1PW3A

Crystal structure of jtor68s
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
NFMLNQPHSVSESPGKTVTISCTRSSGNIDSNYVQWYQQRPGSAPITVIYEDNQRPSGVPDRFAGSIDSSSNSASLTISGLKTEDEADYYCQSYDARNVVFGGGTRLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords immunoglobulin lambda chain variable region
publication title Structural basis of light chain amyloidogenicity: comparison of the thermodynamic properties, fibrillogenic potential and tertiary structural features of four Vlambda6 proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pw3A00
3RUGF 2PCPB 1RJZA 2E9JA 3C8HA 5TPWH 3RFZC 2IFFL 3D18A 4Y5XC 3L3OA 4XXDB 2B39A 1P5VA 4QTIL 4V2BA 4JFPB 5TE4H 5I19H 32C2B 1L9NA 3F7YA 4TUJA 1NMCB 4ZD3L 1CLYH 2FR4A 3GMLA 5ERWB 3UAJC 5JUEH 1B4JL 3L6FB 4NQVB 4LSSL 4R8WH 4X4MA 4QXUL 1DBBL 4UU9B 3EO1B 5CEXA 3C5JA 4UTAL 4QRQB 5ILTL 2HT2C 4TVPE 3MFFA 2DQHH 4MB3A 4IOIB 1OF2A 4HCRA 3BFOA 5IMOA 3P9LA 4AG4L 4JZOA 1I7UA 3FQRA 1XGRA 1P7QD 5EULV 3TCXA 3BW9B 3SDDA 1JV5B 1K3ZA 4LHUD 2VSDA 1LK3H 2H45A 3VG0L 3VXUE 5MEQB 3MV8E 3DTXA 5D6CB 4E9LA 3BKCL 3KXFD 3UPRA 4QRUB 2QADC 1S7QA 4YPGB 3EDFA 3D1MC 1IC4L 4PB9H 3B2UC 2OXGA 1HHHB 4L3EA 1HILA 1T22A 4NHUB 1FFOB 2EO1A 4X6DB 1FP5A 4X80H 1MJ7L 3DX6A 3K7UA 3F62A 1RZJL 4QOKD 3T0EA 4U0QB 1C5BH 5EUOA 3DV4B 4S1RH 3RWJB 4HGWB 4L4TE 2X4RB 4QKXB 5TDNA 3RWEA 4KUCD 3HG1A 5D2LA 3D69B 2BZDA 1KSRA 3GI9H 4PV8B 3MJ6A 5CP3H 4F33A 1GIGL 2EE9A 4RGND 5JNYA 2NNAA 4GMSL 4IRJD 1U95B 2D7QA 5H37H 3T4YA 3X13B 1FZKA 5E00B 4GS7C 5I66A 5CCKL 1I4FB 4D0BB 5GIRA 3VD9A 5K9JH 3LN5A 3TVMD 5F1OB 1ZT4B 3CZFB 4OF5A 2R2CA 3RGVB 1U8NA 4R4BA 5DURD 4IM8A 4U4BA 2HMIC 5HGDB 4NKMA 5FOBB 1I75A 1HXMB 4YHOH 1RI8A 4KHTL 3B6SB 5EDXA 4I3RL 4L5FL 3PHSA 3L7EB 4MVBD 5ITBH 4NCC1 3PWPD 3V0VA 2VDKH 2WWMC 5FGCB 3H9YA 5I1EH 4JN2B 5KBNC 3WFEL 4G6AD 5DR5H 2BNRE 2W60B 3HZKB 5D7SL 3T0AA 3BPNB 2VDQH 4N0YL 1UM4H 3NCYP 1MIEH 3BDYH 1RUAL 2VIRA 4PRBA 2JK5A 1CTNA 1HHGB 4H8WH 1M7DB 1RFDH 1KELH 4Z0XB 1R3IL 3U0WH 2VE6A 3OR7B 4U6HB 4Z0BH 4L8BB 4P4RA 2YKLH 2B20A 4JM2A 4ONOA 1IEBA 3HE7B 2YEZB 1LE5B 1A1OB 4LASH 3HLAA 4JDTL 5GS0D 5HYJA 1XGYL 4P4KB 2PR4H 2BOCA 1ONQB 5JPNB 1WFNA 1EJOH 1PKQA 5C0CE 5JR1L 1EAJA 4TN9A 1B3JA 4X6DF 3RUGA 1HCFX 4KAQL 4XCNA 5CGYD 2ERJB 3DPBA 4KTEH 4S1QL 5D70H 5DJCA 5HI3C 1SM3H 3MO1A 1FVEA 3KYNB 5DMGD 3WXVL 2P4AB 4WO4C 4IOFD 1NGWA 4OIIH 1BIIB 1FGVL 1FVDB 4KK8D 3WN5B 3NZ8A 2Z8VC 1WCBB 4P2QE 5GGUB 5CZXD 4I9WE 2E9IA 4IDLA 5DEFB 2FCBA 4JM4L 1A4JB 3UBXA 1R3JB 4AJ0A 4QGYA 4PJDF 4M7JL 5HGAA 4KJQC 1MJJA 5D5MA 3CLFH 4HUVB 3OL2A 2C5DC 4KMTH 3C6LB 4ETQA 3V4VL 1SVCP 1P7KB 4OF7A 1DQQA 3SBWA 2GTZA 1UXWB 1ZHNB 1H3VA 3DIFA 1J0HA 5E8EA 4HIJB 1YY9D 4UIMA 5MEOA 2AJYL 2PF6A 4BA8A 4GUPA 3O6ML 4TSBH 5DQJB 1ES0B 4N8VA 4M1CD 3BT2H 1HDMA 4YHZH 4RBPH 4K3EH 3V8CA 5E6IB 3IVKA 5HYEA 2Y7QA 1DEEA 1IM3B 2BY0A 3C60C 4OF0A 3GMQA 2AI0L 1KXTB 2VR9A 1YEKL 3GSWA 1RD6A 2IQ9H 3X11B 1IC7L 1FG9C 1IGIL 2X10A 2IEPA 4KK9D 3UJJH 1PGRB 1WBZA 2CLVA 2VQTA 5E5RB 2YSSA 1F2XK 1ZA3A 3SDDD 3S37H 5FYJE 4WI6A 3U7AA 3JWDL 4YEEA 1S9VA 1DFBL 3CXDL 1LK2B 3DUSB 2PCPA 3MNZB 1JK8B 4QHNB 5J1AB 1CFNB 4XPGL 1U8IB 4S11A 4XXDA 5JZ7C 4JFPA 2WINB 4YPJA 3ZTJH 2DLFL 3L3KB 2O5YH 32C2A 2PETA 4NUJB 4V2CB 3CXHK 3NIGE 4QWWD 5M7QA 1D5IH 1RPQA 5HDOA 4YC2C 2XACC 3L6FA 4NQVA 1AY1H 3P11L 3UZQA 3NCYS 3HG1D 3EO1A 4UU9A 3L9RB 1JWSB 4MX7B 4WHTB 2YHGA 4P5TC 4IOIA 1DANU 5FM5M 1H9VA 1WCQA 3QEQB 1HQ4A 4LKCB 4RISH 5DC9B 4F8QA 2GITB 3MXVL 3BW9A 4H1LH 1JV5A 4LVHC 1EEUA 4JO2L 5MEQA 4LU5H 1FAKT 5D6CA 4AEHL 5IK3B 5GZOC 4QRUA 1INDH 4YPGA 3GMMA 5IBUG 1FIGL 2R0LH 1HHHA 1Q1JL 4UAOB 4NHUA 2NY7H 1RZGB 1FFOA 3UPCA 1J8HB 3TBYB 4X6DA 3U36B 4NQED 2EO9A 2BHYA 1OT1A 3DV4A 4RMRA 3RWJA 4HGWA 1LEKB 3DXAE 2X4RA 4DGYH 3MTRA 3FO1B 4NN6C 4RX4D 3D69A 1XGQB 2MQCA 1LO0H 2D4DA 5TE4L 3SKMB 4PV8A 3GSXB 5I19L 2GY7B 3VI3E 3ZTJG 4ERSL 4LPCA 1U95A 4I77H 3RL1B 3X13A 5DUMH 4JM2D 1K4DB 5E00A 4RWHA 5JUEL 4RGNC 4M3KB 4G6JH 1I4FA 3K8KA 4R8WL 5HYJD 4D0BA 2R1WB 5BZDB 1BOGB 1ZT4A 1QSED 3CZFA 1J1OL 3RGVA 4P48A 1AP2A 2DQHL 2B1HL 1JWUB 1KIRB 4GRWF 3VFUB 4PBXA 3TZVC 5HGDA 3BPCB 5FOBA 4ZOBA 5JO5B 1HXMA 2EYRB 3B6SA 1PYWB 1C1EL 3L7EA 5JOPE 2CUMA 5C2BL 4JN2A 4X9IA 1M7IB 5FCUH 2QQLL 2W60A 1RUKH 3HZKA 2APVA 4JRXE 1P4IH 4X80L 4XXCA 4PJBF 4Z0XA 1M7DA 2Z0BA 5C0ND 4LGSB 4U6HA 1L7IL 4L8BA 5EZLB 1NCAH 4S1RL 1NCDH 3HE7A 2YEZA 2I25N 4HGMA 4UT9H 1LE5A 1A1OA 1MFDL 5DO2D 2KQNA 3L3IB 3AM8C 4P4KA 1BPVA 3BQUA 4G7VL 1ONQA 3BKYL 5JPNA 4GXVH 3DX9B 1Z9LA 5DA4A 3NAAH 4IRZL 3BIAX 4PPTA 5GS2D 3O4OB 3OX8B 4BUGA 4MXWH 2NY1D 1AHWC 3OWEA 5C71A 4PY7B 1IBGH 2X5PA 4LK4A 5T1MB 3PXHA 4TRPH 3MRCB 3RX8A 3ZKMC 4WI4A 3KYNA 2COQA 3VFTB 3ZDZF 1Q9WB 3QDHA 4G42B 1QBBA 1BIIA 1FVDA 1Z6JT 3NN8B 4WEUD 1KCKA 5GGUA 1WCBA 2VZ1A 2X44D 4ZQKB 4QHKI 2ZUTA 5DEFA 4KK8C 5HBBA 1A4JA 2YD7A 5CJQH 1NAML 2FH8A 5I1EL 2CQVA 4MD5B 3EFFA 5CZKA 3X14B 1BWMA 3BKML 1ORQB 4M8QB 4HUVA 1MIEL 4H88H 3C6LA 1OSPL 4IS6B 1KELL 2QHRL 2AJVL 3MCG1 4J7RA 4OF6A 1P7KA 4Z7UE 1M71B 4P2OB 1ZANH 4Z0BL 1PSKH 1I7TB 1UXWA 1ZHNA 5EOQL 4PGEB 3RX7A 5F21B 3ZTNL 4HIJA 5CBEB 2ZJSH 5GGQH 5I15L 5DQJA 4DFIA 1CL7H 3PWUB 3G6DL 2CRIA 5C70A 3IAPA 1EJOL 1EZVX 1ES0A 1YY9C 3F7VB 4NOBA 2FSEB 4DKEH 2OK0L 5F9OH 3UC0L 5HVWA 3QXDB 2H2SD 3Q0HA 5E6IA 1RUPH 3BJ91 2YD8A 1ZT7B 1IM3A 5JXEC 3UCRA 1OD9A 2X4PB 3VFRB 2FL5B 1ZGLB 5DRZB 3X11A 2BVQB 1QO3B 5IBUB 3WO4C 4EIZC 3V6OA 2CXGA 1JMZA 1TTFA 3N85H 1UWEL 3TFKC 4Z9KB 4M4RA 3JWOH 2NXZC 1Z3GL 4KK9C 1H15B 5FUZL 4G8IB 3DUSA 1LK2A 3C8KB 1JK8A 4KVCH 4QHNA 5J1AA 4KJYB 4TUOB 1CFNA 1U8IA 4NSKB 4KXZI 2JELH 4P23B 3CK0L 2WINA 5I1GH 4XCFH 2V2WB 2Q87A 4NUJA 3CLFL 2CLRB 4A2MA 2FX7L 3QULB 3OGOE 4KHXH 1LO3H 1AXIB 4PTTB 1B9ZA 4YDLC 3L9RA 4HC1H 1JWSA 4G9FB 1KJ3H 4XP5H 4MX7A 4WHTA 1WT5A 4FNLH 4X4ZA 3WYRA 5DLMH 3QEQA 4LKCA 3H42L 1IGYB 3BT2L 2GITA 4M7ZC 1FAIH 2W0LA 4K3EL 5BOZG 4F7EB 1CD1B 3CFCL 1NFIB 1DVFB 5E03A 4RMVA 5IK3A 3RGVD 1GC1H 1TTUA 5IBTL 1MCBA 4FFWC 4H1LB 5A2LH 3C2AH 3UJJL 1RZGA 3EDKA 4ZTPL 3QIWB 4YHKL 1J8HA 3U36A 3LKOB 1WUNT 1J0IA 1A0QL 3I3BA 2Y07L 3CFKB 1LEKA 4R4FH 4NJAH 4RIRB 3HI6H 3FO1A 5FB8B 2HT3C 4LPTA 1XGQA 2DLEA 3LRGA 3RI5F 3SKMA 3GSXA 4Z7VA 2O5YL 1Y18B 1RULH 4PRHE 4WFGD 3VFWB 1HIML 1IEAB 3RL1A 1KBGH 3BO8B 1YZZA 1K4DA 2BERA 2AAVA 4NC0B 5CP3A 1AY1L 3HE7D 1UZ6F 1QUNA 1WAAF 2ZG3A 2R1WA 4P4KD 5BZDA 5HYQA 3BQUD 1BOGA 3VXSB 3O0RL 1IGMH 4JKLA 3VFUA 1JWUA 1KIRA 3F12B 2BRRL 2Q8BH 1TCRB 5CAYB 5JO5A 3LMJL 3BKJH 1OAKH 1PYWA 4OGAD 3SE3A 1TVDA 4LU5L 4NC1C 5TF0A 4BFGA 4BH7B 2G5BB 4MLSA 5EBGA 3ZKQD 1HHKB 1M7IA 3VDBA 3L3HB 4MJ5B 4CADA 2NY7L 2H41A 2H3NB 5SV4A 1I1CA 3WLWD 4YK4C 1MWAL 3RI5K 2A83B 5EZLA 2IPKB 2QJDA 3CAFA 2NY3D 2VDLH 2ZOKB 4CJ0A 1HHJB 5F93C 5FM8A 5H2BB 3QEUB 3L3IA 2CGRL 1LO0L 3VXUB 4EVNB 1GZQB 5A3ID 3MV8B 3DX9A 3W11D 5DO2C 3C6LD 3GNMH 2XPGB 1NANH 1Q0XL 1W2KT 3HFMH 4I77L 5T1KB 3OX8A 5CHNA 5KVEH 1T7XA 4HMEA 1M7XA 2D7MA 3IDMB 4NM4L 3MACH 4X8JB 1XF3B 3SBWC 4KDTC 3RX5A 4PY7A 2P43B 3W0WE 5IKCB 5T1MA 4W4OA 1BD2E 1FNGB 4GW4B 4JN1H 4FQIL 3MRCA 2FX8H 4DN3H 3MLVL 4B0MM 3VFTA 1Q9WA 4G42A 2WBWB 2GKIA 5D1QD 5E6ID 3NN8A 3BEWB 4F9LA 3VXPB 1A7NH 4G80B 3IU3B 3QAZB 4ZQKA 3THML 4NP4H 4TVPL 4M5YH 3HMXL 4NKIH 4WHYH 3RY4A 2BOBB 2R0ZL 4MD5A 5I8CB 3X14A 2E7HA 3UTZB 1ORQA 4M8QA 4MSWB 3EYOB 4AIZB 5FEBA 3SQOH 4IS6A 4XC1L 5GJSH 5L6YL 3RDTB 1I7TA 1NCAL 4PGEA 4JFOB 2O5XL 3LZFL 4UT9L 1J7VR 4ZNEE 1RZJC 3PWUA 2F8XC 4PJIB 3R1GH 3F7VA 3CXHJ 2FSEA 4RFOH 1LDPL 2JB5H 3SKJL 4APQB 3UDWA 5D1ZB 1CVRA 3QXDA 3P9WB 2BNRB 3QQ3B 2GI7A 3U4AA 1IQDB 1ZT7A 1WFOA 5CD5D 1IJ9A 4N0CC 4Y5YC 2JCCE 4P59H 1I3UA 4YZFF 2X4PA 4IEFB 3VFRA 3BGFB 1MIML 2FL5A 2OZ4L 3QEQD 4XZUA 2DM4A 5DRZA 5LAXB 4GAFB 1ZGLA 2BVQA 1QO3A 3IS0X 2P5WB 3C9NB 1G7IB 1U8MA 3D9AL 3QIUB 3RBGA 2C4FU 4XNZB 4HKXB 4R4ND 1QPXA 3GIVA 1H15A 1T2JA 4LRNH 4OCRL 4G8IA 3WFBH 3HB3C 3C8KA 4N9GB 4KJYA 1N5YH 4TUOA 1QSZA 3DUUB 3O6LH 4NSKA 1KJ2H 4P23A 5JW4Q 3R0MA 3C08H 2IQAB 3MBEB 4WHYG 1G9ML 3LD8C 2CLRA 3OB0H 3LDBB 1ZV5A 3BIBX 3QULA 4KQ4H 5D6DA 4PTTA 4OF8A 4KDVA 5ID0B 2I5YH 1HWHB 3VXOB 4PFEA 1BREA 3G9AB 3HS0A 2J8OA 1N6VA 1N6QL 4P2QB 2ZJSL 3QUMH 4Z18A 4PJ8B 1CL7L 1E0OB 3UJTL 3VD5A 4KQ3L 2RFXB 1W72H 3OAYH 2BNQD 1IGYA 4K7FB 3C5ZD 4LIQE 5CJXA 2NPLX 2J5LC 4I13B 5ICZB 4F7EA 4ZNCD 1PX3A 1CD1A 1YYMH 1NFIA 1DVFA 3GBNL 3VJ6B 4UDTB 1Y6KR 2Z9TA 4JFQB 5CFHA 4I5BA 1JGVH 3PV6B 3QUXB 4YDJB 2RB8A 4P2CG 4H1LA 4L8CB 5KTEL 1W0WB 2AV1A 4NQUA 4UINL 1WEJL 3OBAA 4NRYB 3QIWA 4PJIF 3VGDA 2FH6A 3KJ4C 3LKOA 3RZWA 1OM3L 1AO7B 3WMSA 2VZTA 2Y23A 5JPMB 3CFKA 5DXWA 3G5VB 5IVXE 4RIRA 3L5IA 3OKNB 4RA3A 5FB8A 4HS8L 4IIQB 3SDCB 4FG6C 4XCFL 2P46B 1YY8B 4MS8C 4LSQL 4LFHD 3VFWA 1IEAA 3BO8A 5E2VH 3EZ8A 5TE7H 1T83C 1EFXB 3VGHA 4Y8DC 4HC1L 4ODXB 2JJWA 1WICA 5TE6L 4FNLL 3KPPB 3T65B 3F12A 5K33A 3BQUC 5DLML 4OM1H 5DHYB 1TCRA 5K9KA 1I1FB 1R24B 3KNBA 1J88A 3ULVF 4V1DB 1MAMH 3L95B 4Z7WE 2F19H 2VXSL 3RY6C 3N9GH 1LO2H 4BH7A 2G5BA 4WEBL 2A6IB 5DVKA 1EDQA 1BZQK 1HHKA 5HVHB 1TVHB 3BRDA 3L3HA 4MJ5A 1PJ9A 3PL6D 2A77L 1RZKL 1JWMB 4RWYH 4M9PA 2C7UB 3OHXB 2H3NA 1A7OL 4UOJA 1FLRL 1M4KA 3MJ8B 5FYKU 2QEJA 2A83A 1KG0A 2IPKA 2VLMD 2ZOKA 4R4FL 1HHJA 1XGPB 2VR5A 3I6GB 5H2BA 3QEUA 1UWGH 2X05A 1U42A 2NY3C 3JWDC 3VXUA 4EVNA 1GZQA 2APWA 3MV8A 3U2SB 4WNQB 3ZKND 5FYJL 2XPGA 5T1KA 3W11C 2YPVH 3IFNH 4MA1B 3IDMA 3CNKA 5AZ2H 1KN4L 4X8JA 1CZ8H 2VABB 5IKCA 1FNGA 4GW4A 4L4TA 5C0AE 4WGVB 5IHUL 3CSGA 2Y5EA 2ZCKH 1OAKL 5DC4B 3VXPA 3I9GH 3ZDXF 4G80A 3IU3A 5D1QC 3I02B 1U3JA 1UENA 3S34L 1BECA 4LEXL 1AR1D 4YAQB 2BOBA 5I8CA 1MAJA 1MCWW 2XYCA 2R1YB 3E0GA 3UTZA 3WNPA 1ZGLM 1BBDH 1V3LA 4MSWA 3EYOA 4AIZA 2AK4E 3ALXA 4Y4KC 1PLGH 4K07A 3PDDA 3RDTA 3GSNB 1T80A 4JFOA 4P23D 5EC1B 3UTSD 3NIGF 1PY9A 4MHHI 4XP6L 5F96L 3QUYB 3ARWA 3GJFH 4APQA 1ZLUH 1DQMH 1TZHA 5D1ZA 1J05A 5KSBB 2V9TA 2BNRA 3QQ3A 1NMBL 1L0XA 1ZGLP 1IQDA 2Y1VA 1DQJB 3U46A 3CH1B 1DQDH 4PGCB 4JRXB 4PJFE 5BMFL 5LAXA 4WFFD 3TWCL 5IVOA 2G60H 3ALWA 2WM0A 3C9NA 1G7IA 3U9PH 4DZ8B 3QIUA 3VXNB 4HKXA 1MPAL 3U7WH 4NKOB 4WU5B 4X0KB 1DN2A 4WI2A 2ILLA 1DVFD 2I9LB 3QJFB 1UZ8B 1Q72L 4N9GA 5J12C 4R4NC 4XVTL 5FKAB 1KB9K 1PKOA 1IAIH 3DUUA 4NP4L 4XVJH 1T1ZB 2H9GB 5KSAB 5TGBB 1CXIA 1UM5L 4X83A 3QIWD 2C3WA 2IQAA 3NCBB 3MBEA 4PLKC 4ZDHA 1F6AB 5GISH 4L9LC 2NY5L 3T0BA 1KJ2B 4OLXH 2AKRB 4U3XA 3PHQB 2JIXB 2ZNWA 1KB5B 5ID0A 5C0FB 1HH9B 2D31B 3VXOA 1E6JL 1VGEH 4P2QA 2HLAB 4P9ML 4UTBH 5D8JH 2QSTA 5D93C 4PJ8A 2P42B 1RUMH 2Q7NA 4NFCA 2RFXA 3NPSB 1MCKA 5GHWL 3E2HB 4XP1L 2YD9A 4P46B 4HC1A 4M1GL 4K7FA 4OCLC 3DETD 5ENWB 3QUMB 4K7PH 1HYRC 4EIGB 2QQKH 3C5ZC 4QT5B 1GGUA 1W72B 3VJ6A 3E1F1 4UDTA 4JFQA 5AD0B 3RY5A 2AJSH 3MRJB 3QUXA 4JQIL 4BFBD 4O51B 1XH3B 4L8CA 3HZVB 5J11C 1W0WA 2VLRE 3ULSB 4DTGH 1HNFA 4NRYA 4DKFH 3K1DA 4R0LB 3PWVB 5KSBF 3KS0J 5C0EB 5JPMA 3G5VA 3IS1X 4YX2H 5IHZB 3O6LL 1REIA 3OKNA 2HRPL 4IJ3B 2YK1H 3D0VB 4HEME 4IIQA 3SDCA 3CZJA 4Y16C 2P45B 4MAYB 1YY8A 3MLWH 4TVPD 1T21B 1MCOL 4F58L 3EFDL 3JV5A 4YFEA 2A1WH 3VD3A 5EFIB 1FSKC 2WBJD 4JO1L 5CJBA 1A3QA 1EFXA 2OL3L 4KQ4L 5CS7A 5KG9B 2I5YL 3SCMC 4MJ2A 3VMNA 1VPOL 4ODXA 3VXUD 3LQMA 3EDEA 5SWQB 3E8UH 5EN2B 3MV8D 2OYPA 3KPPA 3T65A 5C09B 2VKXA 4PREB 2BXYA 5FF6B 2CMRH 5DHYA 4N0UE 1D5XB 1I85C 4G6KH 1R24A 2XWTB 3QNZB 1HYSD 3PABB 1BQSA 3GK8H 3CFEB 5LG1A 2JJTC 2A6IA 3O6KL 4XAWH 4L4TD 3QIBB 4OZHF 4M02A 1TVHA 2PYEE 5HI4C 3SGEI 2W9EH 1MHHA 4OFDA 1JWMA 2C7UA 4LIQH 3RVUC 3FB5B 3PL6C 3MJ8A 3S36L 3B5HA 3SY0B 5BQ7B 5HHPA 1EZVY 1MJUH 3U0TB 3UTTE 2CK0H 2XQBH 5JIKA 1N64H 1XGPA 3KPLA 5KAQG 4R2GC 3BUYA 4ZS7H 3U2SA 2V5SA 4WNQA 5KANG 2FIRT 3FO0H 3HNTL 1MI5B 1RIHH 4MLIA 3EO9H 3RDTD 1T66C 5E2VL 4HZLB 2OR7A 2M2DA 1UA6H 3QZWG 2VABA 3VG9B 4JG0H 5FYLE 1KPRB 5F89A 1F3DJ 2IH3B 1IKNC 5BXFB 3OKLB 3A67L 2VR4A 5I1LB 4APQD 2J3SA 2V2XB 2BNRD 1VB9A 1W0YT 3UDWC 3OB0K 4PG2A 3QSKB 3V4PH 1MCNA 1VESA 4PJ9C 4GRLD 4DKDC 3I02A 4U2YA 4PRNB 2GEEA 1VEOA 1GAFH 1QBLL 3VDAA 2YRLA 4Y0GA 1XAUA 4YAQA 4YDKH 3QIUD 5GRUL 4M48H 5I8KH 4NN5C 1U8KB 3F5WA 2R1YA 1CK0L 4WY7H 3MUY1 4PJAE 3OAYK 1P1ZB 4J3XA 5C0CD 4QRRE 4WI8A 5FV2A 1J18A 1ITCA 5CILH 5J13B 5EC1A 4M6AA 2GJZB 4K71C 3MBED 3QUYA 5TF1H 5FO9B 1XF5B 3WNKA 4KJWD 1F97A 3SO3B 2R29L 1XGTB 3LS5L 1N0LA 5KSBA 2WP3T 4GOSA 4Y1AE 1I9IH 1DQJA 2Q7YB 1BZ9A 3CH1A 4PGCA 4JRXA 4P2QD 3GJFB 4JFXB 5I1AB 2RR3A 4I9WD 4LRIC 4PJ8D 3MUJA 2FYYB 5CJOH 2YPLE 4X9BA 4DZ8A 3VXNA 1CGUA 2NZIA 5A1AA 2VDML 4YHIB 4NKOA 4WU5A 3QJHB 4X0KA 2BSRB 4LLVB 2I9LA 3QJFA 3ARQA 1UZ8A 5FGBC 3QUXD 4ZXBB 5FKAA 4LOUD 1IM9B 1OGTB 2H9GA 5I30H 5KSAA 5TGBA 1DCLA 1MFCL 4Q0XH 1AD0B 4LSRL 1F6AA 1KJ2A 4O02L 2AEPL 5I9QC 2AKRA 1BD2B 1RHHA 1ETZB 1PLGL 5IROC 1V7NL 3PHQA 1LNUB 2JIXA 2FJHB 3QRGL 1KB5A 3KLSA 2HWZH 1HH9A 3JWNC 5C0FA 4KWUA 3SDCD 1YQVL 4DGVH 1TZIB 2PN5A 2OCFD 2HLAA 4Y4HB 4DW2H 1HINL 3KLDA 2C3GA 2OTPA 3RJDA 1NGQH 3A6OA 1BIHA 4P46A 2CRZA 3QP3A 5JDSB 3RVVD 5ENWA 3QUMA 5FYJD 2VXVH 4JPWL 3STLB 2WUBH 2QSQA 4QT5A 1TETH 1W72A 1LDSA 4OCSL 5AD0A 3MRJA 2P44B 4O51A 1XH3A 2WLYA 4M62L 2VL5B 2I9TB 3HZVA 1N7ML 5E94B 2UZIH 4S0SD 1DBJH 4OFPA 1E4XH 3U9PL 3LS4L 3ULSA 4XC3L 3U6RB 3GSVB 4R0LA 4M43H 3PWVA 1H3WM 1ADQH 5C0EA 4Y2DC 3FB7B 4W4NA 3MUHL 3DJ9A 4G7YH 5IHZA 3CVHL 4XVJL 4HMCA 3O2WL 2BNUB 3D0VA 1CGYA 4MAYA 4NNYB 4NYLB 2AEIT 2HKFL 1CD9B 5F7MC 1T21A 2JCCB 3MLYH 4OM0L 4M7LL 1DBAH 3WO3B 4D9LL 4NUGL 5GISL 5ACZA 1G9NL 3CDCA 1R0AH 2DBLH 4OLXL 5EFIA 1EEYB 4NKDB 5EORH 4C57C 1RURH 5KG9A 4RFNB 3IETB 2WBJC 5SWQA 4OI7A 1ZS8B 5EN2A 3V5KB 4WUKL 2LFGA 1VGEL 2ZSVB 5EZIH 5C09A 2Z31B 2BFVH 4GXUM 4PREA 5L7XL 5FF6A 3X17A 1D5XA 3ZE2F 1OP3H 1NDMB 4PJ5E 2XWTA 3OJVC 3QNZA 3PJSB 3QUZB 5DK0B 3PABA 3DROB 4K7PL 5HGHA 4UOW1 4HT1L 1TQCC 3CFEA 5CGMA 2YA2A 4FZEH 2A9MH 1A7RH 3TESA 4LGPB 1WFTA 1HYSC 5HPOA 4HLZH 5I1DB 3DXAD 3QIBA 3BI9X 3V7AE 1I9RH 2A0LC 1UXSB 4FFVC 4DTGL 2NY2C 4UV4H 3ZDYE 4UIKH 1I9EA 4Y89A 1INQB 3BPOC 3HPJB 2G5RA 3GJFK 3QDME 4KY1L 4K7PX 3FB5A 3WIIH 5E08L 3SY0A 5BQ7A 3U0TA 1ZVHA 1MFAL 5E6ZA 3TF7C 4AENB 1F58L 3NA4A 4PUBH 4Q2ZB 5I1KH 3MCLH 2AJZB 3L5WB 5I8OL 1N0XL 3MROA 5EWIH 1MI5A 4ZOEA 2B1AL 5EU7C 1EEQA 5AYUH 1G9EA 1OAYL 4HS3B 4HZLA 3BAEL 4LVNB 2IAMB 1KPRA 1G9MC 2JJVA 3QUYD 5FUCE 4AQ1B 3HHRB 2YS4A 5ETUB 5BXFA 3OKLA 3EYQD 2HTKC 2G9HB 5JOPD 5I1LA 1TVBB 5IVXB 1EBAA 3IDYB 1A1NB 1ZLVH 2CMRL 3CPLB 2HN7A 3MYZA 4PRPE 5KAQF 1AI1H 1OAUH 5IMLB 1IVLA 5DMIH 4PJGB 4JRXD 2E7CA 1MCPH 1UQSB 4PRNA 4H5SB 1TXKA 1NBYB 5E5MB 1T03H 4GRLC 4XAWL 1IT9L 4U1MB 2VZUA 3WIHH 3G6JE 1U8KA 4ENED 5EPMB 5IW1B 3EYVB 1Y6NR 3GO1H 2J12B 4E0RA 5J56B 1KT2B 3TYGH 1IQWH 3DBXB 1VGKB 1KB9J 4M5ZH 5T5NG 2CK0L 5KSAD 4G5ZL 2XQBL 2GJZA 5ESQB 3MLZH 2NX5E 2CJUH 3MA7B 4Z7WB 5FO9A 1XF5A 2W9DH 2VAAB 3E6FB 3TT1L 1YC7A 3FO0L 2JIXD 1XGTA 1U8OB 3OPZL 4HAGA 1RZFH 4JVPA 5DVLA 1KTRL 2Q7YA 1JRHI 4KZEH 4ESKA 3GJFA 4JFXA 5J8OA 4JE4B 4L8DB 5I1AA 3MBXL 2FYYA 3WS6A 4HJGB 1TENA 4OGXL 4P46D 1UKQA 2ICWI 2AVGA 1S7TB 3VI4E 4LCYB 3VFNB 4LSVL 2DQFB 4YHIA 3TN0B 3QJHA 2BSRA 4LLVA 3BPLB 3V4PL 1NEUA 3DNKA 4DGIL 4ZXBA 3HC3L 1GAFL 1IM9A 1WQVT 4JEGB 1OGTA 4FQLH 4H0HB 2X9YA 4K9EH 1H8NA 3AS0A 4NCC2 3IFPB 1KLUB 2VJXA 4LL9A 3PGFL 3AY4C 3EYUL 1BD2A 4M93C 3CSPA 1ETZA 1JTTA 1LNUA 2FJHA 5MERB 4MMXC 3EGSB 4NM8H 4PJGF 5CILL 1FZMB 5C0AB 5K9QG 1G6VK 1RZKC 1H5BC 2R8SL 4MAYD 1TZIA 2DKSA 4JFZL 1SBSL 5FK9B 4Y4HA 4KK6D 5SX4I 1CLZH 3KLHC 2ZG2A 1YQ2A 2R9HC 3LEXB 2F15A 4C4KT 4RGMC 4HF5L 4HFUH 4YHLL 1E28B 1UB6B 4DZBB 2LTQB 4PRAB 3K4ZA 3STLA 1I9IL 3PIQB 5T3ZE 1B2WL 1T3FB 2AK1H 4F7CA 2AK4B 3RVVC 1KTLB 5K9OB 4GLRI 1NLBH 1F00I 2VL5A 2I9TA 2DQTL 5E94A 1AFVH 2C26A 2IGFL 2L0DA 2B5IB 4Z7WF 1EPFA 1D6VH 3U6RA 4ZNEA 2EYSB 2Y6SC 3GSVA 3SE4C 3O3AB 3T3PF 1BJ1J 4FQHB 4EOWL 2ZUXA 3V52H 3FB7A 3D0LB 3QI9C 4HW6A 5F88A 3QIBD 1TFHA 3O9WC 1F90L 2BNUA 4YIQA 2PW1A 1R3KB 4NYLA 4MD0B 1XFPA 2JCCA 4JFDE 5GGRY 4NO5B 2ORBL 2YUWA 1NBQA 5C8JB 3KPSE 1MHPH 4LQFH 1FGNL 3IETA 4HIHB 1CXKA 1ZS8A 3V5KA 3MJ7B 1YEEH 2ZSVA 2Z31A 2CIKB 1MI5D 2X4NB 1NGQL 2GJ6E 5E2UH 3S97C 4FQJL 3DYOA 3PJSA 3QUZA 5DK0A 5IB5B 4PGJA 2VQ1A 2VXVL 3ISWA 5ITFB 5ALBH 1CN4A 1IC5H 1TETL 2VXTH 3K1KC 4MGXA 4XP9L 4ZO7A 3RZCB 4CN1A 4WUUE 5I1DA 4Q6IB 4X7SH 1ZE3C 2UZIL 2YD6A 1DBJL 1UXSA 2RHEA 5CEZE 4NZDA 1INQA 3HPJA 4HX1B 1Z9OA 1N3NB 4JHWL 3QG6B 2HFGL 3ARFC 2DS4A 3Q1SH 4NO3B 4G7YL 1FCGA 4TQEL 1L9MA 4AENA 4JDVB 3O8XB 4JG1L 2B4CH 4Q2ZA 5CWSA 2WUCL 4LAQL 2AJZA 3L5WA 4QHLB 1DBAL 3VGFA 1NKOA 4W6WB 4K3DL 1R0AL 2VISB 4WCYL 1U3YA 4YBLB 4HS3A 5H94B 4JAMA 5DVOA 1TITA 3VGEA 1RURL 1NL0H 1K5NB 3N1MC 3CJJA 1QYGH 2IAMA 3R8BB 1JGLH 2NY5C 5E6YA 4NGHL 5ETUA 5M95B 1KPUB 4R26H 2G9HA 1TVBA 5EZIL 2BFVL 4O4YL 5IVXA 1A1NA 1MHCB 3CPLA 3DHMA 1MREH 4BH8B 1D5MB 3VD4A 5IMLA 4M4PA 2FEEI 4PJGA 1L6ZA 4FQ1H 3O81A 1UQSA 3EOBB 1A7RL 1ZVSB 3PHOB 4H5SA 4PJCE 1NBYA 4U7MA 5E5MA 1IC1A 1HOCB 4E41E 5C0RH 4XNUL 1LEGB 4U1MA 4GW5B 1EHXA 1I9RL 1ACZA 5HVFB 3MRQB 4X99B 5EPMA 3EYVA 4LLWA 4UIKL 1U3ZA 4OUUB 1LO4H 2N56A 1KT2A 2Q86B 4ZXBD 3S9DB 3DBXA 3LEVH 1QSFB 3Q48A 4Q9BA 1IM9D 1JPSL 4OZIE 1FV1B 4LNVA 4WWKB 5IWLC 3WDIA 5ESQA 4PV9B 1S78D 4JKKA 4LPWA 4Z7WA 3KHQA 4PUBL 3W0WD 3IJHB 2VAAA 3E6FA 3MCLL 1BD2D 1U8OA 3VE0A 1V8HA 2CR3A 2PYEB 1IAIM 2X89A 3T77B 2EH7L 1NLDH 5EUKB 4L8DA 4Y4HD 3N1FC 4KRMB 4M8VA 2OTWB 5DHVB 4GBXB 5T5NF 4HJGA 5FHBH 3UTTB 1WTGT 4AY0A 2EXWD 3MUGA 1BJ8A 1BLNB 1S7TA 4LSPH 2PXYC 4LCYA 4TTDD 2DQFA 3PG2A 2XA8H 4PJ7E 3TN0A 1DQLL 4OI9A 1RV6X 3A6BH 1FE8L 5DMIL 4BJLA 5KZCB 2KZWA 4ODUB 3MYJB 5BW7C 4J6RL 1WSST 3TO4C 5L0QB 3FB8B 1G7QB 2HVKB 4X6EB 1T7VA 4Y4FC 1WWWX 3ZYOA 1A6VH 3IFPA 1KLUA 2AEQL 1SYVA 3GIZH 3GO1L 3BZDA 1ZLSL 2LU7A 4NFBA 4ZS6C 1IQWL 1RJLB 1U8LB 5ELIA 1OP3K 5HDQH 5MERA 3EGSA 4JLRB 2WSKA 1GZPB 1FZMA 4QTHB 5C0AA 5JW3H 2A6JB 2YRZA 2EYTB 5FK9A 4U1KB 4A6YH 2BC4B 3S7GA 1E6OL 2DQGL 3LEXA 2GAZB 3FO9A 5EOCH 2NTFB 3H9SB 4HFWB 3H0TB 4GO6B 2LVEA 1E28A 3WFHB 1UB6A 2J4WH 1RZFL 4DZBA 3NCFB 4M6OH 3FHQA 3P9MA 4PRAA 4WW2C 1R5VA 3VGBA 3PIQA 4MJ6A 1RMFH 1T3FA 4KZEL 3LIZH 2AK4A 1CICB 1KCVH 3DURB 1KTLA 2Z31D 5K9OA 2IALB 2XZZA 4I0PC 4NWUH 1VENA 3HC4L 1PG7H 3ULUL 3LN9A 4J23A 3QUZD 1YEGH 3N50A 2EYSA 3O3AA 2KZ1B 4W68A 4FQHA 3AREC 5EO0B 1ITBB 3T3MF 4TSCH 4AL8H 1OQXA 5DMJB 1DLHB 5FYLL 3RGHA 4PIRF 12E8H 4NWTH 4Y1AB 1ADQA 1FDLL 1KC5L 1MRFH 1NGZA 1R3KA 4MD0A 5DD1H 5GGSB 4P3CH 4PJFA 2EE6A 4GMTL 3RWCA 3NA9L 4NO5A 2NY6C 2YPLB 3H9ZA 1NGXB 5C8JA 2IBZX 1O7VA 1WITA 2EKSB 3SGJC 2MQ0A 1I8MB 2DQUL 4HIHA 3MLSH 4XVUD 4U2ZA 4O5LH 1URLA 3S3PA 3MJ7A 3W81A 3LQZB 2W65B 3VWJC 1AKJB 1LD9A 4FZ8L 1CLZL 2HYMA 1ZSDB 4XTRC 4CBPA 2X4NA 2XZAH 3DECA 1F3JB 3GI8H 5IB5A 2IAMD 2DQIL 2WBKA 5HDBE 3GSUB 5ITFA 3NGBC 2AK1L 3MRBB 1BAFL 3RZCA 4ONGH 4BFIB 5ADPH 5DEGB 2CKBH 4Q6IA 1NLBL 2X7LB 3I6KB 1ZHBB 2CUIA 3DSFH 4J3VA 3NFNB 3BSZL 1AFVL 3JV6B 5EZJB 4LCIH 4Y5VC 1QFWI 4HX1A 2R39A 1N3NA 4YEFA 3QG6A 4NBZB 5T3ZH 5F6HI 4NZTH 4YE4H 4NO3A 3DRTB 2HRLA 3WSQH 3OKEB 4JDVA 3AB0C 2QSVA 4QHLA 5D7JC 3BOVA 1KGCE 3D2UA 1N59B 3LKNB 1FRGL 5H94A 1AGFB 1A14L 3BN3B 4ONHB 1K5NA 2F54E 1RHFA 2NR6C 1AE6L 5LKNA 1KPUA 3NACH 4HLJA 1FNFA 3MRLB 3EJYD 1MHCA 2X89D 4K3JH 4UT7L 3WS3B 4BH8A 1CDBA 3QHZH 5E2UL 1PW3A 5HHME 4GKSA 2D7NA 2OMBA 3EOBA 1ZVSA 3PHOA 2VH5L 1HOCA 4FQ2L 4ZUTA 2OR8A 2D0HA 5AG9A 1LEGA 1OP9A 2BY3A 2UVEA 4Q74A 4GW5A 4KTDH 4RMUA 3TN0D 3MRQA 3EKCA 4UB0H 4X99A 5I75B 4M03A 4KFZC 2E9BA 2C3HA 4OUUA 1YDPB 2QSCL 4LDOB 1I1AB 1TMCB 2VDNL 4TUKL 3WIHA 3O3EB 3WLBB 1FV1A 3Q1SL 4WWKA 4PJ5B 1OLLA 4F15C 4PV9A 5HHXH 5GGVH 1DL7L 2B4CL 4KPHH 3LQAL 1Z0NA 1X6NA 3IJHA 4OFYA 5CEZH 3QNXB 1ZMYA 5BJTB 5C0AD 1X4ZA 2PYEA 4HQQH 1WZ1H 2DI9A 4FQXB 4L9DA 4KROC 1EHLH 4N0FB 3QHFH 4I18B 5F7KC 5EUKA 1F4YH 3QDMB 1JGLL 1G9NC 2F53B 2OTWA 5DHVA 4GBXA 1ZKAA 4R26L 3ZYJA 3UTTA 3FOMB 4I2XE 4R97C 4PRDB 1BLNA 4YHNB 1K2DB 3QH3B 2R0KH 3HI1B 2EXWC 1T1YA 1X6LA 3HKFA 2B8OT 3MXWL 2AK4D 2UWEE 5DDHB 2PTUA 3WHE1 4BSJA 1QBMH 1YMME 1HSAB 4ODUA 4X5XA 3MA9H 3MYJA 4OQTH 1BX2B 5C0RL 2D7TL 2O5ZH 1G7QA 2HVKA 4X6EA 3FL7A 1J12A 3DVIA 3P0VL 3OAZK 5CSZB 3GRWH 1IZJA 1RJLA 3IDXH 2VZSA 3LEVL 4FMFA 3QCVL 1XT5A 4JLRA 1GZPA 1EA9C 2Z4QB 4QTHA 1CFBA 2A6JA 2JKXA 3F65A 4PRPB 4MJIB 1CVSC 5J06A 1Q0YL 2EYTA 4MJ4A 5DJYB 4U1KA 2P48B 2GAZA 2ADGB 4GAJH 2NTFA 3H9SA 4PG9B 4HFWA 3H0TA 1NMAL 3WFHA 5LWYL 4HEPG 1BMGA 2ZCLL 3G6JB 2H32H 4A6YB 4XMPH 3VXRE 2FJFB 4Y5XB 4YHPB 1TIUA 1CICA 3DURA 4K7PY 1MCRA 5I6XC 4IHOB 3REWA 4NC1E 4LSPL 5IP4A 2AJUH 1QG3A 4NQCE 2PW2B 4UBDC 5HYSG 2XA8L 3PWNB 2NX5B 2R23B 5EO0A 3A6BL 5JORB 3ALPA 3RZCD 4ACPA 4IOSD 5EO1B 4PP2A 1DLHA 3ZDYF 2NXYD 3HC0A 4NZRL 4Y1AA 5I1HH 2ZUQC 1CGSL 2X1OA 2J88H 2QKIB 3TA3C 4PB0H 4E42B 3HZYB 3F7PC 1WWAX 3GIZL 2K3TA 2YPLA 5JOEA 1NGXA 1HNGA 2A6KB 2DQJL 5KOMC 1CD0A 2FWOB 2EKSA 5JW3L 1I8MA 1E27A 2QADB 3B5TA 4XCCH 2EH8H 1MHEB 5HJ3B 4BQBA 3LQZA 2W65A 1AKJA 4JDZB 3QDGE 4XVUC 1ZSDA 5F7UA 1J8KA 3D2UD 4NN7C 5EOCL 5BVPL 1HZHH 1RIUH 5HHVH 5AZEH 4M6OL 1JTPA 3L5HA 5B38G 3LN4B 3GSUA 3K2MC 4BFEA 3MRBA 4K2UH 5E2WH 2IPUG 4RMTA 5C7XH 1GRWA 2QHLA 4BFIA 5DEGA 4YHML 2X7LA 3I6KA 5L8LB 1ZHBA 5BS0B 2AJXH 1YJDL 3NFNA 1KCLA 4JO4L 3JV6A 5EZJA 3S4SB 5C6WH 1YEGL 2CKBB 3LH2H 4GS7B 4OLUH 5DT1L 3SGEH 3G6JF 1MF2H 1SHMA 3DRTA 5E1AB 1DSFH 3MRNB 3OKEA 1QLRB 5IUSA 4NQDE 2ZWLT 3FCTB 1MRFL 4EDWH 4MDJB 2E6QA 3NBNA 2BY1A 4OQ1A 2HFEA 1N59A 3LKNA 1V3KA 3LHPH 3FN0H 3ARGD 4WWKD 1AGFA 4LHUG 1X5YA 4XI5C 5E8NB 2W38A 4ONHA 3P3YA 3N1GC 5CINL 3LY6A 4DVRH 3MRIB 5L88L 1IGFL 2IJ0C 4HWBL 2PYED 2ARJB 3WS3A 3FN9A 4XP4H 4YUEL 3F58H 3EJYC 3GI8L 4KK5D 1VA9A 1MQKH 4JFDB 3VI4F 4GBXD 3UTTD 4ONGL 1SYSB 1S3KH 1MCEA 4JPKL 2YD2A 4MQXD 4OT1H 3RVWD 4B7LA 1BEYL 3LKQB 4OLWH 4LCIL 5C0IB 4EBQH 3TV3L 2ED9A 2VLKB 3IDGB 4FQPA 5KZCD 4BQ6A 1YDPA 2DDQH 1J10A 1I1AA 2Q76B 1JUFB 1U91B 4HJ0C 5T3ZL 3SDAC 3UYRH 3O3EA 5AWNH 3WLBA 3DUHA 1EJ6A 1GHFH 1KACB 3ARBC 4PJ5A 4ELKB 2ENSA 4Z95H 4D3CL 3GB7B 4WO4B 4NIKB 3MNWB 2XRAL 4OAWB 3QNXA 3ES6B 5BJTA 1OAQH 1G0XA 3DX7B 4FFYH 5GS3A 2JF1A 4N0FA 2Q8AL 4I18A 15C8H 1CFSB 3QDMA 3G5ZB 1FBIL 1UACL 3CMOH 1WWCA 4CKVX 1OTSD 4MB4A 4CN6A 4LCWB 4PRDA 2IMMA 4YHNA 1K2DA 3WUWG 3OGCB 3QH3A 1WWBX 4S1SL 3HI1A 5LBSL 1C16B 3IXAB 2Z91B 4NRZA 5HYSB 3M07A 1HH6B 5DDHA 4CMHC 4XHJC 5DA0B 1HSAA 2EDXA 2Y36H 1EGJH 1BX2A 2VERN 2GW5A 4O2EB 3WUZA 7FABL 4KTDL 4QRTA 3UEZA 5J0BA 5CSZA 4K3GA 2Z4QA 2I27N 2NQCA 3K2UH 4PRPA 3C60B 5C08E 4ODHL 4Y1AD 1C08B 3DMMC 4ODTL 5F3HB 4U0RC 5L2KE 5DJYA 3MGOB 3WFDH 5HHXL 5GGVL 3I2CH 3ILQD 4PJCB 4N5ED 4OKVB 2ADGA 4E41B 2YPLD 5JHDE 3PXJA 2ARJQ 2ESVE 4QO1A 3G6JA 4HQQL 5E8DH 4A6YA 1MEXH 3RWIB 5C3TA 1EHLL 2FJFA 2VZOA 3QHFL 5KVGH 4Y5XA 4YHPA 4AH2B 1AKJD 5B38B 1F4YL 2AGJH 4IRSD 3SKNB 4WFEE 3HMWH 1YN7A 4HUNB 5MEPB 2H32B 2X4TB 4ZUWA 4IHOA 2UYLB 5DQDH 3O11B 1H3XA 5INDB 4QHKJ 3B9VA 1S7SB 2PW2A 1SY6H 4YC2B 3A6CH 3PWNA 2NX5A 1X5LA 2R23A 1BBJA 3D25B 3JTSB 2EDTA 3ARPA 4LSUL 5JORA 1MRCH 3MODH 4A2LA 2XQYG 5EO1A 4JR9H 4KUZH 3PDGA 3MA9L 4ORGA 4P5TB 4OQTL 3FHAA 1MCHA 4GKOA 2QKIA 1UKTA 5KN5B 2NXYC 4E42A 3HZYA 4XBPB 3TEUA 5DGRA 4LVHB 4DVBB 3GRWL 5IMKB 5FXCH 2VDOL 5IFHH 2A6KA 2FWOA 5JMRA 1MHEA 5HJ3A 1DR9A 4YBQD 3JZ7A 1X5XA 5D72L 4JDZA 5ALCH 4C58B 1FG2B 2R4RH 1VHPA 4GAJL 5EH1A 3PNWB 4LDEB 5DUBB 2NYYD 2F5BL 4XMPL 1FH5H 3LN4A 4PJHE 3MSPA 2R2HB 3HR6A 3QR2A 4NN6B 5I76B 3KYKH 2IANB 3QPQD 1J1XH 4GRMB 3RP1A 2NY4C 5BS0A 3ESVF 1D7FA 4KI5E 3S4SA 3WIFB 3X3GH 3D48R 3NH7L 1A02N 1MFNA 2CKBA 4RGNB 2AERT 3HRPA 1T0PB 4GW1B 1F42A 5FO8B 5E1AA 2AXFB 2V7HB 5GGTH 1QLRA 3TVMB 3FCTA 3TZVB 1FNEB 4MDJA 4PB0L 5JA9A 4QYOB 2V9RA 4NO0B 1I1AD 4LVOC 1N5AA 1E4KA 3MJ9L 1VACB 1WGOA 4HXBL 2D03L 4HWEH 5E8NA 4ZSOE 2XZQH 4PJ5D 5AEAA 3P0YL 1CDGA 3PGCB 3ARGC 1G6RH 4K55A 4G6MH 3MRIA 3EOYG 1RUQL 3GMNB 4XHQA 4OV5A 1FL3B 1MCSA 4WGWB 5CSGA 1JYWA 4MA7H 1A6ZB 2ARJA 1RVFH 1HSBB 1KN2H 3EYSH 1HZHL 1RIUL 4WTZG 4QCIB 5HHVL 4KVNL 3U9UB 3QDMD 4J3WA 4JFDA 4K2UL 4KK5C 5C7XL 4LHJB 4QTIH 3KPSA 5TQ2H 3RWHA 1CGXA 1SEQL 1YPZE 3LKQA 3WJJC 3AMKA 5C0IA 3QEGH 2X1XR 3RVWC 3IDGA 1BGXL 3AXLB 3X3FL 1B4JH 2Q76A 1HHIB 2OXHA 4LSSH 1U91A 4YGAB 1AHWB 2IPUK 4QXUH 1DBBH 2OP4L 3ULUC 1MF2L 3OZ9L 3RWGB 4UTAH 5ILTH 3QHTC 4ELME 4ELKA 1VKXB 2MCG1 1JVKA 2OM5A 3L5XL 3M8OH 3QXTA 3GB7A 4WO4A 2D9CA 4KUCF 3MNWA 2YUZA 5FYKL 4AG4H 2ZOLB 4OAWA 2NCMA 2E5EA 3ES6A 3NZHH 4LVEA 4XNMB 2P7TA 2PO6C 1Q8MA 3DX7A 5I71C 4PRPD 4OD2B 5ACLA 3VG0H 5DQ9B 1NUDA 3BKCH 5F7YC 3V79C 1CFSA 5KVDL 1E4WL 2BMKB 2Y06L 2YXFA 3G5ZA 1KEGH 2JJUA 3QQNA 2HTLD 4LCWA 3OGCA 4ZOAA 5D2NC 4Z7NE 1C16A 1MJ7H 1OTSC 2R56H 3BUTA 1RZJH 1OP5K 1XZ0B 3B9AA 2Z91A 3IXAA 3H8NA 4L8SC 5HYSA 1HH6A 4JRYE 3RNQA 3UBXG 4LPXA 5GRJH 2HG5B 3A0OA 1OWWA 4JB9L 3L3OB 3QQ4A 3RAJH 3VFVB 4PR5B 1S3KL 2IBZY 1AXSB 1GL4B 2R2BB 1JF5A 4O2EA 2F54B 4OT1L 4DK6A 5IB1B 1GIGH 3UAJD 4TNWK 2NX5D 4OCNC 4GMSH 2P5EE 4NQXB 4OQTA 4YHYC 4Q9CA 5KJRL 1OCWH 3E6HB 2HT2D 1K6QL 4JHAH 4RFEB 3RKDD 1AGBB 1MVFA 5AWNL 3C60A 5F7WC 5HHMB 1C08A 4Y19E 3GRWA 3WO4B 3MGOA 1XGUB 4JREC 4U6XB 4Z95L 4OZGE 4PJCA 1MNUH 4OKVA 4URTB 3Q3GB 4E41A 2NXZB 5BZWB 4M00A 4KHTH 2EIEA 2CLZB 3P0GB 4JQXC 5ABDE 2QADD 4FFYL 2GT9B 3RWIA 5CLWA 3OQ3B 3C6SB 5IGXL 2N7AA 3B2UD 5B38A 3SKNA 1KFAH 1ROWA 1JHLL 3WFEH 5MEPA 2H32A 2X4TA 2ZCHL 3LKSB 5D7SH 2AP2A 2UYLA 3O11A 4IRSC 4N0YH 4PJEB 5INDA 1S7SA 3JSSA 1RUAH 1CF8H 1R3IH 2XXCB 3JTSA 3D25A 1XEDA 4YDLB 4KMLB 1NKRA 2W92A 3R0NA 5DD6B 1JNNL 3V7MA 1JHTB 4JDTH 2YBRB 4P5TA 3BJLA 3JVGC 5KN5A 4QEGA 3ETBF 4M7ZB 4OTXL 4XBPA 2F5AL 3HPLB 4DVBA 2DB8A 5IMKA 4I2XB 4MCYB 1S5IH 4QGTA 1QHPA 3LN5B 4HIEB 3D3VE 1X4XA 2C1PB 5T3ZD 4JY5H 1H3GA 4BKLB 1CS6A 2P47B 1NGPL 2UWEB 3WFDL 3QO1B 1FG2A 1YMMB 1QRNE 5J1TC 1CI5A 3SN6N 3PNWA 1FGVH 5C0BE 5DUBA 3SDXE 2AQ3A 2WWMD 3QPXL 3QXAB 4NQEB 4OSUL 4M7LT 3LQAC 1AGDB 4LLMB 3RIAK 4CN4A 4OBRA 1ZT1B 5I76A 5E9DE 2IANA 2OMNA 4GRMA 4X4XB 4FFZL 5DJAB 2GSGB 3K46A 3S6CA 5SX5K 3WIFA 3QPQC 1OLZA 2VC2L 4PRBB 5I8EB 1FL5B 2R4SH 3V4VH 4NT6A 4JFDD 2I07B 1KIQB 4EN3C 3MODL 4GW1A 1AQKH 5FO8A 2Q3AA 4JR9L 3KPSD 3QUKB 2AXFA 2V7HA 1U8HB 5KVFL 2AJYH 3O6MH 4NNPH 2BOCB 1QSEB 1RSFA 3TZVA 1VFMA 1FNEA 4PP1C 4QYOA 4NO0A 3GDBA 4PJEF 1FLTX 5EOCJ 5FM4A 3T0WA 2YXMA 3DOSA 1VACA 1F6LL 1WK0A 2GJ6D 2HJLB 5IFHL 3BGMB 3QCUH 4OJFL 2D7PA 5HI3D 3FFCE 3PGCA 4JKMA 2EC9T 3L3DB 4HBCH 2AI0H 4EQ3A 3OKDA 4WO4D 4BZ1H 1YEKH 7CGTA 5D2LF 1IC7H 1IGIH 3GMNA 4ZPVB 4OLYL 5DJDB 1A6ZA 1XR8B 1HSBA 1G6RB 2H26A 4YK4B 3JWDH 4QCIA 1OTUC 1A3RL 1DFBH 3U9UA 3CXDH 5CEZD 4XPGH 1FPTL 3AM8A 1RQ5A 3UBXB 2MCPH 1J1XL 5F70A 4XPAH 2DLFH 3UMTA 3VXTB 2UWEF 3K8MA 2PYFB 2NW2B 2CH8A 1ZEAL 2IFGA 3CX2A 3AXLA 3QDGB 5IVNA 1HHIA 4TOYL 3P11H 1AHWA 4MDIB 3V0WH 3DIFB 3RWGA 4UUJB 2Z8RA 5EOTB 1GOGA 1SJXA 1VKXA 1KJVB 4UIMB 2DQDL 5JW4N 5AAMA 4DFHA 2B0SL 4XNQB 4XNMA 3MXVH 3V6ZB 1F13A 1OARH 4OD2A 3C60D 4JO2H 5DQ9A 4HWEL 4AEHH 5CIPH 1M1SA 5HHOE 5LGHH 3TO2B 2V7NB 4JM2F 2BMKA 2ITDB 4XMKL 3LV3B 1FIGH 5C0GB 4AIOA 4E41D 1Q1JH 1FORH 1E4JA 2W9LA 4K3HA 3VFOB 4PGDB 1AD9B 1RK0B 3S3SA 1KN2L 3R4DA 1XZ0A 1ZTXH 2EEAA 5JZ7D 1A9BB 5GJTL 3VWKC 2HG5A 3V8OA 5IHBA 4NZUH 4PR5A 3VFVA 1AXSA 5TQ2L 2R2BA 5IB1A 2F54A 3MOBL 2VN7A 1F45A 4ERSH 3QEGL 3SGKC 4NQXA 1EGJA 5IW3A 1IKFL 3CGTA 3E6HA 2YN5A 4Y5YB 1YJDC 4RFEA 5JXEA 4P5TD 1AGBA 1SBBA 4U6TA 3QQ9D 1J1OH 3RKDC 2B1HH 4ONFL 1XGUA 2O61B 4U6XA 1Z9SA 1DE4B 3M8OL 3MCKB 1HQ4B 1A8JH 3Q3GA 5H35B 3T8XB 5D5MF 3IB4A 5BZWA 1OOAA 3NZHL 1KPVB 3RL2B 2CLZA 5GZOD 3G5XA 1C1EH 5E7FA 2GT9A 2NLJB 5E8OA 5KSUA 3C6SA 1OSZB 4K23L 3GMMB 5C2BH 4DOHB 5SV3A 1KEGL 2QQLH 4MQSB 3LKSA 3CLEL 2FHFA 3LKRB 4OV6F 3LD8B 4PJEA 3O2VL 1JRHL 1R5IA 2R56L 2V17H 1L7IH 4XWGL 5DD6A 2IAND 2BY2A 5GRJL 1JHTA 3PP4H 1QQDB 1SY6A 1MFDH 2YBRA 4HK3J 3RAJL 1AQDB 4Y7MA 4G7VH 4OIBA 5C1MB 3PWLA 3BKYH 3SPVB 3FAXA 1QBAA 1CD8A 4IRZH 2MMXA 4PJXE 1RIVL 3LRHA 2J5LB 1JNHB 2CPCA 3HPLA 1OCWL 5GPRA 4I2XA 4MCYA 5TFSL 4RNRB 4JHAL 5AG8A 4N9OB 4RAUB 1G7HB 1S7WA 1JIBA 4HIEA 4KDWA 4QOKE 2C1PA 5EU7E 4OB5L 3TZVD 1GJIA 1HKFA 3KPTA 3RIFK 4BKLA 4DWHA 1AP2B 2UWEA 3B9KC 3QO1A 4NO0D 1W0VB 1YMMA 1MNUL 1DBKL 3H3BC 3KJ4B 4S10A 1IARB 2ATKB 3IKKA 1OAZH 5IBLD 2AJ3B 1PFCA 1E4KC 3MZGB 1ORSB 3QXAA 4WTZA 3DSNA 4LSTH 4NQEA 4CL7A 4LLMA 1AGDA 5FM5O 1ZT1A 1NAMH 1KFAL 4X4XA 5DJAA 4OZFH 2GSGA 3ELAT 3BKMH 4RX4A 3CSYB 4GKZA 3KGRA 1FO0H 3IRZA 3G6AB 5I8EA 3UROR 1FL5A 1OSPH 1CF8L 3PV7A 2QHRH 2AJVH 4UOW0 1QEWB 3E3QC 2I07A 1KIQA 1ZLWH 3BMWA 5EOQH 3ZTNH 3QUKA 4I3SL 2ESVB 1QFUH 1U8HA 4TYUA 3BQUB 5I15H 4Q9QL 5ICXA 3G6DH 3MRFB 1QSEA 2XN9E 4TSAH 3MOAH 1BQHG 2OK0H 3PWPE 3UC0H 3IFLH 5GGTA 4Z5RA 3P4MB 1G7MB 2HJLA 3BZEB 3BGMA 4UNTA 5H37G 1ZA6B 5F9WC 3ZT7A 1IGCL 1S5IL 3ZKMD 4FTVE 3L3DA 3ZKXC 4OZ4B 4JY5L 3WXWH 4ZPVA 5DJDA 1XR8A 2WP3O 1UWEH 1G6RA 4FA8A 1GOHA 1Z3GH 4MXVE 5FUZH 4YXKH 3NIDE 2WWKT 1OTTC 5DJ0A 2FHCA 4EI5A 3T4AB 2QV2A 2DRUA 2XTLA 4F7MB 1AXTL 2NY3B 1QLFB 1CDIA 3CK0H 3HAEH 1CE6A 3EFFB 1T1WB 3VXTA 4KKBC 1A9EB 5E99L 2DLGA 2NW2A 2PYFA 4LFHG 4OZFG 4QNPE 5LGKA 2FX7H 3QDGA 1EEZB 1KGCD 2R4SL 3N06B 5F97E 3KS0H 3U0PB 5GSVB 1Q9LB 4MDIA 4KDTA 3C5SB 1AQKL 4UUJA 2MJWA 5EOTA 2F54D 4HGKC 1KJVA 4ZFFB 1U93B 4GXUN 4NNPL 4PJHB 1HE7A 3H42H 2E9WA 5DF0A 2QL1A 4XNQA 1PDKA 5GGVY 3V6ZA 3RTQD 5JXED 2GHWB 5D1QB 2ZUSA 5HHMD 3CFCH 3QDJE 3QCUL 1OW0C 5IEHA 3TO2A 1T7ZA 2QLVB 2V7NA 1T2QH 2ITDA 4HBCL 5IBTH 3LV3A 5C0GA 3BE1L 4BZ1L 2FHBA 5CGTA 3MLTB 3TFKD 5DFVD 2NXZD 3V0AC 3MNVB 1JI1A 6FABH 3OJDB 5CIPB 4WDIA 5EIIB 3VFOA 4PGDA 1AD9A 1RK0A 4Q58C 4ZTPH 4YHKH 3RVTD 1II4E 3VFSB 4Y4KB 4L1HA 3EYFB 4NQDA 1A0QH 5JQ6L 4J4PC 2Y07H 4FXKB 4HPOH 1A9BA 3G9VA 3MR9B 1UJTA 3AVEA 2EEDA 4X4ME 2MCPL 4UT6L 2FEEL 4U7SA 4XPAL 4ZSOB 1MCIA 2FGZA 5FDWB 2BSTA 3KPOB 1U3HA 4EXKA 1HIMH 1JCKA 3ROLB 1WJ3A 1KIPB 5DD5L 3ARYA 4Y5YA 1IGJB 2FJGA 5SWZE 3V0WL 3HN3A 1LP9E 3O0RH 4RDQG 2AV7B 1JF1B 3SGDH 2O61A 1DE4A 3MCKA 3FRPG 1S5HB 3QQ9C 2BRRH 3LPFA 5H35A 3T8XA 4L3EE 4OCWL 3LMJH 1KPVA 3RL2A 2DLTA 3VA6A 3UP1A 1J9CT 5J12B 1OARL 2AS5M 1YPZB 4C59B 2NLJA 3T0EE 4FFWD 5LGHL 1OSZA 1T6WA 3BDBA 1MCLA 3T1WA 2P24B 1F3DH 3UYPA 1YMMD 1VSCA 3CCHB 4TNVF 1FORL 3TBVB 4L9LB 3LKRA 4PJHF 3QCTL 4ELMB 2OQJB 4F9PC 2YUVA 5EA0H 4HPYH 1MWAH 1ZTXL 2HT3D 4Z7OE 2Z8WC 3I75B 2MWCA 1YNLL 1QQDA 2EDYA 2CGRH 3UPAA 4NZUL 1AQDA 5D93B 2NY0D 3ABZA 4Z7VB 3SPVA 2KDGA 2DWEA 1GGIL 1RZIA 1Q0XH 3P30L 1BQHB 1JNHA 1JNJA 5GRXG 2BNQB 4AMKL 3DO7B 3C5ZB 4RNRA 2EDHA 3BP7B 4NM4H 1EAPB 4RAUA 1TQBC 4HKJA 1G7HA 4X7EC 5HYQB 2ID5A 4X6FB 2VQUA 5J11B 4H0IA 1QKZL 3BN9D 3H3PL 4FQIH 4JRYB 4DQOL 1EHAA 5CBAA 1W0VA 3MLVH 2D3VA 2N7BA 3V4UH 4JFHE 2X4UB 2ATKA 3GSOB 2AJ3A 5F71A 4JRWA 4NQCD 1ORSA 3U82B 4TNVK 3THMH 5IBLC 1KCSH 2X1QA 4H1LG 4TVPH 4X6CE 5MP6L 3HMXH 4Y16B 2R0ZH 2E27L 2FNBA 2Q6WB 3CSYA 3WKML 4CADB 4JFFB 1MFEL 3GSRB 1NAMB 1FSKB 3G6AA 4EI5D 4XC1H 1T83A 3LEYL 4KRPC 3DVGB 1LO5B 1QEWA 2V17L 3HTLX 4LLAA 4OZGB 4OZFB 5L6YH 3S98A 3S35L 2O5XH 1FC2D 3LZFH 5T3XL 1MJ8H 2H2PC 1N2RB 1FQ9C 1TZGL 1ZVYA 3BZ4B 3PP4L 2ESVA 4XNYL 1YNTB 5I0ZA 2WLZA 2E7LC 3MRFA 1DANT 1LDPH 3QDGD 3SKJH 4ELMF 3PP3H 4LP5A 5CHNB 5F9AC 4KKAC 3P4MA 1G7MA 3BZEA 4N8CH 3RY6A 1ZA6A 4WENB 3CC5B 1MIMH 4N8PA 2OZ4H 4OZ4A 2PKDA 3AS1A 4YJZL 1MCJA 1T1XA 4EI6B 3DV6B 3D9AH 4Z7VF 4L3AA 4RMWA 5EBWB 3PL6B 1OAZL 4OCRH 1A3LL 2X4SB 5EIQA 3T4AA 3MRPB 1EHNA 4LSTL 1C7SA 4F7MA 4Z7NF 2OX5A 2EDBA 5JHLL 1QLFA 4R2GB 4ZFOL 2X41A 5A2JH 1T1WA 3D5OF 1A9EA 1MCDA 4K8RL 4NQDD 1G9MH 1FO0L 4F37K 1FNAA 3JV0A 1LE9A 1EEZA 4G3YH 3HAEB 3U0PA 5GSVA 1Q9LA 5D1XC 4M61B 3C5SA 1I8IB 2RAMA 5E2TL 3RPKA 3EHBC 4O9HL 3ARRA 1EXUB 4OD1L 1QFWL 5C0BB 1N6QH 1QFUL 3SDXB 4ZFFA 2XKNB 1U93A 1U3HD 3QO0B 1I1YA 3UJTH 4PJHA 4U1GC 4TSAL 5HGBB 4KQ3H 1FFQA 4P3DB 3RJQB 1NSNL 3MOAL 3P4NB 5F7HA 3HR5B 4N0CD 3IFLL 3BYTA 5I74C 4PJ9B 3VH8B 5D1QA 1PEWA 5MHSE 4OZGF 3GBNH 2DM7A 2BHUA 3RTQC 4KKCD 3QDAA 4D0DB 5C3LD 3NTCH 4XZUB 4NN5B 5KTEH 3MLTA 4C4KO 3WXWL 1HI6B 3IFOB 3MNVA 3OJDA 5CIPA 1U8MB 4UINH 5EIIA 1WEJH 4RGOL 3VFSA 3HB3D 4Y4KA 1J0KA 5DFVC 5EBMB 3EYFA 4PTUB 1OM3H 3GIVB 1FNHA 5D7KD 4YXKL 1UADC 3RQ3A 5JQHC 3RVTC 4FXKA 3KPNA 3MR9A 4YGVA 3P4OB 4K71B 4AYFA 3GMRB 3WL9B 4HS8H 4WJ5B 5INCB 4D2NA 3UTSB 5HSFA 4ZSOA 5FDWA 3KPOA 4LSQH 2AXGB 4LARL 4X98B 3ROLA 4Q97A 4DN4L 1KIPA 3BGAA 3W9EB 5D96C 1IGJA 2XV6B 2VRAA 4OUOA 4NNXB 3HS0B 4J3SA 4WTXA 2AV7A 5TE6H 1JF1A 3SKOB 4HIXL 3ZYIA 3JTTB 1FFNB 3GKWL 4NKQB 1S5HA 3SJVE 3MJGX 4DAGH 1H3PH 4PY8I 1YPZA 3CSBA 4X6DE 3R06B 1GYAA 4F2MA 2VXSH 5IESH 1ZLWK 1T2QL 2P24A 4I5BB 4WEBH 3TBWB 2HH0L 3SDXF 3CCHA 2BVEA 3TBVA 5FGRA 4L9LA 2A77H 1RZKH 2FDBP 5F9JB 6FABL 2AV1B 4RDQF 1JF6A 5I9QB 4ELMA 1VEPA 2OQJA 2VXQL 4PLJD 5I17B 1A7OH 1P53A 4B7IA 1FLRH 4XPFH 1JHKL 4HPOL 4KV5F 3I75A 1S9KC 1FZJB 2UVFA 2XICA 4FG6D 3RA7L 4OGZA 4MS8D 2VTFA 3WKNA 1AIFB 1MWAB 4PJDE 4U1SB 3RWDB 1YEDB 2NY0C 5FYJH 1JZ4A 1O0VA 1BQHA 5IJKC 4U6VL 2DOCA 2BNQA 4MA3B 2A9NH 5JHDD 3C5ZA 3DO7A 1CDYA 4Z7QF 3BP7A 2ESVD 1EAPA 1KN4H 1FNSL 4LCCC 4X6FA 3JUYA 5A2IH 1VCAA 1WF5A 4ZTOL 2EDFA 1A7BA 4JRYA 4U05A 4WFED 2DI7A 5FGCE 1T0MB 2X4UA 3L1OH 5IHUH 5K9KB 3BN9C 3GSOA 4M6NH 3KNBB 1IL1B 4Y2DB 4BELD 1BF2A 4M1DL 2EZ0C 2ICWJ 1MY7A 3ZE1E 2P5EA 3KYMB 5KVMC 3S34H 4LEXH 3B5GA 4Y16A 4QXGL 3KVQA 1S9YB 2Q6WA 4F57L 4JFFA 2DLHA 1GGTA 4LMQI 1FJ1B 2X1WL 1NAMA 2YMXH 3GSRA 4Y19A 5EA0L 3TIDB 1AGEB 1CLOL 2FBJL 4JO3L 1L7TH 3DVGA 1LO5A 4JKPL 4OZGA 4HPYL 4OZFA 1KG0B 5EG6C 4HWUA 3SCMA 2WBJB 1CG9B 2JJSC 2HFFA 4EI5C 5JXAL 3BZ4A 1N2RA 3BXNB 4U1NA 3FB6B 4XP6H 1YNTA 1FCCA 5F96H 3N1PC 4EDXB 1OD7A 5B4MC 3K74B 3DARA 1I85A 5JA8B 3T1FB 4ZO6A 4NZJA 4P9HL 2WIIB 2LV4A 1TQCB 1NMBH 1NJ9B 1F02I 1X9QA 4ODBD 2XTJC 4YWGL 2JJTA 4OKDA 1I8LC 5T1DL 3DWTA 3CC5A 5BMFH 3TWCH 4EI6A 2M8XA 3DV6A 1QFHA 2NY2B 4L4TB 4ZAKC 3V4UL 3BPOB 2AXHA 5IT2H 1K3IA 5IB3B 1MPAH 3PL6A 2X70B 5EBWA 4KJPC 3SE8L 4KI5D 4JVWA 4FXGB 1Q72H 3PDOB 2X4SA 3MRPA 4XVTH 1KCSL 3OV6A 4GKNB 3SDYH 4PJXB 4KGJA 3T0XA 3VRJB 2A74B 4AIXA 1UM5H 4Y4KD 2HJKB 3GM0A 2NY5H 3D3VA 1BJ1H 1C5CL 2R69L 4HUUB 5ANME 3HAEA 3ESUF 3FN3A 2HJFB 1KNOB 2Y5TA 4F7TB 4M61A 1I8IA 4B50A 2RIKA 4XPTH 1MJ8L 1IKNA 1ED3B 1EXUA 5F1NA 5C0BA 1E6JH 3SDXA 4P9MH 2XKNA 3QO0A 4DKAA 4GAYB 5HGBA 4P3DA 5GHWH 4FXLA 4XP1H 4M1GH 3P4NA 1U3HC 1TZHB 3FRPA 1RZ8B 3V6OE 3HR5A 1J05B 4PJ9A 3T09A 3VH8A 4AZ8A 4N8CL 3U46B 5C92A 3ARDC 3C09C 4JY4A 4GRLB 3TIEB 5J1SC 4D0DA 4JQIH 3ARVA 1MLBB 1HI6A 3IFOA 4GRWE 4KKCC 2WZPD 4YQXL 1J5OL 5EBMA 2MSPA 4PTUA 3OAUL 3FRUB 4XH2B 2FB4L 2XN9B 5C0CB 2ADFL 3P4OA 5D7LE 1WC7B 3U30C 2HRPH 3CVIL 3GMRA 1CWVA 4PLKD 3WD5H 3WL9A 4WJ5A 5INCA 3OJMB 2Z92B 4IMLB 4QY8B 3ARUA 3UTSA 1UWXK 1MCOH 4FTVB 4ZDHB 2AXGA 3HUJE 4F58H 4X98A 2AXJA 3EFDH 1G84A 2F58L 3VFPB 1EO8H 3QEQE 4G3YL 1UEMA 4PJBE 1V3MA 4JO1H 3W9EA 2OL3H 3L7FB 3K81A 4OGYL 4LRIA 1VPOH 2VSCA 4NNXA 3O45B 1T4KB 4MMZC 5HGGS 2MKLC 3SKOA 3JTTA 1FFNA 3QEHB 4LPYA 1NPUA 1BM3L 2YUXA 1YNKL 4EQ2A 2VUYA 1WLHA 4RRPG 43C9B 2GSIB 5FGBA 2BDNL 1J8HE 3R06A 1ODAA 1XF1A 2C3VB 4R6UA 5GZNC 4JRYD 1CE1L 3O6KH 3TBWA 3K0WA 3NTCL 5KOVC 3KDMB 5F9JA 2YD3A 1D6EB 4M93B 5IROA 5I17A 1JTOA 3S36H 2P5ED 3PP3K 2XNAB 4POZD 1H5BB 4PLJC 4Y16D 1FZJA 3ZL4L 4U31A 4GG8B 1Y0LA 4ORZC 5LCVH 1AIFA 4JFFD 1MWAA 4U1SA 3QDJB 4NRXB 4RGMB 3RWDA 4Y19D 1YEDA 2DIAA 5GS0L 3HNTH 4LLYB 3D6GA 3O6FC 3SCMD 1UCTA 5GGRB 4MA3A 2G75B 3SE9H 2EDQA 5A43C 1ZXQA 1J1PH 3A67H 2N4IA 1T0MA 4ZFZB 4QRSB 2FD6L 4DK3A 1YEHH 2C4FT 4DAGL 1IL1A 4Y2DA 3GJEB 1H3PL 3QI9B 3T08A 3O9WB 3KYMA 1QBLH 5HI4D 1ZOXA 5IESL 2YD5A 3O2DL 5GRUH 4I8DA 3WNMA 1MY5A 3RVUD 1S9YA 1MHHB 1CK0H 5SWZB 2BP3A 1GCFA 1FJ1A 5I0DA 3CX5K 3GMOB 3HMXA 4IDJH 1DBMH 4POUB 3TIDA 1AGEA 4XPFL 4JJ5A 3VFGL 5HHPB 2WBJA 1CG9A 4R2GD 3BXNA 4D9RE 3FB6A 3KPLB 4EDXA 3D3VD 3BUYB 1CR9L 4LPVA 3GEWB 1T66D 1J0JA 2R29H 3T1FA 5ADOL 3LS5H 2WIIA 1QRND 2GYSA 4R90H 5CLTA 1NJ9A 2A9NL 4XRCB 1I8KB 2W0FB 5C0BD 2AQ1A 1T2XA 3L5JA 4MNQE 1KIUA 1NC2B 2DTMH 5F89B 3EBAA 1Z0MA 1HEZA 4CAGA 1UM6L 4F3FB 4FOMA 5E9DD 4X4YB 3DXAB 1KOAA 3S88L 3W2DL 3L1OL 2VDMH 3LB6C 4PJ9D 4HCRL 5IB3A 2X70A 2OZ4A 2VWEE 3L3JB 3ORJA 3X12B 4M6NL 4FXGA 3ARFB 1U9KA 1KJMB 3PDOA 3TBTA 5L2JB 1DN0B 1JN6B 1IAKB 2VN4A 1V3JA 4GKNA 4KI5C 4PJXA 5HI5C 3VRJA 2A74A 1MFCH 4CDHA 3F5WB 2HJKA 4LSRH 3V6FB 2IC2A 4O02H 1CGVA 2AEPH 3I3DA 2YMXL 5D71L 1V7NH 4HUUA 1X5IA 1L7TL 3O4LE 2HJFA 5K59E 1KNOA 3QRGH 4F7TA 5B8CC 2ED7A 2OTUB 2Z35A 3Q6FB 4OD3H 1YQVH 1ED3A 3TBSB 4P3WA 5CMAB 4D9QE 3FFCD 1JZ6A 1HKLL 3BEVB 3NCJL 3UJIL 5BV7L 1HINH 4GAYA 3VRLE 4Z8FL 1XR9B 5A2FA 4X6CB 4HIIB 4JGUA 1G7LB 1RZ8A 2EEBA 1BFVL 2N1KA 4JPWH 2E6PA 1BZ9B 1QR1B 4DEPC 5DVMA 2HT4C 4OCSH 1UZ6E 4GRLA 1WAAE 3CIQA 3TIEA 1EUUA 3SKUD 4M62H 4H20L 1N7MH 1MLBA 1D9KC 3LS4H 4XC3H 2EDEA 5IT2L 2I60L 3FMGH 1P9MC 3FRUA 4XH2A 2XN9A 2XG5A 1T5XB 2BJML 5C0CA 2HLFC 1WC7A 3CVHH 3SDYL 1EMTL 3F6IA 1UGNA 3O2WH 3KPRE 1HXYB 3NPZB 2GQHA 4OCYL 2Z92A 4IMLA 4QY8A 1HQRA 5FCSH 1A5FL 4G9FE 1FL6B 2HKFH 4FTVA 4D9LH 1CT8B 4M7LH 4OM0H 1K8IB 5F6HJ 4NUGH 1G9NH 4HWNA 1F4WH 3VFPA 1C12B 2F74B 3U7YL 1RHHB 2ZKHL 1JP5A 4YFLF 5EBLB 3L7FA 1WIPA 5LXGL 4MXQD 3VI3F 4XPTL 3O45A 1T4KA 4WUKH 5DZOA 1XF4B 2DL9A 5HHOD 4WU7B 2ICES 2OL3B 4BK4A 3QEHA 2PXYB 5L7XH 4WV1A 1NCTA 1I3GL 2GIYA 5AUMB 4BZ2L 43C9A 4M3JA 2GSIA 1OPGL 4HT1H 2P8LB 2CIIB 2EXYC 3MC0A 2C3VA 3TO4B 2MOVA 3HNVL 1J0ZA 4U1HA 2FEDC 4Z7UB 4OFIA 3KDMA 3MUZ1 4OLVL 4Y4FB 5D4QA 1CTOA 4ZO8A 5DMYA 2BVUA 1B6UA 3AY4A 1D6EA 4Y2DD 4KY1H 4X6CF 2XFXB 2P1YA 2CRMA 5E08H 4JZJC 5IB4B 1QTYT 2XNAA 5ECJE 1H5BA 1MFAH 4WW1B 1AH1A 3QXWA 2VDPL 4GG8A 1IAII 3WD5L 4GSDH 4POZC 2DM2A 1F58H 3VXSE 3QDJA 4GRWH 4NRXA 1OAXL 5I8OH 1N0XH 4LLYA 5ACZB 2I24N 2QQNL 2B1AH 2PTVA 2ZUUA 1GSMA 1EO8L 2CUHA 1M05B 2D0GA 3CFBB 1JPGA 1OAYH 4WW2B 4H0GA 1JPFB 5FO7B 5GGRA 2G75A 1KYOK 3BAEH 3ZLQC 1CQYA 2ZUWA 4I0PB 3Q2CA 1T0NB 4K8RC 5IQ7L 1TTGA 1X5FA 1JGUL 5FUOL 4CNIA 4HSQA 5JW4M 3HE6A 4MZ3A 4ZFZA 4QRSA 3SE4A 1BFSA 4NOFA 5IIEB 3AREB 4WVRA 3U79A 5IG7B 3GJEA 4X8XA 2NZ9D 3QI9A 4MD4B 3NFSL 5HGHB 3BDXA 5F3BA 1TJIL 2BVYA 3O9WA 2A0LD 4TVSa 4FFVD 1IT9H 2FATL 2NY2D 3AUVA 4YZFE 3OMZA 5SWZA 2R0WH 5DVNA 1GGBL 3VA2C 1LP9A 3KJ6L 4LDLB 4XPBL 3PGDB 3GMOA 2NY6B 2RCSL 3SJVB 1A21A 4G5ZH 3ARTA 2UZYB 5TQ0L 4H26B 3VWJB 5BO1L 1YECL 1FFPA 4YDIL 1NAKL 5LCVL 3TH4T 4Z7UF 5KANI 4E5XB 3TT1H 3ULUE 3MROB 3OPZH 3S36X 1OWRM 1GVIA 4XRCA 3NGBB 1WBXB 3SE9L 1I8KA 1EIBA 2W0FA 2HTKD 1DLFL 3MBXH 3Q6GH 1NC2A 3CD4A 5CEYB 4F3FA 1J1PL 4OGXH 3LCYA 4X4YA 3DXAA 3GHEL 4Y5VB 2HN7B 4LSVH 4JZNB 4N1CA 3AROA 3L3JA 1YEHL 3RNKB 3X12A 3UO1L 4PJDB 2FX9L 1NC4B 4Z77B 4WW2F 4CJ1A 3ARFA 3HA0A 1KJMA 3N1QC 4PRHB 4DGIH 1DN0A 1JN6A 1IAKA 5L2JA 5D2NE 3HC3H 1SJHB 2V9QA 3CUPA 3GBLA 1ZHLB 1XIWA 3AB0B 1AJ7L 1LEIB 4X9HA 5D7JB 1K85A 4RZCB 3D85A 3V6FA 4UI2A 3PGFH 1H3UA 1UJ3C 4UILL 3HI5L 2XN9D 3S8WA 2OI9C 3EYUH 4PJIE 4IMKC 4E0RB 4IDJL 1DBML 1S9XB 1SJVA 5DGQA 5KW9L 4KKLC 2YZ1A 3WDJA 4UQ2A 2OTUA 4U1LB 3Q6FA 2R8SH 3TBSA 4JFZH 1SBSH 4LPUA 5CMAA 1BP3B 1CFVL 4FTVD 5A16B 4WRLA 3BEVA 4C55A 5B21A 1J86A 1XR9A 2X9XA 4PBVC 3ARXA 4HF5H 4X6CA 3JUZA 4HIIA 1G7LA 2P5WE 3ZKSD 4UV7H 3QG7L 4YHLH 2IPTL 2E3VA 4R90L 1TNMA 4MQTB 4RRPA 2E8ZA 2AABL 1B2WH 1QACA 5AAWA 2UY6A 4W6XB 1QR1A 4X9FA 4FP8L 5F6IC 2DTML 4M6ML 2DQTH 2JLLA 2IGFH 4CVZB 4BSWB 3DI3B 3MLUH 4EOWH 1CU4L 1T5XA 3ULVE 5IR1B 3MGTB 5IW6B 1QRKA 5IWLA 1L0YA 4F15B 1KULA 1F90H 1HXYA 1X7QB 1Y6MR 3CDFA 4CVWA 4JQVC 4PS4L 2UV3A 1FL6A 1CT8A 1K8IA 3CVHB 3W0WB 1C12A 2F74A 2MPAH 1CIDA 2ORBH 4KROB 5EBLA 1Q38A 4TTGA 1A6AB 5I1JL 1FGNH 3KLHD 4OD3L 2R9HD 1XF4A 3QDJD 2SEBB 4WU7A 4R97B 1UYWH 3QWOB 2OL3A 4MXQC 2PXYA 4W6YB 2H8PB 1L6XA 5AUMA 1MCQA 5E4EC 3F7QA 4DCQB 4FQJH 4NPYB 2VOTA 1N6UA 2P8LA 1AO7E 2CIIA 4XP9H 1P4BH 4F7CB 5BW7A 3TO4A 1EO7A 1A6WL 4LMQE 5ANMB 3HE6D 1TPXC 4P9HC 4JPVH 4Z7UA 4Y4FA 2Y6SD 1GPOL 3OJ2C 3ZE1F 3QI9D 1TJHL 2BXZA 2XFXA 1S7XB 1P2CB 3FMGL 5HD8C 5IB4A 3O9WD 1MFBL 4JHWH 3MLRH 3QWRA 4ZMAT 5F88B 2HFGH 1QOKA 1JYXA 4HMDA 3ZDXE 4WW1A 2V6HA 4TQEH 1Z5LB 4YIQB 5SWZD 2ITCB 4JG1H 3IGAB 2PW1B 2WUCH 4LAQH 2DD8L 1EERB 3CX5J 3MV9E 1F4WL 4K3DH 3T2PA 4WCYH 4KMQA 1M05A 3CFBA 2EIBA 4WW2A 5FO7A 1JPFA 3K8LA 4L3ED 3NCMA 3MRHB 4GRWB 4OCXL 3WEXB 2YA0A 1YEIL 4V1DE 4I0PA 1T0NA 3T0ED 4NGHH 1QNZL 5I6XB 1EK3A 1BQLL 3EJZD 4O4YH 5ERWA 5D7LB 2CDEB 3G04B 3TYFB 5CZVL 5GS1C 5IV2B 1A7QL 5IIEA 3AREA 3BWUC 3VXME 5IG7A 5GRYA 4QRQA 1U2CA 4MD4A 2VQ1B 4UZGA 1NC2D 3HUJB 5J57B 5L9DH 2NZ9C 1IFHL 2ZUQB 4XNUH 4PJBB 3TA3B 1X4YA 5EU5B 2J1KA 5IFAL 2AEWA 1E4XI 2DYPB 3VGAC 3IJSB 3PGDA 3ARFD 1T89C 1NGYB 2ICCA 3SGJA 3SJVA 1JPSH 2E6JA 2LVCA 5HDLA 3BX7C 1XIWD 4H26A 3VWJA 2UUDK 3D85D 4GSDL 5CWSB 4E5XA 4NN7B 4KGLA 1A2YB 4JFHD 4MB5A 3ZHKA 5TPWL 4JAMB 1WBXA 2XIDA 2EH7H 2X4OB 1NCWH 2K7PA 2KBGA 2MTPA 2WW8A 5CEYA 1CLYL 4WTWA 3UTPE 4Y5VA 4IRJC 2JCCF 4JZNA 2GFBB 1DQLH 2X42A 3RNKA 4PJDA 1FE8H 1KCUH 1NC4A 4L1DA 4Z77A 2GTWB 4PRHA 4ODWB 5GQBA 4LEOB 2GUOB 1SJHA 2J8HA 3WJLA 3TVMC 4EXPX 3FT2B 4J6RH 3AMLA 1DDHB 1ZHLA 1LEIA 5D7JA 2EECA 4RZCA 4Y2OA 2DL2A 2R0WL 4HLZG 2DQEH 2AEQH 2IADB 1LK3L 4LLWB 1T04B 1ZLSH 1S9XA 3EOTH 4LLQB 5KSBE 4WEMB 4PB9L 4MVBC 3HUJF 4U1LA 1EV2E 5DWUH 2DMCA 5A16A 4G6AC 1PEZA 1HHGA 3V2AR 1E6OH 2DQGH 3OR7A 1ACYH 1C5BL 1XCQB 3DYPA 1KF9B 3VE0B 5I16B 3GI9L 1IZKA 5GS0C 1QLEH 1R3LB 3Q6GL 2PXYD 3T2NH 3MZTA 3HC4H 3J7HA 3ULUH 3LKPB 3MUGB 4CVZA 3IF1B 2VLJE 3HZMB 2FECI 4BSWA 5JW4R 4WV1C 5K9JL 3SDAB 5CGYC 3TO4D 2MNUA 5IR1A 3MGTA 5IW6A 3ARBB 5FYLH 4Y4FD 4PLNC 1X7QA 1VEMA 2UY7A