3T6ZA

Crystal structure of steccherinum ochraceum laccase obtained by multi-crystals composite data collection technique (60% dose)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
495
structure length
495
Chain Sequence
b'VQIGPVTDLHIVNADIVPDGFVRPAVNAGGTFPGPVIAGNVGDNFQIVTFNQLIECSMLVDTSIHWHGEFQKGTNWADGPAFITQCPIIVGNSFSYNFNVPGMAGTYWYHSHLTTQYCDGLRGPFVVYDPNDPDANLYDVDDDTTIITLADWYHVLAKEMGAGGAITADSTLIDGLGRTHVNVAAVPLSVITVEVGKRYRMRLVSISCDPNYDFSIDGHDMTIIETDGVDSQELTVDEIQIFAAQRYSFVLNANQPVGNYWIRANPNSGGEGFDGGINSAILRYDGATTADPVTVASTVHTKCLIETDLHPLSRNGVPGNPHQGGADCNLNLSLGFACGNFVINGVSFTPPTVPVLLQICSGANTAADLLPSGSVISLPSNSTIEIALPAGAAGGPHPFHLHGHDFAVSESASNSTSNYDDPIWRDVVSIGGVGDNVTIRFCTDNPGPWFLHCHIDWHLDAGFAIVFAEDIPNTASANPVPEAWSNLCPSYDSAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase
publication title Reaction intermediates and redox state changes in a blue laccase from Steccherinum ochraceum observed by crystallographic high/low X-ray dose experiments.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 135
structure length 495
sequence length 495
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6zA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6zA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6zA03
3OM3B 3OD3A 1OCCB 2GSMB 2QDVA 2IH9A 4DP1X 2DYSB 3ABKB 1AG0A 3WIAA 2I85A 2FJSA 2UXGA 3V9EA 1J5CA 4A2DA 2XU9A 4KOCA 2B08A 4AKPA 2XV2A 2RACA 2GIMA 1X9RA 1NICA 4AZUA 1OE2A 2FQFA 1PLBA 2PP8A 2PPAA 3X1NA 2YQBA 2EILB 3NJKA 2OJ1A 5ANHA 2YAPA 3KW7A 3PAUA 4G72B 2Y69B 1M9WA 3TBCA 5B7MA 3FSWA 4W1TA 1JOIA 1OCZB 2XV0A 4CSPA 3UADA 4PCYA 1NPNA 1M56B 2QDWA 3FPYA 1A65A 3QJQB 1QHQA 3QJVB 1FFTB 1KDIA 1JZJA 1SHXA 5I6LA 2CALA 2YAHA 4BWUA 1JVLA 2XXFA 2IWEA 3PCYA 4YSSA 4UF7C 4YSUA 1V10A 1W6WA 1NPJA 2BZCA 1DYZA 2BW5A 3FQYA 3SBRA 1FWXA 3ABGA 1NINA 3EH4B 4YVNA 1PZBA 3PAZA 5TK2A 3PLYA 3QQXA 3IN0A 2HRGA 3X1GA 4FA7B 4E9QA 2UX7A 2PCYA 3TA4D 2FTAA 8PAZA 1GY1A 3FSVA 3JT2A 1JERA 5AKRA 2XX0A 4KO9A 2FQDA 2VN3A 4RH4A 2DWSA 3FPXA 3TBBA 3L45A 4E9RA 2FNWA 1AS7A 4G70B 3KW8A 1NDTA 4G7SB 2UXFA 1AZNA 5I6MA 1GS6X 2FQGA 1ZV2A 4YSPA 4BWWA 1AG6A 2VSMB 1HAUA 2XYBA 4F2EA 1J9RA 1A4BA 1BQKA 4MFHA 1TKWA 2EINB 1JZGA 3N2JA 1PLAA 2DYRB 4HHGA 1L9PA 3AW5A 4A2EA 1T5KA 1A3ZA 1YLBB 1M57B 3EH3B 1AZRA 3QJUB 1F56A 4YSDA 1ASOA 3FU7B 5I5IA 7PAZA 2UXTA 1BQ5A 1RCYA 1CUOA 2UX6A 1L9OA 2GBAA 2J57A 4HZ1A 4GYBA 3NP4A 2HX7A 4KNTA 3G5WA 2VW7A 3AG1B 2CUAA 2YAEA 6PAZA 3CG8A 1KV7A 1TU2A 2WO3B 1ZDSA 1AIZA 1NIFA 5AZUA 3ZX1A 3NT0A 1XB8A 1GYCA 2AZAA 4GP8B 1AR1B 2P80A 4AX3A 1AACA 1MDAA 1GR7A 2VW4A 2BP8B 1SHWA 1BXUA 3T6ZA 2VM3A 4GP4B 3PPSA 5FC9A 5B1BB 2GB2A 2OCCB 3TU6A 3S3DB 3WNJA 2H3XC 3JTBA 1OCOB 2W8CA 4BDVA 2Y1AA 1BXAA 3OMIB 1X9UA 2R7EB 3FSZA 3UGEA 3NSYA 3WG7B 3GYRA 5F7BA 9PCYA 1J9SA 1ILUA 3ABLB 1CC3A 2YAQA 2BW4A 4YSEA 3FU7A 4HALA 3T6VA 3EHBB 2J56A 1E30A 2ZXWB 3CZUB 1ASQA 3H4FA 4GY4A 2YAMA 2YXVA 4AI7A 3H4HA 2VMJA 3PAVA 1PLCA 1BQRA 2HXAA 1NIDA 2PCFA 3S3CB 5A7EA 4HCIA 1R1CA 5F7AA 2BZ7A 5I6OA 2J55A 2TSBA 3SBQA 3ASOB 1N68A 1WA2X 2PPCA 1MZZA 1JXDA 4DP2X 4P5SA 1DZ0A 5D4HA 1ETJA 2VM4A 3NSDA 3DKHA 5D4IA 1V55B 2J5WA 1ET8A 1A8ZA 4JKNA 2YXWA 3IE9A 2N0MA 1ET5A 1WAEA 1KBWA 2IH8A 4NB7A 4YSOA 2QPEB 1IKOP 2BP8A 2X87A 4G71B 3SBPA 1L9RA 1N70A 3UACA 4A2GA 2EIMB 3NP3A 3MBWB 4N4YB 1A4AA 4YSCA 4E9WA 5PAZA 5I28A 2PP7A 4HCGA 1L9SA 2AZUA 2FWLB 1BYPA 4JHVA 3EH5B 2R7EA 1TEFA 4KO7A 1AANA 3T71A 1SF3A 1AZUA 3S3BB 4M3HA 3X2QB 3V9CA 3FU8A 2CAKA 2QPDB 2VW6A 2DWTA 4QLWA 3S8FB 2XXGA 2BWIA 3IBOA 4PAZA 2NRDA 1ZDQA 3EF4A 1PMYA 2H5UA 1PZCA 3QJSB 4G7QB 2PPFA 4KOBA 2MTAA 7PCYA 3FQ1A 2Q9OA 4BDVB 5B1KA 4YSAA 5EHFA 3CDZA 3WI9A 1PNCA 4BXSV 2FT7A 5D4JA 3NSCA 4Q89A 3SQRA 4AKOA 1WS8A 3S8GB 3DTUB 3GDCA 1MG2C 2BO0A 4DP7X 1OE1A 2HRHA 5LDUA 1J9TA 1KDJA 1ADWA 4DPCX 4YSQA 2HX8A 1I53A 1NTDA 2BHFA 4A2FA 1CYWA 4UANA 1QNIA 4A66A 2XWZA 5TK4A 4P5RA 1PCSA 1ID2A 1E5ZA 3OMNB 3N55A 1PZAA 1SJMA 1ET7A 4DPBX 1CYXA 3NYKA 2VSKB 3DIVA 2IDFA 5I5JA 3PXLA 4JHUA 4E9VA 4KO5A 1NZRA 1ZPUA 4ENZA 2ZONA 1PF3A 2XUWA 4YVUA 5E9NA 1PY0A 1BEXA 3BQVA 3OMAB 3NJIA 2BWDA 3WNIA 1JZFA 2EIJB 1B3IA 1J5DA 1UATA 1PAZA 2UXVA 4BWTA 1XB6A 3ZBMA 4CSZA 4E9YA 3FQ2A 2IDTA 4YSRA 1EZLA 2GC7C 4A68A 4ZK8A 4NERA 2AANA 4E9XA 3C75A 1XB3A 2EIKB 4HAKA 1GW0A 1SNRA 4DPAX 3QJRB 4UAHA 1ASPA 1WS7A 1JZIA 2GC4C 4YSTA 1IC0A 2OV0A 1NWOA 1NIBA 1JZEA 2JXMA 3X1FA 3FSAA 3NJHA 1W8EA 2DV6A 2IDQA 5IY5B 1AZBA 1CURA 2PLTA 4A2HA 3HEIB 2GHZA 3ZIYA 1HAWA 5AFAA 3IN2A 2Q5BA 4M4RB 1TEGA 1PNDA 3AZUA 4QKTA 3IEAA 3UABA 3CDZB 1HFUA 3QPKA 1GS7A 1RKRA 2LLNA 4Q8BA 4L0PB 4DP5X 2IAAC 1BXVA 1KGYE 3NJNA 2IDSA 5I5MA 3NJMA 2BP0B 3NJFA 1J9QA 1E67A 4HHWA 4WKXA 4EF3A 3FU9A 4TXVB 1AQ8A 3RYMA 1AS8A 4HCFA 4A67A 4KO6A 1XMEB 1SF5A 3NSFA 3AG3B 2IDUA 2CCWA 3U25A 2P80D 3X1BA 4BK5C 1GSKA 3T6XA 1OCRB 5I6PA 1QLEB 1KYAA 5B1JC 1IBYA 1JZHA 1JXFA 1URIA 1ZIAA 5B1AB 2X88A 3WKQA 3X1EA 2W88A 1NIEA 5I6KA 2IWFA 1AS6A 2YARA 3CVCA 1OV8A 1W6LA 3FS9A 4KNUA 2A3TA 3UAAA 3AG2B 2FT6A 3MX0B 2YAFA 2AFNA 1RZQA 3OQRA 1BAWA 3CVDA 1E65A 1NWPA 3FYEB 3T6WA 1OOWA 1MZYA 2I7SA 4E9TA 1SFDA 5B7EA 3GXUB 2JFCA 4K9JA 2CJ3A 4N8UA 2B3IA 2XV3A 1SDDB 2DY2A 2HLEB 4NAJA 2FQEA 1KCWA 4DP0X 1IBZA 3TASA 5B7FA 2E86A 2H47C 1IUZA 2BP0A 2XX1A 1MG3C 2WSDA 2ZOOA 3T9WA 1L9QA 4KNSA 1KCBA 1GY2A 4DP9X 3ASNB 2GI0A 2TSAA 3FT0A 1V54B 4G7RB 4BXVA 4FAAB 1A4CA 4W9ZA 5I6NA 2JKWA 1L9TA 2HZHA 1WA0X 1ILSA 1OF0A 2PPEA 3BVDB 1E5YA 4F2FA 4DP8X 2CBPA 2AVFA 4DP4X 2MRYA 3FYIB 3D12B 6PCYA 2YAOA 3NJLA 2WO2B 1WA1X 2HX9A 3NJJA 1EHKB 3AG4B 2XLLA 3CVBA 1RZPA 2I7OA 5B1JA 3H56A 4F7KA 5I26A 5B3SB 2PPDA 4DP6X 4AKQA 1SFHA 3WKPA 2PP9A 1BYOA 4HIPA 4GXFA 1AOZA 1OE3A 4X4KA 3ABMB 1KBVA 1FA4A 1AZCA 3ZDWA 3NJGA 1ZIBA 1AAJA 1VLXA 3QJTB 1JXGA 2ZWNA 4WTQA 2FT8A 2XVBA 1SDDA 3AY2A 3ERXA 2QT6A 2IWKA 4E9SA 4GP5B 5PCYA 1GS8A 1JVOA 3HB3B 1NIAA 3UAEA 4YL4A
chains in the Genus database with same CATH superfamily
1H8NA 3OM3B 4Z7NE 1QW8A 1NCIA 5AW1B 1XIWC 4HIQA 3NN8B 3WNNA 4U1KB 3B2UD 4Z8FL 1TTUA 3P3SA 3IMSA 4AJ0A 3HG3A 2OZ4L 4WCYH 1KXVA 3IJ7A 3DV6A 4OZGF 1BDYA 2CJSA 1ETB1 3LDBB 7TAAA 3CXHJ 4JG9A 3GMMA 2JVUA 1A6ZB 2ITCB 3S34H 3LY6A 1VADA 3VXTA 2AXWA 4PSRA 3GLDA 3GRWA 4U1LB 3L3JB 2VDKB 3RHWF 5CKAA 1UVQA 2Z0UA 1BMWA 1JOIA 1TYEB 3O11A 2E6QA 5E23A 3VXUA 1M56B 4G8GA 3FPYA 4XMZA 1A65A 5DD5L 3WSQH 4Y5VB 1VESA 4KK6C 5C0EB 3IJSA 4HGWB 4C4KO 1HIML 1KDIA 3CTTA 3AREB 4NN7B 1OT1A 4WNJA 4BWUA 2IWEA 2EDWA 2PR4H 4OUUB 1W6WA 4BFIA 3FHEA 4FHBD 1EFXB 3QISA 4YHYB 2Q3AA 3BAXA 2FO4B 1ERNA 2YMTA 1FWXA 1K3IA 4HKBB 4ZMAT 1SLUA 2B5IC 4YPGA 1FNSL 2CK2A 2A77L 4XBGB 32C2A 3FO0H 5JW3L 4GRWB 2BNRB 1NPUA 3LKSA 2HKHL 3MRGA 2XWJB 4MAZA 5CGYD 4B60A 5BVPL 4WUUE 4K8RD 3SKNB 1J05A 1HVXA 1ZJAA 2V2XB 3GWJA 2DIEA 1UYWL 3LEVH 2E46A 3GGWB 1FAIH 3AWEA 4X9HA 1G43A 4OCYH 3E8VA 4GI8A 5IR1B 4K73A 4P46A 5I0YA 4PJGB 3EDKA 4J3OC 4QCIB 4G7SB 3U30C 1ZD6A 3ECWA 5IEKB 2IAMA 2O4EA 2QVFB 2R2EB 3W57A 4NJ9H 1AG6A 5FUZL 1TZAA 5AYTA 5JHDB 5EUOE 5DUML 4X99A 3HN5A 1EMTH 1E4XL 1JNLL 1KTBA 1OKEA 2O6PA 2K70A 5HHPA 4F27A 3RU8L 3ZTNH 4B53A 1PLAA 1MCBA 3L16A 1L9PA 3F65A 3RX7A 3LKOA 4G80B 5F1KC 2LABA 3MRRB 1YPZB 2D7MA 4YDNA 3KDMB 1L0YA 1QEWB 1Z66A 1ASOA 1X7QA 4HPOH 4ISVB 4JZJA 5BXFA 4DZBA 3WUWG 5JPNC 5HY9A 1HYSD 3OMZA 2WXMA 1AYOA 4KGJA 1J7VR 4O00A 2NT1A 4QRSA 1G7PA 4X5RA 5AW4B 1RVFH 2BSSA 5EEUA 1MCDA 1RIVL 3IFNH 3SIKA 4MD0B 4WTZA 9CGTA 5JOFB 1BPLB 3RUGB 2DMHA 3CBRA 4JM0A 5J12C 5MHSE 1NSNH 3ARXA 3QA3A 4FX5A 1TPXB 5BQ7B 1T1XA 3PV6B 1HQRA 3CHXA 4D0BB 4X6CE 3OGOE 1B3JA 1XR8B 3MNWB 5KVGE 4FABH 1QSEE 1JUFA 3MRHA 3W1ZA 2C9XA 2D31A 2VLRD 4Z7UA 4HH9A 3W5NA 1GHFL 4NYLB 1SHWA 2AQNA 2DLIA 3U2JA 1F8TH 4OV6F 3QUKA 3SGDH 1EAJA 3OXRB 3FB8B 1FH5H 3BDXA 1XBDA 1CZ8L 5FX3A 1PZUB 2GB2A 4YHZH 2CJUL 3VD0A 4IIQB 4PJ8C 3GEWB 1TFPA 4EI0A 1P9MA 1YN6A 2A74C 4ZAKC 4FFYA 4M8VA 1MJJA 2DLEA 2Y1AA 3RVXD 3WFDL 3GYRA 3LRSA 4MKMA 3W0WE 5EF1A 4NQVB 4NS0A 4P07A 3BUYA 4JLRB 5LVEA 1RZ8A 3BQUD 4MNHA 4RMUA 3D25A 4UZUA 2DF3A 3FU0A 3TIEB 4UUJB 5I1LA 1INQB 3IETB 5DJ8B 3H4HA 3KNBA 4Y2DA 5EFIB 4HS3B 2VTFA 2XTJE 5AYUL 1HINL 3GB7B 4U7MA 4L8DB 2Z64C 5DZNA 5TDPB 4AEIH 4Y9GA 2VDML 2WUCH 5I73C 2F9BT 2JI3A 4KVNL 2PXYB 1NBZB 4PTTB 1HWWA 2FLBT 3V6FA 3D0LA 5D4HA 1ETJA 5HBBA 2DTML 1WFMA 4V2CB 5GS1A 1AQKH 3E2HC 3WLBA 1ET8A 4XBEL 2X87A 4JRXA 2ATAA 1N70A 3GMNB 4K94L 2JCWA 5ELIA 2A5UA 1H8SA 1FG9C 3DSNB 3VWJD 1MRCH 1KGIA 3FH7A 3EOAA 4HA1A 4N4YB 3HUJE 3WJLC 5D6CA 2BSTB 5F70A 1G7HB 1L9MA 3NZUA 3BH8A 5TGBA 2EVFA 1RPUA 4D9LL 1I3VA 3HAEG 5I0WA 3OXSB 4FE9A 4MD5A 2R2BB 4S2SA 1BMZA 3VRIA 4MCYA 4ALAL 3B6SA 3HAEH 2OR7A 2WUBL 2XXGA 1N0XH 3IBOA 3NDYE 2E9BA 2H5UA 3U6RB 4WF7A 1P7BA 4LLVA 4HQQH 1KIPB 4NO3A 4V1DB 2GJ6A 2LTQC 3IKCA 4ZXBA 1AZZC 2ZIDA 3AU1A 4K3EL 4WSKA 1BZDA 5E5MB 3FRPB 4KQ3H 5FA4A 4LSTH 2LW3A 1OGAB 1J1PL 4RMQA 4ZMXA 2NY5C 5EOCH 4PN6A 4NZUL 3ZYJA 4Q89A 2W92A 2VXQL 3L81A 4IGBC 1MG2C 1U9KA 1EZVY 3QDAA 4PJAA 3W9DA 3HI5L 3O0RL 5C0BE 2RJMA 2C26A 2LLLA 1G7QA 1KFGA 1NA8A 1RUQH 3BP7B 4YFDB 1I7ZB 5KVEL 1OTUD 2H6OA 1RH8A 3FCUB 3MGTB 5EOQL 3RI5F 4NZRL 4MDJA 5F7KC 3DBXB 1NUFA 4QXWA 3O81A 2PTTB 1U6AH 3K3QA 1E43A 1A9EA 4PLJC 2CKBB 3IDUA 2CO6B 4YHPA 4XGZB 3GO1H 4UV7H 2QKSA 4MASA 4ZSOE 3BQVA 5IK3A 2D7TH 4MA8H 3O9WD 3OZ9L 4DKTA 4Q56A 2HT3D 5KOVC 1BEYL 3WE6B 2X4TB 3WXVL 3BDYH 3MCKA 2NPLX 3TVMC 1XBRA 5FOJA 4TQPA 3ESVF 4TLKA 2GC7C 4BKSC 1G5GA 4H8WL 2ZJSH 2Z6FA 3UZQB 4A7UA 4RMVA 3N06B 4JGUA 5JOPE 4XCFL 1EA9C 5KBDA 4OFDA 2XDHA 3FTGA 1D7DA 2ADGA 1I9IL 3QRGL 3VXSD 4MWFA 1T66C 1SMOA 5I1IL 1MWAA 1RJZB 1YNLH 2B1AL 2JXMA 5EOTA 3HG1A 2DD8L 4GSXA 3H9SD 5MI0C 2EUWA 3WIIH 4GMTL 3ECBB 4G7YL 2A9NL 5L6YL 1KYUA 3L4CA 5IQ7H 5SWZE 1NLDL 2GHZA 1A1OA 2WYZA 4L2LA 1D6VL 2XVGA 1P2CA 1UZ6F 4QY8A 3V5DB 5DJCA 5DJYA 3VDCA 3WFEH 3NOIA 2D03H 3HE6D 2AK4D 4FQQB 4XVTH 1CVRA 2LLNA 1Z9OA 4M4PA 4M8RA 3S36H 3SDAB 5F9WC 1T1ZA 4JN1L 1VHPA 3RL2A 4Y4FA 2GBVA 1JL8A 1TQTA 1HHGB 4KVCH 3RWFA 1T6BX 4XMLH 3V4UL 4HUXA 2Y5TA 2DWEB 3D9AH 4HPYH 3EJUA 1XMEB 3KLKA 2QJDA 4P59H 4X4YB 3CFCH 4LKCA 4BM7A 1F2XK 4OD2B 1KACB 4ODWB 3AS2A 3NAAH 4OKVB 1NFDB 3Q5TA 3VGDA 4KI5C 5ISZA 3I84A 3KYNA 1NBYA 4X9YA 1O6SB 2OM5A 1B0GA 4DVBB 4X6FB 1OPOA 5I8EB 3VDBA 3K5RA 1T5WA 3MHZA 2MCG1 4PP2B 5DVLA 5DS1A 1L4IA 2QGDA 3CVCA 2NQ3A 3PV7A 5E2WH 1OZTG 2MOGA 3K91A 4PJBB 4QHNA 1M6UA 3QEUB 4KMTL 4IK7A 1OP3H 3QJOA 4ZFOB 5ID0B 3V4VA 2AFNA 3VI4E 2DH3A 1JNNH 1IJNA 1XZ0A 2X9ZA 3CVDA 4F33A 3UJJH 5LNDA 4AGQA 5D1ZI 3RILA 2QFPA 2IANA 4AVHA 3HFMH 1TQVA 4X7SH 3ZDZB 3OSVA 5EULV 3WN5B 4D2NA 4JDTH 4U33A 2FUTA 2MJWA 3C60A 5J1AA 2EVJA 3LV3A 2Z35A 1BGXL 2YPLD 4NWUL 3WEOA 3K1KC 1DBAH 1U92A 5CUSH 3UBGA 5B4MC 4O02L 3IXAA 5CILL 3QWNA 1YEGL 1T80A 5HYSA 1TQBC 3I6LE 1J88A 1VF5C 2ATKA 2BSRA 4TL4A 4DP9X 1Z9SA 3H9HB 3ZIMA 5LGHL 1VKXB 4HBCL 1S78C 4M03A 4PG9B 4RSYA 1EDQA 4JRWA 5EEVA 2K3TA 1HL5A 1W2KT 1I9RH 4G6JH 5F7EL 2HZHA 4S0TD 1I75A 5FO7A 2G3XA 2X1PA 3K80A 1MFCH 2JTDA 5IF0B 3SGEH 4JM2A 2DMCA 5DLML 3ARGD 1LGVA 5LKNA 2R0WL 5I6XC 5J6HB 4YBLC 3JSSA 1SXNA 2C1PA 5IT2L 1QI3A 2AEQH 3CVBA 2CLVB 1ZEAH 4LT7A 4WW2F 3MTRA 4AQ1B 4F7KA 1P5VB 4BK8A 3LCYA 2PCPB 4APXA 5I30L 2JLLA 2XXMB 3MRCB 2OI9B 1J0HA 1VFMA 5EH1A 4ELMA 4TNEA 4LPVA 1AOZA 5FYJH 3QXDA 4W4OA 4F2ME 2ZCKL 4PJ9A 1LO2H 1OB0A 3RVUD 2VUOA 4HUKB 4YMPA 2Y7SA 4HIJA 2Z92B 3KLLA 4I13B 4EDWL 3FQXA 2UV3A 3I9IA 3L3GB 1JTTA 3L7EB 4NXKA 4P2RD 5D7JD 3WIFA 3ZT6A 3UAEA 4FLRA 1AQDA 1OLZA 3RIKA 1KXQE 4G1MA 3MJ7B 3GUFA 3TYGL 1OCCB 2L3BA 3DRTB 4DP1X 4HJEA 2CH8A 5DUBB 3EUDA 3QFDA 4L4JA 5DHVA 2HT2D 4DJMA 3TPUB 3W82A 4NQSB 4M3KB 5H35A 1J1OL 5JA9A 4BFFA 5CF3A 5FECB 4B9JA 5I8CA 4IOSA 4I0PD 3LXCA 1BBDH 1GVIA 1AI1L 5G4NA 4AKPA 3L5XL 3V5HA 4MTMA 3RDTB 1I1AC 5DGRA 4BFRA 2BC4B 2WB7A 4ZOCA 1SOSA 3WS3A 1CFQA 4KRMB 3K81A 3ZQ9A 3MV7D 1VGEH 4KNQA 1CFSA 1IAOA 2FX8L 2G9HB 1S3RA 1A0QL 1TSRA 5D1ZD 4L48A 3OF6A 5LWYL 3JQOB 4KKAC 3MLUL 3L95B 1OCZB 4P4KC 2P4AB 2OMTA 5IB1A 3DGGA 2VUKA 3TT1L 1MVYA 3EYFB 1G9MH 2VN5A 1LQSR 2Z91A 3GHPA 2R4RH 3C5ZB 4ILDA 4C55A 2OL3A 5CJ8A 3PL6C 3Q8FA 2ZCHH 3FO2B 5I76A 4WK4B 4RRPG 4NQDE 4NO5B 1S7XB 2VAAB 4XN9A 4KTDH 3STBA 5I15H 3UEZA 1SRDA 4P4RB 1IEAB 4TVSa 3TV3H 2XQYK 4OFVA 2DLHA 1HL4A 5C9JA 4GPVA 4UB0H 3IDYC 5D9SB 3BO8B 2D9CA 3KL0A 5BVJB 5CGTA 3PAZA 1BQSA 2KMWA 1G87A 3IN0A 1DANT 3Q05A 2OSXA 1M6OA 1MHHB 4E9QA 2PO6C 4HJTA 3HLAB 3UJIL 3ZKXC 4QMEA 3ARFD 2XX0A 3L9YA 4LBEA 5E8PB 1A7NL 1HWHB 1U42A 1RZ7H 2DQFB 3QRFM 4Q0XH 2EDOA 2AQ1A 4CN1A 3UTTD 1UJ3A 3FOMB 5L88H 5GZNA 4PJXF 4JUSA 1OSZA 2E27L 4N8VB 3QHZL 4PRAB 1CF8H 3N9GH 3KBHE 3T0AA 4YSPA 1M4KA 4DZ8B 2X6AA 5LAXB 3X12A 3MLWH 1KJVB 2Q3ZA 1MH5A 1OW0A 2W0FA 1P7KB 3T2NL 1J9RA 1CLOH 1KBPA 2H1LM 4Y7OC 1A4BA 3GI9L 3VFRB 3QYCA 5F44A 1R3HB 2E75C 2H32B 5CR1A 1MFEL 5KSAA 2Y6SC 4WEUD 1MCOL 1T5KA 2GTQA 4W9EC 5FB8A 3V8CA 3T04D 1CVSC 3ZHDA 4J3WA 1FLRL 5C09B 4OCRH 4LU5H 5I5IA 2EDDA 2YGOA 2OULB 3BWAA 1AD0B 1TNNA 3DROA 3S4SB 4WWKC 3GZQA 4H8QA 2FNBA 4U0RC 4NQEB 1HZHH 3TBWB 3BZFB 5AB1A 4Z7VA 3NP4A 4JFSA 5CAYB 3GMPB 5ITFB 5FGCB 1A5FH 3N1PC 1NM9A 2PWGA 3ENEA 3CG8A 2F0CA 5DK0A 2D9QB 1CICC 4CN4A 3S9DB 1NIFA 4N1EA 1VFAA 5IB4A 1SEQH 3VFNA 1HHHA 2XKUA 2ICWB 3SB3A 3HZKB 5FLUA 1WCBB 4H0GA 1AR1B 3IM1A 5DJ0B 1VRSA 3TEYA 4OM0L 4AC2A 5EO0B 1KCRL 4MNQA 2FYYA 2EH8L 5JPMB 2AJZB 3QUZB 4XODA 4DGYH 4WW1A 5DR5H 3CFEB 2ZPKL 4IW4C 4FFVD 4U1GB 1N59A 2V8MA 1FSKC 1DQLH 2W8CA 4KROD 4NUPA 4P2CG 4OIIH 5IW1B 5ES4B 1FC2D 4X5WA 4UU9A 1S3KH 4HLZG 2NTFA 3FT4B 4KX9A 1U4FA 1U8KB 2DQIH 1VDGA 1KB9K 5K9JL 2Z4TA 3OB0H 4ZQKA 4CVXA 1GMEA 4IBWA 1BAGA 3FU7A 4XO4A 4JBSA 1JD7A 1E30A 1T7VA 3T4AC 5E8NA 3UP1A 2Q0ZX 2Q8BL 4W68A 4N0UA 4QWWD 2YAMA 1HOCB 5H37H 2ZUVA 1U3HD 1RK0B 4U1NB 1OY3B 1NIDA 4OBRA 1YYCA 2PCFA 4DQOH 2ADJA 4UNVA 1QSED 5D2LA 1R19A 2ITFA 3DWTA 2VLLB 4I8DA 2TSBA 1V7NH 3V0EA 1LP9E 3ULSB 2RCSH 4JHAL 4OZFH 5EZLB 1JXDA 1C16B 3MRFA 4G1EB 5FPIA 4D8PB 1QBLH 3DKHA 1SXSA 2VDPL 2X1QA 1O9WA 3CX5K 3SKOB 3MRLA 3C09B 2FK9A 1VERA 2L0DA 2BDNL 5DK2A 1A7OL 1XSIA 2BSDA 4M5ZL 4MYWB 5HDQL 2QQLH 1MJUH 4LCWE 1SY6L 3C6LB 3QQ9C 3U1SH 1XGQB 3QUMH 3GS0A 3V52L 2Y3NA 1JYXA 2AZUA 5E6RB 1UD3A 1AOHA 3BQUB 2Z7WA 1ZOXA 3ILPA 3ETSA 4J2QA 4KPHL 1NKOA 2ESVB 4KU1A 4WAFA 5IFHH 5KVGL 4M3HA 3V9CA 3BEWA 5D7IF 35C8L 1CN4A 1F97A 1S7VA 2EYTB 2NRDA 2BHZA 3KBFA 3GZPA 2XTJD 1G6RH 5I1CH 1JGVL 2WJ5A 3PIQA 4HULB 4AYBA 4IMLA 2X42A 5FF6B 1KIUB 1IC5H 5KBMA 5DEGA 4NCC2 3FFCB 3HNSL 5JNYB 5CM1A 4WRLA 2Z31D 5JUEH 3ZDXB 4CA4A 1YAIA 5EDXA 1AHMA 2FT7A 5G4MA 4ZODA 3LNEA 2NYYC 1QVOB 1DBML 2Z8RA 5I8KH 4JZNB 3BPNC 4K5LA 3SQBB 5DVKA 4CILA 4L3CA 1QP1A 3SYPA 4GJTB 2Z8SA 1I53A 1NTDA 2EIDA 1S7SB 1IGMH 4NPKA 1N2RA 2HMID 2B8OT 3VWKA 3K72A 1E9PA 1G9HA 2EH7H 4AL8C 1KB5A 3A4EA 4AVKA 4BGDA 3HI1A 2AABH 4R2GD 5HPMB 1YCSA 1E5ZA 1JG9A 4PJ5A 4H1LB 5E5UB 4ZTPL 3JWDC 5I0DA 5IBUG 2YQGA 3DO4A 1I3GH 5I1JH 1HEZA 3TZVB 3ZE1E 4MJ2A 1BFTA 1NAKH 2EXTA 4D0CB 4GMSL 2VXSH 4XHJC 4AQZA 1PF3A 2C9AA 4L1TA 3TC9A 5EIIB 5C92A 1FL3A 3NJIA 5CEYB 5E4AA 4CVZB 5F7DB 5F3HB 2UXVA 4QXTA 4UZSA 3FJTA 2WTOA 4B3VA 3G5XB 4P2QE 4V11A 4JREB 3ULUH 4OFPA 2IAMD 1L7TH 2YPVL 3V0VB 2AJXL 3QDJA 3VFVA 5FFGA 4Z3GA 5KS9B 3PABA 4MJHA 3AABA 4Q7DA 2EDJA 4AQ8C 1A66A 2W80C 3UO8B 5C0BD 2XG4A 5DI8A 2IV9A 3KLAB 4IRJA 3QNZB 1NC2A 2AAVA 3B8YA 1QMUA 3ALXA 1LD9A 4GRWH 4RA0C 1IZJA 3HE7C 1ZWIA 4C47A 2XKNB 1IGFH 4P2OB 3RGVA 6FABH 2C7UB 5CSZB 1W8EA 3OHXC 3GBEA 1KOAA 4QTIH 5E2TH 1AZBA 5CO1A 4NI3A 2CG9X 3ZDYF 2D3NA 3IDIA 3T65A 1LWJA 2CD0A 3HG5A 3QFGA 1OEZW 5KG9A 2HFFB 5JIIA 4H0IA 3VE0A 3L5WA 2RGSA 5IOPA 1NCUA 3MUZ1 1BQHG 3RAJL 4HC1L 3P0VH 4Q8BA 3K5SA 2UUDH 4DGUA 1IC7L 3N91A 3FUFA 2I32A 5J6SA 2MCPH 1EO8H 4A7TA 4Y5XC 1Z0MA 1A7QL 1RZFH 5DRNA 3ULAB 3DPBA 4HCFA 4MJIA 3NCFB 5IVXE 1KN4H 5BRZE 3V0DA 1DBBH 3BOVA 2YGNA 1FV1B 1CIDA 1QR1A 1OGTB 3CHOA 4Q9CA 4Z3HA 2CU9A 3A23A 3IF1B 3IDMB 5F7MC 4L8SC 2OFQA 2F74B 3LN5A 3THML 3QORA 1A7RL 2VZSA 4MDIB 5F0LB 2XIDA 3LH8A 1JZHA 4JDVB 4X6DB 1U91B 3UJTH 1UKSA 1JI1A 1SYVA 1FE8H 3CXDH 3JVGC 4OD3H 4N28A 2J5LC 4CJ1A 1W72A 3JXAA 3OAYH 1WBZB 1MI5B 1YRKA 5ESQA 2CGYA 3BRGC 1UOWA 1IKNA 5SWZD 3IFOB 3L3OC 2H2PD 5E0QA 3C8KB 2AK4B 3B9EA 2L7JA 3HE6B 3SSGA 2ZUUA 1J5IA 4HK0B 3TEUA 2QADB 4NO0B 2I7SA 1MZYA 2BVEA 4E36A 3LQAH 3FN0L 3QULA 3ARDC 2CJ3A 5C2BL 4J6IA 5IIEB 1YNKL 5C0AE 1OAJA 2YZ1A 5IMKB 4NO2B 2DY2A 4PG2C 4F7PB 5D7SL 2EACA 5TDOB 3TO4B 4JMNA 5IB5B 1WAPA 5E4IA 4PMEA 5LO7A 2FJHB 4W70A 5DZ9A 4LSVL 1PY4A 3T9WA 1B9KA 3KXFB 2HTKC 1AXTH 3MKKA 3AACA 1ETA1 4O02B 4CSTA 1ZLSH 3FT0A 2V3DA 1V54B 5EZOL 1H3PH 4HD5A 5HYEA 1CG9B 4XWOC 4TNWK 5J3HD 1F6FB 4YHOL 1J9CT 5I6NA 4KKRA 3UBHA 4DP8X 2CIIB 5AAMA 4XPHH 2AJUL 3FYIB 2PCXA 4IRSC 3B7YA 3DBSA 1KJ3L 3DX6B 2AITA 3G08A 3NJLA 1YNTA 3WL9B 3GSRA 1EHKB 3MO1B 1Q1JH 5EB9A 4B9CA 3Q5YA 4A6YA 5T1DL 3MRBA 2HYMA 1LWHA 3EO0A 3WBDA 3WEXB 3WS6A 5KSUB 1QBMH 2RFXA 4B3EA 2XVKA 3G04A 3QIUA 1KBVA 2DQEH 1BJMA 1CFBA 2D7OA 2F7QA 3OAUH 4MBRA 4NUGH 5FO8B 2QQNH 3QI9A 4Q9RH 1MNUH 1PJWA 4JPVL 1SDDA 4FOMA 5K9QI 1DVFA 2WVVA 1JVOA 1VZGA 3G5YB 1B0IA 1RMFL 1Q0YL 1DQML 3JV4A 4I3SL 3E7JA 3IGAB 3SZKC 1BJ1H 1RZGB 3HJ0A 2AXFA 3D5OF 2IGTA 4X80H 1F58L 2DYSB 4Y2LA 4NKMB 4AMXA 4G82A 3ARGB 4S11A 5LHDA 2YA2A 3QUYA 3QWRA 1GJWA 4EVNA 5DQJB 2WIIA 4E68A 4J6RL 2XV2A 3QAZB 5DVPA 4M7JL 4POZD 3AMLA 4TULH 4PJCA 3UTSE 2R1YA 3FQTB 3TIDA 2YQBA 3X1NA 2CRIA 3I9PA 1N0LB 1FNFA 4IKIA 4Y5VC 1TSHA 4P9MH 3FSWA 5H2BB 3FOLA 2WBJC 4H20H 3WNKA 4Z1PA 5I18L 1A7BA 5E2UH 3AREC 1MW3A 2F19L 5FHAH 3VB9A 4MX7B 2QDWA 3HPLA 5AVQB 2CDGA 1QQDA 1SJEB 2V17H 2JNZA 4NKDB 4U6HB 2F6AA 2IDCA 4OTXH 3U4EA 3PWPE 4S1SH 3T3PB 1GGIH 5L2KE 2K4WA 5EU6A 1Z2KA 4OUOA 4E5XG 5H4YA 2VE6A 4ZUSA 1C5BH 1FCGA 4OLZH 2B1HH 4BZ1A 3MBEC 4NGHH 5K1JA 5C1MB 5JORA 3UC0L 1GSMA 2Y1YA 5AVVB 4KXZI 1KGCE 4K2UH 4I5BB 3VI3E 2CKBH 4KRLB 3QG6B 3GPEA 5GGRB 3UTZA 3FB6A 3C12A 1NGXA 1XIWA 2Y5EA 4HKXA 5D1ZB 3OHMB 4KHXH 1XF2B 3DX8B 5G5DA 4UNIA 4ZX4A 4OGAD 3GXFA 4EDXA 5J89A 3WDHA 3BRDA 2DQDH 2Q3XA 2ZTBA 3MROA 5GGQL 1KCLA 3QUXC 1VSCA 4PV9B 4AM0A 4ETQA 1HXMB 4UMSA 1B4JL 3Q1SL 4Y4FD 3VGEA 1INEL 3X3FL 2R8SL 1T6VN 2OLDA 3Q1EA 1KLFA 3N44F 4ZI8A 4F2EA 3MUGA 4NKQB 4FQCH 1UWFA 2FJGB 4Z7NB 4YDJB 4XTRD 1I7RA 1KIRA 4N0CD 4HHGA 1FZKA 1WGOA 3LD8C 2YKKA 3SDXE 1WAAF 5ISZD 1KTJA 3EGSB 4B6ZA 3OZLA 4WV1C 5K59F 3ESMA 5AB9A 2H6PA 5DJ6A 5D8JL 4N0RA 2IC2A 3QJHA 1CUOA 5CLWA 2EKJA 4IOFC 3H3KA 3LSOB 4X9GA 2VERA 1RFDH 2DWDA 4TTDC 1HXYB 5DD6B 3HBPA 2K4AA 4KNTA 5GJSH 4WSJA 5CEXB 5GGTA 4R4NC 3V4PA 4QXUL 4M7LL 3FTWA 3M8OL 2V6HA 3QIBB 2VC2L 3VGFA 5K9KA 3NGBB 1BX2A 3IS0X 4H0HB 2ZOTA 3U7WL 4M8QB 2AZAA 5AD0A 1YEIH 1RUKH 3BWZA 1KC5H 3C60D 2AMUA 2MSPA 4L37B 4PJDA 1ESOA 4L2YA 4X98B 1YN7A 3WTSA 3WMSA 4DGIL 2ZUQB 3V5KB 4PR5B 1JZDC 4L4VE 2BSCA 2GK0A 5HHOA 4WGKA 1U3NA 3KD4A 3P69A 4HIIB 4NM4L 2OR9L 1FVDB 1K8DB 3L6FB 3PWNB 3X14A 1WG3A 2OQJA 4QPEA 5GRZA 5FOBB 3IJEA 4J3OG 4PV8A 4WUUB 3R4RA 1CBVL 2F8IA 3N43F 3GFUA 5C71A 1CC3A 2YAQA 4FFWD 3NABH 2CA3A 3O4OB 4I0CC 4A7SA 2NY1D 1SJVA 4LLYA 4ODVH 3UG4A 4J3OH 3L3DB 4WFEE 2ZAIA 4L9LA 5E56A 4OJFH 4N87A 2WYIA 4AJVA 3RJOA 3HMWL 4A55A 4JFFA 5BW7A 2PXYC 3LH2L 5FA3B 2J8UF 4I3RL 2FSEB 2JCCA 2GHWB 4BSWB 5EUOB 4C83B 2D3VA 3T8XA 5JTWA 3EYVA 2J55A 2DMGA 5JXEA 3KR3L 4PJ9D 3GHEL 3T0EC 3MRMA 4EKJA 2ITEA 4XO8A 1AY1L 5DCCA 3AWFA 4TSAL 3WFCL 2GFBB 3KYMB 4DCQB 4Y9CA 2WTPA 5DT1L 2ZP0T 3FZUD 2QPEB 4JO2L 2B4CC 2VDPB 4GO6B 2MPAH 4KKBD 1J11A 4RWYH 4XB8A 2GYSA 4FG6C 1U8LA 3SDDD 2WP3T 1EGJA 1YEKH 5GSRB 2F54A 4JB9H 4D3CH 2PP7A 3DX0A 3O45A 4YXKL 4HUWB 5ITBL 4P57B 1JGDA 2NW2B 2WJ7A 2EADA 5AKVA 2P28B 2WO4A 3LKRA 5DFAA 4KO7A 1ROWA 4GUPB 3TH2T 4PJ8A 4Q2ZB 5JMRA 1AZUA 2CAKA 4NFDA 2BNUB 2AAAA 3SO5A 5HDBF 5CWSB 4CGUB 4H25A 4X6CB 1NBVL 4J39A 3N0AA 1HQ4A 1QSEB 1R3IH 3BPLC 3T4YB 4HIEB 4Z7WB 4ZFGH 1W15A 1HSBA 1JN6B 4XCYA 3OF6D 4FD0A 5AW8B 5GS0C 5MENA 4GFXA 2Z8WC 3F05A 2WLLA 3SKMB 3CFBA 4BDVB 3V2AR 3VFGH 5D5ME 3QIWB 1U8CB 3CLEL 3DUUB 3HHMA 3RWGB 4L8CA 4YK4C 1E8WA 3P1VA 3Q3GB 1Z5YD 3DTUB 3I6GA 3CIAA 5D1QE 4LLWA 4ZW7A 1GJIA 1MCPH 3STLA 5LDUA 4POUB 3L2LA 1DANU 4PJHF 3CZLA 2CGRL 3KPPA 5D7LE 3QZNA 1QNIA 1T2JA 1UOKA 3W0WB 4BGLA 3B1UA 2EXWD 3ZYIA 3CHRA 3FQRA 4PGCB 1X5MA 5GIRA 3PF2A 4LCUB 3RP1A 2DICA 4LQ1A 3ZTJG 3NBNA 1ET7A 3QZWB 4LESA 2FHFA 3ZUNC 4NSKA 2VSKB 1CDYA 3DIVA 2ZT9C 1ZGLA 1SEBA 4ENZA 2MNWA 3ZTJH 1PSKL 4QD2E 1ES0A 3APFA 5CN3A 1FQ9C 2ZXDA 3VXMB 4FQXB 4PVBA 2I69A 1J8HE 1CGVA 1JZFA 2FZ3B 5FW7A 5C8JA 1PAZA 2FCBA 2Z31B 5DD5H 1BQLL 3CC5A 4NEHB 1WSST 2DEXX 4WJ5B 3VMOA 5DJAA 1IILE 4U6YA 5I1AB 4O4YH 2AF2A 4NERA 5DJ2A 5IVNA 3SJVA 1E9OB 4J1UB 3PJSB 4JDEB 3HUJB 4HOWA 1U2HA 3VQ2C 1WS7A 3ROLB 1GYVA 2BK8A 4JFDE 4QXGL 5KSAD 4H7VA 3GNML 4GAYA 1NWOA 4XXDB 5I8OL 4M7KL 3WKYA 2OYPA 5SWSE 1FYTE 2O6EA 3GI8H 3MQIA 2HKHH 3SPHA 1AQMA 2BMKA 3TH4T 4Z5RB 4Q58C 4TN9A 1T21B 2Y23A 4IGBA 1AGEA 1FFNA 2LQRA 3SDCB 3UXFA 1C12B 1CLYH 3MFFB 3QDMA 3R19A 2DKSA 1UYWH 2BOLA 5IHUH 1G4RA 2D2CC 3FKUS 3K71B 2YD9A 2UZXB 3GRBA 4C54A 1GS7A 2NY2D 5FYKH 4G6FD 4WFHD 2UZIL 4L23A 1WFJA 2VRKA 2FJUB 3CN3A 4ZUWA 1SPDA 2JJVA 3MOQA 2HH0L 5SX4I 1S9WA 4IEFB 1FJ1A 2QMKA 5FUZH 5IJDC 4P2QD 4ZNCD 3FF7A 2H32H 5J13C 3AG3B 4D9QD 3P9LB 1AGFA 4FQIL 3DO7A 4AV4A 5C0BB 3RU8H 1GSKA 1I8KA 3FCSA 1OCRB 4MNQD 5EF0A 4Z6AT 3O3DA 1MCNA 3F5WB 2ATPA 2R0ZL 4N0YH 1WWWX 4JO4L 2FH8A 3X3GL 4GRMB 5KSBB 3GK8H 2OTUB 3A0OA 1D9KC 3TVMA 1UD4A 1XF4A 1CGWA 1NIEA 5CIPH 5ANME 4Z3EA 4WHTA 4Y2OB 1Q0EA 5K93A 4S0SD 2VCOA 3HRZC 3T77B 1BG9A 3MZTA 4HFWA 4KZCA 2EICA 5BCAA 1JPSL 2HRLA 1NOLA 4N2IA 3FH5A 4HFUL 1RZQA 1MEXH 1BAWA 1QTYT 1RIVH 4ZSOB 1REIA 5JXAH 2NY7L 1U8OA 3UTPE 2X2UA 1DN0B 4MXWL 4Y19B 3IGFA 1UWGH 4EJ1C 4FCHA 3NH7H 3VXNB 2Z0BA 3RWCB 2NY0D 1HKLH 5IMMB 5E51A 2QR0B 3DHPA 1MCRA 3O8XA 5B7FA 1H6TA 4IBQA 2Z65C 4WW2C 4XNYL 1I8AA 2BCKA 5E70A 4Q6IC 1D5MA 2WSDA 2VQ1A 3HZMA 4M6OL 4IBVA 3K7UA 4G6AC 3T1WA 1AO7E 1ORSB 1ZT1B 5A7BA 5HYQB 4HUVB 3GDBA 3QC5X 1SXZA 5FIEA 3SD2A 1TCRA 4AYFB 4DTGL 2XQBL 2DPKA 1X5XA 2NXYD 4YHLH 1WA0X 4Z77B 5F3BA 2EDRA 3WFDH 5D1XE 4JFXB 1PLGL 4Z7UF 2R51A 3B9VA 3I6KA 4PS4H 4X4ME 3BZDA 3LYRA 5SWZB 4XB3A 4GRLD 1SUHA 5CJOL 4ZX3A 3O3EA 1ITBB 5EN2B 4TUKH 1WA1X 2EJ1A 1N6UA 3MTXA 1VA9A 4MAYC 1MJ8L 5GZOD 1IAKB 3MFGB 2I7OA 5ETUB 3ZTDC 4U1IA 1JGUL 4G6ML 4YO0A 1FCCA 5AYUH 3BFWA 2QL1A 5T5NF 2F7RA 3DUSB 5C0AD 1A9VA 1S9XA 3AGWA 4ZMPA 4MAUH 2HKAA 4E42A 5GS0D 2HWZL 3ABMB 2XZZA 4PB0L 3LKPB 5IW3A 1Z0NA 2APSA 1IGYA 1VLXA 3FHQA 1LQBC 2FT8A 2LOEA 4U6XB 1KEML 2FB4L 3MJ9L 3MOAH 4TVPD 5F9OH 1OAUH 4XBEH 1GOGA 3EGDB 1FO0H 3GINA 3MRJA 1CDBA 1DL7L 4NUMA 4U3SA 2GSMB 2C9PA 2X2YA 5LXGL 3QBTB 3LZFH 3V9EA 4CU8A 2J2ZB 2IH3B 4D9LH 3DX1A 4LEOA 4BIKA 3JWNH 3ULVD 4HJ1A 3VI4B 4XNXL 3RY6C 1N4XL 2WAQA 1WFIA 1J0YA 2IALA 4PRHB 4PJ5D 1O9ZA 1QWHA 4ALAH 3DPDA 3MCLL 5I19H 1MQKL 2EILB 4F15B 5GS0L 4TS6A 1E6JH 1IGCL 2OJ1A 2Z4QA 4KMQA 4G72B 1UWEH 4J3TA 4GQPH 1GYAA 1EXHA 5F1IB 1KT2B 2E59A 1XGRB 1MFAL 4L05A 3RTQC 1AP2A 4N26A 2JB6B 2XPGB 1UFGA 5JDJA 1ACYH 1GOFA 2GAZB 4UT9A 2P8PB 3VI4F 2YR3A 2D8KA 2XBDA 2ZYRA 4PRNB 3T2QA 1QBBA 5EC1A 2V2TA 5F7WC 4N25A 3B2UC 4NZUH 2MHAA 3B2MA 3HS0B 5E5RB 4MZ3A 1ZHKA 1ZMYA 4U7SA 1VGKA 4P23A 5E94B 3QDJD 3ZJAA 1S7TB 1JV5A 1RK1A 4PRDB 3O0RH 5ACLA 1G0XA 2QSCH 3R06A 3DRQB 3CHPA 4LCCB 2V2WA 3KBPA 1LE9B 4H1LH 4IRJD 4YHKL 1NC2D 4QYAA 3SCMD 4U05A 1EJFA 4RX4A 1V3LA 5LB1A 2X6CA 3VU1A 1KGUA 3RGVD 1HXKA 1GZHA 4OLYL 3TA4D 2WP3O 3S6CA 1XHHA 5ACZB 3R7QA 3SE3A 5FFOA 3MLTB 5AVWB 2FQDA 2VN3A 1T1YA 3ARZA 3UOAB 2DLGA 2G4GA 2X4SA 1IU1A 2FNWA 1Q4NX 4OQTL 4F9LA 5C9KA 1IC1A 4F2MB 3D39A 4P5MB 5CGMA 2JJTC 1ADQL 3ILDA 4O2CB 4WWID 3GJFK 3L4YA 4AGPA 1N6QL 3S5YA 3MLYL 2J25A 4ZW8A 1I1AA 1GMIA 4LEXL 1KTLA 1EEZB 1TYJA 5J7CC 5CJQL 3MRDB 1KCKA 4PRBB 5DRXB 4CVUA 4H8WH 5I1GH 2ZCZA 1FZOA 4MMZC 3PWPD 1Y1UA 4BFNA 5DD0L 2X4UA 1NCWL 1O6VA 4GAFB 4JRYA 5CGYC 4HJUA 4AENA 3F12B 1HCZA 4K8RC 1QSFA 5DA4A 3QRGH 3QORD 3GMOA 2NY3D 1QACA 4OZ4B 4O2EB 4R7LA 2B1AH 4RVBA 4DW2L 2ZKMX 1OAZL 2UXTA 3M7OA 2P8MB 2JB5H 2UWEE 4GMTH 2GJPA 4G7YH 2A9NH 5EIQA 2X89A 1N64L 1CGXA 1N8OE 1NLDH 3BT2L 1BAFH 1D6VH 3E0GA 3P4MB 1XCQB 1YZZA 3BI9X 3IDNA 2G30A 2J8HA 4A2MA 2B77A 4POYA 2W9DL 4CC4A 4BKTC 2CUAA 2OSWA 1IAIL 3T3ME 2P24B 3ZT5A 4B9PA 2Y07L 1T04B 3DUHA 2IOOA 3EYOB 4CC1A 3V4UH 3EGXA 5E6ZA 1PPIA 4KKLD 2DQJL 2WCPA 1I8MB 3H1ZA 2A73B 4GP8B 3SY0B 2VC2B 3I3DA 1NGZA 2ENQA 2QKIC 1P7QA 4NQDB 2BJMH 2VWEC 1CXKA 2H1XA 5AAWC 2DLFL 4AT6B 1X9LA 1Q94B 4BH7A 4JG1L 5DJDA 1HHIA 5ALCH 4AYSA 1MUJA 3PPSA 1XH3B 1HYSC 2V5RA 4PBWD 4NCC1 3LHPL 4Y7MA 5E08H 3BIAX 1XF3A 2HKFL 3WNJA 4Q9QL 3UC2A 3D69A 4LRNH 1JWSB 1JD9A 2HFTA 1JHTB 2G75B 3OPUA 3QFJA 3ZHNA 4YC2B 1ZS8B 4HV8A 4KMTH 2MQGA 5J1SC 4APQA 2HPOA 2YBRB 2ZYHA 4YDLB 4HALA 3EO9H 4PVMA 2HVBA 3EHBB 1Q9OA 5C0NC 1OIOA 1G7JB 4FQ2L 2F5BH 5KTEH 1ZJBA 2Z7UA 4HWBL 4BELD 3HG0A 1QA9A 1FF5A 1KJ2H 3BYTA 3IWVA 3CFMA 1I3UA 4TRPL 4JO8A 4N1CA 1KG0B 2MMXA 1GXEA 3D05A 1R3LA 4LXFA 1BGXH 4QOKA 3BD5A 3J2PA 3C9NA 3M17B 5GSVA 2H0PA 1HZLA 1BECA 3QIUD 4O02H 5JIMA 3DJ9A 3RVXC 1IBGL 5KYXB 4NRZA 2VDNL 2NLJA 2NUPB 5F89B 5LGHH 2J5WA 2VH5L 2X2JA 4LHUA 2IH8A 3M45A 1EIBA 2AV1B 1DVFD 2BP8A 2DQHL 4M56A 3ZL2A 3K4ZA 3GJFB 5F7EH 5ICZA 3P30L 3U2IA 3V10A 4WHCA 4EZMA 2R0WH 4TYUA 3WEMA 4YEFA 3U2SA 2O5XL 4HGMA 3WXWL 2VXVL 4H44C 3LKNA 3QWRD 4P3CL 4DN3L 2X09A 4H40A 3ZUCA 4LLDA 3MNVB 2IGLA 1SDYA 4K9EC 1R3JB 1B2YA 1E4WL 5CLZA 4KRPD 2ZF8A 3G6JA 4L3EE 4YH6A 1KZYA 4K71B 1QX1A 3GSUA 3H3PH 3PGDA 4OF3A 4XNUH 5T8IA 3J27A 2ZOUA 3CDGB 1DE4A 2C9SA 2YUXA 1SXAA 3VWJC 3BXNB 2WB1A 4DNLA 3R8QA 2P5PA 3VD2A 4X83A 3SDYL 2V7HB 1MHEA 4HDIB 1NCAL 4UIKL 5DFWH 5EZIL 1N5AA 4ES9A 5L4MA 3ZR6A 1I7UB 4XP4H 3VH8B 4JL1A 5C0IA 3SDDB 1CFVL 4ELMF 4WJKB 1TTAA 1ZT7A 4GH7B 2R2HA 1J1OH 2IG2L 5EU6D 1M3IA 5HGBB 3ES6A 3CZKA 4P3DB 4NPYB 1LEGA 1AI1H 2WK2A 3L5XH 1G4MA 3VJ6B 3GUTA 4NQXA 1WIPA 4LK4A 5FGSA 4KK5C 2BFVL 4X8CA 3VB8A 1E9QA 4XOCA 3P3YA 4NN6C 1KFAL 1LK3L 1GKOA 2ARJQ 1NZRA 1SMAA 1A0QH 2WLIA 4HVBA 3MYZA 4Q74A 3R0NA 1ZLDA 4JFWA 2OJEB 3MLUH 5AVYB 4MMYB 1C5CL 1IIKA 2H8PA 3HHSB 1LP9B 5LCVA 4X7TA 4K5PA 1A6AA 3IVKB 1LVEA 4UOJA 1CD8A 4IU3A 2EQDA 5CJXC 2E3VA 5KBNC 2B3RA 5K69A 2DI7A 5EOCJ 1OTUC 4YSRA 2HTLD 2WANA 1NDMB 3X17A 3KPQB 3VXOB 5B8CC 3KEHA 4JFEA 5D1QD 4NUJB 4LCWB 3KPRE 3QCUH 1Y6MR 4UAHA 1CGSH 3L3IA 3TESA 3QCVL 3TH3T 4MXQD 5D7LD 3LZRA 3BHBB 4EMZA 3HR6A 1IC0A 3GXNA 1NIBA 1JZEA 1ZV9A 2DV6A 3TJEH 1OAKL 2FJFB 2X4OA 3FH8A 3O9WC 3VTTA 2HT3C 2QQQA 1S7QA 3QO1A 3UROR 5E6IB 4M4RB 3MLRL 1IBDA 3ZVVA 2HJFA 3NCJL 3WEAA 3NIFF 3AS1A 1HFUA 1DJXA 5E4EB 2A9MH 4MVBD 3AY4C 5D7EA 4NC1E 4OLVL 3QHZH 1CXEA 3DXAE 3CD4A 5C7XL 5BUAA 4HHWA 1IKFH 2VM9A 2DBLH 2ZNXA 4I85A 1FRGL 4BJLA 1HILA 3LH9A 4N9GB 3U25A 1R6VA 2VIRB 5ALBH 1NEPA 1IFHH 4BK5C 4OGYL 3F7LA 2P5EA 1Y0LA 4JEGB 4YEEA 1T1WB 2VERN 3MNZA 2BZDA 2FLMA 1OALA 5LBSL 3L4VA 1MCOH 4TTGA 3RWIA 3NZSA 4PJ6A 1JXFA 2HN7A 2LAAA 3AM8A 5HHOD 4DKAA 4KMLB 4GSUA 5A43C 1NJ9A 4JM4H 3HE6C 3L9EA 4GW4A 1TZ8A 3BFOA 2GABA 3MREA 3WTTA 3ZE1B 3AB0C 5D93C 3PP3H 3PS6A 5JHAA 1N18A 4ZO6A 3CWGA 3EDFA 4IJTA 4MNGE 2NY2B 4XVSH 3L4TA 2DDQL 3SPCA 1ZT4A 2AKRB 1YY8A 1I8LC 5DA0B 4AE1A 3BD4A 1AGCA 1IGIH 4ZUUA 3VSUA 5I17B 3LPFA 4LVNC 4P2QB 3OHXA 3H85A 1WEJL 2MKWA 2B3IA 2QVKA 4GS7C 1H3GA 2QEJA 3S35X 3ZE1F 1KCWA 3HA0A 3GSWA 3IYLW 3EFFB 4FG2A 5DXWA 4HT1L 5KZCD 4CMHC 1J18A 1KPUA 4PRPA 2EIBA 1KCRH 3S37L 2CXKA 4RGMB 5JXED 3DETD 3U48A 1C9SA 4LNRB 4EQ2A 1GY2A 2ZPKH 1WCQA 2YEZB 4OLWL 3G3LA 1PX3A 4ZO8A 1ZLUK 3S2AA 3VD7A 4NKIH 2X53A 1UB5B 3DYMA 3M7FB 4EN2A 4UAOC 4EUPA 2UYLB 1QHOA 3L13A 2GPZA 4F2FA 3DIFA 2WNKA 2I60L 2F54D 5KSVA 4XPFL 5TE4L 1GC1C 4EUPG 4L8SA 1KLUB 4JVPA 4WZ9A 1MN4A 5EEZA 1GCYA 1I1FA 2OTWB 2NUTB 1AYRA 2VDOL 5GRVL 5K1NA 5JIKA 3RPIA 5MEPA 3QDGA 4F24A 4RLDA 3V9FA 1P4IL 2BVQA 4C56E 2H0FA 1HHJB 1OK8A 1OGPA 5IVXB 2KI6A 5BRZB 3BKML 2I24N 4JVUA 4PD4K 4RGOL 2Y7LA 4XRCA 4ZD3L 1CE1L 2E6PA 3N41B 5JHMA 2G0LA 4ABWA 3ZDWA 5J9PA 3D0AA 2WYHA 3QZBA 5MEND 3QWOB 3NJGA 4KKNA 3QS2A 1AAJA 1T03H 3IKKA 4KH2A 2VDPH 1S7RB 1K6QL 5H37A 5D2NA 1AO7D 3IMWA 2Y36L 2BDNH 4GAJL 5ADOH 3ARGC 1A7OH 3EYQD 3L3HB 2NXYB 3FUKA 3OD3A 2YS4A 3H3BC 1S9YA 2X4QB 5HDQH 5HGHB 5T1MA 5IVXF 2HAZA 5HJ3B 4QHMB 3A6BL 4OZFA 1X5IA 1IM9A 1D5ZA 5LQBL 4LLMA 4B50A 4GRLB 5CD5D 4FZ8H 3QR0A 5F8QC 5KANG 3S37X 5C0GB 1IL1A 1KCSL 2PF6A 4L4TE 2XU9A 2BHUA 1U58B 1T2QL 2Z93A 3ZKSD 1QLRB 4PM1A 4KPHH 4WQOA 2HFEB 2JLPA 5KVGH 3O0LA 5DK3A 3RVUC 1XVSA 4QRUB 1NCBL 3NJKA 3QRLA 5ANHA 3KW7A 2J1ZA 4GW1A 5E8OA 1BWWA 3I2CH 4AITA 5D7JC 3RZCA 3FRUA 4Z78A 1YJDL 5F8RC 5JQ6L 4HIHB 3GJEA 3HHRB 5KYWA 3MYJB 3VW3H 3OJDB 3TN0D 2HT2C 4LL9A 3ZSSA 4DEUA 2DQTL 1JZJA 4X5XB 2XYCA 4ZFZB 4I0PC 1DBMH 4M1GL 4UIMB 4GT7A 1M7DB 1G6RA 1KNOB 5HJDA 3PCYA 4P5TB 2ED8A 5KYYB 3P3TA 2E9GA 3SJVD 2Q7YA 5E00B 2YD5A 3QEQA 2VR5A 4HU2A 3SGDI 1PY9A 4KGLA 4ZTPH 3NN8A 5DEFA 2B0SL 4U1KA 5BNXD 1T83A 2FTAA 1GGYA 2XA3A 1IFGA 1VZHA 5AKRA 5LJYH 2WLNA 3QDMD 4FYRA 4RH4A 2XWEA 1UGNA 1UUNA 2E7DA 3QH3A 4P9HC 2UY7B 4N8PA 1OO2A 5E99L 2Y7NA 1AS7A 3QXAB 3ULVF 1NDTA 3FAWA 4F58L 4K23L 3PWVB 1AZNA 2ITCA 2HFGH 4GKNB 4ZS7H 5DMKB 5FKPB 4U1LA 1TQCC 1MIMH 3L3JA 3R18A 2YPVH 5KOMC 2WLYA 1BOGB 5IJVB 5M94B 3MV8E 1MY5A 1CTMA 5HJBA 4HEPA 5J11C 5F96H 1G1KA 2A6KB 2W81C 4IBLT 1DCEA 4Y5VA 2EYSB 3WSQL 1VZIA 5C0EA 4HGWA 5LGKA 2WBJA 4XXCC 3AREA 4JE4B 3M6DA 3ARFC 1AZRA 3GSNH 3KCPA 2DH2A 4EI5D 3DX2A 4ONHA 2EDNA 3W9EA 3X13B 4OUUA 7FABH 2PR4L 2KZWA 1SN2A 3CPLA 3GM8A 3Q6FB 4N6QA 1BIIB 1EFXA 1RCYA 2Z3FA 5FUOH 3UTSB 2UX6A 1BVKB 3TJHD 2FO4A 3UG5A 5JHLH 4FXKB 2JQMA 4HKBA 1MHPH 2J57A 1AXSB 2YKLL 1RZKC 5ABDE 2GY5A 5AYQA 1JIBA 1FFPB 1P4LB 4XBGA 1JDAA 5GGVY 5EF2A 2ARJB 2BNRA 2XWJA 4M29A 3RAJH 4LAJH 4PBXA 3SKNA 5IJKC 2V2XA 1HWGB 3B56A 3KPNB 4KDVA 4QTFA 3ZX1A 3GGWA 3LEVL 4BSVB 1V7ML 4HIXL 1FAIL 3ZL1A 1A7QH 1FN4B 1IAIM 5IR1A 1QSVA 4GQRA 1ITCA 3MNDA 1AACA 1E5AA 3MLVL 4FI6A 2F18A 3IFPB 3O8XD 4PJGA 1FNHA 4QCIA 4YGVB 4AC4A 5IEKA 2R2EA 5DTFB 5L2KB 5T1LB 4GP4B 4NJ9L 4CVWA 4MKTA 5JHDA 1A7RH 3W56A 1U0QA 3FB5B 1EMTL 4AMWA 3SGJC 3JTBA 4RAVB 3S2CA 4UTAA 1JF1B 5FV2A 1TT6A 2CPCA 3B4NA 1Y7VA 3L5IA 3GHBH 3ZTNL 3LS5H 1V3KA 3VI3B 6CGTA 3FT2B 4QO1B 3MRRA 2HB0A 2WQVA 4DOHE 1YPZA 5MP6L 3NPSB 3KDMA 2WKLA 5AG9A 1SXCA 4OF5A 5F71A 3PWLB 4HPOL 2J56A 4G59C 5A3IC 1I1RA 5I74C 3B34A 4G5AA 2G2NA 2YXVA 3PAVA 4QYOB 1ZVSB 4PFEA 4ERSL 1H3VA 1LO0L 3L4WA 1YNKH 3CN2A 2A38A 3I9GL 2D2OA 3IFNL 3PQYE 3RUGA 4JKLA 1R1CA 4FFVC 2BZ7A 3GT6A 2NOYA 4DKFL 1NGWB 3NEEA 4KROC 2UVEA 2Q8AL 5BQ7A 3PV6A 5DMYA 3QJFB 4W93A 2DTSA 4LSVH 1XR8A 3MNWA 2YLKA 4FABL 4WEMB 3SDXB 3V6OE 5HYJD 3B9KD 2BOBB 5SWQB 5D96B 5EZOH 4MJ4A 4NYLA 5IQ9A 3UACA 2VDNB 2FR4A 1ETZB 3RLSA 3TONA 1NUGA 5HVFB 4Q9BA 3OXRA 3FB8A 3I75B 4U4IA 1I85A 4QWWC 5LNEA 1FH5L 1ACZA 5CBAA 4AZ8B 4YHZL 5I28A 2O1AA 2BSEA 5DVMA 1U3HC 4N2BA 3OZKA 4A37A 1KJ3H 4A39A 4AMKL 5FV1L 5AW7B 4FG4A 3F84A 1KGJA 5T3ZH 5I9QC 4HP5A 1FH2A 4UTBA 5T1DH 2QPDB 4BZ2H 1F2QA 1FNGB 3K0WA 5B39B 4JLRA 1ZDQA 1PMYA 1CD0A 3TIEA 4TUJB 4YFLI 1U2CA 4PW4A 5DJ8A 3BH9B 4FQ1H 4RIRA 2YD8A 4MLIA 4ZUVB 4LP8A 2ICEC 3FQ1A 5LDSA 4WHYG 3NZ8B 1YMME 1YNTF 4Q4EA 2VABB 3S5ZA 2GCYB 4JPVH 4L4VB 3EDEA 4L8DA 4MZ2A 5TDPA 3WOVA 4AEIL 4U4BA 1EEUA 2TRYA 3NSCA 2PXYA 1NBZA 2VZ3A 4PTTA 2BO0A 4DP7X 1SYSB 1T0NB 1KXVC 4LCYB 2AS5M 1AJ7L 4O51B 2MPVA 1F58H 4P23D 3CN0A 2NT0A 3VG9B 4XE0A 4M48H 4Y88A 3MA9H 4PS3A 2CGZA 3A6OA 1KPRB 4GKOA 3GMNA 4BH8B 1EXUB 5DEJA 2H1PH 4OGXH 3WNOA 2XTJC 1N5YL 3DSNA 4PJ7E 4M61B 3VXQB 2BSTA 1G7HA 1XH1A 3NYKA 4ZMZA 1OSYA 4OCNC 2E74C 2NXZD 1MCHA 1UD8A 3OG6B 4KRPB 4X9BA 3Q2VA 1BG1A 3OXSA 2XRAH 4GSQA 1U33A 4UQEA 1A4KB 4L3ED 4MS6A 5F0PB 2BSBA 2DW5A 1CGTA 1VENA 4M1CD 2J6EL 3NTCL 3WFHB 5I18H 2HG0A 3CDCA 1XF5B 3ZZSA 3AC0A 4GG6E 2MNUA 2E7CA 3KGTA 1N0XL 3D39D 4K5OA 4BWTA 3U6RA 2DQMA 4LARL 1TNMA 4Y0GA 1KIPA 2QHLA 2B4CH 4V1DA 4EZJA 3VYPA 4PJCF 5GS2H 1UJTA 2HMIC 4NJAL 1KIQA 1G1YA 5E5MA 3FRPA 4JKPL 4KQ3L 4N24A 1WV7T 4P49A 4R2GC 1OGAA 3C75A 3QC6X 1OP5K 4LDEB 1GW0A 3FTSA 1JFQH 5EOCL 1WFOA 4LSQH 1JZ5A 3SYCA 2A83B 4UNTA 2GIYA 3BKYL 3IMUA 1QSFD 3BWUF 3L4UA 4WHDA 5GRVK 1TMCB 3UC0H 4UM9B 5FYLH 1MY7A 5F7HA 3BP7A 5AW5B 4XN2A 1I7ZA 4KC3B 1ICTA 2XN9E 3AVEA 2X89D 3DBXA 3BUPA 4B27A 2IAMC 1D5BB 1FORL 3IEAA 2PTTA 1QBAA 2R59A 3VMNA 3WKNA 4ABUA 2WTRB 3QQDB 1NGPH 4MLSA 5GGQH 5HYFA 3GS4A 2CKBA 2CO6A 2CKNA 1B90A 4XGZA 3D34A 3GO1L 4UV7L 4LFHG 3MJ6A 4WTWA 7CGTA 2XZQL 2VMEA 4KO6A 4GBXB 1MKFA 4J28A 3NIGE 5D1QB 4HKZB 5DJZA 1XAUA 2X4TA 3SOBH 1R4XA 4OCXH 5I75C 1P7QD 1EFQA 1U8MB 1UH4A 4JZJC 3KPRD 5D7LB 2Z1PA 3W39A 1MCWM 1CPUA 1YY9D 1T5XB 2B14A 1A9BA 2CE6A 2ZJSL 5DFVD 4JFHE 5D5MF 4PS8A 3QUGA 3UZQA 5D7KD 4ICWA 3QVAA 4PU2A 2R0LH 4U1SB 1JCVA 1V3MA 3BKCH 2BS8A 4J27A 5D8JH 2M8XA 5FXCH 5FEBA 4GEIA 1OV8A 1W6LA 2N3JA 3FS9A 3IU3B 1THCA 3QFJD 1RJZA 2KPNA 3E9TA 4PP1D 1YNLL 3WNPA 4APQD 2GG1A 1A6TA 2NX5E 1CYGA 2UZPA 1NWPA 4QXUH 4LSUL 4FEMA 1J8HB 2YD0A 3TTSA 3V0HA 5JA8B 3ILEA 2XACC 3M8OH 2JKSA 5IQ7L 1BZ9B 3ZKQD 4EXKA 2F8OA 3NCMA 1L0XA 4Z7AA 3ZMEA 3V5DA 3SE4A 1XTMA 2WZAA 4LVOC 1F4AA 4FQQA 5HHMB 3U7WH 3WFEL 1YMHB 3DI2B 4XVTL 1XXFC 2CZNA 1TF4A 1IBZA 1ZHNB 3LNIA 5D4QA 3S36L 3SDAA 2Y6TE 1HK6A 1U93B 3JZ7A 4QOKD 2I9TB 1P9MC 1HHGA 1EAPB 2AQ2A 3OWEA 4KVCL 5CINH 3W38A 3ISYA 4XMLL 4ZRGA 2DWEA 4EN3B 1NCNA 4AEEA 3SGKC 3D9AL 4JFDB 4OZIE 4NM4H 4D9RE 4P59L 1E42A 4X4YA 4HKJB 3CFCL 4LHUD 4WDIB 4PEEA 4OD2A 4ODWA 4OKVA 1LO4H 1NFDA 1FYTB 3IGUA 3DMMB 3NAAL 5SWSB 3WNMA 3FQNB 5L8JB 3EJRA 1O6SA 4DVBA 3ZTCC 4FNLL 4PJDF 4X6FA 4Y2DC 5I8EA 1LL1A 3CZFB 3H42H 1DO5A 4IBYA 4PP2A 4OVVA 5FDYA 3UBXG 3KJ4B 5F6HJ 5MEQB 2IVFC 4AW4A 1RZPA 2J7LA 4PJBA 4RGNB 5DQ9B 3D06A 3LH2H 4GAAA 4I3RH 5HI4D 4ZFOA 5ID0A 1NEZB 5GGSY 2VDOB 1JNNL 4NENA 3UCRA 1R34A 4LCVA 2P45B 3HFML 3O2DA 4W4NA 3KR3H 4X7SL 3GHEH 1CWVA 3D18B 3WN5A 1WRFA 2XVBA 3JT0A 3HPJB 3MMEA 4GP5B 4H4NA 4E9SA 3BAKA 5DT1H 2B20A 2JCCF 2F1AA 4JJHA 5ANMB 3QSKB 2IH1B 4LGSB 3FULA 1RV6X 4GQZA 1MIEL 1CK0H 2LHAA 2WY3B 3S36X 5FYJD 3KWUA 3H9HA 4WO4B 5DS2A 1VKXA 3ZPDA 2GUOB 4OM1L 5IOKA 3B7SA 3JBG7 1JHLH 4PG9A 4ZJ9A 4KXAA 1FL5B 4KKZA 4Y9FA 4PB9L 2R56H 1I9RL 4ABQA 4G6JL 5T5FA 2H26A 4LLQB 2EIZB 4UT6A 1MFCL 5IVZB 1DQDH 1OE2A 2FQFA 4PRIE 4UTCA 4BFBD 2VOTA 1YEDB 4J8RA 5J6HA 4DAGL 5ENWB 1NBVH 3C6EA 3REVB 3TBCA 3BIBX 5I2IB 2M1KA 3IJ8A 5L2JA 1XGZA 1PX4A 2AEQL 2CLVA 1ZEAL 4AQ1A 1P5VA 3SBWA 2PCPA 1QNZH 5JDSB 3QJQB 3FHAA 3MRCA 2EKSB 4MAYA 4AOFA 4X0KB 4H26B 2VLKA 3CLEH 2YD1A 1D5IH 4DKDC 4LCCC 2X44D 2WZ5A 4U49A 1KENL 2VLMD 3GD1C 1L9NA 1P1VA 1LO2L 5I0VA 2IGFL 2CXGA 4GUCA 4POZC 4R5VA 4F1SA 1BJ1J 2E8ZA 1H0DA 2R1XA 4EXPX 1NPJA 3L7EA 5D1XB 2ROXA 2D0GA 1VEMA 1YHPA 1IX2A 1OK0A 1WUNT 3LQMA 1BF8A 1O7VA 1DZBA 3TFKD 1F4HA 3MJ7A 1SOQA 5AW9B 3VFTB 5TK2A 5DUBA 2PWHA 1ACXA 4J3SA 2A6IB 2AEOA 2D3JA 3TPUA 1CLZL 5FECA 3I3BA 3U83A 4WEBH 3FSVA 4NAQA 2OPCA 1OSPH 3CPUA 1JERA 3GIVB 1BBDL 4YDZA 1NL0L 4WFGD 3RDTA 4PPTA 1KY6A 2OZ4A 1PSKH 3RIAK 3P0GB 4KY2A 2BC4A 3WIHH 5TQ0H 2QQKH 3VXMA 5BV7L 2XWBA 3PHSA 1MLBB 2YLHA 4JGMA 1VGEL 1N10A 2X10A 3MV9E 3TN0B 1R9FA 1U41A 1GS6X 2G9HA 2DJ4A 1FI8C 5AWNH 1LMIA 3L1GA 3L95A 3BFQG 4FMKA 4X7FC 2OR8A 1CS6A 5F6IB 3EYFA 2QLYA 1G9ML 1JZGA 2AC0A 4HMDA 5CZVH 3LX9A 1BZOA 3C5ZA 4MCZB 1QAWA 2MQ3A 1TVBB 4Y16B 3FO2A 4QXGH 3RTQA 2A9DA 3WO3B 4AQEA 4YSDA 5I8OH 2VISB 2ZX7A 4J3UA 3F2LA 4NO5A 5LG1A 2KZBA 5DS8B 1VADB 3FF8A 4JKKA 1JPTL 4KTDL 4OGAC 4P4RA 2ROYA 5I15L 4AJWA 1BSIA 2G9KA 1UVQB 3U0TB 1MCEA 4PWIA 3ZTEA 2NCMA 4HK3N 3EDJA 4UB0L 4Y4FC 3BO8A 5D9SA 3VXUB 1QTSA 5E2VL 2G60H 1GH7A 5AG8A 2VW7A 3DDGA 3IJSB 1MHHA 1A7PH 2ZQKA 1L5GB 3HLAA 4LSRL 5ILTL 1PFOA 1CQKA 1OAQL 4XTRC 3QNYB 5E8PA 3RRQA 4N0CC 1T22A 2FWOB 3NT0A 5EC2B 1YO4A 3S0PA 3ATFA 4Q0XL 4JAMB 4P06A 4C59B 3FOMA 3MV8D 5L88L 2IJ0C 4N8VA 3O6KL 4PRAA 1CXLA 3LHAA 3R0MA 1CF8L 5D71L 4DZ8A 5LAXA 3LKSB 1KJVA 3MLWL 1ZLEA 4X4XB 4EI5B 1P7KA 3TURA 5L9DL 1GYWA 1AR2A 1CLOL 2O30A 4ELDA 3VFRA 2OMVB 1R3HA 4BK4A 3D3VE 4LGRB 1X9UA 2PYEE 4GUOA 3PXJA 2PN5A 4P46B 1ILUA 3L5HA 4MMZA 2LGNA 5GGUA 4N5ED 1JPSH 5C09A 3ARRA 4ZS6D 3T6VA 4QT5B 1FHNA 3BKJL 4HFUH 4LU5L 1AD0A 4OCRL 4ZFFB 3CZUB 3S4SA 3BMVA 3MRNB 3APNA 3LEYH 3C60C 4NQEA 4X99B 4PY7A 1HZHL 3TBWA 3VX1A 3BZFA 3UPCA 2Y7QB 1T2XA 5ITFA 1COBA 4CC0A 2Q86B 5AZEH 3S88L 3P0YH 3CE1A 4AGMA 3LIZH 2JQAA 4A63A 1PTZA 1KY7A 4PMFA 2W0KA 4FRWA 2CIKB 3WUWB 4PJEE 4XNYH 3UMNA 3GMQB 2IBZX 4M6OH 5BXFB 1SEQL 2ICWA 3HZKA 1WCBA 4JK0D 3IE9A 2DQ6A 5DJ0A 4FFWC 1FNAA 2R69H 1WISA 2XQBH 5EO0A 2NY1C 3B5TA 4XX1G 4RAUA 4WLCA 4YN3A 1CDGA 2UWEB 5JPMA 2AJZA 3O4LE 3MBWB 5INCB 3CFEA 5AAPA 2WQ8A 5DR5L 1PLGH 4OF6A 2IF7A 4FI8A 3QA3B 3WGUB 4NHUB 1DQLL 4NNPL 5CJOH 3FO9B 3WO4B 4JG5A 5IW1A 1CE6B 4FFZH 4K71C 3FT4A 3RIAF 1U8KA 4JFTA 4P2AA 3T3MB 2DQIL 4CUCA 4RZCB 4W4OC 3ARSA 5SX5H 4PJ9C 2P7TB 3HVDA 2LU5A 4OBSA 3QUKB 2K7PA 2NNCA 3RNQB 3N85H 4BFEA 4YAQA 3PQYD 4DEPC 3N40F 3RZCD 3FZUC 2AXHA 2HWZH 1ZVNA 2XQYA 1RK0A 1LWRA 4U1NA 1RD6A 1OAYH 4KKBC 2Y06H 4Y8AA 4F92B 1EPFA 1K5WA 5KJ4A 4P8QA 4DQOL 1KEMH 4MA3B 2FB4H 1JNJA 2VLLA 3D4GA 3BESR 2AV7B 4PGDB 1V7NL 2OW7A 1DL7H 4AW7A 1C16A 3NFPA 4G1EA 4MNHB 4D8PA 1S7WB 1KDJA 2DJUA 1YA5A 3EIFA 3SKOA 5I1LB 3BSHA 4U1HB 5CZKA 1CYWA 4UANA 3SQOH 2VB5A 4TUOB 3PPEA 4YOKA 4L8BB 3QEQD 3TOPA 1Y1DA 2CBMA 4XNXH 2QQLL 1MJUL 3C6LA 1N4XH 2PMZA 3W81A 1JI2A 3II2A 3QUML 1MQKH 2YA1A 3BQUA 4KJQD 2W60B 1FDLH 3CSFA 1IGCH 3PXLA 1ZPUA 3D0LB 3LRGA 4IHOB 3AXIA 2ESVA 4K3GA 5GS1B 3QE5A 5IV2B 5BZXA 3HZVB 4TMPA 5IFHL 4BQ8A 4EIZC 1MFAH 3WNIA 2A9BA 1FBIH 4TL5A 4S1QL 2EYTA 4JRXB 5A2BA 5TJWK 5IW6B 2EUZA 1JSYA 2FVNA 3BVVA 3MJ8B 1XB6A 5DYFA 4E9YA 5CKGA 5EN3A 4J7RA 1RHHA 3HAEB 5I1CL 3QXVA 2AJVH 3WNLA 2AQQA 3JV6B 5FF6A 2EXWC 1KIUA 2VDRB 5LBVA 2AANA 4QGTA 5JNYA 1YVLA 2VQUA 4ZMOA 5FYKE 4AWJC 2BOCB 1NMAL 4GXUM 5JUEL 1R3KA 3KGUA 1ASPA 1JZIA 4XMTA 4MCYB 4YHKH 3FL7A 4K0OA 3NIDE 1F18A 3MV01 5I8KL 4AG4H 4F5CE 3ULUD 3SQBA 2VXQA 3MLXL 4K9EH 3UH8A 2UVFA 2GJ6B 3IKCB 5AZ2H 4ZXBB 1ZLUH 5IY5B 1KELH 1S7SA 1IGML 1UJ3C 1EFXD 1PKQE 3IWUA 2EYRB 5FA4B 3FO1B 5HPMA 5HVHC 1BVOA 4OQTH 4YPJA 2BNRD 2FEDD 1I3GL 1OW0C 3TZVA 1SBBA 3QB7C 1ADQH 2OX5B 3H2PA 1TZGH 4OAWB 4RCAA 2BP0B 3ZR5A 4PJAB 1NAKL 3MLYH 3W9DB 4D0CA 4EF3A 2VXSL 1F4XH 5KSAC 1J0KA 5EMYA 2PWEA 5EIIA 2ALWA 5CJQH 1M7UA 3NSFA 5CEYA 3ARUA 2VQTA 5F3HA 2RHEA 5F7DA 4CVZA 1JXJA 2CO1A 4ANKA 4L0ZA 12E8L 3HR5B 1MCFA 1CI5A 2F61A 4Z7OB 4X8XA 3V0VA 3VQLA 1HU8A 5KS9A 4RFOL 2ZAGA 5JQHC 4UOZA 3GXDA 2YD6A 1FIEA 2NY2C 2WGXA 2WXKA 3KLAA 2BIHA 3GXTA 1H6EA 1TIUA 4MSWA 5ESAB 1BM3L 2OZNA 2XKNA 4P2OA 2FLRT 2C7UA 3MCKB 4XVUD 2W9DH 2BHYA 1HH9B 4JY5L 3FYEB 4QTIL 3CMOH 2D0HA 1IGTB 3BPOC 1G9EA 2Y07H 5DQDL 2HFFA 5L7XL 2AXJA 5L4FA 3IXTB 2DQJH 2Y7MA 2NSMA 5C86A 3O9WA 2HLEB 1D2OA 2C3XA 4GAGL 5GRUL 2AJSH 4MWFB 4MBOA 2Y1ZA 1EX0A 1DBKL 2DLFH 2JXMB 3KPRB 3CCHB 2MCPL 4JG1H 4X7DC 1RZFL 2QV4A 3RFZB 4V2BA 1A2YA 3LIUA 1H8LA 5CU5A 1H9VA 3AY4A 3GMRB 4YFLF 2WQRA 5DURB 1FV1A 4FAAB 4QI3A 1OGTA 3P54A 4JFHD 1WTGT 3IDMA 3IF1A 2OMXB 4LPWA 5DJYB 2F74A 4XCEB 4KI5E 2PPEA 5ICUA 1OF0A 2G3MA 1E5YA 1A14L 2E5EA 2AVFA 4JDVA 2EXYD 2JJUA 1FAKT 1OQOA 2BIPA 1U91A 3N50A 4JQXA 1TJHL 4N90E 3D12B 3UJTL 4BK5A 4Z23A 2BSED 3EJJX 4R4FL 3CXDL 2NY0C 4OD3L 2VXUH 4EI6B 1WZ1H 4HUXB 1WBZA 1Z5LA 2GSGA 1MI5A 4FQ2H 2BVYA 4HWBH 2EE0A 3AQDA 3DXAB 1SGKA 1JPST 4HYTB 4LKCB 2NCEA 2ICWJ 3C8KA 2AK4A 1CXIA 3HE6A 4TNVK 4HK0A 3MXWL 4NO0A 3U0WL 1ZE3C 1OE3A 3JWNE 2WYTA 3K46A 2BM3A 3NRFA 2APTA 5DHDA 1IBGH 5IIEA 5TQ2L 3QJTB 1IM3B 1T5WB 2CLRB 2G0KA 3HS9A 4Q14A 5IMKA 4NO2A 2BNQE 2BS71 2WVTA 4F7PA 4U3CA 4G83A 3TO4A 3HB3B 3G6AB 4D9RD 5IB5A 4JPSA 1K85A 3FFCE 4NWTL 3A6CL 2B9AA 3V4VB 4F8OA 4ZBJA 3P4OB 4M5TA 3US1A 5GZOC 2OMZB 3ME0B 4JE0A 1AXTL 1WTLA 2IOMA 4O02A 1W0YT 2VRQA 1ZLSL 1T89A 1CG9A 2YWYA 4KK9C 2G2RB 3WXWH 3NSJA 4UQIM 2ERJB 4MNGB 3R7RA 2DJSA 4U7KA 4P3CH 5I66B 3VGAB 3BUDA 2AI0L 3T8MA 4TLSA 2CIIA 3P40A 3KH4A 3GXIA 5JLZB 4J2XA 1CFTB 1ZKAA 3DX6A 1CCZA 3UZEA 3PAUA 3WL9A 2F15A 3KJ6L 3ZQXA 1M9WA 4JKWA 3MO1A 2RH0A 5KBLA 1Q1JL 4NN5B 4W1TA 4QNPE 5JYLA 2IADB 2X38A 1MFDL 2XICA 2ZG1A 2VSCA 1SN0A 2ENPA 3WEXA 4Y4HB 1DVSA 5KSUA 3N3EA 3SDYH 2QTVA 5FO7B 1NCAH 1FFTB 5KUKA 4MD4B 1QI5A 4FLQA 5IBLD 2H41A 2E7LA 3ULVC 4PGEA 5FO8A 4Q9RL 3G6JF 2NDGA 2QQNL 1CFVH 1I1YA 1OGAD 3KPSE 3GZOA 2IG2H 2CUMA 3G5YA 4F80A 2D4DA 3ZO0A 1H3WM 2EC9T 2E47A 2X70B 1RPKA 4I2XE 1NINA 2OMNA 2FBJH 4RA3A 1RZGA 4HGKC 3FBQA 5CCJA 4Q52A 4X80L 1DJHA 4NKMA 1DJIA 2HJLB 2WWKT 1OAXH 3ARGA 1MXDA 4JUTA 4BFKA 1Z9LA 4JX0A 4JFQB 1LK3H 4CW1B 4UWQB 4C56B 4FERA 2WXGA 4NFBA 3PWUB 4UM8B 3IRCA 1IIIA 5IMLA 4IMKC 2XA8H 5KBPA 2DM4A 1N0LA 5LUMA 3OKYA 2WGNB 5CZRA 5LLIC 4NIYE 1FNEA 5BV7B 3MUHL 4P9ML 1FP5A 5DUPH 4IRJC 2R83A 3SCMC 5E2UL 4AVIA 2G2PA 5FHAL 2XPYA 4MX7A 4QTHB 3RG1C 1Q9KB 3QO0B 3UYPB 2EINB 4QR7A 3RGVC 3V4LA 1P5UC 2NZ9C 3ELQA 1SJEA 4P2RA 4QRTA 1GYUA 5EUKB 1BLNB 1J8KA 1ZHLA 2V17L 3CK0L 3ILQC 4NKDA 5E4OA 3DNKA 4U6HA 5F7LB 1YC7A 4JN2B 4OTXL 4RDQF 4L4TB 4I77L 4JR9L 1IAOB 3OB0K 1OAKH 1K2DA 2YOAA 3LN4B 4PY8I 3U4AA 2B1HL 1RUML 5A2AA 2MOVA 4X6DE 1M2VA 4NGHL 4GYBA 4EIBA 2GT9A 4R96B 4TSCL 2RA1A 4YR6B 2J8OA 3AG1B 3B9DA 4I5BA 6PAZA 3MV7A 1F3JA 3QG6A 4RRPM 3OLGA 3MJGX 1XEDA 4FL4C 5HHXL 4XAWL 4OLVH 2Y1VA 1C8QA 5GGRA 5INDB 4X7EC 5C7XH 4HJ0D 5D1ZA 4FXGC 4PGZA 4B0MB 2CBTA 5FK9A 1Q38A 3DX8A 5IP4A 1XF2A 1UWXH 1LEIB 2I25N 1KJMB 2APXA 3BUTA 4B0MM 3QORC 1TTBA 2GBUA 2EE2A 2NY3C 4GOSA 2CK0H 5DSCB 4J12A 2DAVA 1GR7A 4OI7A 1HXMA 2VZTA 3QWQB 4OGYH 3T6ZA 4PJIE 5EZJA 1O5PA 4AGOA 1JVKA 1S4IA 4M7ZB 4G8AC 1M6OB 2ZXEB 3JVFC 5FS5A 2COVD 1EH9A 3GTVA 2XI9A 2XN2A 4HEME 4U1JB 4YDJA 1ZSDB 3ZKND 1LDPH 3CX5J 3G9AB 2MKLC 5L4JA 3KXFE 4FLOA 4L18A 4I48B 1SZNA 3EGSA 4P9HH 4KFMA 3HFFA 1Y07A 1OSZB 5LXVA 3FU5A 4F57L 2HPTA 1XR9B 2DDQH 4NP4H 3RJDA 4OV5A 1UA7A 3FU3A 2FIRT 2W0FB 1U8PA 3ARFA 3SKUD 4GFTB 2AHIA 1RFDL 1Y18A 3FCBA 1HXYA 5AALA 4WVRA 2WXLA 4JY6A 5CEXA 4R3SB 3GLAA 5F7AA 5EF3A 4OI8A 3IGKA 1JPFB 1T0PB 3DURB 1Z6JT 3QIBA 4JCWA 1RK7A 5BJTA 4P05A