2EVIA

Structure of a ndt80-dna complex (mse mutant ma8t)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
303
structure length
290
Chain Sequence
VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*AP*CP*AP*AP*TP*AP*AP*C)-3'
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle/dna
total genus 86
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2eviA00
2EVGA 2EUVA 1M6UA 1M7UA 1MN4A 2EUXA 2EVIA 1MNNA 2EVHA 2ETWA 2EVFA 2EUWA 2EVJA 2EUZA
chains in the Genus database with same CATH superfamily
1RMFH 1JMXA 5D1XD 5DHVA 3TM6A 1G87A 3IEAA 3WXWH 3LQZB 4DEPC 4IMLB 4HWEH 1CDIA 2WLNA 4KI5F 4P2QB 4BSVB 3AUWB 3QFDA 5F7EL 5HGHA 4Z1PA 3IJ9A 4FYRA 4EI5A 5J13B 2WWOA 2XZCH 3EG9B 2NMSA 4LESA 2ESVA 3EOTH 3LKSA 3NIFB 4NQCB 3TBTB 3RBGA 3HG4A 5D5MB 3HR6A 3BP4B 4AQ1C 5C0ND 1YEHH 1GPOH 4P9MH 4PJAA 4IKKA 1SEQH 1BVKA 1MRCL 3PGDB 1S9XA 5A6LA 4CMHC 1R75A 2W9DL 3S96A 3ECQA 1H3UA 4AJWA 1P6AB 3BDYH 2K9UA 5KUMA 5ACZA 4NB7A 3TEXA 3LRMA 2Q6WA 2TSAA 2PTUA 4PCSA 3A4FA 3K2IA 4WFFE 3CFQA 2IXQB 3L3JA 2NY2D 2XA3A 3QR1A 5HYJE 4U1JA 2CNZA 2IG2H 5DMIL 1FNFA 2DIAA 3MV7B 3MGOA 1G9EA 4EBQH 5CKAA 4LEXH 2RCSH 1E9OB 1U8JA 2AJYL 2WKGA 2AXWA 4GYBA 3BFQG 3TFBA 3GTTA 4NN6B 2DIEA 2MNWA 2IALB 2NYYD 5C09A 2YAPA 3Q13A 5SX5H 2OMTA 3UAJC 1DVFC 3SGJA 3EYUL 5GGVL 3WDHA 5IHBA 1R24B 2CDGB 2NXYC 1F3DJ 3TBWB 4JMXA 1E7VA 3RZCB 5JW4Q 1BW8A 4XB7A 3EYVA 1XF2B 5GIRA 2NY1C 2A2QT 2XTSA 3ARPA 3D12B 3QUZA 1B3JA 5AL8A 5I1KH 1J1OH 2HTKC 1XVSA 4RDBA 1Y6KR 2HKFH 1ND0B 4H1LB 3VM7A 2C5DC 1AG0A 4XCEA 1F00I 1HS6A 1WC7A 2DI9A 3BWUF 1INDL 3L1EA 2BNQD 1NLDL 4WLCA 3T0BA 2JQZA 2DMCA 5DLLA 1NEZB 4HDIA 4HUUB 4YDKL 3VXMB 4GXUM 7TAAA 4XOAA 4XPGH 1AHWA 4YAQA 2L7EA 4DN3H 1XGTB 3KLHD 4E9QA 2KHAA 4KK6C 3RTQD 1W0WA 3P0VH 4WV1A 4LNRB 1KB9K 4I3RL 4LLDB 3IDJB 4QAWA 1ZHKB 5E24E 1KDIA 5ANMA 2Z7WA 3FSWA 4Y4HA 3ZDYB 4CC0A 1OAUL 4WQOA 5GS2H 2P1YA 5DYOB 1F3JA 4CBPA 2JXMB 4WO4D 2AQ1A 1FBIL 4M7KH 5LBSL 3X1FA 1I8LA 3WUWA 1J8HE 2FIKA 4LXFA 2BY1A 1LP9F 4XVSL 4NO0A 3WIHH 5KVMC 1FZOB 1Z3GL 3S3SA 1I3GL 3FPXA 1EBPA 2Y0SA 1FJ1B 3T0WA 1ZJBA 3MLRL 1MLBB 1E9QB 4K15A 5DHYB 4DFIA 3TZVC 1HFUA 2B1HH 3IK2A 2BH0A 2NW2A 2J8HA 1ZLWH 1USZA 4FHBD 1KBBA 1VAHA 4ZG1A 2P8PA 2W0FB 1A3LL 1VFAB 3CC1A 1T83A 3D9AH 4LB8A 1QHPA 4KZCA 4IU3B 3LIZH 4WENB 3QI9A 4EOWH 3DJSA 2R56H 3T77A 2NY0B 1UFGA 3GEWB 3L3OA 2JKTM 4UANA 2ICEB 3U4KA 2PO6C 3VXOA 2Z8RA 1GR7A 5AVUB 2F1BA 3UBGA 1FGVH 4S2SA 4PJHE 2DQEH 1EXUB 2VXTH 5F7BA 2YEZB 2YUZA 5SX4I 5LQBH 4N0UB 5ALCH 2GFBB 2AXGB 5D7IF 2VGLM 1P69B 4NC2B 2AXFA 1VGKB 2YA0A 4C56B 1EFQA 4OTXL 2IH1B 3OBAA 5IEKA 2CK2A 3SDAC 3V4VA 4DP2X 4DSYA 2OMBA 2P5EB 3G6DH 3IDMB 1RIHH 1DQJA 4G7YH 2B4CH 1DE4A 1BWWA 4OT1H 1KCRL 3B2PA 2VISB 3QDJB 2Y07L 4LARL 2XA8H 1CTMA 4H26B 5DRZB 5I1GL 4DOHE 4GXUN 3QIWB 2XOTA 4AM0A 1BJ8A 3RNQA 5BOJA 2WTRB 4URKA 1E2ZA 1E4KA 3DDGA 4YXHL 1HCFX 1BMWA 1EJ8A 3SGDH 2VABB 1KN2H 3D0VA 2BSSA 5L8JB 1P5UB 3NDZE 3RDTA 5LDUA 3QUXA 4OCLC 3F12A 2VXVL 2CZNA 2NY6C 3HS0C 5HDQH 1O5PA 2EKJA 5HYSB 1X5LA 4LO9A 3PRZA 2OMWB 4XP6H 2Y06H 3GXDA 1IARB 2WQ8A 4AOFA 2ATAA 3VW3L 3FO9B 2KLRA 2XVKA 1CI3M 1T5WB 1I3RB 4AIZB 1YEGH 3QFJB 4M7ZC 4J5VA 4UF7C 1F3DH 4EI5C 5BQ7A 4HEMA 2W9LA 3ULVH 1X5JA 1T7WA 1KPRB 2FWOA 2ZOKB 3AB0B 4RZCA 3VWKA 1LO2H 2E8YA 3VD9A 1OVZA 3MX0A 3OR7A 4NZJA 5F71A 1UB5A 4FQQA 1VKXA 3VXRD 1PZCA 1WTLA 4CVXA 2J55A 4GSQA 5E94B 2YQGA 4X98A 4YDNA 3JUYA 5IY5B 2OA9A 3DUSB 3OKKB 1S7XB 1SBBA 5EBWB 3LKNB 4S10A 3VM5A 3G5YA 3H9SD 3VMPA 2X4OA 4PFEA 3GHEL 2LV4A 2AJXL 5L0QB 1G6VK 3BE1H 2EEBA 3P2DA 1U4EA 3D4GA 3DO4A 3V9EA 3GJEA 4L4TB 4NNPL 1P84K 3FH5A 5CR8A 4PRPA 3RGVD 4QLWA 5FYJD 3PV6A 4J3OH 4NEHB 4YK4C 4JCLA 1I1AD 4MAYB 4IU2B 4BWUA 2G2RB 5I5RA 5K9JH 3QULA 5CN2A 1LQBC 5EO1B 4LQFL 4F7KA 1RZFL 3K5SA 5DSCB 3IDYB 2D2OA 1M53A 3LVTA 5BVPH 3H42H 5EZLB 4KOCA 2R9HC 1DLHA 5T3XE 4ZQKA 5LGHL 5LNDA 1OTSD 1G4MA 4L8SB 2EVFA 4L3EA 1KFAL 5JXEA 4B7IA 4UNUA 3WEAA 2PXYA 3D09A 1QMUA 2X4UB 1B2WL 5TQ0L 1HTYA 4GI6A 4B3VA 2DQTL 1UGNA 3ZZQA 4G9FA 3NSXA 4I0PD 3PQYA 2QPEB 4YSSA 3F05A 2AK4A 5C6TL 4DGIH 2EEXA 4K9JA 3THMH 3W3BA 4LRIA 3VDCA 1F97A 3D34A 3NACH 1SM3L 1U93A 5MHSD 3BMVA 1RZ8A 5KSVB 1NC2D 2VC2H 4OZIA 4GG6B 2GHWB 2BPBA 4Y2DA 3FCBA 1MAJA 1S7TA 2NY3B 4QIRA 1AHWC 2XPGB 5EU4B 5L9DH 5K9KA 3ARGB 1IZJA 2VDNL 1BD2B 4UNIA 2A9NH 5CP7A 1IQWH 4YWGH 3L1GA 4KTDL 1L6XA 1RPQA 1OKEA 4PJIE 5A40E 2KUTA 4U6YB 3MFFB 4Y4HC 5IVZB 4A38A 5LLIC 2DMBA 3IFLH 2YPLB 1KB3A 5CJQH 3SOTA 2IBZY 3LN4B 3EYFB 4MCNA 1FUNA 3PXLA 3VFUA 3UROR 2VAAB 1IFRA 4GLRH 4M8QA 5FO2A 2DQHH 3QDGD 4XPBL 4NQXB 4X4KA 2WZAA 1QYGH 4E42B 3FT3B 1I8LC 2ZYIA 4JRYB 1FL6B 4ONGL 3CN4A 2G4EA 2R69H 3G5XA 4Q4EA 2F19L 4AK2A 1FFNA 1R4XA 3SY6A 3KNBB 4OCNC 2WD0A 4I18B 2QLVB 3HHSB 5D7SL 5J12C 3HI1B 3VYPA 4YS4A 4PJBA 5B38B 3TOPA 5LGKA 3D0LA 4NQEE 1D5MB 3ULSB 5D6CA 1ERNA 3HMXA 2C26A 1JHKL 1QWNA 4WFHE 3V7AE 2BK8A 1T83C 4R3SB 4JM2F 2R2BB 1GA2A 2AANA 4Y16D 3QI9C 1UKQA 1YEDA 4G8FA 4LCYB 2VIRA 4HWNA 4ES8A 3GBDA 4AEEA 3E8UH 4NBXB 1MCNA 4KKBC 1AZZC 1BV8A 2FIRT 1TTCA 4N1HB 4DH2A 1P1VA 1QRNA 3HG1B 4H5SB 2HRHA 1CO1A 3IPFA 4Y4KA 4PY8I 5FYKD 4RDQG 5EIIG 2BOCA 3RWHA 3QDAA 3DVNA 4R4FH 3TLRA 1RJYA 3H6JA 5HD8D 3BP6B 5FYJL 2OK0L 1YO4A 3QO0B 2N0KA 4HZ1A 1FPTH 4V33A 3AAZA 5I1IH 2V33A 3LN5B 5ALBH 3TT1L 1ZD6A 3Q43A 1I85A 1GYCA 5I75B 5I66A 2BSRB 1R5WA 1WRFA 3EJJX 1HYRC 1GCFA 1IU1A 3QJOA 5AWNL 5HYJA 1ZKAA 5FUCC 1JV5A 3J07A 3QUYA 1XGPA 1M9SA 2NY5C 3Q8BA 3ZE2F 1N26A 2OR9L 3FU7A 1E4KC 3D33A 3BT2H 1LNUA 2QL1A 3Q2CA 2IPUK 4LLMB 2MOVA 3M8OH 3VGHA 5EBLA 2B3IA 3LS5H 3RDTC 4BV1A 1CQKA 1N64H 3QUXC 4DP7X 2YJQA 5DR5L 1QFWM 2GIMA 4I4WA 4CGTA 5J7CC 2ILLA 3BD4A 2TRHA 1AI1H 2G5BB 2UVEA 4Z7OB 1UVQB 2DICA 4A39A 1E40A 2GEQA 4UINL 5H94B 3DJTA 4XMVA 5EOCJ 4DVBA 2F5BL 2X9WA 4ZUVB 4A7QA 3KD4A 3BZEB 4F1ZA 3MRRA 4M8VA 4DGYH 5E6RB 1G7LA 3GMMA 2EO1A 2CCVA 3VWKC 3I2CL 3VGBA 4PJXA 4ATTA 4NLHA 5CZXD 2BVPB 1AD0B 5CEXB 3DX1A 4HD5A 4F93B 1KBVA 4LSSL 2WYHA 3FT2B 5D96C 2GJJA 2QV4A 3SDCA 5LXGH 5HGAA 2HVJB 3GI8H 1OPOA 3B5GA 3CUPA 4F7TA 4M8RA 4WCYH 5IMMB 1OK0A 2EKSA 4JJHA 1QUNB 3ECUA 5KBKA 1HYSD 3MDJA 2P24B 1ET8A 2A4ZA 2EZ0D 5I73C 3EYSL 3V4PA 4EDWL 3EDKA 3SDYH 1OP4A 2ATKB 4K3EL 3K91A 4ZD3L 4BQ6A 5FXCH 2MEJB 4YPGB 2KC0A 5JIPA 4HS8H 4NJAH 3MRIB 4O2EB 5A2BA 1I7TB 2B1OA 2F74B 2FBOJ 5LCVA 3ZDXE 2VO5A 3S5LB 3LQMA 4PGBA 3MRPA 4A2FA 2JB5L 5DS8B 8FABA 4KZEH 1GZQB 3K71B 2O1AA 3B7YA 2CJUL 2QADC 3O4LE 5AW3B 1JSYA 3C6LB 3VXUE 1J8HA 3MREA 4B7LA 1CVSC 2DQJL 2PXYC 2MRYA 3DA0A 3P4NA 4NQCE 5B39B 3VE0B 1HT6A 3UYPA 2D4DA 3C5XA 5HY9A 4UB0L 4AENB 3U6XA 2NQ3A 5CR1A 2CJTA 5F2FA 5FA4B 1MWAA 1NUNB 4MXQC 5DC9B 3OXSA 4TULL 3S3BB 1QABA 3FO0H 5FYKL 3EJPA 1RERA 3U9UA 3HE6B 4LRIC 1Z0MA 2R51A 4PJGF 5IBLC 1KACB 4BXSV 5I6PA 3FCTA 1CD8A 5DD3L 3DROB 4GSDH 4Y2DC 4UUJB 2B2XL 4KAQH 1MI5D 5F1NA 4F3FB 2VDMB 3OJVC 1SVZA 5GHWL 43CAA 4M00A 3FUDA 2HLAA 4ZUSB 2Z31B 1K6QL 4DETA 5IJVA 1MCSA 4WHYG 3M1CA 3ZRSA 1KCUL 4NUJB 3L2NA 1RP8A 3A5VA 1FSKB 2APXA 1N3NB 2D03L 4XMTA 4K94H 1A3QA 2RMNA 5J6SA 3NUKA 3QPXH 2IMMA 2UUDK 4LIQH 1HKLH 1T6WA 3GO1L 3EBIA 2ZSWB 1FL5A 4ZFGH 4JFEA 2KZKA 1UJ3A 4KQ0A 4JPIB 2P5WD 3BGFB 1TQUA 3B8YA 5FO8A 1DDHB 2Q20A 4K7PY 4IW4C 4WTXA 2DD8H 5SWSB 3UBXI 2IQ9H 1MDTA 1QQDB 2I25N 3L95B 3BVWA 4GH7B 1QBAA 3CSTA 4G59C 4KHTH 4KXDA 3V6BR 4KV5E 4YL9A 3HNTH 2FAUA 2BRRH 4W9KC 4JCWA 4XBGB 5D72H 5GGSY 3O2WL 5T1LB 4UT9H 1QKZH 4NQSA 1BVOA 2EDDA 4MAUL 2PR9A 4LPCA 3BP5B 5E08H 2MPAL 3OKOA 1SXBA 1WCQA 4GI9A 2BOBA 4XMZA 3OAUL 3MPCA 2DAVA 1UD3A 5IMKB 1JL8A 2HT4D 5T1DH 4FQIH 4RX4D 3PP3H 5IB1B 1B0IA 4GKSB 3FQUB 4KMLB 5I30H 1U3HD 3DTXB 3C9NB 2BNRD 3HZMA 2DWDA 2XN9B 1WD9A 2J56A 2VNCA 3QG7L 3ZDYE 2VDOL 3CFKA 4RAUB 3VXSD 4Y4KC 1PCXA 3HKFA 2QVKA 1EZVX 5FYLE 1TTGA 4Q9QH 4HIIA 1QI3A 1FAKT 2HTLD 1DUYB 2HN7B 1UM4H 4JFDB 4H40A 4JREB 2DYRB 4MDJA 5I74B 4ZMPA 3GSWA 3IDNA 2IANB 3AADB 4CC1A 2YRPA 1LE9A 4NO2B 1IE5A 5C7XH 2ZOLA 3NIGB 3WFDH 2OYKA 2MTPA 1OAYL 2G3NA 5KSUB 4GT0A 5LBVA 1PU0A 1I85C 3FYEB 1J5HA 1SBSL 3V4UH 1N7MH 3QUYC 5CMAA 4P9HH 1WK0A 2ZCHL 4P59L 3Q5YA 1T3FB 2WLZA 3UZQB 3WBDA 4P3CH 4J3OF 1E6OH 2CKNA 3L3IB 2AQTA 3V9FA 1HEZA 3GDBA 1CGWA 4ANUA 4NKQB 3HR5A 2BIIA 3CV5A 3ZTJH 3SEPA 5SV4A 5B3NA 2XWDA 2J4WH 3LQAH 1HEHC 1L9RA 2F58L 4LLYB 3P9MA 2GSIA 1ZXQA 4LSVH 3EJYC 3PXJA 1P7QA 1Q9OA 2WWMC 3EGSB 3QZWA 3CJJA 4BZ2L 1KXQE 3FSOA 4BDVA 2VZ1A 1KIUB 2WQVA 3MLSL 4WW2A 3KPRE 4XT1C 5AW7B 4C56E 3FHAA 2YGPA 3NAAH 4U6VL 4GI8A 5IK3A 1RZIA 2P5EE 1UJTA 3U6RA 1UA3A 4N8VB 3V79C 3KCWA 2QVMA 5DHMC 1AR1D 4XNDA 4XWOC 1IEBA 2HG0A 5FYJU 4WNSA 5A6IA 1J0ZA 2OMXB 5IMOB 3QDJE 3PNWA 4WAFA 3ZW3A 2H0EA 1T22A 3FBQA 3FU8A 4OFDA 1UZ6E 5DRWA 1FH5H 4W6WB 1MCFA 4A2EA 4NRZB 3U2SB 1LE5B 3B9DA 3N9GL 2IF7A 3FO1B 2PCFB 3UBXA 5MP6L 2JJTC 2A0LD 8CGTA 4OIIL 1SUHA 3DOSB 1ASPA 3UBHA 5F7KC 3H56A 4J3UA 3SDDA 3TN0C 4JFZH 1T6VN 3D2UD 1AHKA 1DEEA 2E3VA 4NO3A 4NGHH 1AO7D 3MRCA 5DJ8A 4M93C 4KXBA 4PJIA 4QHNA 4TM9A 4OCYL 4ZUUA 3T2LA 5BRPA 2CDFA 3M1BA 4N4YB 4G8EA 1NCBL 4QRPB 4KROC 4H4NA 3FB7A 1OAKH 1IGFL 1IGJA 4TUKH 1T1XB 4O02A 4NZRH 4A04A 1JK9B 1CLZH 3AU1A 1DHKA 4JFQA 2FEEL 3AS2A 2CM5A 1E0OB 3L4VA 4CN1A 2HH0H 3EYOA 3FQXB 1YJDC 2DJUA 4MX7A 4Q6IA 3V5HA 4HIHA 3WFHA 4X7TA 3KVQA 5FCSH 3WGUB 4PEEA 5DZVA 5LCVH 4JLRA 5KTEH 1C16A 4AUUA 2CLZA 3HZVB 1J10A 1MN4A 2QQLH 4JPWL 5HHQB 4KGJA 2QZ5A 4JKNA 4AVJA 4YHKL 4MJ6B 2NTFB 2Q7AA 1OP5H 4F5CA 1XB6A 4WI3A 4IRJD 4M61A 4QKXB 4EUPB 5KYNA 1WGOA 1CD1B 5DJZA 1G9MC 3RY5A 2YC1A 1D9KB 4NP9A 1E5CA 1MWAH 2XQBH 4XPAL 4ZOBA 3GMNB 1J5OL 2I69A 1CFSA 4G7SB 4G9DA 4UM9B 3U0WL 5AKSA 1ECZA 1AACA 1W8EA 1KGCD 3WE6A 1A4KB 3WTXA 3PWNA 4JFXA 4QR7A 5AYQA 3H55A 4MA8L 1DSYA 2WTPA 2GTQA 2BOLA 2EYSB 2P44B 2RHEA 1XGQA 4HJGB 4R7NB 3VFRA 3II3A 1TKWA 1ZVNA 1MAMH 3A6CH 4LSUL 3K4AA 4JHWL 3S4SB 3UDWA 3A24A 5AG9A 5GRWA 2OQJA 4AJ0A 2AK1L 1K4DA 3H0TA 3WNJA 2FL5A 4Y9CA 5LNGA 1QVOA 3S34H 4FJYA 3P3YA 1S3RA 3TVMC 5H2BB 1TTBA 1AFVH 4WW1B 4JFFB 3RPIA 2FRGP 4FADA 2EIDA 4ZI8A 3HPJA 3LY6A 3PF2A 3C87A 1B0RA 4G6JL 1CK0L 3SIKA 2FUTA 5TGBA 4GG6E 5CINH 1UZGA 5DEGB 2BZCA 3QHTC 1V3LA 5FYKU 3LNGA 1OSEA 1VERA 4JRFA 5A2LH 3VD7A 4HYTB 5JQIB 1U2CA 2NNAA 1L9NA 2ZONA 5CN3A 2VXQH 4MDRA 2Z92B 4M56A 2X2YA 2H32H 1PCSA 2ZJSH 1BD2E 4FXKA 4BKSC 3UMNA 1V8HA 1RUML 4HIQA 4IK7A 4QO1B 5AB1A 3COOA 2RACA 4O4YH 3DPBB 1OSZA 3LZNA 1INQA 1NC4D 3VG9C 4X4ZA 1JGVL 1RK0A 1RUKH 2YPLE 4L3CA 2WMPA 4OCWL 2P5PA 1C1EL 3O9WD 5IB2B 4L8BB 2UV3A 4JO2L 4R2GB 4HOZA 4X6CB 4RBPH 3U4EA 1IVTA 2IWFA 4N6QA 4J3SA 2ISDA 1DQDH 2CSPA 3G08B 3DHMA 3NPSC 3T2NL 5I1EL 4F7MB 4I89A 1ORSA 4EQ2A 4Z3IA 4X0NA 4U3SA 4WI9A 3CK0L 1KTJA 3UJJL 2QTEA 2ICWB 2P7TA 1B88A 4AX3A 4HCRH 3ALPA 4KUZL 4NIYE 1NGZB 2WVVA 1KBGL 2ZCLH 4LCIH 3LPGA 4YXLH 1NAMA 2HA1A 4NUGL 3SPCA 5L2JA 3OPZL 4TL4A 3BEWB 3F5WA 2HT2C 3RFZB 4QRRB 4ZOEA 4UQBA 5E5UB 1M9WA 4MQXD 1KN4H 4NO5B 4ODTH 3HB3B 1A2YB 3VFNB 4F8LA 5IB5A 2JI3A 3BWZA 2F7RA 4LPVA 2Y22A 1V7NL 4OLZH 3MA9H 3LS4L 5CGMA 3HG1E 1QFWH 3X11B 3ZKMC 1FZJB 1RIUL 3LQZA 4IMLA 4P2QA 4BSVA 3L1FA 3Q6GL 2LFGA 4HGMA 2I60L 3EG9A 4WW2C 1E42A 4ZXBB 3TBTA 4NQCA 5KVGE 4POZD 1FCGA 5D5MA 3Q01A 3BP4A 2JKJA 5I1CH 4ESKA 3KBPA 4Q9BA 3GXTA 3SKOB 4J1UB 3VRIB 5C0BE 4NCC1 3PGDA 4TLTA 3B3IB 3SE9H 1O75A 5A3IC 4U7MA 5AVSB 1FFTB 1FAIL 1MFBH 4N0YL 3FBKA 4KUCF 5KSAB 1XCQB 3G6JE 2WTOA 3GSNH 4U2YA 3BQVA 1F56A 1M3IA 2IXQA 5KSBB 2Y4SA 1JG9A 4RWYL 5FB8B 4XPHH 3MV7A 1PD1A 3TEZA 2Y1VA 1E9OA 2DLEA 5LAXA 3R7QA 3OF6A 3H3PL 2E6PA 2DF3A 3HC2A 5ILTL 2MQGA 2IALA 1LO3L 3H7BB 2YA2A 2CLRB 1ZLUH 5F9OL 3KPLA 4NM4L 3U9PL 4OZIF 5AB2A 4Z7OE 4X5XB 4ADJA 1R24A 1UOKA 4AJVA 4PVMA 3ARYA 2YUXA 2CDGA 2A9BA 1Z5YD 3TBWA 3RZCA 1B4LA 4RA3A 4NNYB 1XF2A 1A14H 4DO6A 5H4ZA 4EN3B 5T5FH 2WXRA 1ROWA 1HHGB 2LHAA 4DK6A 1ND0A 1CFVH 3L3DB 3QDMB 4Q6IC 2J1WA 1LO4H 5MEND 3FN0L 3B7SA 3T0DA 1KXHA 3CU1A 1DL7L 5E03A 4D0DB 3DX2A 1OWRM 2F1EA 5FK9B 1Z9SB 4UQ9A 1NEZA 4IBZA 2FATL 1AJ7H 2ZWZA 4XHJD 4HUUA 1YMMB 1DSFL 4M7LH 3B8SA 1HILA 1BM3L 2CG9X 3VXMA 3MJGX 3VTAA 5D71H 1PTZA 2WLIB 3F6JA 2ZX5A 3EJRA 1S7QB 2GJPA 3MLZL 4PRNB 3C75A 1L3NA 1XGTA 2PNDA 2WM0A 2CGRL 2WUCH 3EH4B 1NAKH 3NZUA 4KHXL 1AANA 3GNML 2FYYB 4LLDA 3IDJA 1ZHKA 5DFTA 1UCTA 3TASA 4ORGB 3R1GL 2E6JA 2J73A 4PJBF 4YUEH 5AOLA 5KBNC 3VSUA 2AQRA 2QVFB 1MOEA 2C1PB 5F7FA 3KR3H 4JY4A 5DYOA 2PR4H 2YIHA 5KVDE 2DOCA 3TX4A 4OCXH 4HUVB 3D85D 1H5BB 2JXMA 4EPSA 1OGAD 2UYLB 1NA8A 2GITB 1NGWB 3P0YL 1H15B 4L2YA 5I17B 5AVTB 2NQDA 3L8QA 2ZQKA 3QJFB 1FZOA 1EHXA 3UDWC 4EXKA 1FJ1A 1HL8A 1HDMB 1MLBA 4L4VB 2D9QB 3DKHA 4LLWB 5DHYA 1LO5B 3CPUA 5J3HD 3CLWA 2HKHL 2BS9A 2AFNA 3VGAC 5IB3B 2W0FA 1WLHA 1VFAA 3S6CA 3SKNB 1MW0A 4K5MA 4IU3A 4OFYD 3V6ZB 1EK3A 3VGDA 3WNPA 35C8H 2W92A 2FWLB 1FHNA 2ICEA 1LMKA 1DJSA 4FKHA 4FXKC 4YFLI 4YQXH 1RZ7L 4RISL 4XO8A 2N0MA 3VAEA 1A7BA 1EXUA 2LGNA 3C12A 3V10A 1MCDA 2IOOA 3CCHB 4N0UA 3UG3A 1UH2A 2GFBA 2AXGA 3UTSD 3MCYA 2ADFH 2IADB 1KXQA 1VGKA 3WN5B 2WLMA 2IVFC 1I9RH 3FAXA 2IH1A 4ZOAA 3VGFA 2DM4A 4WIQA 1W15A 4GKZB 5CJ5A 3FULA 2P5EA 3LV3B 4XN1A 4HPOH 4BK8A 3IDMA 4QJ3B 4P2RD 1QW9A 3L5WB 3PPSA 3N1GC 3NGBB 2WYZA 2OX5B 3W5MA 3QDJA 1JZDC 4KVCH 5KW9H 3H54A 3WTYA 4OM1H 4FLOA 2XQYG 1G6RH 5C08B 4ETQB 3HBZA 4H26A 4E9WA 3QCVL 4M48L 5DRZA 5A1AA 1JVLA 5B3SB 4N24A 2OI9B 4M8UA 3QIWA 1EA9C 2CO6B 4MD5B 2WTRA 5ABZA 5CJBA 4OLUL 4FQLH 3MOAH 1MRFH 4PJXF 5EZJB 1ZHBB 4DQOH 1HKFA 2EDXA 2JWYA 1HOEA 2VABA 3C5ZB 5T33H 2OYPA 4ZSOE 1P5UA 4QJ5B 4QJ4B 2R23B 5I6KA 4PWFA 4O9HH 4XC1H 4XTRD 3QJXA 5HYSA 3KEDA 1HOCB 5I15L 3B5HA 1W2KT 2XN9E 5JW4M 1GC1C 1S9KC 1EO8L 4MAZA 3FO9A 4FQ2L 5FO9B 1I3RA 4PJ6A 3QFJA 4L5FH 1JRHH 4JFDE 3EHBD 4AKPA 3QORB 1U6AL 5CD5C 1FNAA 2QQNH 1KPRA 2ZOKA 3CN3A 5IVXB 1UZ8B 1PGRB 3SCMD 2M2DA 3S98A 2P46B 5E94A 1ZRUA 3DUSA 3OKKA 3QUHA 2YHGA 4D9RD 4Z7WB 1S7XA 3BKYL 3HCVB 5HBBA 2V2TB 5EBWA 3LKNA 2HPOA 4Z7NB 4Y9BA 5I8KL 1WYJA 4MJID 2CR6A 4YC2B 5HHPB 4D0BB 2X1OA 4CC4A 4LDLB 1DQLL 1QLFB 1QSFB 4L4TA 4P5TB 4Q9RH 1ZV2A 3PL6C 4RNRB 4ODUB 4K71C 4WK2B 4XNXL 2BP3A 1HH9B 1SXNA 2HWZH 3DYOA 4IU2A 2G2RA 4MAYA 4MB5A 3DIFB 1U8MB 2WBJD 3FUFA 3TYGL 5EO1A 1IO4C 3V4PL 4NN6C 3PAVA 4CVUA 1KBPA 5DSCA 1OW0A 2K0RA 5EZLA 1A6PA 1ZY9A 1DJYA 2V4LA 3ABGA 1T1WB 3OLEA 3VU2A 4AH2B 5JIKA 4JMNA 3TT3L 1R5VB 1P5VB 4L8SA 5DRNB 5C2UB 1I82A 1TTRA 2Q8BH 3RZCC 5JMRA 4P4KB 1XR9B 3FTZA 4M7LT 4CAGA 3LHAA 2X4UA 1T20B 2B7DT 3NJKA 2F8XC 4X9HA 2FQFA 4L9DA 5JIIA 1IBGH 1U8LB 1RZJC 3HUJB 3QRFM 1JZEA 2EXWD 4N0CD 3KLAB 3Q06A 1GYVA 4GIAA 4H7VA 4U4IA 4GG6A 1O7DE 3QCUL 2HUEA 2JLLA 2XPGA 2VLRB 5EU4A 4LHUB 5LBSA 2PWDA 1KIPB 3ARGA 3QIUD 3OWRA 1NH6A 1PG7W 1QWHA 1BD2A 1NCTA 3ARBD 2Q2EB 3MRHB 1AMXA 3DSFL 3UEQA 3U6XS 3VG0L 4FNLL 3F7KA 2FNBA 4U6YA 3MFFA 5IVZA 3NSDA 3WFBH 2H45A 4QOKB 1PNCA 3BT0A 3L4UA 5F96L 3T08A 1FVCB 2YPLA 4Z0XB 3LN4A 1TITA 3EYFA 3GRGA 2VWEE 5DURB 5TQ2H 4TQIA 2VAAA 5L2KB 5HHNB 4JHVA 3SPJA 3W9EB 1TIUA 4NQXA 2QPFA 3WD5L 4ZMZA 4E42A 3FT3A 1TETH 1R3KB 1A1MB 2ZKYA 5TE6H 4JRYA 4NLAA 1FL6A 3UIZA 3EGDB 4CSTA 1TVHB 4WI7A 4PWKA 1HH6B 3BAEH 5JQ6H 4X9GA 4N28A 1Z2KA 3KNBA 3EOBA 4I18A 1G1OA 3HHSA 4YSPA 5JOPD 3HI1A 5B38A 4M5YH 2CA4A 2EYTB 3MRKB 1D5MA 3ULSA 4BUGA 4R3SA 1HWGB 4C58B 4FQ1L 2R2BA 4IKIA 4OD1L 2NY0C 4WWID 4LCYA 1CZ8H 2ICEC 3WFCL 4UTCA 2RIKA 1Q0XL 3ARSA 3PHAA 4F2EA 5E1HB 4QD2E 1JPTL 4H5SA 5D8JL 3HG1A 1FIGL 1V7MH 3KWUA 3ZZ1A 1MELA 1WIUA 2AERT 4J6RH 4R8WL 3VMNA 4Y1AB 4FHKA 1HZHH 2D7NA 3BP6A 3LKOB 5IQLA 4Q0XL 2NXZB 4EZJA 3RY4A 4UM8B 1V10A 2XZQL 2C3WA 3GLDA 3QO0A 5GGTH 3BUYB 4LVOB 4HK0B 4WWKC 4XMXA 3D5OF 4LT7A 3PREA 2YEVB 4KPHL 2CMRL 2QSQA 4LPYA 2VJXA 3LN5A 1JXJA 4GBXD 3NESA 5KZCD 1FDLH 2D0HA 2FB4L 3D4CA 3FS9A 2QELA 3BPLB 3WS6A 2BSRA 2R1XB 1O9ZA 4GAFB 2VN7A 4JFFE 1SNRA 4WW2F 3QIWC 4K9EH 4KK9C 5DO2D 2G9KA 1GHFH 2JJVA 3CX5K 4B27A 3IJHB 4H8PA 4W4OA 1RXLA 2Q5BA 4LCWD 4W9GC 3TH4T 3GI9L 4LLMA 3BSGA 5IHUH 2F7PA 2X1WL 3QIBB 1P5UC 4EMZA 4MS8D 1DBAH 3ASNB 3MUJA 3ZE1E 2CBOA 1VCBC 2G5BA 2NR6A 1UVQA 1W6LA 2DEYX 5H94A 3ZSTA 3NIDF 4Z18A 4IBQA 1JOIA 3VX0A 3BZEA 3MLTB 5HVHB 3KXFB 3IGUA 1GS8A 1FNLA 5I1JL 1CE1H 3LPOA 5AZEL 2CPCA 1IC0A 3BP7B 4S1RH 5KYYB 3AB0C 5IFHL 3AMLA 3WLWD 1IC5H 3SPHA 1IZKA 2BVPA 4WVRA 4XBPB 1AD0A 1XH3B 4C54A 5CEXA 4GMTH 3RVTC 2AXHA 1BX2B 1JJUA 2WVSA 3R18A 1UTDA 3FT2A 2DRUA 2HVJA 1WAAE 2MOGA 3ELQA 2W95A 5IMMA 5JOFB 2NSXA 4BQBA 3NK4A 1QUNA 1UXMA 4MFHA 4U3HA 4HK3J 4MMZB 3TO4D 5I5MA 2P24A 1YY9D 4P06A 1UYWL 2AJYH 4XB3A 4UILL 2YLHA 2MQ0A 3L16A 4XX5A 3REVB 4QRRE 2CRZA 2ATKA 1IQDB 4KI5D 5E6IB 4MAYC 4ODHH 1F2QA 4H8WC 4OIFA 4PD4J 1I7RB 3TPKA 4WI8A 4NP4H 4S1SH 2DWEB 4YPGA 3KWWB 2VSDA 5GGVH 3MRIA 4KK8C 4O2EA 4V1DD 2EH8H 1I7TA 2PPFA 2AI0L 4E68A 2F74A 4N26A 2D8KA 1OW0C 3B2VL 3B2XA 3F85A 4OLWH 3S5LA 2WAHA 1F1DA 3AACA 1MW1A 5DS8A 4EIZC 2XDHA 2HZHA 2XRAH 5G4OA 4R96A 5CCKL 1GZQA 3K71A 5HJ3B 4UT6H 2APTA 4XCFL 4L8SC 3C6LA 2L3BA 2HMID 5B39A 2E9BA 5DDHB 5BO0D 4F7CB 3VE0A 3CIAA 3ZL1A 2WZ0A 4NAJA 4D8PB 4AENA 1JXDA 1NLDH 4W9JC 5FA4A 3FU0A 1C12B 3F6LA 4I0CC 7FABL 3TWYA 1MFDL 3HE6A 2D7OA 4BA0A 3VXNB 4YDKH 5DJXA 3MKGA 4B9KC 5KYWA 2J88L 5EN3A 1P7KB 3CFDB 1RVFL 3DROA 3WENA 5KS9B 3D25B 3SGKA 4UUJA 1P7BA 2NY3C 4F3FA 4GRWB 3TURA 1MCPL 5DJYB 1BQSA 1QD0A 3VI3B 4I3RH 1M1XB 2R0KL 4ZUSA 2Z31A 2F8OA 3APMA 1A7NH 1Q0YL 5BZDA 4X8GA 4A2LA 4PRDB 3HBPA 1GMIA 3CN1A 1OAUH 5CCHE 2WXIA 2NNFA 4NUJA 2H3KA 1URLA 4DP9X 3AQDA 1OB0A 2R4RH 2YEQA 4QRSB 5HHMB 2LTQC 1ADQL 1N3NA 1WWAX 5BRZD 4BM7A 1FBIH 4WU7B 2H6OA 4F27A 1ZDSA 2XWBB 5CM1A 2CO4A 3CU7A 1QG3A 4XVSH 1N0XL 2EVIA 1I3GH 3HNVH 1MHEB 3QDME 4JPIA 1UEYA 4J3TA 4P49A 2BP8B 1DDHA 2RR3A 2NTSP 2WVUA 4XPFH 3S48A 2NYKA 5SWSA 1JZHA 2LAGB 4R97B 1DDTA 4ENEC 1QQDA 3L95A 4I18C 1A3LH 1A3ZA 1TJGH 4XBGA 1YMME 4YE4H 2HRLA 3NA9L 3FOMA 5T1LA 3LH2L 4RMBA 3BP5A 1C5CH 3QR2A 3VXTB 1S9VB 4WO0A 4WWNA 1L6ZA 5DQDL 2DDQL 5IMKA 2Z91B 3HAEG 4KKQA 4QWWD 4RWHA 3TBYB 4JDVB 4NI3A 4ZTEA 5FS5A 2AABH 2ENYA 2X42A 4GKSA 4XP4L 5IB1A 3RIAF 3NFSH 2NZ9D 3DTXA 3C9NA 4B9CA 5GS0D 3SYAA 2XN9A 5FW7A 4RAUA 4YSCA 5HYFA 3L45A 1N8ZB 1SF5A 5LG6A 4IS6B 4RMWA 3S37L 2VM3A 4OTXH 3OAWA 1DUYA 2HN7A 4JFDA 4F24A 3ARDD 4TNFA 1OTTC 1Z9OA 1UD5A 3RQ3A 2IANA 5E8OB 3QZWG 3U36B 1FO0H 4KQ3L 3C08L 3F2LA 4NO2A 2P43B 2YUVA 4Y89A 2AGJL 1JGUH 4F15B 3UGUA 3WLBB 3ZE0E 3MRQB 5KSUA 2BWDA 3CHPA 5I1GH 3WS6C 2UWEF 3I6GB 3L3HB 1NGXB 1BYNA 1CF8H 1ZTXL 1LEIB 3KL0A 3NIFF 3QEQD 1DQVA 4M29A 5I0ZA 5D5MF 3NRFA 3DMMB 2IWKA 2VUYA 4TQEH 2BY0A 1T3FA 3UZQA 4OFPA 3EJZC 4GIPD 3L3IA 4W4OC 4KKZA 3UBXG 2BVUA 5JUEL 2VXVH 4UBDD 4WHDA 3II1A 1WEJL 3I9GL 2X2UA 3FQ4A 3IAPA 2H26B 3NEXA 4NQTA 1J18A 1I75A 4LLYA 1BF8A 1K5WA 4QTIL 2FO1A 2NR6C 2VUOA 3EGSA 5E4IA 1HXMB 1WUZA 1KIUA 4J2XA 3L3KB 4JGNA 1CD0A 1ZLSH 2NRDA 1J88A 5AW1B 4KVPA 1GZPB 4G83A 1OLLA 4FXGB 4N8VA 4L23A 2P80A 1JYWA 5HI4D 3JZYA 5TF0A 5IHLB 4L48A 2WQWA 2JSFA 2OMXA 4FNPA 4H88H 1GYWA 4P23D 5IMOA 3V0VB 2VW4A 3ILQC 3MXWL 2AJXH 3U2SA 2OR8A 3NRQA 4NRZA 4OSUL 1LE5A 4N8UA 3FO1A 2PCFA 4JFOB 2EDWA 4CKVX 4LCCB 3DOSA 3UEZA 4NBZB 4Y7MA 1KJ2L 3QRGL 2A74B 3FQYA 4MA3B 3V7AG 3ZBMA 5FUZH 3RUGA 1Z5HA 3RA7L 2DB8A 4LQFH 3CXFA 5FDYA 2BFGA 3CXDL 3ZPDA 3K2UH 4U3XA 3P69A 3ZKND 1QEWB 5E2WH 1ZANL 3RU8L 4QRPA 3EO0B 1HHHB 4JRLA 4OGXL 5AYUL 1KCVL 1T1XA 4TSAH 3ULUE 3RAJL 1U3NA 1JK9A 1XQ4A 3F7YB 3O6LL 3QPQC 5MEOB 1A7RL 4FD0A 3TTYA 3C6LC 5BPPA 3L9BA 1NCGA 3GWJA 1DBBH 1KEML 3NSJA 4N2MA 5IVXE 1PZSA 4ODBD 1JAEA 2ICWI 1UUNA 2XG5B 5SV3A 2XZAL 4P46B 4NPJA 3ZDYF 3D39D 5GS0L 2Z64C 1JGDB 4KBPA 4LSRH 4WHTB 3HZVA 4N5EC 4ZS6D 2Y23A 4Z7WE 5TDNB 3VYOA 5I0YA 5HHQA 3HE6C 4KJQC 1TZIB 1H8LA 2NTFA 2Y1ZA 4MJ6A 4Z7NE 2FWUA 2HVBA 3BOVA 1DZBA 4JM4L 2K78A 5D4QA 5DZLA 5JPMC 4AIOA 4L05A 1J8RA 1EX0A 3S97C 4EUPA 1CD1A 1RUPL 2WCSA 2FGWL 2VDNH 4FEIA 3SGKC 3VQ1C 2RH0A 4QNPE 3OJDB 4HKJB 4M43L 1D9KA 1TEGA 4KTDH 4WNQB 3BN9C 1NSNL 1URZA 2NSQA 3DHPA 4LGPB 5BMFH 3KYOB 5C0RL 4HS6B 2Z31C 3GMNA 4XO9A 3WNLA 3FQ2A 1IT9L 5FW8A 1NMBL 3WIFB 3EYQD 2X4SB 4UM9A 2B15A 4JG9A 1KTDA 4PUBL 3OZLA 4BFNA 1JZIA 1FSKC 1U21A 3KPSB 5F88B 1A4KA 1JZ7A 1OGTB 4XPBH 4KO5A 2OLDA 2XTJB 4U1SA 5C0GA 1HE7A 4LDCA 3BJLA 2L7UA 2EYSA 4ONGH 4HJGA 4R7NA 1UADC 2X5PA 3GZOA 3S4SA 4O2CB 1ZOXA 1XGUB 3BGFC 1XAKA 5I1HL 1BWMA 1OARL 5H2BA 4A2GA 3L4XA 4WW1A 4UU9B 4JFFA 4E0RB 2C9AA 4HC1A 5I1DB 2FEEI 4WDIB 3KLDA 5DEGA 5T1KD 4XE0A 5E6YA 4HXAL 1EUTA 4R6UA 5IROC 2VLRE 5E70A 1ES0B 3T09A 3X1GA 4B9IA 4NAMA 4OJAA 2Z92A 3D06A 5EIVA 4OJYA 2VQUA 2M26A 3KLQA 3BKMH 4QO1A 4HZAA 5E5RB 3Q1SH 1ZS2A 1BGXL 3BVNB 2GK0B 3N1MC 2NY4B 3DPBA 1N59B 3Q5OA 5EOTB 4QOKE 4D7BA 2VJ0A 1IGCL 5A2IH 1GYAA 4KQ4L 5F7DB 1PSKH 4L8BA 5FYJH 2OYLA 4Z6AT 2N59A 5DLML 5B1KA 5I74C 4X6CA 3IS0X 2DWTA 3P4LA 3G08A 1S8DA 3GHPA 2ICES 4F7MA 2A9ML 1CDGA 3TT1H 3OB0H 2AVFA 2NPLX 3KAAA 4MCYB 5MI0B 4JM2D 5C07D 2ICWA 4FLQA 4UIMB 1WAAA 5JPNB 3MFGB 4N2DA 2J5LC 1BVNP 1U8QB 1UCBL 3BH9B 3HRPA 1WZAA 3I9AA 1OAZL 4XBMA 1AKPA 3I9IA 4KGLA 1AS6A 3BQUB 3BEWA 3ZZSA 3RFZA 1BQHG 2V2XB 4YDLB 3HS9A 4YNYB 4QRRA 3Q44A 4GIOA 5HGDB 1A2YA 2J6WA 4NWUL 3VFNA 1Z32X 2C9XA 2WSKA 4NUMA 1S5IL 2WWKO 4X80H 4RGNB 4UTAH 1QSED 4JPKL 2ZOTA 2O30A 3X11A 4FAAB 1O5DT 1FZJA 3IJ7A 5DCCA 2V6HA 5HHOB 3MBXL 2VH5L 5LGJB 5DC4B 1YNLL 2E0PA 3JWDH 3QWOB 5AALA 4ZXBA 1KYOK 3VB9A 2K45A 1KJ2B 4OLYH 4DGWC 3BRDA 1JNLL 1Q72L 5DZOA 3SKOA 4J1UA 3VRIA 3LZOA 4LL9A 3B3IA 1AR2A 4UOJA 4XNYL 3GJFK 3NABH 4BE6A 4A55A 3Q6FB 1KBWA 5KSAA 4WUUB 1XCQA 2WB1A 4H1LG 2Z8WC 3VVWA 1CFMA 4M6AA 3DYMA 3RWDB 3T2PA 1VEMA 3IFPA 3BLKA 4HKBB 1F5WA 5KSBA 1QBLH 6TAAA 3B7TA 2JK5B 1FWXA 3EYSH 4Q6YA 1NEZG 1O7DC 2MCPL 5FB8A 3JTSB 5D7JB 3ESPA 3GSQB 3AS0A 3VFGH 4K3EH 4ZD3H 3OKEB 1AIZA 1LDPH 3KS0J 4G2AA 5FR3A 2VLMD 1RHHA 5JW5B 1VADB 2WBKA 4DEUA 3UGEA 5EU3B 3H7BA 4FQXB 5DRXB 3VYNA 1U3HA 2CLRA 3VRLF 1SFHA 3FU5A 3UAJD 4XNUL 1WF5A 2V3DA 3UPAA 4X5XA 1DVFD 3W37A 4GG6F 2EUXA 1IEAB 1A6AB 2WSPA 3C5JB 3PWPD 1R5IB 5IG7B 1HIMH 3ILPB 4NNYA 1KCKA 2NXYD 5ICUA 4EN3A 2X89D 4GP8B 4QTHB 1HHGA 4LPTA 2NY1D 3L3DA 3QDMA 3T3PE 1CYXA 2YO3A 1I9JL 2HTKD 1SJXA 1J8KA 1CTNA 4TULH 4D0DA 4DVRH 2BLFA 5FYKH 3CE1A 5FK9A 2F5AL 1Z9SA 3FPYA 2FSDA 4PJ5B 2MKWA 1UA7A 1ACYL 2E59A 4MA7L 5TE4H 4UT7H 1YMMA 1U8PB 1N18A 5EU6B 4NOBA 1N5AB 1DBKH 2B2XH 3IJEB 1AC0A 3CBKB 5I0VA 5LKNA 2WLIA 5J6GB 3SPIA 1S7QA 2H6UA 4IMKA 5B22A 1V3JA 4PRNA 2ADJB 4XBEL 3O3BB 1KYAA 5JHLL 1D9KC 3T9WA 2FYYA 4B9YA 1AKJB 4KK6D 4HLEA 4ORGA 5BRQA 1LD9B 4V11A 5EIIB 2KBGA 4ODSL 2BERA 3EBAA 2C1PA 4JHBA 5AKRA 3O6KH 5ABDE 3DX6B 3BISA 5EIQA 4DF9A 5M95B 1S4IA 4AL8L 1H5BA 3O4OC 3WTUA 1GVIA 4K5PA 3C60B 2GITA 2UYLA 2YOAA 5F1KC 1H15A 5HGBB 5I17A 1XGYL 1JPSH 3QJFA 5D7LB 1S3KH 4AGLA 3NN8B 2VITB 1HDMA 3C2AL 2VZSA 4L4VA 2OSLB 4LLWA 3NDYE 1LO5A 5ESVB 2VKWA 5AUMB 1XR8B 3TZVD 3X3GL 4FG6C 5CEZD 4TUJB 3SKNA 4R26L 3FUHA 4MCZB 4MAUH 3SPVB 3V6ZA 1UM5H 4GJTB 2IDSA 1ZDQA 4ELMB 4OJFH 3I74A 1G94A 4LEOB 4TUUA 1ZXKA 2VXSL 4GRWE 4OIAA 5E2JA 3VI3E 1FYHB 1JGLL 3QJUB 2KQNA 3JQOB 3FJTA 1VFBB 2PO6D 4FQJL 4AYMC 3F58L 2WINB 2VDOH 1M7XA 3CCHA 3TBBA 3WKML 2DQUL 4PREA 4DJMA 4HMCA 4ZPVB 2IADA 1YAZA 4K5LA 5HYSG 3OQ3B 3WN5A 3KPPB 4ILDA 2Z7ZA 2HX8A 4JANB 1OAXH 3D1MC 1KB5B 4GKZA 4R2GC 3J7HA 3LV3A 2X44D 1CYGA 3SDAD 3L5WA 4ALAL 1TZGL 3ROOB 1WITA 4A7VA 4Z7OF 1FNGB 2OX5A 4MBOA 4JRXD 1S7SB 2J2ZB 2YD9A 3QJRB 4ETQA 5C08A 1SBSH 1IM3B 2AVGA 2LU7A 5EOQL 4K07A 3BD5A 4ZO7A 4D9QD 4G5ZL 3N85L 3W0WD 2GJ6D 2CO6A 2VDKH 4P59H 3HC3L 4JO8A 4MD5A 1KULA 1M71B 5IQ7L 2CKBL 4M3KB 5EZJA 3RFZC 3CZNA 4Y9FA 1MCWM 1ZHBA 3EZ8A 4G7VL 3C5ZA 9PCYA 3KS0H 2XJLA 2R23A 5SWZD 5GRJH 2VQ1B 3HB3C 1CR9L 4LU5H 1RSFA 3I9PA 4RRPM 5D1ZB 3SZKC 1LM8V 5AVQB 3Q05A 3GK8L 1HOCA 2OZNA 1QLEL 2NY6D 3RB5A 4MASA 4BZ2H 4ZMXA 3F65A 5E5LA 4QHUB 5FO9A 1MW3A 1B4TA 5GPRA 1XF5B 3FSAA 4U6VH 1XB3A 2KT6A 3QORA 1J9QA 4ZXBC 1Q38A 5IVXA 4EI5D 5CEYB 4F8NA 2ESVD 2Q9OA 1T66C 3MV8B 4HMDA 3MNDA 3RX7A 2A6DB 3OKDB 3KWVA 3GPSA 4CILA 4NZDA 4HJ1A 4Z7WA 4A63A 3IYLW 5D1QB 2ZUQB 3HCVA 3RIFK 1XMWA 5J1AB 5KSAC 1JRHI 2ZD0A 4NKMB 2V2TA 3N9GH 2WK2A 4PGDB 4E5XB 1WE5A 5KBLA 3OMIB 4OIIH 4E9SA 5HHPA 1UATA 3NJFA 4D0BA 3G7TA 4Z8FH 3ETTA 3OAYH 3W5NA 4OGYL 1QLFA 1QSFA 2IDTA 4P5TA 5E2VH 4RNRA 5F7MC 2Q7YB 4ODUA 5E9NA 1HH9A 2JIXB 4ZPVA 3DIFA 2HYMA 1JZJA 2CLVB 4GPVA 1AXTL 4OCYH 5F1NB 4BA8A 4PWJA 1JK8B 1SY6H 1NCBH 1QTPA 2ORBH 1BA9A 5C09D 5CEZL 4AH2A 1T1WA 1P4UA 3GQFA 4K7PH 4PS4L 4EI0A 1ILUA 1R5VA 3O8XB 1P5VA 2MH4A 1T2JA 2R9HD 5DRNA 2ZCKL 1HCVA 4P4KA 1XR9A 2CO7A 3FTYA 4XN2A 4LHQB 1HSAB 1X6LA 2P3YA 4EN3C 1I3VA 1T20A 4JDTH 3P3TA 4NZTL 3FQRB 4H25B 4G8IB 4LAQH 2YKLL 3QUZD 5ITBL 3U1SL 4D94A 4HHAB 1U8LA 4DP6X 3DSNB 3HUJA 3LTVA 4R5XA 2ZX6A 3AS1A 2AITA 3SGEI 4KJYB 1H8SA 5J06A 2F7OA 1HQ4B 1N10A 4PI2A 4EN2A 1QFUH 3SO3B 2DI8A 2NX5E 4BXVA 3OV6A 5AAPA 1H6FA 4IMKC 1F2XK 4FLRA 4LHUA 1GAFL 4XPTH 2Y7QB 1KIPA 4I5BB 4AKOA 1L7IL 4XPAH 2WAQA 3ZR5A 1NCDL 3QEHB 3UJIH 5D2LB 1T0MB 1JFQL 4BFRA 5D1XE 4BE5A 3U0WH 3T65B 3I3EA 4KFZC 1B4JH 2X28A 4FFWC 4ONFL 1JPST 5B4MC 3AG2B 4QOKA 4W6XB 1GTFA 3TNMB 2EQDA 1FVCA 3GJFB 4ZNEE 4Y4HD 4Z0XA 5HP5A 2RFXB 1D5RA 1FRGL 1B6UA 2X05A 1N6QH 4AW7A 1ZGLP 4MA8H 2R0ZH 2RTTA 5L2KA 5HHNA 4JPQA 1H5BC 2BJMH 2FVNA 5E2UH 3W9EA 3X17A 2YPKB 4UDUB 3WIAA 2RAMA 2EE9A 4LSUH 1R3KA 5HTSA 4HVBA 3AFLA 3EGDA 1TVHA 2ZP0T 1T0NB 5I6LA 2QBWA 1T5XB 4Y4FC 3KPQB 1QPKA 1MCIA 3F3HA 4MD0B 1A4BA 4ZW8A 4G6MH 4KTGA 3TCXA 2OXGB 3MGAA 4NO0D 1IGTB 4P5SA 2H3NB 5CSGA 4X7FC 1OD7A 4IRZH 4G6JH 3MRKA 1NL0H 3TEYA 3AWGA 3SQBB 4Y5VB 2FX9L 4JCMA 2XIIA 3RI5K 2J8UB 4Z7VB 1Q90A 2ENPA 1EJOL 3F62A 3K8LA 1UWGL 5KVFL 2K7PA 2GSMB 1M57B 3IKKA 4PWIA 1EVUA 3NIGF 4XMLH 4TKWA 4MXVF 3QI9D 2ZXGA 4MB4A 4UYPA 3UXFA 3V55A 2WYTA 5EPMB 3CHXA 3OJ2C 4XI5C 2FQGA 3LJ3A 1IKFL 2NW3B 4ANVA 4KKBD 3RTLA 4U6TA 1JGVH 1JTOA 2YAHA 3W38A 2V17L 1WZ1L 1EHAA 3HNSL 1MCRA 4JJOA 4Y1AA 3KPSE 3MO1B 4X2UA 4KTYA 5HDWA 3LKOA 4PR5B 3HFML 4M4PA 4UM8A 2XTJE 1E5BA 3CH1B 3T2NH 2MIZA 3WKNA 2CKBB 1Y6NR 2BVQB 1U8IA 2MNUA 2VUKA 2LU3A 3BUYA 4HK0A 1G9NL 1GL4B 1OL0A 3JV6B 4HWBL 2W5PA 2CPUA 1ZS8B 2BVYA 4HIXH 5EC1B 4J7RA 1ZHNB 3BUIA 2BY2A 5HJDA 2G9HB 4G8AC 4GXVH 1KBGH 1QLEB 2R1XA 5CS7A 3JVGA 3H9ZA 1YEEH 4CVWA 5EG6C 4UMGA 2OI9C 5G2NA 3OPZH 4F2ME 3BUQA 3ZYJA 3MBWB 1JNNL 2VQTA 3D8MA 3IJHA 3KLLA 3IGAB 4BRVA 1Y7VA 3H3KA 3HN8A 5E2TL 5IQOA 5A2JH 3TO2B 4OU3A 3C5ZC 3QIBA 3WJLA 1GKOA 4KDTA 3CFEB 1V7NH 4BFEA 4XN8A 3WKYA 4F57L 4ZZKA 3RDTD 1JZ4A 3QUXD 5B1BB 1AQKL 2HVKA 2O5YH 3E1ZA 3OHMB 2VM4A 4DPCX 4M7JH 2VDQL 3ULUC 3MLYL 1BOGB 3A6BL 2J1KA 3CVIL 3MLTA 4KJWC 3RKDC 3V8OA 3KXFA 3RUGF 5DYFA 3S5LG 1EHNA 2W94A 3CFMA 2GBUA 1UOVA 4TV3A 3QORC 4YDIH 12E8H 3LRLA 1AMYA 3BP7A 5AOIA 5KYYA 1L9QA 3QHZH 3TH3T 4XBPA 1FAIH 1XH3A 2WIIB 3VWKD 5B39G 3L5XL 4HZLA 1BX2A 2HFGH 2B3RA 1N5YL 4JN1L 3QNXB 1ET7A 1PLGH 2XIDA 3ES6B 2FDBP 2ZUTA 4RWYH 4B5EA 4G6AC 5JOFA 4NAQA 1SHXA 1XBDA 4X7DC 5LNEA 1KELH 4YC2C 3QE5A 3WIIL 4MMZA 4ZFFB 1Q1JH 3JV4B 3P02A 2QMJA 1MH5A 4JFHD 3H3PH 3MZGB 4P5TC 1NIAA 4X6EB 3H4HA 2XQYK 3IETB 5DQ9B 3N41B 4ZTPL 3REVA 4C59B 1LO3H 1IQDA 1R34A 2KPWA 5E6IA 3WKQA 5EEWA 3ZHNA 4KWUA 1I7RA 4P2AA 4PRPD 4S0HA 5HYQB 3BEVB 2DWEA 1TTUA 3S3CB 4NM4H 2N4IA 3KWWA 5ANHA 3U9PH 3TIDB 1E90A 4IIQB 4E41B 1WG3A 3UC0L 3N04A 1ICTA 2KLSA 2X70B 3BVUA 1OCOB 3ZT6A 1J7VR 5HHOE 2VN5A 5HJ3A 3LCYA 1K8DB 4KUCD 2OTWB 4P4KC 1KZYA 2QADD 2XI9A 1R3IH 4OZFB 3FN0H 5DDHA 1D2OA 3WSQH 4F7CA 4L3ED 3M07A 3IDIB 3I3BA 5JXED 5CP3H 2PXYD 3MBEC 3NH7H 5L4IA 3OAZH 1G4RA 4U05A 1AGFB 1QI5A 4Y1SA 1NKRA 2O26U 4JRWA 2X41A 1C12A 3MCLL 4KNUA 1CCZA 1Q9LB 2X2IA 4MXQD 3PQYD 4B9FA 3VXNA 3US0A 1TCMA 1CJYA 1NCAL 1P7KA 3CFDA 3DYPA 4M02A 2DZEA 1AGDB 3RL2B 5IBLD 5KS9A 3D25A 2R2CA 1RULL 2EDOA 4Y2DD 5DJYA 4KHXH 1IBHA 3GNMH 3VI3A 4JX0A 2CA3A 4XMUA 3V4VL 1M1XA 3BN3B 1L0XA 2XV6B 5EWIL 3T6VA 2GSGB 4PRDA 4XP5L 1F6AB 2A3TA 4PJDB 4QRSA 4YGAB 2PPAA 4UV7L 1L5GB 3HJ0A 3FO2B 4WU7A 2VAJA 2WJ7A 2NY5L 2XWBA 3LKRB 4P4RB 4PVBA 3CZEA 4N90D 1J0HA 1Q94B 1MHEA 1CLOH 1PVHA 3SCMA 1KBKA 2BP8A 4RAVB 3IU3B 3BFOA 4QHMB 4YBQC 2HKHH 5E8DL 2G2NA 4PJ5E 1CD9B 3M7OA 3GLEA 4FFYL 1KMGA 2NUTB 4R90H 5E99H 4BKTC 2UZIH 1A1NB 5EU6E 1AXIB 1UXWB 4PJ7B 4X6CF 3RX9A 3UAEA 4E9TA 4IIZA 4Z9KB 5CJ8A 2F53B 1MEXL 4EEEA 4HH8A 3CFIC 3MLUH 1S9VA 3VXTA 1WBYB 3CDFA 5ADPH 5F3HB 4U2ZA 1TJIH 3HVNA 2Z91A 4R7LA 1RZ7H 3B9AA 4RISH 3TBYA 3D87B 4JDVA 3L6FB 4X9BA 2Z1KA 3CLFH 1FC1A 1EIBA 4YHPB 1N8ZA 1QRND 2HX9A 1FP5A 4IS6A 4TRPL 1HI6B 3HE7B 1I1YB 2CUIA 4Y4KD 4H2AA 3AY4A 4EI6B 2NXZC 1YAIA 5F6IB 1NGPL 4FJZA 5F44A 2XETA 3BSZL 5E8OA 2BXYA 3U36A 4ZFQA 1X9LA 3D51A 4TTDC 4AYID 2F1AA 5D7LE 4I0KA 2VR3A 2YAQA 5T3ZL 5MHSE 3DIVA 4BZYA 3MRQA 3QCVH 2B14A 3BPLC 5EA0H 3B4NA 2AW2A 2G75B 3CHOA 3I6GA 2WLYA 3L3HA 5JW3L 3E8VA 3JVGC 1ZIAA 1NGXA 4M6NL 3N5AA 5FA3B 1A02N 1ZV9A 1LEIA 3KL3A 2VDQB 3DMMA 4J12A 3S35L 4JHUA 4WFFD 1AQDB 5AL0A 4FGMA 4ELME 2XFXB 5HYJD 1OTUC 1X7SA 3QUYD 1IBZA 4WEEA 5CLXA 1G7MB 1GGIL 3QIBC 3WJLC 3ZMNA 4KDTC 3MODL 2KDYA 3PJLA 5CZKA 2H26A 3WTSA 2H4EA 4EIUA 3L2LA 4KKAC 5KSBF 5CWSB 3W11C 1UEMA 2V9RA 2K6WA 2XPZA 3ABZA 1ZLEA 1OQOA 3MXVL 1HXMA 2QHLA 4JAMB 1AGCB 1RUQL 4OQ1A 1U6AH 3EJYD 3L3KA 3ZKQD 3CFJB 2N7BA 2YBRB 4M03A 2WWMD 3R8BB 5HVHC 4YOKA 4HGKC 5EZIH 3OHXB 1GZPA 2QFPA 3FZUD 4FXGA 1GOHA 2YA1A 4KO6A 4TVPL 3S8GB 2PYEB 3BKYH 1ODAA 4NKIH 4XC3H 3V0VA 5I8KH 5GZOA 4WSJA 3VQ2C 3SDCD 4KH2A 4A6YB 3F64A 4FYTA 4JFOA 1NCWL 1ZWIB 4UQ3B 4LCCA 3B43A 4MMZC 2YAOA 4XNXH 2VJ8A 2WCPA 5IFJB 2A74A 1QBMH 2Z4TA 3TYGH 3VVVA 4MA3A 3W2DH 1GGUA 2N7AA 1CLVA 1FNEB 3TN0D 1RL1A 4EUPG 2B16A 5E6IC 3ML8A 4CL7A 1A64A 1C5DB 1QEWA 3ZDZB 1UD2A 1IFGA 1HHHA 3EO0A 3TT3H 3A4DA 5DHDA 1DANT 5DUML 4KROD 4PIBA 2AQ3A 3F7YA 5MEOA 1HJBC 5DZAA 1B2YA 3DHJA 1ZV5A 4F20A 1TCRB 2Y36H 4G6KL 1D5IL 1ZCRA 2AJVH 1IAIL 3K81A 3MAWA 4NUQA 2OSWA 1E6JL 2XG5A 3IWVA 1J8HD 3RILA 4P46A 3T4AB 5F72S 3MV8E 3S2CA 1JGDA 3L7FA 1GMEA 2VLKB 3C6SB 2CD0A 5ISZB 4WHTA 2GK2A 3S4SG 5TDNA 5D1QE 3NCCB 2A6JB 3MLXH 4CRPA 3BLPX 4QYAA 1TZIA 3LZPA 4HPYL 1I7UB 4PJ8B 5FKPB 6FABL 2A83B 1BHGA 2WO4A 4JVWA 4FULA 2EIBA 2K4WA 4MMYB 1OANA 5TPWH 1VPOH 4LGRB 1I8MB 5FHAL 3JV5A 4J6IA 2YRLA 4HKJA 4E9XA 4DP8X 4WNQA 3DSFH 5HVWA 1L0PA 3VG0H 5C9KA 4FNLH 3KYOA 1MCHA 4HS6A 1L3WA 5F6HI 3OTTA 3O6FB 3CDZB 3KCPB 3WIFA 2X4SA 3BJ91 2W0KA 3D48R 3V0IA 1U2HA 4N8CH 4XN5A 2H1XA 3KPSA 2ZIDA 3H53A 4JR9H 5F88A 2QVTA 4QRUB 1MHCB 5FGCB 2EP6A 1OGTA 1KDJA 3CXHJ 1P4IL 3AVEA 3WD5H 4NQQA 3LEVL 1ASOA 2A4CA 1JP5A 1RLWA 3D3VB 4O2CA 3APFA 2DQCL 5BVJB 2W65B 1XGUA 3CZSA 4WK0B 3WOVA 1JZ8A 3IU4H 3KBEA 2W59A 3OZKA 4JFED 3T1FB 5A7EA 4MDIB 1OCZB 3GTNA 4V2BA 3HIZA 1NOAA 2Y5QA 5AEAA 2BY3A 3AT0A 4R97C 1MJ8H 4UU9A 5D96B 5I1DA 4E0RA 4EIBA 3ZGIA 4QYOB 2HPTA 4WDIA 4E9VA 3VQLA 4MRBA 2ZUXA 3KYKL 4FQ1H 3ARFB 5DMYA 1VA9A 2OCFD 3B9KB 4M1CC 3QGVA 4HJ0D 2VSMB 4YXKL 5CBAB 5IJCC 2GYSA 1OE1A 2N1KA 1CDUA 1FVEB 2FQEA 4JO4L 4OM0L 1MQKL 2VDPH 4PSPA 5D8JH 4FABH 1LK3H 2DQDL 3UG4A 4P5MB 3BVNA 5B3JE 2GK0A 2C9PA 3QUMH 1N59A 2WQRA 5CILH 1NKOA 3FAWA 5EOTA 5FUOL 1A8ZA 2OULB 3N1QC 5HHVH 4MNHB 5I6NA 4Q0XH 5F7DA 1TJMA 4JE4B 3RWGB 4WEBL 4N2KA 1OHZA 5GS1B 3ARWA 1WQVT 3ISYA 3AY4C 3MRLB 3SYPA 3PGFL 3TNNB 2CMRH 2W9EL 5I28A 5BV7H 3ORJA 4I2XB 2WBWB 3EFDH 2JELH 1M2VA 1YYLL 3K6FA 3PFUA 2FB4H 3BGMB 4HJJL 4M9OA 4WZ9A 1NDGB 4MCYA 4YSRA 4F15C 5KJRL 2WWKT 3PHOB 4N2NA 4UIMA 4AVKA 4X9YA 5JPNA 3K6SB 3Q8AA 1U8QA 5CJOL 2FNWA 4H8UA 3BH9A 4RGOL 3LZFL 1F4HA 3U2IA 1MI5E 3MV9B 4XVJL 5FC9A 4JKWA 4AEHH 3STBA 1PX4A 4AQAB 2J8UE 3BQUA 5I2IB 3DMMC 2QSCH 3MA7B 1W0YT 2V2XA 5IIEB 3WKPA 4XMWA 1R17A 2RB8A 4L29B 1CBJA 4YNYA 1XTMA 2HT2D 1YJDL 2F54B 3QSKB 4Z7WF 2A1WL 3ZHFA 2EH7H 1FG9C 2ZXQA 1SHMA 4Z7NF 1DVYA 4W6YB 1G7IB 5HDLA 1X9RA 3PPEA 1JGEB 1KTCA 3DO7B 1MREL 5HHOA 1SOQA 1PEWA 4M5ZL 1XF4B 4QNPF 3JVFC 4N87A 5DS1A 3ZKMD 5LGJA 3QWOA 3RPKA 4YHLL 1BZ7B 3MR9B 4CDGC 1OSPH 1P7QD 1KJ2A 4Y8AA 3AT9A 4L1SA 2P5WE 5BUAA 5C7ZA 4MKMA 1HINL 1XF1A 3NCWA 1AP2B 4FXGC 2YD7A 3FB6B 3PNRB 1BQLL 2ITFA 2IDUA 4KJPC 5DU7A 1CBVH 3P3SA 1AQ8A 5DI8B 3Q6FA 3KPNB 4NFBA 4WUUA 1J9CT 2O61B 3DPDA 4Z7AA 4TQHA 3RWDA 1QUPA 4HKBA 2FH8A 3GRWL 5F93C 2IV9A 5GZOC 3QXUA 2JK5A 2DMKA 1EEZB 1WFIA 3IT8D 4XGZB 4OJCA 3JTSA 3P30L 5D7JA 4LCCC 3ME0B 3RGBA 2FBJH 3GSQA 4IJ3B 2D7MA 3OKEA 2A74C 4HOWA 4X8CA 2D9CA 2B1AL 5GXBB 2C1OB 4FQCL 2EDJA 3HUJF 5JW5A 4FNUA 1VADA 4OZGF 5EU3A 5GRYA 4FQXA 5DRXA 4BKLB 2YKKA 5D1XC 3R06B 3SDXB 2AI0H 1DQMH 4PQXA 5JIHA 3IFNH 4F37K 5L88L 3P4MB 3I85A 1MHPL 3ECWA 4P5KB 4K8RL 3GSUB 5KWYC 1IEAA 2W38A 4P2OB 1A6AA 1N67A 3C5JA 5AENA 4LFHG 1MCOH 1R5IA 2E5EA 1JWUB 2PMZA 3ILPA 5E4AA 4U1LB 2YD8A 4HG4K 4XMPH 4QTHA 3TV8A 1ZHLB 2YZ1A 1T04B 2A4EA 2BZ7A 1DJXA 4NCC2 3O3AA 5J11B 3W9DB 4BD4A 1UT1A 2GJZB 2OJEB 4ABUA 1MFDH 4PJ5A 3B9EA 5DFVC 1O6SB 3BPCB 1WFMA 3BXNB 3RVWC 3LNEA 1RVFH 1KJ3H 5EU6A 2EDEA 2MSPA 3CZFB 2JFCA 4JFWA 1N5AA 3IJEA 4L8DB 1UGKA 25C8L 1L7TL 1VZIA 4XCCH 5J6GA 2F8IA 4JW3A 1MCPH 2ICCA 4DWHA 4U1KB 2ADJA 3O3BA 5D1ZI 4U49A 4IJTA 4XVTH 3BD3A 1BZEA 2ZKMX 1AKJA 4OUUB 1H8NA 3FUIA 3F6IA 3QNYB 1LD9A 3V7MA 2KMWA 5EIIA 3SKMB 1ADQH 2G3XA 1JNJA 1T1YB 1NLBL 3HG2A 4E41E 1YEJH 4OZHE 3DX6A 2G4GA 3INOA 2GABA 2G3MA 3IBEA 4KU1A 4NKDB 2XTJC 3C60A 3UG5A 1GRWA 1U91A 5HGBA 1F1GA 5D7LA 2X7LB 1JXGA 4C55A 2Q76B 1S7WB 2WXGA 2VITA 4TSCH 2OSLA 1G5GA 1CT8B 1A8JH 5DD6B 4CADB 3MLVH 5AUMA 3QQ3B 1XR8A 4FZEL 2ZYSA 2LVEA 2IBZX 1A7QL 3NA9H 4TUJA 4URTB 5T3XL 1ULVA 2PPEA 1IGYB 4MCZA 3SPVA 4CNIB 1EFXB 4AY0A 1H9DA 4YDJB 3K4DA 4ELMA 4GAJL 3LYRA 4LEOA 3T0EA 3CDCA 3AM8C 2DDQH 1EERB 4LRNL 5DQDH 2WXKA 4JG1H 1BVNT 5FPIA 4XP4H 3X14A 4G6FD 1P6FA 1Z0NA 1VFBA 4FFZL 5F7LB 2WINA 1I1FB 4WI6A 4PI0A 1CGTA 1PX3A 4WGKA 4YLCA 7PAZA 1A6UL 1CGSH 2DEXX 2FQDA 2GT9B 2HG5B 2NY4C 4TOYL 5JHMA 4WO4C 4PJDE 1JHTB 4PVNA 5IIEA 1LO0L 1NIBA 5ESAB 3KPPA 3KJ6H 2LU4A 2WUBL 2XKSA 2H1PL 4JANA 1JF6A 4W9IC 1KB5A 3T0AA 1BAFH 5KVFE 1RUAH 3F7VB 3G6AB 1MIML 3ROOA 1TTAA 1FNGA 3BH8B 5MI0C 1S7SA 2J2ZA 2QT6A 2Q0ZX 2FH6A 2D7QA 1IM3A 2EDHA 4G1MB 5EO9B 3SYOA 1ZTXH 5JPNC 4OCSL 3OKLA 3ZQXA 3BCDA 3VH8G 3DVGB 3D4ZA 4UCFA 4AT6B 3KBHE 2L0DA 1E3XA 5K59E 1JVOA 2ATPB 4PJ7E 3BQUC 4GO6B 5C0JB 1OF0A 1S78C 4AQZA 3Q3GB 5JUEH 2D0FA 4YDLC 4NHCH 2QV2A 2O5ZL 1FORL 2YD2A 1EDYA 2F0CA 3ROLB 2VQ1A 5E9DB 1LL1A 5D1ZA 3LZQA 1E4HA 4Z95L 4QTIH 4RGNC 1YDPB 4GXFA 4DKFL 4PJHB 4G3YL 2QDWA 4NERA 2V5YA 4NC0B 4EKXA 5C2BH 3GEFA 1TFHA 4UZSA 4APXB 4QHUA 5L8LB 3GMPA 3DTUB 3SE8L 4OGAC 3FN9A 1CU4L 3N6YA 1F0LA 5K5YA 4OB5H 5DO8A 4P2QD 2X87A 4YHYC 4CJ1A 3UFIA 5AVYB 5CEYA 1YPZE 2Y5TB 3WN6A 4DTGL 5CD5D 1TQCB 3PWJB 4FI6A 4NQCD 4JHZA 3MV8A 1A6ZB 1M7IB 5C1MB 2A6DA 3OKDA 5M7QA 2WCGA 4PBDA 3JWOL 5D1QA 5J1AA 4XWGL 1SDYA 4NKMA 1PY9A 3PWLB 4OSUH 4PGDA 3TVMB 4E5XA 5CGBA 3BKCL 1VGEL 1AY1H 1KT2B 4Z3TA 2DQFB 4FX5A 5BOPA 4NYLB 4TPRH 2DLFH 3IPEA 5D7JC 3E0GA 2Q7YA 4GAAA 3RA7H 3DRQB 2BDNL 3D05A 1NMAH 4MJ2A 1CL7H 2JIXA 3NPZB 3SD5A 3HG3A 4ZW5A 5AZ2H 3MV7D 2CLVA 4GRLB 4H20L 4PRHA 5GGQH 3CFCL 4NIKB 1PY4A 2HUHA 2E8ZA 1JK8A 2YJLA 3OF6D 1WWWX 2R39A 2LAAA 3PDGA 4FQXC 5K1VA 2CUAA 4GUPB 1CVRA 4OGXH 2ZKHH 4NHUB 4LCUB 5KS9F 2OJZH 3RAJH 1HJCA 3O6LH 1F3RB 1DVUA 1OCWL 3NVQA 3O8XA 3QEGL 4GRWF 4ZZFA 3AT8A 2B9BA 4OGQC 2BINA 1TMCB 4ERSH 1HSAA 2F2HA 4RLDA 5KAQF 3RZCD 1ZSDB 3LZLA 3FQRA 3HHMA 4CKQA 4H25A 3GZKA 4G8IA 5JHLA 1AZCA 3NP4A 3NPSB 5GS0H 4AZ8B 4HHAA 1WH0A 3DSNA 4U6HB 2A77L 3FSZA 2PYEE 3GXIA 3W39B 2Z93B 5CKGA 5F1IB 5I19L 4ZUTB 4JDZB 1OOAA 2HJLB 1KC5H 2VDLH 1KG0B 3IJ8A 4JM4H 1HQ4A 3SKUD 2FGWH 4A2HA 1BAWA 4BWWA 4ZS7L 2X0VA 3FC8A 3VXMD 4GT7A 4I5BA 3HAEB 1NSNH 2EE3A 3NFNB 2FHFA 3U4AA 2AQ2A 2Q3XA 4LSPH 3SOBL 5D2LA 1T0MA 1IT9H 1OM3L 5K33A 4WGVB 1CQYA 2QQQA 5IBTL 5INDA 3RWJB 5I8OL 3T65A 2E46A 2AEWA 1T7VA 1RZKL 3ZKXB 3U83A 1PZAA 3K4ZA 3RWIB 3ZDZE 3TNMA 1E4XH 5IFAL 3GJFA 1DVZA 2RFXA 3DI3B 2JF1A 4HOMA 4Z0BH 4PB9L 2YPKA 4UDUA 1NAML 4I1NB 1PG7L 4QLRA 3C60C 2Z8SA 3WMQA 3GC3A 3GFUA 4JFPB 3MOBL 1UH4A 1UA6L 1T0NA 2E9IA 2R29L 4R4NC 3VJ6B 1T5XA 3KPQA 3ECBB 4R7XA 4MD0A 4HX1B 2OXGA 5JOEA 4OF5A 1IGTA 3UC2A 2H3NA 1MKFA 2VLKE 5ISZE 1RURL 1T7YA 2HRPH 2YXFA 2OL3L 2VSKB 1GC1L 2E7DA 4M3HA 3HLKA 4Y5VA 1NPNA 2J8UA 4Z7VA 1KYDA 2Y6TE 4F58L 4IHOB 2R15A 5E51A 3CPLB 2APFA 3JWDC 3TL5A 3QAZB 4ZMLA 5TH2B 3L9YA 2ENSA 4ZUWB 4XX1E 3Q1EA 4HCIA 1A9BB 3EBHA 1TYRA 2NY0D 5EPMA 1JCKA 4OLVH 4K7PX 3QYNA 4Y9EA 2PP8A 3X1EA 2NW3A 3WNOA 4AUYA 4ZMAT 5ID0B 1IKNA 2WXLA 4QY8B 5IV2B 4A7GA 1RLBA 3BW9B 1H19A 3MO1A 2IPTL 4ATWA 5IGXL 1CB4A 5FGCE 2F7QA 3NTCL 1ILSA 4FQHB 4PR5A 1BG9A 2F9BT 5EV7A 5A16B 5MENE 3CH1A 1C8QA 3GHBL 2CKBA 2R0WL 5CFHA 2BVQA 4AQEB 3HHRB 3V0HA 1IB5A 3JV6A 2JMRA 1ZS8A 3DURB 1PEZA 3D3VE 1WAEA 4YBHA 2P5ED 4PTTB 5CN1A 1ZHNA 2YOCA 2G9HA 3A4EA 4GB9A 1VHPA 1KGWA 4DKEL 5BJTB 3QDJD 2WXFA 2QVIA 3CVHH 1BF2A 4NQEB 1MDAA 3MBWA 4ADGA 2VDRH 3IGAA 3QIWD 3V52L 1TVBB 2BIQA 1MFCL 2O5XL 2R4SL 3TO2A 5SX5K 4KVNH 2DIBA 3CFEA 3UERA 3LMJL 1Z6JT 1JI2A 4CU6A 5E23A 3TCLB 4ZMYA 5JHBA 5D1ZC 1QAWA 3GSVB 2CH8A 4JQIH 3IMUA 1W9XA 2WZ5A 4LCVA 5GRVK 5KOMC 1YNLH 1OGAE 1HQRB 1BOGA 1AZUA 4IBUA 1BXAA 2KYIA 1F4XH 1Q72H 5DJ2B 1ZGLB 4N1EA 3QFJD 1CICB 4RAHA 1QHQA 5BUPA 2NNCA 4KX8A 4XNYH 1SJMA 4I2XE 4QGYA 2WIIA 3ATFA 3O2DL 1N2RB 4MZIA 1HNYA 3N55A 3KYMB 2AZAA 5D1QC 3PGCB 2ZUQC 4M6ML 3RVTD 1FNSL 3ES6A 5KVEL 1EQWA 1KUMA 4ODVH 5FYLL 4ELDA 1YNTB 4ZFFA 5KEZA 3KPTA 1DQKA 3JV4A 3SPGA 4LSQH 3BVXA 3K80A 2ZXEB 5HDBF 4X6EA 5I1LA 4G8GB 4OCRL 3IETA 4AG4L 5DQ9A 2BVEA 3N50A 5F8QC 4DPAX 4L4TD 3WFEL 1J1XL 2F54E 5HYQA 3BEVA 4O5LH 2FCBA 3II2A 4TVPE 3UTSE 4MAYD 4I88A 3TIDA 2COQA 3JV0A 4XR8C 5D7HA 3OGCB 2PUQT 3DTDA 4IIQA 4DQAA 1KTKE 4E41A 5JXAL 3QP3A 4JB9H 1BLNA 2ZWKA 4LGSB 3ZTCC 1IILE 4KK8D 3WXWL 3GS4A 2X70A 1WAPA 4HWEL 4NSKA 2XKUA 4JKMA 3O8XC 1K8DA 5BQDA 3JWNE 4I48B 2G0LA 4P2RE 2OTWA 5CZXC 3EOTL 3IB4A 4OZFA 4LP4A 3IDIA 3IN2A 4WHYH 1YEHL 2XJKA 3P11L 4HUNB 1GPOL 4P9ML 2F5AH 2K70A 4IYKA 1ZLWK 4R0LB 3X13B 3LNIA 3BDYL 2FO8A 4OFIA 1K72A 1Q9LA 4KRPB 5D6DC 3VFSB 1E28B 3RIKA 1HEJC 1W72H 2J6EH 3C8HA 3DGCR 3AC0A 3US1A 1XXDC 3RL2A 1AGDA 4IDJH 2VMDA 3SO3C 2EXYC 3LXUX 5IKCB 3JYBA 5CIPB 5JQHC 3OM3B 1EXGA 3TP4A 2NY3D 3S3PA 1U9KA 2GVYA 4HH9B 1DZ0A 1PZ5B 4JDEB 2NLJB 2XFGB 3L5HA 1LMIA 4XMKL 1B0GB 3ARGD 1A4AA 4KITB 2GSGA 2LFEA 2ED8A 3SDXE 1F6AA 1R3JB 1BD2D 3UTOA 3FB5B 2EIJB 1EDHA 2OL3B 5GRZA 3T71A 3WI9A 3ZDXB 2WJ5A 1L5GA 1TPXB 5A2CA 4WK4B 1JPEA 2AKRA 2VDRB 3FO2A 1T03H 2YPLD 4UTBA 4P4RA 3O4LB 3LKRA 3OMAB 4PGZA 1RZPA 5GRVL 1ZVSB 1DFXA 3S36L 3VXUB 3HFFA 4BZ1H 4NRYB 5AKVA 1XGYH 3EGXB 3ZL2A 5I1KL 1J1OL 3MRBA 2HKFL 3MUHL 1I1RA 3C2AH 4PCTA 3BIKA 3AABA 4RAVA 4JRYD 3IU3A 2ZUUA 4O58H 4QPEA 4QHMA 2ZNWA 2BRQA 2BXZA 2EC8A 2QMKA 5IW6B 2JTDA 2EUWA 5AAMC 3WTTA 5ITFB 2NUTA 1HSBB 4R26H 1NBYB 4ENED 4PLKC 1W16A 1NIFA 1A1NA 2Z7UA 2FYVA 3AZUA 1UXWA 1BQHB 2G60L 3KYAA 4GQ9L 4PJ7A 4HWUA 4Y5VC 4CN6A 4XPGL 5E8NB 2F53A 3S8FB 2DW5A 4DN3L 3M46A 3PL6B 1WBYA 1QBBA 4DERA 5F3HA 5L4FA 3DWTA 4HWBA 3CD4A 4K71B 3QYCA 1JZ3A 4FQJH 1OPGH 1WS8A 3P0VL 1HHKB 3B83A 3F58H 2B77A 1YNKL 4ALAC 2BSCA 3WKMH 4ZX3A 3GMRB 4YX2H 2WYIA 5DUPH 3OZ9H 1IKNC 4YHPA 4H0GA 2VL4A 3M1OA 3HG1D 4CGUB 1HI6A 3HE7A 2Z35B 1I1YA 4PJEB 3TGXA 2WW8A 1IGML 4EI6A 2WXNA 4OR1A 2M83A 5C0DA 4HQQH 4CSPA 4Z7UF 4M7KL 2ZOUA 3EOAB 1ZVHA 1CFQB 1OTTD 1YYMH 5IB4B 2C4FU 3WNMA 4YO0B 3R19A 3WIHL 2IQAB 2Z0UA 4H8WL 3K46A 4IKNA 1BZ9B 4MNQB 5CJXC 4HAGA 3QQ4B 4G5ZH 2B1HL 2G75A 5I1AB 2XVLA 3PCYA 4JFYB 5FA3A 4X6DA 2VQ4A 2QGCA 2GIXA 5IQ7H 2IV8A 3D9AL 1AQDA 2A6KB 5FHBH 3DGGB 4UIKH 2HT4C 4HIEB 4GAGH 1SQMA 2R56L 4UZGA 3BYYA 1YEIH 3EJZD 3PUCA 1PX8A 4JHAH 1VFMA 4YHOH 1FGVL 3IDUA 2VXTL 4WI4A 2C34A 4K3JL 4OFVA 5B8CC 2FX7H 2HTLC 3VWJB 5LQBL 5ALCL 5CWSA 2DKSA 2VR7A 2EYRB 4XXDB 3Q8CA 4JG0L 4WSKA 2NR6D 4OKVB 4JAMA 1AGCA 1Z1WA 4B60A 5E8PB 3MTXA 3CFJA 2YBRA 5JR1H 3OHXA 3W81A 4DN4L 1SLVA 3MOQA 3SBPA 3G6DL 3UGXA 1KXVA 4WUKH 4B0MM 1NBCA 1LWJA 1O9WA 3TS8A 1RIHL 2OZ4H 2PYEA 2B4CL 4OT1L 1YEKH 1A4JB 5GGRB 2XZZA 3U1QA 5A2KH 2WLLB 2XWRA 5I18L 4BRJA 5IHHA 1D6VH 1NJ9A 3F84A 2XA8L 5L4JA 5I71B 1JPFB 1NCIA 3GTVA 1KLUB 3ILQD 1SOXA 4A6YA 1ZWIA 3FU6A 4UQ3A 1KTRL 3AQZA 5BZZA 4OH2A 5IFJA 2YUWA 2DTSA 1MUJB 1QZNA 2VZVA 1EEYB 5EHFA 1FNEA 3VXPB 1JGIA 2L04A 2RALA 4KKRA 4JKKA 4PU2A 4MD4B 5E9DE 3V9CA 1JWMB 2YN3A 5HDQL 4BBWA 1NGQH 5CEZH 4IIQC 1EGJH 2F61A 2Y06L 4APQB 3IDGB 2ZCKH 3U46B 1YEGL 3C09B 3TJEL 1MWOA 1G7JB 3KPRB 4DW2H 1UOWA 1TCRA 3QPQD 5HYEA 2JE8A 4Y7OC 3ZE2B 3C6LD 1AXSB 1J48A 4HFUH 3ZT7A 4WWKB 3MMEB 4M62H 1UT2A 4FFTA 4RDQF 3T4AA 4ZPTB 3I02B 5C3LD 4X4ME 2VLKA 3C6SA 5ISZA 2CIKB 1R9FA 1G0YR 2A6JA 1MHHB 4TSBH 2X4TB 4N5ED 1I7UA 5BS0B 3VFOB 4PJ8A 5FKPA 5FM4A 2A83A 3HE6D 4KJQD 7PCYA 2QKSA 3AU0A 1I8MA 1TQSA 4FOMA 5KVGL 1D6EB 1THAA 3MUGB 1HL5A 1JFQH 4JZNB 1KOAA 4U31A 3L4YA 5K9JL 1ONQB 3BUTA 5MERB 3DRTB 3N06B 4ONFH 2EIKB 5JA9A 3BN9D 4ZQTA 3O6FA 3CDZA 3KCPA 3PWPB 3X2QB 2Z31D 3LEXB 3VD1A 3N3EA 3H42L 4FFYA 1FRGH 2VZUA 4YLBA 3FTXA 2XG4B 4QRUA 1MHCA 1BFSA 1JN6B 2AJUL 1LK2B 1XZ0A 4BJLA 1CFNB 2YPVH 1NBQA 2EDMA 4MCMA 1DCEA 3ZN6A 5JDJA 1TG8A 3BWAB 3C8KB 4QHKJ 2DWYA 1VZGA 3D3VA 3JTBA 5BVJA 4AVHA 2XXCB 2W65A 5K39B 3IVKA 2XQYA 2XX1A 3T1FA 4MDIA 2HFEA 4ANKA 3RWHB 1JVKA 3JXAA 4DGIL 1F11B 4OAWB 5ICZB 2D3JA