFA 2DY2A 1PX8A 4G5AA 5CEYB 3K6NA 5DZOA 4LKCB 5B8CA 2G5RA 3ES6A 4XI5C 1F11A 4K2UH 4KZEL 3L5XL 5EU6D 4E2OA 4F27A 3EH3B 2I60H 1N5YL 1TUPA 1CS6A 4KKQA 4XN4A 5JHLH 3S88H 1LK2B 3BPOB 3Q9PA 3WMQA 1XH0A 4N2IA 2VLKB 4UQIM 2YK1L 4H26A 3PF2A 2D4DA 2X3CA 5HDBE 4JPVH 4HWBL 1RK1B 4QRTB 4O4YH 1FFNA 4YO0B 5EBMB 4BK8A 3KLHC 5ANME 1N59A 1MCQA 4E9XA 4ZJ9A 2OYLA 1FFRA 1KXTA 4I8DA 3VRJA 3OKYA 1MY7A 2XNAA 3QCVH 4UTAH 1GR7A 4PRPD 2GC7C 4KVCH 5DJAB 1NGWB 1MWAB 1XV8A 5FB8B 3FUHA 1VF5C 2W95A 1D5BA 1OO2A 2WBJB 1KCWA 5DUBB 1FO0L 4GXUM 3Q8BA 1J5OH 5E24E 4ZFGH 4MAYB 2FB4L 1FI8C 4JFFA 4V1DE 1NMAH 1YYLH 3I3EA 4EEEA 3S0PA 4M3HA 3E8UL 4PWJA 3CLEL 2PTTA 1E28A 3FOLA 4JN2A 4LVOB 3ULSB 4TXVB 3BZFA 3ZHKA 3ZGHA 5GGRY 1FNGB 1DN0B 2ZXGA 1F4XH 4PJGB 1O6VA 1BXUA 4WSKA 1CL7L 2GFBA 5I15L 5KBDA 3PAVA 3Q43A 1EEQA 1X5ZA 4IYKA 5SX4H 4JFDA 1PU0A 1T6WA 1U2CA 3HI5H 4D0DB 3II1A 5D1ZI 4OLWH 5FFOA 1PBYA 5JHMA 1UXLA 4N5UA 2VW6A 5DHYA 5FUZL 3H9SB 2VDMB 4MCYA 4PJDE 2FNBA 5KSAC 2IOOA 3ZHFA 3S8FB 4UOW0 4Y7MA 1U8NA 2FBJL 1Q0YH 3P30H 1MI5B 2JQZA 5F0JB 1ETZB 5KJRH 3FQWA 1A7QL 1GKEA 3GJEA 4LVEA 1KPVA 5DZJA 2C7UB 1XZWA 4O2FB 5TF0A 5HPMB 4NNXA 1IM3A 1KCRH 2VSMB 3CN2A 1AR1B 3RL2A 4XVOA 1MFNA 1EO5A 5EUKA 3L5XH 4BQ9A 1CICB 1H5BC 1N5YH 5K1VA 2MNWA 1I3UA 4LL9A 3MLXL 1UJ3C 2X89A 5T8IA 2YAHA 5KG9B 1BG1A 4I48A 2YK1H 1I9IL 5AG9A 3KHOA 4PY7B 3HN5A 4QY8A 3KZ8A 1EUTA 4HWBH 5GGUA 3TXAA 1QG3A 2HX7A 1LO4L 1F5WA 2OTUB 4Y2DC 3BPCA 4MYWB 2D0FA 5DMIL 4WRLA 2ZCKL 1JPSL 2WM0A 1BJMA 1WV7T 4S2SB 1TG8A 5F7EL 2WTPA 3SGJC 1AD9B 1BHGA 3GS0A 4ZMNA 3CVIL 4YHIA 4G8GD 5GQBA 1TQSA 1O9WA 4NWUL 4QGYA 4CRPA 3WNPA 2FB4H 1QEWA 1XD0A 2Z4TA 1NCJA 5DVOA 4RCAA 1U95B 2KKQA 3IPBA 3E8UH 3BLPX 4O2CA 2ARJQ 3CLEH 3ARFC 5EO9A 2K7PA 5DJ0B 3BN9D 1KTLB 3GRWA 3MRNB 2WQSA 3HI1B 5I15H 2F2HA 1CL7H 1R24B 2ZJSL 1MHHB 4NX0A 4HMEA 1F56A 3A21A 3BLKA 1T80A 5T1KB 3MV7D 1N0LB 1NCUA 3RWHB 1CYGA 2LTQB 3VG9C 5FUZH 3HJ0A 2FDBP 1FL3A 1AZRA 4KUCD 4XP4H 2EIEA 5B22A 2XN0A 2FBJH 3BLBA 1S7VB 2HJKB 4P8QA 4PCYA 2IH1A 4ZX5A 3STZA 1K8DB 1ANUA 2JJSC 4YSDA 5LKNA 1LE5A 1A7QH 4QCIB 2R8SL 1KTKE 3HNSL 5HVHB 4FL4B 3WDJA 2WIMA 2HPTA 4EI5A 1AXIB 1HCYA 3RWEA 2BXZA 4L1BA 5CCJA 4NJ9L 4LBEA 4YC2B 2IDTA 2Y06L 1QNZL 5HHNB 4DIXA 4U1NB 2EDDA 1KOAA 2QSVA 1DQJA 3DVGB 1FJ1B 1F1DA 2V5SA 1TZIA 4JRXA 3MLXH 1CG9A 4OGYH 3VXQA 1I9IH 4DGVL 3DPDA 4NQCE 3Q01A 4N85A 5CD3B 4HUMB 5HDBB 4N8VB 4K5NA 2BZCA 4QTHA 1LO4H 1Q9KB 4G80B 4A2DA 5I6LA 5DMIH 2ZCKH 1JPSH 3OSKA 5ANMB 4K5OA 3UTZA 5CJQL 1M3JA 3CJJA 5F7EH 3S35L 4OV5B 2G5BA 4LEOB 5KYYA 2WZPA 4IBYA 3CDZA 1R3IL 4TV3A 3TP4A 3CVIH 4NO3A 2PLTA 3VAEA 3FQUA 4DQAA 4NWUH 1UH4A 4GFTB 3BUYA 3QJHA 5GS0D 5D7LB 1LO5B 2Y2TA 4LLQB 2A73B 2OJ1A 5G4MA 5JO5B 3U9PL 2D8KA 4OFIA 2XCMC 3GSXA 2VLRD 2APWA 3MRMB 5I8EA 2F8VA 3AW5A 4R2GB 4AGPA 1LK3L 2ZJSH 4RMVA 4FG2A 2W92A 2VN7A 5I8OH 4F8QA 4F15C 2OKMA 2O5YL 1P7QA 4ZUUB 1VFAA 5E94B 2FZ3A 5ALCL 1CDYA 1E8YA 4DZBA 2YD0A 3FQNA 2HTLC 2QV4A 4KKAC 4PWIA 4JQXA 4URKA 1RZ8B 2CJUL 4PJDB 2COVD 3SPJA 3EO9L 4WWNA 1DJHA 4JN1L 4IHOB 1I82A 2ALWA 2R8SH 5T3XD 4OCYL 4DP4X 3UXFA 1WG3A 1E9QA 2E46A 4N5EC 2VB5A 1TFHA 3RWDA 3DRQA 2BSTA 3LMJL 5J12B 1NDMA 4HLEA 5J5EA 5C0CD 5E70A 3F85A 2JQAA 4NUJA 4F8TA 1E27B 4NJ9H 5IEKB 2X1OA 1VCBC 1QNZH 2Y06H 4NENB 5FDYA 1HXMB 3L2NA 5F1OB 5L2KE 3FTWA 4KJQC 5FFLA 1T03L 2CBMA 1M71B 4HUUB 3KPLB 2A9DA 2AXGB 3PGDB 4DGVH 1D2OA 4BQ6A 4P5RA 5FLVA 3L4TA 4QOKA 3NGBC 3TF4A 4M6NL 2FJHB 3UBXG 1KY6A 3TN0C 5IM7A 3QUZA 3QULA 1QYGL 1NBVL 4L4VD 4HS3B 4Y2LA 5T3ZE 5HYQA 4P4KC 1RH8A 5CJQH 2TSAA 4IBQA 1E5BA 5A2AA 1J8RA 3S35H 5JORA 1CIUA 1TKWB 3PCYA 5DQ9B 1AFVL 1EXHA 1NFIA 3FS9A 3WEAA 2Y5TA 1I1AA 3CK0H 1R3IH 4NKMA 4DPCX 3GKZA 3W57A 4PJIA 3U0PA 4P23C 4ZXBB 5HTSA 4V1DA 4ZUTB 3QEQE 3VU1A 5JXEC 3IDIB 2KUTA 2ITDB 4DZ8A 4OF3A 5BW7A 2FYYB 1Z3GL 3OHXC 3OR7B 3PHQA 4FJ6A 3U9PH 4IS6A 3ZDZF 4Z3FA 2EVFA 1RZJL 3VUAA 3EFOA 3SE9L 3VFMA 2G30A 3ZTJH 3QI9A 1LK3H 3AS2A 2DLTA 1U92A 2YWYA 3DUUA 2EXTA 2DBJA 5ALCH 5I1EL 1FA4A 1YECL 3MNZB 5JW4N 3GMNA 3LQZB 1QSEE 2HXAA 4BZ2L 2CJUH 4R90L 4HBCL 5JNYB 3E8VA 3EO9H 3LZRA 5CFAA 3O8XC 4JN1H 1LP9E 3GXNA 5F7LB 3JWOL 4OCYH 2MKLC 1SVBA 1C8QA 1ZA3B 3LMJH 4XXWC 4MMYB 2CHZA 4X6CF 2O5ZL 4YHOL 1BZ7B 2M1KA 3QO0B 2YA1A 2LT9A 2JKJA 3LRSB 4FI6A 1I31A 1T03H 2F54D 2OMWA 1VACA 4MNQD 2EYSB 4LXFA 1P4LB 4NT6B 3OM3B 4OLZH 5LBSA 4L0PB 5DRZA 3U2SA 5LXGL 1ACXA 3I50L 4M6NH 1ZSDA 4P05A 3H2PA 1QYGH 3HG5A 1NBVH 1WT5A 4OF5A 4IOFD 4JFXB 4WWKD 1GCFA 2C9PA 4XH2B 1S9VA 1ZSHA 4DO5A 1JTTA 5F3HB 3RIFF 1AFVH 3VFNB 1WS7A 2A6IA 2P28B 3ARED 1COBA 5H94B 3SCMA 4Z78B 5D2LB 1IV8A 1R3KA 2Y5QA 3ARYA 3UO1L 3TBYB 1ZT4B 1EZVY 3KJ6L 4FFTA 1LEKA 1RURL 2KZKA 1L0XA 5EU6E 2J4WL 2MRYA 1LHZA 1Z3GH 2BY1A 4L9LA 4G6JL 5J57B 4BDVB 1S7XB 2GBTA 4F9PA 2AFNA 3KGSA 3MCYA 1CD1A 3SE9H 4G9FE 2DMGA 1S5IL 4NZFA 5I26A 1RJLA 3OB8A 1FLRH 2W07A 2P44B 5HHPA 2F5BL 3D51A 3CFJB 4GKZB 5TK2A 4WFED 5I1EH 1YECH 1DVYA 5E00B 4AVIA 4PRPE 4CVZA 2ZUQC 1T22A 3OZLA 4BZ2H 1NCIA 4R90H 3M07A 4XO4A 1N6VA 4HBCH 1KJVB 3N0AA 5CBEB 2VDQL 4F2ME 2MOGA 4TTDC 1AS7A 4JDEB 2CIIA 3O2WL 4YHPA 5ESAB 1KB5A 4JFPB 3WUWB 4N0RA 1EAJA 4FMVA 4ONHB 4WI5A 3RGVD 4BFJA 3BVUA 3NOIA 2O5ZH 4YHOH 5MP6L 1WLHA 3RWJA 5I9QB 4LMQE 4X0KA 5I5MA 3T6VA 1LO3L 2ZXBA 1E42A 2P52A 3O2DA 2DEXX 1A4BA 4F58L 1NAMB 1P2CA 1BREA 4KI1A 5C0EB 5LXGH 3BZEA 3I50H 2QQLL 3ZDYE 1MPAL 1QMUA 2ZAGA 1CFMA 4NPKA 1TTUA 1LM8V 1YUHB 3LXUX 1O7DC 3FZUD 4D8PA 1OAZL 35C8L 4JLRA 4EZKA 1BX2B 3QSKB 2ED8A 3VXME 3BESR 3FFCA 2Y22A 4MMZC 1JWMB 5EBLB 3U6RA 4HEPG 1HNGA 4AMKH 1NGXA 1QVOB 2DI8A 2JKWA 3AQZA 1WA1X 1EXUB 4GRLA 3UO1H 4ACPA 4MQXC 4DEPB 4JM2F 5KVDE 3KJ6H 4GP8B 3CHXA 1RURH 3ARXA 3MMEB 3EZ8A 2J4WH 3AXIA 1P84J 3P0YL 3EGDB 3NCCB 4B6ZA 3ECBA 3LNIA 4G6JH 2X70A 3DXAD 3K4AA 2CR0A 3TASA 2HUEA 3TCXA 1RK0B 4FFWD 4I18C 1L9PA 1Z7JA 5I71B 1KXVC 5SWZD 3BHBA 3QDMA 1S5IH 4XNMA 2PABA 1G7JB 2X0VA 2JK5A 2F5BH 4M48H 5EPMA 3MNWB 4L3AA 4MDJB 2F8XC 1WCBB 1ZV9A 3PG2A 4UOJA 2O5XL 2WCPA 4GI8A 3TYGL 5A6IA 1LLAA 3EOBB 3SKMA 5C0JB 3JZ7A 1UURA 5J6GA 1QSEB 3S8WA 1AGBB 1OANA 1HSAB 1Y18B 3MRBA 2VDQH 1E8XA 3KCPA 4IGBD 4ZAKA 2QVTA 1LEGB 5FS5A 4OCXL 3UPAA 1J88A 2YRPA 3MRJA 3O2WH 3U9WA 1AHWB 2K7QA 1MFEL 5INDA 4MJJA 4X8JA 4HOXA 5B3NA 3HBGA 5MP6H 5FO8B 2QTEA 4PJBE 4TS6A 4YDVA 1K8IA 4N25A 4EVNB 5D7IE 4G6ML 5L2KA 2F7RA 1LO3H 1E43A 1A6ZB 1VB9A 1B6UA 2ADYA 4F58H 1CD9B 4KUZL 1FYHB 2J72A 2PXYB 3OG6B 2WXPA 4ELME 5A3ID 2NSQA 4LCYA 5CEZD 1OZUA 2R2CA 1EZUA 2ZYIA 5IVXF 1D6EA 3ZE0F 2QQLH 3S34L 1MPAH 4QR7A 1OPOA 3IKKA 4G71B 4BJLA 5FYLE 2VZ3A 5SWSD 3TNNB 5ANHA 1OAZH 1UOKA 1QAWA 2YPVA 5BOJA 4L3EA 35C8H 4YVNA 4ZFZA 4NO5A 4ESKA 5JPNB 4OKVA 1DVTA 2DW5A 3K1DA 5DJDA 5I0XA 3HUJA 3V4PA 1H15A 3GI9L 2ZAIA 3TO2B 4OFYD 2G3MA 3VXOB 1PZBA 2OULB 4P2RE 4QHNA 1EEUA 1QFHA 3IBOA 4UMSA 4E0RA 1E9OB 3D85D 3QEQA 5GPRA 1HOEA 1XBRA 2IOMA 4EUPG 1CVSC 4PM1A 2AQPA 4PJ9C 2D7PA 2FJGA 4IIQC 1S7QA 3P0YH 1MCEA 3B56A 1G9MC 3RX5A 4HQQL 3PRZA 4O2EA 1R5IA 4BWUA 5GZND 4UILL 5CM1A 4OLXL 5CIPA 4G9FB 5LAXA 4GBXC 4ETQA 3HBPA 2Y6SC 1FRGL 5EO1B 5HYEA 5DHVH 2VNCA 4ONOA 5FK9B 1FG9C 2DQJL 4NQXA 3Q2NA 2O5XH 5JTWA 3TYGH 2EQDA 3MV11 2AK1L 3TONA 1IUZA 4LP5A 4S0SD 4ATWA 3L5WA 5F8RC 1C5CL 3DROA 5FECB 2EDOA 3BOVA 5AW8B 3IJSB 4L1LA 1KJ2L 1UH3A 3MRFB 4OCXH 2PCPA 1LP9A 3TFKD 2X4SB 5FCSH 4ZFOL 1HHGA 4WW2F 5J3HD 2EDXA 3UX9B 1LE9A 3ENEA 2C9SA 3AY2A 1MFEH 3B8SA 1Q9WB 3NH7L 5HHOD 4DP2X 2GB2A 3K2MC 4KHXL 1IB5A 1SJVA 2JQMA 1H19A 2JIXD 4G6MH 1WZKA 2M8XA 3QIWD 3EKCA 2A6KB 3POHA 3RKPA 3CDCA 3IAPA 3V6FB 1B2WL 4H0IA 4KUZH 3O3UN 3K8LA 2NDFA 2F8OA 3N42B 3S34H 1KSRA 4PI2A 5IR1B 2FIKA 2X41A 3ZDYB 1UOVA 2YQGA 3CFIC 5AALA 4I9XA 2E47A 5E7FA 1AS6A 4G83A 3WTWA 3VXRE 4ADGA 5M95B 4Q97A 3D4CA 3MROB 4IBSA 2Y36L 2CRYA 1AI1L 5FM5M 5T3XE 1DVQA 1TZGL 1RSFA 2WBXA 3TVMD 3VXMB 3GI9H 2NY1B 3TO4A 4W9KC 5CGBA 2JJWA 1OGSA 2EIDA 4CU6A 5E1AB 1L9SA 1LGVA 4R7DA 1J48A 3VI3F 4OI9A 4XGZA 4G70B 2DAVA 4OUUA 5T5FL 5EU6A 1W91A 1OCRB 4LU5L 3FCTA 4PJEE 1P6AB 4HIHA 3H0TB 1J1OL 1VZHA 3O6FD 4HQQH 3SBQA 2VABA 4F7CA 1ID5I 5F97E 3OC8A 2VW4A 3D5OF 4IDLA 1ADQL 4UILH 5C0BB 2FSDA 4OLXH 3NJLA 2BVEA 1QLFB 1QOKA 3P02A 3WTTA 4ZQKA 1FRGH 2MOVA 1T04A 4JGUA 1MCRA 4Q2ZB 1XR8B 3MPCA 1KN2L 2DQJH 3FTVA 4F8NA 4CVUA 3QXVA 4PRPA 1ZVSB 2ZOWA 2AK1H 1FPTL 3E7JA 1TJHL 3HE6C 4EI6B 1HWGB 3IXAA 1C5CH 4BE6A 5D1ZB 3WN5B 1DQVA 2VQ4A 1G6RB 4PP2B 4F2MA 3EAKA 3QARA 1KJ2H 4PJ5D 4OF7A 2ATPB 3GLZA 4W9CC 3KVDD 2BSSA 2XV3A 1PJWA 2G75B 1BMGA 1KXHA 3NH7H 1OTSC 1N68A 1S7RB 2CCLA 2GYSA 4KHXH 4NQVA 4AWJC 3PABA 4K7PX 4IIZA 4PP1D 3KPNB 3FT9A 4KK5C 4GLRI 4GAYA 2WNKA 3DKHA 2J8HA 4G7VL 3DURA 8FABA 3VFWA 1B2WH 4IKJA 4NERA 4ABQA 4LRIA 3LIZL 4M02A 1OOAA 4Z77A 2JSFA 3CH1A 1KTJA 4OCRL 5AVQB 3RDTB 3F5WA 1TTGA 3FB8B 4FNQA 4U0RC 3KBPA 1RY7B 4LLUB 3VFPB 4GQZA 4M1CC 2EVJA 1ZV5A 4DP9X 2WLNA 3BH8B 3EJYD 4X98A 3ZL4L 4C4BA 5I0VA 2WK2A 2Y36H 4FKEA 4PJAB 3QVAA 2XKUA 2VLJE 5KZCB 2GTZA 4FXGB 1AI1H 2Y3NA 3RZCC 3W5MA 1TZGH 2DPKA 1U2YA 1MCWM 2KLSA 4ICWA 4Y88A 4N90D 1Z9NA 4F3FA 3Q2VA 4P57B 4WEBL 4PY8I 3EO0A 2NDGA 4P2RB 3W82A 3SD2A 4BH8B 5T5FH 1EWHA 3GMPA 3G6JB 4GYBA 1JWUB 1FGNL 4LU5H 4PW9A 3RB5A 3VNYA 2ITEA 1EDQA 1J9RA 3A3YB 3ZGIA 1J1OH 2WTRA 3E3QC 4N6QA 4X4ZA 4Y1SA 3U1SL 43CAA 4B27A 5DJZB 2VTFA 3GUTA 2R23A 2C4FT 3KPQA 5J13C 1OALA 3OKEA 3KLLA 2I07A 1ADQH 1KIRB 3AWEA 4PTTA 1MQ8A 1RHHA 2RAMA 3V6OE 4JFUA 2AEIT 1FNEA 4JJHA 3BEVB 2JXMB 4IK6A 2ISDA 1KN2H 4ODWB 5GGQL 4KWUA 1G7MA 3B43A 1NBCA 3T9WA 4OIAA 4PJFE 2Z93B 1G0XA 3GJFB 5DEJA 1TJHH 1X4YA 5JQIB 3K81A 1CDHA 3LXAA 2GKIA 5D70L 4G8GA 2YLKA 1YDPB 1FNLA 4Y5VB 2BW5A 2LW3A 3FCGA 3GZOA 3MGOA 5HDLA 4F8PA 3APNA 4ZPTB 3MLPA 1XGPA 3L95A 4BD4A 2WJ7A 4IJ3C 4R5XA 2R1XB 4M93C 1JRHI 1BFOA 4X9YA 5EU5A 1JPEA 1OVZA 3GRGA 2R0LL 5FO7B 3UAAA 4G59C 4PJBA 5ICZB 2X53A 5D7IA 3R7QA 4UT9A 1MJ7L 5D5ME 5IVOA 4G7VH 5IEHB 3GSOB 2WKLA 2R2HA 5IJKC 4TUOB 3LIZH 3ZRFC 1ZDQA 4KDTC 5A2KH 4ELMA 3MV7A 4MHHG 4OCRH 1XMWA 4WFEE 2FAUA 1CFQB 5DJXA 2NUTB 3WHXB 1A9EB 1EGJL 3ZL4H 4O02L 3TV3L 1FWXA 4TN9A 3SGEH 3T09A 1FFOA 3DX0A 4HUXA 4ODBD 1AD0A 3AZUA 1WC7B 1ES0B 3DBXA 1SN0A 3VXRB 2WW8A 1AHKA 3IF1A 3MLZL 5FYJD 3W9DA 3PWPE 1NGZA 3L3HA 4WEBH 1Q94B 2UY7B 4GT7A 2V0AA 1HESA 2EVHA 3QQXA 5ERWA 1FGNH 4WW2C 2VUYA 2PYFA 4PJEB 3U1SH 3DHPA 3RTQC 2KT6A 3B2VL 4WU5A 3UADA 2QKIC 3TEXA 4ZW3A 2N0MA 3P0GB 4UOQA 5E2WL 1PDKB 2DLHA 2K8MA 2OV0A 4UQ2B 3ZIYA 5MENB 4DTGL 2LU4A 3V52L 1JZ4A 1XGQA 4BUHA 2ICWJ 5EZOL 1KYUA 4AENB 2XQYK 3GMLB 5GGQH 5HDQL 3QYCA 5B38B 2EDKA 2O6PA 1INEL 4M7ZB 5KVEL 4NRYB 5ICXB 3IRCA 4HS8L 5D70H 2HRPL 3AU1B 4E9RA 2A4CA 3MRCB 1U3HD 4TPRL 5KUMA 2YHGA 4LHQB 3JYBA 4P48A 4XVUD 3NQKA 4FQXB 5I0ZA 4XNZB 3L3KB 4M3JA 4G7RB 3QQDB 2HFTA 2R1WB 3FH5A 2OMUA 4LEEA 1C08B 2R0LH 2VLRA 2YC1B 1BBJB 5TH2A 5JPMC 3RHWF 3QUMA 3A4EA 2ZXQA 4FTVD 3DXAE 5FO9B 3WCYA 4NHUA 2B20A 2HLAB 1OAXL 1BQRA 1MJ7H 3FQ1A 7PAZA 4PGEB 3L16A 1FN4B 3QG7L 5L7XH 5I1LA 1TCRA 2V2XB 5AVVB 5ILTL 1SXSA 3U4EB 2APBA 2E56A 1E9PB 1XD1A 2QSCL 3VXSD 4HIPA 4IOIA 2R59A 1XQ4A 1EGJH 1ZHLB 4X6EB 5KN5A 1IIKA 4O02H 3TBTA 1DDHB 3UG3A 3TV3H 2OI9C 3D2UD 3QQ9C 1ZS2A 3LIUA 4NNYB 3K6IA 3EYFB 3SN6N 5E08L 4B9PA 5J9PB 2UXTA 4N2DA 4QXTB 2VLJB 5F0LB 3JZYA 3ESOA 4KOBA 5KYNA 2OR8A 3GS7A 3MLZH 2MCG1 2G5UA 1UOLA 1P7BA 5C0CA 4WTZG 1U91B 3IGAA 1NMCC 1Q1PA 1T1ZA 4L8BA 5CZVH 1ZKAA 2X9XA 4L4TB 3FB7A 4QRAA 4OVUA 2XHNA 3SDCB 3E1F1 4KMLB 3IJEB 2DD8L 4HC1H 1MHEB 1QWHA 3LPOA 5EO0B 4KNQA 3B2VH 1B0RA 4GXFA 3ARDD 3NPSB 4U1LA 3KYNB 3KPSD 3S5ZA 4IRJC 4CMHC 5CEZE 3QIUC 5I1GL 4PW3A 1HQ4A 1EBAA 5E2WH 4QAMB 2R69A 3AY4C 3PQYD 3Q5YA 3QR1A 5H2BA 3IJ7A 4L4VA 4DTGH 2XXMB 4M8QB 4CGUB 3V52H 4I0KA 5CN1A 3HR6A 1G1CA 3FHQA 5CMAA 5EZOH 3HPLA 5HDOA 9PCYA 1PQZA 3HC3L 1CQYA 1XGRA 3UAFA 5HDQH 1IGFL 4WNQA 3BW9A 1KIQB 1INEH 5KVEH 4U1KB 5C7XL 3PS6A 3MLUL 4PJFB 3O3AB 1I7RA 4HS8H 2H41A 2HRPH 2PWGA 4C4UA 2KMWA 4QXWA 2QVMA 1DVFC 4M03A 1NWOA 4TPRH 5IWLC 5DGQA 1DQDL 3SY0A 4Q0XL 4WV1B 1U3JA 2C34A 3ARSA 5KYWB 2P5ED 3P4OA 2COQA 4YLBA 2JKSA 3JUYA 4QWWC 2ZCLL 3EADA 3LB6C 1GS8A 2IC2A 4GUQA 1HHJB 2QADB 3DIVA 4NRXA 2GK2A 4ZX6A 1OAXH 3CC5B 5JYMA 4RGNB 1D2PA 2RACA 2BP0A 3QG7H 2IALA 5D5MB 4Y16C 1TVBA 1IGML 1H6TA 3L2MA 1BDYA 3IN0A 4N8CL 3S37X 5DD1L 4AIOA 5L8LB 1H8NA 5ILTH 4KK6C 2AMUA 4U05A 3S4SB 4U6HA 2H0FA 1FIGL 3PIQB 3UTQA 3NEOA 1GC1C 5CWSA 2QSCH 5JDJA 2MHAB 1TMCB 5DC2A 5LGJB 2PPCA 2GT9A 4HMCA 5F6HJ 5IG7B 2IAMC 1LTXA 4KRLB 3U79A 1UD4A 2P8PB 2ENJA 5HYSG 4NXSA 3U1PA 3DO7A 1SPDA 4HJJL 4DT2A 2XXCB 4KK8D 2R1YB 2VDLB 1X4XA 3QUYB 4ELKA 4NP9A 4R0LA 4IKNA 1Z6JT 4OBRA 4XNQB 2IADB 2UZXA 5HHOE 3DRTA 4FULA 4QJ4B 1SJHA 3PWPB 3GZKA 2F1EA 5INCB 2ERJC 2CLZB 3MHZA 5C0DA 5GS1B 1YRKA 4A7GF 3WNIA 4DN3L 2DD8H 4F8OA 1THAA 1DBKL 3TOPA 4CVXB 2F54A 3HAEG 2ZPKL 3RGHA 4MNQA 3DARA 2XVLA 4WDIB 4CBPA 1RPQA 1XCXA 2WQAA 2EKJA 3FQYA 1QO3B 5I1GH 1X5GA 3EJPA 2EXWD 4M5YL 2D7NA 3H2QA 3BD5A 3MV9D 3HPJA 3WE1A 3I9GL 4WWKA 3T4YB 1JXDA 2DOCA 3NJIA 2VO5A 2O6CA 4DP1X 1EFQA 1IGJA 4AJVA 3HC3H 3BISA 4PBXA 2XY1A 3L9RB 1FSKC 4LPTA 1IGFH 3QJVB 5SWQB 1AGCA 2BXYA 4CSTA 3U46A 3AREA 1NEUA 4KKLC 1IVLA 4Z5RA 3MLUH 5F3FA 2X2UA 1QFPA 3BCFA 3MUGA 1QX1A 2A0LC 3KJ4C 4UM9D 1UGKA 1RJZA 3EO1B 3EJTA 5DEGB 2AAVA 3HFFA 1DQDH 3TIEA 2CO3A 3CSYA 3D39E 4Q0XH 1SEQL 4XI5D 3CZUB 3D1MC 3WELA 4EDXA 1K5NA 4A04A 3PWUA 4W68A 2V9RA 3W0WE 2ZKWA 3FUMA 3QDJB 1RJYB 2DKMA 1OP4A 2B14A 1HK6A 1AHMA 1IGMH 5AL8A 3WJMA 4N8CH 3KLHD 1D7DA 5DD1H 4MCZB 4WK2B 4FXKC 1UZ6E 1FIGH 4PMEA 4K07A 3DGGA 5IHUH 1HHKB 5D1XC 3RFZC 4X5WB 4KHTL 4XMPL 1AZUA 3F8UB 3FQ2A 3L9EA 4GO8A 5CCHE 1ZIBA 2VRKA 4NDMB 3UTSE 1HJBC 4PJ5E 1XIWC 1I7TA 4HJJH 4U3XA 3RYMA 1E8WA 3G6AA 3QAZB 3BPLC 4JMNA 3TBBA 4OZIA 5F2FA 2H7WA 1HCFX 4CU8A 2CM5A 2AQTA 4Q4EA 3UZEC 1O6SA 4ATTA 3RGVA 2QHRL 1XF2A 2H3KA 3HKZA 4DKTA 3FQTB 4PEEA 3UGXA 1E6OL 3B4NA 4GMSL 4TUUA 4Z7UB 3IB4A 4UV7L 5KYUB 3SBRA 3MBWA 2YD1A 3BZ4B 3EDEA 2LU7A 4DN3H 1DBKH 1TVHB 2WIIA 2BM3A 4PJGF 3V10A 2ZPKH 2AGJL 2DEWX 1S9WA 4JPSA 4PVNA 4IEFB 5EDXA 4M5YH 1G5AA 1UXSB 2EYRA 2ADGB 5F1IB 4WZ9A 2EILB 2WO2B 1CXHA 4PD4K 1JXKA 3I9GH