2EVIA

Structure of a ndt80-dna complex (mse mutant ma8t)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
303
structure length
290
Chain Sequence
VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle/dna
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*AP*CP*AP*AP*TP*AP*AP*C)-3'
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 86
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2eviA00
1M7UA 2EUWA 2EVHA 2EVFA 2ETWA 1M6UA 2EVGA 2EVIA 2EUXA 1MNNA 1MN4A 2EUVA 2EVJA 2EUZA
chains in the Genus database with same CATH superfamily
3RZWA 2QJDA 5IB5A 2YFNA 4NPYB 4LRNL 3GXTA 1DEEB 1B2WH 3B9KA 3MLYL 1RK1A 2ICEA 2KZKA 2V2XA 5F7MC 1KJ3H 4OGAC 5C0CB 4KKLD 4PJ5E 4PG9B 4EN3A 3PWUB 4E9XA 4GFTB 1FIEA 2LT9A 3BP7A 4A7GF 1TNMA 1BYOA 4HJ0D 3SQBB 5LKNA 3N85H 5AUMB 1IQWH 3J07A 3N0PB 2HMIC 1UFUA 4A63A 1QHQA 2NT0A 3OXRB 1IBGH 2J6WA 1D7FA 1P4BL 3N0AA 5DK2A 4F9PC 5FGCE 4PY8J 1TQVA 2BZ7A 3S5YA 2K3HA 2PPDA 4X6BB 1KTCA 4XPGH 2VLLA 3MV8B 2WKLA 1G84A 1TO5A 4DFHA 5I0ZA 2H1XA 4IRSA 1E5YA 1G9NC 4PS4L 1MFDL 2VB5A 3A67H 4OD1H 4P5TC 4YHLH 1R5VA 2UX6A 3ESVF 1EDYA 1ZAGA 5D55A 4YZFF 3WDJA 4TQ8A 3V4VH 1M1XB 4HZ1A 1KYOJ 5LAXA 4HH9A 4F5CA 1RIHL 3UYPB 5GS0H 3T8XB 3MBED 2IQ9H 3U46A 3EH4B 2H6PB 4WNSA 5D2NC 2R51A 3ZTNH 3P02A 4BJLA 4O2FB 1EEZB 1HH6A 1MRFH 4N2LA 1AGDB 2X40A 3NG5A 3U7WL 3ZR6A 5DD1L 3PPEA 3ZY7A 3OL2A 1DJWA 3A21A 4QT5A 4Y9GA 4YSUA 5JXAH 5DD3H 4KNUA 2C7UA 3C8HA 3DUSB 3L5XH 4M3HA 5JHDA 4EUPH 3CFQA 1U92B 1KUMA 3M07A 4MA8H 4ISVB 1A5FH 2JKRM 4YSCA 4KO5A 2NYZA 2HRPH 4HK0A 4MXWH 2VSMB 1KBGH 2V2TA 5D4JA 3CIQA 1PDKA 2X1QA 4M5YL 4PV8B 1T2QL 1FNAA 4UB0L 1XGQB 4QY8B 1KG0B 2YAQA 2J8HA 2ZAIA 1D5RA 1QQDB 3QORC 3TJEL 4IBZA 5DD0H 2R4SH 1LK3H 1RK7A 3M8OH 1HOCB 4QLRA 3TTYA 3L81A 4LLYA 4OKVA 4F3FA 1H8OA 1P9MA 4TNVF 1DDHB 5B3SB 1IEHA 4QUOA 4F7MA 2BVQB 5I5RA 5E00A 3IMWA 5DSCB 1PLGL 5I9QB 2CK0L 1ETJA 1WZ1L 3BQUD 5C0JA 1T7YA 4U3SB 2ZWLT 4I1NB 3VRIA 1FDLH 5D93B 4AW7A 2GFBB 4GSRA 3AXHA 1XIWA 4AYEC 3ZTDC 3V52L 5AD0B 3N43F 4N0UA 1JVOA 5ENWB 1VFBA 4AE0A 1CFVH 3LNIA 2A4EA 1PCSA 2IO5A 3Q2VA 2WQWA 3CHPA 2TAAA 3IDMB 1JWSB 4Q0XH 2OQJA 4KJQC 5HHVL 4OIAA 4P05A 1B4LA 2BP5M 2IXQA 1RV6X 2PXYA 3WJJC 2XTSA 1T7XA 2F8IA 3H9YA 5EIIG 1BM3H 3G04A 5ICYA 3T1WA 1NBYA 4YK4C 5KTEH 1G5GA 3GPSA 3JWNG 4UBDC 4Y2OA 4PTUB 2ESVB 2VN4A 5LXVA 3NAAL 3TVMA 2FUTA 3B56A 3FYEB 5B3NA 4WI4A 1U8CA 1UH4A 1XSIA 4HOXA 2CO7B 3QPKA 4AMXA 3CJJA 1KTDA 5JQ6H 1ZHBB 4FL4B 4KO6A 4MJIA 1A6WL 1QBLL 2NY5L 2VNCA 5E94B 3EYVB 1PY0A 1R3LA 2V0AA 1NWPA 2CKBA 2BP8B 3C5ZB 4L8SC 5DZPA 3PWPD 3QI9D 1A7OH 3PHQB 2R4RL 3O6FC 3CUPA 3FJTA 5D2LB 2JKTM 3O2WL 2X4NA 3KVQA 5E4AA 1EAQA 1VSCA 4JFXA 3NZ8A 3MJ7A 2WC7A 3RTQC 4H2AA 3IKKA 3CBJB 1ZA3B 1RHFA 2BNQA 5HYJE 5SWZD 4BK8A 2GBAA 4P2RA 3Q5OA 2OCCB 3Q13A 3TTSA 1G6RB 3IGFA 4MNGB 1NAKH 4G8AC 4TL4A 1SMDA 1ZSDB 2XWEA 5T1KD 1ETZB 2CIIA 4KKZA 2CJSA 2X0WA 4IOFC 4QHMA 2Y69B 3FAWA 4FJ6A 4NM8L 5E1AB 1JVLA 2NY2C 5HY9A 1UGNA 3IAQA 3T0EB 2ED9A 3JTSB 3KPSD 3GI9H 1R3JA 2IDCA 3EYSL 5FM4A 4GAYA 2VUOA 3PHOA 5E6IB 1LE5B 4ZMNA 1IJNA 3PWLB 1GJIA 4XNQA 5E4EC 4P57A 2G2RA 5CZVH 4IDJH 3TN0A 3KPQA 1A6ZA 1NCBH 1USZA 2BOLA 2VRAA 3QQ4A 5KYXA 4E42B 2VSDA 3P73B 3EYOA 2WB7A 3O3DA 1O9VA 4QRQA 3VWJB 4E5XB 4JFQA 2ICWI 5IFHH 3U4EB 2P5PA 1WSST 5FLUA 4BFEA 2ZYSA 2CLZA 3UBFA 1SUHA 3DX0A 1HE8A 3NCJL 3VNYA 2X4UA 4AC4A 2Z3FA 1BXVA 5D71L 3T3PB 4BFGA 2XKSA 3KM1A 5KANG 3TOPA 1JNNL 3LQAC 4FNUA 3GSOA 1BLNB 1HAUA 5IVXA 4CNIA 2H1PH 2M2DA 3PIQB 5C6PB 3LRSB 2Z1KA 3KWVA 1BZDA 1KTJA 3AXLB 3E2HC 3UG3A 4JM4H 5IMMB 2FDBP 4FXGA 2ADFL 1QA9B 1WP6A 2VIRA 5T1LA 5I15H 1FHNA 3EJYC 4AOFA 3Q06A 1CXHA 4PCKA 4NUMA 3F05A 2ZAHA 3CBKB 1NOFA 2XQBH 2FYYB 4FNLL 1XZWA 4EOWH 3K5RA 4XVSL 3T77B 4ZS6D 4DVRH 2K3TA 4NZUH 2V8LA 1T1YB 3KPSE 4LSRL 3QNYB 1S7WB 1GRWA 1RHHA 3V0VB 2TRHA 2Y23A 1HSBB 2RMNA 1COBA 1HNYA 3OXSA 4UM9B 1I85A 2X4PA 3PHSA 4A7VA 4HHAB 4K94L 2AK4B 3VM5A 3P69A 3DO3A 5DHVA 3LH9A 1JYVA 2R0ZL 1ES0A 2YHGA 5JHLL 2G3MA 2HTKD 3ARDB 2VXVH 4NPJA 2OJEA 1DJXA 4RDQF 3S98A 3C5XA 3H55A 3IDYB 4FTVA 1BBDH 4GI8A 3F83A 5E0QA 2NUTB 1OALA 1IC7L 5KSAD 4IGBA 1HEZB 4BSVB 2OP4L 3G5ZB 4BH7B 3BKJH 4MAUL 4DO5A 2AXJA 1VZIA 3HEIB 1AKJA 4PJ9D 5JYMA 2BSTB 1YJDL 4KQ3H 4PI2A 2F5BL 2UZXB 3RWCA 5KOMC 3QUXD 3CMOL 5AWNL 5C2UB 2NY1B 2E9WA 1QSEA 2Q2LA 3BSHA 2D31A 3BGFC 2XDHA 5J6GB 3EOBB 1PIGA 1IM9D 5E8PB 1AO7B 1F90H 4AJYV 3QWNA 2B4CH 3BKCL 1AZUA 1F8TH 2BNRD 2R2BA 2VXQA 3BSZA 4GMSH 4JDVB 4PTTA 2OSLA 1E6JL 4NP9A 3DV4A 4GY4A 4I0PD 1LE9A 1DJIA 1I1CA 1DVQA 1LMKA 1VAHA 3FT0A 3FUMA 5F6HI 4Y5VC 3TONA 4F7EA 2A4ZA 1YN7B 3HAEG 4HU2A 3FDWA 2WBJA 4Y4FD 4UV4H 1ZA6A 4I48B 5GGRY 1KJMB 4UIKL 2L7EA 4RSVA 1I8LA 1NOLA 4IBWA 4HCIA 1OGAD 2GW5A 2VITA 4PWIA 4PGBB 2C9PA 5HP5A 1M05A 1QR4A 3FQUB 4MS6A 2DQIH 2J8UE 3W37A 3QZNA 3GSNH 1I7TA 4F37F 4WK2B 4N24A 5TFSH 5JR1H 1P84K 2I25N 3ZKQD 5F88B 3BZFA 1J0HA 1XX9C 4XVJH 5KS9F 1K8DA 4PJGE 4WIQA 4ORGA 3V8OA 1QBMH 4E9RA 5E8OB 3T6ZA 3U48A 4HUWA 1UKSA 3SIKA 1N6UA 2R7EA 5TH2B 3CFCL 4AV0A 3TFKD 2GIMA 2HKHL 1SHWA 4WRLA 1NAMA 3GJEB 1K8IA 4R0LB 3ZSTA 2XACC 2O5YH 1MFMA 2Y5QA 3RWDB 4Z7OF 4H8WC 5FKPB 2EXSA 3NZHL 1MI5B 5FEBA 4BEIA 4W4NA 1TKWA 2BNRE 3ETSA 5EZLA 1E9QA 3D39B 2A9MH 3QIBD 4K5MA 5H37A 3L2MA 1INDH 4LASL 3OKDB 3RJQB 2XTJC 2WXJA 3H42L 3ATBA 3P4NA 4DZBB 3MRJA 1DL7H 5SWSE 1PZDA 1ZJBA 1A9BB 3NJXA 1AHWA 2VW7A 1OGAE 2IH1B 4UT9A 1Z3GH 3WO3B 1GZPB 3UIYA 1GW6A 3DROA 3HFMH 1FNGA 1JPGA 35C8H 3X3GL 4DN4L 1PG7W 4OCSH 3V4PA 2VN3A 4I4WB 2MQGA 3D25B 3ATDA 3RG1C 25C8L 1BJMA 4HHWA 4GMTL 3WG7B 1LILA 1CB4A 3GMQA 4YSEA 5FUZH 3JV4A 1IRAY 5BQ7B 5I6PA 5I1AA 1NL0H 3BAKA 3C8DA 4ONGH 2NCEA 1MLBB 4N2MA 4S1DD 4GRLC 2A99A 3B4NA 1DLHB 1BQHG 1U8JA 2B20A 4H5SA 1UJTA 5ECJE 2VERN 1AR2A 1JGUL 1JRHL 2P24A 2ZG1A 1NEPA 4PRID 1MUJB 4H8UA 3BDYL 5KBMA 5C0AD 2X9YA 3X11B 4DSYA 1G9EA 1XO8A 1DUYB 4XBPB 3A4FA 5KYWB 2XXGA 4CMHB 2EP6A 2YWZA 2B9BA 3QEGL 4M00A 4N9OB 4P23D 2B08A 4QRFA 2JH2A 3H9HA 1EK3A 2ENSA 2XWJB 5DJ6B 2BLFA 4J3SA 4MB5A 2BOBB 3FO9B 1X5ZA 3EJJX 2RA1A 2R0LL 4PRDA 2W07A 4Y16B 5LQBH 4F7KA 2V37A 4P9HH 2VJ0A 4YSTA 5I73B 3AJ7A 1E30A 2HYMA 4NQCB 3K6FA 3MLUL 4YIQB 2VZTA 3VXQB 5CLWA 3U82B 3JTBA 1A4KA 1J1XH 3ZE2E 1C5DB 4UYQA 4XPFL 4AENA 1VEMA 3EGDA 1FA4A 2L7UA 1TETH 2VDKH 3VD7A 4TRPH 2CDGA 3MJ8B 4RAHA 5AYTA 1X4ZA 1YDPA 3FRPG 4WI6A 3VFNA 4H8QA 4YSPA 1A3LH 4MDJB 4XP1H 1Z9MA 5L4FA 4P9ML 2I85A 2JWYA 3UCRA 2Y06H 4R7DA 2ZJSH 5F7WC 5L8JB 2JIXD 3MLWH 1UYWH 3CHXA 3RNKA 1OB1A 4OY9A 2EDTA 3H6AA 4OAWA 2VLJB 2R1YA 4OJYA 1DVYA 4DAGH 4J4PD 3ELAT 4PRIE 2QADB 3H3PL 2VUYA 3UAJC 4DGIL 1W0WA 2AKRA 4WI3A 5C0AE 1KY7A 3D9AL 4G6MH 4LCCB 1O7VA 4YDJB 2V7NB 1QPKA 3OX8A 5JPMB 1RZ7L 2B1AH 3IJ8A 3LMJL 4QHNB 3WFCH 4GXUM 4GAGL 3UC2A 4JDZB 4FDWA 5EEUA 4URKA 1MHPL 2W80C 1XR9B 3EDEA 2W81C 1GC1H 3MV7B 3VSQA 3BI9X 3SE9H 3AM8A 3U9WA 2Y1VA 5D1QC 3RWGA 1FG9C 1TTFA 4GUQA 4BFOA 4KPHH 4OVUA 1S3RA 4PV1C 2R1XA 3WFBL 2J1WA 1G0XA 1DP0A 2DI9A 2HVJB 5K39A 5TJWK 3S97C 6FABL 3KXFD 5CEYA 2F54A 2R56H 5LJYH 2WD0A 1J8HE 1QLEH 5KYUA 2B15A 1TQBB 4L4TD 4AEFA 3EH2A 3CVHH 4HFUL 3JTTB 4CVXA 3V0GA 4M7ZB 1F00I 4G6AD 3CDGB 4TQHA 1CF8H 1G7QB 1H5BA 3IU3A 2D73A 2QV4A 1LO5B 1CDIA 1MW3A 1UXWB 3IPBA 4NN6B 4BD4A 1EBAA 3NFNB 3ZKXC 5F89B 3ZO0A 4PJBA 3SYQA 4H1LH 1E3FA 5EZIH 5DRNA 1LEIB 1BD2E 1IBGL 2AQ3A 4N8CH 3BT0A 4WWKC 3VSVA 3ZKSD 1XR8B 4L5FE 1QI4A 4ODTH 4YEFA 1QR1B 4XPGL 4BGLA 3KAAA 4NO3B 2A74C 3LN5A 4RH4A 3M1OA 3VFSB 4A2FA 5FHAL 3UZEC 2XI9A 3II2A 3ZDYF 5I30L 5D4QA 5CGYC 4M8RA 2WQSA 3P0VH 4HS6B 5BZWB 1OPOA 4YSQA 1M3IA 4V1DA 4UT6A 4S10A 2AZAA 5GS0L 4GXFA 2IQ9L 3QFGA 2F8XC 3VB9A 3QUYC 4HKXA 3MKKA 1UG9A 3VXRD 4LOEA 3WNPA 3G08A 3U79A 2CJTA 3LZQA 5E99H 3J7HA 1NFDF 1HZHL 3KXFE 3MYJA 5DD3L 4AMWA 3DIVA 3QEQA 3ARZA 3DKHA 5F8QC 3APNA 3BIKB 5DZNA 2EDKA 4L4TE 1A7QH 3X14A 3ZTCC 3WFEH 4JFZH 1OQXA 4MXWL 1KBGL 3KZ8A 1X5XA 4MB1A 1J0YA 2Y6SD 4R4BB 5F70A 3SCMD 5AVVB 3VXSD 1GTFA 2XWZA 5EBWA 3ECBB 1IGTA 4YHYC 1LO4H 1B0GA 1X5AA 3QR2A 5D7IB 1UUSA 4PJXB 2R4SL 4LGSB 2NSXA 1G7IB 2V33A 3LEVH 3ZVVA 5EWIL 1L9MA 2AJ3B 2XZAL 3B9KD 2FJHB 4JPVH 3BPLB 3ARBC 2VDQL 2XN2A 5FOJA 3AS3A 3G6JE 5FAAA 3B2UC 1OCWH 2VAAB 5B39G 2OL3B 43C9A 5F9JB 3BP6B 2FLBT 2XQYG 3MFFA 1FL5B 1E2ZA 3V10A 1BG9A 4XXWA 1PD6A 3BH8A 2CO2A 1MCLA 4M1GL 2P5WA 1PNCA 4FXKC 4XZUB 4UNVA 3GJFA 1WWBX 4Z7VA 1LO2L 2B5IC 4B9FA 1WJ3A 4FQ1H 5DWPA 3VXRE 4X5WA 4CVZB 5MEOB 3VFGH 4GG8A 4AM0A 4JO5A 4JZJC 5L4IA 4IRSD 2NSQA 4PW4A 3LXUX 5F7BA 4YWGL 3RKDC 2H2SD 2V9TA 3ULUD 2Z35B 3HZMA 4LOUD 2AK1L 4IRZA 1LP9B 4Q0XL 1ZTXE 4FABH 4Z7NB 4ZOCA 4ZO6A 2E7DA 4OR1A 4Z95H 5D5MA 4ZAKB 3WHE1 4KKBD 1JZGA 5I1JH 1G9NH 5C07A 4RRPA 5KTEL 3ENEA 4V2BA 3MUGA 1UD6A 4Z8FL 3TEUA 1T6BX 2QGBA 4AI7A 3LEYH 2X0UA 2G75B 2HH0H 4YXKH 2NY7L 5LCVA 1RZ8A 3VXSE 5I66A 1VZGA 3BMWA 4HVBA 1JGVL 1PG7L 4UILH 2W9DH 4L8CB 2XKUA 4JM2B 5JHDD 3SGKA 3KPRA 3KYKH 3MRFA 5AL8A 5K1NA 3V6OA 1A6UH 2ZUSA 5L88L 3U1SL 1YPZF 1KN4H 4HUUA 1A7OL 2QVMA 5EIIB 5ACLA 2EYTB 4IQHA 3HUJB 1KJ2L 2XNAB 3FOMB 4GXVH 3DECA 1F5WA 3ZOAA 4KROB 3MACL 1MFAL 2C1OB 3WGVB 3MRMB 4FKEA 1NSNL 1F4XH 1AMXA 1EWHA 1FO0H 5J9PA 3MXVH 4DGUA 5J12B 3MCLH 1NAKL 2VDPH 5CBEB 5AW5B 4XZ4A 2Y2TA 2OS7A 3WN6A 4TVUA 5CCKH 3BPNC 1JP5A 4NPYA 3MUY1 3SPIA 1V55B 3B7SA 5GHWH 4ABUA 1VFAB 1DEEA 3IFOA 1CD9B 1BQSA 1Q0XL 3QP3A 4WCYL 1F13A 2J4WL 2E0PA 5C0CA 3T2NL 1T3FB 3WKML 4PG9A 4WU5A 3SYPA 4OJEH 3TPUA 1D9KB 2EQDA 5GGTH 1XIWD 1FSKC 2VYRE 2WV3A 4DEWA 5E7FA 3N44F 4Q9RH 2JKIS 2VE6B 1NCBL 3SQBA 3DX3A 4G8GB 2A6IB 4QHPA 1QFHA 5DFVC 2MOQA 3UBXI 1QW9A 2HT3C 2J20A 5JHDE 5IFHL 4PEEA 4ZYKA 5ALBH 4X6BA 4GLRI 4UANA 1MZZA 3C2AH 3ZX1A 2ITDB 4MJHA 3TVMD 2R0KH 3AWFA 4MXQD 2WN3A 2CR3A 4RIRB 4NEHB 4DQOH 1M1XA 1U8LB 3MODL 3UYPA 4JM4L 4MJID 3T8XA 1B0WA 4NZRH 5GGVL 2CR6A 4XXCA 2FATH 2H6PA 3VWKC 4O2FA 1EEZA 2GSGB 1DBBH 3LZPA 5F3HB 1AGDA 1G0DA 1ML0A 2COQA 1W8EA 3X12B 4ABVA 4AEIH 3KMDA 3AY4A 4NZTL 3CTTA 2VO5A 1TUPA 3DUSA 4IBQA 4CADB 4F7CB 3O8XB 5GS2D 4EOWL 4A55A 5EUOF 3P4MB 4ISVA 3FC8A 4L1SA 3PAUA 2GSMB 3IJSB 4NZUL 3TNNB 1S4IA 1MFCL 2X4TB 4HJIA 4KUZH 1OCOB 2BNQD 4FI8A 4PV8A 4TL5A 1XGQA 4I3RL 4AKQA 1KG0A 4YO0B 3S36L 4P2RD 2BINA 2K7PA 3Q6GL 4XN2A 1U2YA 1DQJB 5D6DA 3HN5A 2IQAB 1WIOA 1DUZB 1ZD6A 1Y6KR 3GEFA 3FT2B 1R75A 2YMXH 1HOCA 1ID2A 4OH2A 4NP4H 5DURD 1E67A 1BBDL 2H4EA 2LU5A 1DDHA 1TPXB 2EXYD 4PJEF 3VXNB 5B1JA 5LAPA 2BVQA 5E03A 2J72A 5DSCA 2DQUL 1M7UA 3ILQC 4FFTA 4ZUTB 3IJHA 1CBJA 2EIBA 3BAYA 2NLJA 3BKJL 3BUIA 4EI5C 4ZG1A 5JOFB 1UFGA 4U3SA 4XP9H 1OF0A 3FB8A 3TN0D 1JNHA 2APVA 3GBDA 4HBCH 4KQ3L 3QA3B 4RDQG 4WI5A 1F6AA 5HPOA 4CJ1A 4WJG3 1JI2A 4ZFQA 4AITA 1H15A 4MJIE 2GFBA 2A6JB 5DUBA 1U8PB 3G6DL 5AD0A 4WY7H 4PB9L 3EF4A 5FW6A 4WEEA 2BIQA 2C9VA 4WJ5A 5ENWA 3T3MF 2UY7B 4FMKA 4TSBH 3RWIB 1JWSA 4M4RA 2DQFB 2YD5A 4AK2A 2FJGB 1IFHH 5E5UB 3PV6B 1CFTB 2FYVA 2QDVA 5F96H 1LM8V 1F90L 2FO8A 3IU4H 3LQAH 2ESVA 2BO0A 2J8UF 3MLTB 2DM3A 5T5FH 4OI7A 2B4CL 2MHAB 4KI5D 1F8TL 2K8QA 3N41B 4GMSL 1NCAH 1ODAA 3TWCH 4L48A 5CEZD 5T1LD 4F57H 3TEYA 5CCJA 2O5ZL 3L5IA 2YXWA 4WFFD 4F58L 4MS8D 4LBAA 2CO7A 1ZHBA 4M29A 5IQOA 4L9DA 4N8VG 3BVXA 3SY0A 1BAGA 3EYVA 4UV4L 3WIAA 3CLFH 3MRHB 2BP8A 3HBGA 1IQDA 2XJLA 3NSDA 4G9DA 1HCZA 3PHQA 5DJXB 1ZIAA 5IFJA 1PCXA 3QIWC 3WGUB 4I1PA 1MREL 4H0LC 3OKOB 4FZEL 1BDYA 1J5CA 2Y36L 3GSNL 4MMZC 5EPMB 3OR6B 5GRJL 4B50A 3QZWG 3DUHA 3US0A 4JKLA 4M7JH 2CQVA 4W93A 2E5EA 2YC1A 4TVSa 1ZV2A 4FTVD 2J88H 1SXAA 1QRKA 2P26A 4U6YB 1GGBL 1G6RA 4MNGA 1OP5H 5J1SC 5FV1L 3HAEB 4IGBD 5IQNA 5AVXB 4L1TA 3RB5A 1LLAA 4ZO8A 1ZSDA 1ZV5A 1SJMA 1ZVHA 3QJFB 3HG1D 4ZNCD 2WZ5A 3AREC 4M7KH 2F19H 2QGCA 5DJ8A 1AKJD 5E1AA 4O02H 4ZRGA 5IVXE 1YNTB 4FLSA 4QAMB 3JTSA 5C70A 3T0EA 5HGBB 4YL9A 2O5YL 3QNXB 3CGTA 1ZHNB 1T03H 4IKNA 5AW4B 4LRIC 4KI5E 4YHPA 2DTMH 1LE5A 5DT1H 5BMFL 3HHMA 4MMXA 1QLFB 2H47C 4JDTL 2A9ML 4WFFE 1JF5A 1PZAA 3LRKA 2EDXA 3P73A 1QSED 2JV6A 4I13B 4E42A 3FUIA 3VWJA 1A64A 4NQDA 2IDUA 5EDXA 1JHKH 3ZHDA 3S35H 4E5XA 3V5HB 3CU7A 4LT7A 1OW0C 2BIIA 2P5EA 2YGNA 2YOCA 4GW1B 4OJDH 4PGCB 5BQDA 4ZUUB 1KWKA 3F8UB 1ADQH 4N25A 2E7LA 4LPYA 1DQDL 4GQQA 4OSUH 5JW5A 2ATAA 2WQ8A 3EDJA 4OGXH 1Z3GL 4DP4X 1JCKA 3SGDI 1UD8A 2W1NA 3AG1B 1BLNA 4O2CB 5IHZB 3HB3C 4C47A 4BV1A 4XP6H 4L8DA 1I7UB 2MPAH 3LRSA 1V7MH 4OCSL 2VDMH 3AXLA 1T4WA 1URZA 2IALB 2YK1H 3NJJA 4J39A 5BVPH 1QASA 4OFQA 2WBJD 2X05A 1IC4H 3OPZL 4FTVE 5F6IC 2VXTH 3WYRA 3N1FC 1P5VB 1NL0L 1WV7T 2VQ4A 5AVTB 3ROOB 3P4OB 4A7UA 1I1AB 1YY8B 2BRQA 3FQTB 3HG1E 3C8KB 3BAEH 5HYSA 1UJ3B 2OMWB 3ZQXA 1IGIH 3FQXB 4X80H 3VDAA 3QXTA 4MQXD 2Z9TA 3ZE2F 1T1YA 3QNYA 3V0VA 1C16B 2GBVA 4YGVB 4ZPVB 3TO4A 4EQ3A 4IEFA 4UM9A 2MCPH 1E9OB 1NQBA 2J6EA 2AK4A 3VG9B 1Z9NA 2NSMA 3SQOL 4OZIB 3ARDA 4GRWE 2F53B 3DHJA 2ILLA 4YHKH 3A6CL 1IKFL 1SDDB 3WKQA 4RWYH 4ETQA 2EVJA 5I26A 2YEZB 4ZMVA 3TZVB 3KLSA 2NUTA 5IW1B 1I3UA 4BH8B 5TD4A 3VXTA 5BZXA 1BQHB 3ALXA 5HJ3B 1LK2B 1J1XL 2KDGA 1BX2A 4BH7A 1YY9C 5MI0C 1N64H 1QOKA 1TETL 2BSTA 4QXUH 4E9YA 2YD7A 2NYYD 1XGPB 5D7JB 2JTYA 4DGVL 4NWTH 4C56A 1JGIA 5SX4I 1KXVC 2UZXA 4KQ0A 3EGSB 3WU1A 5TDOA 1A3LL 4XP1L 1W6WA 1MJ8H 3GPEA 1EERB 4ZMYA 2NY6C 2N7SA 2Y06L 1NEZG 2ZJSL 4CC0A 1AI1H 5C0GB 1X4XA 2A9AA 1WUNT 3GMPB 1MJUL 1BA9A 4JFWA 4F33B 1A6PA 1MCOL 3EOBA 5J6GA 2Y4SA 4OZHB 5E8PA 1AO7A 3LQZB 4DAGL 4Z78B 4DPAX 2ZONA 3SDDA 4CA4A 5FM5O 3RWEB 2J1ZA 4ENED 3KGTA 2ZCZA 4QNPE 1AD9B 3UIZA 3IRPX 3ARFA 3CX2A 4JDVA 1YZZA 1L4IA 2W60A 4G6ML 5FHBH 1HIML 2R29H 2JJSA 1RPQA 4Y4KD 2B1AL 4EZKA 3FRPB 5B3JE 4PRBB 2XWBB 3WUWB 1A9EB 4R9HA 4OFVA 2G4GA 2PCXA 4LDEB 3VRJB 3FU7B 3SE9L 3LS5H 3LY6A 4J8QA 1KJMA 4J3WA 5J6SA 4CDHA 2AVFA 4M5TA 3E3QE 1NJ9A 5SX4H 3WI9A 4UUJB 1RXLA 4KJYB 3V0WH 3FQUA 4EQ2A 4X4YA 4XN1A 2I60H 4QKXB 4LVNB 1IAOB 4JL1A 5I0WA 4JL2A 2IPTL 4NUJB 2F15A 5F88A 3CZKA 1GH7A 1TITA 4IU2B 4MHHG 1PZSA 1QLEL 4NKDA 3EGXA 3IB4A 3KDPB 3W82A 4F9LC 3MRPB 2X44D 2PYFA 2TRYA 1UUNA 1KIQB 5TH2A 5DEJA 1CF8L 4KVCH 1FAKT 2NDFA 1ZRUA 2AF2A 2JCCB 4BE6A 4R0LA 1JERA 3V2AR 3IAGC 3BP5B 1FP5A 4OUOA 4EIZC 2AJUH 5FKPA 5MEQA 4ILDA 4K3EL 2Q10A 5AW6B 2EECA 3D39A 4UTBA 1EO8H 1PSKL 4WTWA 2CR0A 3NIGE 1BV8A 3A0OA 3QQ9C 3X1EA 5JORB 2GEEA 1F56A 3EJRA 3GZOA 4PJCA 2GCYB 4BELD 4XX5A 4G80B 4J2QA 4D94A 1EJ6A 4OJFH 4N1CA 3TBWB 3RVUC 4DZBA 5GZOC 1XB8A 3GMMB 1E65A 1FCGA 5FS5A 5F93C 2NQ3A 5C08A 3CDZB 1A9BA 3GBMH 4XMKH 1O9WA 2IH1A 4KRMB 5B38B 1GZPA 3FOLA 1AY1H 3QRFM 1T1WB 1WVZA 5E99L 4QHKI 1DVUA 1XCWA 5F3BB 3PWJB 3L08A 5E2VL 3RDTA 5ALCH 1AYRA 3RZCA 4I4WA 2WLIA 1E0OB 1HDMB 3D25A 2F74B 3T09A 3EO0B 3Q8CA 3W57A 2FBRA 4ATTA 1JZ6A 3DK0A 4JFZL 1QNZH 4G7QB 1NBVH 3G6JF 5B1BB 4R4ND 5DHXB 5BQ7A 1I1FB 3EHBC 1EFXB 3FONB 2OAAA 4KKQA 4WO4D 2F61A 3VO0A 1Q94B 5F1SA 3EF7A 1JS4A 1FRGL 3ZR5A 1DLHA 1OKEA 1SOXA 2O93L 3S3SA 3QUZD 3BVWA 3N42B 4ENZA 1UWEL 1XL4A 4K7PL 1HCFX 4EJ1C 2F54D 3HW7A 1MUJA 4L0YA 1PKQB 4MZIA 4X7EC 3X11A 2PABA 1HKLL 2R9HC 4Z7QE 5EEZA 4P2OB 2WTPA 1DUYA 2DQJL 4PQXA 4XBPA 5KYWA 4N2BA 2XFXB 3IN0A 5K59F 4JPVL 5B7EA 4ICXA 1SLVA 3ABMB 1GKOA 1JGDB 2XWJA 5DJ6A 4Y1AB 3F58H 2BOBA 2HFFB 4KY1L 1CIDA 1WAEA 5D8JL 3T4AA 1WD8A 4LVHB 1CXEA 3WMQA 1TJHH 4R96B 2DKMA 3IDIA 2V5SA 4NQSA 4YIQA 5L2KE 3AY2A 3VXQA 4IBTA 1IC0A 1E4WL 3JZ7A 5E8EB 4AJ0A 1C5DA 3HOGA 1NMAH 3VFGL 4J3VA 4R90L 1NUGA 1C7SA 1IGCL 3QBTB 4QRRB 1E3XA 2W9EH 3HS0B 1QO3A 3NFSL 1BVOA 5EBMB 1G9NL 2YUXA 2OXHB 2Z65C 4V1DD 2BVTA 5FYKE 1SYSB 3U1PA 5B39B 2E9GA 3L45A 4KNTA 1JWUB 4R2GC 4K2UH 3BO8A 5FUCE 3AGVA 5TQ2H 1KT2B 2F7IA 3CVCA 4PJIB 4YXKL 3VDCA 2VLJA 5EOTB 5D7SL 3S3BB 3MBWB 3SSGA 2VERA 3S6CA 3S8FB 3QEQD 2YAFA 2NQCA 3GRWL 4QTIH 4FFZH 2IBGA 2QKIA 2HJFA 3H4FA 4LNVA 4W6WB 1EPFA 3GWJA 2CO6A 1PS3A 4LCCA 3MRLB 4YDJA 4ZODA 4WKXA 5JPMA 4TNFA 3DA0A 4QHNA 1UZ6E 1NMCB 4W9GC 4YBLC 1CGUA 4JDZA 1JZ4A 4BZ2L 3N2JA 4GXVL 1XR9A 3F7VA 3ULVD 3N43B 1MFBH 2VLKA 5BV7H 3K72A 5SV3A 4X6DB 5SX5K 4CL7A 3UBHA 4XE0A 5E6RB 1ZLEA 1F4XL 1BQKA 1IAKA 1U8OA 2KERA 3ZTJG 5I0XA 1T7VA 2HVJA 3AABA 1X9QA 4QHUA 3KYMB 3MCLL 2EO9A 2GT9A 1HQRA 2O72A 3U4BL 1THCA 4RFEB 4B0MM 2ENYA 4UDTB 3RX9A 4F7PB 5CCKL 2OCJA 3QDMB 2FIKB 5GHWL 3RY6C 1J12A 2FWUA 4HJJL 4Q2ZB 2HCZX 4V1DE 2O30A 4F8TA 2XETA 2GKIA 4UF7C 2JJUA 1USQA 5E2JA 2DYSB 4HAGA 2P5WD 2WLLA 2WIMA 3CDGA 5GGTL 2ZF9A 3GC3A 1G7QA 1EGJH 4C58B 1E4JA 1YYLH 5TF0A 1NCDL 2EDNA 1UXWA 3BWUC 3NFNA 1KN2H 1YMHA 4U1HB 4PLJC 1LEIA 2BM3A 3D3VB 3RVXC 4LCVA 1OQOA 4HGWB 1TZAA 1NKOA 1BZ8A 1XR8A 2EEFA 3ZJAA 4BXSV 1IEBA 5C07D 1WFJA 1QR1A 3L9YA 4PWFA 5F7EH 4NO3A 1CDJA 3QDGB 3MNZA 3QXUA 5FYKU 2R0WH 1JL8A 3L95B 3GIZL 2VM4A 4OV5B 2GJZA 1JDDA 4PWHA 4PGDA 4AVJA 1RJZA 3BIAX 1SM3L 3C5ZC 1M7IB 4X6CE 4JN1L 2QQQA 1KB5L 4PCTA 2V3DA 1UD5A 4NC1E 1AQKL 1TIUA 2A9NH 2ZXBA 2ATPB 3E9TA 3GINA 1LWHA 1N9PA 1WFNA 3CLWA 5ICZA 2FATL 3N3EA 2VDLH 4P4KA 4K5OA 3S35X 3AG3B 1DBBL 2AQQA 3ECQA 4R83A 1CVSC 1EANA 1WWWX 5IJDC 3RL1B 1IEAB 4JGNA 2NYKA 3BIKA 2EO7A 3ATAA 4RNRB 2R69L 1P7KB 2UZYA 4N2CA 1R3KA 1MNUH 3VG0H 4OFKA 3O41A 4R4BA 1WTGT 5A16B 2B0SL 2P5WE 4QGTA 4YBHA 1INEL 1E5AA 4Z7VE 3HI5L 5EA0L 2YARA 3MRKB 5ANME 1VGEH 1IBYA 2XG5B 5JOPE 5E1HB 1L9QA 4C55A 1X9LA 3MZTA 2YMXL 4LSUL 2XWTB 3WSQL 1G7IA 1TOXA 2C9UA 1HHJB 2AJ3A 4UTCA 5C07E 3GHEL 5C0RL 1MCJA 5C0CD 3BW9B 3QFDB 3LCYA 2BNUB 4FFYL 2VAAA 3V0JA 3QZPA 2OL3A 4LHJB 5F9JA 4AYMC 3BP6A 4OFDA 2DKUA 4HBCL 1PL3A 2VDQB 4HEPG 2QPEB 1FL5A 2EYRB 4PFEA 1HU8A 4LDCA 4XPAH 3TA3A 1YO4A 1QSFA 3HRZB 4XZUA 1MCHA 4G6KL 2ZWNA 4WY7L 1WZAA 2EE9A 3MV8D 1TNNA 4CVZA 2HUEA 3F6LA 4OD3L 2DQGH 1LP9A 2VABB 3OV6A 3QIBC 2ZCKH 1IFHL 3Q9QA 4ZAKA 4FP8H 1OTUC 2HG5B 1VFMA 1FNLA 2XX1A 3I6KB 3L3IA 1MWAL 4Y2DB 4OLVH 4WW1B 2YD1A 3IU4L 4HMCA 1DVZA 3LQAL 4L3AA 4TSAL 2MSPA 2X4RB 4H8PA 5IBTH 4HJEA 3TWCL 1NCAL 1CFQA 3HE6C 3IGUA 1OGSA 2GI0A 1V8HA 3BFQG 3NIFE 4JZOB 1NLDH 5IROA 4CBZA 5FLVA 1OCCB 4QTHB 3CCHB 4JM2A 4HEMA 4LIQH 3LKPA 4KO9A 3FTGB 1L0XA 2BJMH 4FQJL 4JZNB 3CFJA 3CLFL 4JDEA 1WS7A 3QJHA 3TBTB 3MI6A 5C0CE 1HL8A 3HZKB 3IGLA 1I9EA 2N01B 5EIIA 2WQAA 2EYTA 1GGIH 3HUJA 5GS1C 4PMFA 2XNAA 3FOMA 4FF9A 3UMNA 1GYVA 1BXUA 4KXDA 4H20L 2WQUA 4M7JL 2C1OA 5B1CA 2FECI 1KJ2B 32C2B 4NSKB 3CPUA 3SZKC 2WWNA 1MQ8A 1XF4B 2DH2A 3SKUD 1PLBA 2JI1A 3TH2T 4IBLT 4A6YA 3PABA 5CD5C 5CGMA 4HCFA 1MSPA 4N8VB 3MV8E 4R5VA 4ZUWB 3GM8A 1GJUA 5LG6A 5CBEA 3ES6A 2FX8L 1ONQA 4JS7A 2OMXB 3C12A 4XNDA 2EDMA 4NHCH 4ZTPL 3QCTH 3SKJH 2VN6A 2AJYH 4O02L 3VRLE 3TF4A 2GVYA 3B6SB 1UVQA 2HTLC 2A77H 2LOEA 3OC5A 5IBLD 1T3FA 4K15A 3PP3H 2QFPA 1T03L 5H2BA 3DHUA 3QZWB 5EB9A 3MRGB 1OTTC 1N5AA 4GP4B 1JZ2A 1LDSA 2K45A 4JFDB 2VE6A 4A2LA 1KYOK 3O81A 4G8GA 2A6IA 2XXCB 1CLZH 2J56A 2UVEA 3S37H 4PWGA 4AIXA 5CSBA 3X2QB 1SXBA 3P3UA 4PM1A 3WTTA 4LEOA 2J5LB 2ESVD 4GKZB 4OCLC 1N0XH 4JPQA 5A3ID 5F2FA 1EEQA 1NGPH 2B8OT 3DYOA 2CRIA 4RFOH 4QLWA 4FZ8H 2E59A 5DLML 5KS9B 1OB0A 1CO1A 3P77A 1JDCA 3GSWA 2MPAL 3T0WA 1U8LA 3IM1A 3V9CA 4X5LA 1V7ML 4I5BA 4A2EA 1NIBA 4HUKB 1ETA1 5H94A 3UBXG 4X8XA 5L8LB 1RIUH 3Q3GB 1GY2A 1JGLL 4HBQA 1DLFH 3KVPA 4L37A 1IC4L 2GSGA 4OM0L 5F3HA 3LN4B 1VRSA 2VM3A 5DGQA 3AWEA 4Z7OB 2ZT9C 3TBVB 3MUHL 5E4IA 1JXDA 3BAEL 1CF1A 4F7CA 3O8XA 1W91A 3MJ9H 1M4KA 2JB5L 3WELA 4DK6A 1U6AL 1ZPUA 3TNNA 1R3HB 1GSKA 2F68X 5A2JH 1IC1A 4TUKH 1Y07A 3CN1A 1PNDA 4MKTA 3RP1A 2UZIH 3T6VA 4YO0A 4A2MA 5HHOE 3K6SB 2ICWB 2GQHA 1OP3K 4G6JH 3QHTC 4TOYL 4N3TA 2IQAA 1DUZA 4Z7UF 3MKGA 4B97A 5I8OL 1NPJA 2X2IA 1ITBB 1GGUA 1KEML 1H3PL 3LOWA 3T0ED 3VXNA 4G59C 2ESVE 1QLRA 4ACTA 2H0EA 4QTFA 2X7LB 5E6ID 4ZUTA 3WHXB 2NX5A 1SEBB 5JOFA 4ES9A 3CSBA 3IJYB 2VMJA 3CSGA 4H8WL 5EZJB 1OK0A 3M17A 4QXUL 4EI6B 3FRUB 1MEXL 3QA3A 1IV8A 4QNPF 5LBSA 4AQ1B 1QFUL 1RQ5A 3HG2A 3VWJD 3EOTL 1TMCB 2ZG3A 5B8CC 4NFCA 2A6JA 3NSFA 1BVLB 2P5ED 1MJ8L 2C3HA 5B3JF 3K8MA 4LEXL 5DR5H 2HSIA 3KEDA 8CGTA 4AIOA 3AU1A 4H0GA 3CFEB 2G9HA 1UT9A 1XHHA 1NANI 3L4TA 3O3BB 3RWIA 2DQFA 3LDBC 5D2LE 2FJGA 5I74B 4NRXB 1JXKA 5IK3B 1U4EA 4Y8DC 1DO5A 3NRQA 2OCFD 3E6HB 3ETTA 1WFUA 3MLTA 5E5RB 1OAXL 2V8MA 4ODVH 2Z8SA 4GBXB 3GMOB 4NM4L 4IIQB 3K3QA 1I4FB 3CMGA 3PP4L 4N2NA 2R29L 5TE7L 4AGOA 4OIIH 2LAGB 2L8AA 4Y19B 2ZG2A 3G5WA 2APFA 2V6HA 1VKXB 1SUJA 3FQNA 5DYOB 2Q8AH 1WZLA 3EO9L 1GY1A 3DMMB 2DRUA 4HS8H 1VZHA 5K69A 1NEZB 1AQDA 5JIIA 2Y25A 4B41A 2NY0C 4Z7WF 3T0EE 5FIEA 1OARH 1IC5H 3Q2LA 2FCBA 3KBHE 1QHPA 2D3NA 4UM9D 1U3HB 2Y6SC 3HVDA 5A7EA 3SCMC 1YUKB 2AK4D 4JW3A 4N2DA 4IMKC 1NANH 4G7RB 1ZLUK 2BRRH 4LESA 4M5SA 5HJBA 1NGYA 3ARDD 4AUJA 5HPMB 3GSNB 2C3GA 1ZLSL 5C9KA 1CGTA 2P9RA 3D12B 3D87B 1FFQA 3L4YA 3HAEA 1E2VA 2ICEC 4AT6A 3ARGC 3QJFA 1CDHA 1VCAA 3T3PE 5M94B 4PP1C 4EN3C 3ABGA 3WEXA 1HOEA 4TLSA 3MRQB 3VSTA 5JZ7C 2W0PA 1YNTA 5HGBA 4ZD3H 1WEJL 1ZHNA 4C56D 2AJUL 2ZWKA 4K3DH 4U1NB 3BGMB 4HD5A 2DWTA 1A6TA 4EBQH 1EO8L 1QLFA 2E7MA 2NY1D 4HUXA 1EDHA 1VPOL 5TQ0H 1S7UB 3K1KC 4XVOA 2CG9X 1JZ7A 4XT1C 4FNSA 3V0AC 3T2OA 3U2SA 1AHMA 5I1GL 2CAKA 4GW1A 4YX2H 2I32A 2WZ6A 4PGCA 1AO7D 3WOVA 5SX5H 3KPMB 1SBBA 3QVAA 3S0PA 3SDDD 1BGXH 2R15A 5FGCB 3MRDB 4HMEA 4F93B 4DK5A 5KAQF 3D2UB 4X8JB 1NCCH 2AK4E 2WMPB 5HHNA 5FECA 2KZWA 3JUZA 5IHZA 1NCOA 4GG6F 4MDRA 4Z7QF 1RZGB 3EDDA 5ALCL 2LE9A 5DZJA 4OCRH 4AXWB 3FXIC 4XR8C 1B2YA 2YD4A 2FX9H 2HFGH 2ITCB 5AEAA 4QRUB 2EIZB 2ZYRA 5EZOL 1MAKA 4UNTA 1QNZL 4OU3A 3VVVA 4K71B 4C8XA 1PAMA 3OSKA 4NUQA 4PY7B 1P5VA 1CBVL 4JRYB 3P4OA 5EN3A 3I84A 1E4HA 4OQTL 3FQTA 5DJAA 4JHUA 3BFOA 5MP6H 3P3SA 1UJ3A 2OMWA 3WN5C 5AVSB 1CT8B 1H3XA 1H0DA 1Q72H 3N04A 2GTZB 4P3CH 3GIVB 3ZDYB 5LNGA 5IB3B 1S3KH 1C16A 4ZPVA 4YGVA 3SPGA 4N26A 5FK9B 1E9OA 4M1CD 4G82A 2QSQA 3I6GA 3RYMA 2QSCL 5FYJD 3FFDA 4ZBJA 2WJ5A 4DKEH 2AV1B 3QWRA 1U41A 2GAZB 4OZIA 3F58L 3QZMA 1ZHLB 3B7TA 5I5MA 2F53A 3RFZB 4FADA 1W8OA 3IDNA 2OMNA 4APQC 1JN6B 1CK0H 1SDDA 3GMNB 4L29B 1H8LA 2YEZA 3MR9A 3OHXB 3TZVA 3N1PC 1AO7E 5IW1A 1NFDB 1SF5A 4BH8A 4UTAA 1BQHA 1Y1DA 1OWWA 5HJ3A 3ISYA 3TV3H 1ZVSB 4Y4HB 2IWKA 2ZPKH 5C9JA 2HN7B 5AW1B 4TPRL 3D39D 1QI3A 2BIMA 1ZLDA 3JV6B 2HUHA 4FYTA 4U6XB 5CLYA 4G8EB 3UJIH 1FVDB 3HBQA 1ITCA 3WNIA 2W9EL 2EVFA 4FKKA 1XGPA 5D7JA 1NUFA 4XNMA 6CGTA 2YAOA 4LCWB 4EZJA 1FVCB 2VDKB 1M6OB 4GH7B 4AC2A 5JW4M 4ONOA 5B4MD 4ZUSA 2PXYC 1X5KA 5H35B 2PTUA 5C0GA 3STLB 3GMPA 5EF0A 2I07B 2ARWA 3UG4A 1YC7A 2XIBA 4F33A 1SN0A 3RVTD 4LDOB 3LQZA 4XX1E 3O3UN 2IH9A 3MBXH 3RZCD 1W2KT 3DSFH 3C09B 2WXNA 1JV2B 3H7LA 4PLKD 4AMKH 1CD8A 3FHAA 1OE2A 1N6QH 2VJXA 5FYJE 1KCRL 1DFBH 3BH9B 5F44A 4H2CA 2YR3A 3FRPA 4XN5A 3ZKMC 1EHLH 2NUPA 3TU6A 2XWBA 1RL1A 1IAIM 4KK5D 4FG6D 2CMRH 3VRJA 4FS0A 4KOBA 3L4ZA 2HFEB 3MV01 3R4RA 4UUJA 4LFHD 4M7LH 4KJYA 4WWNA 2NXZB 3BVDB 1F41A 1MI5E 1JE6A 2PWDA 3NVQA 4J3OD 5IW3A 3T2QA 3ZXAC 3D39E 1SJHA 3O11B 4NOFA 1JOIA 3NJVA 1RZIB 5CHNB 5CBAB 3OKNA 1N4XL 3LZFL 4ERSH 3DI2B 4WUUB 1T21A 1TTGA 5IQ9A 1T6VN 1S5IL 3KEHA 3M1BB 5IWLC 2M26A 4G11A 4HPYH 4LXFA 4M6OH 1QWUA 2Q6WA 4BHUA 2EAEA 5IHHA 1I8KA 1PD1A 4X6CF 3HHSB 1KIQA 1QLEB 5GSVB 3A23A 1PX3A 1UM6L 1YYLL 1LVEA 1V3LA 4K8RD 4KK6D 2KQMA 3S7GA 1K4DB 1U3NA 1YPZB 1KN2L 2NZIA 1GTNA 4PY8I 1OLLA 5T3ZD 4E2OA 4LQ1A 5KZCB 4NIKB 4FMVA 1P5UC 2K9UA 3LS4L 4W9EC 4W9HC 1GGYA 2HA1A 5DRZA 4TN9A 3V9FA 1JZEA 5I71B 1CTOA 5AAWC 3D07A 3S88L 4UV7L 3QJXA 1A6VL 2GCYA 2KT6A 2OXGA 4G5ZH 2VLMD 4G80A 4A04A 2LHAA 3T0AA 4XPBL 1THAA 3NMEA 2VLJD 3VMNA 2B59A 4BZ1H 1OAUL 1K5NA 1T5WB 1U3ZA 4PRAA 4QCIB 5DA4A 4ELKB 4J2XA 1MCWM 4OIBA 4M8UA 2QADD 4JPKH 1S9WB 5L0QB 1OAYL 3S37X 3KWTA 1AZVA 3I9PA 4ZSOB 2JKSA 2P48B 3AQZA 4FNPA 4CMMA 1T1WA 3CBRA 4DEPC 1MQKH 4PD4J 5FYJU 4NO0B 3DVIA 4PGEB 2CM6A 5F3BA 5EFIB 3L5HA 2E3VA 5DMGD 1OHZA 4CSPA 2F74A 4FHKA 4BK5A 3EO0A 4JY6B 2NY4C 3K2MC 4P46B 1JPFB 5GISH 1T22B 3WS6C 5AYQA 3N44B 2VLKD 3DVGA 4ZW8A 3D4GA 4WI0B 4I88A 1MNUL 3FN0H 1I1FA 3I3EA 3VG0L 4NQCE 4NQEB 3VQ2C 4GUPA 3VXOB 5DF0A 1Q94A 4ALAC 1IVTA 1WFIA 1PZ2A 3HI6H 1XB6A 2KKQA 3SODB 1D9KC 1I85C 2BVUA 3T6WA 1EHNA 3MNVB 3WENA 2A6KA 4JK0D 1PKQA 3H85A 1XH0A 4XGZB 4JO3L 4P2OA 2OR8A 4ABWA 1MIML 15C8H 4XTRC 1KENL 2XFXA 5AW0B 1I7ZB 4IKLA 4OBRA 1NIFA 2WXRA 4X4ZA 4I3GA 1VACB 4CSZA 2WO3B 1JGDA 5IR1B 1X5MA 2HFFA 3QPQC 1ZMYA 5J6HA 2IAMC 2MNJB 3D06A 1OD9A 4KJWD 2VLJE 2DKSA 3BVNB 4RMVA 4X7TB 4R96A 4KKNA 4CAGA 3O9WA 1TVBB 4HIXH 1Q4NX 4N2KA 4D9QD 2N1TE 5FDYA 1FZJB 1DCEA 1QYGH 5E8EA 4XC3H 3P9MB 1UA6H 3FUNA 3GSUB 5EUOB 5FB8A 4Z76A 3SBPA 3ZL1A 1BMGA 2PMZA 4ONHA 3WUZA 4FN0A 4AE1A 4QRRA 1B0RA 1CD1A 1AFVH 1O7SA 3HS0A 3DJRA 3HMXH 1OSZB 1KTKE 3NJLA 2ZCKL 3FQYA 3S3JA 1N68A 5EBMA 5IZ7A 4NUPA 2LV4A 3MV7E 3P54A 3CPLB 4HT1H 3VGGA 5B39A 4S1QL 1JWUA 1AQMA 3WXVH 4P4KD 2J7LA 2XQYA 2GJ6B 1BP3B 1CL7H 1UKQA 4P5TB 3UYOD 1BXXA 2NOYA 3O4OC 2V9QA 5EOTA 3ESMA 3MX0B 4PJEB 3MBWA 5EOCJ 1NLDL 2D4FA 3HBPA 3MLXL 4GO6B 3ZT5A 4HCRH 6PAZA 3KM2A 5FWRA 2V5YA 2OJZH 4LIQL 1QHOA 1D7CA 2GSIB 1RY7B 3MMEB 4N90E 5D2NB 2WBJC 3VRLF 4MD5A 3IGKA 4FKHA 4AKPA 2BFVH 1FORL 3GBNH 3LKRB 1SXNA 4EDXB 1CGYA 4NBXB 4PJAF 1FBIH 4R8WL 5IHLB 3F01A 3QQ3B 4LL4A 4UDUB 5EU4B 3T3MB 3Q01A 3ZW3A 2APSA 2BIHA 3F85A 5FFLA 4ANVA 4MQXC 3GFUA 4JQIH 4LLDB 3KL3A 3D50A 5DJYB 4ZTOH 1RZJC 4KTDL 1R0AH 3DJTA 1MFEL 1KJVA 4JY4B 3CSPA 3I9GH 3QORB 2J8UB 3UXFA 5KJ7E 3IVKB 5CINH 2K0RA 3VD2A 1S78C 3VFOB 1OAQH 4JPIB 4UDTA 3SKJL 3IDJB 3P2DA 1XBRA 2LABA 3FSVA 4UQIM 3L6FA 4JFEB 3FUFA 1NC4B 1UZ8A 4Q2ZA 2YXVA 5BZDA 1FZMB 4KDTA 3C5SB 1QSFD 4M6MH 3QR1A 2P28B 2PWFA 4U1IB 4BSWB 5ACMA 1X6LA 3BOVA 1ODUA 2EACA 3WY3A 4GT7A 3LZNA 4KNSA 2HT4D 4NNPL 3KLHD 1CLZL 3D3VA 4G70B 4HGWA 1CTNA 4ZAKD 5JXEA 1ZK5A 1XMWA 2Z4QB 3LIUA 4G43B 2ZX8A 3L5JA 4DFIA 2LU4A 3PV7A 5CD3B 5E2UH 3P0YH 4FTDA 1HQ4A 2XV0A 5TDPB 1ZKAA 1OVZA 4MNQA 4GP5B 1XCQB 1KULA 2J71A 4UT7L 1M7IA 4CVUA 5IF0B 2P47B 3HR5A 4MD4B 1GPOL 1PYWA 1JPTH 4RFNB 2E76C 5J3HD 5IROD 3DURB 1ZLUH 4YK4B 2IDSA 5D7IE 2ATPA 2E7BA 4JM2D 2XZZA 1RIUL 4PJXE 5E1QA 5FYLH 4APXB 1XGUB 5SWSB 1KB5B 1O5PA 3D5OF 3G5XA 5E4OA 1D5XB 1JMZA 3HG5A 5H4YA 5ICXA 3T71A 4O2EB 3S3PA 3NJGA 1KLGB 3QJRB 1DSYA 3RL1A 1IEAA 3JYBA 3V6FB 2WZPA 2MRYA 3H3BC 1CLVA 4IBVA 2WAHA 4KROD 2JXMB 2PWGA 1P7KA 1FC1A 3BWUF 3K2UL 4QJ5B 5I8CB 1XV8A 4HWZB 4V2CB 1D6VH 2WQVA 4TUKL 4DP7X 3RPBA 4FNTA 5A16A 5IGXL 1FFOB 3EO1B 1NGXA 3O6FB 1SOSA 6TAAA 1F0LA 5EIVA 4KHXH 1FQ9C 2EXWC 1XF3B 2F8VA 3CZEA 4NWUH 5DRWB 1RURH 1TEGA 4G6JL 2W0FB 4M3KB 3MRKA 4L4VE 5E9DA 2OM5A 2XG5A 3RTQB 2YPLA 1SEQH 2HJKA 1LP9E 4Z0BH 2XWTA 4QD2E 4UNIA 2EJ1A 1X6NA 4Y88A 1C8PA 1Q1PA 4J6RH 4XMVA 3HCVA 4MCMA 1F18A 3QFDA 3MJ6A 4U1KA 2BNUA 4EIUA 1J1PH 4KK9C 4OCWL 2Y3AA 4HJ1A 4PJHF 1L7IH 4G8GD 2NY2B 3L48A 4I3SH 2QVFB 4X5XB 4WKZB 2WSPA 2XBTA 4YDZA 2VR4A 3CFBB 1W9XA 5EN2B 4NQXB 4HEME 2YWYA 1UCBH 1BAFL 1IGFL 1N0LB 5MERB 2N56A 3RIFF 4QAWA 5DR5L 3UO8B 3G9VA 4MCNA 1FJ1B 2FWOB 3EZJB 1KLUB 2VR8A 4K3GA 3LRMA 3BWSA 3NCCB 1F2XK 5DZAA 4U1GC 2HPTA 1LDPH 4KVNL 3JWNE 2HG5A 4KUCD 3I6KA 4FFVD 2ISDA 1FE8L 4WW1A 4HIPA 3CXDH 1TVHB 4XMPH 4IW4C 2X4RA 1IFGA 3HN3A 1LTXA 4D7BA 1D5BA 3BZ4B 1IB5A 2Z7WA 2P1YA 1MWAB 3NFPA 4ZK8A 5I1KL 2E8ZA 2PTVA 3SE6A 3W0WA 2CJ3A 4OIIL 4KQ4H 1R6VA 4JZOA 4KTEH 4BQBA 4OBSA 3O45B 3CCHA 4L5FH 3E2HB 4QTHA 5HVHC 2Q8AL 3FTGA 3MRIB 3O8XD 2ZUTA 4HS8L 3QFJA 3V95A 2WTRA 1H3UA 1RUML 4JZNA 4H25A 5ADPH 1D7BA 2AQ2A 3TBTA 1E4KC 1IC5L 2XA8H 3NBNA 4RRPM 5DS1A 1T1ZB 3GS0A 4R4NC 1EUTA 1ZLWK 2X38A 3TBSA 3B43A 4KV5F 3V0HA 1KIRB 4Q89A 1ZXKA 1WFOA 4G8GE 3LEXA 4W9IC 1KJ2A 4NSKA 1NWOA 1J5IA 2A1WH 1YNLH 5FC9A 3SPCA 3CZUB 8FABB 3UJJL 4HIJB 4GEIA 4HJGA 2FRGP 4N8VA 4TKWA 1FFPB 3DTXA 4O9HH 3BEWA 5ESAB 3R8QA 4DPCX 4UZGA 4Y8AA 5FV2A 3LN9A 3QWOB 5F21B 1F3JA 4ONFH 3BVVA 4XVUD 2KBGA 3K4ZA 1U58B 3VFVB 4PJ8A 1AGBB 1H5BC 1NCIA 3UTPD 2H8PB 1NLBL 2VZ1A 3B6SA 3WL9B 4WUKH 1X5HA 3BJ91 1Y1UA 5DJCA 4ZD3L 5ITBL 2P80A 4QRPB 5CJXC 4K3DL 4J8RA 3FU3A 4O02B 4PPTA 1L3WA 3QZWA 4O58L 4JREC 1ZEAH 1R19A 4N1HB 4JFDA 4PLOB 4AVHA 1LO3L 3D85B 3T4YB 5TQ0L 4JR9L 4WEBH 1U8IB 3OB0K 1MAJA 3TT3L 3ZDWA 4CRPA 4QDGA 4WHYH 1Q1JH 2DQCH 1AXSB 3FT3B 3O4LE 4JPSA 4S0SD 4BDVB 2X4QB 1UASA 2CSPA 3F62A 4XI5D 3DUUB 1IKNC 1IX2A 1BGXL 1YEHL 5E9NA 5KVGH 1H6FA 1UATA 2X4OB 5IG7B 1NGQH 5KS9A 5E08H 1NCWH 3CWGA 4C4KT 3BGFB 4OZGF 1QI5A 3RB7A 5LVEA 2I7OA 4PS7A 3VB8A 4OCRL 3GXDA 2VW6A 3Q3GA 3HC2A 5CUSL 2IFFH 4HDIB 4X6FB 3N1GC 4JRFA 1RH8A 3WFZA 4GSDL 4ZOAA 2DWEB 2VDMB 3LN4A 4PRPA 2D7QA 3R7QA 5KAQG 4MX7B 3A47A 4XHJC 5EO1B 3GRBA 1AS8A 4JQXC 1SJVA 2O5XH 4QWWC 4Y5VB 2ZOOA 4HIIB 4NJAH 1ZLVK 1AMYA 2BH0A 3KL5A 3X17A 4XAWH 1OOWA 1Q72L 3UTPE 2R23B 1GZHA 1MH5A 1R3HA 3L3KA 1EMTH 2WCPA 2Q20A 2YRLA 3DRQB 4OZ4A 2YSTA 2OR7A 2WANA 3IFLH 5TPWL 3MZGB 2YSSB 3EBAA 3WKPA 3K6SA 4CN1A 2R2HA 1F2QA 4WEUD 3NESA 4DKEL 1L9TA 5I1EH 5JIMA 2EE6A 4KKCC 1TXKA 3L13A 3QO1B 3FU0A 3SDXA 3RJDA 2DJMA 2DLHA 3ARPA 1OIOA 4YVUA 5JO5B 3X1GA 2WO4A 3FN3A 4NO5B 4ODHH 1J1OH 5EEXA 2FQFA 1MAML 3QRLA 4KAQL 4POZD 2B1HH 2XQ0A 2XY2A 3I6SA 2EYSB 3TV3L 4ODUB 1J0JA 3WHXA 1SEBA 1YEIH 2YEQA 3IJYA 4F27A 4EI6A 3VH8B 3FRUA 1DVFC 3G6JB 3GM0A 4EAEA 2B16A 4Q8BA 5D1ZC 1UZGA 3L3DB 1BVLA 1DBJL 4ZFFB 1FN4B 4NYLB 1T89A 1EHXA 1G1OA 3LKQB 3ULUH 3ZK0A 1TG8A 1BZ7A 1IBHA 3CFEA 3O3BA 3FQWB 5GSRA 3RPKA 2XTJB 3WTSA 1MIEH 4EXPX 1PZCA 2Q9OA 3HC0B 4BKTC 3LH2H 3E6HA 1A7BA 1MXGA 3H9SB 4GBXA 3DSFL 3GMOA 2C9AA 4IIQA 1UACL 3E8VA 4N28A 2Q8BH 2IOIA 3DOSB 1KYDA 1TCRB 4X9BA 3V6OC 2OX5B 3ZLQC 1J9QA 5DK0A 1S5HA 1EHLL 5DYOA 1VKXA 1ZT4B 1NCNA 3NCWA 4KRPC 3PUUA 3R1GL 4M5ZL 5F7LB 2C4XA 1NEZA 5LO7A 2L04A 4H44C 5BUGA 4RMTA 1S7RB 3EYUH 1JZFA 5DRXA 2IADB 1KXTA 1EVTC 3TCLB 4FLRA 3NSYA 5C09B 4KJPC 5I16A 4EEEA 2ZP8A 1CXFA 5AW3B 1KCWA 2F53D 4X5QA 5K9JL 3UP1A 5FOBB 5HPMA 1V54B 2H2PD 3BWZA 3UAAA 3TZVD 1HHIB 1DVTA 2DWYA 3HPJA 3F7PC 4B27A 3RL2B 3VE0B 1K6QH 3KBPA 2UUDK 1H8SA 3DX8A 2RCSL 3LV3A 1I8IB 1B6UA 4WTZG 2BC4A 3MRQA 3N91A 3I9IA 4Q56A 4QRSB 4EF3A 4KRNA 2WSKA 3MLZH 5D7JD 4MB4A 4LHUG 3M1CA 4U1NA 4AEHL 1WAAE 3NJKA 8PAZA 4PJ5A 4RCAA 3IXAB 3D52A 3QB7C 5T33L 1AQ8A 5I8KL 5D70H 1JUFB 5FWQA 3QS3A 4LCYB 1RVFH 1KXQE 4PIRF 1E8XA 3ECUA 3GMLB 4J12A 4BZ1L 1FUNA 4HZLB 5BOPA 4Q9QH 3B2VL 3CXHJ 3MRDA 1HINL 3WIHL 1J18A 1QACA 3B9DA 3ESPA 2GK0B 1WO2A 5IEHA 3U30C 2WMPA 3BN3B 4WGKA 1MQKL 2V5RA 2AJZB 1JCVA 5GGSB 4OGYH 4AXWA 3AY4C 1BFTA 1K2DA 4LLVA 2ITCA 1KCVL 2CKBH 2EIZA 2NT1A 4QRUA 4XWOC 2JTDA 5F7DA 1DE4B 3FN0L 4G42B 4PY7A 2HPOA 3ZDXF 4JRYA 4IOSA 4CW1A 4NZDA 4PP2A 3FU8A 1KOAA 5GS2H 2VGLM 5DD5H 5IB1A 3RA7L 3NIDF 5E6YA 1H6UA 1CT8A 1KB9J 3OAUH 4NZ8A 1U8KA 3QHZH 5D1QB 3GIVA 4AIZA 1FAIH 3MO1A 5D6DC 4WFGD 4EKXA 4U2YA 5FK9A 1JK9B 3GSVB 15C8L 4NKMB 1EAPB 4BWUA 3TEZA 4KKAD 5DLLA 1F11A 3W5MA 5F1IA 3O0RH 1OWRM 5D1XC 5B1JC 3VACA 2YMTA 3RFZA 1JN6A 4KO7A 3NJFA 3GMNA 4L29A 2JQZA 3IMUA 3OHXA 4OZHE 5F7KC 1NFDA 2NR6A 1XBDA 2LQRA 3P3YA 1WG3A 2ZSWB 3W39B 5GJSL 2APXA 2JQAA 1BMWA 1ZVSA 3QPXL 4XC3L 4Y4HA 1UA6L 2HN7A 2AABH 3JV6A 4XO3A 2OR9H 4U6XA 1NUNB 2ROYA 1L9OA 1YECL 1J9RA 4G8EA 3SE4A 2DIBA 1U93A 3KH4A 2Y3NA 3ZKXB 1AFVL 3BEVB 2OI9C 3KLLA 4TNWK 5GS0C 4LCWA 4WWKB 3RGVC 3DX1A 1FVCA 3G6AB 1M6OA 5C3LD 4DOHB 4HT1L 5DTFB 2AJSH 2LFEA 3APCA 3PL6C 1N67A 1FV1B 2A74B 1GL4B 4AYGA 4JAMB 5CMAB 5EU6B 5KW9H 4XC1L 2D7TH 5DQDL 1JYXA 2XRAL 1JPSH 3V4UL 5DC9B 1AD0B 3VJ6B 4U6HB 2BHUA 2BY2A 3MJWA 3NEXA 4AQEB 1ROCA 1LO0H 2CGYA 3H56A 5CEZH 4WFGE 4U4BA 1JV2A 1NIAA 1T7WA 3QUYB 3ZZSA 2DQHH 1KGIA 1B88A 1I3GL 1CI3M 2KDYA 1KCKA 1HVXA 3BH9A 3NGBC 3BUQA 2LU7A 1EFXD 2E86A 2BFVL 2IPUK 3IJEA 1KGWA 5J11C 1Y7VA 1FBIL 1R3IH 2YD6A 3E1F1 1GOGA 4CN4A 2JCCE 1EJOH 2HFEA 3VD3A 3Q9PA 3RVWD 2CHXA 3PWNB 1IAII 3CSTA 1O7DC 4JHVA 1GHFL 4RGMC 5LGJB 1ESOA 4P2OD 4ZTOL 4RMQA 5DHVH 4AZ8B 3FB5A 3O11A 4G8FB 1RZIA 3PAVA 4YHYB 4Y1AD 1FZOA 4L2LA 1A8JH 1OAQL 4P06A 3WLWD 2XG4A 3ZYIA 3M1BA 5CSZB 4U6VH 1UWFA 2NY3C 3TPKA 4GI6A 2Z91B 3GNML 1ASQA 5HYJA 2DL2A 1MY7A 1G9HA 2PTTB 3O9WD 1M7DB 3HHSA 3ARBB 5GSVA 5K93A 4Z77B 3QCUL 5JQIB 4LU5H 5AB0A 1ANUA 1K4DA 2IBBA 3AUWB 4PJXF 4N85A 4TSCH 3SDYL 3DETC 4QRRD 3CV5A 4MMXC 5DS8A 2DQDH 4ZXBC 3L1EA 4U1LB 3T8MA 2P49B 5TE6H 3BESR 4FXKB 3PLYA 3TH3T 3L2LA 2B5IB 1IAIH 4I2XB 5E2UL 3P0YL 4N3UA 4GRWH 4JZJB 1PAZA 2ENPA 3CC5B 4MVBD 4MMYB 1TU2A 5HHQB 1Z7JA 1OL0A 3IXTA 1LXMA 3U36A 1RUAL 1S46A 4ZDHB 4QCIA 3KVDD 3EFDH 4PJFE 5FYLL 3BSZH 2VXQH 1AP2B 1S9WA 3MJGX 1A3ZA 4LEEA 3LIZH 3SYCA 2K4WA 4ODBD 2YAPA 2K1MA 2C9QA 3QI9A 4YZFE 5DUML 3UGEA 4A2HA 4NO0A 5GQBA 3ZYJA 5K9KB 4M4PA 2HFTA 4Y1AE 1NPUA 4JY6A 5ABDE 1JPFA 1T22A 5TGBB 3ZKNC 5HI4C 1MDTA 3IF1B 1CGSH 3CXFA 3BX7C 4WI0A 5I1CH 3SO3C 2BVOA 5JMRA 3FUJA 4G7YH 5GGUB 4H0IA 4NQEA 2GG1A 3VXOA 4D8OA 1NDMB 5DJ0A 4MA7H 2YEVB 3NACH 4KHXL 3UO1H 3TO4C 3TESA 1OP9A 3QUHA 4NWUL 4P5KB 1RURL 5TF1H 4FC3E 2JK5B 4QRRE 1CDCA 1SEQL 1RZJH 2MWCA 3F7QA 1ZT7B 3HZYA 2Y6TE 4FQXC 4TLKA 3OB0H 1N7MH 2F1AA 3ZHNA 3CZGA 3QDMD 2VCOA 2ALAA 1TLMA 3ASOB 1A4JB 4TTGA 5K9OB 1VACA 2ZOUA 4A2DA 3OG6B 3DXAB 5IR1A 1CICC 2Q7YA 1NAMH 5AZEL 5DVLA 3SPVB 4PJIE 3BPNB 1GS7A 3KWWA 4I3SL 2AEQH 2WXKA 3AFLA 3MAWA 5L6YH 1D7DA 1TVBA 2EDRA 1A02N 3D3VD 2FHBA 2E7CA 2WUCH 5DEGA 4J1UB 1UCBL 1ZDSA 4XMZA 4PVBA 3D0LB 5D72H 5DUPH 2GEQA 3ZPDA 1E4XH 5BW7C 1FSKB 1GIGL 3GSUA 2HWZH 4QJ3B 5EUOA 3I3DA 3SJVB 5H37H 3SKMA 1CLCA 4KC3B 3HLKA 2JF1A 1ND0B 4YFEA 1S7XA 2VXSL 3IKCB 5L4MA 2C3VB 1ZLVH 1Q0YH 4F9PA 3EJCA 3LNFA 1QP1A 3CPLA 4X6DE 4ZMLA 4TYUA 4UT9H 2C3XA 4Z7UB 1URIA 4B9IA 1EDQA 1I3VA 1DQMH 4HEPA 2GJ6A 4TTDD 1MN4A 2R2EB 3ARFC 3LTVA 1JNLL 4PJEA 1XDTT 4KQ4L 3V4PH 2KPWA 4FQLL 1D2PA 4KTEL 2ZUVA 5DMIH 5T1DH 3TO2A 3WTYA 1IKOP 2WZPD 1XF5A 3II3A 2GSIA 3MMEA 3QDME 1P7QB 1FCCA 5D2NA 5ADPL 5IMLA 3VWKB 1SBSH 4HKJB 1MJ7L 4ZUVA 2SEBB 2XA8L 4P3DA 1GAFH 3GRWA 5FUOH 4EDXA 1HK6A 1AR1C 2RD0A 4JFOB 4NHUB 2VDNH 1E8WA 5E9DD 3QQ3A 2I9LA 2XZCL 3KPPB 4YSSA 1HSAB 2BERA 4LQFL 2YPLD 2O26U 4Y0GA 4YXHL 4BZ2A 2A1WL 5KJRL 4LLDA 5DO2D 2OYLA 5DJYA 5I24A 3S3DB 1G87A 1GGCH 5D1XE 1SHMA 4UWQB 4OLZH 3QDGE 4R26L 1AGEB 1IT9L 1Q8MA 2E4TA 3QORA 2J8UA 2I24N 2ZE0A 1CR9H 4Y9FA 4LMQI 2FO4A 3VFOA 4JPIA 3IDJA 1P7HL 3IDGB 4Z3HA 4YBQC 4KITB 4ODSH 4PJ6A 4BYHA 1H3GA 1JDAA 2YPVA 3KDMB 3C5SA 3LXBA 5I19H 2ZOTA 3OMIB 3NPSC 3QXVA 4U1IA 4PJGA 3T04D 4Z3FA 5AG8A 4RGND 3GLZA 3D18B 4K23H 4EI5B 3BAWA 1QFWM 3RQ3A 3L1OH 4K07A 2GIYA 4Z7WB 3C75A 4RMUA 4WEBL 5GGTA 2ZCLL 1WGOA 3SGEI 1MHEB 2DDQL 3QR0A 5ECGA 1KFAH 2VSKB 4G43A 5KJ4A 4JO2L 4JFPA 4Y2DD 3MRNB 4DN3L 4NFBA 5GRUH 5CD3A 3N9GH 3VFPB 5JIPA 5KVGL 5MHSE 5EBLA 5IF0A 1NGQL 5E08L 4D9LH 2R39A 3W0WD 1U3HC 4FHBD 2H32H 1J48A 2AV7A 3DURA 1OOAA 4YDNA 3OB8A 5EU5A 2YIHA 3F3HA 3Q2CA 2IFFL 4APXA 5SWSA 3QFJD 1KB5A 5CO1A 3RDTC 5INCB 4Z0XB 2C3WA 1PVHA 2FT7A 4PRNB 4IM8A 5I28A 2CIKA 4XCEA 4ES8A 4O2EA 5I18H 5CJQH 5AW8B 2W65B 3BXNB 4DVBA 3SKOB 2O5XL 4N0FB 4N2EA 3O6ML 3A4DA 3W38A 3V6FA 5HVGB 1JHTB 4B7IA 1G4MA 2Y0SA 2PW1A 5CN3A 2JXMA 3FH5A 1SMAA 1ORSB 3NJHA 4YXLL 1SHXA 3N41F 4HWZA 4R5TA 4L8SA 4XMUA 3BP4A 5LDUA 4TM9A 3EO1A 2R69A 3QIWB 2WZAA 1YEJL 4HLZH 1XF3A 5DRWA 5A2CA 3UBXA 4IYKA 2W0FA 4HC1A 4MMZB 4W9KC 5I1EL 5ERWA 3L17A 3VA6A 3RTQA 3N5AA 1J0IA 2A73B 2VLRB 4M8QB 3FT4B 3GO1H 3O3AB 1LGVA 2YGOA 3CSYB 4XCNA 1J1OL 3ZMNA 3PNWB 3T4AC 4GG6B 3DOHA 1YNKL 3RLSA 2EH8L 2P80D 3AAZA 3FBKA 2ZWYA 4PHZA 4Z7AA 2HT2C 5EEYA 2B1HL 1DN0B 1N10A 3AREB 2WLHA 4V11A 4YHIB 4JFDD 1UD4A 4JRLA 3V55A 4UQEA 2X12A 4UIMB 5KSBF 2Y1YA 4FFYA 3R8BB 5EN2A 4ZFOA 2HLEB 4OLUH 1N0LA 4AEEA 1BQLL 2FD6H 1IGML 3BE1L 5L2KB 3S8GB 3DX7A 2Z4TA 2EABA 3A6OA 4XX1G 3ME0A 1F4YH 4OCXH 1LNUB 1SN5A 3RGHA 3DIFB 3N6YA 1T0NB 3QIUC 4MASA 2X6AA 2ZCHL 4RAUA 4UT6H 5EO0A 4HSQA 3FTVA 3IEAA 3EH3B 4KKRA 1TVHA 1ACYL 1B3IA 2H45A 2OTUB 4M61B 2BP0B 3VFWA 4HULB 3V79C 3BZ4A 4LKCB 4RMRA 5TTRA 1MWAA 4HXBL 3GI8H 4Y5XC 2PPFA 4PRPD 3D05A 2QKIC 4P2QB 3HB3B 2D9QB 1FGNH 3PXHA 5IJVB 4I1RA 2B39A 5IMOB 1RUPL 4GJTB 3PRZA 1NGWB 3MRIA 2AXFB 1L7TH 1W0VB 2VT0A 5LBVA 2Q76A 4FQQA 4U0RC 3BYYA 4E9VA 3PGCA 2CA4A 3S34L 5F6IB 4NT6B 1FL6A 5CILL 1IZJA 4JB9L 5D1ZI 3L3OA 1BQUA 1DSFL 1HNGA 3ULVH 1O0VA 3TJHD 3Q1SH 1KIRA 4JFDE 4QOKB 1PJ9A 1ZSHA 2B2XH 4HUVB 1WAAF 3DSNA 4A7TA 4P9HC 4WU7B 1GXEA 3BAXA 3HNVL 1B6DA 2EEXA 2FR4B 2A9DA 4HIJA 3ZQWA 1E28B 1QSVA 3T6QC 2ZUYA 3H54A 5ESAA 4ZS7L 1KSRA 2G2PA 5T3XH 4AQOA 3W11D 1W80A 1K6QL 5HGDB 2R2CA 1U58A 1BPVA 1T2JA 3VFVA 4MRCA 5KS9E 4XCCH 1AGBA 4KOCA 3EYQC 2BSCA 2H8PA 4UOW0 3WL9A 3QQDA 3EZ8A 4U2ZA 5AW9B 5KVDH 1J8HA 2HX7A 2LGNA 3GJFH 2KL6A 5EU3A 4XB7A 2V9UA 5J89A 4OJAA 1W72A 2CUIA 1QPPA 4NGHH 5MI0B 3T4YA 2TSBA 4IRZH 5DUJA 2VMDA 3BIBX 4F24A 1T4KA 3E8UH 4O51B 5L4JA 1B3JA 1GCYA 1OSYA 4Z7OE 1JFQH 5L2JA 5IB4B 3FB7B 1AXSA 3FT3A 4M7LT 1RUQL 3ASWA 3GTNA 4YFLI 1BD2A 5FO9A 4YEEA 4Q9QL 3DUUA 3TEWA 1U8QA 1MWOA 2NY6B 4O4YH 4FFWD 3D34A 3HJ0A 4GBXD 5LCVH 2X4OA 3BN9D 3VX0A 5IG7A 5JNYB 4TVPL 1GC1C 2NXZC 5K5YA 2ZX5A 2X4SA 4LHUB 1DVSA 3C60C 4AK1A 1UB5B 1Z5LB 4D9RD 4X6CB 1TZHB 4OGYL 2QMKA 1KPVB 2ZXQA 1MHHA 3MLVH 1MW2A 7FABH 3DMMD 4UQ2B 4HD9A 4X6FA 4JMXA 2CKBL 5I6XC 1Q9KB 4U3XA 2EINB 2DWEA 2GUYA 1DBAL 2IC2A 1CFSA 4JHWL 4B9PA 3FFOA 4KZDH 5EO1A 4RMWA 5DD5L 2Z93B 4H88H 3U9PH 4Y5VA 3MRRB 4PJBF 1GKEA 3TBYB 3KXFA 2AI0H 4EN2A 3CIAA 3OAUL 2BSSB 4B9YA 4NPKA 4X83A 1FAIL 3FB6B 3GB7B 3O2VH 3FUDA 1CS6A 3MGAA 4L4TA 3U1QA 2MQCA 5LDSA 2YSSA 2F58L 3OZ9H 4UOJA 2WTOA 1QX1A 4BM7A 4JANB 3KD4A 4F8QA 3O0RL 4Z6AT 5CP3A 1DEDA 4HF5L 2QL1A 5HI3C 3STZB 1CC3A 2YXMA 1ZVYA 2CGRH 5AKTA 2A0LC 2WWMD 3EOAB 3ETBJ 4LARL 3RVVD 1BYNA 3FHQA 2O6EA 1ACXA 5DU7A 5I1LB 5JA8B 5JDSA 1OZUA 5IQ7H 3QNFA 4PJ7E 1E50A 5KVFH 3TA3C 4ODUA 2P4AB 5DD6B 1FPTH 2AABL 5K1JA 3W3BA 2XTLA 3ORJA 5JDJA 3G6JA 3GBLA 2ZXCA 2P42B 4D9RE 5JW4R 4Y19E 3CVIH 5D7LB 3BLBA 2OULB 4QJ4B 1MHCB 1Q9LB 2YUWA 3L3DA 1G0YR 4YOKA 5C2BH 1FN4A 4HFWA 2AJSL 2WYIA 3MOBL 3Q8BA 4JKKA 5MENB 3CK0H 1BVKB 4BRJA 3ARRA 4KX7A 3WEAA 5EU7C 3FQWA 4KXBA 5C6TL 5LHDA 1JGEA 2D7TL 2UYLB 3FMGH 1JPSL 3FTYA 4P5MB 1CXIA 3QH3B 1ZK9A 3HC0A 3QUGA 1QZ1A 2QKSA 2YZ8A 5IVOA 1PQZB 4LL9A 4ZZFA 4N2HA 1LO0L 2I27N 1E6OL 1MRDH 5CEZL 2K4AA 3H9SA 2OTPA 2Z1PA 1I7RB 2DQHL 1FIGH 2XHNA 1ET5A 3DOSA 1TCRA 2D3JA 3L3GB 3LXCA 4ZQKB 3UPRB 2OX5A 3I02A 2HLAB 1SFHA 4IOSD 4JRYD 3SKNB 4Z9KB 1XQ4A 2WINB 3FZUC 1WYJA 1ZT4A 3CDYA 5HD8D 5AKSA 1Z3RA 1R3IL 5JLZB 5EUKB 1EJOL 1JI1A 4ALAL 2IWFA 4U31A 1CLYH 4JUSA 5GGVY 4AH2B 1S7RA 3EHBB 3H2QA 1U4FA 3UPAA 1KBKA 3HNSH 2IADA 3ALPA 1MG2C 2IWGA 1WFMA 4GRLA 4OD2A 3SE3A 1NDGA 3PWPB 3FSWA 1KIUB 2YD9A 3AQXA 5IHWA 1A7NH 2FQGA 2IV9A 3LB6D 5HHME 2IWEA 1FGVL 2EICA 3THML 4AL8H 1QBAA 4BQ8A 2CBPA 2G5UA 2Y5EA 4NNXA 4TUJB 5FOBA 1WA2X 2AQNA 3MOQA 2EDJA 4XNUH 1JXJA 4M56A 1G6VK 1OTSD 1WH0A 5SWZB 3APMA 2NR6D 5HDLA 2BWQA 3VE0A 2E6PA 1OT4A 3S5ZA 4Y4HD 3N42F 3FQ4A 4IOIA 2L0DA 4FCHA 5CP7B 1I8IA 4PJFF 4DGWC 5EOQH 4IBSA 5T1KB 3IWUA 3QJQB 3UGUA 4XMXA 2DQDL 5IVNA 2F9BT 3QULA 3FCUB 4LCWD 3VQLA 4XMTA 4PJAB 1KF9B 1JZ8A 5DHDA 5GGQH 4FA8A 2PWEA 3B34A 3IXAA 4W68A 4YNYA 5C0BB 3KYOA 3BISA 4JCLA 4JRYE 3Q8EA 2EIEA 1YUHB 1JUFA 3IBEA 3K2IA 3FTXA 1SVBA 1UHVA 3MPCA 3VFUA 5B21A 4HZLA 1DSWA 3FO2B 4FLOA 4YFLF 1KNOB 3KE0A 3ZDYE 3BSZL 2VXQL 1S8DB 4R2GB 3MRBB 3LIZL 3CX5K 3C6EA 3HE7C 1NFIB 1VENA 1E7UA 1G7JB 4K0OA 1WCBB 2RFXB 1NCJA 1DQVA 3A4AA 3QXDB 5GGSA 3PXJA 1KY6A 2CHZA 2BWIA 3ZZ1A 4MZ3A 5FCUH 3UAJA 4D3CL 2O6CA 1EIBA 3L4CA 1D2OA 1Q9WA 5IOPB 1UOLA 1NFDE 2OSYA 2ZKHH 4G7YL 3VFRB 2YPKB 4PJIF 3BZEA 4YBLB 4YUEH 4MA7L 1R34A 5F9WC 2Z8RA 5JIQA 4LLQB 1XT5A 1BZ9A 3NSXA 2FH8A 3MREB 5D1QA 1N19A 1FNHA 4OQTA 3UMTA 1RZJL 1WBXB 4WUUD 1N7ML 2V2WA 1M71A 2EKSA 3A6BH 1WF5A 4LCWE 3UZVA 1JK9A 4A7QA 4CKVX 3GSVA 1FH2A 1XCXA 4EO5A 1G6RH 4NKMA 2WUBH 5D9SA 3BAJA 4HLJA 1CWVA 4X7CC 4UQ3B 5ESVB 3UJTH 5HYJD 2AQSA 3P9WB 1F42A 4E9LA 3NPZB 5HHOB 4R3SB 4RETB 3EAKA 2CPUA 4X6DF 1KYUA 3WAJA 3WIIH 4Z5RB 2KLTA 1UD3A 5HTSA 2FIRT 1G1CA 2AEQL 2BWDA 5L6YL 3GKZA 4OF3A 3DVNB 1GYAA 3SHSA 2WUCL 2ZSWA 3W39A 3U0PA 4RFNC 5KZCD 3D48R 5DUPL 2FVNA 1CI5A 4HIHB 4N5ED 5B1AB 4XNZC 1XCTB 3BZ5A 3DJ9A 2AGJH 3ECVA 5AVYB 3SO5A 3MN8A 4DNLA 3FO1A 4TULH 3BEVA 3ULAB 1WGVA 3ESOA 2J5WA 5CXPA 1Q0YL 1DQLH 1RULH 3G6AA 1T20B 3LHAA 4WV1A 1HYRC 3REWA 2A74A 1FV1A 3H3KA 3UERA 4JAMA 4ZW3A 3UZEA 2HVKB 3OKEB 5EU6A 1MCDA 3QG6A 1UXSA 4ANWA 1KGUA 2Y7NA 4JJ5B 5CLZA 1AD0A 4U6HA 4NO0D 3V4PL 5AALA 4LSVH 3TBBA 3L4XA 1YYMH 3N50A 3VYOA 4WUUE 2IVFC 4YDIH 4P46D 5LWYH 1HWGB 1JZDC 2W0LA 5KSUB 4WW2B 3QUYA 2ZX9A 3H53A 3IPFA 4NCC1 2NTFA 4PJHB 3TYGH 2ZUUA 4NJ9H 1PEWA 3FCTB 1Z5HA 4NQED 5IUCA 1Y0LA 3EJZD 5I23A 4FQCL 3DRTB 3D0VB 3GHBH 1YPZE 1XFPA 5E2TH 3BT2L 3PWNA 3QXAA 5FO8B 1GVIA 2AITA 4CGTA 3ECWA 3VDBA 5AOKA 2J6EH 4LPXA 4AZ8A 2CLVB 4OLZL 3FS9A 2ZXAA 3REVB 1W16A 2AJVH 4F1ZA 1CR9L 2K9FB 3WJMB 2JE8A 1I31A 1WA0X 4JO1L 5J8OA 5CSZA 5EIQA 4RA3A 2A4CA 4OTXH 2PP9A 5BO1H 4MSWB 2A3TA 2PTTA 1NBZA 3ARBA 4OGAD 5I19L 3Q6FB 1A1MB 4Z23A 4ZSOE 2XJKA 4RDBA 2AQPA 3RBSA 3LD8C 4NXKA 1FG2B 3NDYE 1W6LA 1YEEH 2XICA 3U0WH 2HMID 1OT2A 3EXLA 4DP9X 2AEWA 1VJSA 5A43C 1E9PB 1CXKA 1X7QA 3GKWL 2ZQKA 4U1LA 2LR4A 5C0EB 1BWMA 2QR0B 1KFAL 4G1MB 1WWCA 4KHTL 3TT1H 2DMBA 5GRUL 3EBHA 3I74A 1OPGL 2G5BB 4I2XA 4PD4K 3EUUA 2H9GB 3CDCA 4JZJA 1T66C 3N9GL 1KPUB 4NQEE 1I8UA 1C8QA 2GJ6D 3V5KB 1EO7A 1UWGH 1H9VA 2NQDA 1SMOA 3QIBB 4KMTH 4P5TD 1YEKH 5HHQA 4D9LL 2W59A 2Y22A 5T1MA 4ZDHA 4XCYB 3JVFC 1J0ZA 5IW6B 3IFPB 5DYFA 5BRQA 1S7VB 2YFOA 3ZL4H 4HV8A 2FSEB 1D5IH 3MLPA 2OMUA 4GW5B 1XF2B 1R5WA 3HE6B 4F91B 1JZ5A