3T6ZA

Crystal structure of steccherinum ochraceum laccase obtained by multi-crystals composite data collection technique (60% dose)
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
495
structure length
495
Chain Sequence
VQIGPVTDLHIVNADIVPDGFVRPAVNAGGTFPGPVIAGNVGDNFQIVTFNQLIECSMLVDTSIHWHGEFQKGTNWADGPAFITQCPIIVGNSFSYNFNVPGMAGTYWYHSHLTTQYCDGLRGPFVVYDPNDPDANLYDVDDDTTIITLADWYHVLAKEMGAGGAITADSTLIDGLGRTHVNVAAVPLSVITVEVGKRYRMRLVSISCDPNYDFSIDGHDMTIIETDGVDSQELTVDEIQIFAAQRYSFVLNANQPVGNYWIRANPNSGGEGFDGGINSAILRYDGATTADPVTVASTVHTKCLIETDLHPLSRNGVPGNPHQGGADCNLNLSLGFACGNFVINGVSFTPPTVPVLLQICSGANTAADLLPSGSVISLPSNSTIEIALPAGAAGGPHPFHLHGHDFAVSESASNSTSNYDDPIWRDVVSIGGVGDNVTIRFCTDNPGPWFLHCHIDWHLDAGFAIVFAEDIPNTASANPVPEAWSNLCPSYDSAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reaction intermediates and redox state changes in a blue laccase from Steccherinum ochraceum observed by crystallographic high/low X-ray dose experiments.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Laccase
total genus 135
structure length 495
sequence length 495
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6zA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6zA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6zA03
2TSBA 1BQRA 2PPCA 5F7BA 2QDWA 3CVBA 3NSYA 2DY2A 3PAZA 2XX0A 5AKRA 1JXFA 3FYIB 1QHQA 1A8ZA 2MRYA 1AS6A 2GC7C 1NICA 1ILUA 2AZAA 3EH5B 3FSAA 5I5IA 1ASOA 2B08A 1IBZA 2HXAA 5FC9A 2AVFA 4W1TA 5F7AA 3X1GA 3OMNB 2ZONA 5ANHA 2J55A 4KNTA 4X4KA 3NP3A 5I6KA 1L9PA 2VSMB 2CAKA 3FPYA 1GSKA 3BVDB 2PCYA 3N2JA 4Q8BA 3SBRA 2DYSB 1OCRB 1URIA 2GIMA 1IUZA 4G72B 1QLEB 4M4RB 4F2FA 1BAWA 2HRGA 4TXVB 2YARA 4GP5B 3ASOB 3NYKA 4M3HA 3MBWB 4AKOA 2PPEA 3FSVA 3JT2A 1AZRA 4KOBA 1J9TA 3EHBB 4GY4A 1PZBA 2PP7A 4E9WA 3TBBA 2BP8B 2IWFA 3QJRB 4BDVA 1L9TA 1W6LA 3QPKA 4YSCA 2IDFA 3T6XA 3OD3A 1MG2C 2N0MA 3NJNA 3T6VA 2DWTA 5TK4A 4PCYA 1JZIA 3NSFA 1TEFA 2X88A 2PPAA 3EH3B 2UX7A 2XV0A 1ASQA 3D12B 3H4HA 1CYXA 1SNRA 2H5UA 2I7OA 2VW7A 3GYRA 4BWTA 3UAAA 2H3XC 1QNIA 4NERA 3FSZA 3FSWA 3NJHA 5I6OA 1DYZA 3MX0B 4A2GA 5IY5B 1NPNA 1FA4A 3X1EA 2DYRB 1A4CA 1JZJA 4KOCA 2UXVA 3IE9A 1NDTA 2JFCA 3AW5A 4AKPA 4YSAA 2IH8A 2EIKB 4YSRA 1XMEB 3IN2A 3NT0A 3PCYA 4E9TA 1BXUA 2PCFA 3X1BA 1A4BA 1X9UA 2XYBA 1FWXA 1GS6X 1SDDB 2FT6A 2FQFA 3NJMA 4JHUA 4HIPA 5B1JC 3S3CB 3WI9A 5B7MA 4DP0X 5PCYA 2PP9A 4GXFA 2IDSA 1A3ZA 5I28A 2QT6A 4W9ZA 1AZCA 3CVDA 1WS8A 1L9OA 3T6ZA 3UACA 2XV3A 1N68A 2H47C 4GYBA 1PLAA 3WNJA 3OMIB 1ADWA 2CJ3A 2HRHA 3ABLB 2FQEA 2XVBA 2PPFA 3IN0A 1J5CA 4F2EA 4AZUA 1ZPUA 4DPCX 5TK2A 5B1BB 2ZOOA 2HLEB 1FFTB 7PCYA 1NINA 5B3SB 1HAUA 3AG3B 1RZPA 1BQKA 1ZIAA 5B1JA 2VW4A 2J57A 1AG0A 1ET8A 2OV0A 5D4JA 1PLCA 1OE2A 2BP8A 3NJKA 3NJIA 1OF0A 4JKNA 3FQYA 1MZYA 1KCWA 5I6MA 1M56B 2AZUA 2GI0A 4HALA 3OM3B 4YSPA 4DP1X 2X87A 3X1FA 4E9VA 1EHKB 2VW6A 1WA0X 1SHWA 4DP4X 2LLNA 4HCIA 2OCCB 4KO6A 2XX1A 1GR7A 2YAEA 4G7RB 1J5DA 1A4AA 1M57B 3ZBMA 2FT8A 3H4FA 5PAZA 5B7EA 4YVNA 1EZLA 1OCOB 4G70B 4N8UA 2YAOA 4JHVA 1E5ZA 2E86A 1MZZA 2FJSA 1GW0A 1SHXA 1HFUA 3ABKB 5B1AB 4DP6X 6PAZA 3FU7B 1JERA 4AKQA 4MFHA 4EF3A 4DPAX 1OE3A 1RKRA 3CZUB 1VLXA 3NJLA 1E30A 4DPBX 9PCYA 4QKTA 3WKPA 4YL4A 1CYWA 4G7QB 2QPEB 3JTBA 2BP0B 2Y69B 4P5RA 4UAHA 1KCBA 2I7SA 3L45A 1SJMA 1ZIBA 1BYPA 2IWKA 2CALA 2IDUA 3T9WA 1HAWA 1PNDA 1I53A 2IDQA 1E67A 1B3IA 2XXGA 3CVCA 4F7KA 4HAKA 2PPDA 3NJJA 3FYEB 3CDZA 4A2HA 2W8CA 1AZBA 1ZDSA 5D4HA 1XB6A 1BYOA 1AZNA 4YSEA 1ID2A 1PCSA 1NIFA 7PAZA 4GP8B 2BW5A 2J5WA 4P5SA 3V9EA 3U25A 2DV6A 4E9SA 2YQBA 4BK5C 4YSDA 1JVOA 4A66A 1NIAA 4DP7X 4YSSA 4WTQA 2DWSA 1KV7A 8PAZA 2BZCA 1NWOA 1TEGA 3H56A 2Y1AA 2I85A 2MTAA 4YVUA 3SQRA 4HHWA 3QJTB 3GDCA 2XUWA 4KO5A 5B7FA 1AG6A 5I5MA 3QJVB 4KNSA 1MDAA 2VN3A 1OCZB 1ETJA 1KGYE 2B3IA 1ZDQA 4Q89A 2FWLB 2W88A 2CUAA 1NZRA 3ASNB 1AR1B 2CBPA 2IDTA 2XWZA 1JZEA 1GYCA 1MG3C 3DTUB 3C75A 1AS8A 2BWIA 3GXUB 3BQVA 4BXSV 4A2EA 4YSQA 3S3DB 5AFAA 2YAMA 1JZGA 3KW8A 1NIBA 2R7EB 1GS7A 4K9JA 1AZUA 2BHFA 1M9WA 3ZX1A 2YAQA 1W8EA 4GP4B 3WIAA 2VM4A 5E9NA 2HX8A 2BZ7A 4BWWA 3EF4A 4A2FA 1NIEA 1V55B 2YXWA 2BWDA 3TA4D 3G5WA 4BWUA 3CDZB 4ZK8A 2UXTA 4YSOA 1BEXA 3NJGA 3S3BB 1NPJA 2XU9A 4CSPA 1BQ5A 1T5KA 3X2QB 1IC0A 1PY0A 1WAEA 3AG4B 2GB2A 3FS9A 4E9YA 1PLBA 1GY1A 3OMAB 5A7EA 3ERXA 3NP4A 2EILB 2P80D 3QJSB 3ABMB 3EH4B 1ET5A 3TASA 1L9QA 3T6WA 1PZCA 4AX3A 3OQRA 1TKWA 1AIZA 1JOIA 1KDIA 3ABGA 4NB7A 1WA2X 4DP9X 2VMJA 1AAJA 2AANA 3PPSA 1SF3A 4G7SB 1JXGA 3ZIYA 3DKHA 1OCCB 2QPDB 3N55A 2QDVA 1JZFA 2XXFA 5I6LA 3UADA 3FQ1A 2JXMA 2YAFA 1ASPA 2Q5BA 3FU9A 1AACA 3PLYA 5I6PA 1WA1X 1V54B 2IAAC 1ILSA 4WKXA 3UABA 4A68A 1BXAA 2PLTA 4UF7C 1L9SA 3TU6A 3X1NA 4E9RA 4E9QA 2VM3A 4ENZA 3V9CA 1KBVA 3QJQB 3QQXA 4UANA 1KYAA 1SDDA 2VSKB 4NAJA 2A3TA 2YAPA 4HHGA 1GY2A 2YXVA 2IH9A 3HEIB 3FU7A 2R7EA 3AY2A 2XLLA 1PAZA 2P80A 1J9SA 2FNWA 3QJUB 1J9RA 2FTAA 2FQGA 1AS7A 4AI7A 4KO9A 2TSAA 4YSTA 3AG2B 1PMYA 1JXDA 1UATA 1WS7A 2OJ1A 3CG8A 3PAVA 4FA7B 3AG1B 4HCFA 4RH4A 3IEAA 2EIMB 1N70A 2BO0A 4KNUA 2GHZA 3SBPA 2GSMB 4G71B 3UAEA 2GBAA 3IBOA 3SBQA 1PNCA 1AANA 1BXVA 2FQDA 3UGEA 1SFDA 1PZAA 3FT0A 1JZHA 1NIDA 2ZWNA 1KDJA 2RACA 2WO2B 1V10A 3FU8A 1ZV2A 3TBCA 1E5YA 4HCGA 2NRDA 1OOWA 5I26A 4BDVB 4CSZA 1NTDA 2UXFA 1GS8A 3WKQA 2EIJB 1SF5A 2HX7A 4QLWA 2PP8A 3DIVA 4FAAB 4DP2X 2BW4A 3ZDWA 5AZUA 4A67A 2WO3B 6PCYA 1KBWA 2FT7A 3KW7A 1YLBB 4PAZA 5EHFA 1J9QA 1RCYA 3PXLA 1CUOA 1OE1A 2JKWA 4HZ1A 1CURA 1XB3A 4YSUA 5LDUA 1AQ8A 2J56A 2UXGA 1NWPA 3NJFA 3NSDA 3S8FB 5I5JA 3WNIA 3S8GB 2AFNA 4E9XA 2YAHA 1AOZA 2XV2A 1OV8A 5D4IA 1RZQA 2HX9A 1PF3A 3HB3B 1JVLA 3FQ2A 3NSCA 1CC3A 1L9RA 1XB8A 1IBYA 4DP8X 1R1CA 3FPXA 2Q9OA 2WSDA 1ET7A 1TU2A 2ZXWB 1IKOP 3PAUA 5B1KA 1DZ0A 1X9RA 3RYMA 1E65A 1A65A 3T71A 4BXVA 2BP0A 2CCWA 5I6NA 2UX6A 1F56A 1W6WA 2EINB 3AZUA 4A2DA 4L0PB 4N4YB 1SFHA 4DP5X 4KO7A 3WG7B 2HZHA 2GC4C 2IWEA
chains in the Genus database with same CATH superfamily
3CFCH 3KNBA 2DYPB 2E27L 5H8DA 4XHJC 1YSOA 3BW9B 1QHQA 3U36A 3WUWB 3ME0A 5BJTA 3AC0A 2OXGB 4L1TA 4FFZA 2H26A 4YXLH 2CDGB 4G7VH 5KSAD 1ILUA 1UZ6E 4L3EE 2X1OA 4Y9CA 4OCSL 3WIFB 2WIMA 1QYGH 5IBTL 2XT1B 3FRPB 3VB9A 4E2OA 1C8PA 1ANUA 1E0OB 5D1QC 3QUMB 3O4OB 1X5YA 4BJLA 1E4JA 2OTWB 2Y7SA 1TMQA 4KHXH 2P9RA 3C6EA 4NQCA 5IW6A 3B1UA 2OW7A 5IOPA 5D93C 3RA7L 4YDJA 1AGDA 1MY5A 3FCUB 4G11A 2K9FB 5IB1A 1DQDH 1BP3B 1KPVB 4U4IA 2VSMB 4OZIF 3R7RA 3BPOB 1WCBB 1KC5H 1URIA 4YHZH 1X5XA 3UEQA 2XIBA 5D7IF 1FJ1B 2J73A 5JW4N 3ULVC 2VDPL 4Z3IA 3GSNL 3EGSB 1H8SA 4WWKC 4YXHH 5BRPA 5B38G 2JJTA 4TQEL 2XKNA 3KEDA 5F1SA 4WI8A 3S34H 2GTWB 3OKDB 1T04A 4WEMB 5E99H 2YMXH 4YSCA 4UQEA 1TJMA 4U1SA 2W94A 4LEOB 1TMCB 3OAUL 2MNWA 4B95C 2XDHA 3BVXA 3MRIA 4ZYKB 3RGVD 1DJXA 4YHML 4NUQA 5I1LB 4TUKH 4UOW1 5I30H 3PWLA 1MI5B 2FGZA 2R29H 4WJG3 1D6VH 1T1ZB 3HMWL 3SDAA 3W37A 2P5EB 5HI4D 1RQ5A 4M6OL 5I76A 5E1AB 2R2BA 4ERSH 3FSZA 3NJHA 5EZLA 2ZX8A 2DQMA 2ZUUA 3EOYG 5DHVB 2EIEA 3VSQA 5CP3H 4JHWH 5E70A 2N7BA 3OHXA 5BRZE 4F91B 5HHOD 4PRPB 3F6LA 1H6UA 4RIRA 4Y9GA 1C1EL 3SDXF 3ULVE 1DUYB 2AITA 2WKOF 5BQDA 3AY4A 2EIKB 1JYNA 3RFZA 1I1AC 1TJIH 3MOBH 3Q01A 4YDIL 2AC0A 1U3HC 3PCYA 3BH9B 1BXUA 2FWOA 4TF4A 5DS2A 5AB1A 2QMKA 4F58H 5DJZB 4R4ND 5JHBA 2IBZY 4Y4KB 4O2CA 2VDNB 2Z31C 3OG4B 4AUJA 1ES0B 2WD0A 5DJ8B 3VGFA 5IQ9A 5JOEA 3DUUA 2OMUB 3MSPA 35C8H 1P7KA 3V4LA 4GXFA 4OT1L 1PKOA 2AEQL 2LTQC 4ZXBD 1YAZA 2XN9B 1LNUA 1UA3A 2W60A 3JWNC 4JHAH 4LVOB 4YO0B 3QQ3B 1A7OH 3MFFA 3WXWH 4CDHA 1PPIA 4H8QA 3EKCA 3O2VH 1C12B 1SN0A 2EVGA 5I24A 4A6YL 2Y06L 3BEVB 1CGVA 4IRJC 3W5MA 4B9CA 4JW3A 4F2EA 1N8OE 3V10A 3VFOA 4UDUB 4C4BA 1WK0A 1NAKL 1I7TB 2OJZH 2PO6A 2NNXA 1WFMA 3CLWA 3HE7B 4XNDA 3BGAA 3CFDB 4FTVA 1BQKA 2V2WB 3UGXA 2J57A 4HETA 1P5UB 4X2UA 3QDJB 1ZT4B 1ET8A 2NY3D 4MNQA 4PJ5D 4Q6IA 4YZFE 5F0PB 3MRCA 4AYDC 4P3CH 4HWNA 3WS6C 2VRQA 2IDCA 4QHKI 5FB8A 4PSPA 4ZTOH 3MPCA 3QEGH 1N59B 4KAQL 2YEQA 2G3MA 3NZ8A 1A64A 4BH7A 2GT9B 3KBPA 1ED3A 2R56L 2VISA 2EEXA 1SHWA 4DP4X 2DQIH 3CFKA 4GQ9H 5DUBA 3UYRH 1UH4A 3MRMB 2DJSA 5K1JA 5DJ2A 1H6FA 1QUPA 3QUZC 3GSVB 2FT8A 3IDGB 4GXVL 3IFPB 5AG9A 4YHIB 2F54B 5K93A 1OTTC 3G6AA 4JKPH 4BA8A 4H1LA 3KYKH 4UTBH 4FFTA 4HLJA 3G5YA 3T0BA 2DWEB 4OFVA 3EUDA 1VLXA 4F9LA 1Z5HA 2KH2B 1B2WH 1F5WA 3VYNA 3ME0B 5F1IA 3KDMB 1NCWH 1IC5L 3BEWB 3GBDA 4OTXL 1SEBA 4X6BB 1AD0A 5GRYA 3ATAA 4H20L 5TE7L 1S7XB 3H42H 3L3KA 3V6OA 4DHLA 4P5RA 1E40A 4PU2A 5JXAL 2FX9H 3BT0A 4MJ4A 5AOLA 4DGYL 1NQBA 3NCBB 4O02H 2HJFA 1BYPA 3T9WA 5DMGD 1KGXA 1QW9A 4U3XA 2Z0UA 1A25A 3ROLB 1IM9A 3APMA 4FNPA 1R5VB 4U6YA 4IGBD 2KDYA 5DGQA 1DJGA 2EDKA 5E00B 5GJSH 3RX8A 1XB6A 3D50A 4GKZA 4M5TA 4J2XA 2WLZA 2DI9A 2ZAHA 5IG7A 1ID2A 3I02A 4LCYA 1UA6L 4WNQB 3WNOA 3R0NA 3QIBA 1PDKB 2EABA 4XVSL 5CZKA 4HIJB 5INDB 3RJOA 3QUXD 2BSBA 1T4KB 1RHHA 5DQ9A 1NIAA 3ZKND 4XI5C 5EBLA 1JE6A 4LVOC 4HCRA 4M5ZH 3HBQA 1MFEH 2AEWA 2ITDB 2V2XB 2ZYHA 3NRPA 2NY5H 4PJCF 1TLMA 2EE6A 2Y1AA 1AP2A 4N8PA 1I1AA 3VFWA 1BX2A 2IGLA 2KC0A 3PIQA 2QFPA 1WAPA 4TQEH 1ZGLM 3IGFA 1Z5YD 1CDYA 2AQ3A 4GIAA 1Q1JL 3ZO9A 5DVMA 2DLEA 2FECI 4NQQA 4NQSB 2WJ5A 2FWLB 1U3HB 3HZVB 1X4ZA 5IBUG 1FE8H 3DTUB 4Z7VB 1OALA 4PLNC 3GTTA 2OL3A 3KLDA 2IQAA 1TVBA 4UDUA 2IGTA 4BFFA 4YHKH 4CVZB 2IAMB 2P8LB 1C9SA 1U8PB 4FQXD 4N85A 3S3DB 2Z7UA 5AFAA 1B4JL 1NLDL 3KW8A 4M7ZB 4PB9L 2NNFA 5E8OA 3MBED 3FN9A 2DQEL 3ARPA 1JS4A 1ZVSB 4P2QD 4PP2A 1A7NH 4N2OA 2VM4A 5E9NA 2BSED 1T89C 4PG9A 4Y8AA 3VFNB 1OT2A 3GUTB 3FOLA 1LWJA 3IM1A 4ZS6D 4XNBA 3VNYA 1JZ5A 2P8MB 2H3KA 1J0HA 2BWDA 2NY5C 5EUKB 4ALAL 4TMPA 5KYYB 4XGZA 3LKRA 1R33A 2FLMA 2F1BA 1I8UA 3A6BL 4WSJA 4EXKA 3S3BB 3ELQA 2CA3A 5DQDH 4PJXE 3U7AA 3UZQB 4Z1PA 3K1KC 1H6TA 2Z0BA 4NQEA 3RDTA 3JQOB 3GEWB 3ARFC 1S9VA 1NGWA 4FP8L 2Z65C 1YC7A 4TUOB 1B4LA 5ADOL 1CXEA 3JTTB 3WFCH 3HUJE 1AD9A 2HJLA 1EBPA 2CLRA 5IVXB 3GXNA 1AC6A 1Y07A 2OSXA 3WS3B 5DVOA 2GIXA 2WAHA 4XBGA 4LASL 2W38A 4APQD 3T1WA 4DP9X 4OAWA 1AAJA 3D2TA 1U33A 2V5YA 4JZNB 1FLRL 4LQFL 2OKMA 1IEBA 2N3JA 2RFXB 2BIIA 4CN6A 2XXFA 1QRNA 5FHBL 3RPIB 3PWUB 4CADB 2CNYA 2AVGA 2FX9L 2YAFA 4WW2A 3IMRA 4IK7A 2OFQA 1HE7A 5AW9B 1FNFA 4DW2H 3T08A 5JHDB 2IAAC 4GUCA 2VLME 4ZXBA 1WCQA 4NZTH 3MRIB 4MKMA 3K91A 5DLMH 3X1NA 1I9RH 3O3AA 1KEGL 2XWXA 2BCMA 4M4PA 4IOIB 3LZRA 4I88A 2OI9C 4EUPA 2PWGA 5DI8A 1G9NC 3TNNA 2R7EA 5EU7C 4XXCC 1D5BA 3RKDD 5AAPA 4TSAH 4WNSA 4YX2L 1HS6A 2V9UA 1MWOA 1CFNA 1K4DA 4XVSH 1NBVL 4QHNB 2NTFB 1BREA 3NCCB 4G8GA 1A6AA 1AS7A 1D5XB 4YSTA 1EEZB 5IVZB 5A3ID 4GRLA 4GRMB 3O6KH 2OX5B 1C5CH 1KELL 3CG8A 5FDWA 3CFBB 1IGML 3BOVA 3FFOA 1N6QH 4P05A 4RGND 3VWKC 5AENA 4UQAA 5FV2A 3GGWB 1NMBL 4GW5B 1BM3L 2K0RA 4JPQA 4O9HL 4NQXA 4ZJ9A 4A7VA 1N6UA 3O6MH 3RVTC 3FT0A 2DQUH 3S0PA 1XF5B 3C6LD 4JCLA 3V6ZA 4EN3D 2I26N 3D85D 3ELAT 4N2KA 1DCLA 1EHLL 1JV5A 1NCUA 4X5RA 1IC5H 1LO5B 2NDFA 1YYML 3SB3A 1O7DE 3W9DB 2GTWA 1S7WA 3WKQA 4RDBA 4X9GA 4IBTA 1ZOXA 2Q87A 4BK8A 4HUWB 3NFNB 4YXKL 5JIKA 3VGAC 3IXTB 1CJYA 1OK0A 2L7EA 1CMOA 4I2XB 3VGEA 2WWOA 1KTDA 3BHBB 3KPSE 5EHFA 1G7QA 1IAKB 1IJ9A 4L5FH 3TJEH 4J8QA 2NUPA 4PS8A 4FCAA 1XB3A 5E2WH 1I8LC 1E8WA 1FVDA 3PGCA 5DZPA 5EIVA 5HYJA 5T33L 4RWYL 3NJFA 2K9UA 1UZ6F 3FTGA 1KPVA 3FULA 5KVDL 1JGVL 4FG6C 5D4IA 1NEZA 1BMWA 1KIQB 2RIKA 5C0AA 3RKDC 3TBSB 1IM3A 1CQYA 4I18A 3HB3B 1TJHH 35C8L 3P30L 4K15A 2H26B 3FUJA 1X5FA 2AJUH 1KV3A 2WYZA 1J12A 2F68X 4FTVD 5KBKA 5GHWL 5EF1A 3MNZB 4ODTH 4KJWC 4MBRA 4IKIA 1VESA 3RILA 3T71A 3AT8A 2YRZA 5EWIH 1GOGA 1S46A 2EINB 3QP3A 4MA7H 2QQLH 3L3DA 4OD1L 4N4YB 4GAGL 3EHBD 2G60H 2D31B 2I07B 2P8PA 1SOQA 3DV4A 3LPFA 2VR7A 3V5HA 5KSBB 2Z91B 3MX0A 4LK4A 1G7PB 3QISA 4TNVF 3BGMB 3CQQA 3TNMA 1IFHH 4E41A 3QH3A 3U1SL 2ZUXA 4AYBA 1TVHA 4ZUTB 4BZ1H 3MRDB 1XGQA 5GGRB 5JQHC 5HYSG 4AM0Q 5KUKA 1GMEA 3DBXB 1TPXB 1XF4B 1DO5A 4X4YA 3VACA 3SYQA 5FUCE 2XQYG 4GG6B 3F7QA 1CD8A 1L9PA 4JPIB 1RUQL 1WAAE 3EYSH 2R27A 4P59L 1B6UA 2R4SL 4JFDA 5I73B 1OCRB 3P9MA 4KTGA 3T2LA 4PGEB 5CLWA 1ZA6B 3V4UH 3NYKA 1XMWA 4Z0XB 1N0LB 4FQXA 4XHQA 4AKOA 4CC0A 3CFEB 4XNAA 1A0QL 5TE6H 1I1FA 5ISZB 1O7SA 3TBBA 5CBAB 1N6QL 4TQIA 2WQUA 3F7LA 1T5XA 3IRPX 1MW3A 1QVOA 4L1LA 4ZTEA 4QRTB 2SEBA 5DEGB 5F21B 2OX5A 5FM5M 5C09D 2DWTA 3UBGA 1HHKB 4L37A 4OH2A 3MMEB 1JZIA 1R5IA 1VEPA 4XCEA 5EBWA 5HHOB 2UVEA 3CIQA 5KBNC 1Q90A 1TEYA 4QTIH 3I6GA 1RPKA 4Q52A 3QEQA 4U2ZA 3ULVL 4U0QB 2I7OA 3EBHA 4AW7A 4FJYA 4NJAL 1PSKH 1P5VA 4AC2A 1MIMH 2FYYA 5M94B 3HG5A 5K9QI 3AS2A 4IJ3C 1T80A 3SKNA 5T1JA 1Z3RA 4WIQA 4OM1L 4AK1A 3T0EB 3VJ6B 2F53B 4NZTL 4OZFB 2MWCA 4APXB 2EUXA 4NENA 3D0VB 4PD4J 3VCLB 2OMYA 3BAIA 4ZXBB 2YLHA 3VYPA 4KKLC 5CUSH 1W72A 2QLVB 3IN2A 1TG8A 4QTIL 4Z3HA 2BNQA 3ZHDA 3HS0C 1NBYB 4PJDB 1AYOA 3HAEH 3AROA 1F00I 1G1OA 4G1MB 3AS0A 4LLDA 2AP2A 2V2TA 2FT6A 2QADD 1MHEB 4J8RA 4ZNEA 2ZSVA 3QNXB 1BIIB 4NC1E 4X8GA 5KJRH 3E6FB 4LP4A 3VI3B 2DIJA 2ZXGA 2C4XA 3HAEB 3GMQA 1BOYA 3PDOB 4Q6KA 3VX0A 1WS8A 5K9OA 1FCCA 1KCSH 3DGGB 3NFSH 1NFAA 5CUSL 1E2ZA 3LPGA 1F4XH 3S4SB 5KZCB 1F6FB 1KCKA 4U6VH 1KCRH 3RIFF 3SE4C 1J1XH 4PJ5B 2MHAB 4N90E 3ZTCC 3IMBA 1TZ8A 2HT2D 1K72A 5AUMA 3ABLB 4BH8B 4K07A 5EEZA 2D0FA 1YNTB 3GI8L 1PZDA 3LH2L 2DM2A 3OKOB 4P9HL 3LRHA 4Y5VC 3ZDXB 3DVGA 3UTTE 2PW1B 4G9DB 3QFJE 1IGYB 5F7EL 1F1DA 2X6UA 1DQML 2VXVL 1BQHA 3T04D 1HTYA 3JUZA 4H8HA 1KENH 2PR9A 4WAFA 2VDOL 1KOAA 2HKFH 4FF9A 4O51A 4QEGA 3BP7B 1SMOA 4X50A 4C56E 1DDTA 3B8SA 3L3GB 4AGPA 3D06A 1KXQA 1WZAA 5JW4R 4PP2B 1E28A 4Z7QE 3NIFF 4HUUB 5E8NB 4B6ZA 5F7DB 4IEFB 2BP8A 1J1XL 3D2UD 3OC8A 4N2FA 4M3JA 2VH5H 3VE0A 1YNKH 1ECYA 4R7LA 4MS6A 1EHKB 3W2DH 2BOCB 1OZTG 2CH8A 2FHCA 4OW6A 3SDDC 2V4LA 4BFNA 3B2XA 2X12A 4FFWC 2PUQT 4IGBA 4ZTPL 4TLKA 3QQ9D 5L6YL 5SWZA 3F65A 1EFXD 3Q8AA 1GTFA 1M57B 4HUCA 4JDZA 3LNHA 3VXUA 2EDOA 2NY6C 3T0AA 1Q9OB 3JBG7 5JQ6H 3PABB 4I3RH 4MAYC 5GS3A 1E5ZA 2NY3C 1I3RB 4YFEA 4FXGA 1E50A 1JWUB 1TZHB 3RTQD 1XX9C 4MA1B 5DJYB 2EIBA 2W9LA 4PJ8D 4X5PA 5DK2A 1LDSA 4AJ0A 3RKPA 3DGGA 1RURH 2X4RA 3TL5A 2JKRM 5HPMA 3MCG1 4G2AA 3EADA 2ZUTA 3VXPB 2FUTA 5DRZB 1HCVA 3P4MA 3CN4A 4OZGF 4HIQA 4BRJA 3ZKSD 1MY7A 4J8RB 2GJZB 4R97C 4UAHA 1DLHB 1FI8C 1MUJB 4ZFFB 3H85A 3QAZB 5GS0C 4WW1B 5TFSL 1NGQH 5HHPA 1A02N 4Y9EA 1NAMA 5C9KA 5K9QG 5CWSB 4PI0A 3PWJA 4N8VB 3UO8B 2V3FA 2NYZA 2RGSA 5ID0B 2IV8A 4MZRA 4WGWB 2JJSA 1NUFA 5JIHA 3UBFA 4KK5D 5FYKE 4JRXA 3VNZA 3VXTB 4CGTA 1RLWA 4K3EL 3BFQG 2V7NA 1DP0A 5FYJL 2LAGB 5I18H 3OL2A 1FIEA 4H1LG 4TQ8A 2XYCA 1AFVL 1NIFA 2BW5A 1VZHA 1NDGA 2RA1A 2VDQB 3V4VL 4E9SA 4H2AA 2Q7NA 5TQ2L 4JFOA 4YDZA 3L7FA 4Y0GA 3SPHA 1WBZA 3GJFA 4MAZA 3ESOA 1PTZA 2ZPKL 3B43A 3BKMH 4XCEB 1F13A 1KB3A 4XP5H 1O75A 3G5YB 5ICZB 3SQRA 4S1RL 3C09C 3EJUA 1W2KT 5E9DE 5I8OL 5M95B 4L0ZA 1N64H 1DTUA 1WIUA 4YK4C 3U2IA 2H32B 2ICWA 3K0YA 3GRWA 4QRRB 1NZRA 5TF1L 4BZ2A 3U0PA 1E43A 4MB3A 1RPUA 4KZDL 2VISB 4P5KA 1UUNA 4M5ZL 1AHWC 4HWUA 3T2QA 4OCSH 5C0AD 4XXCA 1FO0A 1XAUA 1BD2D 5I1KH 1YY9C 4JKWA 3ZE0F 4PJAA 4PRHB 4HIHA 1RJYA 4ZAKB 2ATPA 4XT1C 5T3XL 4Z8FL 4X80H 3QO1B 4Y9FA 3BLPX 1ZT4A 3PNWB 3EJRA 1VENA 3LRLA 1GIGL 1F86A 1G1YA 4J3OD 3TA3C 3QUYC 2WLIB 5E4IA 3RIFK 4HUVA 3P69A 4XP1L 2XNAB 4HOMA 1RZIA 3AT0A 5CIPB 2EC9T 3AACA 2X38A 1CFQA 2E56A 2FZ3A 4KJQC 3AQDA 3AB0C 3LHPH 3ZW3A 4N6RA 2DYPD 4PB9H 4GMTH 1FPTL 1JWSA 4GI6A 5F7YC 4E9YA 1PLBA 3SDXE 1ND0B 1OSEA 1TSHA 5I19H 3QR0A 1MJJB 2Y0SA 4AV4A 2O5NA 4QD2E 3QI9C 1VPOL 2PN5A 3DX6B 4ODBD 1CT8B 2YPVA 4MGXA 1X7QB 3DUUB 4XTRD 3O4LA 1GTNA 1V27A 4NZUL 1KEML 2H1PH 3LXBA 3L9EA 5E6IA 2WWKO 5IVOA 1MFCH 4JPKH 2XVLA 5ESAB 5I16A 1B0GA 2Q2LA 4Q0XH 4W9GC 2NQ3A 1FFOA 3ISWA 1SJEB 5K59F 2WXQA 2ZCKH 3RP1A 2PLTA 2UY7A 4QKXB 3WENA 1KY7A 1QEXA 4P4KB 3DJSA 5CEZE 6FABH 2VLJD 1UB5B 5GISL 3JV4A 1IAKA 2KLRA 2CO4A 5JR1H 3FU7A 2VYRE 2R2BB 4P2RD 3T0WA 2VDKB 3ZHNA 4L4VA 4Q9BA 3TM6A 5BOJA 1NUDA 3H9SB 4FZEL 3QC6X 4KKCD 3ZN6A 5CD3B 5T3XE 4QHMB 3AADB 5E8EA 4QGYA 4KKLD 4YK4B 3ZKQD 1MREH 4HFUL 1XXFC 2O1AA 4YIQA 4WHTB 3TVMC 2A83A 2J5LB 4WFFD 5ALCH 1OAQL 5BZWB 3PQYB 5TE4L 4EE2A 2ZKXA 1RIUL 2X4PA 1JVKA 1TENA 4AITA 2QR0B 1SYSB 3D8MA 5HPOA 2EDMA 5L4MA 2IOOA 3QO1A 2Y5QA 4I1PA 1RJYB 1PG7H 4GSRA 3VI4B 1PNCA 4ZFQA 4ATTA 3VRIA 3LKNA 3DX7B 3KHOA 4EPSA 4MD0B 4HLZH 1UOWA 3H9HB 1UB6A 5TF1H 5FO9A 3TIEB 1RURL 3WHXB 2W80C 3N44B 1JG9A 4L8CA 3TBCA 3B2VL 1SJHA 4ZFOB 1HN1A 4F27A 2I9LB 3QDMD 4HWBL 4G8GB 4NP9A 5FO9B 3QC5X 4JKLA 4B9JA 5JXED 1U21A 4JQVC 5JIQA 1KLFA 4M1GL 4RFOL 1XH3A 3G5VB 5T3ZD 2BW4A 2G5BA 3E3QC 4D0DB 5DJAB 5I0ZA 3NQKA 4V1DB 4IBVA 1NKOA 2VN4A 4ORGA 4X80L 4EIGB 2OTWA 4Q74A 4HVBA 4XMLH 4JANA 1AZZC 3U4KA 1YEJH 5IESH 4AJWA 5EUOB 2R15A 3K6SB 1GZQB 4FJZA 4LASH 4YSUA 2MEJB 2ED6A 4HFWB 1H15A 3GJFB 4BKLA 1ZGLP 5C07B 3EIFA 2FJHA 1ORQB 2CXKA 5F9WC 4J5VA 32C2B 4ZO9A 4HWEH 1TTAA 1RZQA 2E9BA 5DHYA 2Z4QA 4Q4IA 2YZ1A 5BZXA 3KXFD 2L8AA 4N2EA 4FMFA 3OXRA 4S1DC 2V7NB 4U0RC 2RFXA 4TSBH 2R0KH 2MJWA 4DP8X 2LAAA 3KJ6L 5KS9A 3J7HA 4NZRL 1WE5A 1R3LA 4PJGA 3FH5A 5DMKA 5ANMB 4XNYH 5D71L 4XCYB 1K6QL 1R4XA 2VDLB 4OSUL 1EIBA 1RZJC 2CLRB 4ZOAA 4AEFA 5CLYA 3LV3A 1E9OB 3DSNB 3VD7A 2DMBA 4LBAA 5D7LA 1NBVH 4NQCD 3ARGB 3EJJX 1BEYL 2FWSA 3F7YA 3QUXB 1TQWA 4G6MH 4KKAD 5MP6H 5B3JE 2WB1A 3AWFA 3BQUD 3NIDE 5AVVB 3T8XB 6CGTA 1CR9H 5IT2H 1NICA 4OT1H 3VXQB 3CHQA 4AGOA 5GRWA 4Q9CA 2ARJQ 3ATBA 1LO3H 4FNTA 3ZL4L 2B08A 3FAXA 1LM8V 5I1KL 3BUYB 3EOTL 4N8VG 2DLGA 4K8RH 4JB9H 5FC9A 2AVFA 3IJ8A 2X41A 2CWRA 2UWEF 4RWHA 4F33B 4CUCA 3BRDA 1MHCB 1MCDA 5JPNC 4JQIA 4F5CA 3V5KA 3KPTA 2VN7A 3SBRA 2PCYA 2CNZA 1OANA 3VXUB 5BZDA 1LK3L 4QOKA 3GKWH 1YG9A 1LQBC 4AQEA 1HYSD 3WEXA 4TXVB 3S88L 2FO4A 4OZ4B 3BLBA 5FR3A 1WIOA 3LIZL 1NAML 3RZCC 3ZE2E 5CN1A 2AGJL 2PP7A 4JG5A 3SYOA 4LPXA 3FTSA 5IROA 5CCKL 4PIRF 1TJGH 1CICA 2C9UA 3D4YA 3DPBB 5IJVB 4F80A 1HSAB 5KANI 4PS4L 4XPTL 1N8ZB 1XCQA 1OP5K 3T77A 3CK0H 4JREC 2V2XA 1IKFH 1A7QL 2VDOB 4OF7A 1S7UA 3BAKA 1KNOA 1OY3B 1Z0NA 3I6SA 1XIWA 1LQSR 1B4JH 1TJHL 3GYRA 5GS0L 4H13C 4NERA 3F7YB 4RA3A 1CGWA 1F11B 4MAUH 2HT3D 5KG9B 4PFEA 4N0UB 4Q97A 5J3HD 3RGVA 2YK1H 3PL6B 1B0RB 1QP1A 2M8XA 1WGOA 4RAVA 1VERA 3X1EA 1GHFH 2WB7A 3I84A 2TRHA 1JZJA 2GEEA 4L3ED 4TRPL 1BGXL 4WFGE 4XC1H 1YMMD 4ONFL 4HUNB 2O6EA 3IETB 1BZEA 4NKIL 2LLGA 3S3JA 4FABL 3IYLW 2EZ0C 2CKBA 1HL4A 2JTYA 1QACA 4KI5F 5T1KB 1BJ1H 4MNHB 1WBZB 1MIEH 3LMJL 2J8UF 2VQTA 1CDJA 3B9KA 4TTDC 5FECB 2IWGA 4U2YA 2IADA 3VFRA 2PCPA 1QFPA 1YMMA 4JE4B 4HFUH 3DUHA 4YXLL 4PUBL 1M05B 5KSVB 1QNZL 4XMKL 4Y16A 3MRJA 1ORQA 1PG7W 4OZFA 3VXTA 4LPCA 3T6ZA 3ZKXC 1QABA 2GJRA 1B0IA 3U7WH 4PGJA 4PJFA 4PCKA 5IFHH 1BG1A 1R19A 1MQ8A 2HRHA 3MYZA 1IX2A 3QBTB 4TNWK 1A6TB 4QYOB 5DJAA 4L4JA 5A16A 1LD9B 2G5BB 4D0DA 1JXJA 1RZJH 1XSOA 1OEZW 4NZFA 4RBPH 1OSPH 4XRCA 2A9NL 4JCWA 2JCCB 3K2UL 1HL5A 5GGVY 4YHIA 1J7VR 2WTOA 1UD3A 2VABA 2R2EB 3Q2CA 1R3KB 3C12A 3UYPA 2YJQA 1G84A 4PJIB 2YEZA 4JDTH 1I8MA 2PTTB 2HLFC 4LCWB 2NX5D 3GSXB 4IOFD 5J6HA 4GIPD 4EI5A 4WFHD 1F1AA 2YUZA 3ARFD 2VZUA 3MJ8A 4XVUD 4X4ZA 3DX8B 1KXTB 4HDIA 3BPCB 4GW4A 2K6YA 3HRZB 4NNXA 4ODUB 5BPPA 4D8PB 1XGRB 4PV1C 4UOQA 3WL9A 5C86A 1OAUL 2VW6A 1CXIA 1DQMH 2WBWB 2Y23A 3LQZB 3Q6GL 5LN4A 3U4BL 4S1DD 4I4WB 4M48L 3SBWC 1MEXH 4WWOA 4JDTL 1ETZA 3EYQC 1KTCA 4CVXB 3GXDA 4UZSA 2CLVA 2ZWYA 3QE5A 2VIRA 1TUPA 4BFIA 3RWCB 3T8MA 2E86A 3FO9A 5FXCH 3BKCL 5CZXD 4QHLB 3ZDZB 3QNYA 3THML 5D96C 3EGXB 4EI6B 2ZJSH 3HHMA 3MRLB 3FU7B 4NFBA 5H2BB 1QEWA 4QIRA 2YUXA 1IAIL 1NCNA 1WFNA 2AXFA 4N8CL 1QTPA 4P9HC 5CU5A 5INCB 4XWOC 2NLJA 1JF1B 4WWKA 3FQ4A 1XAKA 1M1SA 2HUHA 4LOUC 3LN5A 3J07A 3MUY1 1HHGB 2O30A 3FRUB 4LAQL 5FAAA 5AB0A 5JO5A 4S2SB 3VGDA 2DLFH 1CD9B 3D4CA 5DQJA 2Y5TB 3MRQB 5C3LD 5F3FA 4ELME 2VXTH 5DQDL 2LW3A 2YR3A 3DX4A 4OIFA 4C8XA 5E6UB 5JPNB 1I8KA 1XF2B 4HEPA 4OZHB 1X7QA 5DFTA 4HAKA 2YO3A 3FYEB 3O0LA 1JNLL 5D7IE 1UM4H 3GNMH 3CU7A 2Z8SA 4ONFH 2N56A 5J7CC 1GA2A 2WZ6A 3V6OE 5C0BB 2F74A 4FZEH 1AIFB 4HV8A 3K46A 5DHVA 5LBVA 4M62H 2GW5A 4NRXB 5D6DA 4ZMXA 4XX5A 1G9MC 3K6OA 1RMFH 3ZZSA 4DKEL 1FN4A 5DEJA 1TYJA 3F58H 3U9PL 5BW7C 8PAZA 3K4AA 4R7VA 3WXVL 5BUPA 5LWYL 3MV7E 1KFGA 1BZQK 4XO9A 3ZT5A 3F8UB 5DT1L 1TQBC 3JV6A 1EAOA 5LBSL 3QXWA 4LEXH 2WXJA 3T0EA 3PNWA 2XUWA 3SKNB 1PQZA 4JVUA 1KF9B 4X5QA 2HVKB 2N4IA 2NXYB 3QUKB 1ZSDB 1WH0A 4AQAA 3ASNB 1RUAL 4JO3L 4AMWA 3QJHB 3SKMB 3VG9B 2OMZB 5DD6A 4RQQA 2OA9A 1IZJA 2P7TB 2IXQB 2ZE0A 1MCIA 5E8DH 2A4ZA 3G08A 3X11B 3HB3D 3ULVH 4PRNA 5F1NB 2XJLA 4RZCA 2OBGA 4ZDHB 2J71A 2OTPA 2D4DA 3OZ9H 3FNKA 5DEGA 5C71A 1PZSA 1YCSA 4TQPA 3P77B 1OP5H 3GBMH 4KY2A 4M6NL 3QORD 4TVPL 4YWGL 3SY0B 5FPIA 3VXMA 4JO3H 4QXUL 2RCSH 3WKMH 5AW3B 4EQ3A 3VW3L 5I23A 2JXMB 3D51A 1LMIA 2ATAA 1KB5L 3T5WA 2BM3A 3QJXA 2MOGA 1XZ0A 1FYTD 4LSTH 3QJHA 4FXKA 1O6SA 1INEH 4HULB 2YD7A 2GB2A 4X7SL 4WSGA 3DRTB 3S5YA 2C7FA 4ZODA 4Y2NA 1B2YA 3VXMD 4LEBA 3TA3D 1G9EA 3PHOB 5EO0A 1U8OA 2YMTA 4AX3A 2LHAA 3IDUA 1R34A 4R26H 3U6RA 4KVCH 4HUXA 3ARFB 3B9VA 4XN8A 4M29A 3SZ6A 4F57L 1RZKL 1I8IB 3G6JB 5A2FA 4OD3L 4UUJB 4ODSL 4BZ2L 1BM7A 4NQED 4XO5A 5AAMA 5ID0A 1JI2A 2X7LB 1D6VL 3G04B 4Y5XB 2QPDB 4XNQA 3KPRA 5DA4A 1XCXA 3MZGB 1THAA 2H3NA 3V52L 5AOIA 2EDQA 5IBLD 4AVJA 1IBHA 3EG9A 4Z7UF 3ZXAC 1O9WA 1JPEA 2IGFL 3LRKA 2BY0A 5JZ7C 3H9YA 3M1BA 1GYVA 1ZLEA 2BSTA 4FYQA 4IMKA 1P53A 2DTML 2KLTA 3V5DA 4OD2B 4YBHA 1A7RH 3HI1A 4CVXA 4WKZB 5D2NB 3JTTA 1I8AA 1UM4L 3PQYD 4NO5B 3GS4A 3B7SA 5E5MA 2XTJD 3L48A 1DLFL 2ATKA 1HHIA 2P80A 3BVNB 3CE1A 1J9RA 4GIOA 4I18B 3T2OA 3FAWA 2OMTB 4ZTPH 2R23A 4FC3E 4NQVB 1UATA 1HHGA 3Q13A 3SDAD 2NX5A 4LL4A 5HDBB 4RRPA 1KCSL 5GRXG 2EIMB 3O9WC 1WISA 4KHTL 3SBPA 5JUEH 5ERWA 3MV9E 3MUZ1 2F53D 3D2UB 3D07A 2VRKA 3FT4A 3KPNA 3UTQA 4AIZB 4PRBA 4PV9A 3HKFA 4WK2B 4JR9H 1E42A 4HHAA 2HG5B 2R4SH 3IJYA 4BUHA 4U1IB 3JVGC 5EOQL 3SPCA 4KITB 3K81A 4FQ1H 4XB7A 2DEWX 4P07A 3KJ4C 4RGOH 2OULB 4W9KC 1O7DC 3N0PB 3VXUD 2HN7B 3COOA 4NJ9L 4C4KO 4CU8A 1E7UA 2YGVA 2O5YH 3BJLA 4JY5H 1E4KC 5I19L 2R8SL 3OKOA 5DRXA 1FL5A 1OL0A 5IWLA 4PR5A 4MJ5B 1G9NL 5CMAA 1P7QA 3MJ9A 3DHMA 3KBHE 3LB6D 2VLRE 1OE1A 1SLVA 5EB9A 4MNHA 1NSNL 2BHZA 3IU4L 2VLKA 3P0VL 4WHYG 5C0FB 4QXUH 3RUGB 1HHHA 3GMQB 4OCWH 2AABL 5FYJH 4HWBH 3UBXI 1FZMA 4ELDA 1LEKB 4L1HA 4FQ2L 4X8CA 3GMOB 2OP4L 4QHNA 4GKZB 4AJVA 1PX3A 2IIJA 3I6LD 4YEFA 2WSDA 3GSRA 4G7VL 3EFDL 3S6CA 2D03L 2YBRA 3I9IA 4JG0L 1PJWA 1X5HA 1NCDH 3RYMA 3FN0L 3ARFA 5E23A 1KGIA 2JCWA 3ARDA 5JXEA 3FQXB 4P2YA 4J4PC 1YMMB 1IU1A 3WG7B 4GG6F 3WY4A 4I89A 1WBYA 3DI2B 3DGDA 3KWVA 4KKRA 3T3PE 4ZOCA 1QLRB 1T6BX 4ZX5A 3ALWA 5HJ3B 2MRYA 3WOVA 1CLZH 5DR5H 3EFDH 4KDTA 4MYWB 2DMHA 3R8QA 1WICA 4R4BA 2Z3FA 4L29B 1U58A 3AUWB 1FH5H 4XH2A 5I1IL 4WDIB 3NIGB 5IM7B 3W0WA 3NOIA 1EEYB 2O6FA 4RMRA 1QAWA 2NYYD 4RGMC 5EEWA 3BE1H 3GPEA 2JF1A 4UV7H 3IDGA 2WN3A 3GSWA 4KV5E 2YC1A 3IJ9A 1QLEB 5IHWA 2EIZB 4M43L 1A21A 2X9YA 4YDVB 5HHNA 1KNOB 2VJ0A 4S10A 1KTLB 3BZ4B 3ZE1B 4KOBA 5L7XH 3GB7A 1BD2B 4Y5XC 3DSFH 2QLYA 4F92B 3LDBB 4I85A 1RJLB 2V7HA 4MA1C 4F8LA 5FYLH 2YGPA 2B59A 4N0CC 1MCLA 4N2CA 2GYSA 3U46A 5CLZA 3B9KD 5IESL 4R2GB 4QNPE 1W0WB 3OD3A 4UV7L 2JJWA 2E5EA 3LV3B 3B8YA 5TK4A 4H7VA 4GH7B 4PCYA 5DD5H 3W0WB 4BYHA 2J21A 1TEFA 2CDFA 2PPAA 5JOFA 2CLZA 3KWTA 2NYKA 2HLFD 4MCYA 4AQEB 1QNIA 2DQFB 3LRSB 2YFOA 4TL4A 5CJ5A 1H9VA 4PJHF 4CAGA 3VFGL 3U7YH 1G7LB 3SSGA 4B50A 5A6IA 1GJIA 4OV5A 2I5YH 2F74B 1G9NH 3NESA 1K6QH 4X6DB 5HI5D 2X4OA 1PJ9A 4NP4H 4PB0H 2OJEB 1YEFH 3S36H 4GG8B 1N3NB 4RESB 1LHZA 5GIRA 4OJYA 2PCFA 2YIHA 1VSCA 2LVEA 5C0DB 5JPNA 2QQNH 2X1PA 2YPKA 5IVNA 2XYBA 2X2HA 3GMLB 1FVEB 1SDDB 2FQFA 4FE9A 1CICD 3I75A 3FT1A 3ARGA 1HH9B 1EERB 2YD1A 4FXGC 5F72S 3TEUA 1G4MA 1MN4A 5E1QA 3HJ0A 2E3VA 1K2DB 1IILE 2ENQA 3ASWA 3CVDA 3HN8A 5BO0D 5HYFA 3MNVB 1MRFH 3UTOA 2XV3A 2BSSB 3PAYA 4P23B 4XO4A 3VFMB 1SYVB 4H26B 2HB0A 3C60C 5H94A 1D6EB 2Q8AL 5C3IA 1OGTA 4AQZA 2GAZA 3BDBA 1J5CA 3HMXA 5E6YA 4GSQA 5G4MA 3WTUA 4KNQA 1CGSL 4MJ5A 5G2NA 1ZPLA 4LLYB 4RSYA 5E94B 3F64A 1X44A 4AYFB 1U2YA 1W0VA 1UD5A 2NCMA 1KWKA 2WBXA 2X0VA 1I9RL 3PP3H 3BJ91 2CMRL 4GI8A 1N19A 2OV0A 2F0CA 3HZMB 4M1GH 3GO1L 4TNEA 2Y6SC 4A38A 1OF0A 4PJEE 4GW4B 4FMKA 4NNXB 3FQYA 2OK0L 2DPKA 2H1LM 4N2AA 4HDIB 1IC1A 4JFEE 4QGTA 5HHQA 1SEQL 4MMZB 1OGTB 2BCKA 4KKQA 1F3RB 4WUUB 2AK4E 1KYOJ 5D1XB 1PZUB 1FGNL 2APFA 3SE6A 4GT0A 4CVUA 3GSVA 1JFQL 4KDTC 1UB5A 5F97E 1KELH 5IFAL 4P4KA 4K9EC 4HOWA 3FRPG 5IVXF 5TPWH 3BO8B 5TDPA 2DH3A 3FTUA 4TLSA 3WIHH 5HHMB 4K3JH 5FWRA 5TGBA 1MPAL 3TNNB 1HHIB 1BGXH 4ZPVA 4HBCH 4PS3A 3KPLB 4GUPA 3HZMA 3L9RB 1WWAX 2PXYD 1E30A 2IJ0C 3NJLA 1PKQE 2HWZL 3PQYA 4UOZA 3PV6B 4XP1H 5TQ0H 3W39A 3WKPA 4PVBA 1EK3A 3CFJA 1M6OA 4IMKC 1R3IL 2XI9A 4LLYA 2PR4H 3TYFA 1KCUH 3VXSD 1LEIA 1U2HA 3BDXA 3UTTD 3CZJA 3QB7C 5L4JA 3US9A 3QFJD 5T5NF 4LCCC 3V9FA 4E0RA 1DJHA 5DWPA 4HKBA 3MRKB 5FOJA 1E67A 4P5TB 3DX1A 1A47A 1GKEA 4JKMA 4G5AA 4HK3N 4KPHL 1WBXB 5DRNA 1ZDSA 1RZIB 2DBLH 2ESVB 2HTKD 2JKNA 3QCTH 1R9FA 4YSEA 4OBRA 4HUVB 2WV3A 2BRRL 1RK0A 1FAIH 3H0TB 4HK0A 5D1XC 3U4EB 1F42A 2XY2A 3V6FA 4I5BA 1B0GB 4UT9A 4Y4HB 3U25A 4AL8L 3CCHB 2VXVH 1SDYA 5DJZA 1F97A 2WCSA 5G4NA 5GRJL 1UH2A 4UT9L 2K45A 4U1JA 5KS9E 1UACL 5AW1B 3QZMA 2QGDA 4GOSA 2BC4A 4HW6A 1A9VA 3FZUD 3PFQA 3RNQA 5FO8B 2P47B 1YEIH 3QDGE 1RK1B 3RTLA 4FULA 3BSZH 4RFNB 3BMWA 1QA9B 4X8JA 4BGLA 3IPEA 1YO4A 4NC0B 4GKLA 3BDYH 1AG6A 2Q1EA 1F8TL 1BQHG 1CGYA 3QHFH 3QJVB 3RWDB 1G7LA 4KRPB 5KJ7E 4X5XA 3LXUX 3KBEA 3F00A 5LG1A 5JMOC 2AJVL 1JZEA 5MP6L 1JYVA 4AW4A 3LKSA 2AJSL 1KJ2L 4FCHA 3SQOL 3WLBA 4IKLA 3WNKA 4DETA 1AO7E 2IQAB 1F90L 3UYOD 1AR1C 1MLBB 3MRHB 3QYCA 3PP4L 4HPOL 4I18C 4W93A 3BKCH 5BZDB 5C0CB 3K5SA 1KUMA 2YKLH 1IJNA 5KJ4A 3V5KB 4OZFG 4BQCA 2J4WH 4RBPK 3FCTB 4NUJA 1FBIL 4JE0A 1AXSB 2D7QA 5C2BH 4GP4B 2IV9A 2CRYA 2UWEB 5C6PB 2MH4A 3EJZD 4J3OH 3V8CA 3EF4A 1SEQH 2EEAA 4PBXA 2R69L 4NP4L 5DTFB 4M6ML 3MO1B 4IQHA 4PEEA 2CPCA 3ZRCC 2E7LC 2CIIB 1JF6A 1WD8A 2G75B 4YSOA 3X3FL 3NJGA 3REWA 2B3RA 1SJXA 2J72A 4CSPA 1FN4B 3J2PA 4HF5L 1I85C 4IBLT 5D6DC 4WEBL 3I3DA 3S37L 3NP4A 4IGBC 4JGMA 1EEYA 3D25B 4GMSH 2MIZA 4KZ0A 1YEJL 1H6EA 1OD7A 1P4UA 1ZRUA 2YA0A 3KVPA 3HCVA 3GTVA 1RZGA 4M5YL 2OW6A 3LH9A 4LP8A 1T83C 1QLFA 3B5HA 1T0OA 1T20B 2XPGA 1FNAA 5IW3A 4JQIL 4RNRB 4MD4A 3JWOC 5DJXA 2Q5BA 4LHUG 4IU2B 4C83B 1D2OA 1DQIA 4G3YH 3RWJB 1JZDC 1GVIA 1MAMH 3U30C 1AD0B 5KW9L 3DYOA 4TSBL 4JFTA 3IPBA 4HGKC 3L3OC 5IMKA 3JWNE 4TS6A 1L9SA 5C0AE 3WLWC 4ENZA 1QQDA 2YJLA 5D1ZB 4HFWA 3QQXA 4HH8A 2WJ7A 4XE0A 5SWZB 3HNSL 1SBSL 5GRVL 2B20A 1GZQA 1HXMB 2K6WA 1W8NA 1I4FB 5EUOF 3O3DA 1U91B 4F7PA 1RI8A 1QG3A 2ITFA 2C3XA 3CUPA 3SD2A 3U2SA 2YD9A 3OAWA 5DSCA 1MIEL 2ROYA 3LMJH 4KXZI 4MNGE 3WNMA 3EAKA 4KX9A 1KG0B 4AQ8C 2FLBT 5H2BA 2FHBA 2H32H 4ZMYA 5HYQB 4HS6B 4CMMA 1ADQA 5DURD 3ZKNC 1UOVA 2MOVA 4MXWH 4H88H 3O9WD 1XR8A 3QUXC 1YYMH 3U30B 3N44F 1C16A 3FB6B 4UNUA 4QUOA 4XXWA 3U1PA 2NX5B 4OGZA 1AGFA 5D1XA 1H3VA 4EJ1C 5CD5C 5F88A 1E4WH 3C8KA 4HAGA 4H8VA 3LQZA 4OLZL 1KBGL 3E8VA 1YEGH 2QVIA 3ZOAA 1BXVA 1DEDA 2FQDA 3OLDA 3UGEA 3TFBA 2M2DA 1I3RA 3BDYL 4R3SA 2FJGB 1QWUA 4UQDA 1ZHNA 2KDGA 43CAA 1MWAA 2PW2B 3AM8A 3A0OA 4QRUA 2V2WA 4F24A 3MXWH 3FO1A 2FE0A 3QZOA 4KJPC 4X6DF 1IGJA 1U92A 5JA9A 5GZNC 3P0YL 4OY9A 2Z7WA 1AKJD 1M2OA 15C8H 2ZTBA 2HX7A 25C8H 4ZBJA 2UZYB 5F9WB 1XR8B 2E8YA 4R7DA 3KLQA 2HFTA 5IHZB 4A67A 4A7GF 2VLKE 4W4NA 1A1OA 3FT2B 5DDHB 3X3GH 3FFCE 2J4WL 1D6EA 2ZKWA 1WTLA 3K0WA 3UDWC 3HG1D 4M4RA 3JV4B 3DETD 4UQ3B 3WNNA 1ZD6A 4C47A 2VLJE 4FNQA 1KTJA 4L48A 4KUZH 2G2NA 1LNUB 4R4NC 1MNUH 4Z0BH 5H35A 5AW8B 3GLDA 3Q8BA 1I7UB 3D3VD 3P0YH 4P2RE 1H3PL 4TM9A 3O2DA 3T65B 1KTKE 3N91A 2F53A 5DD1H 2ERJC 2I60L 1J0ZA 3WY1A 2O5YL 1M05A 5L88H 1L9RA 4IU2A 5I17A 3RL2A 1OPOA 3TWYA 4RNRA 4E5XB 4XPFH 2AKRA 2E7DA 1ET7A 2J12B 5FLUA 1BLNB 2FRGP 1OM9A 2G3XA 4WFFE 4MHHI 3ZE1F 2K1MA 4Z23A 2OJEA 1E4XI 4KI1A 3ESPA 4JM2C 1PD0A 3B3IB 3MV8D 1MRCL 2BP0A 2BVPB 2CKBB 2Q8AH 1JGVH 3FT3A 2BSTB 5LGHH 4AZ8A 3S48A 3S9DB 3EJYC 1YPZE 4KO7A 3OKLA 4PJ9B 1LK2B 3GD1C 3D25A 2TSBA 2PPCA 2GJ6B 3DJZA 3V7MA 3RQ3A 1DVXA 5AOJA 1CI5A 2NNAB 3FDWA 1ETB1 4XNQB 1JPST 4LVHC 4YBQC 3TZVD 1IGCL 2QFRA 4QJ4B 3GINA 1FRGH 1D7CA 1ZSHA 2IO5A 2NY4C 2K70A 3FSAA 3LXCA 1DBAL 3PGDA 3QDME 4PLJD 5LGJB 2GSGB 1NCDL 1JTPA 2ENYA 3GM8A 2WXFA 4ZYKA 4N25A 3VXNA 2O93L 5BQ7A 1A5FH 2EADA 2IPKA 1P2CA 5T3ZE 3EYOB 1NC2D 1PG7L 4UOW0 1JHTA 2AEIT 4V2BA 1T3FB 5I6KA 3TBWB 3MZTA 5LNEA 1IVTA 1YC8A 3DVFA 2CK2A 4JPIA 4Q8BA 5CGMA 2PTVA 4R2GD 1IUZA 1HINL 3HLAA 1JBJA 3K2UH 3FO2B 2JH2A 3QEQB 5CFHA 4LSQL 3O8XD 3O81A 4YDVA 3JT2A 4GINA 1H3TA 3QG6A 2R39A 3U0PB 1IGMH 3KXFE 4RX4A 1MHPL 3UERA 1IAII 4IS6A 2NSXA 4MCZA 5DHVH 1L9TA 4JQXA 1NUNB 3ZTNH 4WJ5B 4XN2A 4AM0B 4F8PA 3EUUA 1CIDA 2MNJB 1LO0L 1M1XA 2X70A 3NJNA 1JIBA 1OAYH 4PGCA 3PS6A 1UD2A 1FVCB 2XWRA 5TDOB 4HGMA 3GT6A 1JZ4A 5BXFA 3ARUA 1IBGL 4GAYB 4BEIA 1P9MC 2R29A 4PJBE 1XF3A 4J4PA 2XZCL 3IS1X 3KNBB 15C8L 5J5EA 2XIDA 3LEVL 2CHZA 4JVPA 5I1HL 1CE1L 3EYUH 4L8SC 1IC7L 3STZB 3KGUA 1NPNA 4PJ8C 4Z3EA 3TBTB 2HT2C 3IFLL 4LSVL 1VAHA 2XOTA 3HUJF 2UXVA 3VXNB 3RY6C 2Q2EB 4HK0B 4LOUD 3U4EA 3V6FB 3KGRA 2R4RL 2XZAL 4NNPH 2WC7A 3CX2A 4P4RA 3NT0A 4JN1L 1WYJA 1J48A 3B83A 5SWSD 3D18A 3PHAA 4K94H 1NAMB 5LBGA 1VZGA 1ZGLA 3TOPA 3ZYOA 3NJMA 3MRKA 3PJLA 3WSQL 2IH3B 2Q20A 3NCYP 3B7RL 4DEPB 4QHUA 2NTSP 2X89D 4IRJB 4HJTA 2P45B 3DOHA 2F8IA 5I74C 3RWCA 1WUZA 2YD8A 1AZCA 4JFFB 1XGYH 4OLXL 3TH2T 1JPSH 4AENA 4NWTH 4Z77A 2BK8A 3EZ8A 4ZNCD 1N68A 2XXMB 3HRPA 3Q8CA 3ZGHA 1LXMA 1J88A 1TTGA 5DJDA 3FQRA 1DSYA 3KPPA 4MNGA 4TN9A 4ZAKD 5JDJA 4LKXB 4KQ4L 3KPOA 3UO1H 3AMLA 5CGBA 1TYEB 4PRPD 1SLXA 1ZLUH 4HJGA 3NH7L 3QXUA 2G30A 2JB6A 3L95B 1E3XA 1HZHL 3POHA 3RZCB 1NEZB 2CR6A 4JDZB 1F90H 5HGAA 3NN8A 5E08L 3NA4A 3OBAA 1FRGL 2W91A 5B1JA 1WSST 2F8XC 5TJWK 1Q38A 4G9FB 2XETA 2XG4A 1F4XL 4H8PA 2GITA 4GLRI 3CFUA 2NTFA 3P4OA 2VLRA 2DQHL 4MMZA 1IE4A 1RHFA 3OJ2C 1BZ7B 4MXVF 3I2CL 5HHQB 5IHZA 3D0AA 3MV8B 2XN9D 3F12A 2PYEA 4WU5B 4KY1L 3P0VH 3C5SA 3NCMA 2CLVB 1JDDA 2XVGA 1FSKC 2CXGA 3CWGA 3AMKA 2GTZB 1OWRM 5B7EA 1GGCH 4YVNA 1RIUH 4F7CB 5IMKB 3NZUA 3QO0B 4G70B 4CC4C 1FG2B 5LQBL 5IKCA 3ULUD 1XF5A 3BH8A 4NQUA 1ZTXH 3ABKB 5B1AB 5CCHE 1MCOL 4DP6X 1X9LA 4MMXB 1VB9A 4ANXA 3RPIA 4ABUA 1FDLH 3W3BA 1PS3A 3H9SA 3QG7H 2EP6A 3FUEA 2BNRB 3IFOB 4X8XA 1ID5I 4JZNA 3MV9A 1NBZB 4DPBX 4YDLC 4G1EB 1KXQE 3QZWB 2Y7QB 2D2CC 1V7NH 3JTBA 5HP5A 4TULL 4D9QE 4W68A 3ARXA 1ZVYA 1UXWB 3MJ7A 4MJID 3VFTB 3L45A 3H9SD 1UJ3C 4MASA 2MCG1 1R47A 5KG9A 4MDRA 4RFEB 1J0KA 1KGCD 2JI1A 1A6UH 5G55A 1AGEB 3GMLA 1AHMA 3O3DB 1CXHA 4IOIA 1DBML 2AQRA 5B21A 1I8IA 4NO3B 1UT2A 3NEEA 4XC3L 5D7JB 4WFHE 5D4HA 1V3JA 3QK0A 4NNPL 3CZKA 4OTXH 4UMGA 3FB5A 1V3KA 3QWOA 1PCXA 1UGNA 3VQMA 5L9DH 2Y07H 5CZVH 3ESNA 3MOAL 4JRYA 5CGTA 1QSEA 4FADA 5JXAH 2J2ZA 4XN1A 2KMWA 3MI6A 4Q9RL 4WI5A 1O6SB 2BOBA 4Y2OA 1SXSA 1TSRA 3FFDA 2ZXBA 4PJHB 4HG4J 4PJ8A 4WTQA 2ICEA 4G6FB 3DMMA 1SN2A 2IAMD 5EULV 4BBWA 5FYLL 3S8WA 2WW8A 3GMNA 3MV11 4OLYL 2CDEB 4X5XB 2AI0L 2YPLB 2R0ZL 2KS0A 4N0UA 1W8OA 1TIUA 1FNGB 1XCTB 4ZMNA 1XTLA 1QBLH 4NCDA 2IDTA 4XX1G 4B9PA 4F33A 2BFGA 2X40A 1MOEA 1RJLA 2ZOUA 1Z9LA 2C3VA 2BP5M 3QORA 2CIIA 4OGXH 2GJJA 5ESVB 4OGYH 3BCFA 4N9GA 4U7MA 1MCJA 3F6JA 3VXRE 3LNEA 3P3YA 1EZVX 3I3EA 3RAJL 2J25A 3BSZL 5A1AA 2GPZA 4WF7A 2F1EA 3RPBA 1RIVL 4UIMB 1OW0C 1QASA 1QBAA 3OJVC 3FCTA 3ZX1A 3KLKA 5FYJU 3CX5J 3GZPA 5D7LB 2QTVA 1XD1A 1RK0B 2CDEA 3KWXA 4IDJL 4JR9L 2K4AA 1S9YA 4AOFA 3HE6C 1XVSA 4YQXL 5E2JA 3S88H 3SJVD 2WUBL 4PWJA 1F6AB 3RGHA 4JNXA 1U58B 1GH7A 3LKSB 1R3LB 4FFZL 3PP4H 3JWNH 2VQ1B 4NRXA 4ANWA 4NGHL 4PJ8B 4YEEA 1NUGA 4ICWA 1G6RL 3OMAB 3L4VA 5A7EA 2CIKA 4A37A 5EC2A 1LEIB 3OSKA 4GRWH 1BZDA 5A40E 5E1GA 3L5HA 1JNLH 2DOCA 4YHMH 5GJSL 1JOIA 4IDJH 4NB7A 2MKWA 4UQ2B 4Z7IA 3KD4A 2EO7A 4ZUVB 3E8UH 2ADIA 4I2XE 1H5BB 1WFIA 4U6HA 3ZIYA 2DDQL 3MV7A 4GUPB 1QKZL 4KTDL 1VGKA 5FCUH 5I15H 4QAWA 3T4AA 2PETA 4B3VA 2DQJH 3WTVA 5DO8A 4MX7B 4NO0B 4MNQE 3LZOA 2C9SA 5C9JA 4HIEB 2IBZX 4I5BB 1Q72L 4DQOH 5I73C 2N01B 5AAWC 5TFSH 1EVUA 2GJZA 3ZTEA 1SN5A 2GK0A 1BIHA 2D0GA 1L6ZA 3A24A 4PJIF 4F2ME 1KJMA 3NCJH 2R1WA 4NAJA 1FZJB 3RUGF 2HFGL 3U83A 5AWNH 1MLCA 2X3AA 2Q86B 2EVFA 3FTWA 3BWZA 3QARA 4NZDA 1NFIA 3KLAB 4D0CA 4EI6A 4P59H 3LKNB 5AB9A 2AJZA 4UU9B 4XP6H 1FZOB 4HUWA 5EA0L 5H37G 4MA8H 1QSFB 1FGNH 2E9GA 3BCDA 4J12A 3D39E 1MAML 5FOBA 4F2MA 4M1CC 1M6OB 3L4UA 4YMPA 5IMMA 2LE9A 1JXDA 4OCMC 3BEWA 2BNUA 4FA7B 5B8CA 1LYQA 1P1VA 2ZPKH 3FTXA 4HCFA 5EZIL 1FYTE 2Y7MA 2PTUA 4ONHA 2GTZA 3W9EA 5KSBE 5IMMB 3BKJL 1C8QA 5KN5A 2PO6B 2WOBA 3CTTA 3DXAB 2NY2D 3HJEA 5EUOA 2CKNA 2NQDA 3IBOA 3KXFA 4BELD 2Z93B 4BSJA 2HG5A 5IEKA 1BWMA 1A7NL 3GQFA 2O5XH 3J27A 3HHSA 4JFUA 1L0QA 2OMBA 2OCFD 3FT4B 5B39B 2JELL 3MRPB 2Q86A 2ADJA 3HG1B 3Q43A 3BZDA 5F7DA 3B7TA 4TOYL 5LJYH 2I9LA 1EEQA 5SWSA 2VUYA 5AW0B 4L8CB 1DBBH 4IBSA 5JIMA 4KGJA 2R51A 2Y24A 1D5ZB 4FQQA 3V0VB 2W60B 3H42L 2IAND 1J1PH 4RISH 2PP8A 4TULH 5CLXA 2VN5A 5A2AA 4R5TA 4LIQE 1IGYA 1UA7A 2PW1A 3CJJA 1XF1A 1NMCC 4ZTOL 3Q3GA 5BS0D 3WTXA 1IGIL 1SUHA 2LU5A 4AXWB 3KPMB 4K7FB 3BP6B 1AE6L 1YEHH 1N3NA 3NSDA 2ADIB 3IDYC 2JK5A 4UQ2A 5IFAH 1QFWM 2J1XA 3JZYA 1F0LA 2PCPB 3MOAH 2O5ZH 5JLZB 4RISL 1DUZA 1X7SA 5GGTH 3S7GA 4K3JL 2CBTA 3IGAA 4HZLA 4I48B 4A7GA 5GRVK 4J39A 2YWYA 3GZOA 4FKKA 5IT2L 1J5OH 5G5DA 1P9MA 1TU2A 5GGVL 2I5YL 1T1YA 3NFSL 1WHPA 4JAMA 4H0GA 3VG9C 4FHKA 1NBYA 3SGDH 3OX8B 1A65A 2CCWA 2NXYC 1U8IB 5JOFB 1UKQA 3AZUA 3G6JA 2F53E 2Z9TA 2ISDA 5HGHA 3NRFA 1SFHA 4DP5X 4M02A 4I0PD 3MQIA 4NQDD 4F8NA 2OMUA 5DMGC 3MJGX 4JJHA 3F83A 3P30H 4UIMA 4O02L 3MRRB 1DVFD 1RJCA 3FB7B 3ARBB 4TVUA 3VD0A 2V7HB 4MQTB 1DSFH 2GC7C 4E68A 4P2OB 2K3TA 3TT3L 4OGYL 3ARDD 4IJTA 2XBTA 2FX8H 1Z3GH 5FYKL 1T0PB 3PY9A 4GAJH 3PFUA 4D9LH 1IBZA 1ODUA 5IBLC 4GUQA 1N8ZA 1XCQB 3ATEA 2QTEA 5CCKH 5AWNL 1P0SE 3X13A 4QYAA 2AXGA 3C5ZC 1NCTA 3UDWA 2PXYB 3N2JA 3WIIL 3O2DL 3LS5H 1S9KC 3FUMA 5B39A 1NKGA 4JRXE 5JQIB 3LRSA 4NC1C 1H3WM 3FL7A 3BN9D 2JLLA 3C2AH 1XGUA 4LHUA 3L1OL 1J9TA 3EHBB 4GY4A 3SDCA 3GXMA 3M7FB 4BFBD 1JGDA 2CHXA 5JOPD 2P7TA 1IVLA 5JIDA 4Q2ZB 1TFHA 5F6HJ 1KPUB 4XPHL 3TURA 4U1SB 1MH5A 3Q2NA 1PAMA 3I6LE 1MHCA 4ODHH 4U7KA 3EOAB 4DVRL 3OKDA 5FOBB 3T2NH 3Q05A 5C08B 4LHJB 4HGWA 4BM7A 3NQIA 2ZX9A 2OZ4H 4YNYB 4NFDA 1VFUA 4GEIA 2Q7YA 1R75A 3D0LA 3KPRE 2P26A 4BWTA 5CZRA 5GRUL 1ZLUK 1F02I 1XFPA 2YC1B 1YA5A 3DGCR 4DH2A 2VL4A 2BNQE 1IARB 1T7YA 2JI3A 4ZPTA 4WSKA 2RAMA 1ODAA 5GJTH 5I6OA 1JD7A 5L4FA 3MX0B 1CBVL 4M1DL 1GGUA 4QOKD 3BWSA 1KYOK 2VO5A 4IRJD 4CNIB 2PO6D 1VEOA 3MJWA 4Y7MA 1LLAA 3DHPA 4APQA 1NDTA 1TF4A 2R69H 4B3EA 4OFPA 1MFAL 4IW4C 4MA7L 3QW9A 1G43A 1QD0A 4P4KC 4LO9A 4M7ZC 4FHBD 1O6VA 2ZOWA 5KVGE 4HS8L 3U9UB 1KBBA 4PJAF 4ZUVA 5CMAB 1RZJL 4PLKC 4OVUA 4F7EB 1HC1A 1WPCA 1V3MA 4M93B 3PGFH 4HKXB 2CK0L 3LAFA 4YZFF 2XZQH 3QHTC 3LPWA 4FQCL 4AT6B 5C0RH 3MFGB 2C4FU 1YRKA 1MFAH 4YGAB 3BRGC 4W9CC 3WEBA 4HXAL 3LKOA 4CW1B 5GGRY 1S3KL 2PYEB 1T0NA 4G9FD 2NLJB 1F6AA 4LQ1A 5F7NC 1DQJA 3L5JA 2BWQA 4HS8H 4ORGB 4UQ3A 2FQEA 3TLRA 4NRYA 2K7QA 4FQHA 2G0LA 1RLBA 2XRAL 4OV6F 3HPLA 3D2UA 3FHQA 4UAOB 3ARED 2JSFA 1FFTB 2F54A 2CGRL 2VIRB 3P9LA 1EBAA 4DZBA 2BHYA 4G6JH 1TTUA 5F7KC 1HHHB 1PLGH 3F84A 2XFXB 5CO1A 3OPZH 1UM6L 4BHUA 1MFEL 5C0FA 2FX8L 4KTYA 4GKNB 5ADPL 3GI9L 1T5WA 1KFAH 4P0DA 3LRMA 1S3KH 4U1LA 3QS2A 2VDMH 5FB8B 2ZQKA 2JKSA 2V6HA 1EAPA 3HRZA 3ZGIA 5T5FL 1LL1A 5HGBA 4Z7OE 5FF6B 1B9KA 4FQJL 5FEBA 3A23A 2F6AA 3LOWA 4MAYD 3ULVF 1KCVH 4G7YH 4OIIL 2OYKA 3F01A 2BVOA 2X3BA 3K72B 4IBUA 3BZ5A 4QRRE 3P9LB 2ZKHH 1AH1A 3II3A 3P54A 4BSWA 5LG6A 4JFQB 4LF3B 3E6FA 1MZZA 4L4TE 2EDFA 2XWTB 4X98A 4L4VB 1BM3H 4O9HH 4LCCB 3MBWA 4HS6A 4CMMB 4X6CB 5CINH 2FBJL 4WGKA 4DEUA 3DO4A 4MFHA 4NWUH 5SWZD 1OE3A 1E5CA 3TONA 3DVNA 3G04A 4Y5XA 1AR2A 3QYMA 3GNML 4QT5A 2W95A 1BG9A 1C5DB 5SWQA 4Y89A 3QWOB 5F9OL 1WRFA 4P3WA 1VFOA 5E9DA 3K3QA 3LPPA 1WT5C 4JPVL 4XAWL 4Y1SA 3RTQA 3VYOA 3MLSH 3QDJD 3O41A 2ZXCA 4GXUN 1T03L 3VFUA 1AGEA 5E95B 5CINL 4ENEC 5EDXA 3CHOA 5CJXA 4X42A 3NTCH 4NO5A 3KPSA 3IAGC 3DTDA 4XZUA 2DIBA 2EACA 1T66C 4WY7H 4OF6A 4OLEA 1WZKA 4LEXL 1NCBL 3VXMB 3AAZB 3BAYA 5DJCA 2X70B 3N42B 1X5GA 1U6AL 4F37F 4WJ5A 2DV6A 2VDRL 1T5XB 3HE7C 4DKFH 1GOHA 4W9IC 1BMGA 4ZMVA 4L3FA 3CH1B 4DUWA 2C1OA 2VAAB 4XBEL 4DOHE 3OVUB 3EYQD 4N6QA 3N0AA 3QIUC 4NO0D 4MSWA 2CZNA 1UWFA 2I85A 4Z0XA 1W15A 1P6FA 2AEPL 1X5ZA 2AV1B 5EN3A 4UWQB 2EXYD 1TQCC 3ARGC 4HHWA 2M26A 1PZ2A 2GI7A 1RZFL 3IB4A 4ZMTA 4MZIA 1ETJA 1KGYE 4Q89A 4LCWD 2W88A 5I8EA 2B1AL 5L0QB 3IU3B 4D94A 3EGSA 3WGUB 1GYCA 1FO0B 3VU1A 2EDNA 1BZ7A 1KIRB 3QRLA 4LGPB 5CSZB 4GXVH 2Z31B 3B9AA 2GSGA 2QJDA 3H3PH 1XQ4A 5IB3A 1UQSA 5D5MF 2VZSA 5GRUH 5C8JB 4NEHB 1HHKA 3VXSE 2ENJA 5I1AB 3K74B 3VWJC 2CD0A 4XMLL 4OZIB 5D9SA 3P0GB 5HGAB 5LDSA 1AR1D 4DUXA 3P77A 2YAQA 4A7UA 1R24B 2FB4L 1NSNH 2OI9B 2RR3A 3NIGF 1KBPA 3UL4A 1QA9A 4X8JB 3BT2L 3FRPA 3BZEA 4N2BA 3APDA 3QXVA 2XV6B 3A4DA 3WIFA 3ZQWA 4DKDC 1IQWH 3FCSA 4HQQH 4ZK8A 3B3BA 3ZUCA 2J44A 1BEXA 5D7HA 4ELKB 3EDFA 1AI1L 3Q5OA 3TEXA 1EXHA 3RL2B 4PRID 1FNHA 4ZMLA 5C0EA 5CEZH 4JFYA 5HJBA 1QUNA 2QQKH 3ERXA 1JGEA 3NFPB 3UIZA 1YYLH 1QPPA 3TASA 4JRYE 3X3GL 5DUML 2Z1KA 3E9UA 4IMLA 3GMMA 4YUEL 4L9DA 1HKLH 2VMJA 4RRPG 2WUBH 1SF3A 5DZ9A 2IFFL 2WBKA 3M86A 4K23H 4WWKB 3BGMA 3N55A 2VERN 1G7PA 4OR1A 2E27H 4I2XA 4BD4A 2X9XA 1E4HA 5DD3H 1MCRA 1HL8A 2BPBA 3N1MC 5EIIG 1MCCA 1ZVHA 3ET9F 3HZ3A 4HKZB 4U1GC 3TF7C 4HPYH 3NFNA 4K3HA 1DVSA 1JUFA 5DS1A 4FX5A 1W9XA 5DUMH 4XPFL 3NFPA 3TVMB 1YJDC 2UZPA 1OGSA 3SCMA 2BINA 3TU6A 4D9LL 4EDWH 1FH5L 3SJVA 5C0EB 4WLCA 1HNYA 2HFFB 5GHWH 4UBDC 1DN0A 1N0XL 3VWKA 2VM9A 4H5SB 1ZANH 4HHGA 4MXVE 4IKJA 4OZHA 1P7HL 1XF3B 1H15B 7TAAA 4WNJA 4DEPC 4DO4A 1XF2A 4JGNA 3FJTA 4PJ7A 5ACLA 5JW3L 1KC5L 3C6SA 3OG6B 1YEEH 5EU6D 1FQ9C 3TN0B 1CLOH 2Q8BL 4R96A 2FQGA 5L4IA 3HTLX 4AI7A 3O45A 2YMOA 5CJXC 5AW6B 3WO4B 2DTMH 4FNLH 2OJ1A 4CVWA 1ICTA 4LSSH 4WV1C 4XPAL 4JM2A 2D3NA 3JTSA 5ICXA 2WXRA 4KK6C 4KNUA 3VI3F 1CVRA 4Y19D 2JCCA 1ZTXL 3TTYA 1KTDB 3BHBA 3H9HA 1FF5A 4AIOA 2WLKA 3D34A 3NIDF 3QG7L 4D9RD 2EO9A 1H3GA 3NCYS 4FL4B 5DF0A 4H8WH 1JWMB 4F7PB 4YE0A 4WQOA 3MRCB 4K0OA 2VDOH 3UBXA 5IEHB 2P4AB 3W9DA 2EDDA 4Q6IB 5ECJE 4NRZB 1LO5A 3JYCA 1Q94B 4OB5L 2WKOA 1BFOA 2Q3ZA 2QHRL 3QXDB 4KXDA 3FMGL 3PHQB 1QFHA 2EIJB 4QLWA 3NPSC 2WWMD 5C97A 4G82A 3RWJA 1XL4A 3MOQA 1L5GA 3EBIA 1JYXA 1A3LH 1QTSA 2QKIA 4FEIA 3VFOB 1A4JB 1M71A 2BSDA 2P3YA 2EUZA 4XODA 1ZEAH 1RZKC 2C1OB 2AXWA 4YGVB 4M7LL 4A39A 1C1EH 1NFIB 4U1KA 2HJKB 4TKWA 2UXGA 4BCZA 3L4XA 5DMYA 5E1HB 1QLFB 2RCSL 3B2UD 3WNIA 3VDBA 2OAAA 1I8MB 4OLUL 2XV2A 2F58H 2VSDA 1QSEE 3MFFB 4ZFOL 1A6AB 3VI3A 3VXOB 1Y6KR 1HH6A 1PF3A 2F5BL 2JIXD 5TPWL 4M3KB 2O6CA 4PUBH 5FLVA 5TH2B 2KHAA 3P11H 2OYPA 3RDTB 4LPUA 4NQEB 4FI8A 4WHCA 2QSQA 2ZXQA 3KYAA 4GO9A 4UDTB 1OP4A 1W72B 3CDFA 2PCFB 3O41B 2NY4B 5DZAA 5EFIA 5GIRB 5C0DA 1VKXB 1EXUB 2XPYA 2BH0A 1UOLA 3KJ4B 5IJDC 2CJTA 4O00A 3ZKMC 4JFZL 4KKCC 3T77B 2ZG1A 2I9TA 5T3ZH 3GSUA 1EDHA 3F3HA 3PUUA 4FQ2H 2HZHA 2GC4C 2H4EA 4K3DL 1H8NA 4MCMA 1WLHA 1DEEB 4CJ0A 2LV4A 2KZBA 3CZFB 3MBEC 5GRZA 2A74A 3ZYIA 2AS5M 3EYFA 2XX0A 4EZLA 2A6KB 2BIMA 2Z8WC 5F96L 4OGXL 1UKTA 2VDPB 1XEUA 4FQXC 3ZSTA 2NXZC 3EH5B 3O3EA 2YQGA 3FW6A 4R7DB 4XNYL 1AMXA 1HQRA 1CLCA 2G5RA 2W5PA 4AVIA 1R17A 2NMSA 1DR9A 1NCAH 1OZUA 1USQA 4JFZH 2EYSB 2XTLA 3GPSA 2JV6A 4FN0A 4LRIA 4QRTA 2IVFC 3B4NA 4X0KA 3WD5H 4KNTA 3FFCD 3NP3A 4ZQTA 2NY0B 2DYSB 2KYIA 3APNA 1MWAB 5BO1L 4DIXA 3DA0A 1LWHA 4R3SB 2NR6C 3EFFB 5FUOH 1MEXL 3VD3A 1QSZA 4LT7A 4GP5B 1N0LA 4PJGE 1I3GL 3SEPA 1AP2B 1XBRA 1QR1B 1QPKA 4F8TA 5D2NC 4UNVA 3BKML 1BD2A 4I3GA 1VGEH 3D3VE 3BPLC 1T5WB 1I31A 4R0LB 2Z4TA 4GMTL 4LPVA 3UZVA 3NAAL 5IK3B 3BN3B 2IWFA 1U3YA 1QX1A 2H0EA 3AS1A 3BE1L 4P2QA 4FQIH 1VFBA 2DW5A 4HIJA 3T6XA 3RGBA 3D85B 3N43B 3L2MA 4PGBA 2ENSA 4DPRA 2ZNXA 1KB5A 3OC5A 3F05A 5FX3A 2FJFA 2X2UA 1YUHB 1JJUA 4NZ8A 3TPUA 4H8WC 5GS1A 5FUZH 2VW7A 1JD9A 1G0DA 3H6JA 3CN0A 2F9BT 5BJTB 3IMTA 5D4QA 4I3RL 1MFCL 1SVBA 4JPKL 2P8PB 3VDAA 2W0KA 1OAZL 4RMUA 1CDHA 3ZSSA 5M7QA 2PWEA 5MEPB 1FA4A 1DZBA 3NTCL 3KPQB 4AL8C 2QV4A 4XCCL 3O6FD 1F3JB 5GZNA 1OLLA 5DJXB 4C83A 1A1MA 3N9GH 3BX7C 1OTSC 4Q7DA 4W6YB 3OF6A 4YSAA 4X6BA 2J88H 1GGYA 3CK0L 4QRPB 2OSLA 5I30L 3BGFB 3CSGA 2YPLD 4IHBA 5HHMD 4BKLB 4E9TA 2K78A 3FU3A 4K5PA 1YMHB 4G8IB 4X9FA 4A6YH 1I1RA 3QIUA 4K5LA 1QPXA 1RHHB 4UQBA 4D3CH 5B7MA 1HEZA 3AREC 3HC4H 5F93C 5PCYA 1IGCH 3U6XS 3WY2A 4YL9A 3SDAC 3ULSB 1HZKA 1OT1A 2WY3B 4X6CF 5A2JH 3CPUA 3KR3L 2ZXDA 2VXSH 2FD6H 4GJTB 2YEVB 2H47C 5DMKB 3HI6L 1J8HB 5D7KE 1KT2A 4PD4K 5DUBB 2IALB 4BH7B 5DK2B 1QKZH 2A6DA 2E7MA 3MGAA 1CF1A 1ZE3C 1TT6A 2OSLB 3VM5A 3NEXA 3VI4A 1MJ8L 1UWGL 4PLKD 4M61A 4OKDA 5B3SB 4EOWH 4XN4A 4ETQB 4GFXA 4FI6A 1L0PA 2AGJH 2I24N 4PVLA 2JI2A 3LCYA 1BAGA 3MR9B 1E2VA 4WHTA 2EYTA 3OLGA 3NJKA 1UZGA 3VSUA 5IJCC 3VXSA 1NFDE 1WDAA 3MYJA 4K71B 1KIUA 2Y3NA 3FQNB 4LNRA 5HDLA 2GI0A 3WLBB 4V1DA 5D93B 1NGXA 4Y1AE 2OMNA 4K8RD 4XP6L 3G5VA 2WQ8A 2QADB 2A9NH 2ZOLA 1C12A 3X14B 3D85A 4BE6A 2LLNA 3NIFB 2UY6A 2YAEA 1A4KB 1KJ2B 2BIOA 3BSGA 2YGNA 3G5XB 3IJSA 4NN6C 4E41D 1HDMB 4TSCL 1IE5A 3MREA 5SWSE 1AKJA 1DQTA 4JBSA 2PR4L 3OKMB 1MW1A 4WEEA 4LVEA 4YXHL 3KEHA 1P7KB 4QJ3B 3AJ7A 4FLRA 3I75B 3SE8L 5DJ0A 2B1HL 1OM3L 5C09B 2ATKB 2JJSC 5T5FA 3O8XC 1U8KA 4H25A 1BF2A 5J8OA 5CP3A 4M5YH 5F7WC 3QVAA 5DYOB 3JV5A 3H2WA 3WTWA 5C6WH 4JPSA 3LKPB 1DUYA 2Y22A 1U3ZA 4YL4A 3VDCA 4PCSA 1KWGA 5IB5A 1TZAA 1FAIL 2HLAB 4X6CA 1I7TA 1ACYL 4RAUB 4U31A 3KYKL 4UTBL 3PHSA 4FYRA 3QA3A 4KKBD 4PRPE 5FV1L 3TBVB 4YN3A 3RY4A 4NO2A 1MPAH 1HAWA 2ZSVB 2ZUQC 4CN1A 3KS0J 5DO2D 2DQFA 4PLJC 3B5GA 1TQTA 1AQMA 2AAAA 2A74B 2P5WE 4HWZA 4N5EC 1ZLVK 4YBQD 4PJDF 3LZFL 3ZQXA 4TLTA 2QELA 1LE9B 5HHVL 5JLZA 2ZG2A 5BRQA 4UUJA 3VH8G 3HFML 3IKKA 3U0WL 2AJ3A 1UKSA 5GQBA 4FFVC 4EXPX 2YFNA 4APXA 4L2YA 3T4YB 5ESAA 5I16B 5LGYA 3ZDYB 1NA8A 2X10A 1TZIB 2XN9E 5L88L 1URZA 4DK3A 1NGYA 4Y4KA 1A6WH 2JKXA 1HX0A 3BQUA 3DRTA 1H3UA 3ARBD 2DBJA 5LHDA 4JO8A 1G9MH 4PRHA 4R90L 4PJCB 4XNUH 5CNHA 5FYLD 5TGBB 3K2MC 1S4IA 5ITFA 1EPFA 4UMSA 2EDYA 1SM3L 3QSKB 1CLYH 3QZPA 2FD6L 1SXBA 1BYNA 3SDYL 3QPQ