3T6ZA

Crystal structure of steccherinum ochraceum laccase obtained by multi-crystals composite data collection technique (60% dose)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
495
structure length
495
Chain Sequence
b'VQIGPVTDLHIVNADIVPDGFVRPAVNAGGTFPGPVIAGNVGDNFQIVTFNQLIECSMLVDTSIHWHGEFQKGTNWADGPAFITQCPIIVGNSFSYNFNVPGMAGTYWYHSHLTTQYCDGLRGPFVVYDPNDPDANLYDVDDDTTIITLADWYHVLAKEMGAGGAITADSTLIDGLGRTHVNVAAVPLSVITVEVGKRYRMRLVSISCDPNYDFSIDGHDMTIIETDGVDSQELTVDEIQIFAAQRYSFVLNANQPVGNYWIRANPNSGGEGFDGGINSAILRYDGATTADPVTVASTVHTKCLIETDLHPLSRNGVPGNPHQGGADCNLNLSLGFACGNFVINGVSFTPPTVPVLLQICSGANTAADLLPSGSVISLPSNSTIEIALPAGAAGGPHPFHLHGHDFAVSESASNSTSNYDDPIWRDVVSIGGVGDNVTIRFCTDNPGPWFLHCHIDWHLDAGFAIVFAEDIPNTASANPVPEAWSNLCPSYDSAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase
molecule tags Oxidoreductase
publication title Reaction intermediates and redox state changes in a blue laccase from Steccherinum ochraceum observed by crystallographic high/low X-ray dose experiments.
pubmed doi rcsb
total genus 135
structure length 495
sequence length 495
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6zA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6zA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6zA03
1QNIA 5E9NA 3UAEA 2GI0A 2BP8A 3G5WA 1X9UA 1PMYA 1N70A 2GBAA 1NPNA 4Q89A 2H47C 3PPSA 4UF7C 2PPAA 4AKOA 2PPCA 3TBCA 3UAAA 4KO5A 1XB3A 1PAZA 2VW6A 3FU7B 2Q9OA 3SBQA 1FWXA 1KV7A 1BAWA 1BYPA 4W1TA 5B1BB 3ZX1A 1ETJA 3EH4B 4DP6X 1WA2X 1JOIA 1AACA 2GSMB 1AZNA 1JVOA 1XB6A 2CBPA 1RCYA 2IDSA 3FU7A 2JKWA 4HCGA 1NINA 4UANA 2WSDA 3NJNA 3GDCA 3WIAA 4A2FA 1A4BA 4BWUA 2GIMA 3S3BB 4DP1X 4E9VA 5B7MA 4QLWA 2EIMB 4YSRA 5I6NA 7PCYA 2PCYA 4A66A 1JZHA 1SHXA 3SBRA 3NJHA 1CYXA 1AZBA 2J5WA 1AZRA 1V54B 1MG2C 1PLBA 2DY2A 3NSCA 3RYMA 1TEFA 1OCZB 4NERA 3CG8A 4HHWA 4DPAX 1PNCA 2UXVA 1OV8A 1PLCA 2BP8B 3FSZA 4E9WA 3NJJA 1NIFA 1RZQA 2FQEA 1GY2A 4GYBA 4BWTA 3NJLA 2FQDA 1AAJA 2YAEA 1RKRA 3NJIA 3PXLA 2YAMA 4G72B 1HFUA 5I26A 2HX9A 1JXFA 3C75A 5TK2A 2RACA 1SFHA 2HLEB 4JHUA 3MBWB 1JVLA 1I53A 1AS6A 3NT0A 5B7FA 1KGYE 1ZPUA 3TBBA 1KCBA 3U25A 4E9TA 5I28A 1M57B 5D4JA 3T9WA 3OMIB 1W6WA 3ZDWA 3L45A 3CZUB 1M9WA 5A7EA 2R7EB 4P5RA 1BXVA 2IDQA 4HCIA 2YARA 2YAQA 1BQKA 1CUOA 1ILUA 4A2HA 2P80D 4QKTA 4E9SA 4P5SA 1BEXA 1ASOA 3TU6A 3WI9A 2AANA 2BW4A 3QJTB 2BWIA 1NICA 2YAFA 1UATA 2Y1AA 4MFHA 2E86A 1NWOA 4YVUA 3X1FA 4BXSV 2HXAA 3T6WA 2GC7C 4EF3A 2WO3B 5B1JC 4X4KA 5PAZA 2XLLA 3CVBA 4A68A 3X2QB 2FT8A 2UXFA 2BP0B 5FC9A 1FA4A 3TA4D 3GYRA 3S3DB 1L9PA 3X1GA 2VMJA 4G7QB 1OE3A 4HAKA 3QJQB 1CYWA 1MZYA 1A4CA 1HAWA 3UADA 5I6LA 2XWZA 1F56A 9PCYA 1R1CA 4NAJA 4GP4B 1ZIAA 2XX1A 3DKHA 1SDDB 5I6PA 3FQ2A 2VW4A 4YSSA 1GS7A 4HCFA 1V10A 4ZK8A 4DP4X 7PAZA 2PLTA 2DV6A 2XXFA 1MG3C 2EILB 4E9QA 4E9RA 2NRDA 1KCWA 4G70B 1J5DA 1SJMA 4FA7B 1NIAA 4DP7X 4F7KA 2ZXWB 3AG3B 4L0PB 1AR1B 5I5JA 2H5UA 3PCYA 2AZUA 4KO6A 5I6MA 1ADWA 3OD3A 1E5YA 1KYAA 2BW5A 4HHGA 1W8EA 2CUAA 2AZAA 2PPEA 3EF4A 3QPKA 5B1AB 3OM3B 1CURA 1AZUA 2CALA 1OOWA 1RZPA 3AY2A 1IBYA 2FWLB 1GS8A 1JXGA 3JTBA 2Q5BA 2QPEB 4WKXA 2EINB 3ZBMA 1E65A 2IAAC 1SHWA 3MX0B 1DYZA 3IN2A 2YXWA 2GHZA 3FSAA 5I6OA 4PAZA 3CDZA 2WO2B 3PAVA 1ET8A 1ET7A 2I7OA 1AG0A 4F2FA 3CVDA 2BZ7A 1IBZA 3FPYA 1ID2A 2P80A 5LDUA 2XU9A 1N68A 2XV2A 3NJMA 1A65A 2VSMB 3X1BA 5D4HA 3KW8A 4YSAA 2BHFA 1OF0A 1L9TA 3WNJA 1NIBA 1DZ0A 4GY4A 3S3CB 3NSYA 2J57A 1JXDA 1KDJA 2XXGA 1T5KA 3NSDA 2MTAA 1KBVA 2QDWA 4KNSA 4TXVB 1GYCA 3AG4B 1L9RA 3OQRA 4M4RB 4PCYA 1IUZA 2J56A 3NJGA 2VM4A 3SQRA 5I5IA 3ASNB 1URIA 1ASPA 5B1KA 2HRGA 2YAOA 3FT0A 2TSBA 4AI7A 3S8GB 1BQ5A 2IWFA 1V55B 1EHKB 4JHVA 3SBPA 3IN0A 1JZIA 1NIDA 4AZUA 1WS8A 4HZ1A 3FYIB 5B3SB 3X1NA 3FQYA 4E9YA 2FT6A 2YAPA 2IDUA 3BVDB 4GP8B 2CAKA 2FT7A 4BDVB 3OMNB 1KDIA 1WAEA 1OE2A 1XB8A 1L9QA 2HX7A 1E67A 2DWSA 1TEGA 3DIVA 3ABGA 2N0MA 4DP5X 4KOBA 1GSKA 4BWWA 2PP7A 1M56B 1A4AA 2I7SA 2FNWA 4ENZA 3NP3A 1ET5A 1WA0X 1BXAA 4FAAB 2MRYA 2YQBA 2CCWA 4YSOA 2XUWA 5B1JA 3AW5A 4A67A 3FS9A 3H4FA 1AG6A 3AG2B 3H56A 4HIPA 2JXMA 4WTQA 4DP8X 1EZLA 2PP8A 4G71B 1A8ZA 2VSKB 3T6VA 2XYBA 1AQ8A 3UGEA 2HX8A 3EH5B 1VLXA 1AIZA 2XV3A 2GB2A 3AG1B 4NB7A 1GY1A 3ABKB 1J9TA 6PAZA 3QJVB 1SF3A 3FYEB 2J55A 4DP2X 2W8CA 2UXTA 4KNUA 1JZGA 3QJSB 5TK4A 3PAZA 1AS8A 3WG7B 2PPFA 5F7AA 3ERXA 5ANHA 3ABMB 3QQXA 1NPJA 4A2EA 4DP9X 1SDDA 3IEAA 3N2JA 4N8UA 2YXVA 2CJ3A 1FFTB 4F2EA 1NWPA 1ASQA 1CC3A 4A2GA 2VM3A 3NJFA 4YSTA 3UABA 3WKPA 1PZCA 2PPDA 2LLNA 4JKNA 2HZHA 5I6KA 2YAHA 1J9SA 1GR7A 1HAUA 4CSZA 4GXFA 2FTAA 2BZCA 2IWEA 3FQ1A 3CDZB 1E5ZA 3UACA 3ZIYA 1OCCB 5I5MA 2QPDB 1NTDA 1AZCA 4AX3A 2EIKB 4Q8BA 3X1EA 4W9ZA 8PAZA 3FU9A 4KO7A 2TSAA 1IKOP 3DTUB 1AS7A 1SFDA 2UXGA 3EH3B 1JERA 1PY0A 4K9JA 3ABLB 2IH8A 3FSWA 4YL4A 3H4HA 3IE9A 1IC0A 4KOCA 1W6LA 3NYKA 3OMAB 2BWDA 1BYOA 1PF3A 1SF5A 1ZDSA 3KW7A 4YSUA 1AOZA 4BK5C 1PCSA 1NIEA 3TASA 3JT2A 1J9RA 2XVBA 1A3ZA 4BXVA 1QLEB 2XV0A 3T71A 1OCRB 3S8FB 4G7SB 3WNIA 2IWKA 2QT6A 3HEIB 4YSDA 1XMEB 2XX0A 2IDFA 1ILSA 4RH4A 1MDAA 2B3IA 2BO0A 4KNTA 2QDVA 3EHBB 1JZEA 2I85A 2OJ1A 1J9QA 5AKRA 1TU2A 3V9EA 3GXUB 3PLYA 2W88A 1WS7A 2ZOOA 4A2DA 5D4IA 1ZDQA 1BXUA 2A3TA 1WA1X 4UAHA 2ZWNA 3FPXA 4YVNA 4YSEA 2BP0A 3FU8A 2HRHA 2IH9A 1X9RA 4DPBX 2IDTA 4YSCA 3CVCA 3HB3B 1TKWA 4KO9A 2X88A 1MZZA 1ZIBA 3NSFA 3NP4A 1NZRA 4N4YB 2FQGA 2UX7A 2AFNA 5AZUA 2PCFA 4DP0X 3ASOB 3N55A 4CSPA 3T6ZA 5EHFA 4HALA 4YSPA 5AFAA 1BQRA 4GP5B 3T6XA 2DYSB 3IBOA 1PLAA 2OCCB 1OE1A 1PNDA 2EIJB 6PCYA 2VW7A 2JFCA 5F7BA 4BDVA 2PP9A 1ZV2A 1YLBB 2VN3A 5B7EA 2UX6A 2R7EA 3NJKA 1JZFA 1KBWA 3QJRB 4M3HA 1E30A 2AVFA 1B3IA 1AANA 2DWTA 2DYRB 1GW0A 1L9SA 4G7RB 2ZONA 2FJSA 3BQVA 4YSQA 1JZJA 1OCOB 1QHQA 1PZBA 3D12B 3V9CA 1PZAA 2FQFA 5PCYA 2Y69B 3FSVA 3AZUA 4E9XA 4AKQA 1L9OA 2B08A 2GC4C 4AKPA 1SNRA 1J5CA 1NDTA 2X87A 3WKQA 4DPCX 3QJUB 5IY5B 2H3XC 3PAUA 1GS6X 2OV0A
chains in the Genus database with same CATH superfamily
1CD9B 3PJLA 3RWHA 4BFIB 1NMAH 3CFBB 2VLKE 5DJ2B 5E2TH 5HDWA 1EMTH 1WT5C 2DB8A 1N70A 4CU6A 1RURH 5T3XE 4N8CL 4ANUA 1YEKL 4Y5VA 4BZ1A 3VFTB 3LEYH 4AKOA 5F96H 1G9MH 2C7FA 3STZB 1XB3A 1ZA6B 2Q7AA 2AK1H 1HHKA 4KX9A 3OJMB 4NRXB 2W5PA 4MSWA 3BISA 2AJSL 1RIVH 1WA2X 3IJYB 3O2DH 1ORSA 1UA7A 3ULVE 4P2OC 3O8XA 1ZT7A 5JHMA 1NM4A 4KQ3H 1TQCB 2WHVA 3FFCE 3EF7A 2BP5M 5ITBL 1RUQL 4P06A 4PJFF 1J0KA 1DQIA 4UANA 3VI3B 3WKNA 3D50A 3F7VB 1XF3A 3ULUC 4D9QD 4EZLA 3RPIA 3ME0B 4XH2A 2JTYA 3VXSD 3WFCH 5JDSB 4PJ9D 1JZHA 3UXFA 3FW6A 1IC1A 5GS0D 1OIOA 5DQDL 4LSRL 3UEQA 4LSUL 3RYMA 1X5HA 2BSCA 4OLEA 5AZEL 4WI9A 1LP9E 4MNGA 5A2BA 1SBSL 1XTLA 1PLCA 2X4QA 1S7WB 1E50A 2EDTA 3HVNA 3LQAC 3PWPB 1A3LL 1NEUA 5DD0H 1ZOXA 4FQJH 3CZKA 1P4LA 1NCAH 4WTXA 3NJLA 2FQDA 4LNRA 1EO8H 2EVIA 3DXAE 1DSYA 2QQNH 4KK5D 4DFIA 4XMPH 2YSTA 1MJ7H 1LDSA 1RUQH 1KB5H 1J5OL 4YBLB 1JPGB 1SFHA 1GC1C 2BNQB 4FG4A 2DQDH 2HFFB 2WBKA 3Q2WA 4WZ9A 4PCTA 5FB8A 3ZQXA 2VLMD 1IL1B 3ENEA 4X7DC 3U25A 1W8OA 2BSSA 5EFIA 3A4EA 3L17A 3R18A 1DSFH 3DDGA 3ZVVA 1P7HL 4M5TA 1IGCL 2DQDL 4JM2D 5E8EB 5JW4Q 2ICWI 1CXHA 3VGAB 5F7WC 2ICEC 1QEXA 1P1ZA 3ARYA 3CFQA 3HRZA 3NQIA 3SYPA 5JXEC 1JGVL 1VFBA 4N8CH 1HQ4B 1BEXA 5IFHL 4JRLA 1W72L 2IAMD 1NCAL 1WAAA 3V5DA 1V7NH 4DEWA 4DN4L 1GYAA 4OCLC 3GMOA 4WI2A 3QJZA 3LNDA 1S7TA 1UATA 3VXRA 1A3QA 3NABL 1FG9C 4MFHA 2QFRA 3WIIH 1F4WL 2XRAH 5E4EC 4DKEL 5TFSH 4AMKL 2MNWA 2I60L 4WWNA 2QTVA 1ESOA 2FT8A 1WBXA 4MBRA 4N0CC 3D48R 5FF6A 4QJ3B 3TO4B 1OGTA 1OKEA 3VU2A 1WWCA 3SEPA 4YDVB 5DZ9A 3ILDA 3C2SA 4YDKH 4HWUA 4OLWL 2H26A 2CG9X 1YEFH 3Q3GB 4CSTA 3LPGA 5CZXC 2QGBA 5ICUA 2WLIA 3TCLB 3U0TA 3UADA 4A37A 1L0PA 2IPKA 3K6DA 4LSQL 5IVXF 4U1GC 1WFMA 3FRUB 2B5IC 5FV1L 1T3FB 1YEDA 4MCZB 4LRNL 2E9GA 4N8VG 2LT9A 3BN9C 4NQCB 3LKNA 4PGEB 5FM4A 1E5UI 3HZKA 3LRMA 4N8PA 3BP6A 4HX1A 4KKAC 4PJHE 3HG3A 2J1WA 3UPCA 4DP7X 1G9ML 4XRCB 3HZVA 5CCJA 3A6OA 1XIWC 4AEEA 1JP5A 3DBXB 4C56B 5BRZE 5ESAA 1EMTL 2GJJA 4ZMAT 4OUUB 1OSZB 1NMAL 3PWVB 3NH7L 4M3KB 3FUFA 4GEIA 2OR9H 1IBFA 2CUAA 3O45B 3MJ8A 2X4OA 3NK4A 5IFJA 4L8CB 4HIIA 3LRLA 4PRIE 5B4MD 3V7AG 4IK6A 3FXIC 5FOBA 1XD0A 5TDNA 1FZMA 4MXVF 1V7NL 3NH7H 3HBPA 2ZKWA 3L4YA 4YR6B 4ZUWA 2C9QA 3TN0A 3CFKA 3W56A 1HSBA 2CIKB 5GZOA 5JPNB 3ZRSA 5AOLA 3KR3L 1H8LA 1M71A 4RGOH 3G9VA 2NXZC 4RGNC 4I8DA 4WIQA 3T77B 1IBZA 4M7LH 2KZ1B 2XU9A 1IAIL 3OKKB 4NWTL 4YHPA 1N6QL 2HG5B 1V5JA 1SXBA 3JUZA 2XBZA 1S78C 4DHLA 5FGRA 4OM1H 1NBCA 2WXIA 1T5KA 2XXGA 4NO3B 2NTFB 4KNSA 4XGZB 2C1OA 1NSNL 2JXMB 1FE8L 3SPHA 1G1OA 4OGAC 3GINA 4IJ3B 3SQRA 1GGTA 3AWEA 5G55A 4MS8D 3EJYC 4F92B 2VDRB 1CFNA 3QNZB 2WQAA 3WJJC 1H19A 2BFVH 4A2LA 1NAMH 2HCZX 2DMGA 4AI7A 2TSBA 4HLJA 1A3LH 3V4VA 3D3VE 4JO5A 1FZOB 3O2VL 1INQA 1G0XA 1Q72L 3SDXE 3S8GB 3QUMH 2OA9A 2FO4A 3RKDC 3HFMH 4WWID 4ABWA 5EUOA 4BIKA 2WYIA 4GAJH 3HN8A 1QFUH 3HC3H 1QHPA 5FYKD 3TH4T 4U3CA 1XGTB 2YD0A 4UQ2B 5E23A 3ARBC 4X5LA 5CZVL 2ZUWA 5EBMA 2GEQA 4DH2A 1ZXKA 5FKAB 4S1RL 2HVKB 3MX0A 1OWWA 5CD3B 2COVD 4MVBC 1KY6A 2GSIB 2JMRA 3DXAB 1WFNA 4HMCA 4JQIL 2L3BA 2RCSL 3NP3A 1DSFL 4UIMB 2HWZH 3HJEA 4X99B 1U8QB 3UH8A 2MRYA 2XT1B 2Y5TA 5AW0B 4QOKE 5FA3A 1WV7T 2EDJA 5HGGS 4QXGL 5EORH 2I07B 1UOKA 1AOHA 2F7PA 1AG6A 3AG2B 2Z64C 3H56A 4OLVL 3BDYH 3DRTA 2CK2A 4IGBB 3O6ML 2R2BB 3T6VA 2XYBA 1OD7A 1X3DA 4XVTL 2QPSA 1F1DA 2VRKA 1NBVH 2NQ3A 3GJEA 5BVPH 3W2DH 4YLBA 4D7PA 4NAQA 1RMFL 2AF2A 2N56A 2YRBA 2MPAH 4MA3A 1A7RL 1RZJH 4ODHL 5DD0L 1QWHA 3UP6A 3ZDYE 3T09A 4HQQH 3QEGH 4L4VB 5DJDB 5FUOH 5JIHA 3SE9L 1LO3L 2MH4A 5DRXB 1QLRA 4JFVA 5JZ7C 3C9NA 1AD9A 1B9KA 2IH3B 2GTZB 3K81A 5KJRH 3L1FA 3HN3A 4Z95H 1SDDA 3N2JA 4ONGL 1J12A 5IJDC 4KI5C 4LCUB 5IJKA 3C8DA 2BK8A 4JFEB 2VDRH 4O2FB 4QAMB 3RE0A 5EG6C 3QQDA 5DJ6A 4RZCA 4QTFA 2PPDA 4JX0A 5T3ZE 2XHNA 1DVFC 2LLNA 2VMCA 3Q8FA 1RSYA 2JIXB 4NS0A 2VDNB 2YXMA 1NGPL 5AOZA 5F7NC 2SEBB 1VKXA 4CA4A 3C8KA 4C59B 2VAAB 4O2FA 3CFJA 1MCPL 3FDWA 5FCUH 1KEGH 3IU3B 1Q1PA 5GRZA 5IB3A 4Z23A 3SDDD 5MEQB 1FVEA 3UTOA 3ZE1E 3BVVA 8PAZA 3DTUB 1UWGH 1K8IA 4Z0XA 1FNSH 1YJDL 3KL0A 4HAFA 2VAAA 4M1GH 4I1RA 2IH8A 4Q6KA 3TIDB 3HJ0A 1AO7A 3R4DA 4JFPB 2DQGH 2ERJB 2L0DA 3HLAB 1DJWA 1VPOH 4NO0B 1ZT4A 4TLUA 3N1MC 1F1AA 1U8HA 3GT6A 3HIZA 2YUVA 1IIKA 2VC2H 1PZ5A 3IMBA 2VLKD 5BZWB 3P11H 3BGFC 3CHOA 4MTMA 4GXUM 4PJ7B 1UENA 3ZE0F 4Z78B 1MY5A 5CN1A 5D7SH 4OJCA 1GZQB 2QZ5A 4ONHB 5D7EA 1PFOA 2CRZA 3B8YA 5IQ7L 1UZ8B 2WGXA 3MREB 3P73A 4TUUA 2XA3A 3HE6C 1KELH 4QRPE 4PV1C 3VWJB 1BZQK 1I3VA 2ZUTA 3QYMA 4X5XA 1MDAA 3EGXB 4R90H 1G84A 4IBYA 4I89A 3T0EE 3DO7B 1R5WA 3IE4A 1MRCH 3WN6A 1U58A 4NM8L 4DF9A 3VI3A 3GMPA 5HVHB 1IGFH 4M29A 1KG0B 5DRNB 1F4XH 4JY5H 5K93A 3V6OA 5ID0B 3D2TA 3WO4C 3SO5A 4Y4FD 2WZ0A 1QUNB 2AK4D 4PV8A 1Q0YH 4OCYL 5DFVD 4MMXB 3GSUB 4NRYB 3LN4B 4G6JH 2HRHA 3RZCB 1SY6H 5AW5B 5CZXD 3KMDA 3X3GL 3CCHA 3MV9A 4JPIB 4ICWA 4M6MH 3ZDXF 3CFEA 3EYOB 4X6BA 2EC8A 4KO9A 3VJ6B 1RZFL 2D31B 2X88A 2YMXH 3INUH 4JPKL 5I1KH 4X4XA 2YR3A 3IKCB 3PDGA 4RWHA 4LNVA 3TO4D 1BVNP 2P7TB 1BEYH 4XOEA 1Z6JT 4PWHA 1Q9WB 5F7DA 3D18A 2P5EE 1FNLA 3MZTA 1G9NH 3IDNB 3LN5A 1N12A 4AE1A 3RIAF 1AGEA 2F54D 4WSJA 3OKKA 1SXSA 4I0PD 1MFDL 1U91B 4Z7IA 4KJYA 5B39B 1IQWH 4FFYL 5J4MA 3NAAH 4XP9L 3CNKA 3QE5A 4X9IA 1IAII 1YLBB 2ZPKH 3RRQA 2ADYA 4KK8D 4HOXA 3C5XA 4JM2C 3QJRB 5KBMA 1OW0A 5I71C 1GMIA 2CQVA 4BA0A 2HVBA 2AVFA 1OTTC 1UD6A 3NEEA 4JFQB 1I8MB 2DYRB 2EVJA 4RSYA 3HCVB 1L9SA 5I76B 5GGUB 3FQUB 1YY8B 1FH5H 1F0LA 2P5EA 3SSGA 1OTSD 3H2PA 1S8DB 3HAEA 5JW4R 4IBLT 4KI5E 4OQTL 4LGPB 4HS8H 4W9LC 1U8IA 2P5WE 4YHKL 1S7TB 1JHKL 3LX9A 1WZKA 4AKPA 1FAKT 4WU5A 4KK5C 3MXWL 1S3KL 2BS9A 3S88H 5J11B 1I9RL 2OMVA 3SIKA 2ZCLH 2WZAA 4XN2A 2OV0A 4MQTB 1LDPH 1IIIA 4S1QH 5F88B 3DBXA 3O6FB 4K71C 4K15A 2RQEA 4LVHB 4K71B 3VFMA 2X89D 5I1JL 1QI5A 4XVSH 1CGSH 3B8SA 4NWUL 1RZFH 5ISZD 2EDHA 5EDSA 1S5HA 5DLLA 4UQCA 5HI5C 4WY7L 3TF7C 5DRZA 5ALBL 3CDGB 3T2QA 5FOBB 4H20L 1X4ZA 3ZZLA 1F1GA 2JQAA 3ARGD 4G6JL 2J8UE 4IIQB 1BYPA 1TZ8A 1T3FA 4YHYC 2EQDA 1JPEA 4GQ9L 3PQYE 1WZMA 3W0WA 1AZNA 1H5BC 1Q90A 3FO0H 4Q0XL 1AE6L 5F1OB 1KFAH 4EI5B 1GGCL 1NBZB 1SEQH 4BK5A 3V79C 4DPRA 4KU1A 4U1NB 2WSDA 4BWUA 5A16B 3AS3A 4FQLL 4AVJA 1S9VB 3TT1H 3TFKD 1RP9A 4RBPK 4WW2A 2AC0A 3K6FA 4XMLH 3SBRA 4OY9A 2JB6A 3PJSB 1ZY9A 2BHYA 4Y5YC 2CKBH 3HHMA 4WU7A 4NQDA 5FO7A 4P3WA 4RFNC 4AK2A 4S0HA 4FXKB 5DQ9B 3D0LA 4KUCF 5D70L 1D9KB 3CPLA 5GJSL 3X3FH 4I1NB 2EYTB 2PXYB 2BRRL 5K9JL 2MWCA 2Z7YA 3N91A 1H3GA 2FJHA 1XEDA 2BSTA 3PQYD 1VHPA 3T65A 4ACTA 3EH2A 1D5XA 3FTGA 5D2LA 2EKJA 1NCOA 5F3HB 2IQ9L 2F9BT 4KRPB 3H9SB 5I18H 3W82A 2AAVA 1HHKB 4N8VA 4PJEF 3G9AB 4ENED 1BFSA 2L4OA 3GSNH 3JVGA 3CZNA 4OZFG 4B9KC 1TZGL 4Z7VB 3T8XA 2XJKA 3I6SA 1WHOA 2Z34A 1UM5L 4GAGH 3UJTH 4DKFL 3BQUD 5FCUL 4ZI8A 4HCIA 3L3GB 4KDVA 1Z3GH 1OCWH 2AJXL 2J73A 4LSTH 4AQ1B 3QDGA 2AKRA 5ANMA 3D39A 3VA6A 1T2QH 35C8H 1TF4A 3WI9A 2JI1A 1ZVHA 2BWIA 4B3VA 5AVQB 3RGVB 5GS0L 3U48A 2ZOLB 3CSYA 3NTCL 1BWWA 1JGUH 3REWB 3VDBA 5IJKC 4FTVB 1BF2A 3ZKNC 3CVBA 1NCUA 1MLCB 1U3HA 3A6BL 3BJ91 3IPEA 3STLB 4F24A 1CXFA 3BGFB 2X44D 1MI5D 1FA4A 3SD5A 3CCHB 3MV9B 3K0WA 4H2CA 4D8PB 1UURA 3N43F 2ISDA 3QJQB 5SWZD 2E7BA 2UZIH 3SE3A 4JHZA 3CFCH 5D7HA 3O6LH 2EZ0C 3BVNA 5EZOH 3VU1A 3D39E 4EI6A 3JVFC 3VGEA 2CD0A 2A9CA 2Z0UA 3RWDA 2W65A 1KGXA 3PV7A 4ALAH 5I1LB 4OF8A 3N85L 3CX5J 2AV1B 1DQDH 3S36X 4ODTL 2OLDA 3CN0A 1GS7A 3D2UA 4IKIA 5EN3A 5SWSD 3S7GA 4TMPA 4B97A 7PAZA 3BE1H 1BPVA 3MRDB 1MCRA 4RMBA 3ZKXB 4TLSA 2ENQA 4UOQA 2NRDA 1KCWA 2JJTC 3HR6A 3ZE2B 3EO1A 3GZQA 1MFAL 2IPKB 2QLYA 4YDIL 5D1ZB 2HT4D 1C5DB 1OK8A 3GF8A 5JUEH 5ELIA 4KO6A 1KXTB 3UTPE 2IXQB 4H25A 5IVXE 3OD3A 4O4YL 4OFYD 3CFTA 1D3CA 1KB5L 1USQA 4HHGA 5BS0B 1N0LB 2NXYB 4PW9A 5CEXA 3L3OB 4HMEA 3H6AA 1CLZL 4KTGA 2YD1A 4HETA 4JB9H 3U46A 1JPFA 3MLTA 1IAKB 3HZMB 4PJ8B 4KK9C 3W57A 3B2VL 2DQJL 4MD5B 2WZPA 4FFYA 5A2JH 1SBSH 3RI5K 3MNZB 4ORZC 2YD3A 1HYRC 3OKEB 2ORBL 1J0IA 5ALCH 1ET7A 3BSHA 3TBWA 1UASA 2W0FB 1U42A 2P80A 4HKZB 3MU3A 1GKEA 2XV2A 2XVLA 5FX3A 1ZLVH 4LOUD 2NZ9C 1X7QB 1HZHL 3JWDC 5BV7L 1MLBA 1NCDL 3LRGA 1BZ7B 3GSXB 3WLWC 3LV3B 4WTZG 2DQIL 2HUHA 3NSDA 1A9BA 3BRDA 3PQYB 4XZUA 4MDIB 2P5EB 3QEQD 3AG4B 3NFSH 2VWEC 2ZSVB 2JNZA 5DJ8B 4ENEC 5I76A 1YAIA 3QHZL 4W9CC 3DETD 5LGHH 5HHOA 1BZ7A 1BCIA 1OARL 3ECBB 3ZMEA 2RFXB 3DX3A 4GH7B 4ODSL 5ESAB 2QSQA 3QI9B 1HCFX 3U36A 5L9DL 4WI7A 3MOBL 3RIFK 5C0JA 2PCPB 1OP3H 5G4OA 3KBHE 2Z6FA 1KC5L 1XT5A 4R0LA 4R7LA 5E4AA 5BJTB 1CE1H 4L18A 1TEGA 3VGDA 2DAVA 2YEVB 3OLIA 5I8OL 4MD5A 4X5PA 2DM2A 4A7TA 3FQXB 2X4NB 2F61A 1PX8A 3K2UL 4Z5RB 1BA9A 2PO6B 3QUZD 4ENZA 4AGNA 1XF1A 3QS3A 3WMPA 3EHBD 2JKSA 1MSPA 1CFMA 4I88A 5GHWH 2AQ2A 1A21A 1NBZA 1PEZA 3H4FA 2VR7A 4KVCH 3AREC 3QA3B 5J7CC 4GXUN 1XFPA 3GRWH 1UXWA 3MACL 4U1HA 4GKSB 3D4GA 4PV8B 3DXAA 4MZRA 3LRSB 4GBXB 3WTYA 4JS7A 1J1PL 3ABKB 2H32A 2X1WL 5HGDA 4WV1A 1CDBA 4OZFA 4KGJA 2HT3D 2Z1PA 4B0MB 1GPOH 1I3GL 3PXJA 2ARJA 4WW2B 4OKVA 4X83A 4DCQA 3OR6A 1JZGA 4HOWA 1FJ1B 5IUSA 1AGFA 2E4FA 2BVPA 1OAQL 5IKCB 3LRSA 2XZQH 2ZG2A 5T1LD 1D5IL 1T0PB 2MHAB 4YC2B 5E4OA 3TCXA 5E1AB 4JHAL 4YE4H 3KYNB 3NFPB 4PVMA 2YWYA 4HFUH 4J4PC 2C26A 2EDOA 5E1QA 2DTSA 1DL7H 1I8KB 1W0WA 3CSTA 15C8L 5AKTA 5C0CA 1RK0A 3DURB 4PN6A 3FN0H 1JV2B 3BPLC 4YSTA 4NUGL 2F53D 4D9LH 3ESOA 3LPPA 4OFIA 4CADB 4OZ4B 2Z35B 5L4IA 3KDMB 1E9PA 3NRFA 3INOA 5E70A 2OM5A 4KKBD 3WNNA 3ARFB 4HUUB 1MFUA 4NZFA 1UVQA 4OCSH 3HOGA 5DJYB 2WCGA 1I8MA 4GXFA 2FTAA 5HYQB 3FQ1A 4Q2ZA 5GRYA 1UH3A 5DMKB 3QULA 1X5FA 1NTDA 2Y6SD 2Q20A 1PX3A 1U8MA 2H3NB 5A2FA 3L3GA 3X1EA 1MHEA 5LGYA 5KYYA 3FU9A 3K4ZA 4PRHD 2UXGA 2WY3B 3B3IA 5ADOL 2O5ZL 2CJTA 4DQOL 5TE6L 4X8GA 3V8OA 4IHOA 4KKRA 5J1AA 4GRLB 5HY9A 5IP4A 1XSKA 1LO2L 4XT1C 5AVXB 5C0ND 1EFXD 1JHLH 4HJJL 5IB2B 1UKQA 1DQKA 1ECYA 1BYOA 1O9VA 2NY3D 1F11A 1FH2A 5F7EH 3TO4C 4GRWE 5E00B 1PCSA 3OHXA 1QSEE 1Z5YD 2ZJSH 3SKOB 2EICA 1QUPA 5AZEH 1ODUA 1F97A 4BXVA 5HY9B 5BW7A 3S8FB 2ZTBA 1XD1A 3WNIA 1E4XL 3KWVA 2R1WA 4XP6H 2X9WA 3BP7B 4YH6A 2QQKH 4HISA 3WOVA 1INDH 4ZXBC 1T20B 5KVGE 2YOCA 2OMYA 4QLRA 1A14H 4QIRA 4Z77A 4BRVA 3VXTA 1ZJBA 3PWLA 4AGPA 4ONOA 3MRJA 3RVWC 2JKXA 5AVTB 2GPZA 4GQZA 2D7TH 3RURA 2B7DT 1TU2A 3MDJA 4ZW3A 3GXUB 5LWYL 1AC6A 4JFFD 1MCBA 3GZPA 3RU8H 1CD0A 1DCLA 1PBYA 5BRZD 1BQSA 5I74C 3ZT5A 5EU7E 3IXTB 5CAYB 4B6ZA 4KVNL 3EOYG 5BS0A 2YEZA 1PSKL 2H1PL 3EJCA 2YGOA 3DMMC 4XC3H 5E2UL 2AQQA 3VG9C 4BFKA 3TN0D 4TNWK 5A6LA 1E27B 1EZSA 1UJTA 3BZFA 3MBEA 3O11A 3VTAA 3HB3B 1T2QL 3LEYL 4XCCL 3US1A 1I8UA 4Y4FC 5TD4A 3NCJH 2J21A 3J8F7 2NMSA 3UJTL 4DKFH 4WWOA 4NN7B 2V3FA 4OT1L 5DMIL 3MFFB 4G5ZL 3E3QC 1T6BX 3FT4B 3UBFA 4LKXB 3ECWA 1PLAA 3L4XA 2AEIT 1E4KC 2ICWB 3E8UH 4XPBL 4LLMB 1AJ7H 3AROA 4BDVA 3UTTD 3ZE2E 4K8RC 1MWAB 4PUBH 3NCXA 3BP4B 1RLWA 1L3WA 2FEJA 1NOAA 5ETUB 4JCLA 2DKSA 1QBMH 3TLRA 4AMWA 4LBAA 2OTUA 4ZNCD 1J1XH 4L5FL 1VIWA 2DWTA 3RWEA 3EJQA 2NSQA 3IMTA 2ZONA 2C9UA 1A1OB 1XZWA 4JGUA 5GS1B 1KWGA 2YN3A 2CBMA 1J8HB 2A6KB 4MJ5A 4DZ8A 4HT1H 1AHMA 4ICXA 5DA4A 3LEVL 4WHTB 2GG1A 4DEUA 1O0VA 3VWKC 4U49A 3GMLB 5J57B 1CGTA 2IPTH 3WKQA 2FWOB 5IY5B 2GJ6B 3QUKA 2B1OA 1WDAA 4JFTA 5AW8B 3SCMD 3F5WA 4HYTB 2EUXA 5MEQA 5T1KA 3SKNB 5ABDE 4QJ5B 4OJYA 5DEZA 3O6FC 5E9NA 1JS4A 4WFFD 1D5BB 5IJVB 1OM3L 3JV4A 2ZUYA 5F9JB 2PPCA 4X8CA 4GQPH 2UYLB 3IDIB 3GBNH 2YIHA 3T0EB 2W9EH 1A7NL 4G80B 4U1MA 5TDNB 1BAWA 3MLUL 1K8DB 2R69L 3M07A 4S1DD 2WXFA 1CT8A 2CNYA 2YD7A 3FB7B 1USZA 4LEBA 4U1KB 1BXXA 2MOQA 3DXAD 3I3DA 2QPUA 2GSMB 3WEOA 1GOFA 1BQHB 3I3BA 4WV1C 1ZV5A 1OSZA 2Y3AA 1F41A 3MLWL 4PCKA 5E6ZA 3FQRA 1MQKL 1BZOA 3U7YH 3SDCA 3WIAA 2G2NA 4JO3H 3QXDB 4WFEE 4GG8B 2EIMB 3VM5A 1M2VA 1ETA1 1U8OB 4XPTH 4EIBA 2JJWA 5C08E 3DO7A 5C7XH 3IJSB 3ABZA 3NJHA 5EUKB 3S6CA 2C3WA 4JQIA 4OF3A 1PLBA 3G6JA 1XF4A 4OQTH 1HKLL 4JJ5A 1XQ4A 4UINH 5A2CA 3CV5A 4K94H 3DUHA 1WYJA 3QH3B 4X7SH 5I16A 4JFXB 2XN0A 4JN1L 3D25B 1T66D 4YDLC 5AOKA 4JG1L 2COQA 3DOSB 5FXCH 4R0LC 4NLHA 5GGRY 5K1NA 1H15B 1AAJA 1SYVB 4ERSH 4Y9CA 1KN2H 1F6LL 2JELH 1IGYA 2FGWL 3GMNA 1BD2D 3AVEA 5DK2A 4DIXA 4JHUA 3MO1B 5C08A 3RZCC 2BXYA 1RUKH 3MV8E 1IGMH 3L4ZA 4C47A 5I16B 2R1YA 2OTWB 1A6UL 2VXSH 3WO4B 1DQLH 4K7FA 4Y19B 2I26N 3UYOD 4PJAA 1RUKL 2WP3T 4YDJB 5G5DA 1W80A 2Z92A 4HUCA 1A9EB 1HEZA 1ZEAH 3VXQB 3F12B 4WUUB 1JXJA 1Z9MA 3VXSB 5CZRA 4M1DH 5FIEA 1A6ZB 2X4PB 5CN3A 2WLLB 4QAWA 1FNFA 4QEGA 2F68X 2W92A 3BKCH 4H8WC 3V6OC 2P1YA 2YUZA 2OCFD 4WI8A 3MV8A 5GRWA 3M17A 5DJZA 4WAFA 4YEFA 4JFOB 4UINL 7FABH 2GW5A 2F1BA 3CDCA 3F12A 3PDOA 3R7RA 5GSRB 4E41A 2WO3B 3EYSH 3TJEL 1S3RA 3NZHL 1ZXQA 3BUPA 2UXFA 1D7FA 1R24A 1JK8A 3GI9L 3L7FB 4JPVH 5ADOH 3LRHA 4KVPA 2H45A 4P3DB 1WHPA 1OE3A 3BHBB 2GY5A 3G7TA 4HAKA 1QI4A 4AIEA 1B4LA 2F74B 4R2GB 2ICWJ 1SYVA 2KZKA 2BCKA 4I0KA 4UNTA 1ML0A 1MW1A 4QRFA 1I1AD 1WCBB 1SM3H 1YNTA 1ZE3H 2EUVA 1QBML 3MLWH 4RGND 4Z7VF 1V3LA 2WIIA 3T0EC 2NX5E 1WAPA 3CN2A 4HCFA 3WV0A 5J13C 2EADA 3ROLA 1FRGH 4O58L 4LF3A 3RWIB 4FULA 2W95A 4NNYB 2EKSB 4HS6A 4ORGB 1CD8A 3WSQH 1FFRA 1QNZL 4LAQL 5GGVY 5HDLA 4J8RB 1K5NA 4XBEL 4YZWA 1PD1A 4PB0L 2AZUA 2X2JA 3QUMA 1OB1B 4FG6D 4HH8A 4PRBA 3KPSE 4PJFE 1PSKH 2HRPL 5CEZH 2OTUB 4G8GE 1QQDB 5D72H 5EBLA 5A6IA 2F8VA 2ZWZA 3ZRCC 3CHXA 3OM3B 4E41D 3QHFL 2CALA 5IW1A 3UFIA 3IMWA 4NUPA 1XCTB 3HG1B 3WL9A 1KEGL 1CCZA 2NYZA 3JTBA 4L3EA 5EZLB 3QCUL 1I3UA 1P7QB 1SHWA 3BQUB 4K3EH 3BEVB 4NQDB 5FO7B 2VDPB 5FA4B 2G75B 1INDL 2A1WL 5HHQB 4KRNA 1XEUA 3L6FA 1J1XL 3RL2A 1JHTB 4JO1L 5AYQA 5ABZA 4YPGB 1BAFH 1CXIA 1IM9A 4G6AD 1WD9A 1S9VA 3MTXA 3TZVA 5D4HA 3D9AL 4OGXH 5CLYA 2K9FB 5GS1C 1U8JA 3BD3A 3VFOB 3RWJB 1FIEA 3CXDL 4FNSA 5EIIB 3TBSB 1JYNA 3ULVD 1FIGL 3WU1A 5E6UB 3ZJAA 5J6HA 3TOPA 2NZ1A 1X4YA 3OQRA 1U8LB 4MJ5B 2WLZA 3N6YA 2J56A 4DZ8B 5F9WC 3C6LD 4P57B 5DU7A 1KPRA 3QEGL 4JM0A 4OT1H 5L2KD 3S3JA 1F58L 3FT0A 2V9UA 1BQ5A 4Y9FA 1Z0NA 4Q4EA 3PP3K 2MCAA 3O41B 3CTTA 3PQYA 4XZUB 4MAYA 2PR9A 1FNGA 2AJZA 5JHDE 5MERB 1M7UA 1I7RA 2CRIA 4M8RA 3KCWA 4MZ3A 2X6CA 1E8XA 5TGBB 1NGQH 3D39B 1DLFH 1VAHA 2OMUA 2Z8WC 2MSPA 4K0OA 4DQOH 1MPAL 1QA9B 5CXPA 4N68A 3T3ME 5HGAB 4AYFB 4X6DF 4B41A 2EVGA 2VXUH 5E5MB 4UZUA 4XXDA 2V3EA 5ADPL 1FNGB 2ZX7A 5LHDA 1D5RA 2F8XC 1OOAA 1CL7H 5KSVB 1T1ZB 5EO1B 3ZW3A 1JYWA 2Y0SA 3KEHA 3QQ4A 2EH8H 1MAMH 3MFFA 2ATPA 2Y5QA 3MRLA 3AW5A 3OLEA 3FUKA 5F7UA 4KHTL 2H8PB 3OPUA 1SUJA 4WNQB 4Y2DB 2J88H 4LP8A 1RZIA 3FL7A 1U8JB 2PP8A 4ZS6D 3GI8L 4J4PD 2LFGA 3FQTB 4NFDA 4PRNA 4X8JB 3IM1A 3BP6B 4HX1B 3CE1A 4RAUB 5EBWB 5KYUB 1R3JB 4PLJD 1JFQH 5C8JB 4P5MB 4XNUL 2WJ5A 4P48A 2HT4C 3ZDXB 4NQCA 3ZL1A 1B0RA 2AK4B 2K3TA 5IR1B 2VR5A 1UHVA 3FO1B 3P4NB 4NUJB 1DQVA 4RNRB 5T1MB 2BSDA 1WZLA 2WQSA 3CH1B 3LN5B 4MAYD 1OAQH 4J28A 2EE0A 1WGOA 4UM9A 5TK4A 4NZTL 4ANKA 6TAAA 3HE7A 3IJEA 3LKRA 4JFHD 3OPZL 5I0VA 3SCMA 3CSFA 3SB3A 3RNKA 1KOAA 1KIRA 4R3SB 4WQOA 5GS2D 2YBRA 1ZT7B 1N0LA 4N5UA 4JGMA 4OF7A 2H4EA 3ROOA 1IT9H 2OZ4L 1KCRL 3BPCA 4PJ5A 2GJ6E 3S97C 1TJGL 4MXQD 3TN0C 1SJEB 1J1OH 1L0XA 5DYOA 1ZGLA 2AJ3B 2A4CA 3U6XS 1S8DA 3W5MA 4KKCD 3BPNB 3DX4A 3OC8A 5I8OH 1HAUA 1UB6A 1S5HB 4I5BA 4LEOB 1DP0A 1MCQA 4ZD3L 3IF1A 4G7VL 1TJGH 5D7LE 1KYUA 2FX9L 3CDZB 4PJBE 4C4BA 3BKMH 1T04A 4KKQA 1I85C 4YHOH 3GKWL 2JCCB 3P4OA 3QG6A 3RY6A 1UYWL 3TA3A 5ICYB 3RX9A 2WVVB 2Z91A 4GBXA 2HFGL 3BH9A 1SOXA 1LP9B 3V6FA 4L4TB 4MD0A 2YA0A 3PHSA 3L5JA 1G7QA 2J72A 2GJ6A 1XDTT 5DMKA 1NCHA 3CSGA 1GAFL 3QHZH 4Z7NF 4PJAE 5E2WL 4Q97A 4OJEH 1SXCA 2IFFL 2K8MA 4WWKC 3OMAB 4Z7WA 1ZKAA 4JPWH 2ZXGA 2VDLL 4MDJA 4W9IC 4E2OA 4MQSB 4BK5C 3PV6B 4XNXL 1GZHA 4CBZA 3SDAB 4UOW0 1KGIA 2VN5A 3U9WA 4IOFD 1N7MH 2VO8A 4QCIA 4XMZA 5LCVH 4AZ8A 5MEND 2G4EA 2PYFB 4HK0A 5D7KD 1NAKH 4QHNA 1M3IA 4PS8A 1NC2A 1E4WL 4Y19D 1DJHA 1SHMA 5CBEA 1RHHA 1O7DE 2R23B 4J6RH 1B0GB 3FT1A 4LOEA 4OI9A 4R9HA 3MRNA 2VC2B 1JZEA 4N6QA 5HYSG 4GBXC 2Y6SC 1VB9A 3EDDA 1GGBH 4KK9D 5ALCL 2ZF9A 2PXYD 5F3HA 4YS4A 4TN9A 3P3UA 4ZSOB 4GAAA 4UTAH 4U1SA 2GFBA 1EXHA 4P4RB 1I1RA 5DMGC 5DDHB 3P77B 1JAEA 1S9XB 4OGYL 1I8LC 1C7SA 5E9DD 1DO5A 4C56A 3GSVB 3MRBA 5LNGA 1JXKA 3M45A 4RMTA 1J0HA 1OPOA 3PUCA 1N18A 1TXKA 2Z8RA 4JPVL 5JIPA 2NY6D 4QRSA 5AZUA 1L5GB 4UQAA 3VFTA 5JUEL 5LGHL 1N5AB 1NMCC 3BE1L 3TH3T 1YEDB 2FIKB 3MRPA 3U6RB 3EYQC 3T6XA 1B4RA 5EOTA 4DK6A 2F5AH 1EXGA 3N44F 3FJTA 5CR8A 4RZKA 1MHHB 3LPFA 4HIEB 4K7PX 4K5NA 1L5GA 2EDKA 5KSAC 3R19A 1TITA 4XMPL 4YFEA 2W60A 2DWDB 4HC1L 3V4PA 4L0YA 1UWFA 3GRWA 4N2NA 4R84A 1NFAA 1B3IA 5DUBA 1OSYA 3ULVF 3G6JF 5DDHA 2W80C 3H6JA 1CFSA 1TLKA 2D2CC 3I6LE 3QQ4B 4U33A 5BW7C 4PJCE 1YNLH 2WYTA 4AG4H 1DZBA 3Q0HA 2ATPB 2FQFA 3DV6A 5PCYA 5IHLB 1NC4A 4JAMA 1AD0A 3ZOAA 4DPCX 3QJUB 2GSGA 4NUQA 4M5YL 4P5TB 4IU3A 5T1LA 1CO1A 2RIKA 5EZIL 1C12A 1RFDH 3FB6B 2E7MA 3BKJH 3ZR6A 4WWKD 2UY7A 4HAGA 1WH0A 1AQHA 2HPOA 1PDKA 4HS8L 4WI6A 3ZIMA 4PJ8C 4L3AA 3FONB 1XCWA 2BY0A 4MXWH 3SN6N 1JGLH 4L4TD 2AMGA 4P5TA 5HYQA 1K85A 1MHHA 4YJZL 3T6QC 1FWXA 2UZPA 1G7LA 4O58H 1F11B 1TQTA 3N9GL 3SDXA 1IGIL 1DBBH 3ZX1A 2CDFB 3MLZH 2PO6D 3MR9A 3QUZB 5L7XH 3ARWA 3HG1E 4QD2E 2BSBA 5K39B 1NGZB 4GS7B 3FTZA 3CHPA 1K4CA 3ARFD 1FIGH 3AQZA 1U3JA 2R2BA 2WAQA 4ZW8A 4NJAL 3A4AA 5ABAA 1NFDB 1DVFA 4FZEL 3SKUD 1CICA 4OIFA 4UT9L 2J8UA 2HTLC 2MNUA 3VDCA 4LU5H 3FTSA 2VZOA 1NAMB 3GI9H 4ZOEA 5DEJA 4H8PA 3MOAH 3RGVC 2XG4B 4CKQA 4Q9CA 5KW9H 3TJEH 4PHZA 2E3VA 2DY2A 4YQXH 1TEFA 3TFKC 2ZOWA 5CLWA 3CG8A 5I8EB 4GO8A 4OLZL 2A9BA 1P4IH 1AR2A 1XCTA 3HG1A 2BP8B 4V1DB 4LIQH 1OXYA 5D1ZI 1OGAA 3C60D 4KUCD 3WJLC 3IKCA 2X6MA 3MFGB 3WD5L 2GIYA 4IBTA 2P5PA 1T1XA 4RFOH 3PGDA 4G1EA 4FP8H 5DTFA 1DBKH 2YAEA 4NKIH 1XX9C 4G72B 4MJ6B 5H4ZA 1SJEA 5DYOB 1AMYA 3C75A 2X53A 2RACA 5TK2A 1F4XL 2DIAA 2F54E 2HLEB 3FT2B 3MBWB 3CBKB 3IJYA 1R3KA 1QUNA 3IFLH 4U6HB 5TF0A 1E3XA 5ECJE 4P4KB 1SEBA 5DMGD 1UA3A 1UGKA 1E7UA 4YX2H 5CCKL 3TYGH 3ZUCA 1P7KA 4FXGC 4KHXL 3L45A 4ZTPH 2V17H 3IETB 5KZCB 1A1NB 1YN6B 2IPUG 5HYIA 3RGVA 4S1QL 1JF1B 1FRGL 2ZIDA 3DGGB 2IBBA 4CC4C 1RZ7H 4ISVB 4MA8H 1G4MA 4FQIH 4N2GA 4PTUA 2P8PA 3UZVB 5I1GH 1CDHA 4NWUH 5AL0A 4RFNB 1RHHB 4GIOA 1ASOA 4FQCH 4IBUA 4N0RA 4D0BA 3GK8L 1WBZA 3H0TB 1G7MB 4Y2DA 4AYBA 1MCOH 2WLJA 5DSCB 3FMGL 2E86A 5I1IL 3SPIA 4PRNB 4TOYH 1TJMA 1WPCA 4PRDB 4X4YB 5E99L 3WGVB 1YJDC 3V55A 5PAZA 3IDMA 3GXDA 4A68A 3W11D 2P24B 3GD1C 5FC9A 3WMQA 3NCJL 3WDJA 1HH6A 5CILL 3GO1H 12E8L 2Z7WA 4HWBL 1XGPA 3BAXA 4GAYA 3MV8B 3Q5OA 4PRPA 1GXEA 1MZYA 1HAWA 2NSMA 3RWEB 4F7CB 3KGRA 1HEHC 4X80L 2BHUA 3MUHL 5JORA 5DVNA 4WLCA 3T77A 2CJSA 1X5AA 4DP4X 2DYPA 1D7DA 5EEWA 1G4RA 4YDJA 3FC8A 1MG3C 5E8EA 4YNYB 4LVHC 4Q6YA 3CWGA 4Y89A 3EUUA 1Q0XL 3KS0J 1XF5A 4IRSD 1QZNA 3WE1A 4HUXB 1O5DT 3PJNA 4URTB 3J2PA 1FZMB 3TV3H 3MLTB 2PKDA 5F7FA 5HPOA 1DJYA 4JDZA 4KJPC 5DD3L 4XCNA 5F0JB 4PJIE 3X3GH 1SY6L 3A4DA 2QR0B 1DANT 3B83A 2X70A 3S35H 4F33A 2AZAA 1EAOA 2PPEA 3VSVA 4X4YA 3D51A 4LMQE 4BKLB 2BVEA 1AGDA 1MQ8A 3MXWH 5BV7B 3RTQB 4DERA 2W0FA 3VWKA 2A5UA 2E7HA 3ARQA 1IBYA 4DZBB 2FWLB 1BVLA 1FFNA 4HD5A 2QPEB 2B0SL 2ZXQA 5CWSA 4V33A 2X0VA 5I30L 3IAPA 3PF2A 4JM2B 3UBXG 1LWRA 2LU3A 1DQMH 3K6IA 3CLFH 5BZDB 4TUKH 3BJLA 3L5HA 1KACB 1KB5B 4K4KA 1AGCA 1GW6A 4WJKB 1MCWM 3UPRA 3X11A 3BLBA 4FQ1L 1B9ZA 4A63A 5B8CB 5LDSA 5IHZB 2CKNA 4NT6A 3HBZA 3X1BA 2XWTA 4NXKA 1CTOA 2FX8H 2YJQA 3Q05A 4NN7C 5DR5H 4BHUI 3RWGA 5EU3A 1Q38A 2OPCA 2UUDK 4M7JH 1ANUA 1U8NA 3EGSA 2EO9A 5I9QC 1GJUA 4BQ8A 1CFBA 4RWYH 2R1WB 5KS9F 2GITA 1JWUA 4NZ8A 3VGHA 4AYEC 3WJMB 1KLFA 1TZHB 5CS7A 5CCGE 2R0LL 4PY7A 3MRCA 4XOBA 4BZYA 3EO9L 4NRZA 4LDOB 4ODWB 1A7PL 3DBSA 1EHKB 4PMEA 1E6OL 3GBNL 1FV1A 1ZANH 4JFZL 3V4UH 3PNWB 4KTDH 3RAJH 3UTZB 2Y7LA 1TVHA 1AVAA 1H6TA 3O2VH 3CH8A 2R15A 2X4UA 4UT6H 5BXFB 5HYJA 1Q9OA 2F5BL 3HMXH 4QCIB 4AZ8B 3FO2A 4D0CB 3ABGA 2RB8A 2X2YA 2ZP0T 3OG4B 4KGLA 3VFUB 5F93C 4LLYB 2EEFA 1M56B 1N8ZB 4OCXL 2BIIA 5T5NF 2C4FT 1Z9LA 3QDJB 4TL5A 4DAGL 3APCA 2EUZA 4ZTOH 1G7JB 4K7PL 4WKZA 1NGPH 3QUZA 3N42F 1ZWIB 3BCDA 4TRPH 5LN8A 2HG5A 2FYVA 1N6UA 3R1GH 5GXBB 1QRNA 2AQPA 1RJYA 1CF8L 3VXNA 1XXDC 4P04A 4Y16D 4FNTA 3MRHA 3PGFL 2ZP9A 5K69A 3KJ6L 1ZLWK 1FGVH 1Y07A 2XFGB 1E4KA 4QHMA 3DVGA 2C7UB 2OSYA 2IGFL 4B9GA 4MJ2A 5GGRB 1T66C 2VH5H 3FQ4A 4H4NA 4OH2A 3KWUA 3T4YA 3QGVA 4AJ0A 1NBVL 2MQGA 3HC2A 3WG7B 3VD4A 5DMIH 1SVZA 4AIZA 2P46B 1UM6H 5JW5B 3V4LA 1KC5H 2PTTB 1DDHA 3HG4A 2EE2A 5EOQH 1NC4B 4H40A 4JAMB 4FMFA 2ITFA 2MPAL 1YJDH 2FL5A 3Q06A 2YS4A 2YXVA 3C2AH 1UWGL 3OKNA 4WNJA 5E2JA 1FHGA 3WEAA 4MKMA 4BFGA 4JVPA 4A2GA 2BSTB 2WYHA 3DIFA 3ISRA 3WTWA 2XXMB 3US0A 2BDNH 1T7YA 1HYSC 1DQQA 1R5VA 3O6MH 4MWFB 3QO0B 4XHJD 4YUEL 3QDJD 4L0ZA 4U1NA 1KEML 1JDDA 1NEPA 4BFFA 3ZTJG 1C5DA 1KB9J 4JZNA 2OK0L 3K0YA 2MJWA 4EI5D 4WNSA 3RU8L 2RCSH 3NCBB 1CIUA 3QPXH 1S7QA 1EAPB 4GW5A 5B1CA 5DZLA 5DEGA 3HC3L 3GIZL 5D93B 4U1JB 1C8PA 3FUNA 2RJMA 5C8JA 4AY0A 4P23A 4UV4H 3L13A 5DC0A 1IEHA 2ZYRA 1RLBA 4TSAH 4OF6A 1L7TL 2TSAA 4XPGH 3WHXA 4ZX3A 3OZ9L 5EF0A 2DWXA 4XWOC 3NOIA 2W07B 5ACZB 4ONGH 2EC9T 4A2MA 4WJ5B 5FGSA 4OZIE 5AKVA 3ABLB 3MCYA 4P07A 4XAWH 4D2NA 2R2HA 2LE9A 4FNQA 4YL4A 2C9RA 2XZQL 5T1LB 3O2WL 1H6FA 1IC0A 2FATH 1G6RH 3O9WD 2NSXA 1UZ6F 2D3NA 2QVTA 3DSFH 3O6FD 4MS8C 4NKDA 5JQ6L 1OLZA 1WBXB 1FHNA 2VZUA 5C07E 5KEZA 4A55A 3QIWA 3FB7A 1P4UA 2YRZA 5FB8B 1N0XL 1W72H 2XXCB 1CVRA 3WFEH 4IK7A 2XVBA 3I6KA 2YPLD 1WWBX 3I2CL 3PL6C 1GYVA 1BVKB 4JFEA 2F7OA 4D9RE 4GRMA 1U95A 5TH2A 1ZS8B 4OLVH 4M1CC 5CKAA 1GCYA 5INDB 3D4YA 5ANMB 1ILSA 4HEME 4AYFA 4KJYB 5B39A 1AXIB 4P2QB 1B6UA 4HPOH 4NPJA 4XVUD 4ZOCA 4M6OL 1TUPA 3ARBB 3K80A 3TC9A 4G82A 4NKMA 3CHSA 4AQ8A 1IEBB 4PGEA 4FE9A 4MYWB 4GKLA 4G8FA 5B22A 3OLGA 4OJFL 3I9AA 3HAEB 5IB4A 3VH8G 5GS0C 4LCYB 2F54B 4DSYA 5A3IC 1ZVNA 4ZAKC 1VRSA 4YXHL 4P9HH 1MFCH 1U3HD 2XZCL 4XMKH 2JWYA 3QBTB 2VLRA 1K4DA 1ACXA 1QFPA 2BP0A 2ID5A 3HHRB 3QXVA 4IM8A 1Q9WA 5DHYB 2NT0A 5D7IB 5F7DB 5TE4L 1CTMA 4NO3A 4HD9A 4G6MH 4HIJB 1BD2E 5A2KH 3FBKA 1TKWA 1IGYB 1MZZA 1S2EA 3DV4A 4M6NL 4IJ3C 3L3OA 2E7LC 4JDEB 4FLRA 3RFZC 2B1AH 2PCFA 1EHLL 3ETBJ 1LWJA 2N59A 5D2NE 3T6ZA 5EHFA 4MJ6A 1M71B 5FO2A 4DGYL 3VXRB 3JWNG 3MRDA 2AV7A 3MUUA 3O3AB 2OCCB 4HUNB 1N8OE 1RIHH 1MUJA 3FOMA 5ITBH 1SXAA 4JRYA 3GUFA 4J3XA 3EGXA 4IDJH 4X5WA 1BPLB 1RULH 4HSAC 4I18B 5JPNC 4LSPH 4PVLA 3NJKA 4S1SL 3OF6A 1BAGA 1BZDA 1C5CL 1SJHB 3QUYD 2VQ1A 1J48A 3N06B 1F4HA 3O45A 1NCNA 3VFWA 3BPCB 4Q9QL 1YNTB 1U8NB 3EGSB 5JIQA 3E1ZA 3HNSL 1X5XA 3K71A 1KCKA 3QORD 3VI4B 1G6RA 1FYTB 4AUYA 2DQCH 5IFJB 1H3XA 4R26L 2O6PA 5H37H 2V2TA 4Z7OB 1KIRB 1Z5LB 2BY2A 6FABL 3UO8B 1ACCA 2VR4A 2IV9A 4X8XA 5E8NA 3U30C 2G4GA 5DHYA 2IAMB 2QADC 3HI1A 5JXEA 3KPMA 5GRUL 3S3SA 1EVTC 3T0EA 1OF2B 3FUHA 2G5BB 2NTSP 2UZYA 5CGYC 2HA1A 1QATA 3N43B 1FFPA 4PI2A 2WCPA 3F7YA 1Q9OB 3H3BC 4K3DL 4LOUC 4NPYB 1HOEA 2NUTA 3V6FB 3EYUL 5KVFE 5I66B 4M7LT 5FAAA 3SJVB 5ILTL 5AG8A 2GBAA 2KDGA 1YYCA 4U3XA 4OIIL 4QXUL 5SX5K 1BJ8A 2B5IB 2VLJE 1DEEA 2CKBL 2XNAA 5A43C 3SCMC 4KO5A 4WO0A 1PAZA 2D0HA 4HS3B 4B9IA 2VL4A 2QADB 3OKLB 4R4FH 1GOGA 3T3MF 5D71L 1UZ6E 4L8SB 1B0WA 3V0JA 4S1SH 1UZGA 2WBJB 4QRQA 1BOGB 3CFKB 3ARGA 4XP4L 4FQPA 1N0XH 1RCYA 5DJ6B 1KFAL 5IMLA 4AV4A 3P40A 3RVXC 3ZSTA 1UB5B 4M5SA 1MRFH 4AOFA 4KI1A 4K5PA 4TQEL 5DUBB 1MRDH 3ESVF 4CUCA 3S3BB 5B7MA 4NDMA 5JQ6H 3WXVL 3G04B 4FXTA 4Y4HD 1R0AL 2HN7A 4Y8DC 2VLJA 5ECGA 4K5LA 1GSMA 3A6BH 5DQDH 1NLDH 4LGSB 5EU3B 1SLWA 5I0DA 3OAYH 5DZPA 4FZ8L 3NSCA 3T1FB 2G5BA 3ZMRA 5F9OH 1I7TA 2X5PA 5EU5B 4TQEH 2IVFC 3QDMD 4ETYA 2BIPA 4H5SB 4XB3A 2XTJB 4KQ3L 4JB9L 2P45B 4Q14A 4APQC 4P9HL 1CLZH 1LQSR 1NEZA 5D7LB 3OV6A 1I9RH 5C07B 4R97B 3L4VA 3I50L 1QPPA 1FO0L 2VZ3A 5D71H 1ECZA 4Z7QB 2K6ZA 4OFQA 4YE0A 4AYSA 4XNDA 1KGCD 3OXRB 4QRSB 1AS6A 4OLYH 3T3PE 3BPOB 5BCAA 4YDIH 1T1XB 4QUOA 2JI3A 5CU9A 1MFAH 5I28A 2G5RA 4KRLB 5DJXA 2V8MA 1M9WA 2R7EB 2IQ9H 4FABH 2A6DB 3KLDA 1HINL 4HFWB 4K23H 1CS6A 2Y07H 3MV11 4I3SL 4Z18A 1UGNA 2ADFH 1TSHA 5ENWA 5HYSB 1IKNA 3CZLA 3LNEA 4QKTA 1SEBB 3E3QE 2X41A 5K9JH 1F4YL 1RIUL 2AANA 3LIZL 1F90H 3OAZK 5EZOL 4PJGF 1QSFD 1T6VN 2VXQH 3IXAA 4LSSL 5FHAH 3RY4A 3HZYA 3O6KL 1G6RL 1MCIA 1TENA 4N2FA 1QABA 2GC7C 4KJPD 3QUKB 5CUSL 4X4KA 2EP6A 1WUNT 2OYKA 2JKNA 2XWRA 2BP0B 1KBGH 5FUZH 5IREA 2GBVA 4TVPD 3FCUB 4KY2A 4OZIA 4BH7B 4NYLB 1JGUL 2AXGA 3MNVA 4L4TE 5DZJA 1GYWA 3NVQA 1A4CA 2EKSA 3MXVH 4XPAL 2UYLA 3IDIA 4F7TA 3S4SB 3B9KD 1R1CA 1Z0MA 2YGQA 2OL3H 1CFQB 4ZAKA 3B2DC 3X13B 1TFHA 4ZFOA 1E28A 3BIKA 1LNUA 1NBYB 1CDCA 2I69A 3LKSB 3WCYA 4AE0A 4Y0GA 3V2AR 4QI3A 2PCXA 4ISVA 4GT7A 4G70B 3C60B 3IKKA 2WBWB 2HAZA 4MQXC 3UYRH 4Y5VC 4H8UA 3GS7A 4PJDB 3LQZB 1VGKA 5F96L 1AR1B 4M6NH 2R51A 4PIRF 4OB5H 2H5UA 4F80A 4AJYV 1CR9L 4L3EB 3IU4L 1ADWA 1PYWB 1E5YA 1XL4A 2Z3FA 5E51A 4LBEB 2QPFA 2A6JB 4UI2A 5FYJE 2A4ZA 4X42A 4H7VA 1UXSB 4IHBA 2FSDA 4F20A 3EF4A 5L0QB 5JLZB 2AI0L 4EDWL 5ID1B 1IILE 2X0UA 2K7QA 2Q7YA 4YHNB 2IGFH 4KKLC 5DFAA 2NLJB 5FPIA 4L8BA 3Q2VA 3OKDB 4HSQA 5C6TH 2ZXDA 3BSZA 3SDDA 2BC4B 4KDWA 5EU4B 1YVLA 3C5SA 3LB6C 4U2YA 3RUGB 1OAUL 4JKKA 1U58B 1R9FA 3CDZA 3BDBA 1CK0H 1ET8A 1QSZA 2VRQA 5DRNA 5DLMH 2BSED 2NQDA 1IRAY 3FOMB 4ZMYA 3KPOB 4BGLA 2O6CA 5CWSB 1T4WA 5I1HL 1Q0EA 2B59B 2BHFA 2XVGA 5GS2H 1NIBA 3KGUA 3X12A 2IG2L 3FQWB 5EO0B 3S3CB 1HDMB 1RH8A 2W94A 4G8EA 5EN2A 2BWQA 1JF5A 4CC1A 4CVZB 4KZEH 3H42L 3CVHH 5D7LD 5EZJB 4BINA 1GHFL 1T7XA 1OP3K 1BF5A 1L9RA 2C3VB 4MA7L 3SZKC 2EIZB 4KZDL 2EZ0D 4ZW6A 3C09C 3L2MA 4PR5B 3W0WB 3C09B 1JPTL 3ZR5A 2OMZA 4V2CB 1UWEL 5DD6A 1V55B 4JHVA 2BERA 1JZIA 4JMXA 4AZUA 3I9GL 1NGWA 2ZNWA 1VADA 2YK1H 1S9WB 1T1ZA 4B9FA 2J20A 3CFUA 1B6DA 3O6FA 3BC9A 5T3XD 4XCEB 4HC1A 3LIZA 4D3CL 1PIFA 2VLJB 1LDPL 2OYLA 2C3GA 1WAEA 5KOMC 4YHNA 4RMWA 1OGSA 1UD5A 1MCNA 3FU6A 3NSXA 3U7AA 4DJMA 2GEEA 3F58H 2GY7B 2OK0H 2IBZY 4U2ZA 4Y1SA 5BZXA 3CVHL 4ZQTA 5IZ7A 2HT2D 2FEDD 2Z92B 3B2PA 3LY6A 2AMUA 1HU8A 5TDPA 3CDFA 3U1SL 5DJYA 4L8SA 4NCC2 5F7LB 1I1FA 2LGNA 1JGEB 5MP6L 3L9EA 5CCHE 3BP5A 2CK0H 5CHNA 4U7SA 3UTQB 4KJWC 3C6LB 2OJEB 4PJ6A 3OSVA 3L7EB 3QDJA 3RUGF 4YHZL 1LJMA 2GB2A 3IFNH 1U8MB 4N2OA 3IAGC 3S5ZA 2AEQL 1A64A 2OTPA 1N5YH 1PW3A 4Z7NE 3BVWA 3L16A 2Z31A 1XSOA 4KV5F 4ELMB 1G43A 1AR1C 4IIZA 2FUTA 3KL3A 1I9JL 4L29A 4HG4K 1RVFH 3PAZA 5LGJA 3G5ZA 3PGFH 1FV1B 2A9MH 1F86A 3LH9A 4FQIL 4N2BA 3WIHA 1RZ7L 1BZEA 4CADA 4A2EA 2JSFA 2XQYG 4OZHF 1WG3A 3ZK0A 4ES9A 2NY5H 3AT0A 4AQ8C 1BYNA 4OCWL 5IB5A 4PS4H 3VYPA 3FUEA 1NDGB 2CJ3A 5CCKH 4KNQA 3WL9B 3ZO0A 1EO5A 3RTQC 2NY4C 1LD9B 2BNRA 3MOQA 3QIUB 2CO7A 1PZCA 1YEGL 4X5RA 2Y3NA 2WKGA 4Y4KB 3K6OA 1Q0XH 1IE5A 5IW1B 5TDOB 1QW9A 2ZQKA 1ITCA 4X98B 5GGSA 4KXZI 4D8PA 5KVGL 1SJHA 4ZO7A 3OKNB 4D9QE 1CWVA 1AQDA 1MW0A 1P9MA 3KDPB 1TT6A 4NENB 5F1NB 3ZQ9A 4OAWA 3ZIYA 3RVTD 1ZHNA 1FN4A 3QYNA 3OAWA 5HYSA 5A6MA 3FNKA 4MAYC 4N0YL 3GUTA 5SWSE 4KO7A 1UACL 1CU4H 1F02I 3BLKA 4R7NB 2NY0C 3VD5A 1RUAH 3T8MA 3IB4A 4HIXL 4LHJB 1DE4A 3IT8D 4KRPD 4UT9H 1X9LA 2LLLA 3O11B 5E6SB 4DT2A 1QFWI 3HC0B 4DOHE 5KYWA 5FWQA 4RWYL 1MCLA 2VC2L 1RD6A 4P3DA 4TS6A 3SDCC 4Y4FB 4FQCL 4JM4L 1U8CA 1KBKA 4JUSA 2YGNA 1R24B 2F74A 1VDGA 4AQEA 5A2IH 1NGZA 4JHBA 2EIBA 5T1DH 5IMMB 1I7TB 3NIFB 1BP3B 4ODXA 4IIQA 4XNZC 3VG9B 5D8JH 5ITFA 5L7XL 2ZOKB 4X6EA 3KPRA 4H2AA 1EERB 3HEIB 5AYTA 5MP6H 2ZCZA 1VZGA 3A4FA 1IGJB 3VTMA 3DYMA 4OKDA 3UGUA 4D0CA 3L9YA 1UM4H 5I30H 3QQ3A 2JE8A 3QWOA 3QZOA 4DW2L 3CFJB 3IWVA 2G9KA 2A0LC 1SMDA 3PLYA 3G04A 1U95B 3OJ2C 1UCTA 4TSCL 1IBGL 1NMBL 1DBKL 1F2QA 3KLAB 4H1LH 4R4BA 1WA1X 4UAHA 4WGWB 1BWMA 3S96A 4QHLA 1ND0A 4F58L 4S10A 1QBLL 2QVIA 2IDTA 2W0KA 4TVUA 5CUSH 4OLWH 4HCRA 3QORC 4UUJA 1JE6A 5DK0B 4HUWA 5KJ7E 3N44B 4FX5A 4BCXA 3UDWC 2HT2C 4P4KD 5D4QA 3RPKA 5F8RC 3LCYA 2C1PA 1KBGL 3D6GA 2UX7A 2FJHB 1R4XA 2BFVL 4GI8A 3W39A 2N7AA 1LM8V 3B7RL 2XRAL 4P23C 3KWTA 3LD8C 2VGLM 5D7JA 3RNKB 3UC0L 4FOMA 1Z9SA 3QJFA 4HV8B 1U6AL 4GRLC 3NABH 3MNZA 5HHMD 3QT2A 3ULVH 3RL2B 1KJVA 3KGTA 3C9NB 4RGNB 2D4DA 1JF1A 1SN2A 3SCMB 1HXYA 3UZVA 2E6PA 4PJFA 4GMTH 3SGJA 1AC0A 2AQ3A 2B16A 3V7AE 2LOEA 4NXSA 4FCAA 3RG1C 4KKPA 2AXGB 1JZFA 2FZ3A 4ZMZA 3PWJB 2WTOA 4Z3FA 5E1GA 1E3FA 1DQQB 4MWFA 3MRMB 5HHNB 5KVMC 3B7YA 4H0GA 5EBLB 2Y24A 5F6IB 2QSCL 4JK0D 1FVDA 2WBJC 4QXTB 4G42A 2YFOA 4I18A 2A9AA 3EH1A 4AXWA 5JW3L 3FSVA 4K3DH 5FF6B 1UD8A 1I3RA 1XIWB 4I2XB 4F8QA 3UPAA 2I32A 4N90E 2AI0H 4H1LA 4HUVA 1ZHBA 1YNKH 1H3UA 5HXMA 2DLFH 2HLFD 3MBXL 1N2RA 2WNWA 3AABA 3PGCB 1S78D 3AXLA 3Q8EA 1HSAB 4Y9BA 1KTRL 1RP8A 2FHCA 2NX5A 6FABH 4LIQE 3GMRB 4PJCA 1A22B 3C08H 3VW3L 4MNHA 2PCFB 1JSYA 4YK4B 3T0XA 3PPSA 1MIEH 3HFML 3P02A 5AOMA 3UAJA 2HMID 1QG3A 4BK4A 3T08A 2BIOA 2CXKA 4FZ8H 5F7HA 1U91A 3I9IA 3L1OH 2Q9OA 3V6OE 2QBWA 1BMZA 1F8TL 5ID1A 3ML8A 3UG4A 2QZQA 2KI6A 2PYFA 3WFCL 1QFWM 3T0DA 2H1XA 4KUZL 5C2BH 3VB9A 4PJ7A 2BNRD 4P9ML 4TULL 5CHNB 2JB5H 3VFRA 4H8QA 4M9OA 2AEPH 2R0ZH 3WYRA 2YO3A 2XQBL 1YMMB 2CBPA 3SOTA 1P4BL 1WAAF 2LTQB 2JKWA 1Y18A 3DX8A 4PM1A 1DVTA 4YDKL 3JBG7 2EYSA 3GLDA 1KZQA 1S7WA 1N6QH 2AJSH 2BX5A 4P2QA 3P9MB 1G87A 4ELMA 3NJXA 2M83A 4NQSB 2F7QA 4OQ1A 3VMOA 1DDTA 1ZRUA 2HB0A 2NNXA 5HGHA 4AMKH 4I0PC 5EC1A 4CBPA 1HSBB 2CIKA 1A02N 1FL5B 2YKKA 2GJPA 3OAUL 4QTHB 5IEHA 3UIYA 2FWOA 3D4CA 4LSSH 3PHQA 1FJ1A 3PHOB 3FSZA 1G9HA 1S5IL 1GY2A 1P5UA 1S7VA 3AXLB 3FCTA 1Q9LB 1JRHI 5DI8A 2MQCA 4ANXA 4ODWA 1VF5C 1O9ZA 1ZGLM 1THAA 1SMAA 2Z8VC 1RKRA 4N6RB 3CHQA 3QISA 1FNEA 2X40A 1MWAL 4TVPH 4C4UA 3ECQA 3FAXA 1LE9B 1JXFA 5E7BA 3N9GH 5TDOA 1ZLVK 2XWEA 3O3EB 1HYSD 1JVLA 2EYTA 1KLFB 1TZHA 3VE0A 3G5YA 4IMLB 1BM3H 1PG7L 1I7UB 2ZXAA 4L4JA 4E9TA 5D4JA 3HNTH 3BSGA 4G3YH 5C07A 3CFDB 2F58H 2Z9TA 4YWGL 3HBQA 3JV6A 4I48B 5SX5H 4MNQD 3RNQB 2W60B 4S2SA 1P5VB 4OBSA 2G3MA 5CMAA 1KCSL 3VX0A 2DL2A 1Y6NR 4LSPL 1XCXA 5HYJD 4MRCA 1TLMA 4YHLH 3UIZA 2CR6A 3K5SA 3TU6A 3FAWA 3OB8A 1NDMB 3CFDA 2ZX8A 4GPVA 3DRTB 2FIKA 1CN4A 4HEMA 3SYCA 3T3MB 3P3YA 1ZVSA 3GTNA 4YVUA 3MJ9A 4W6WB 3T1FA 3TEUA 1MCCA 3HG2A 1WJ3A 3L7EA 4BV1A 3WS3B 4JE0A 3E6FA 1RY7B 3X2QB 2ZWKA 4UIMA 5DQJA 3ARXA 3WY3A 3MRQB 4N5ED 5F97E 3SKOA 4Z1PA 3UJIH 2J6EH 3ALPA 1NDMA 5D7LA 3QH3A 4BKTC 5BO1L 3S3DB 3QPQC 1XH1A 5C0EB 3QRGL 1EUTA 3L3OC 2V6HA 4F9PA 2WWMD 1AO7E 4A1RA 3GIZH 3U4BL 1HCVA 2DQHL 2HKFL 3OGOE 4L8DB 1Y6KR 4HUXA 1T7VA 3POHA 4Y4HB 2YA1A 3DKHA 1MFCL 2N3JA 3DTXA 3L95B 1B0GA 2DLGA 2WMPA 3FQ2A 3KPLB 2E9BA 4G9FA 1NUNB 2G9HB 3F2LA 1V8HA 2DV6A 3D85A 4F57L 2Y36L 4I4WA 1A9EA 1HEZB 1AP2B 3VXQA 4HS3A 3ZKXC 5D2NA 3AC0A 5EU6A 1NUDA 4MZ2A 4EOWL 1NIAA 1T1WB 2EEBA 3RVXD 5JYMA 2UZYB 4CILA 5HI3D 3UZEC 1UD2A 4PWKA 3RA7L 3TO2A 4JG0H 3MJGX 1YEHL 2FE0A 4HUUA 2CLRA 1DVZA 4J23A 4PJAF 4NC1C 2Z1KA 3PABB 1HNYA 4QYOA 2DQFB 3NRQA 4FS0A 3SDAA 1J05B 4MAUH 4HWZA 1KTKE 3VI3E 3FCSA 4PJ5E 2WIMA 3V6BR 4QF1A 4PJDA 4UTAL 2ZOLA 1YMHA 1CI5A 4WFGE 2FR4A 4MD4A 1C08A 1QACA 2YRLA 4KH2A 1G94A 1KXTA 2VR8A 3TZVB 5E9DA 2EAEA 1HWWA 1S7XA 2OW6A 1WBYA 1JDCA 2FATL 4OBRA 1KY7A 1DYZA 4IKLA 2MTPA 4ZNEA 2B2XL 3WJLA 2BLFA 4EUPA 1GYUA 2I7OA 3HHSA 2J88L 3LN9A 4PGBB 4XE5B 4ADGA 3AMKA 4R5VA 3QPXL 4KKAD 5GJTH 2O6FA 1XTMA 2B4CH 4TQIA 4E41E 1AHWB 3E8VA 4NENA 2XIBA 3I6GB 4GI6A 1U0QA 3MGOB 2J57A 3E1F1 3R06B 1PQZA 4K9EL 4N5EC 4KI5D 4P2RA 3U4AA 1SLVA 1H8NA 4AXWB 3UBXI 4GG6B 4I77L 3D8MA 4N0FA 3DVNB 2D7OA 4B9JA 2QHRL 5EOQL 4DEPB 2IWFA 1NA8A 4OZFH 1NEZB 4IKJA 4ZBJA 4QF1B 1OQOA 3MKGA 4MYPA 4HZ1A 3V4UL 5AB2A 3I74A 5C0AE 1C7TA 2WXOA 2E27H 3C2AL 1ZHBB 3IDYB 2VXTL 2ZP8A 4NM4L 1UT1A 4ADIA 3P4LA 2HFTA 5I1EH 1S7XB 1D9KC 1XB8A 4X5XB 1CYGA 5F9JA 4WEUD 3S2AA 1GZQA 2V7HB 3EW3B 3QEHA 3ARBA 3JTTB 2D9QB 1CGUA 1GSKA 1RZIB 5FM5M 2CO1A 1JTOA 2C1PB 2DOCA 2A9NL 3TWCH 5I6XC 1MELA 5CN2A 1BXAA 4OF0A 5DR5L 3PY9A 4BUQA 4P8QA 2O26U 3VD2A 1X5YA 1OGTB 2Y06H 2P8MA 5F9WB 1WVZA 3QFDA 2XQ0A 4OFKA 3LVTA 3D3VD 3UTSE 3VSTA 5D96B 4X7CC 2O93L 4XMVA 1R75A 5A3ID 1D6VH 1A8ZA 3ARBD 1N9PA 3LQAH 4K9EC 2PWEA 5C0NC 1PLGH 3I2CH 1A9BB 1AQMA 1OAZL 4M8QA 1JGIA 1PZSA 3K74B 2F5BH 3HMXL 3NZSA 2F7IA 1EJFA 2DTMH 3OAZH 4OV6F 5L4JA 2CMRL 3RWCB 2HMIC 5D1QA 1KIQB 1ZD6A 2NOYA 1MXGA 1CBVL 3U36B 1P6AB 3CXHK 4ZW7A 1EZVX 4MAYB 1FC1A 4XC1L 1VADB 2VMEA 4UM9D 3CAFA 4WUKH 1U8IB 5AAMC 4XCEA 2ZX5A 4ZMLA 4OGAD 4AW7A 2ZWYA 4X0KB 3DOIA 4HDIB 2CCVA 5E8NB 3LNHA 3MLVL 1MF2H 5C08B 4LFHG 3S37X 3F6JA 3IDGA 2DM4A 2V2XB 4WI4A 3KLLA 3GBML 3B56A 1IAKA 3HZMA 4J4PA 4LCVA 2A4EA 3MO1A 4G6FB 2P49B 4U31A 2ADIB 5HHOE 1CD1A 3L4WA 5JIMA 5EWIL 4UDTA 3VFGL 4L37B 5IROA 4FQ1H 1YEIL 4KX7A 3OJDB 3QR0A 3OLDA 5J6GA 4HXBL 4NFCA 1YEWA 4P4RA 2EIKB 4DO4A 4K55A 2HT3C 1AS7A 4QO1B 3VH8A 4BA8A 3FO1A 4NUJA 3QAZC 2X38A 5L4MA 1AQDB 2P44B 1OY3B 4EI0A 5HHXH 2EEDA 3BZEA 3FHQA 1MAJA 4LVEA 4ATWA 1FL3A 3TT3L 3CLFL 1C5BL 4B95C 2ZYSA 4N9GA 5LBSA 3ZDZF 4PY7B 4U4BA 4DKAA 2PF6A 3X14B 3WTTA 1NC4D 4JFDD 4HZAA 4FLHA 2OR8A 4ZTEA 1I8KA 4FXGB 2DWEA 3L9BA 2YKLH 4XP1H 5FW7A 5E0QA 3TP4A 3T04D 3TASA 2YK1L 3JT2A 4OGXL 4J27A 1ED3A 3D9AH 3ZDZE 4BFEA 4UQ2A 4G80A 4U1MB 1ZEAL 1PU0A 4OZGF 1MNUH 1MFNA 1UWEH 3GSRA 4ZSOA 4GSDH 4MMXC 4UQ9A 2FBRA 4YX2L 3UGXA 1E5CA 3LPOA 2IDFA 3Q1SH 3S5LB 3NA9H 3A67L 2FWSA 1JD7A 5EC2B 4NP4L 3BWAB 3TZVD 4MJ4A 3AY4A 4IRZL 4RIRA 4LLYA 1IM9D 4EXKA 5I15H 1DJIA 1I7ZA 1MHPL 2EYSB 3BSZL 1QKZL 2NT1A 3E0GA 2O30A 3VNZA 4LHUG 4G43B 1KB3A 4JANA 4P4KC 1IGJA 3O8XC 4JEGB 4ERSL 1ZDQA 4LCWB 2B39A 2IOIA 3CLEH 2ZWNA 1MVFA 2DQFA 1P2CB 3FPXA 3L7FA 3L4TA 1YECL 5HGBA 3HFFA 5F1IA 3UBGA 5JR1H 4ZMOA 4NN6C 2JJVA 5I0XA 4HT1L 3O4LD 4NHUB 3VFVA 5IUCA 2AGJL 1OAJA 3GIVA 3D4ZA 2NW2B 5SWZE 5EU6E 3NPSB 4BUHA 3WSQL 2X6UA 3GO1L 5I75C 2J1YA 2VISA 5D9SB 3LQAL 2XWDA 4H0LC 1PDKB 3KXFE 4NQEA 4BYHA 5DRWA 5E8OA 5KVFH 5DUPH 5L4FA 4YDLB 4TNVF 3V4PH 5HVHC 2Z31B 2WINA 3BUYA 1RU9L 3QO1B 3EO0A 5AZ2H 4YSPA 4JO2L 1I85A 4FG2A 1BJ1H 2FSEA 3IBOA 2BVPB 2QMJA 5HDRA 5IHZA 2VW7A 1AJ7L 2I9LB 3CBJB 2XWCA 5LNEA 4DQAA 1THCA 2ZOKA 2WQRA 1NC2D 3GSRB 4K7FB 3MRKA 3LJ3A 4Y19A 5CEYA 4ZZKA 3BIAX 4FEIA 4GLRH 1KV3A 2FX8L 4UTBH 2K4WA 2NYYD 2XSKA 3FRPA 5HVFB 4IS6B 3QDHA 3MI6A 2WWKT 1U3ZA 4ELMF 2BOCA 1QYGL 5MENA 3GSOA 2X05A 3QNXA 3MBEC 2X09A 3QC6X 1XL6A 2YLKA 4GS7C 4I7ZC 2PMZA 4TKWA 3U2IA 2GITB 3UG5A 2Z0BA 1CICB 3MLXL 4HJ0D 1PZBA 2OL3A 3WTUA 4IBWA 1WD8A 3NIDB 2FZ3B 1E27A 2FK9A 3DX7B 5CU5A 4RFEA 1VACB 2OSXA 3N41F 3SZ6A 4P46C 5ACZA 2ZOUA 5HPMA 1BBDL 3DX0A 3V0VB 3Q48A 3QNXB 3GGWA 2VABB 3CZSA 4NKIL 2Q6WA 1YA5A 3HLAA 4JY6A 3EKCA 5IVZB 5D2LF 1G7LB 2IGLA 2A73A 3AMLA 4GBXD 1DQJB 2A9DA 3GFUA 4D0DA 3F04A 3L5XH 1X9UA 3DX7A 4FQHB 3KWWA 4Q89A 4RA0C 1BX2B 1DQLL 1H3PH 3W39B 1KJVB 1YEJL 4UF7C 3V0VA 3QCTH 2DBJA 2DLIA 5IQ9B 2JLLA 1A6UH 4L9LB 5EPMB 3SBQA 1E42A 3NIGE 1R3KB 1QTPA 1JVKA 2Y23A 3VXPB 4W1TA 2NY2D 5C0AD 2HJLA 1MAKA 2I5YH 1I1YA 5E00A 4IS6A 4KMQA 5LO7A 3TVMA 5KVDL 4JFYB 5FR3A 4OD2A 2K1MA 3E2HC 3GSOB 1PYWA 4WEMB 2IDSA 4G83A 1SMOA 4XCYB 5ESVA 3THML 1Q4NX 2G60L 2MQ3A 3LKOB 1FYTD 4LCIL 3LS4H 2GIMA 4LE8A 3ZT6A 4Y5XB 4KK6D 3V5DB 2NX5D 2DQEL 2PCYA 3VYNA 2O1AA 4LRIC 4WO4B 2ZAIA 2OZNA 5MEPB 3FO2B 4D0BB 1J5IA 1NJ9A 2HJFA 5K59E 1ZCRA 3OKEA 2YEQA 5DSCA 2OSLA 4JO3L 4DPAX 2O72A 2C5DC 3S9DB 3DYOA 3NJJA 4XC3L 3VI4E 1NIFA 2HUEA 1QSEB 5IVZA 4IGBC 4GAYB 5AVUB 4F3FA 5EOCJ 3NGBB 5E94B 1HH6B 2V5SA 5DC4B 4M5YH 4N2KA 1IGTB 1YYML 1FGNH 3LMJH 2AHIA 3AU1B 1FPTL 2HX9A 1KTDA 2VLRD 4CDHA 1GGBL 3IJ7A 3DRQB 3WNMA 3O9WB 4Z3JA 1H3WM 3U4BH 3VG0H 4JFHE 2OMXB 2FEDC 1ZPUA 3TBBA 3MHZA 3VFOA 1MFEH 5F7KC 3GSUA 4A7SA 4FFWD 2EH7H 3FT3A 3CZUB 3O4LE 3Q1EA 4P2RB 5I74B 3HI6L 1BXVA 3MJWA 3AWFA 4Q6IC 4WWKB 3S48A 4EBQL 1E4XH 4CVWA 3IF1B 3TA3B 1BQKA 1PY9A 4H8WL 2WKOF 1D5IH 3DJSA 1UKTA 4OD3H 5D7JD 4HIQA 5KSAD 3T2OA 5MEOB 3F7VA 4PJDF 4XMUA 3P2BA 5IIEA 3KPPB 3ME0A 1K72A 3LZPA 3H9ZA 2HRLA 4TL4A 5I19H 3VA2C 3GDBA 3FB8A 4OV5A 4GO9A 4GUQA 3B2MA 3X1FA 5E2WH 4OIIH 4QXUH 4YFLI 2DWEB 1AXTH 1ZGLB 1QSED 3RX8A 5BVJA 3HKZA 2AJVL 4G9DA 3A6CL 4L5FH 3HUJB 4Z8FL 1WLHA 2HFGH 5EO9B 4XAKD 1ZHKB 4G7QB 1MJ8H 4NHUA 5D6DA 5E5RB 3PV6A 5BZZA 4AT6A 5AB0A 1ZLSH 1PG7H 4RBPH 2V5RA 2PTVA 1GOHA 2QLVB 4U4IA 5I73B 4ZDHB 4HGMA 4NAJA 5B3JF 3VFPB 2ICEA 3MUGB 5E6RB 5AALA 1EEQA 3IGKA 2VDML 4FERA 4NKMB 3B37A 4L1DA 4ZT1A 4PLKC 5HP5A 4G5ZH 1X4XA 2RGSA 4JQVC 4UT6A 4C83B 4DK5A 4G8FB 1EJ6A 2BCKB 1GTFA 3RNQA 5EBWA 5KYUA 4F7KA 2OMVB 5CD5D 4JW3A 1FVCB 2ZXWB 3BOVA 3KLQA